BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig4132

Length=782
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009764156.1|  PREDICTED: lysophospholipid acyltransferase ...    310   2e-99   Nicotiana sylvestris
ref|XP_009759896.1|  PREDICTED: lysophospholipid acyltransferase ...    310   3e-99   Nicotiana sylvestris
emb|CDP09808.1|  unnamed protein product                                307   2e-98   Coffea canephora [robusta coffee]
ref|XP_009628905.1|  PREDICTED: lysophospholipid acyltransferase ...    306   5e-98   Nicotiana tomentosiformis
ref|XP_007023108.1|  MBOAT (membrane bound O-acyl transferase) fa...    301   1e-97   
gb|AER57989.2|  putative lysophosphatidylcholine acyltransferase 2      305   2e-97   
emb|CBI34747.3|  unnamed protein product                                305   2e-97   Vitis vinifera
ref|XP_002282807.1|  PREDICTED: lysophospholipid acyltransferase 1      305   2e-97   Vitis vinifera
ref|XP_009609255.1|  PREDICTED: lysophospholipid acyltransferase ...    304   4e-97   Nicotiana tomentosiformis
ref|XP_004245650.1|  PREDICTED: lysophospholipid acyltransferase ...    304   5e-97   Solanum lycopersicum
gb|AFK40120.1|  unknown                                                 295   9e-97   Lotus japonicus
ref|XP_007023107.1|  MBOAT (membrane bound O-acyl transferase) fa...    301   2e-96   
ref|XP_007023106.1|  MBOAT (membrane bound O-acyl transferase) fa...    301   4e-96   Theobroma cacao [chocolate]
ref|XP_011081031.1|  PREDICTED: lysophospholipid acyltransferase ...    301   7e-96   Sesamum indicum [beniseed]
ref|XP_010112575.1|  hypothetical protein L484_010580                   301   1e-95   Morus notabilis
gb|KJB68444.1|  hypothetical protein B456_010G246400                    295   1e-95   Gossypium raimondii
ref|XP_004244602.1|  PREDICTED: lysophospholipid acyltransferase ...    300   2e-95   Solanum lycopersicum
gb|KDP25507.1|  hypothetical protein JCGZ_20663                         298   1e-94   Jatropha curcas
gb|AHE80989.1|  acyl-CoA:lysophosphatidylcholine acyltransferase        298   1e-94   Carthamus tinctorius
ref|XP_012087002.1|  PREDICTED: lysophospholipid acyltransferase ...    298   1e-94   Jatropha curcas
gb|KJB68448.1|  hypothetical protein B456_010G246400                    294   1e-94   Gossypium raimondii
gb|KJB29823.1|  hypothetical protein B456_005G120200                    298   1e-94   Gossypium raimondii
ref|XP_010055596.1|  PREDICTED: lysophospholipid acyltransferase ...    297   2e-94   Eucalyptus grandis [rose gum]
gb|EYU38990.1|  hypothetical protein MIMGU_mgv1a005877mg                296   3e-94   Erythranthe guttata [common monkey flower]
ref|XP_006440536.1|  hypothetical protein CICLE_v10020062mg             296   4e-94   Citrus clementina [clementine]
ref|XP_010278548.1|  PREDICTED: lysophospholipid acyltransferase 1      296   4e-94   Nelumbo nucifera [Indian lotus]
gb|AGL74879.1|  1-acylglycerophosphocholine O-acyltransferase           296   5e-94   Vernicia fordii [tung oil tree]
ref|XP_006358391.1|  PREDICTED: lysophospholipid acyltransferase ...    296   6e-94   Solanum tuberosum [potatoes]
gb|KHG06049.1|  Lysophospholipid acyltransferase 2                      296   7e-94   Gossypium arboreum [tree cotton]
gb|KDO63564.1|  hypothetical protein CISIN_1g012501mg                   296   7e-94   Citrus sinensis [apfelsine]
ref|XP_006477394.1|  PREDICTED: membrane-bound O-acyltransferase ...    295   1e-93   Citrus sinensis [apfelsine]
gb|AHE80987.1|  acyl-CoA:lysophosphatidylcholine acyltransferase        288   2e-93   Hiptage benghalensis
ref|XP_007155562.1|  hypothetical protein PHAVU_003G212400g             295   2e-93   Phaseolus vulgaris [French bean]
gb|KJB68442.1|  hypothetical protein B456_010G246400                    295   2e-93   Gossypium raimondii
gb|KHN14121.1|  Membrane-bound O-acyltransferase domain-containin...    294   3e-93   Glycine soja [wild soybean]
ref|XP_011072149.1|  PREDICTED: lysophospholipid acyltransferase ...    294   3e-93   Sesamum indicum [beniseed]
ref|XP_003549863.1|  PREDICTED: lysophospholipid acyltransferase 2      293   5e-93   Glycine max [soybeans]
gb|AHE80988.1|  acyl-CoA:lysophosphatidylcholine acyltransferase        293   6e-93   Hiptage benghalensis
ref|XP_008448977.1|  PREDICTED: lysophospholipid acyltransferase 1      293   9e-93   Cucumis melo [Oriental melon]
gb|KJB29824.1|  hypothetical protein B456_005G120200                    293   1e-92   Gossypium raimondii
gb|KHN34432.1|  Lysophospholipid acyltransferase 2                      291   7e-92   Glycine soja [wild soybean]
ref|XP_003525728.1|  PREDICTED: lysophospholipid acyltransferase ...    290   8e-92   Glycine max [soybeans]
ref|XP_010919229.1|  PREDICTED: lysophospholipid acyltransferase ...    290   1e-91   Elaeis guineensis
ref|XP_009377923.1|  PREDICTED: lysophospholipid acyltransferase ...    290   2e-91   Pyrus x bretschneideri [bai li]
gb|AER57988.1|  putative lysophosphatidylcholine acyltransferase 1      289   2e-91   Helianthus annuus
gb|AHE80986.1|  acyl-CoA:lysophosphatidylcholine acyltransferase        289   3e-91   Hiptage benghalensis
ref|XP_004298745.1|  PREDICTED: lysophospholipid acyltransferase 1      289   3e-91   Fragaria vesca subsp. vesca
gb|AGO14581.1|  lysophosphatidylcholine acyltransferase                 289   3e-91   Ricinus communis
ref|XP_008369472.1|  PREDICTED: lysophospholipid acyltransferase ...    289   4e-91   
ref|XP_004953433.1|  PREDICTED: lysophospholipid acyltransferase-...    288   4e-91   
ref|XP_002454488.1|  hypothetical protein SORBIDRAFT_04g031990          288   7e-91   Sorghum bicolor [broomcorn]
ref|XP_004148282.1|  PREDICTED: lysophospholipid acyltransferase 1      288   1e-90   Cucumis sativus [cucumbers]
ref|XP_008646049.1|  PREDICTED: lysophospholipid acyltransferase 1      287   2e-90   
ref|XP_008795385.1|  PREDICTED: lysophospholipid acyltransferase ...    287   2e-90   Phoenix dactylifera
gb|AFW72781.1|  hypothetical protein ZEAMMB73_982934                    288   2e-90   
ref|XP_010934443.1|  PREDICTED: lysophospholipid acyltransferase ...    286   3e-90   Elaeis guineensis
ref|XP_009391951.1|  PREDICTED: lysophospholipid acyltransferase ...    286   3e-90   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010693498.1|  PREDICTED: lysophospholipid acyltransferase ...    286   3e-90   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004515799.1|  PREDICTED: lysophospholipid acyltransferase ...    286   5e-90   Cicer arietinum [garbanzo]
ref|XP_006358867.1|  PREDICTED: lysophospholipid acyltransferase ...    286   5e-90   Solanum tuberosum [potatoes]
ref|XP_006417213.1|  hypothetical protein EUTSA_v10007564mg             286   6e-90   Eutrema salsugineum [saltwater cress]
ref|XP_008803275.1|  PREDICTED: lysophospholipid acyltransferase ...    286   6e-90   Phoenix dactylifera
gb|AGL81301.1|  lysophosphatidylcholine acyltransferase                 286   7e-90   Momordica charantia [balsam pear]
ref|XP_010933881.1|  PREDICTED: lysophospholipid acyltransferase ...    285   9e-90   Elaeis guineensis
ref|XP_002304469.2|  membrane bound O-acyl transferase family pro...    285   9e-90   Populus trichocarpa [western balsam poplar]
ref|XP_008238778.1|  PREDICTED: lysophospholipid acyltransferase 1      285   1e-89   Prunus mume [ume]
ref|XP_007209112.1|  hypothetical protein PRUPE_ppa005358mg             285   1e-89   
ref|XP_009339650.1|  PREDICTED: lysophospholipid acyltransferase ...    285   1e-89   Pyrus x bretschneideri [bai li]
ref|XP_002298063.2|  membrane bound O-acyl transferase family pro...    285   1e-89   
gb|KEH31706.1|  membrane-bound O-acyltransferase family MBOAT pro...    285   2e-89   Medicago truncatula
ref|XP_009364173.1|  PREDICTED: lysophospholipid acyltransferase ...    284   2e-89   Pyrus x bretschneideri [bai li]
ref|XP_011029182.1|  PREDICTED: lysophospholipid acyltransferase ...    284   2e-89   Populus euphratica
ref|XP_002892700.1|  membrane bound O-acyl transferase family pro...    284   2e-89   Arabidopsis lyrata subsp. lyrata
ref|XP_011033798.1|  PREDICTED: lysophospholipid acyltransferase ...    284   2e-89   Populus euphratica
ref|XP_002892698.1|  predicted protein                                  283   3e-89   
gb|AHE80985.1|  acyl-CoA:lysophosphatidylcholine acyltransferase        283   1e-88   Bernardia pulchella
ref|XP_006665020.1|  PREDICTED: lysophospholipid acyltransferase-...    280   2e-88   
gb|AGM15931.1|  lysophosphatidylcholine acyltransferase 1               281   2e-88   Physaria fendleri
ref|XP_010494450.1|  PREDICTED: lysophospholipid acyltransferase ...    281   3e-88   Camelina sativa [gold-of-pleasure]
ref|XP_010494443.1|  PREDICTED: lysophospholipid acyltransferase ...    281   3e-88   Camelina sativa [gold-of-pleasure]
ref|XP_006307436.1|  hypothetical protein CARUB_v10009061mg             281   3e-88   Capsella rubella
ref|XP_010553491.1|  PREDICTED: lysophospholipid acyltransferase ...    281   5e-88   Tarenaya hassleriana [spider flower]
gb|AAF88094.1|AC025417_22  T12C24.17                                    280   5e-88   Arabidopsis thaliana [mouse-ear cress]
ref|NP_172724.2|  lysophosphatidylcholine acyltransferase 1             280   6e-88   Arabidopsis thaliana [mouse-ear cress]
gb|AAM13086.1|  unknown protein                                         280   7e-88   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010546005.1|  PREDICTED: lysophospholipid acyltransferase 1      280   7e-88   Tarenaya hassleriana [spider flower]
gb|EPS74023.1|  hypothetical protein M569_00723                         280   1e-87   Genlisea aurea
ref|XP_006364125.1|  PREDICTED: lysophospholipid acyltransferase ...    280   1e-87   Solanum tuberosum [potatoes]
ref|XP_010476235.1|  PREDICTED: lysophospholipid acyltransferase 1      280   2e-87   Camelina sativa [gold-of-pleasure]
ref|XP_004252578.1|  PREDICTED: lysophospholipid acyltransferase ...    279   2e-87   Solanum lycopersicum
emb|CDY57076.1|  BnaCnng31560D                                          279   2e-87   Brassica napus [oilseed rape]
ref|XP_010458693.1|  PREDICTED: lysophospholipid acyltransferase ...    279   3e-87   Camelina sativa [gold-of-pleasure]
ref|XP_003570095.1|  PREDICTED: lysophospholipid acyltransferase 2      278   6e-87   Brachypodium distachyon [annual false brome]
ref|NP_001047723.1|  Os02g0676000                                       277   9e-87   
ref|XP_010255524.1|  PREDICTED: lysophospholipid acyltransferase ...    277   2e-86   Nelumbo nucifera [Indian lotus]
gb|AHE80984.1|  acyl-CoA:lysophosphatidylcholine acyltransferase        274   1e-85   Bernardia pulchella
dbj|BAJ87726.1|  predicted protein                                      273   3e-85   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDX98051.1|  BnaA06g08020D                                          273   5e-85   
ref|XP_009148576.1|  PREDICTED: lysophospholipid acyltransferase 1      273   6e-85   Brassica rapa
gb|ABK24304.1|  unknown                                                 269   2e-83   Picea sitchensis
gb|KFK43529.1|  hypothetical protein AALP_AA1G138000                    268   6e-83   Arabis alpina [alpine rockcress]
gb|ERN19360.1|  hypothetical protein AMTR_s00069p00124460               263   3e-81   Amborella trichopoda
gb|AGM15932.1|  lysophosphatidylcholine acyltransferase 2               263   4e-81   Physaria fendleri
ref|XP_006857893.2|  PREDICTED: lysophospholipid acyltransferase 1      263   5e-81   Amborella trichopoda
ref|XP_006391786.1|  hypothetical protein EUTSA_v10023446mg             262   1e-80   Eutrema salsugineum [saltwater cress]
emb|CDY63224.1|  BnaCnng41640D                                          262   1e-80   Brassica napus [oilseed rape]
ref|XP_002886438.1|  membrane bound O-acyl transferase family pro...    261   2e-80   Arabidopsis lyrata subsp. lyrata
ref|NP_176493.1|  lysophosphatidylcholine acyltransferase               261   2e-80   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009113025.1|  PREDICTED: lysophospholipid acyltransferase 2      260   6e-80   Brassica rapa
emb|CDY45972.1|  BnaA09g12940D                                          260   7e-80   Brassica napus [oilseed rape]
ref|XP_006300445.1|  hypothetical protein CARUB_v10020125mg             260   4e-79   
gb|KFK40546.1|  hypothetical protein AALP_AA2G010000                    256   1e-78   Arabis alpina [alpine rockcress]
ref|XP_010473534.1|  PREDICTED: lysophospholipid acyltransferase 2      256   2e-78   Camelina sativa [gold-of-pleasure]
ref|XP_010430382.1|  PREDICTED: lysophospholipid acyltransferase ...    255   4e-78   Camelina sativa [gold-of-pleasure]
gb|KJB68445.1|  hypothetical protein B456_010G246400                    248   7e-76   Gossypium raimondii
ref|XP_010418312.1|  PREDICTED: lysophospholipid acyltransferase ...    249   1e-75   Camelina sativa [gold-of-pleasure]
ref|XP_004515798.1|  PREDICTED: lysophospholipid acyltransferase ...    243   3e-73   
gb|EMT11337.1|  hypothetical protein F775_10016                         231   1e-69   
gb|EMS54344.1|  hypothetical protein TRIUR3_33673                       229   5e-69   Triticum urartu
ref|XP_001780460.1|  predicted protein                                  219   4e-64   
ref|XP_001763507.1|  predicted protein                                  211   5e-61   
ref|XP_001751825.1|  predicted protein                                  207   1e-59   
gb|KDO63565.1|  hypothetical protein CISIN_1g012501mg                   204   8e-59   Citrus sinensis [apfelsine]
gb|KCW72087.1|  hypothetical protein EUGRSUZ_E00532                     202   2e-58   Eucalyptus grandis [rose gum]
gb|KDO63566.1|  hypothetical protein CISIN_1g012501mg                   201   6e-58   Citrus sinensis [apfelsine]
emb|CAA03955.1|  unnamed protein product                                192   1e-57   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008364537.1|  PREDICTED: lysophospholipid acyltransferase ...    197   5e-56   
gb|EYU29841.1|  hypothetical protein MIMGU_mgv1a0059781mg               183   3e-54   Erythranthe guttata [common monkey flower]
emb|CDY64621.1|  BnaCnng44390D                                          174   5e-50   Brassica napus [oilseed rape]
ref|XP_010934444.1|  PREDICTED: lysophospholipid acyltransferase ...    169   2e-45   Elaeis guineensis
ref|XP_007023110.1|  MBOAT (membrane bound O-acyl transferase) fa...    163   1e-43   
ref|XP_006440537.1|  hypothetical protein CICLE_v10020062mg             162   2e-43   
gb|KCW72088.1|  hypothetical protein EUGRSUZ_E00532                     161   8e-43   Eucalyptus grandis [rose gum]
ref|XP_002500677.1|  predicted protein                                  150   4e-38   Micromonas commoda
ref|XP_003064354.1|  predicted protein                                  149   6e-38   Micromonas pusilla CCMP1545
ref|XP_001422221.1|  predicted protein                                  144   2e-36   Ostreococcus lucimarinus CCE9901
ref|XP_005649636.1|  membrane bound O-acyl transferase family pro...    132   5e-32   Coccomyxa subellipsoidea C-169
emb|CDY57972.1|  BnaC03g74130D                                          132   6e-32   Brassica napus [oilseed rape]
ref|XP_003084126.1|  Predicted membrane protein (ISS)                   130   3e-31   Ostreococcus tauri
ref|XP_005850438.1|  hypothetical protein CHLNCDRAFT_20761              128   2e-30   Chlorella variabilis
ref|XP_002950776.1|  hypothetical protein VOLCADRAFT_120919             127   1e-29   Volvox carteri f. nagariensis
gb|KDD76279.1|  membrane-bound O-acyltransferase                        123   1e-28   Helicosporidium sp. ATCC 50920
ref|XP_007021531.1|  MBOAT (membrane bound O-acyl transferase) fa...    110   1e-26   
gb|KIY98914.1|  hypothetical protein MNEG_9048                          117   2e-26   Monoraphidium neglectum
gb|KHG30541.1|  Lysophospholipid acyltransferase 7                      109   2e-26   Gossypium arboreum [tree cotton]
ref|XP_009850699.1|  hypothetical protein NEUTE1DRAFT_100500            112   1e-24   Neurospora tetrasperma FGSC 2508
gb|AIC75358.1|  NCU06194-like protein                                   113   1e-24   Neurospora crassa
ref|XP_963006.2|  MBOAT family protein                                  112   1e-24   Neurospora crassa OR74A
gb|EGZ72137.1|  MBOAT-domain-containing protein                         112   1e-24   Neurospora tetrasperma FGSC 2509
ref|XP_003346472.1|  hypothetical protein SMAC_05367                    108   4e-23   
ref|XP_003655647.1|  hypothetical protein THITE_2119570                 108   4e-23   Thielavia terrestris NRRL 8126
emb|CCC12295.1|  unnamed protein product                                108   6e-23   Sordaria macrospora k-hell
gb|EXX59759.1|  Ale1p                                                   106   1e-22   Rhizophagus irregularis DAOM 197198w
gb|ESA24244.1|  hypothetical protein GLOINDRAFT_100689                  106   1e-22   
ref|XP_011398849.1|  Membrane-bound O-acyltransferase domain-cont...    105   2e-22   Auxenochlorella protothecoides
ref|XP_001229385.1|  hypothetical protein CHGG_02869                    105   3e-22   Chaetomium globosum CBS 148.51
dbj|BAJ34298.1|  unnamed protein product                                103   5e-22   Eutrema halophilum
ref|XP_007511041.1|  predicted protein                                  105   5e-22   Bathycoccus prasinos
ref|XP_003662929.1|  hypothetical protein MYCTH_2304133                 105   5e-22   Thermothelomyces thermophila ATCC 42464
dbj|GAM40820.1|  membrane bound O-acyltransferase                       105   5e-22   Talaromyces cellulolyticus
emb|CCK72954.1|  hypothetical protein KNAG_0M01010                      105   5e-22   Kazachstania naganishii CBS 8797
ref|XP_006959253.1|  MBOAT-domain-containing protein                    104   6e-22   Wallemia mellicola CBS 633.66
gb|KJE00353.1|  lysophospholipid acyltransferase                        105   6e-22   Cryptococcus gattii NT-10
ref|XP_002509709.1|  o-acyltransferase (membrane bound) domain co...    102   7e-22   
ref|XP_003192128.1|  member of the MBOAT family of putative membr...    104   7e-22   Cryptococcus gattii WM276
gb|KIY36135.1|  lysophospholipid acyltransferase                        104   7e-22   Cryptococcus gattii E566
gb|KIR67395.1|  lysophospholipid acyltransferase                        104   7e-22   Cryptococcus gattii CA1873
gb|KJB68443.1|  hypothetical protein B456_010G246400                    102   8e-22   Gossypium raimondii
gb|KIR55618.1|  lysophospholipid acyltransferase                        104   8e-22   Cryptococcus gattii Ru294
gb|KIR50417.1|  lysophospholipid acyltransferase                        104   9e-22   Cryptococcus gattii CA1280
gb|KJB68447.1|  hypothetical protein B456_010G246400                    102   1e-21   Gossypium raimondii
gb|AAB47420.1|  O3635p                                                  102   1e-21   Saccharomyces cerevisiae [brewer's yeast]
gb|EME43207.1|  hypothetical protein DOTSEDRAFT_72556                   103   1e-21   Dothistroma septosporum NZE10
gb|KIW49985.1|  hypothetical protein PV05_11612                         103   1e-21   Exophiala xenobiotica
gb|KIR87840.1|  lysophospholipid acyltransferase                        103   1e-21   Cryptococcus gattii VGIV IND107
gb|KIW44575.1|  hypothetical protein PV06_03035                         103   2e-21   Exophiala oligosperma
gb|KGB74382.1|  endoplasmic reticulum protein                           103   2e-21   Cryptococcus gattii VGII R265
emb|CDI52297.1|  endoplasmic reticulum protein                          103   2e-21   Melanopsichium pennsylvanicum 4
gb|KIR33912.1|  lysophospholipid acyltransferase                        103   2e-21   Cryptococcus gattii VGII MMRL2647
gb|KIR25106.1|  lysophospholipid acyltransferase                        103   2e-21   Cryptococcus gattii VGII LA55
gb|KIR40539.1|  lysophospholipid acyltransferase                        103   2e-21   Cryptococcus gattii VGII Ram5
ref|XP_004178270.1|  hypothetical protein TBLA_0A09670                  103   3e-21   Tetrapisispora blattae CBS 6284
gb|KIW15251.1|  hypothetical protein PV08_05296                         103   3e-21   Exophiala spinifera
gb|KKA19937.1|  Uncharacterized protein T310_6051                       102   3e-21   Rasamsonia emersonii CBS 393.64
ref|XP_002488149.1|  MBOAT family protein, putative                     102   3e-21   Talaromyces stipitatus ATCC 10500
emb|CCU77332.1|  MBOAT family protein                                   101   5e-21   Blumeria graminis f. sp. hordei DH14
dbj|GAA26490.1|  K7_Yor175cbp                                           100   5e-21   Saccharomyces cerevisiae Kyokai no. 7
emb|CBQ70814.1|  conserved hypothetical protein                         102   5e-21   Sporisorium reilianum SRZ2
gb|EGA60489.1|  Ale1p                                                   102   5e-21   Saccharomyces cerevisiae FostersO
gb|KIY71758.1|  endoplasmic reticulum protein                           101   5e-21   Cylindrobasidium torrendii FP15055 ss-10
gb|KEY81407.1|  hypothetical protein MBOAT                              102   5e-21   Aspergillus fumigatus var. RP-2014
gb|EST06028.1|  hypothetical protein PSEUBRA_SCAF3g03529                102   6e-21   Kalmanozyma brasiliensis GHG001
ref|XP_566668.1|  endoplasmic reticulum protein                         102   6e-21   
ref|XP_012046278.1|  lysophospholipid acyltransferase                   102   6e-21   Cryptococcus neoformans var. grubii H99
gb|EDP47498.1|  MBOAT family protein, putative                          102   6e-21   Aspergillus fumigatus A1163
ref|XP_007724974.1|  hypothetical protein A1O1_05900                    102   6e-21   Capronia coronata CBS 617.96
gb|EGA80860.1|  Ale1p                                                   102   7e-21   Saccharomyces cerevisiae Lalvin QA23
gb|AJT71605.1|  Ale1p                                                   102   7e-21   Saccharomyces cerevisiae YJM193
ref|XP_007364213.1|  MBOAT-domain-containing protein                    101   7e-21   Dichomitus squalens LYAD-421 SS1
gb|KIO30962.1|  hypothetical protein M407DRAFT_68729                    100   7e-21   Tulasnella calospora MUT 4182
gb|EDV10758.1|  hypothetical protein SCRG_01566                         102   7e-21   Saccharomyces cerevisiae RM11-1a
ref|NP_014818.1|  Ale1p                                                 102   7e-21   Saccharomyces cerevisiae S288C
gb|EDN64033.1|  acyltransferase for lyso-phosphatidylethanolamine       102   7e-21   Saccharomyces cerevisiae YJM789
ref|XP_747591.2|  MBOAT family protein                                  101   8e-21   Aspergillus fumigatus Af293
gb|EYU29840.1|  hypothetical protein MIMGU_mgv1a0059782mg             99.4    8e-21   Erythranthe guttata [common monkey flower]
dbj|GAC74527.1|  predicted membrane protein                             101   9e-21   Moesziomyces antarcticus T-34
gb|ETS62438.1|  hypothetical protein PaG_03055                          101   9e-21   Moesziomyces aphidis DSM 70725
ref|XP_001396584.2|  MBOAT family protein                               101   9e-21   Aspergillus niger CBS 513.88
emb|CAK42214.1|  unnamed protein product                                101   9e-21   Aspergillus niger
emb|CCF54383.1|  uncharacterized protein UHOR_02112                     101   1e-20   Ustilago hordei
ref|XP_002497049.1|  ZYRO0D14212p                                       101   1e-20   Zygosaccharomyces rouxii
ref|XP_448977.1|  hypothetical protein                                  101   1e-20   [Candida] glabrata
ref|XP_664134.1|  hypothetical protein AN6530.2                         100   1e-20   Aspergillus nidulans FGSC A4
ref|XP_008601653.1|  MBOAT family protein                               100   1e-20   Beauveria bassiana ARSEF 2860
gb|EPS26117.1|  hypothetical protein PDE_01053                          101   1e-20   Penicillium oxalicum 114-2
gb|KGQ08072.1|  Lysophospholipid acyltransferase                        100   1e-20   Beauveria bassiana D1-5
dbj|GAA92222.1|  MBOAT family protein                                   100   1e-20   Aspergillus kawachii IFO 4308
gb|EHA24428.1|  hypothetical protein ASPNIDRAFT_40328                   101   1e-20   Aspergillus niger ATCC 1015
ref|XP_008893288.1|  hypothetical protein PPTG_01660                    100   1e-20   Phytophthora parasitica INRA-310
gb|ETI45133.1|  hypothetical protein F443_10202                         100   1e-20   Phytophthora parasitica P1569
ref|XP_001907785.1|  hypothetical protein                               100   1e-20   Podospora anserina S mat+
dbj|GAC96833.1|  endoplasmic reticulum protein                          100   2e-20   Pseudozyma hubeiensis SY62
gb|EPQ63874.1|  Lysophospholipid acyltransferase                      99.8    2e-20   Blumeria graminis f. sp. tritici 96224
ref|XP_002908002.1|  lysophospholipid acyltransferase, putative         100   2e-20   Phytophthora infestans T30-4
ref|NP_596779.1|  membrane bound O-acyltransferase, MBOAT (predic...    100   2e-20   Schizosaccharomyces pombe
ref|XP_003713879.1|  membrane-bound O-acyltransferase domain-cont...    100   2e-20   Magnaporthe oryzae 70-15
ref|XP_002378255.1|  MBOAT family protein, putative                   99.4    2e-20   Aspergillus flavus NRRL3357
gb|KIV89225.1|  hypothetical protein PV10_08811                         100   2e-20   Exophiala mesophila
gb|KIO15837.1|  hypothetical protein M407DRAFT_34555                  99.8    3e-20   Tulasnella calospora MUT 4182
gb|AJT74034.1|  Ale1p                                                   100   3e-20   Saccharomyces cerevisiae YJM271
gb|AJU10190.1|  Ale1p                                                   100   3e-20   Saccharomyces cerevisiae YJM1463
gb|AJU03859.1|  Ale1p                                                   100   3e-20   Saccharomyces cerevisiae YJM1402
gb|AJU02867.1|  Ale1p                                                   100   3e-20   Saccharomyces cerevisiae YJM1400
gb|AJT92097.1|  Ale1p                                                   100   3e-20   Saccharomyces cerevisiae YJM1250
gb|EEU07750.1|  Ale1p                                                   100   3e-20   Saccharomyces cerevisiae JAY291
gb|AJT94055.1|  Ale1p                                                   100   3e-20   Saccharomyces cerevisiae YJM1307
ref|XP_001209647.1|  conserved hypothetical protein                   99.8    3e-20   Aspergillus terreus NIH2624
gb|AJT88264.1|  Ale1p                                                   100   3e-20   Saccharomyces cerevisiae YJM1133
ref|XP_003958417.1|  hypothetical protein KAFR_0G02490                  100   3e-20   Kazachstania africana CBS 2517
ref|XP_001257694.1|  MBOAT family protein                             99.8    4e-20   Aspergillus fischeri NRRL 181
gb|AJT72094.1|  Ale1p                                                   100   4e-20   Saccharomyces cerevisiae YJM195
gb|EPX73246.1|  membrane bound O-acyltransferase                      99.4    4e-20   Schizosaccharomyces octosporus yFS286
dbj|GAK64886.1|  endoplasmic reticulum protein                        99.4    4e-20   Moesziomyces antarcticus
gb|EPE07275.1|  mboat family protein                                    100   4e-20   Ophiostoma piceae UAMH 11346
gb|KIV80618.1|  hypothetical protein, variant                         99.4    4e-20   Exophiala sideris
gb|KIW88666.1|  hypothetical protein Z519_10712                       99.8    4e-20   Cladophialophora bantiana CBS 173.52
gb|EPY50263.1|  membrane bound O-acyltransferase                      99.0    5e-20   Schizosaccharomyces cryophilus OY26
gb|KIM67661.1|  hypothetical protein SCLCIDRAFT_13849                 99.0    5e-20   Scleroderma citrinum Foug A
ref|XP_003676874.1|  hypothetical protein NCAS_0F00340                99.4    6e-20   Naumovozyma castellii CBS 4309
gb|KJX99558.1|  mboat family protein                                  98.6    6e-20   Zymoseptoria brevis
ref|XP_011105555.1|  YOR175C                                          99.4    6e-20   
dbj|BAE61812.1|  unnamed protein product                              99.0    6e-20   Aspergillus oryzae RIB40
ref|XP_001822945.2|  MBOAT family protein                             99.0    6e-20   
gb|KIV80617.1|  hypothetical protein PV11_08107                       99.4    6e-20   Exophiala sideris
ref|XP_003682983.1|  hypothetical protein TDEL_0G04050                99.4    7e-20   Torulaspora delbrueckii
gb|KJK64438.1|  MBOAT membrane-bound O-acyltransferase family pro...  99.0    7e-20   Aspergillus parasiticus SU-1
gb|EYE97245.1|  MBOAT family protein                                  99.0    7e-20   Aspergillus ruber CBS 135680
ref|XP_003283301.1|  hypothetical protein DICPUDRAFT_52171            98.2    7e-20   Dictyostelium purpureum
gb|KII96053.1|  hypothetical protein PLICRDRAFT_151169                98.6    8e-20   Plicaturopsis crispa FD-325 SS-3
ref|XP_002153292.1|  MBOAT family protein, putative                   97.8    8e-20   Talaromyces marneffei ATCC 18224
gb|KID89664.1|  Membrane bound O-acyl transferase, MBOAT              97.4    9e-20   Metarhizium guizhouense ARSEF 977
gb|EJT43770.1|  ALE1-like protein                                     98.6    1e-19   Saccharomyces kudriavzevii IFO 1802
ref|XP_007816773.2|  MBOAT family protein                             97.4    1e-19   Metarhizium robertsii ARSEF 23
ref|XP_007912419.1|  putative mboat family protein                    98.2    1e-19   Phaeoacremonium minimum UCRPA7
ref|XP_001270060.1|  MBOAT family protein                             98.2    1e-19   Aspergillus clavatus NRRL 1
gb|EYB30911.1|  hypothetical protein FG05_30155                       97.8    1e-19   Fusarium graminearum
ref|XP_007745096.1|  hypothetical protein A1O5_06312                  98.2    2e-19   Cladophialophora psammophila CBS 110553
ref|XP_004363935.1|  hypothetical protein CAOG_03096                  97.4    2e-19   Capsaspora owczarzaki ATCC 30864
gb|EPT02812.1|  hypothetical protein FOMPIDRAFT_1143313               97.8    2e-19   Fomitopsis pinicola FP-58527 SS1
ref|XP_003850448.1|  hypothetical protein MYCGRDRAFT_74592            97.8    2e-19   Zymoseptoria tritici IPO323
gb|KFX41999.1|  Lysophospholipid acyltransferase                      97.8    2e-19   Talaromyces marneffei PM1
ref|XP_002153291.1|  MBOAT family protein, putative                   97.8    2e-19   Talaromyces marneffei ATCC 18224
emb|CEF74923.1|  unnamed protein product                              97.8    2e-19   
dbj|GAO20078.1|  hypothetical protein UVI_077590                      97.4    2e-19   
ref|XP_642430.1|  membrane bound O-acyl transferase family protein    97.1    2e-19   Dictyostelium discoideum AX4
gb|KEZ44883.1|  1-acylglycerol-3-phosphate O-acyltransferase          98.6    2e-19   Scedosporium apiospermum
gb|EKV12115.1|  MBOAT family protein, putative                        97.8    2e-19   Penicillium digitatum PHI26
gb|EMT70727.1|  Lysophospholipid acyltransferase                      97.4    2e-19   Fusarium oxysporum f. sp. cubense race 4
gb|KKA29495.1|  hypothetical protein TD95_001594                      97.1    2e-19   Thielaviopsis punctulata
ref|XP_007808225.1|  MBOAT family protein, putative                   96.7    2e-19   
gb|EXV00040.1|  MBOAT, membrane-bound o-acyltransferase family pr...  97.1    2e-19   
gb|EWG49706.1|  hypothetical protein FVEG_09159                       97.4    2e-19   
emb|CCT69301.1|  probable membrane-bound O-acyltransferase domain...  97.4    2e-19   
ref|XP_009526165.1|  hypothetical protein PHYSODRAFT_351108           96.7    2e-19   
gb|EXK40377.1|  hypothetical protein FOMG_07275                       97.1    3e-19   
gb|EXM23656.1|  hypothetical protein FOTG_09095                       97.1    3e-19   
gb|ENH74660.1|  Lysophospholipid acyltransferase                      97.1    3e-19   
gb|EGU84591.1|  hypothetical protein FOXB_04886                       97.1    3e-19   
ref|XP_008022914.1|  hypothetical protein SETTUDRAFT_37763            97.4    3e-19   
gb|EWZ38307.1|  hypothetical protein FOZG_09983                       97.1    3e-19   
ref|XP_006692858.1|  hypothetical protein CTHT_0023960                97.4    3e-19   
gb|KFG82606.1|  putative MBOAT family protein                         95.9    3e-19   
gb|EHN00131.1|  Ale1p                                                 97.4    3e-19   
gb|EMF12021.1|  MBOAT-domain-containing protein                       97.1    3e-19   
ref|XP_006671034.1|  MBOAT family protein                             97.1    3e-19   
ref|XP_009263323.1|  hypothetical protein FPSE_11931                  96.7    4e-19   
dbj|GAM86818.1|  hypothetical protein ANO11243_048380                 96.7    4e-19   
gb|EWC45084.1|  hypothetical protein DRE_06223                        96.7    4e-19   
ref|XP_009268403.1|  Lysophospholipid acyltransferase                 95.9    4e-19   
ref|XP_007784935.1|  hypothetical protein W97_08878                   96.7    4e-19   
ref|XP_002795040.1|  MBOAT family protein                             96.3    5e-19   
gb|KHN97685.1|  Membrane bound O-acyl transferase, MBOAT              95.1    5e-19   
ref|XP_003000833.1|  membrane-bound O-acyltransferase domain-cont...  96.3    5e-19   
ref|XP_007729423.1|  hypothetical protein A1O3_01085                  96.3    6e-19   
gb|KEF58080.1|  hypothetical protein A1O9_06003                       96.3    7e-19   
emb|CCE34255.1|  uncharacterized protein CPUR_08187                   94.7    7e-19   
gb|KID75185.1|  Membrane bound O-acyl transferase, MBOAT              94.7    8e-19   
gb|KEQ96118.1|  hypothetical protein AUEXF2481DRAFT_107545            95.9    8e-19   
gb|KIX06409.1|  hypothetical protein Z518_04385                       95.9    8e-19   
gb|KFY39392.1|  hypothetical protein V494_03994                       95.9    8e-19   
gb|KFA65387.1|  hypothetical protein S40285_00447                     95.5    8e-19   
ref|XP_003304329.1|  hypothetical protein PTT_16886                   95.9    9e-19   
gb|KDQ14382.1|  hypothetical protein BOTBODRAFT_159594                95.5    1e-18   
gb|KFA52880.1|  hypothetical protein S40293_00960                     95.5    1e-18   
ref|XP_005536310.1|  hypothetical protein, conserved                  95.5    1e-18   
gb|KEY67288.1|  hypothetical protein S7711_04541                      95.5    1e-18   
ref|XP_001931658.1|  membrane-bound O-acyltransferase domain cont...  95.5    1e-18   
ref|XP_011387284.1|  hypothetical protein UMAG_01407                  95.5    1e-18   
ref|XP_009155143.1|  hypothetical protein HMPREF1120_02849            95.5    1e-18   
gb|KJZ73352.1|  hypothetical protein HIM_07146                        95.1    1e-18   
ref|XP_009656962.1|  membrane-bound O-acyltransferase domain-cont...  95.1    1e-18   
gb|KFY27737.1|  hypothetical protein V491_00760                       95.1    1e-18   
ref|XP_007675587.1|  hypothetical protein BAUCODRAFT_138379           95.1    1e-18   
gb|KIW78152.1|  hypothetical protein Z517_07985                       95.1    2e-18   
gb|KJK79563.1|  Lysophospholipid acyltransferase                      94.7    2e-18   
emb|CDM37593.1|  Lysophospholipid acyltransferase                     95.1    2e-18   
gb|KFY15240.1|  hypothetical protein V492_02127                       94.7    2e-18   
ref|XP_006969788.1|  predicted protein                                94.7    2e-18   
gb|KJJ12453.1|  hypothetical protein U727_00434080251                 94.7    2e-18   
gb|KGO36091.1|  Membrane bound O-acyl transferase, MBOAT              94.7    2e-18   
ref|XP_003672702.1|  hypothetical protein NDAI_0K02680                94.7    2e-18   
ref|XP_008712338.1|  hypothetical protein HMPREF1541_09442            94.7    2e-18   
ref|XP_007315260.1|  hypothetical protein SERLADRAFT_460099           94.4    2e-18   
ref|XP_011128095.1|  hypothetical protein AOL_s00215g591              94.4    2e-18   
gb|KIK42844.1|  hypothetical protein CY34DRAFT_751446                 94.0    3e-18   
ref|XP_008893287.1|  hypothetical protein PPTG_01659                  94.0    3e-18   
gb|KGO66567.1|  Membrane bound O-acyl transferase, MBOAT              94.4    3e-18   
gb|KFY25500.1|  hypothetical protein V493_04639                       94.0    3e-18   
ref|XP_010761659.1|  hypothetical protein PADG_06237                  94.0    3e-18   
gb|EEH16836.1|  hypothetical protein PABG_06923                       94.0    3e-18   
gb|ETP43022.1|  hypothetical protein F442_10106                       93.6    3e-18   
emb|CDR41219.1|  CYFA0S06e04170g1_1                                   94.4    3e-18   
gb|KIO03107.1|  hypothetical protein M404DRAFT_1001724                94.0    3e-18   
gb|EFA78146.1|  membrane bound O-acyl transferase family protein      93.2    3e-18   
ref|XP_002557289.1|  Pc12g04190                                       94.0    3e-18   
gb|KFZ15915.1|  hypothetical protein V502_05341                       94.0    4e-18   
gb|KFY84839.1|  hypothetical protein V500_08954                       93.6    4e-18   
gb|KIM95007.1|  hypothetical protein OIDMADRAFT_134806                93.6    4e-18   
gb|KEQ75562.1|  MBOAT-domain-containing protein                       93.6    4e-18   
ref|XP_002590246.1|  hypothetical protein BRAFLDRAFT_254328           92.4    4e-18   
gb|AGO11950.1|  AaceriAGR271Cp                                        94.0    4e-18   
ref|XP_009526166.1|  hypothetical protein PHYSODRAFT_314590           93.2    4e-18   
ref|XP_007792823.1|  putative mboat family protein                    93.6    4e-18   
gb|KFZ06990.1|  hypothetical protein V501_06894                       93.6    5e-18   
ref|XP_778325.1|  hypothetical protein CNBA3250                       93.6    5e-18   
ref|XP_007879910.1|  hypothetical protein PFL1_04196                  93.6    5e-18   
ref|NP_986937.2|  AGR271Cp                                            93.6    5e-18   
gb|KHJ30705.1|  putative mboat family protein                         93.2    5e-18   
ref|XP_011110775.1|  hypothetical protein H072_4885                   93.2    6e-18   
gb|KIY01470.1|  hypothetical protein Z520_03022                       93.6    6e-18   
gb|KJR86382.1|  lysophospholipid acyltransferase                      93.2    6e-18   
ref|XP_001598340.1|  hypothetical protein SS1G_00426                  93.2    6e-18   
ref|XP_001248887.1|  hypothetical protein CIMG_02658                  92.8    7e-18   
gb|ERS97165.1|  hypothetical protein HMPREF1624_06496                 93.2    7e-18   
gb|EFW22616.1|  MBOAT family protein                                  92.8    7e-18   
gb|KIH90667.1|  lysophospholipid acyltransferase                      93.2    7e-18   
ref|XP_007800504.1|  hypothetical protein EPUS_05507                  92.8    7e-18   
emb|CDH11884.1|  probable Lysophospholipid acyltransferase            93.2    8e-18   
ref|XP_003071140.1|  MBOAT family protein                             92.8    8e-18   
gb|EAS37304.3|  MBOAT family protein                                  92.8    8e-18   
gb|ELR10439.1|  hypothetical protein GMDG_00851                       92.8    8e-18   
gb|EHK17744.1|  hypothetical protein TRIVIDRAFT_57516                 92.4    9e-18   
ref|XP_003045299.1|  hypothetical protein NECHADRAFT_70470            92.8    9e-18   
gb|KIW73132.1|  hypothetical protein PV04_01273                       92.8    9e-18   
gb|KIJ19826.1|  hypothetical protein PAXINDRAFT_125984                92.4    9e-18   
gb|KFY76169.1|  hypothetical protein V498_09723                       92.4    1e-17   
gb|KFY64486.1|  hypothetical protein V496_03214                       92.4    1e-17   
gb|KEQ80500.1|  MBOAT family protein-like protein                     92.4    1e-17   
ref|XP_007927276.1|  hypothetical protein MYCFIDRAFT_188669           92.4    1e-17   
gb|KFY72919.1|  hypothetical protein V499_06961                       92.8    1e-17   
gb|EJY79710.1|  putative membrane protein                             92.0    1e-17   
gb|EUN22675.1|  hypothetical protein COCVIDRAFT_30352                 92.4    1e-17   
gb|EMD92685.1|  hypothetical protein COCHEDRAFT_117155                92.0    1e-17   
ref|XP_001805526.1|  hypothetical protein SNOG_15376                  92.0    1e-17   
emb|CDF89810.1|  ZYBA0S05-02234g1_1                                   92.4    1e-17   
ref|XP_007715804.1|  hypothetical protein COCCADRAFT_7983             92.0    2e-17   
dbj|GAM22032.1|  hypothetical protein SAMD00019534_052070             91.3    2e-17   
ref|XP_004356029.1|  membrane bound O-acyl transferase family pro...  91.7    2e-17   
gb|EKG16068.1|  Membrane bound O-acyl transferase MBOAT               92.0    2e-17   
gb|KEQ63877.1|  MBOAT family protein-like protein                     92.0    2e-17   
ref|XP_002543581.1|  conserved hypothetical protein                   92.0    2e-17   
gb|EJU06489.1|  MBOAT-domain-containing protein                       92.0    2e-17   
gb|KIL95824.1|  hypothetical protein FAVG1_00562                      91.7    2e-17   
gb|KDN37996.1|  MBOAT-domain-containing protein                       91.7    2e-17   
ref|XP_012137084.1|  PREDICTED: lysophospholipid acyltransferase ...  90.9    2e-17   
ref|XP_003171932.1|  membrane-bound O-acyltransferase domain-cont...  89.7    2e-17   
gb|KIK94416.1|  hypothetical protein PAXRUDRAFT_449654                91.3    2e-17   
ref|XP_012137085.1|  PREDICTED: lysophospholipid acyltransferase ...  90.5    2e-17   
ref|XP_003844361.1|  similar to MBOAT family protein                  91.7    2e-17   
ref|XP_007697212.1|  hypothetical protein COCSADRAFT_188292           91.7    2e-17   
gb|KFX94623.1|  hypothetical protein V490_04285                       91.7    2e-17   
ref|XP_001643411.1|  hypothetical protein Kpol_1042p12                91.7    3e-17   
ref|XP_008880481.1|  hypothetical protein, variant 2                  89.4    3e-17   
dbj|BAO40203.1|  acyltransferase for lyso-phosphatidylethanolamine    91.3    3e-17   
gb|KIJ70373.1|  hypothetical protein HYDPIDRAFT_143668                90.9    3e-17   
gb|KIW09392.1|  hypothetical protein PV09_00286                       91.3    3e-17   
gb|KFX96380.1|  hypothetical protein O988_05353                       90.9    3e-17   
gb|EZF25800.1|  hypothetical protein H100_01833                       91.3    3e-17   
ref|XP_008722431.1|  hypothetical protein G647_00806                  91.3    3e-17   
ref|XP_002621865.1|  MBOAT family protein                             90.9    3e-17   
ref|XP_009843853.1|  hypothetical protein, variant                    90.5    3e-17   
gb|KDQ28890.1|  hypothetical protein PLEOSDRAFT_1040003               90.5    4e-17   
gb|EGE83597.1|  MBOAT family protein                                  90.9    4e-17   
gb|EQB57300.1|  MBOAT family protein                                  90.9    4e-17   
gb|EDZ69237.1|  YOR175Cp-like protein                                 88.6    4e-17   
ref|XP_008035617.1|  MBOAT-domain-containing protein                  90.5    4e-17   
ref|XP_011276207.1|  lysophospholipid acyltransferase                 90.9    4e-17   
ref|XP_003701761.1|  PREDICTED: lysophospholipid acyltransferase ...  90.5    4e-17   
ref|XP_007287206.1|  mboat family protein                             90.5    4e-17   
gb|KIW35152.1|  hypothetical protein PV07_01867                       90.9    5e-17   
ref|XP_007296108.1|  MBOAT family protein                             90.5    5e-17   
emb|CEP64216.1|  LALA0S10e05160g1_1                                   90.5    5e-17   
emb|CDO74287.1|  hypothetical protein BN946_scf184663.g8              89.7    6e-17   
ref|XP_007374537.1|  hypothetical protein SPAPADRAFT_60345            90.5    6e-17   
gb|KIL67251.1|  hypothetical protein M378DRAFT_74038                  90.1    6e-17   
gb|EGE00480.1|  MBOAT family protein                                  90.1    7e-17   
ref|XP_002555703.1|  KLTH0G15422p                                     90.1    7e-17   
gb|EZF30310.1|  hypothetical protein H101_06052                       90.1    7e-17   
ref|XP_008430409.1|  PREDICTED: lysophospholipid acyltransferase 1    89.7    7e-17   
gb|ERG84336.1|  lysophospholipid acyltransferase 2                    88.2    7e-17   
emb|CCX07676.1|  Similar to Lysophospholipid acyltransferase; acc...  89.7    8e-17   
gb|EEH03012.1|  MBOAT family protein                                  89.7    8e-17   
ref|XP_007752991.1|  hypothetical protein A1O7_00760                  90.1    8e-17   
gb|KID99127.1|  Membrane bound O-acyl transferase, MBOAT              88.6    8e-17   
ref|XP_008880480.1|  hypothetical protein H310_14403                  89.4    8e-17   
ref|XP_002770884.1|  DEHA2F23364p                                     89.7    9e-17   
gb|EHL03575.1|  putative Lysophospholipid acyltransferase             89.4    9e-17   
ref|XP_007586208.1|  putative mboat family protein                    89.7    9e-17   
ref|XP_003022005.1|  hypothetical protein TRV_03899                   89.7    1e-16   
gb|EJY76231.1|  Membrane bound O-acyl transferase family protein      89.0    1e-16   
ref|XP_003686174.1|  hypothetical protein TPHA_0F02600                89.7    1e-16   
ref|XP_002845553.1|  MBOAT family protein                             89.4    1e-16   
ref|XP_005101404.1|  PREDICTED: membrane-bound O-acyltransferase ...  89.4    1e-16   
ref|XP_008083810.1|  hypothetical protein GLAREA_00861                89.4    1e-16   
ref|XP_003017240.1|  hypothetical protein ARB_04117                   89.7    1e-16   
gb|KIM83962.1|  hypothetical protein PILCRDRAFT_97057                 89.0    1e-16   
gb|KIY45977.1|  MBOAT-domain-containing protein                       89.0    1e-16   
emb|CDO96291.1|  unnamed protein product                              89.4    1e-16   
gb|KIM67664.1|  hypothetical protein SCLCIDRAFT_20710                 89.0    1e-16   
ref|XP_002615737.1|  hypothetical protein CLUG_04619                  89.4    1e-16   
emb|CEP13852.1|  hypothetical protein                                 89.0    1e-16   
emb|CCF46357.1|  MBOAT family protein                                 89.0    1e-16   
ref|XP_455985.1|  hypothetical protein                                89.0    2e-16   
gb|ESZ91978.1|  MBOAT family protein                                  89.0    2e-16   
ref|XP_007684405.1|  hypothetical protein COCMIDRAFT_33486            88.6    2e-16   
ref|XP_007252280.1|  PREDICTED: membrane-bound O-acyltransferase ...  88.2    2e-16   
emb|CCA18673.1|  lysophospholipid acyltransferase putative            87.8    3e-16   
ref|XP_005158807.1|  PREDICTED: lysophospholipid acyltransferase ...  86.3    3e-16   
emb|CDW83355.1|  UNKNOWN                                              87.4    3e-16   
ref|XP_002838340.1|  hypothetical protein                             88.2    3e-16   
emb|CEJ04691.1|  hypothetical protein RMCBS344292_18646               86.7    3e-16   
ref|XP_006001444.1|  PREDICTED: lysophospholipid acyltransferase 2    87.0    3e-16   
ref|XP_005158806.1|  PREDICTED: lysophospholipid acyltransferase ...  85.9    4e-16   
ref|XP_002004184.1|  GI19773                                          88.6    4e-16   
ref|XP_008858839.1|  membrane-bound O-acyltransferase (MBOAT ) fa...  87.4    4e-16   
ref|XP_653096.1|  membrane-bound O-acyltransferase (MBOAT ) famil...  87.4    4e-16   
gb|KIK07691.1|  hypothetical protein K443DRAFT_673268                 87.4    4e-16   
ref|XP_007592829.1|  MBOAT family protein                             87.0    6e-16   
gb|KFH65307.1|  hypothetical protein MVEG_08787                       87.0    6e-16   
emb|CCE44830.1|  hypothetical protein CPAR2_406330                    87.0    8e-16   
ref|XP_001734903.1|  membrane-bound O-acyltransferase domain-cont...  86.7    8e-16   
ref|XP_001884296.1|  predicted protein                                86.7    8e-16   
ref|XP_007893047.1|  PREDICTED: lysophospholipid acyltransferase ...  87.0    8e-16   
ref|XP_003868851.1|  Ale1 protein                                     87.0    8e-16   
gb|EPB87696.1|  hypothetical protein HMPREF1544_05477                 86.3    8e-16   
ref|XP_007550954.1|  PREDICTED: lysophospholipid acyltransferase 1    86.7    8e-16   
gb|KDN48105.1|  hypothetical protein RSAG8_03121                      86.7    9e-16   
emb|CEJ81320.1|  Putative MBOAT family protein                        86.3    1e-15   
ref|XP_007839398.1|  hypothetical protein PFICI_12626                 86.3    1e-15   
ref|XP_007327854.1|  hypothetical protein AGABI1DRAFT_112247          85.9    1e-15   
ref|XP_006460393.1|  hypothetical protein AGABI2DRAFT_203434          85.9    1e-15   
emb|CEG65666.1|  hypothetical protein RMATCC62417_02402               85.5    1e-15   
emb|CCM03379.1|  predicted protein                                    86.3    1e-15   
ref|XP_505624.1|  YALI0F19514p                                        85.9    1e-15   
ref|XP_007337991.1|  endoplasmic reticulum protein                    85.9    1e-15   
ref|XP_699295.3|  PREDICTED: lysophospholipid acyltransferase 2 i...  85.9    1e-15   
emb|CEF68933.1|  Membrane bound O-acyl transferase, MBOAT family-...  85.9    2e-15   
gb|ENH85298.1|  mboat family protein                                  85.1    2e-15   
emb|CCA18672.1|  lysophospholipid acyltransferase putative            85.5    2e-15   
ref|XP_007003334.1|  hypothetical protein TREMEDRAFT_43126            85.5    2e-15   
gb|KDN66214.1|  putative MBOAT family protein                         85.5    2e-15   
ref|XP_003645444.1|  hypothetical protein Ecym_3123                   85.5    3e-15   
gb|EFX00128.1|  mboat family protein                                  85.5    3e-15   
gb|EFQ28671.1|  MBOAT family protein                                  85.1    3e-15   
ref|XP_006860851.1|  PREDICTED: lysophospholipid acyltransferase 1    84.7    3e-15   
gb|EHJ64677.1|  hypothetical protein KGM_03183                        84.7    3e-15   
gb|EJT50052.1|  member of the MBOAT family of putative membrane-b...  85.1    3e-15   
ref|XP_010778906.1|  PREDICTED: lysophospholipid acyltransferase 2    84.0    3e-15   
gb|AIN34715.1|  fatty alcohol acetyltransferase                       84.0    3e-15   
gb|EKD00632.1|  member of the MBOAT family of putative membrane-b...  85.1    3e-15   



>ref|XP_009764156.1| PREDICTED: lysophospholipid acyltransferase 1-like [Nicotiana 
sylvestris]
Length=463

 Score =   310 bits (794),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 160/187 (86%), Positives = 175/187 (94%), Gaps = 0/187 (0%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGFSGWT+SSPP+P WDRAKNVD+LGVELAKSSVQLPLVWNIQ
Sbjct  263  KYYFIWSISEASIIISGLGFSGWTDSSPPEPRWDRAKNVDVLGVELAKSSVQLPLVWNIQ  322

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERL+ KG+KPGFFQLLATQTVSAVWHGLYPGY+IFFVQSALMIAGSR IY
Sbjct  323  VSTWLRHYVYERLVQKGRKPGFFQLLATQTVSAVWHGLYPGYIIFFVQSALMIAGSRVIY  382

Query  418  RWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPVVL  239
            RWQQ T   + +KILALMNFAYTLLVLNYS VGF+VLSLHETL +YGSVYY+GTI+P+VL
Sbjct  383  RWQQATKGTLFEKILALMNFAYTLLVLNYSAVGFMVLSLHETLTSYGSVYYIGTIIPIVL  442

Query  238  IMLGNII  218
            I+LG +I
Sbjct  443  ILLGKVI  449



>ref|XP_009759896.1| PREDICTED: lysophospholipid acyltransferase 1-like [Nicotiana 
sylvestris]
Length=463

 Score =   310 bits (793),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 160/187 (86%), Positives = 172/187 (92%), Gaps = 0/187 (0%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEA+I++SGLGFSGWT SSPPKPLWDRAKNVD+LGVELAKSSVQLPLVWNIQ
Sbjct  263  KYYFIWSISEAAIVVSGLGFSGWTNSSPPKPLWDRAKNVDVLGVELAKSSVQLPLVWNIQ  322

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERLI KG+KPGFFQLLATQTVSAVWHGLYPGY+IFFVQSALMIAGSR IY
Sbjct  323  VSTWLRHYVYERLIQKGRKPGFFQLLATQTVSAVWHGLYPGYIIFFVQSALMIAGSRVIY  382

Query  418  RWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPVVL  239
            RWQQ     + +KIL LMNFAYTLLVLNYS VGF+VLSLHETL AYGSVYYVGTIVPVVL
Sbjct  383  RWQQAATGTLFEKILVLMNFAYTLLVLNYSAVGFMVLSLHETLTAYGSVYYVGTIVPVVL  442

Query  238  IMLGNII  218
            I+L  ++
Sbjct  443  ILLSKVV  449



>emb|CDP09808.1| unnamed protein product [Coffea canephora]
Length=463

 Score =   307 bits (787),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 159/187 (85%), Positives = 171/187 (91%), Gaps = 0/187 (0%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEAS+IISGLGFSGW++SSPPKP WDRAKNVDILGVE AKS+VQLPLVWNIQ
Sbjct  263  KYYFIWSISEASMIISGLGFSGWSDSSPPKPKWDRAKNVDILGVEFAKSAVQLPLVWNIQ  322

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERL+  GKK GFFQLLATQTVSAVWHGLYPGYMIFFVQSAL IAGSR IY
Sbjct  323  VSTWLRHYVYERLVQDGKKAGFFQLLATQTVSAVWHGLYPGYMIFFVQSALFIAGSRVIY  382

Query  418  RWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPVVL  239
            RWQQ T  A+ KKIL  +NFAYTLLVLNYSC+GFLVLSLHETLA YGSV+YVGTI+P+ L
Sbjct  383  RWQQATSAALFKKILVFLNFAYTLLVLNYSCIGFLVLSLHETLAGYGSVFYVGTILPIAL  442

Query  238  IMLGNII  218
            I+LGNII
Sbjct  443  ILLGNII  449



>ref|XP_009628905.1| PREDICTED: lysophospholipid acyltransferase 1-like [Nicotiana 
tomentosiformis]
Length=463

 Score =   306 bits (785),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 159/187 (85%), Positives = 173/187 (93%), Gaps = 0/187 (0%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGFSGWT+SSPP+P WDRAKNVD+LGVELAKSSVQLPLVWNIQ
Sbjct  263  KYYFIWSISEASIIISGLGFSGWTDSSPPEPRWDRAKNVDVLGVELAKSSVQLPLVWNIQ  322

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERL+ KG+KPGFFQLLATQTVSAVWHGLYPGY+IFFVQSALMIAGSR IY
Sbjct  323  VSTWLRHYVYERLVQKGRKPGFFQLLATQTVSAVWHGLYPGYIIFFVQSALMIAGSRVIY  382

Query  418  RWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPVVL  239
            RWQQ T   + +KIL LMNFAYTLLVLNYS VGF+VLSLHETL +YGSVYY+GTI+P+VL
Sbjct  383  RWQQATKGTLFEKILTLMNFAYTLLVLNYSAVGFMVLSLHETLTSYGSVYYIGTIIPMVL  442

Query  238  IMLGNII  218
            I+LG  I
Sbjct  443  ILLGKAI  449



>ref|XP_007023108.1| MBOAT (membrane bound O-acyl transferase) family protein isoform 
3 [Theobroma cacao]
 gb|EOY25730.1| MBOAT (membrane bound O-acyl transferase) family protein isoform 
3 [Theobroma cacao]
Length=339

 Score =   301 bits (771),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 159/187 (85%), Positives = 172/187 (92%), Gaps = 0/187 (0%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGFSGWTESSPPKP WDRAKNVDILGVELAKSSV LPLVWNIQ
Sbjct  140  KYYFIWSISEASIIISGLGFSGWTESSPPKPKWDRAKNVDILGVELAKSSVVLPLVWNIQ  199

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERLI+KG+KPGFFQLLATQTVSAVWHGLYPGY+IFFVQSALMIAGSR IY
Sbjct  200  VSTWLRHYVYERLITKGRKPGFFQLLATQTVSAVWHGLYPGYIIFFVQSALMIAGSRVIY  259

Query  418  RWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPVVL  239
            RW+Q T  A++KK    MNFAYTLLVLNYS VGF+VLS+HETLA+Y SVYY+GTI+P+ L
Sbjct  260  RWEQATNMALVKKAFVFMNFAYTLLVLNYSAVGFMVLSMHETLASYSSVYYIGTILPIAL  319

Query  238  IMLGNII  218
            I+LG II
Sbjct  320  ILLGYII  326



>gb|AER57989.2| putative lysophosphatidylcholine acyltransferase 2 [Helianthus 
annuus]
Length=454

 Score =   305 bits (781),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 161/187 (86%), Positives = 172/187 (92%), Gaps = 1/187 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISG GFSGWT+SSPPK  WDRAKNVD+LGVE AKSSV+LPLVWNIQ
Sbjct  256  KYYFIWSISEASIIISGFGFSGWTDSSPPKARWDRAKNVDVLGVEFAKSSVELPLVWNIQ  315

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVY+RL+ KGKKPGFFQLLATQTVSAVWHGLYPGY+IFFVQSALMIAGSRAIY
Sbjct  316  VSTWLRHYVYDRLVQKGKKPGFFQLLATQTVSAVWHGLYPGYLIFFVQSALMIAGSRAIY  375

Query  418  RWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPVVL  239
            RWQQ     + KK L LMNFAYTLLVLNYSC+GF+VLSLHETLAAYGSVYYVGTI+PV L
Sbjct  376  RWQQAVPPTV-KKFLMLMNFAYTLLVLNYSCIGFMVLSLHETLAAYGSVYYVGTIIPVAL  434

Query  238  IMLGNII  218
            I+LGNII
Sbjct  435  ILLGNII  441



>emb|CBI34747.3| unnamed protein product [Vitis vinifera]
Length=456

 Score =   305 bits (781),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 157/187 (84%), Positives = 174/187 (93%), Gaps = 0/187 (0%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEA++IISGLGFSGWTESSPPKP WDRAKNVDILGVELAKS+V LPLVWNIQ
Sbjct  256  KYYFIWSISEAAVIISGLGFSGWTESSPPKPKWDRAKNVDILGVELAKSAVTLPLVWNIQ  315

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLR+YVYERLI  GKKPGF QLLATQTVSAVWHGLYPGY+IFFVQSALMIAGSR +Y
Sbjct  316  VSTWLRYYVYERLIQNGKKPGFLQLLATQTVSAVWHGLYPGYIIFFVQSALMIAGSRVLY  375

Query  418  RWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPVVL  239
            RWQQ T NA+ KK++  +NFAYTLLVLNYSCVGF+VLSLHETLA+YGSVYY+GTI+P+VL
Sbjct  376  RWQQATSNALFKKMVVFINFAYTLLVLNYSCVGFMVLSLHETLASYGSVYYIGTILPIVL  435

Query  238  IMLGNII  218
            ++LG II
Sbjct  436  VLLGYII  442



>ref|XP_002282807.1| PREDICTED: lysophospholipid acyltransferase 1 [Vitis vinifera]
Length=463

 Score =   305 bits (781),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 157/187 (84%), Positives = 174/187 (93%), Gaps = 0/187 (0%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEA++IISGLGFSGWTESSPPKP WDRAKNVDILGVELAKS+V LPLVWNIQ
Sbjct  263  KYYFIWSISEAAVIISGLGFSGWTESSPPKPKWDRAKNVDILGVELAKSAVTLPLVWNIQ  322

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLR+YVYERLI  GKKPGF QLLATQTVSAVWHGLYPGY+IFFVQSALMIAGSR +Y
Sbjct  323  VSTWLRYYVYERLIQNGKKPGFLQLLATQTVSAVWHGLYPGYIIFFVQSALMIAGSRVLY  382

Query  418  RWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPVVL  239
            RWQQ T NA+ KK++  +NFAYTLLVLNYSCVGF+VLSLHETLA+YGSVYY+GTI+P+VL
Sbjct  383  RWQQATSNALFKKMVVFINFAYTLLVLNYSCVGFMVLSLHETLASYGSVYYIGTILPIVL  442

Query  238  IMLGNII  218
            ++LG II
Sbjct  443  VLLGYII  449



>ref|XP_009609255.1| PREDICTED: lysophospholipid acyltransferase 1-like [Nicotiana 
tomentosiformis]
Length=463

 Score =   304 bits (778),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 160/187 (86%), Positives = 170/187 (91%), Gaps = 0/187 (0%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEA+IIISGLGFSGWT SS PKP WDRAKNVD+LGVELAKSSVQLPLVWNIQ
Sbjct  263  KYYFIWSISEAAIIISGLGFSGWTNSSSPKPRWDRAKNVDVLGVELAKSSVQLPLVWNIQ  322

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERLI KG+KPGFFQLLATQTVSAVWHGLYPGY+IFFVQSALMIAGSR IY
Sbjct  323  VSTWLRHYVYERLIQKGRKPGFFQLLATQTVSAVWHGLYPGYIIFFVQSALMIAGSRVIY  382

Query  418  RWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPVVL  239
            RWQQ     + +KIL LMNFAYTLLVLNYS VGF+VLSLHETL AYGSVYYVGTIVPVVL
Sbjct  383  RWQQAATGTLFEKILVLMNFAYTLLVLNYSAVGFMVLSLHETLTAYGSVYYVGTIVPVVL  442

Query  238  IMLGNII  218
            I+L  ++
Sbjct  443  ILLSKVV  449



>ref|XP_004245650.1| PREDICTED: lysophospholipid acyltransferase 1-like [Solanum lycopersicum]
Length=463

 Score =   304 bits (778),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 159/187 (85%), Positives = 171/187 (91%), Gaps = 0/187 (0%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGFSGWT SSPPKP WDRAKNVD+LGVELAKSSVQLPLVWNIQ
Sbjct  263  KYYFIWSISEASIIISGLGFSGWTNSSPPKPRWDRAKNVDVLGVELAKSSVQLPLVWNIQ  322

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERL+ KG+KPGFFQLLATQTVSAVWHGLYPGY+IFFVQSALMIAGSR IY
Sbjct  323  VSTWLRHYVYERLVQKGRKPGFFQLLATQTVSAVWHGLYPGYIIFFVQSALMIAGSRVIY  382

Query  418  RWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPVVL  239
            RWQQ T   + +KIL  MNFAYTLLVLNYS VGF+VLSLHETL AYGSVYY+GTIVP++L
Sbjct  383  RWQQATKGTMFEKILIAMNFAYTLLVLNYSAVGFMVLSLHETLTAYGSVYYIGTIVPILL  442

Query  238  IMLGNII  218
            I+L  +I
Sbjct  443  ILLSKVI  449



>gb|AFK40120.1| unknown [Lotus japonicus]
Length=211

 Score =   295 bits (754),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 166/203 (82%), Positives = 184/203 (91%), Gaps = 2/203 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGFSGWTESSPPKP WDRAKNVDI+GVELAKS+V +P VWNIQ
Sbjct  9    KYYFIWSISEASIIISGLGFSGWTESSPPKPRWDRAKNVDIVGVELAKSAVVIPTVWNIQ  68

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERLI  GKKPGFFQLLATQTVSA+WHGLYPGY+IFFVQSALMIAGSR IY
Sbjct  69   VSTWLRHYVYERLIQNGKKPGFFQLLATQTVSAIWHGLYPGYIIFFVQSALMIAGSRVIY  128

Query  418  RWQQGTGN--AILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQQG     A++K +L  MNFAYTLLVLNYS VGF+VLSLHET+A+YGSVYY+GT++PV
Sbjct  129  RWQQGVPPTMALVKNVLVFMNFAYTLLVLNYSSVGFMVLSLHETIASYGSVYYIGTVLPV  188

Query  244  VLIMLGNIIkpakparskarKDQ  176
            V+I+LG +IKP KP R+KARKDQ
Sbjct  189  VVILLGKVIKPGKPVRTKARKDQ  211



>ref|XP_007023107.1| MBOAT (membrane bound O-acyl transferase) family protein isoform 
2 [Theobroma cacao]
 gb|EOY25729.1| MBOAT (membrane bound O-acyl transferase) family protein isoform 
2 [Theobroma cacao]
Length=417

 Score =   301 bits (770),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 159/187 (85%), Positives = 172/187 (92%), Gaps = 0/187 (0%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGFSGWTESSPPKP WDRAKNVDILGVELAKSSV LPLVWNIQ
Sbjct  218  KYYFIWSISEASIIISGLGFSGWTESSPPKPKWDRAKNVDILGVELAKSSVVLPLVWNIQ  277

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERLI+KG+KPGFFQLLATQTVSAVWHGLYPGY+IFFVQSALMIAGSR IY
Sbjct  278  VSTWLRHYVYERLITKGRKPGFFQLLATQTVSAVWHGLYPGYIIFFVQSALMIAGSRVIY  337

Query  418  RWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPVVL  239
            RW+Q T  A++KK    MNFAYTLLVLNYS VGF+VLS+HETLA+Y SVYY+GTI+P+ L
Sbjct  338  RWEQATNMALVKKAFVFMNFAYTLLVLNYSAVGFMVLSMHETLASYSSVYYIGTILPIAL  397

Query  238  IMLGNII  218
            I+LG II
Sbjct  398  ILLGYII  404



>ref|XP_007023106.1| MBOAT (membrane bound O-acyl transferase) family protein isoform 
1 [Theobroma cacao]
 ref|XP_007023109.1| MBOAT (membrane bound O-acyl transferase) family protein isoform 
1 [Theobroma cacao]
 gb|EOY25728.1| MBOAT (membrane bound O-acyl transferase) family protein isoform 
1 [Theobroma cacao]
 gb|EOY25731.1| MBOAT (membrane bound O-acyl transferase) family protein isoform 
1 [Theobroma cacao]
Length=461

 Score =   301 bits (772),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 159/187 (85%), Positives = 172/187 (92%), Gaps = 0/187 (0%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGFSGWTESSPPKP WDRAKNVDILGVELAKSSV LPLVWNIQ
Sbjct  262  KYYFIWSISEASIIISGLGFSGWTESSPPKPKWDRAKNVDILGVELAKSSVVLPLVWNIQ  321

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERLI+KG+KPGFFQLLATQTVSAVWHGLYPGY+IFFVQSALMIAGSR IY
Sbjct  322  VSTWLRHYVYERLITKGRKPGFFQLLATQTVSAVWHGLYPGYIIFFVQSALMIAGSRVIY  381

Query  418  RWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPVVL  239
            RW+Q T  A++KK    MNFAYTLLVLNYS VGF+VLS+HETLA+Y SVYY+GTI+P+ L
Sbjct  382  RWEQATNMALVKKAFVFMNFAYTLLVLNYSAVGFMVLSMHETLASYSSVYYIGTILPIAL  441

Query  238  IMLGNII  218
            I+LG II
Sbjct  442  ILLGYII  448



>ref|XP_011081031.1| PREDICTED: lysophospholipid acyltransferase 1-like [Sesamum indicum]
 ref|XP_011081032.1| PREDICTED: lysophospholipid acyltransferase 1-like [Sesamum indicum]
Length=465

 Score =   301 bits (771),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 154/187 (82%), Positives = 173/187 (93%), Gaps = 0/187 (0%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISG+GFSGWT+S+PPKP WDRAKNVDILG+ELAKS+VQ+PLVWNIQ
Sbjct  265  KYYFIWSISEASIIISGMGFSGWTDSNPPKPRWDRAKNVDILGLELAKSAVQIPLVWNIQ  324

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERLI KGKKPGFFQLLATQTVSAVWHGLYPGY+IFFVQSA MIAGSR +Y
Sbjct  325  VSTWLRHYVYERLIQKGKKPGFFQLLATQTVSAVWHGLYPGYIIFFVQSATMIAGSRVLY  384

Query  418  RWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPVVL  239
            RWQQ +   ++KK+  L+NFAYTLLVLNYSCVGF+VLSLHET+ AY SVYY+GTIVP+VL
Sbjct  385  RWQQASQTPLVKKLFDLLNFAYTLLVLNYSCVGFMVLSLHETVTAYRSVYYIGTIVPIVL  444

Query  238  IMLGNII  218
            I+LG +I
Sbjct  445  ILLGKVI  451



>ref|XP_010112575.1| hypothetical protein L484_010580 [Morus notabilis]
 gb|EXC34122.1| hypothetical protein L484_010580 [Morus notabilis]
Length=464

 Score =   301 bits (770),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 162/189 (86%), Positives = 175/189 (93%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIIS LGFSGWT+SSPPK  WDRAKNVDILGVELAKSSV+LPLVWNIQ
Sbjct  263  KYYFIWSISEASIIISSLGFSGWTDSSPPKARWDRAKNVDILGVELAKSSVELPLVWNIQ  322

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVY+RL+ KGKKPGFFQLLATQTVSAVWHGLYPGY+IFFVQSALMIAGSR +Y
Sbjct  323  VSTWLRHYVYDRLVQKGKKPGFFQLLATQTVSAVWHGLYPGYIIFFVQSALMIAGSRVVY  382

Query  418  RWQQGTGN--AILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQQ      A++KKIL LMNFAYTLLVLNYSCVGF+VLSLHETLA+YGSVYYVGTI+P+
Sbjct  383  RWQQSVPPKLALVKKILVLMNFAYTLLVLNYSCVGFIVLSLHETLASYGSVYYVGTILPI  442

Query  244  VLIMLGNII  218
            VLI+LG II
Sbjct  443  VLILLGYII  451



>gb|KJB68444.1| hypothetical protein B456_010G246400 [Gossypium raimondii]
Length=304

 Score =   295 bits (755),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 172/189 (91%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEA++IISGLGFSGWTESSPPKP WDRAK VDILG ELAKSSV LPLVWNIQ
Sbjct  103  KYYFIWSISEAAMIISGLGFSGWTESSPPKPKWDRAKVVDILGFELAKSSVLLPLVWNIQ  162

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERL+ KGKKPGFFQLLATQTVSAVWHGLYPGY+IFFVQSALMIAGSR IY
Sbjct  163  VSTWLRHYVYERLVKKGKKPGFFQLLATQTVSAVWHGLYPGYIIFFVQSALMIAGSRVIY  222

Query  418  RWQQG--TGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            +W++   T  A++KK  A+MNFAYTLLVLNYSCVGF+VLS HETLA+YGSVYY+GTI+P+
Sbjct  223  QWEKAIPTNMALVKKAFAVMNFAYTLLVLNYSCVGFMVLSKHETLASYGSVYYIGTIIPI  282

Query  244  VLIMLGNII  218
             LI+LG II
Sbjct  283  ALIILGYII  291



>ref|XP_004244602.1| PREDICTED: lysophospholipid acyltransferase 1-like [Solanum lycopersicum]
Length=463

 Score =   300 bits (767),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 151/187 (81%), Positives = 172/187 (92%), Gaps = 0/187 (0%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISE+++IISGLGFSGWT+SSPPKP WDRAKNVD+LGVELAKSSVQLPLVWNIQ
Sbjct  263  KYYFIWSISESAVIISGLGFSGWTDSSPPKPRWDRAKNVDVLGVELAKSSVQLPLVWNIQ  322

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERL+ KGKK GFFQLLATQT+SAVWHGLYPGY+IFFVQSALMIAGSR IY
Sbjct  323  VSTWLRHYVYERLVQKGKKAGFFQLLATQTISAVWHGLYPGYIIFFVQSALMIAGSRVIY  382

Query  418  RWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPVVL  239
            RWQQ T   + +KIL L++FAYTLL+LNYS VGF+VLSLHETL +YGSVYY+GT++P+VL
Sbjct  383  RWQQATKGTLFEKILTLISFAYTLLILNYSAVGFMVLSLHETLTSYGSVYYIGTVIPIVL  442

Query  238  IMLGNII  218
            I+L  +I
Sbjct  443  ILLSKVI  449



>gb|KDP25507.1| hypothetical protein JCGZ_20663 [Jatropha curcas]
Length=458

 Score =   298 bits (762),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 172/189 (91%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGFSGWT++SPP+P WDRAKNVDILGVE AKSSV+LPLVWNIQ
Sbjct  256  KYYFIWSISEASIIISGLGFSGWTDTSPPRPRWDRAKNVDILGVEFAKSSVELPLVWNIQ  315

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERLI KGKKPGFFQLLATQT SAVWHGLYPGY+IFFVQSALMI GSR IY
Sbjct  316  VSTWLRHYVYERLIQKGKKPGFFQLLATQTTSAVWHGLYPGYIIFFVQSALMINGSRVIY  375

Query  418  RWQQG--TGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQQ   +   ++K +L  MNFAYT+LVLNYSCVGF+VLSLHET+AAYGSVYY+GTI+P+
Sbjct  376  RWQQAVPSNKGLVKNVLVFMNFAYTVLVLNYSCVGFMVLSLHETIAAYGSVYYIGTILPI  435

Query  244  VLIMLGNII  218
            VLI+LG II
Sbjct  436  VLILLGYII  444



>gb|AHE80989.1| acyl-CoA:lysophosphatidylcholine acyltransferase [Carthamus tinctorius]
Length=462

 Score =   298 bits (763),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 159/189 (84%), Positives = 171/189 (90%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGFSGWT+SSPPK  WDRAKNVD+LGVE AKSSV+LPLVWNIQ
Sbjct  261  KYYFIWSISEASIIISGLGFSGWTDSSPPKAQWDRAKNVDVLGVEFAKSSVELPLVWNIQ  320

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVY+RL+ KGKKPGFFQLLATQ VSAVWHGLYPGYMIFFVQSALMIAGSRAIY
Sbjct  321  VSTWLRHYVYDRLVQKGKKPGFFQLLATQAVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  380

Query  418  RWQQGT--GNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQQ      AI+KK   LMNFAYTLLVLN SCVGFLVL+L ETLAAY SVYY+GT+VPV
Sbjct  381  RWQQSVPPNMAIVKKAFMLMNFAYTLLVLNASCVGFLVLNLDETLAAYASVYYIGTVVPV  440

Query  244  VLIMLGNII  218
            ++I+LGNII
Sbjct  441  IVILLGNII  449



>ref|XP_012087002.1| PREDICTED: lysophospholipid acyltransferase 1-like [Jatropha 
curcas]
Length=465

 Score =   298 bits (763),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 172/189 (91%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGFSGWT++SPP+P WDRAKNVDILGVE AKSSV+LPLVWNIQ
Sbjct  263  KYYFIWSISEASIIISGLGFSGWTDTSPPRPRWDRAKNVDILGVEFAKSSVELPLVWNIQ  322

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERLI KGKKPGFFQLLATQT SAVWHGLYPGY+IFFVQSALMI GSR IY
Sbjct  323  VSTWLRHYVYERLIQKGKKPGFFQLLATQTTSAVWHGLYPGYIIFFVQSALMINGSRVIY  382

Query  418  RWQQG--TGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQQ   +   ++K +L  MNFAYT+LVLNYSCVGF+VLSLHET+AAYGSVYY+GTI+P+
Sbjct  383  RWQQAVPSNKGLVKNVLVFMNFAYTVLVLNYSCVGFMVLSLHETIAAYGSVYYIGTILPI  442

Query  244  VLIMLGNII  218
            VLI+LG II
Sbjct  443  VLILLGYII  451



>gb|KJB68448.1| hypothetical protein B456_010G246400 [Gossypium raimondii]
Length=359

 Score =   294 bits (753),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 172/189 (91%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEA++IISGLGFSGWTESSPPKP WDRAK VDILG ELAKSSV LPLVWNIQ
Sbjct  158  KYYFIWSISEAAMIISGLGFSGWTESSPPKPKWDRAKVVDILGFELAKSSVLLPLVWNIQ  217

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERL+ KGKKPGFFQLLATQTVSAVWHGLYPGY+IFFVQSALMIAGSR IY
Sbjct  218  VSTWLRHYVYERLVKKGKKPGFFQLLATQTVSAVWHGLYPGYIIFFVQSALMIAGSRVIY  277

Query  418  RWQQG--TGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            +W++   T  A++KK  A+MNFAYTLLVLNYSCVGF+VLS HETLA+YGSVYY+GTI+P+
Sbjct  278  QWEKAIPTNMALVKKAFAVMNFAYTLLVLNYSCVGFMVLSKHETLASYGSVYYIGTIIPI  337

Query  244  VLIMLGNII  218
             LI+LG II
Sbjct  338  ALIILGYII  346



>gb|KJB29823.1| hypothetical protein B456_005G120200 [Gossypium raimondii]
Length=462

 Score =   298 bits (762),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 158/187 (84%), Positives = 171/187 (91%), Gaps = 0/187 (0%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGFSGWTESSPPKP WDRAKNVDI GVELAKS+V LPLVWNIQ
Sbjct  263  KYYFIWSISEASIIISGLGFSGWTESSPPKPKWDRAKNVDIPGVELAKSAVVLPLVWNIQ  322

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERLI+KGKKPGFFQLLATQTVSAVWHGLYPGYM+FFVQSALMIAGSR +Y
Sbjct  323  VSTWLRHYVYERLITKGKKPGFFQLLATQTVSAVWHGLYPGYMLFFVQSALMIAGSRVLY  382

Query  418  RWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPVVL  239
            RW+Q T   ++KK L  +NFAYTLL+LNYS VGFLVLSLHE+LA YGSVYYVGTI+P+ L
Sbjct  383  RWEQATNMGLVKKALVFINFAYTLLILNYSAVGFLVLSLHESLALYGSVYYVGTILPITL  442

Query  238  IMLGNII  218
            I+LG II
Sbjct  443  ILLGYII  449



>ref|XP_010055596.1| PREDICTED: lysophospholipid acyltransferase 1-like [Eucalyptus 
grandis]
 gb|KCW72086.1| hypothetical protein EUGRSUZ_E00532 [Eucalyptus grandis]
Length=465

 Score =   297 bits (760),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 171/189 (90%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIII GLGFSGWTESSPPKP WDRAKNVDILGVE A S+VQLPLVWNIQ
Sbjct  263  KYYFIWSISEASIIIGGLGFSGWTESSPPKPKWDRAKNVDILGVEFATSAVQLPLVWNIQ  322

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVY+RL+ KGKKPGFFQLLATQTVSAVWHGLYPGY+IFFVQSALMIAGSR IY
Sbjct  323  VSTWLRHYVYDRLVQKGKKPGFFQLLATQTVSAVWHGLYPGYIIFFVQSALMIAGSRVIY  382

Query  418  RWQQG--TGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQQ      A++K IL  +NFAYTLLVLNYSCVGF+VLSLHET+A+YGSVYY+GTI+P+
Sbjct  383  RWQQAIPPKMALMKNILVFLNFAYTLLVLNYSCVGFMVLSLHETIASYGSVYYIGTILPI  442

Query  244  VLIMLGNII  218
             LI+LG +I
Sbjct  443  ALILLGYVI  451



>gb|EYU38990.1| hypothetical protein MIMGU_mgv1a005877mg [Erythranthe guttata]
Length=466

 Score =   296 bits (759),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 152/187 (81%), Positives = 170/187 (91%), Gaps = 0/187 (0%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEAS+IISGLGFSGWT +SPPK  WDRAKNVD+LGVELAKSSVQLPLVWNIQ
Sbjct  266  KYYFIWSISEASVIISGLGFSGWTGASPPKARWDRAKNVDVLGVELAKSSVQLPLVWNIQ  325

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERL+  GKKPGFFQLLATQTVSAVWHGLYPGY+IFFVQSA MIAGSR +Y
Sbjct  326  VSTWLRHYVYERLVQNGKKPGFFQLLATQTVSAVWHGLYPGYIIFFVQSATMIAGSRVLY  385

Query  418  RWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPVVL  239
            RWQQ +  A+LK +L   NFAYTLL+LNYSC+GF+VLS+ ET+AAYGSVYY+GTI+P+VL
Sbjct  386  RWQQASQTAVLKNLLVFSNFAYTLLILNYSCIGFMVLSMRETVAAYGSVYYIGTIIPIVL  445

Query  238  IMLGNII  218
            I+LG II
Sbjct  446  ILLGKII  452



>ref|XP_006440536.1| hypothetical protein CICLE_v10020062mg [Citrus clementina]
 gb|ESR53776.1| hypothetical protein CICLE_v10020062mg [Citrus clementina]
Length=462

 Score =   296 bits (759),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 172/189 (91%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGFSGWTESSPPKP WDRAKNVDILGVE AKS+VQ+PLVWNIQ
Sbjct  260  KYYFIWSISEASIIISGLGFSGWTESSPPKPKWDRAKNVDILGVEFAKSAVQIPLVWNIQ  319

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERLI  GKKPGFFQLLATQTVSAVWHGLYPGY+IFFVQSALMIAGSR IY
Sbjct  320  VSTWLRHYVYERLIQNGKKPGFFQLLATQTVSAVWHGLYPGYIIFFVQSALMIAGSRVIY  379

Query  418  RWQQG--TGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQQ       ++KKI+  +NFAYT+LVLNYSCVGF+VLSLHET+A+YGSVYY+GTI+P+
Sbjct  380  RWQQALPPKMELVKKIMVFLNFAYTVLVLNYSCVGFMVLSLHETIASYGSVYYIGTIIPI  439

Query  244  VLIMLGNII  218
            VLI+L  +I
Sbjct  440  VLILLSYVI  448



>ref|XP_010278548.1| PREDICTED: lysophospholipid acyltransferase 1 [Nelumbo nucifera]
Length=464

 Score =   296 bits (759),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 158/188 (84%), Positives = 171/188 (91%), Gaps = 2/188 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGFSGW++SSPPKP WDRAKNVDI+ VELAKS+VQ+PLVWNIQ
Sbjct  263  KYYFIWSISEASIIISGLGFSGWSDSSPPKPRWDRAKNVDIIRVELAKSAVQIPLVWNIQ  322

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERLI KGKKPGFFQLLATQTVSAVWHGLYPGY+IFFVQSALMIAGSR IY
Sbjct  323  VSTWLRHYVYERLIQKGKKPGFFQLLATQTVSAVWHGLYPGYIIFFVQSALMIAGSRVIY  382

Query  418  RWQQGTGN--AILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQQ       ++ KIL  MNFAYTLLVLNYSCVGF+VLS+HETLA+YGSVYYVGTIVP+
Sbjct  383  RWQQAIPENMGLVGKILGFMNFAYTLLVLNYSCVGFMVLSMHETLASYGSVYYVGTIVPI  442

Query  244  VLIMLGNI  221
             LI+LG I
Sbjct  443  ALILLGYI  450



>gb|AGL74879.1| 1-acylglycerophosphocholine O-acyltransferase [Vernicia fordii]
Length=465

 Score =   296 bits (758),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 173/189 (92%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGFSGWT++SPPKP WDRAKNVDILGVELAKS+V+LPLVWNIQ
Sbjct  263  KYYFIWSISEASIIISGLGFSGWTDTSPPKPRWDRAKNVDILGVELAKSAVELPLVWNIQ  322

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERLI KGKKPGFFQLLATQT SAVWHGLYPGY+IFFVQSALMIAGSR IY
Sbjct  323  VSTWLRHYVYERLIQKGKKPGFFQLLATQTTSAVWHGLYPGYIIFFVQSALMIAGSRVIY  382

Query  418  RWQQGT--GNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQQ      A++KK+L  MNFAYT+LVLNYS VGF+VLSLHET+AAYGSVYY+GTI+P+
Sbjct  383  RWQQAVPPSKALVKKMLVFMNFAYTVLVLNYSAVGFMVLSLHETIAAYGSVYYIGTILPI  442

Query  244  VLIMLGNII  218
            + I+LG +I
Sbjct  443  LSILLGYVI  451



>ref|XP_006358391.1| PREDICTED: lysophospholipid acyltransferase 1-like [Solanum tuberosum]
Length=463

 Score =   296 bits (757),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 151/187 (81%), Positives = 170/187 (91%), Gaps = 0/187 (0%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISE+++IISGLGFSGWT+SSP K  WDRAKNVD+LGVELAKSSVQLPLVWNIQ
Sbjct  263  KYYFIWSISESAVIISGLGFSGWTDSSPSKQRWDRAKNVDVLGVELAKSSVQLPLVWNIQ  322

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERL+  GKK GFFQLLATQT+SAVWHGLYPGY+IFFVQSALMIAGSR IY
Sbjct  323  VSTWLRHYVYERLVQNGKKAGFFQLLATQTISAVWHGLYPGYIIFFVQSALMIAGSRVIY  382

Query  418  RWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPVVL  239
            RWQQ T   + +KIL LM+FAYTLL+LNYS VGF+VLSLHETL +YGSVYYVGT++P+VL
Sbjct  383  RWQQATKGTMFEKILTLMSFAYTLLILNYSAVGFMVLSLHETLTSYGSVYYVGTVIPIVL  442

Query  238  IMLGNII  218
            I+LG +I
Sbjct  443  ILLGKVI  449



>gb|KHG06049.1| Lysophospholipid acyltransferase 2 [Gossypium arboreum]
Length=462

 Score =   296 bits (757),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 158/187 (84%), Positives = 171/187 (91%), Gaps = 0/187 (0%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGFSGWTESSPPKP WDRAKNVDI GVELAKS+V LPLVWNIQ
Sbjct  263  KYYFIWSISEASIIISGLGFSGWTESSPPKPKWDRAKNVDIPGVELAKSAVVLPLVWNIQ  322

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERLI+KGKKPGFFQLLATQTVSAVWHGLYPGYM+FFVQSALMIAGSR IY
Sbjct  323  VSTWLRHYVYERLITKGKKPGFFQLLATQTVSAVWHGLYPGYMLFFVQSALMIAGSRVIY  382

Query  418  RWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPVVL  239
            RW+Q +   ++KK L  +NFAYTLL+LNYS VGFLVLSLHE+LA YGSVYYVGTI+P+ L
Sbjct  383  RWEQASNIGLVKKTLVFINFAYTLLILNYSAVGFLVLSLHESLALYGSVYYVGTILPITL  442

Query  238  IMLGNII  218
            I+LG II
Sbjct  443  ILLGYII  449



>gb|KDO63564.1| hypothetical protein CISIN_1g012501mg [Citrus sinensis]
Length=462

 Score =   296 bits (757),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 171/189 (90%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIII GLGFSGWTESSPPKP WDRAKNVDILGVE AKS+VQ+PLVWNIQ
Sbjct  260  KYYFIWSISEASIIICGLGFSGWTESSPPKPKWDRAKNVDILGVEFAKSAVQIPLVWNIQ  319

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVY+RLI  GKKPGFFQLLATQTVSAVWHGLYPGY+IFFVQSALMIAGSR IY
Sbjct  320  VSTWLRHYVYDRLIQNGKKPGFFQLLATQTVSAVWHGLYPGYIIFFVQSALMIAGSRVIY  379

Query  418  RWQQG--TGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQQ       ++KKI+  +NFAYT+LVLNYSCVGF+VLSLHET+A+YGSVYY+GTI+P+
Sbjct  380  RWQQALPPKMELVKKIMVFLNFAYTVLVLNYSCVGFMVLSLHETIASYGSVYYIGTIIPI  439

Query  244  VLIMLGNII  218
            VLI+L  +I
Sbjct  440  VLILLSYVI  448



>ref|XP_006477394.1| PREDICTED: membrane-bound O-acyltransferase domain-containing 
protein 2-like [Citrus sinensis]
Length=462

 Score =   295 bits (756),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 171/189 (90%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIII GLGFSGWTESSPPKP WDRAKNVDILGVE AKS+VQ+PLVWNIQ
Sbjct  260  KYYFIWSISEASIIICGLGFSGWTESSPPKPKWDRAKNVDILGVEFAKSAVQIPLVWNIQ  319

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVY+RLI  GKKPGFFQLLATQTVSAVWHGLYPGY+IFFVQSALMIAGSR IY
Sbjct  320  VSTWLRHYVYDRLIQNGKKPGFFQLLATQTVSAVWHGLYPGYIIFFVQSALMIAGSRVIY  379

Query  418  RWQQG--TGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQQ       ++KKI+  +NFAYT+LVLNYSCVGF+VLSLHET+A+YGSVYY+GTI+P+
Sbjct  380  RWQQALPPKMELVKKIMVFLNFAYTVLVLNYSCVGFMVLSLHETIASYGSVYYIGTIIPI  439

Query  244  VLIMLGNII  218
            VLI+L  +I
Sbjct  440  VLILLSYVI  448



>gb|AHE80987.1| acyl-CoA:lysophosphatidylcholine acyltransferase, partial [Hiptage 
benghalensis]
Length=271

 Score =   288 bits (738),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 154/187 (82%), Positives = 165/187 (88%), Gaps = 1/187 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGFSGWT+SSPPKP WDRAKN DILGVELAKSSVQLP VWNIQ
Sbjct  72   KYYFIWSISEASIIISGLGFSGWTDSSPPKPRWDRAKNTDILGVELAKSSVQLPSVWNIQ  131

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVY+R++ KGKKPGF QLLATQ  SAVWHGLYPGY+IFF  SALMIAGSR IY
Sbjct  132  VSTWLRHYVYDRIVQKGKKPGFLQLLATQATSAVWHGLYPGYIIFFGHSALMIAGSRVIY  191

Query  418  RWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPVVL  239
            RWQQ     I KKI  LMNFAYT+LVLNYSCVGFLVLSL ETLAAYGSVYY+GTI+P+V 
Sbjct  192  RWQQAAPGHI-KKIFVLMNFAYTILVLNYSCVGFLVLSLRETLAAYGSVYYIGTIIPIVF  250

Query  238  IMLGNII  218
            I+LG +I
Sbjct  251  IILGKVI  257



>ref|XP_007155562.1| hypothetical protein PHAVU_003G212400g [Phaseolus vulgaris]
 gb|ESW27556.1| hypothetical protein PHAVU_003G212400g [Phaseolus vulgaris]
Length=463

 Score =   295 bits (754),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 171/189 (90%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGFSGWT+SSPPKP WDRAKNVDI+GVE AKS+V +P VWNIQ
Sbjct  261  KYYFIWSISEASIIISGLGFSGWTDSSPPKPRWDRAKNVDIIGVEFAKSAVTIPAVWNIQ  320

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERLI  GKKPGFFQLLATQTVSAVWHGLYPGY+IFFVQSALMIAGSR IY
Sbjct  321  VSTWLRHYVYERLIQNGKKPGFFQLLATQTVSAVWHGLYPGYIIFFVQSALMIAGSRVIY  380

Query  418  RWQQGTGN--AILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQQ      A+ K +L +MNFAYTLLVLNYSCVGF+VLSL+ETLA+YGSVYYVGTI+PV
Sbjct  381  RWQQAVPPTMALAKNVLVIMNFAYTLLVLNYSCVGFMVLSLNETLASYGSVYYVGTIIPV  440

Query  244  VLIMLGNII  218
            V+I+LG +I
Sbjct  441  VMILLGKVI  449



>gb|KJB68442.1| hypothetical protein B456_010G246400 [Gossypium raimondii]
 gb|KJB68446.1| hypothetical protein B456_010G246400 [Gossypium raimondii]
Length=464

 Score =   295 bits (754),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 172/189 (91%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEA++IISGLGFSGWTESSPPKP WDRAK VDILG ELAKSSV LPLVWNIQ
Sbjct  263  KYYFIWSISEAAMIISGLGFSGWTESSPPKPKWDRAKVVDILGFELAKSSVLLPLVWNIQ  322

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERL+ KGKKPGFFQLLATQTVSAVWHGLYPGY+IFFVQSALMIAGSR IY
Sbjct  323  VSTWLRHYVYERLVKKGKKPGFFQLLATQTVSAVWHGLYPGYIIFFVQSALMIAGSRVIY  382

Query  418  RWQQG--TGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            +W++   T  A++KK  A+MNFAYTLLVLNYSCVGF+VLS HETLA+YGSVYY+GTI+P+
Sbjct  383  QWEKAIPTNMALVKKAFAVMNFAYTLLVLNYSCVGFMVLSKHETLASYGSVYYIGTIIPI  442

Query  244  VLIMLGNII  218
             LI+LG II
Sbjct  443  ALIILGYII  451



>gb|KHN14121.1| Membrane-bound O-acyltransferase domain-containing protein 2 
[Glycine soja]
Length=463

 Score =   294 bits (753),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 170/189 (90%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGFSGWT+SSPPKP WDRAKNVDI+GVE AKS+V +P VWNIQ
Sbjct  261  KYYFIWSISEASIIISGLGFSGWTDSSPPKPRWDRAKNVDIIGVEFAKSAVTIPAVWNIQ  320

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERLI  GKKPGFFQLLATQTVSAVWHGLYPGY+IFFVQSALMIAGSR IY
Sbjct  321  VSTWLRHYVYERLIQTGKKPGFFQLLATQTVSAVWHGLYPGYIIFFVQSALMIAGSRVIY  380

Query  418  RWQQGTGN--AILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQQ      +++K +L   NFAYTLLVLNYSCVGF+VLSLHETLA+YGSVYY+GTIVPV
Sbjct  381  RWQQAVPPTMSLVKNVLVFTNFAYTLLVLNYSCVGFMVLSLHETLASYGSVYYIGTIVPV  440

Query  244  VLIMLGNII  218
            V+I+LG +I
Sbjct  441  VMILLGKVI  449



>ref|XP_011072149.1| PREDICTED: lysophospholipid acyltransferase 1-like [Sesamum indicum]
Length=465

 Score =   294 bits (753),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 164/201 (82%), Positives = 182/201 (91%), Gaps = 0/201 (0%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWS+SEAS+IISGLGFSGWT+S+PPKP WDRAKNVDILGVELAKSSVQLPLVWNIQ
Sbjct  265  KYYFIWSMSEASVIISGLGFSGWTDSNPPKPRWDRAKNVDILGVELAKSSVQLPLVWNIQ  324

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERL+ KGKKPGF QLLATQTVSAVWHGLYPGY+IFFVQSA MIAGSR +Y
Sbjct  325  VSTWLRHYVYERLVQKGKKPGFVQLLATQTVSAVWHGLYPGYIIFFVQSATMIAGSRVLY  384

Query  418  RWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPVVL  239
            RWQQ +    LKK+L  +NFAYTLLVLNYS VGF+VLSL ETLAAY SVYY+GTI+P+ L
Sbjct  385  RWQQASQTDSLKKLLVFINFAYTLLVLNYSSVGFMVLSLQETLAAYESVYYIGTILPIGL  444

Query  238  IMLGNIIkpakparskarKDQ  176
            I+LG +I PA+PARSKA+KDQ
Sbjct  445  ILLGKVIVPARPARSKAQKDQ  465



>ref|XP_003549863.1| PREDICTED: lysophospholipid acyltransferase 2 [Glycine max]
Length=463

 Score =   293 bits (751),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 170/189 (90%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGFSGWT+SSPPKP WDRAKNVDI+GVE AKS+V +P VWNIQ
Sbjct  261  KYYFIWSISEASIIISGLGFSGWTDSSPPKPRWDRAKNVDIIGVEFAKSAVTIPAVWNIQ  320

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERLI  GKKPGFFQLLATQTVSAVWHGLYPGY+IFFVQSALMIAGSR IY
Sbjct  321  VSTWLRHYVYERLIQTGKKPGFFQLLATQTVSAVWHGLYPGYIIFFVQSALMIAGSRVIY  380

Query  418  RWQQGTGN--AILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQQ      +++K +L   NFAYTLLVLNYSCVGF+VLSLHETLA+YGSVYY+GTIVPV
Sbjct  381  RWQQAVPPTMSLVKNVLVFTNFAYTLLVLNYSCVGFMVLSLHETLASYGSVYYIGTIVPV  440

Query  244  VLIMLGNII  218
            V+I+LG +I
Sbjct  441  VMILLGKVI  449



>gb|AHE80988.1| acyl-CoA:lysophosphatidylcholine acyltransferase [Hiptage benghalensis]
Length=462

 Score =   293 bits (751),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 157/187 (84%), Positives = 168/187 (90%), Gaps = 1/187 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGFSGWT+SSPPKP WDRAKNV ILGVELA SSVQLPLVWNIQ
Sbjct  263  KYYFIWSISEASIIISGLGFSGWTDSSPPKPRWDRAKNVSILGVELATSSVQLPLVWNIQ  322

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVY+RL+ KGKKPGF QLLATQT SAVWHGLYPGY+IFFVQSALMIAGSR IY
Sbjct  323  VSTWLRHYVYDRLVQKGKKPGFLQLLATQTTSAVWHGLYPGYIIFFVQSALMIAGSRVIY  382

Query  418  RWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPVVL  239
            RWQQ    A +KKI  L+NFAYT+LVLNYSCVGFLVLSL ETLAAY SVYY+GTI+P+V 
Sbjct  383  RWQQA-ATAHIKKIFVLVNFAYTILVLNYSCVGFLVLSLRETLAAYSSVYYIGTIIPIVF  441

Query  238  IMLGNII  218
            I LG+II
Sbjct  442  IFLGSII  448



>ref|XP_008448977.1| PREDICTED: lysophospholipid acyltransferase 1 [Cucumis melo]
Length=464

 Score =   293 bits (750),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 172/189 (91%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGFSGWT+SSPPKP WDRAKNVDILG+E  KS+V++PL WNIQ
Sbjct  263  KYYFIWSISEASIIISGLGFSGWTKSSPPKPRWDRAKNVDILGLEFVKSAVEIPLKWNIQ  322

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERL+ KG+KPGFFQLLATQTVSAVWHGLYPGY+IFFVQSA+MIAGSR IY
Sbjct  323  VSTWLRHYVYERLVQKGRKPGFFQLLATQTVSAVWHGLYPGYIIFFVQSAVMIAGSRVIY  382

Query  418  RWQQG--TGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQQ      A LK ILA +NFAYT+LVLNYSCVGF+VLSLHETLA+YGSVYY+GT++P+
Sbjct  383  RWQQAIPPSMAFLKTILAFLNFAYTVLVLNYSCVGFMVLSLHETLASYGSVYYIGTVIPI  442

Query  244  VLIMLGNII  218
             LI+LG+II
Sbjct  443  TLILLGSII  451



>gb|KJB29824.1| hypothetical protein B456_005G120200 [Gossypium raimondii]
Length=463

 Score =   293 bits (749),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 158/188 (84%), Positives = 171/188 (91%), Gaps = 1/188 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGFSGWTESSPPKP WDRAKNVDI GVELAKS+V LPLVWNIQ
Sbjct  263  KYYFIWSISEASIIISGLGFSGWTESSPPKPKWDRAKNVDIPGVELAKSAVVLPLVWNIQ  322

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWH-GLYPGYMIFFVQSALMIAGSRAI  422
            VSTWLRHYVYERLI+KGKKPGFFQLLATQTVSAVWH GLYPGYM+FFVQSALMIAGSR +
Sbjct  323  VSTWLRHYVYERLITKGKKPGFFQLLATQTVSAVWHQGLYPGYMLFFVQSALMIAGSRVL  382

Query  421  YRWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPVV  242
            YRW+Q T   ++KK L  +NFAYTLL+LNYS VGFLVLSLHE+LA YGSVYYVGTI+P+ 
Sbjct  383  YRWEQATNMGLVKKALVFINFAYTLLILNYSAVGFLVLSLHESLALYGSVYYVGTILPIT  442

Query  241  LIMLGNII  218
            LI+LG II
Sbjct  443  LILLGYII  450



>gb|KHN34432.1| Lysophospholipid acyltransferase 2 [Glycine soja]
Length=463

 Score =   291 bits (744),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 168/189 (89%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGFSGWT+SSPPKP WDRAKNVDI+GVE AKS+V +P VWNIQ
Sbjct  261  KYYFIWSISEASIIISGLGFSGWTDSSPPKPCWDRAKNVDIIGVEFAKSAVTIPAVWNIQ  320

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERLI  GKKPGF QLLATQTVSAVWHGLYPGY+IFFVQSALMIAGSR IY
Sbjct  321  VSTWLRHYVYERLIQTGKKPGFIQLLATQTVSAVWHGLYPGYIIFFVQSALMIAGSRVIY  380

Query  418  RWQQGTGN--AILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQQ      +++K +L   NFAYTLLVLNYSCVGF+VLSLHETLA+YGSVYYVGTI+PV
Sbjct  381  RWQQAVPPTMSLVKNVLVFTNFAYTLLVLNYSCVGFMVLSLHETLASYGSVYYVGTIIPV  440

Query  244  VLIMLGNII  218
            VLI+L  +I
Sbjct  441  VLILLAKVI  449



>ref|XP_003525728.1| PREDICTED: lysophospholipid acyltransferase 2-like [Glycine max]
Length=463

 Score =   290 bits (743),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 168/189 (89%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGFSGWT+SSPPKP WDRAKNVDI+GVE AKS+V +P VWNIQ
Sbjct  261  KYYFIWSISEASIIISGLGFSGWTDSSPPKPCWDRAKNVDIIGVEFAKSAVTIPAVWNIQ  320

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERLI  GKKPGF QLLATQTVSAVWHGLYPGY+IFFVQSALMIAGSR IY
Sbjct  321  VSTWLRHYVYERLIQTGKKPGFIQLLATQTVSAVWHGLYPGYIIFFVQSALMIAGSRVIY  380

Query  418  RWQQGTGN--AILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQQ      +++K +L   NFAYTLLVLNYSCVGF+VLSLHETLA+YGSVYY+GTI+PV
Sbjct  381  RWQQAVPPTMSLVKNVLVFTNFAYTLLVLNYSCVGFMVLSLHETLASYGSVYYIGTIIPV  440

Query  244  VLIMLGNII  218
            VLI+L  +I
Sbjct  441  VLILLAKVI  449



>ref|XP_010919229.1| PREDICTED: lysophospholipid acyltransferase 1-like [Elaeis guineensis]
Length=465

 Score =   290 bits (743),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 171/189 (90%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGFSGW++SSPPKP W+RAKNVDILGVELA S+VQLPLVWNIQ
Sbjct  263  KYYFIWSISEASIIISGLGFSGWSDSSPPKPQWERAKNVDILGVELATSAVQLPLVWNIQ  322

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLR+YVYERLI KGKKPGF QLLATQTVSA+WHGLYPGY+IFFVQSALMIAGSR IY
Sbjct  323  VSTWLRYYVYERLIQKGKKPGFLQLLATQTVSAIWHGLYPGYIIFFVQSALMIAGSRVIY  382

Query  418  RWQQGT--GNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQQ     NAI +K+L  +NFAYTLLVLNYSC+GF VLS+ ETLA+Y SVY+VGTIVPV
Sbjct  383  RWQQAVSPNNAIFRKMLTFINFAYTLLVLNYSCIGFQVLSMKETLASYQSVYFVGTIVPV  442

Query  244  VLIMLGNII  218
            VLI+LG II
Sbjct  443  VLIILGYII  451



>ref|XP_009377923.1| PREDICTED: lysophospholipid acyltransferase 1-like [Pyrus x bretschneideri]
 ref|XP_009344265.1| PREDICTED: lysophospholipid acyltransferase 1-like [Pyrus x bretschneideri]
Length=465

 Score =   290 bits (741),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 169/189 (89%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASII+SGLGFSGWTESSPPKP WDRAKNVDI+GVE AKSSVQLPLVWNIQ
Sbjct  263  KYYFIWSISEASIILSGLGFSGWTESSPPKPRWDRAKNVDIIGVEFAKSSVQLPLVWNIQ  322

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERL+  GKKPGFFQLLATQTVSAVWHGLYPGY+IFFVQSALMIAGSR IY
Sbjct  323  VSTWLRHYVYERLVKPGKKPGFFQLLATQTVSAVWHGLYPGYIIFFVQSALMIAGSRVIY  382

Query  418  RWQQGTGNA--ILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQQ       ++KKIL  +NFAYT+LVLNYSCVGF+VLSL ETLA+YGSV+++GT +PV
Sbjct  383  RWQQAVPPTMDVVKKILMFINFAYTVLVLNYSCVGFIVLSLRETLASYGSVHFIGTFLPV  442

Query  244  VLIMLGNII  218
             LI+L  +I
Sbjct  443  ALILLSYVI  451



>gb|AER57988.1| putative lysophosphatidylcholine acyltransferase 1 [Helianthus 
annuus]
Length=462

 Score =   289 bits (740),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 172/189 (91%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEA+IIISGLGFSGWT+SSPPK  WD AKNVDILG+E A+S+V++PLVWNIQ
Sbjct  261  KYYFIWSISEAAIIISGLGFSGWTDSSPPKARWDHAKNVDILGLEFARSAVEIPLVWNIQ  320

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVY+RL+ KGKK GFFQLLATQTVSAVWHGLYPGY+IFFVQSALMIAGSRAIY
Sbjct  321  VSTWLRHYVYDRLVPKGKKAGFFQLLATQTVSAVWHGLYPGYIIFFVQSALMIAGSRAIY  380

Query  418  RWQQGT--GNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQQ       +LKK+  L+NFAYT+LVL+YSCVGF+VLSLHETL +YGSVYY+GTI+PV
Sbjct  381  RWQQSVPPNLGLLKKLFMLVNFAYTVLVLSYSCVGFMVLSLHETLTSYGSVYYIGTIIPV  440

Query  244  VLIMLGNII  218
            VLI+LGN+I
Sbjct  441  VLILLGNVI  449



>gb|AHE80986.1| acyl-CoA:lysophosphatidylcholine acyltransferase [Hiptage benghalensis]
Length=462

 Score =   289 bits (740),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 153/187 (82%), Positives = 164/187 (88%), Gaps = 1/187 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISE SIIISGLGFSGWT+SSPPKP WDRAKN DILGVELAKSSVQLP VWNIQ
Sbjct  263  KYYFIWSISEPSIIISGLGFSGWTDSSPPKPRWDRAKNTDILGVELAKSSVQLPSVWNIQ  322

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVY+R++ KGKKPGF QLLATQ  SAVWHGLYPGY+IFF  SALMIAGSR IY
Sbjct  323  VSTWLRHYVYDRIVQKGKKPGFLQLLATQATSAVWHGLYPGYIIFFGHSALMIAGSRVIY  382

Query  418  RWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPVVL  239
            RWQQ     I KKI  LMNFAYT+LVLNYSCVGFLVLSL ETLAAYGSVYY+GTI+P+V 
Sbjct  383  RWQQAAPGHI-KKIFVLMNFAYTILVLNYSCVGFLVLSLRETLAAYGSVYYIGTIIPIVF  441

Query  238  IMLGNII  218
            I+LG +I
Sbjct  442  IILGKVI  448



>ref|XP_004298745.1| PREDICTED: lysophospholipid acyltransferase 1 [Fragaria vesca 
subsp. vesca]
Length=464

 Score =   289 bits (740),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 170/189 (90%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASII+SGLGFSGWTESSPPKP WDRAKNVDILGVE AKS+VQLPLVWNIQ
Sbjct  263  KYYFIWSISEASIILSGLGFSGWTESSPPKPKWDRAKNVDILGVEFAKSAVQLPLVWNIQ  322

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERL+  G+K  FFQLLATQTVSAVWHGLYPGY+IFFVQSALMIAGSR IY
Sbjct  323  VSTWLRHYVYERLVKPGRKACFFQLLATQTVSAVWHGLYPGYIIFFVQSALMIAGSRVIY  382

Query  418  RWQQGT--GNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQQ    G  + K I+ ++NF YT++VLNYSCVGF+VLSLHETLA+YGSVYY+GT++P+
Sbjct  383  RWQQSVPQGMDVAKNIMVVLNFMYTVVVLNYSCVGFIVLSLHETLASYGSVYYIGTVLPI  442

Query  244  VLIMLGNII  218
            VLI+LG +I
Sbjct  443  VLILLGKVI  451



>gb|AGO14581.1| lysophosphatidylcholine acyltransferase [Ricinus communis]
 gb|AHF20951.1| lysophosphatidylcholine: acyl-CoA acyltransferase [Ricinus communis]
Length=465

 Score =   289 bits (740),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 169/189 (89%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGFSGWT++SPPKP WDRA+NVDILGVE AKS+ +LPLVWNIQ
Sbjct  263  KYYFIWSISEASIIISGLGFSGWTDTSPPKPQWDRARNVDILGVEFAKSAAELPLVWNIQ  322

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVY+RL+ KGKK GF QLLATQT SAVWHGLYPGY+IFFVQSALMIAGS+ IY
Sbjct  323  VSTWLRHYVYDRLVPKGKKAGFLQLLATQTTSAVWHGLYPGYIIFFVQSALMIAGSKVIY  382

Query  418  RWQQG--TGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQQ   +  A+ KKIL  MNFAYT+LVLNYSCVGF+VLSLHET+AAYGSVY++GTIVPV
Sbjct  383  RWQQAIPSNKALEKKILVFMNFAYTVLVLNYSCVGFMVLSLHETIAAYGSVYFIGTIVPV  442

Query  244  VLIMLGNII  218
            V  +LG II
Sbjct  443  VFFLLGFII  451



>ref|XP_008369472.1| PREDICTED: lysophospholipid acyltransferase 1-like [Malus domestica]
Length=465

 Score =   289 bits (739),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 169/189 (89%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASII+SGLGFSGWTESSPPKP WDRAKNVDI+GVE AKSSVQLPLVWNIQ
Sbjct  263  KYYFIWSISEASIILSGLGFSGWTESSPPKPRWDRAKNVDIIGVEFAKSSVQLPLVWNIQ  322

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVY+RL+  GKKPGFFQLLATQTVSAVWHGLYPGY+IFFVQSALMIAGSR IY
Sbjct  323  VSTWLRHYVYDRLVKPGKKPGFFQLLATQTVSAVWHGLYPGYIIFFVQSALMIAGSRVIY  382

Query  418  RWQQGTGNA--ILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQQ       ++KKIL  +NFAYT+LVLNYSCVGF+VLSL ETLA+YGSV+++GT +PV
Sbjct  383  RWQQAVPPTMDVVKKILVFINFAYTVLVLNYSCVGFIVLSLRETLASYGSVHFIGTFLPV  442

Query  244  VLIMLGNII  218
             LI+L  +I
Sbjct  443  ALILLSYVI  451



>ref|XP_004953433.1| PREDICTED: lysophospholipid acyltransferase-like [Setaria italica]
Length=457

 Score =   288 bits (738),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 150/187 (80%), Positives = 167/187 (89%), Gaps = 0/187 (0%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEA+IIISGLGF+GW+ESSPPK  WDRAKNVD+LGVELA S+VQLPLVWNIQ
Sbjct  259  KYYFIWSISEAAIIISGLGFTGWSESSPPKAKWDRAKNVDVLGVELAGSAVQLPLVWNIQ  318

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLR+YVYERLI KGKKPGF QLL TQTVSAVWHGLYPGY+IFFVQSALMI GSR IY
Sbjct  319  VSTWLRYYVYERLIQKGKKPGFLQLLGTQTVSAVWHGLYPGYIIFFVQSALMINGSRVIY  378

Query  418  RWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPVVL  239
            RWQQ   N++ + ILA +NFAYTLLVLNYSC+GF VLS  ETLA+Y SVYYVGTIVP+V 
Sbjct  379  RWQQTVNNSVFRGILAFLNFAYTLLVLNYSCIGFQVLSFKETLASYQSVYYVGTIVPIVC  438

Query  238  IMLGNII  218
            ++LGN+I
Sbjct  439  VLLGNVI  445



>ref|XP_002454488.1| hypothetical protein SORBIDRAFT_04g031990 [Sorghum bicolor]
 gb|EES07464.1| hypothetical protein SORBIDRAFT_04g031990 [Sorghum bicolor]
Length=457

 Score =   288 bits (736),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 150/187 (80%), Positives = 168/187 (90%), Gaps = 0/187 (0%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGF+GW+ESSPPK  WDRAKNVD+LGVELA S+VQ+PLVWNIQ
Sbjct  259  KYYFIWSISEASIIISGLGFTGWSESSPPKAKWDRAKNVDVLGVELAGSAVQIPLVWNIQ  318

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLR+YVYERLI KGKKPGF QLL TQTVSA+WHGLYPGY+IFFVQSALMI GSR IY
Sbjct  319  VSTWLRYYVYERLIQKGKKPGFLQLLGTQTVSAIWHGLYPGYIIFFVQSALMINGSRVIY  378

Query  418  RWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPVVL  239
            RWQQ   ++ L+ ILA +NFAYTLLVLNYSC+GFLVLS  ETLA+Y SVYYVGTIVP+V 
Sbjct  379  RWQQAVSSSFLRGILAFLNFAYTLLVLNYSCIGFLVLSFKETLASYQSVYYVGTIVPIVF  438

Query  238  IMLGNII  218
            ++LGN+I
Sbjct  439  LLLGNVI  445



>ref|XP_004148282.1| PREDICTED: lysophospholipid acyltransferase 1 [Cucumis sativus]
 gb|KGN55973.1| hypothetical protein Csa_3G043890 [Cucumis sativus]
Length=464

 Score =   288 bits (736),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 169/189 (89%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGFSGWT+SSPPKP WDRAKNVDILG+E  KS+V++PL WNIQ
Sbjct  263  KYYFIWSISEASIIISGLGFSGWTKSSPPKPRWDRAKNVDILGLEFVKSAVEIPLKWNIQ  322

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERL+ KG+KPGFFQLLATQTVSAVWHGLYPGY+IFFVQSA+MIAGSR IY
Sbjct  323  VSTWLRHYVYERLVQKGRKPGFFQLLATQTVSAVWHGLYPGYIIFFVQSAVMIAGSRVIY  382

Query  418  RWQQG--TGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQQ      A LK IL  +NFAYT+LVLNYSCVGF+VLSLHETLA+YGSVYY+GT++P+
Sbjct  383  RWQQAIPPSMAFLKTILGFLNFAYTVLVLNYSCVGFMVLSLHETLASYGSVYYIGTVIPI  442

Query  244  VLIMLGNII  218
             LI+L  II
Sbjct  443  TLILLSYII  451



>ref|XP_008646049.1| PREDICTED: lysophospholipid acyltransferase 1 [Zea mays]
 gb|AFW72782.1| hypothetical protein ZEAMMB73_982934 [Zea mays]
Length=457

 Score =   287 bits (734),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 151/187 (81%), Positives = 167/187 (89%), Gaps = 0/187 (0%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGF+GW+ESSPPK  WDRAKNVD+LGVELA SSVQLPLVWNIQ
Sbjct  259  KYYFIWSISEASIIISGLGFTGWSESSPPKAKWDRAKNVDVLGVELAGSSVQLPLVWNIQ  318

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLR+YVYERLI KGKKPGF QLL TQTVSA+WHGLYPGY+IFFVQSALMI GSR IY
Sbjct  319  VSTWLRYYVYERLIQKGKKPGFLQLLGTQTVSAIWHGLYPGYIIFFVQSALMINGSRVIY  378

Query  418  RWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPVVL  239
            RWQQ   +++L  ILA +NFAYTLLVLNYSC+GF VLS  ETLA+Y SVYYVGTIVP+V 
Sbjct  379  RWQQAASSSLLSGILAFLNFAYTLLVLNYSCIGFQVLSFKETLASYRSVYYVGTIVPIVC  438

Query  238  IMLGNII  218
            ++LGN+I
Sbjct  439  LLLGNVI  445



>ref|XP_008795385.1| PREDICTED: lysophospholipid acyltransferase 1-like [Phoenix dactylifera]
Length=465

 Score =   287 bits (734),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 169/189 (89%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEAS+IISGLGFSGW++SSPPKP W+ AKNVDILGVELA S+VQLP+VWNIQ
Sbjct  263  KYYFIWSISEASVIISGLGFSGWSDSSPPKPQWEHAKNVDILGVELATSAVQLPIVWNIQ  322

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLR+YVYERLI KGKKPGFFQLLATQTVSAVWHGLYPGY+IFFVQSALMIAGSR IY
Sbjct  323  VSTWLRYYVYERLIQKGKKPGFFQLLATQTVSAVWHGLYPGYIIFFVQSALMIAGSRVIY  382

Query  418  RWQQGTG--NAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQQ     NAI +K+L  +NFAYTLLVLNYSC+GF VLS  ETLA+Y SVY+VGTIVP+
Sbjct  383  RWQQAVSPKNAIFRKMLTFINFAYTLLVLNYSCIGFQVLSFKETLASYQSVYFVGTIVPI  442

Query  244  VLIMLGNII  218
            V I++G II
Sbjct  443  VFILMGYII  451



>gb|AFW72781.1| hypothetical protein ZEAMMB73_982934 [Zea mays]
Length=483

 Score =   288 bits (736),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 151/187 (81%), Positives = 167/187 (89%), Gaps = 0/187 (0%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGF+GW+ESSPPK  WDRAKNVD+LGVELA SSVQLPLVWNIQ
Sbjct  285  KYYFIWSISEASIIISGLGFTGWSESSPPKAKWDRAKNVDVLGVELAGSSVQLPLVWNIQ  344

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLR+YVYERLI KGKKPGF QLL TQTVSA+WHGLYPGY+IFFVQSALMI GSR IY
Sbjct  345  VSTWLRYYVYERLIQKGKKPGFLQLLGTQTVSAIWHGLYPGYIIFFVQSALMINGSRVIY  404

Query  418  RWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPVVL  239
            RWQQ   +++L  ILA +NFAYTLLVLNYSC+GF VLS  ETLA+Y SVYYVGTIVP+V 
Sbjct  405  RWQQAASSSLLSGILAFLNFAYTLLVLNYSCIGFQVLSFKETLASYRSVYYVGTIVPIVC  464

Query  238  IMLGNII  218
            ++LGN+I
Sbjct  465  LLLGNVI  471



>ref|XP_010934443.1| PREDICTED: lysophospholipid acyltransferase 1-like isoform X1 
[Elaeis guineensis]
Length=465

 Score =   286 bits (733),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 171/189 (90%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGF+GW++SS  KP WDRAKNVDILG ELA S+VQLPLVWNIQ
Sbjct  263  KYYFIWSISEASIIISGLGFTGWSDSSHSKPQWDRAKNVDILGGELATSAVQLPLVWNIQ  322

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLR+YVYERLI KGKKPGF QLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSR IY
Sbjct  323  VSTWLRYYVYERLIQKGKKPGFLQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRVIY  382

Query  418  RWQQGTG--NAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQQ     NA+L+K++A  NFAYTLLVLNYSC+GFLVLS+ ET+AAY SVY+VGTIVP+
Sbjct  383  RWQQAISPKNALLRKMMAFANFAYTLLVLNYSCIGFLVLSMKETVAAYRSVYFVGTIVPI  442

Query  244  VLIMLGNII  218
            VLI+LG+II
Sbjct  443  VLILLGHII  451



>ref|XP_009391951.1| PREDICTED: lysophospholipid acyltransferase 1-like [Musa acuminata 
subsp. malaccensis]
Length=465

 Score =   286 bits (733),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 168/189 (89%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISG GFSG ++SSPPKP WDRAKNVDILGVE A S+VQLPLVWNIQ
Sbjct  263  KYYFIWSISEASIIISGFGFSGRSDSSPPKPQWDRAKNVDILGVEFATSAVQLPLVWNIQ  322

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERLI KGKKPGFFQLLATQT+SAVWHGLYPGY+IFFVQSALMIAGSR IY
Sbjct  323  VSTWLRHYVYERLIQKGKKPGFFQLLATQTISAVWHGLYPGYIIFFVQSALMIAGSRVIY  382

Query  418  RWQQGTG--NAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQQ     N + +K+L   NFAYTLLVLNYSC+GF+VLS+ ETLAAY SVY+VGT+VPV
Sbjct  383  RWQQAVNVKNFLFRKMLTFTNFAYTLLVLNYSCIGFMVLSMKETLAAYRSVYFVGTVVPV  442

Query  244  VLIMLGNII  218
            ++I+LG II
Sbjct  443  IVILLGYII  451



>ref|XP_010693498.1| PREDICTED: lysophospholipid acyltransferase 1-like [Beta vulgaris 
subsp. vulgaris]
Length=462

 Score =   286 bits (733),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 164/187 (88%), Gaps = 0/187 (0%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISG GFSGWT +SPPKP WDRAKN DILGVELAKS+VQ+PL WNIQ
Sbjct  261  KYYFIWSISEASIIISGFGFSGWTNTSPPKPKWDRAKNADILGVELAKSAVQIPLDWNIQ  320

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERL+ KGKK GFFQLLATQTVSA+WHGLYPGY+ FFVQSALMIAGS+ IY
Sbjct  321  VSTWLRHYVYERLVQKGKKAGFFQLLATQTVSAIWHGLYPGYIFFFVQSALMIAGSKVIY  380

Query  418  RWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPVVL  239
            RWQQG     LKKIL  +NF YT+LVLNYS VGF+VLSLHETL AYGSVYY+GTI+PV L
Sbjct  381  RWQQGVSADFLKKILTFVNFVYTMLVLNYSAVGFMVLSLHETLTAYGSVYYIGTIIPVAL  440

Query  238  IMLGNII  218
            ++L  ++
Sbjct  441  LLLDCVV  447



>ref|XP_004515799.1| PREDICTED: lysophospholipid acyltransferase 1-like isoform X2 
[Cicer arietinum]
Length=465

 Score =   286 bits (732),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 164/203 (81%), Positives = 180/203 (89%), Gaps = 2/203 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGFSGWT+SSPPKP WDRAKNVDILGVELAKS+V +P VWNIQ
Sbjct  263  KYYFIWSISEASIIISGLGFSGWTDSSPPKPRWDRAKNVDILGVELAKSAVVIPAVWNIQ  322

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERLI  GKKPGF QLLATQTVSA+WHGLYPGY+IFFVQSALMIAGSR IY
Sbjct  323  VSTWLRHYVYERLIQTGKKPGFLQLLATQTVSAIWHGLYPGYIIFFVQSALMIAGSRVIY  382

Query  418  RWQQGTGN--AILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQQ      A++K  L   NFAYTLLVLNYS VGF+VLSLHETLA+YGSVY+VGTI+P+
Sbjct  383  RWQQAVPPTMALVKNALVFTNFAYTLLVLNYSSVGFMVLSLHETLASYGSVYFVGTILPI  442

Query  244  VLIMLGNIIkpakparskarKDQ  176
            V+I+LG +IKP +P RSKARKDQ
Sbjct  443  VIILLGKVIKPGRPVRSKARKDQ  465



>ref|XP_006358867.1| PREDICTED: lysophospholipid acyltransferase 1-like [Solanum tuberosum]
Length=463

 Score =   286 bits (731),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 149/174 (86%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEA+IIISGLGFSGWT SSPPKP WDRAKNVD+LGVELA SSVQLPLVWNIQ
Sbjct  263  KYYFIWSISEAAIIISGLGFSGWTNSSPPKPRWDRAKNVDVLGVELAMSSVQLPLVWNIQ  322

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERL+ KG+KPGFFQLLATQTVSAVWHGLYPGY+IFFVQSALMIAGSR IY
Sbjct  323  VSTWLRHYVYERLVQKGRKPGFFQLLATQTVSAVWHGLYPGYIIFFVQSALMIAGSRVIY  382

Query  418  RWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGT  257
            RWQQ T   + +KIL  MNFAYTLL+LNYS VGF+VLSLHETL AYGSVYY+GT
Sbjct  383  RWQQATKGTMFEKILVAMNFAYTLLILNYSAVGFMVLSLHETLTAYGSVYYIGT  436



>ref|XP_006417213.1| hypothetical protein EUTSA_v10007564mg [Eutrema salsugineum]
 gb|ESQ35566.1| hypothetical protein EUTSA_v10007564mg [Eutrema salsugineum]
Length=465

 Score =   286 bits (731),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 169/189 (89%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGFSGWT+ + PKP WDRAKNVDILGVELAKS+VQ+PLVWNIQ
Sbjct  264  KYYFIWSISEASIIISGLGFSGWTDDASPKPKWDRAKNVDILGVELAKSAVQIPLVWNIQ  323

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERL+  GKK GFFQLLATQTVSAVWHGLYPGYM+FFVQSALMIAGSR IY
Sbjct  324  VSTWLRHYVYERLVKNGKKAGFFQLLATQTVSAVWHGLYPGYMMFFVQSALMIAGSRVIY  383

Query  418  RWQQGTGN--AILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQQ      A+L+KI+ L+NF YT+LVLNYS VGF+VLSLHETL AYGSVYY+GTI+PV
Sbjct  384  RWQQAITPKLAVLRKIMVLINFLYTVLVLNYSAVGFMVLSLHETLTAYGSVYYIGTIIPV  443

Query  244  VLIMLGNII  218
            VLI+L  ++
Sbjct  444  VLILLSYVV  452



>ref|XP_008803275.1| PREDICTED: lysophospholipid acyltransferase 1-like [Phoenix dactylifera]
Length=466

 Score =   286 bits (731),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 168/189 (89%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASII SGLGFSGW++SSPP P W+RAKNVDILGVELA S+VQLPL+WNIQ
Sbjct  263  KYYFIWSISEASIITSGLGFSGWSDSSPPTPQWERAKNVDILGVELATSAVQLPLMWNIQ  322

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLR+YVYERLI KGKKPGF QLLATQTVSA+WHGLYPGY+IFFVQSALMIAGSR IY
Sbjct  323  VSTWLRYYVYERLIQKGKKPGFLQLLATQTVSAIWHGLYPGYIIFFVQSALMIAGSRVIY  382

Query  418  RWQQGT--GNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQQ     NAI +K+L L+NFAYTLLVLNYSC+GF VLS+ ETLA+Y SVY+VGTIVP+
Sbjct  383  RWQQAVSPSNAIFRKMLTLINFAYTLLVLNYSCIGFQVLSMKETLASYQSVYFVGTIVPI  442

Query  244  VLIMLGNII  218
            V  +LG II
Sbjct  443  VFTLLGYII  451



>gb|AGL81301.1| lysophosphatidylcholine acyltransferase [Momordica charantia]
Length=465

 Score =   286 bits (731),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 169/189 (89%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEA+IIISGLGFSGWT+SSPPKP WDRA NVDI+G+EL KS+V++PL WNIQ
Sbjct  263  KYYFIWSISEAAIIISGLGFSGWTKSSPPKPSWDRAINVDIIGLELVKSAVEIPLKWNIQ  322

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERL+ KGK+PGFFQLLATQTVSAVWHGLYPGY+IFFVQSALMIAGSR IY
Sbjct  323  VSTWLRHYVYERLVQKGKRPGFFQLLATQTVSAVWHGLYPGYIIFFVQSALMIAGSRVIY  382

Query  418  RWQQGTGN--AILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQ       A LK IL   NFAYT+LVLNYSCVGF+VLSLHETLA+YGSVYY+GT++PV
Sbjct  383  RWQVAVPPTLAFLKIILGFFNFAYTVLVLNYSCVGFMVLSLHETLASYGSVYYIGTVIPV  442

Query  244  VLIMLGNII  218
             LI+LG+II
Sbjct  443  TLILLGSII  451



>ref|XP_010933881.1| PREDICTED: lysophospholipid acyltransferase 1-like [Elaeis guineensis]
Length=465

 Score =   285 bits (730),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 169/189 (89%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEAS+IISGLGFSGW++SSPPKP W+RAKNVDILGVELA S+VQLP+VWNIQ
Sbjct  263  KYYFIWSISEASVIISGLGFSGWSDSSPPKPQWERAKNVDILGVELATSAVQLPIVWNIQ  322

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLR+YVYERLI KGKKPGF QLLATQTVSA+WHGLYPGY+IFFVQSALMIAGSR IY
Sbjct  323  VSTWLRYYVYERLIQKGKKPGFLQLLATQTVSAIWHGLYPGYIIFFVQSALMIAGSRVIY  382

Query  418  RWQQGTG--NAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQQ     NAI +K+L  +NFAYTLLVLNYSC+GF VLS  ETLA+Y SVY+VGTIVP+
Sbjct  383  RWQQAVSPKNAIFRKMLTFINFAYTLLVLNYSCIGFQVLSFKETLASYQSVYFVGTIVPI  442

Query  244  VLIMLGNII  218
            + I++G II
Sbjct  443  MFILMGYII  451



>ref|XP_002304469.2| membrane bound O-acyl transferase family protein [Populus trichocarpa]
 gb|EEE79448.2| membrane bound O-acyl transferase family protein [Populus trichocarpa]
Length=465

 Score =   285 bits (730),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 169/189 (89%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEA+II+SGLG SGWTE+SPP+P WDRAKNVD+LGVE AKS+VQLPLVWNIQ
Sbjct  263  KYYFIWSISEAAIIVSGLGLSGWTETSPPRPQWDRAKNVDVLGVEFAKSAVQLPLVWNIQ  322

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVY+RL+ KGKKPGFFQLLATQT SAVWHGLYPGY+IFFVQSALMIAGSR +Y
Sbjct  323  VSTWLRHYVYDRLVQKGKKPGFFQLLATQTTSAVWHGLYPGYIIFFVQSALMIAGSRVLY  382

Query  418  RWQQG--TGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQQ      A++KK+L  +N AYT+LVLNYS VGF+VLSL ET+A YGSVYY+GTIVP+
Sbjct  383  RWQQTIPPNMALVKKLLVFINVAYTILVLNYSAVGFMVLSLQETIALYGSVYYIGTIVPI  442

Query  244  VLIMLGNII  218
             LI+LGNII
Sbjct  443  SLILLGNII  451



>ref|XP_008238778.1| PREDICTED: lysophospholipid acyltransferase 1 [Prunus mume]
Length=465

 Score =   285 bits (729),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 167/189 (88%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASII+SGLGF+GWTESSPPKP WDRAKNVDILGVE AKSSVQLPLVWNIQ
Sbjct  263  KYYFIWSISEASIILSGLGFTGWTESSPPKPRWDRAKNVDILGVEFAKSSVQLPLVWNIQ  322

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERL+  GKK GFFQLL TQTVSAVWHGLYPGY+IFFVQSALMIAGSR IY
Sbjct  323  VSTWLRHYVYERLVKPGKKAGFFQLLTTQTVSAVWHGLYPGYIIFFVQSALMIAGSRVIY  382

Query  418  RWQQGTGNAI--LKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQQ     +  +K IL  +NFAYTLLVLNYSCVGF+VLSL ETLA+YGSV+++GTI+P+
Sbjct  383  RWQQAVPQNMDAVKNILVFINFAYTLLVLNYSCVGFIVLSLRETLASYGSVHFIGTILPI  442

Query  244  VLIMLGNII  218
             LI+L  +I
Sbjct  443  ALILLSYVI  451



>ref|XP_007209112.1| hypothetical protein PRUPE_ppa005358mg [Prunus persica]
 gb|EMJ10311.1| hypothetical protein PRUPE_ppa005358mg [Prunus persica]
Length=465

 Score =   285 bits (729),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 167/189 (88%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASII+SGLGF+GWTESSPPKP WDRAKNVDILGVE AKSSVQLPLVWNIQ
Sbjct  263  KYYFIWSISEASIILSGLGFTGWTESSPPKPRWDRAKNVDILGVEFAKSSVQLPLVWNIQ  322

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERL+  GKK GFFQLL TQTVSAVWHGLYPGY+IFFVQSALMIAGSR IY
Sbjct  323  VSTWLRHYVYERLVKPGKKAGFFQLLTTQTVSAVWHGLYPGYIIFFVQSALMIAGSRVIY  382

Query  418  RWQQGTGNAI--LKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQQ     +  +K IL  +NFAYTLLVLNYSCVGF+VLSL ETLA+YGSV+++GTI+P+
Sbjct  383  RWQQAVPQNMDAVKNILVFINFAYTLLVLNYSCVGFIVLSLRETLASYGSVHFIGTILPI  442

Query  244  VLIMLGNII  218
             LI+L  +I
Sbjct  443  ALILLSYVI  451



>ref|XP_009339650.1| PREDICTED: lysophospholipid acyltransferase 1-like [Pyrus x bretschneideri]
Length=461

 Score =   285 bits (729),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 166/189 (88%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASII+SGLGFSGWTESSPPKP WD AKNVDI+GVE AKSSVQLPLVWNIQ
Sbjct  259  KYYFIWSISEASIILSGLGFSGWTESSPPKPRWDNAKNVDIIGVEFAKSSVQLPLVWNIQ  318

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERL+   KK GFFQLLATQTVSAVWHGLYPGY+IFFVQSALMIAGSR IY
Sbjct  319  VSTWLRHYVYERLVKPSKKAGFFQLLATQTVSAVWHGLYPGYIIFFVQSALMIAGSRVIY  378

Query  418  RWQQGTGNA--ILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQQ       ++KKIL  +NF YT+LVLNYSCVGF+VLSLHETLA+YGSV ++GTIVP+
Sbjct  379  RWQQAVPPTMDVVKKILVFINFTYTILVLNYSCVGFIVLSLHETLASYGSVNFIGTIVPI  438

Query  244  VLIMLGNII  218
             LI+L  +I
Sbjct  439  ALILLSYVI  447



>ref|XP_002298063.2| membrane bound O-acyl transferase family protein [Populus trichocarpa]
 gb|EEE82868.2| membrane bound O-acyl transferase family protein [Populus trichocarpa]
Length=465

 Score =   285 bits (729),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 169/189 (89%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEA++IISGLGFSGWT++SP KP WDRAKNVDILGVE AKSSVQLPLVWNIQ
Sbjct  263  KYYFIWSISEAAVIISGLGFSGWTDTSPSKPKWDRAKNVDILGVEFAKSSVQLPLVWNIQ  322

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVY+RL+ KGKKPGFFQLLATQT SAVWHGLYPGY+IFFVQSALMIAGSR +Y
Sbjct  323  VSTWLRHYVYDRLVQKGKKPGFFQLLATQTTSAVWHGLYPGYIIFFVQSALMIAGSRVLY  382

Query  418  RWQQG--TGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQQ   +   ++K +L  ++FAYT+LVLNYS VGF+VL+L ETLA YGSVYY+GTI P+
Sbjct  383  RWQQAIPSNMDVVKNLLVFISFAYTVLVLNYSAVGFMVLTLQETLALYGSVYYIGTIAPI  442

Query  244  VLIMLGNII  218
            VLI+LGN+I
Sbjct  443  VLILLGNMI  451



>gb|KEH31706.1| membrane-bound O-acyltransferase family MBOAT protein [Medicago 
truncatula]
Length=462

 Score =   285 bits (728),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 167/187 (89%), Gaps = 1/187 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGFSGWT+SSPPKP WDRAKNVDILGVE AKS+V +P VWNIQ
Sbjct  263  KYYFIWSISEASIIISGLGFSGWTDSSPPKPRWDRAKNVDILGVEFAKSAVVIPAVWNIQ  322

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVY+RLI  GKKPGF QLLATQTVSA+WHGLYPGY+IFFVQSALMIAGSR IY
Sbjct  323  VSTWLRHYVYDRLIQSGKKPGFLQLLATQTVSAIWHGLYPGYIIFFVQSALMIAGSRVIY  382

Query  418  RWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPVVL  239
            RWQQG    + K  L   NFAYTLLVL+YSCVGF+VLSLHETLA+YGSVY++GT++P+V+
Sbjct  383  RWQQGVPPTV-KNALVFANFAYTLLVLSYSCVGFMVLSLHETLASYGSVYFIGTVLPIVI  441

Query  238  IMLGNII  218
            I+LG +I
Sbjct  442  ILLGKVI  448



>ref|XP_009364173.1| PREDICTED: lysophospholipid acyltransferase 1-like [Pyrus x bretschneideri]
 ref|XP_009364174.1| PREDICTED: lysophospholipid acyltransferase 1-like [Pyrus x bretschneideri]
Length=465

 Score =   284 bits (727),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 166/189 (88%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASII+SGLGFSGWTESSPPKP WD AKNVDI+GVE AKSSVQLPLVWNIQ
Sbjct  263  KYYFIWSISEASIILSGLGFSGWTESSPPKPRWDNAKNVDIIGVEFAKSSVQLPLVWNIQ  322

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERL+   KK GFFQLLATQTVSAVWHGLYPGY+IFFVQSALMIAGSR IY
Sbjct  323  VSTWLRHYVYERLVKPSKKAGFFQLLATQTVSAVWHGLYPGYIIFFVQSALMIAGSRVIY  382

Query  418  RWQQGTGNA--ILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQQ       ++KKIL  +NF YT+LVLNYSCVGF+VLSLHETLA+YGSV ++GTIVP+
Sbjct  383  RWQQALPPTMDVVKKILVFINFTYTILVLNYSCVGFIVLSLHETLASYGSVNFIGTIVPI  442

Query  244  VLIMLGNII  218
             LI+L  +I
Sbjct  443  ALILLSYVI  451



>ref|XP_011029182.1| PREDICTED: lysophospholipid acyltransferase 1-like [Populus euphratica]
Length=465

 Score =   284 bits (727),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 170/189 (90%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEA++IISGLGFSGWT++SP KP WDRAKNVDILGVE AKSSVQLPLVWNIQ
Sbjct  263  KYYFIWSISEAAVIISGLGFSGWTDTSPTKPKWDRAKNVDILGVEFAKSSVQLPLVWNIQ  322

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVY+RL+ KGKKPGFFQLLATQT SAVWHGLYPGY+IFFVQSALMIAGSR +Y
Sbjct  323  VSTWLRHYVYDRLVQKGKKPGFFQLLATQTTSAVWHGLYPGYIIFFVQSALMIAGSRVLY  382

Query  418  RWQQGTGNA--ILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQQ   ++  ++K +L  ++FAYT+LVLNYS VGF+VL+L ETLA YGSVYY+GTI P+
Sbjct  383  RWQQAIPSSMNVVKNLLVFISFAYTVLVLNYSAVGFMVLTLQETLALYGSVYYIGTIAPI  442

Query  244  VLIMLGNII  218
            VLI+LGN+I
Sbjct  443  VLILLGNMI  451



>ref|XP_002892700.1| membrane bound O-acyl transferase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH68959.1| membrane bound O-acyl transferase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=462

 Score =   284 bits (727),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 167/189 (88%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGFSGWT+ + PKP WDRAKNVDILGVELAKS+VQ+PLVWNIQ
Sbjct  261  KYYFIWSISEASIIISGLGFSGWTDDASPKPKWDRAKNVDILGVELAKSAVQIPLVWNIQ  320

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERL+  GKK GFFQLLATQTVSAVWHGLYPGYM+FFVQSALMIAGSR IY
Sbjct  321  VSTWLRHYVYERLVQNGKKAGFFQLLATQTVSAVWHGLYPGYMMFFVQSALMIAGSRVIY  380

Query  418  RWQQGTGN--AILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQQ      A+L+ IL  +NF YT+LVLNYS VGF+VLSLHETL AYGSVYY+GTI+PV
Sbjct  381  RWQQAISPKMAMLRNILVFINFLYTVLVLNYSAVGFMVLSLHETLTAYGSVYYIGTIIPV  440

Query  244  VLIMLGNII  218
            VLI+L  ++
Sbjct  441  VLILLSYVV  449



>ref|XP_011033798.1| PREDICTED: lysophospholipid acyltransferase 1-like [Populus euphratica]
Length=465

 Score =   284 bits (727),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 169/189 (89%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEA+II+SGLG SGWTE+SPP+P WDRAKNVD+LGVE AKS+VQLPLVWNIQ
Sbjct  263  KYYFIWSISEAAIIVSGLGLSGWTETSPPRPQWDRAKNVDVLGVEFAKSAVQLPLVWNIQ  322

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVY+RL+ KGKKPGFFQLLATQT SAVWHGLYPGY+IFFVQSALMIAGSR +Y
Sbjct  323  VSTWLRHYVYDRLVQKGKKPGFFQLLATQTTSAVWHGLYPGYIIFFVQSALMIAGSRVLY  382

Query  418  RWQQG--TGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQQ      A++KK+L  ++ AYT+LVLNYS VGF+VLSL ET+A YGSVYY+GTIVPV
Sbjct  383  RWQQTIPPNMALVKKLLVFISVAYTILVLNYSAVGFMVLSLQETIALYGSVYYIGTIVPV  442

Query  244  VLIMLGNII  218
             LI+LGNII
Sbjct  443  ALILLGNII  451



>ref|XP_002892698.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68957.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=447

 Score =   283 bits (725),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 167/189 (88%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGFSGWT+ + PKP WDRAKNVDILGVELAKS+VQ+PLVWNIQ
Sbjct  246  KYYFIWSISEASIIISGLGFSGWTDDASPKPKWDRAKNVDILGVELAKSAVQIPLVWNIQ  305

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERL+  GKK GFFQLLATQTVSAVWHGLYPGYM+FFVQSALMIAGSR IY
Sbjct  306  VSTWLRHYVYERLVQNGKKAGFFQLLATQTVSAVWHGLYPGYMMFFVQSALMIAGSRVIY  365

Query  418  RWQQGTGN--AILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQQ      A+L+ IL  +NF YT+LVLNYS VGF+VLSLHETL AYGSVYY+GTI+PV
Sbjct  366  RWQQAISPKMAMLRNILVFINFLYTVLVLNYSAVGFMVLSLHETLTAYGSVYYIGTIIPV  425

Query  244  VLIMLGNII  218
            VLI+L  ++
Sbjct  426  VLILLSYVV  434



>gb|AHE80985.1| acyl-CoA:lysophosphatidylcholine acyltransferase [Bernardia pulchella]
Length=466

 Score =   283 bits (723),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 165/189 (87%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGFSGW  + PPKP WDRAKNVDILGVE AKS+ +LPLVWNIQ
Sbjct  263  KYYFIWSISEASIIISGLGFSGWAPTDPPKPRWDRAKNVDILGVEFAKSAAELPLVWNIQ  322

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVY+RL+ KGKK GF QLLATQT SAVWHGLYPGY+IFF+QSALMIAGS+ IY
Sbjct  323  VSTWLRHYVYDRLVPKGKKAGFVQLLATQTTSAVWHGLYPGYIIFFIQSALMIAGSKVIY  382

Query  418  RWQQGT--GNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQQ T    + +KKI   MNFAYT+LVLNYSCVGF+VLSLHET++AYGSVYY+GTIVP+
Sbjct  383  RWQQATPPTKSFIKKIFVFMNFAYTVLVLNYSCVGFMVLSLHETISAYGSVYYIGTIVPI  442

Query  244  VLIMLGNII  218
            +  +LG II
Sbjct  443  LFFLLGYII  451



>ref|XP_006665020.1| PREDICTED: lysophospholipid acyltransferase-like [Oryza brachyantha]
Length=388

 Score =   280 bits (715),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 165/187 (88%), Gaps = 0/187 (0%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGF+GW++SSPPK  WDRAKNVD+LGVELAKS+VQLPLVWNIQ
Sbjct  188  KYYFIWSISEASIIISGLGFTGWSDSSPPKAKWDRAKNVDVLGVELAKSAVQLPLVWNIQ  247

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLR+YVYERL+ KGKKPGF QLL TQTVSAVWHGLYPGY+IFFVQSALMI GS+ IY
Sbjct  248  VSTWLRYYVYERLVQKGKKPGFLQLLGTQTVSAVWHGLYPGYIIFFVQSALMINGSKVIY  307

Query  418  RWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPVVL  239
            RWQQ   N +   IL  +NF+YTL+VLNYSC+GF VLS  ETLA+Y SVYYVGTI+P+V+
Sbjct  308  RWQQAVSNPVFHAILVFLNFSYTLMVLNYSCIGFQVLSFKETLASYQSVYYVGTIIPIVV  367

Query  238  IMLGNII  218
            ++LG +I
Sbjct  368  VLLGYVI  374



>gb|AGM15931.1| lysophosphatidylcholine acyltransferase 1 [Physaria fendleri]
Length=465

 Score =   281 bits (720),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 168/189 (89%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGFSGWT+ + PKP WDRAKNVDILGVELAKS+VQ+PLVWNIQ
Sbjct  264  KYYFIWSISEASIIISGLGFSGWTDDASPKPKWDRAKNVDILGVELAKSAVQIPLVWNIQ  323

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERL+  GKK GFFQLLATQTVSAVWHGLYPGYM+FFVQSALMIAGSR IY
Sbjct  324  VSTWLRHYVYERLVQNGKKAGFFQLLATQTVSAVWHGLYPGYMMFFVQSALMIAGSRVIY  383

Query  418  RWQQGTGN--AILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            +WQQ      A+L+K++  +NF YT+LVLNYS VGF+VLSLHETL AYGSVYY+GTI+PV
Sbjct  384  KWQQAISPKMAMLRKLMVFINFLYTVLVLNYSAVGFMVLSLHETLTAYGSVYYIGTILPV  443

Query  244  VLIMLGNII  218
            VLI+L  ++
Sbjct  444  VLILLSYVV  452



>ref|XP_010494450.1| PREDICTED: lysophospholipid acyltransferase 1-like isoform X2 
[Camelina sativa]
Length=449

 Score =   281 bits (719),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 166/189 (88%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGFSGWT  + PKP WDRAKNVDILGVELAKS+VQ+PLVWNIQ
Sbjct  248  KYYFIWSISEASIIISGLGFSGWTNDASPKPKWDRAKNVDILGVELAKSAVQIPLVWNIQ  307

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERL+  GKK GFFQLLATQTVSAVWHGLYPGYM+FFVQSALMIAGSR IY
Sbjct  308  VSTWLRHYVYERLVQNGKKAGFFQLLATQTVSAVWHGLYPGYMMFFVQSALMIAGSRVIY  367

Query  418  RWQQGTGN--AILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQQ      A+L+K +  +NF YT+LVLNYS VGF+VLSLHETL AYGSVYY+GTI+PV
Sbjct  368  RWQQAISPQMAMLRKSMVFINFLYTVLVLNYSAVGFMVLSLHETLTAYGSVYYIGTILPV  427

Query  244  VLIMLGNII  218
            VLI+L  ++
Sbjct  428  VLILLSYVV  436



>ref|XP_010494443.1| PREDICTED: lysophospholipid acyltransferase 1-like isoform X1 
[Camelina sativa]
Length=465

 Score =   281 bits (719),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 166/189 (88%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGFSGWT  + PKP WDRAKNVDILGVELAKS+VQ+PLVWNIQ
Sbjct  264  KYYFIWSISEASIIISGLGFSGWTNDASPKPKWDRAKNVDILGVELAKSAVQIPLVWNIQ  323

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERL+  GKK GFFQLLATQTVSAVWHGLYPGYM+FFVQSALMIAGSR IY
Sbjct  324  VSTWLRHYVYERLVQNGKKAGFFQLLATQTVSAVWHGLYPGYMMFFVQSALMIAGSRVIY  383

Query  418  RWQQGTGN--AILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQQ      A+L+K +  +NF YT+LVLNYS VGF+VLSLHETL AYGSVYY+GTI+PV
Sbjct  384  RWQQAISPQMAMLRKSMVFINFLYTVLVLNYSAVGFMVLSLHETLTAYGSVYYIGTILPV  443

Query  244  VLIMLGNII  218
            VLI+L  ++
Sbjct  444  VLILLSYVV  452



>ref|XP_006307436.1| hypothetical protein CARUB_v10009061mg [Capsella rubella]
 gb|EOA40334.1| hypothetical protein CARUB_v10009061mg [Capsella rubella]
Length=465

 Score =   281 bits (719),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 167/189 (88%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGFSGWT+ + PKP WDRAKNVDILGVELAKS+VQ+PLVWNIQ
Sbjct  264  KYYFIWSISEASIIISGLGFSGWTDDASPKPKWDRAKNVDILGVELAKSAVQIPLVWNIQ  323

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERL+  GKK GFFQLLATQTVSAVWHGLYPGYM+FFVQSALMIAGSR IY
Sbjct  324  VSTWLRHYVYERLVQNGKKAGFFQLLATQTVSAVWHGLYPGYMMFFVQSALMIAGSRVIY  383

Query  418  RWQQGTG--NAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQQ      A+L+K++  +NF YT+LVLNYS VGF+VLSLHETL AYGSVYY+GTI+PV
Sbjct  384  RWQQAISLKMAMLRKVMVFINFLYTVLVLNYSAVGFMVLSLHETLTAYGSVYYIGTILPV  443

Query  244  VLIMLGNII  218
             LI+L  ++
Sbjct  444  GLILLSYVV  452



>ref|XP_010553491.1| PREDICTED: lysophospholipid acyltransferase 1-like [Tarenaya 
hassleriana]
Length=462

 Score =   281 bits (718),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 168/189 (89%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGFSGWT+SSPPKP WDRAKNVDILGVELAKS+VQ+PLVWNIQ
Sbjct  263  KYYFIWSISEASIIISGLGFSGWTDSSPPKPKWDRAKNVDILGVELAKSAVQIPLVWNIQ  322

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERL+  GKK GFFQLLATQTVSAVWHGLYPGY+IFFVQSALMIAGSR +Y
Sbjct  323  VSTWLRHYVYERLVKSGKKAGFFQLLATQTVSAVWHGLYPGYIIFFVQSALMIAGSRVVY  382

Query  418  RWQQGTGNA--ILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQ+       I +K+  L NF YT+LVLNYS VGF+VLSLHET+ AYGSVYYVGT+VPV
Sbjct  383  RWQRAIPPKMDIPRKMTVLANFLYTVLVLNYSSVGFMVLSLHETITAYGSVYYVGTVVPV  442

Query  244  VLIMLGNII  218
             +I+LG+++
Sbjct  443  SVILLGHVV  451



>gb|AAF88094.1|AC025417_22 T12C24.17 [Arabidopsis thaliana]
Length=457

 Score =   280 bits (717),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 166/189 (88%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGFSGWT+ + PKP WDRAKNVDILGVELAKS+VQ+PLVWNIQ
Sbjct  256  KYYFIWSISEASIIISGLGFSGWTDDASPKPKWDRAKNVDILGVELAKSAVQIPLVWNIQ  315

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERL+  GKK GFFQLLATQTVSAVWHGLYPGYM+FFVQSALMIAGSR IY
Sbjct  316  VSTWLRHYVYERLVQNGKKAGFFQLLATQTVSAVWHGLYPGYMMFFVQSALMIAGSRVIY  375

Query  418  RWQQGTGN--AILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQQ      A+L+ I+  +NF YT+LVLNYS VGF+VLSLHETL AYGSVYY+GTI+PV
Sbjct  376  RWQQAISPKMAMLRNIMVFINFLYTVLVLNYSAVGFMVLSLHETLTAYGSVYYIGTIIPV  435

Query  244  VLIMLGNII  218
             LI+L  ++
Sbjct  436  GLILLSYVV  444



>ref|NP_172724.2| lysophosphatidylcholine acyltransferase 1 [Arabidopsis thaliana]
 sp|F4IDU4.1|MBOA1_ARATH RecName: Full=Lysophospholipid acyltransferase 1; Short=AtLPLAT1; 
AltName: Full=1-acylglycerophosphocholine O-acyltransferase 
1; AltName: Full=1-acylglycerophosphoethanolamine O-acyltransferase; 
AltName: Full=1-acylglycerophosphoserine O-acyltransferase; 
AltName: Full=Lysophosphatidylcholine acyltransferase 
1; Short=LPCAT1; AltName: Full=Lysophosphatidylethanolamine 
acyltransferase; Short=LPEAT; AltName: Full=Lysophosphatidylglycerol 
acyltransferase; Short=LPGAT; AltName: Full=Lysophosphatidylserine 
acyltransferase; Short=LPSAT [Arabidopsis 
thaliana]
 gb|AEE28904.1| MBOAT (membrane bound O-acyl transferase)-like protein [Arabidopsis 
thaliana]
Length=462

 Score =   280 bits (717),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 166/189 (88%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGFSGWT+ + PKP WDRAKNVDILGVELAKS+VQ+PLVWNIQ
Sbjct  261  KYYFIWSISEASIIISGLGFSGWTDDASPKPKWDRAKNVDILGVELAKSAVQIPLVWNIQ  320

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERL+  GKK GFFQLLATQTVSAVWHGLYPGYM+FFVQSALMIAGSR IY
Sbjct  321  VSTWLRHYVYERLVQNGKKAGFFQLLATQTVSAVWHGLYPGYMMFFVQSALMIAGSRVIY  380

Query  418  RWQQGTGN--AILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQQ      A+L+ I+  +NF YT+LVLNYS VGF+VLSLHETL AYGSVYY+GTI+PV
Sbjct  381  RWQQAISPKMAMLRNIMVFINFLYTVLVLNYSAVGFMVLSLHETLTAYGSVYYIGTIIPV  440

Query  244  VLIMLGNII  218
             LI+L  ++
Sbjct  441  GLILLSYVV  449



>gb|AAM13086.1| unknown protein [Arabidopsis thaliana]
 gb|AAM91162.1| unknown protein [Arabidopsis thaliana]
Length=462

 Score =   280 bits (717),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 166/189 (88%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGFSGWT+ + PKP WDRAKNVDILGVELAKS+VQ+PLVWNIQ
Sbjct  261  KYYFIWSISEASIIISGLGFSGWTDDASPKPKWDRAKNVDILGVELAKSAVQIPLVWNIQ  320

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERL+  GKK GFFQLLATQTVSAVWHGLYPGYM+FFVQSALMIAGSR IY
Sbjct  321  VSTWLRHYVYERLVQNGKKAGFFQLLATQTVSAVWHGLYPGYMMFFVQSALMIAGSRVIY  380

Query  418  RWQQGTGN--AILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQQ      A+L+ I+  +NF YT+LVLNYS VGF+VLSLHETL AYGSVYY+GTI+PV
Sbjct  381  RWQQAISPKMAMLRNIMVFINFLYTVLVLNYSAVGFMVLSLHETLTAYGSVYYIGTIIPV  440

Query  244  VLIMLGNII  218
             LI+L  ++
Sbjct  441  GLILLSYVV  449



>ref|XP_010546005.1| PREDICTED: lysophospholipid acyltransferase 1 [Tarenaya hassleriana]
Length=463

 Score =   280 bits (717),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 169/189 (89%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWS+SEASIIISGLGFSGW +SSPPKP WDRAKNVDI+GVELAKS+VQ+PLVWNIQ
Sbjct  263  KYYFIWSVSEASIIISGLGFSGWIDSSPPKPKWDRAKNVDIIGVELAKSAVQIPLVWNIQ  322

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERL+ +GKK GFFQLLATQTVSAVWHGLYPGY+IFFVQSALMIAGSR IY
Sbjct  323  VSTWLRHYVYERLVKRGKKAGFFQLLATQTVSAVWHGLYPGYIIFFVQSALMIAGSRVIY  382

Query  418  RWQQGTGN--AILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQQ       I +K++  +NF YT+LVLNYS VGF++LSLHET+ AYGSV+YVGTIVP+
Sbjct  383  RWQQAINPKMGIPRKVMVFVNFLYTVLVLNYSSVGFMLLSLHETVTAYGSVHYVGTIVPI  442

Query  244  VLIMLGNII  218
            V+I+LG ++
Sbjct  443  VVILLGYVV  451



>gb|EPS74023.1| hypothetical protein M569_00723, partial [Genlisea aurea]
Length=461

 Score =   280 bits (716),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 146/188 (78%), Positives = 166/188 (88%), Gaps = 1/188 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWS++EAS+IISGLGFSGWT+S PPKP WDRAKN+DI  VELAKSSVQLP+VWNIQ
Sbjct  261  KYYFIWSLAEASVIISGLGFSGWTDSDPPKPRWDRAKNIDIFRVELAKSSVQLPVVWNIQ  320

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRA-I  422
            VSTWLRHYVYERL+ KG+KPGFFQLLATQ VSAVWHGLYPGY++FF QSA+MIAGSRA I
Sbjct  321  VSTWLRHYVYERLVKKGQKPGFFQLLATQIVSAVWHGLYPGYILFFFQSAIMIAGSRAVI  380

Query  421  YRWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPVV  242
            YRWQQ T N+  + +  L+NF YT++VLN S VGFLVLSLHETLAAYGSVYYVGT +PV 
Sbjct  381  YRWQQATKNSAARLLFDLINFGYTVVVLNTSSVGFLVLSLHETLAAYGSVYYVGTALPVA  440

Query  241  LIMLGNII  218
            LI+LG I+
Sbjct  441  LIVLGKIM  448



>ref|XP_006364125.1| PREDICTED: lysophospholipid acyltransferase 2-like [Solanum tuberosum]
Length=464

 Score =   280 bits (715),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 147/188 (78%), Positives = 162/188 (86%), Gaps = 1/188 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTE-SSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNI  602
            KYY IWSISE +IIISG GFSGW + ++PPK  WDRA NVDILGVELAKSSVQ+PLVWNI
Sbjct  263  KYYFIWSISEVAIIISGFGFSGWADMTNPPKAQWDRAINVDILGVELAKSSVQIPLVWNI  322

Query  601  QVSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAI  422
            QVSTWLRHYVYERLI KGKKP F QLL TQTVSAVWHGLYPGY+IFFVQSALMIAGSR I
Sbjct  323  QVSTWLRHYVYERLIQKGKKPSFIQLLVTQTVSAVWHGLYPGYIIFFVQSALMIAGSRVI  382

Query  421  YRWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPVV  242
            YRWQQ T N   +K L   NF YTLLVLNYS VGF+VLSLHETL AYGSVYY+GTI+P++
Sbjct  383  YRWQQATSNIQFQKTLVFTNFVYTLLVLNYSAVGFMVLSLHETLTAYGSVYYIGTIIPIL  442

Query  241  LIMLGNII  218
            +I+LG +I
Sbjct  443  VILLGKMI  450



>ref|XP_010476235.1| PREDICTED: lysophospholipid acyltransferase 1 [Camelina sativa]
Length=465

 Score =   280 bits (715),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 166/189 (88%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGFSGWT  + PKP WDRAKNVDILGVELAKS+VQ+PLVWNIQ
Sbjct  264  KYYFIWSISEASIIISGLGFSGWTNDASPKPKWDRAKNVDILGVELAKSAVQIPLVWNIQ  323

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERL+  GKK GFFQLLATQTVSAVWHGLYPGYM+FFVQSALMIAGSR IY
Sbjct  324  VSTWLRHYVYERLVQNGKKAGFFQLLATQTVSAVWHGLYPGYMMFFVQSALMIAGSRVIY  383

Query  418  RWQQGTGN--AILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQQ      A+L+K +  +NF YT+LVLNYS VGF+VLSLHETL AYGSVYY+GTI+PV
Sbjct  384  RWQQAISPQMAMLRKGMVFINFLYTVLVLNYSAVGFMVLSLHETLTAYGSVYYIGTILPV  443

Query  244  VLIMLGNII  218
            VLI+L  ++
Sbjct  444  VLILLSYVV  452



>ref|XP_004252578.1| PREDICTED: lysophospholipid acyltransferase 1-like [Solanum lycopersicum]
Length=459

 Score =   279 bits (714),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 146/188 (78%), Positives = 162/188 (86%), Gaps = 1/188 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTE-SSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNI  602
            KYY IWSISE +IIISG GFSGW + ++PPK  WDRA NVDILGVELAKSSVQ+PL WNI
Sbjct  258  KYYFIWSISEVAIIISGFGFSGWADMTNPPKAQWDRAINVDILGVELAKSSVQIPLAWNI  317

Query  601  QVSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAI  422
            QVSTWLRHYVYERLI KGKKP F QLL TQTVSAVWHGLYPGY+IFFVQSALMIAGSR I
Sbjct  318  QVSTWLRHYVYERLIRKGKKPSFIQLLVTQTVSAVWHGLYPGYIIFFVQSALMIAGSRVI  377

Query  421  YRWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPVV  242
            YRWQQ T N   +K L  MNF YTLLVLNYS VGF+VLSLHET+ AYGSVYY+GTI+P++
Sbjct  378  YRWQQATSNIQFQKTLVFMNFVYTLLVLNYSAVGFMVLSLHETVTAYGSVYYIGTIIPIL  437

Query  241  LIMLGNII  218
            +I+LG +I
Sbjct  438  VILLGKMI  445



>emb|CDY57076.1| BnaCnng31560D [Brassica napus]
Length=465

 Score =   279 bits (713),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 165/189 (87%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGFSGWT+ + PKP WDRAKNVDILGVELAKS+VQ+PLVWNIQ
Sbjct  264  KYYFIWSISEASIIISGLGFSGWTDDASPKPKWDRAKNVDILGVELAKSAVQIPLVWNIQ  323

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERL+  GKK GFFQLL TQTVSAVWHGLYPGYM+FFVQSALMIAGSR IY
Sbjct  324  VSTWLRHYVYERLVKSGKKAGFFQLLGTQTVSAVWHGLYPGYMMFFVQSALMIAGSRVIY  383

Query  418  RWQQGTGN--AILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQQ      AIL+ I+  +NF YT+LVLNYS VGF+VLSLHETL AYGSVYY+GTI+PV
Sbjct  384  RWQQAISPKLAILRSIMVFINFLYTVLVLNYSAVGFMVLSLHETLTAYGSVYYIGTIIPV  443

Query  244  VLIMLGNII  218
             LI+L  ++
Sbjct  444  GLILLSYVV  452



>ref|XP_010458693.1| PREDICTED: lysophospholipid acyltransferase 1-like [Camelina 
sativa]
Length=465

 Score =   279 bits (713),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 166/189 (88%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGFSGWT  + PKP WDRAKNVDILGVELAKS+VQ+PLVWNIQ
Sbjct  264  KYYFIWSISEASIIISGLGFSGWTNDASPKPKWDRAKNVDILGVELAKSAVQIPLVWNIQ  323

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERL+  GKK GFFQLLATQTVSAVWHGLYPGYM+FFVQSALMIAGSR IY
Sbjct  324  VSTWLRHYVYERLVQNGKKAGFFQLLATQTVSAVWHGLYPGYMMFFVQSALMIAGSRVIY  383

Query  418  RWQQGTGN--AILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQQ      A+L+K +  +NF YT+LVLNYS VGF+VLSLHET+ AYGSVYY+GTI+PV
Sbjct  384  RWQQAISPQMAMLRKGMVFINFLYTVLVLNYSAVGFMVLSLHETVTAYGSVYYIGTILPV  443

Query  244  VLIMLGNII  218
            VLI+L  ++
Sbjct  444  VLILLSYVV  452



>ref|XP_003570095.1| PREDICTED: lysophospholipid acyltransferase 2 [Brachypodium distachyon]
Length=459

 Score =   278 bits (710),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 143/187 (76%), Positives = 164/187 (88%), Gaps = 0/187 (0%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWS+SEAS+IISGLGF+GW++SSPPK  W+RA NVDILGVELA S+VQLPL WNIQ
Sbjct  259  KYYFIWSVSEASVIISGLGFTGWSDSSPPKAKWERAINVDILGVELAGSAVQLPLKWNIQ  318

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLR+YVYERLI KGKKPGF QLL TQTVSA+WHGLYPGYMIFFVQSALMI GSR IY
Sbjct  319  VSTWLRYYVYERLIQKGKKPGFLQLLGTQTVSAIWHGLYPGYMIFFVQSALMINGSRVIY  378

Query  418  RWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPVVL  239
            RWQQ   N++L  IL L+NFAYT++VLNYSC+GF VLS  ETLA+Y SVYYVGTIVP++ 
Sbjct  379  RWQQAVSNSVLHTILTLLNFAYTMMVLNYSCIGFQVLSFQETLASYKSVYYVGTIVPILC  438

Query  238  IMLGNII  218
            ++LG +I
Sbjct  439  VLLGYVI  445



>ref|NP_001047723.1| Os02g0676000 [Oryza sativa Japonica Group]
 dbj|BAD29531.1| membrane bound O-acyl transferase-like [Oryza sativa Japonica 
Group]
 dbj|BAF09637.1| Os02g0676000 [Oryza sativa Japonica Group]
 gb|EEC73776.1| hypothetical protein OsI_08451 [Oryza sativa Indica Group]
 gb|EEE57566.1| hypothetical protein OsJ_07912 [Oryza sativa Japonica Group]
Length=459

 Score =   277 bits (709),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 164/187 (88%), Gaps = 0/187 (0%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWS+SEA+IIISGLGFSGW++SSPPK  WDRAKNVD+LGVELA S+VQLPL+WNIQ
Sbjct  259  KYYFIWSLSEAAIIISGLGFSGWSDSSPPKAKWDRAKNVDVLGVELATSAVQLPLMWNIQ  318

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLR+YVYERL+ KGKKPGF QLL TQTVSAVWHGLYPGY+IFFVQSALMI GS+ IY
Sbjct  319  VSTWLRYYVYERLVQKGKKPGFLQLLGTQTVSAVWHGLYPGYIIFFVQSALMINGSKVIY  378

Query  418  RWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPVVL  239
            RWQQ   N +   IL  +NF+YTL+VLNYSC+GF VLS  ETLA+Y SVYY+GTIVP+V+
Sbjct  379  RWQQAVSNPVFHAILVFVNFSYTLMVLNYSCIGFQVLSFKETLASYQSVYYIGTIVPIVV  438

Query  238  IMLGNII  218
            ++LG +I
Sbjct  439  VLLGYVI  445



>ref|XP_010255524.1| PREDICTED: lysophospholipid acyltransferase 1-like [Nelumbo nucifera]
Length=464

 Score =   277 bits (708),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 143/188 (76%), Positives = 164/188 (87%), Gaps = 2/188 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEAS+IISGLGFSGW++SSP  PLWDRAKN+DI+GVELAKS+V+LPLVWNI 
Sbjct  263  KYYYIWSISEASLIISGLGFSGWSDSSPSNPLWDRAKNIDIIGVELAKSAVELPLVWNIH  322

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERL+ KGKKPGF QLLATQTVSAVWHGLYPGY+IFFVQS LM+A SR IY
Sbjct  323  VSTWLRHYVYERLVEKGKKPGFAQLLATQTVSAVWHGLYPGYIIFFVQSVLMVAASRVIY  382

Query  418  RWQQG--TGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQ+       ++KKIL  MNF  TLL LNYSCV FLVLS+HET+ +YGSVYYVGT++P+
Sbjct  383  RWQRALPRNMDLVKKILVFMNFTCTLLSLNYSCVAFLVLSMHETITSYGSVYYVGTVIPI  442

Query  244  VLIMLGNI  221
            +LI+LG I
Sbjct  443  ILILLGCI  450



>gb|AHE80984.1| acyl-CoA:lysophosphatidylcholine acyltransferase [Bernardia pulchella]
Length=459

 Score =   274 bits (701),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 162/189 (86%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEAS+IIS LGFSGWT SSPPKP WDRAKNVDILGVE AKS+ +LPL+WNIQ
Sbjct  258  KYYFIWSISEASMIISTLGFSGWTGSSPPKPRWDRAKNVDILGVEFAKSAAELPLMWNIQ  317

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVY+RL+ KGKK GF QLLATQT SAVWHGLYPGY+IFF+QSALMI GS+ IY
Sbjct  318  VSTWLRHYVYDRLVPKGKKAGFVQLLATQTTSAVWHGLYPGYIIFFIQSALMIEGSKVIY  377

Query  418  RWQQG--TGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQQ       + KK+L  +N AYTLLVLN SCVGF+VLS HET+AAYGSVYYVGTIVP+
Sbjct  378  RWQQAIPPKKVLFKKMLVFINMAYTLLVLNCSCVGFMVLSFHETIAAYGSVYYVGTIVPI  437

Query  244  VLIMLGNII  218
            V+ +LG II
Sbjct  438  VIFLLGFII  446



>dbj|BAJ87726.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=460

 Score =   273 bits (699),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 163/187 (87%), Gaps = 0/187 (0%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWS+SEA+IIISGLGF+GW++SSPPK  WDRA NVDILGVELA S+ QLPL WNIQ
Sbjct  260  KYYFIWSVSEAAIIISGLGFTGWSDSSPPKAKWDRAINVDILGVELAGSAAQLPLKWNIQ  319

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLR+YVYERLI KGKKPGF QLL TQTVSA+WHGLYPGYMIFFVQSALMI GS+ IY
Sbjct  320  VSTWLRYYVYERLIQKGKKPGFLQLLGTQTVSAIWHGLYPGYMIFFVQSALMINGSKVIY  379

Query  418  RWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPVVL  239
            RWQQ   N+ L+ IL+L+N AYT++VLNYSC+GF VLS  ETLA+Y SVYYVGTIVP++ 
Sbjct  380  RWQQAVSNSGLRTILSLLNCAYTMMVLNYSCIGFQVLSFQETLASYKSVYYVGTIVPILC  439

Query  238  IMLGNII  218
            ++LG +I
Sbjct  440  VLLGYVI  446



>emb|CDX98051.1| BnaA06g08020D [Brassica napus]
Length=466

 Score =   273 bits (698),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 147/190 (77%), Positives = 165/190 (87%), Gaps = 3/190 (2%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTES-SPPKPLWDRAKNVDILGVELAKSSVQLPLVWNI  602
            KYY IWSISEASIIISGLGFSGWT+  + PKP WDRAKNVDILGVELAKS+VQ+PLVWNI
Sbjct  264  KYYFIWSISEASIIISGLGFSGWTDDEASPKPKWDRAKNVDILGVELAKSAVQIPLVWNI  323

Query  601  QVSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAI  422
            QVSTWLRHYVYERL+  GKK GFFQLLATQTVSAVWHGLYPGYM+FFVQSALMIAGSR I
Sbjct  324  QVSTWLRHYVYERLVKSGKKAGFFQLLATQTVSAVWHGLYPGYMMFFVQSALMIAGSRVI  383

Query  421  YRWQQGTGN--AILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVP  248
            YRWQQ       +L+ ++  +NF YT+LVLNYS VGF+VLSLHETL AYGSVYY+GTI+P
Sbjct  384  YRWQQAISPKLGVLRSMMVFINFLYTVLVLNYSAVGFMVLSLHETLTAYGSVYYIGTIIP  443

Query  247  VVLIMLGNII  218
            V LI+L  ++
Sbjct  444  VGLILLSYVV  453



>ref|XP_009148576.1| PREDICTED: lysophospholipid acyltransferase 1 [Brassica rapa]
Length=466

 Score =   273 bits (698),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 147/190 (77%), Positives = 165/190 (87%), Gaps = 3/190 (2%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTES-SPPKPLWDRAKNVDILGVELAKSSVQLPLVWNI  602
            KYY IWSISEASIIISGLGFSGWT+  + PKP WDRAKNVDILGVELAKS+VQ+PLVWNI
Sbjct  264  KYYFIWSISEASIIISGLGFSGWTDDDASPKPKWDRAKNVDILGVELAKSAVQIPLVWNI  323

Query  601  QVSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAI  422
            QVSTWLRHYVYERL+  GKK GFFQLLATQTVSAVWHGLYPGYM+FFVQSALMIAGSR I
Sbjct  324  QVSTWLRHYVYERLVKSGKKAGFFQLLATQTVSAVWHGLYPGYMMFFVQSALMIAGSRVI  383

Query  421  YRWQQGTGN--AILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVP  248
            YRWQQ       +L+ ++  +NF YT+LVLNYS VGF+VLSLHETL AYGSVYY+GTI+P
Sbjct  384  YRWQQAISPKLGVLRSMMVFINFLYTVLVLNYSAVGFMVLSLHETLTAYGSVYYIGTIIP  443

Query  247  VVLIMLGNII  218
            V LI+L  ++
Sbjct  444  VGLILLSYVV  453



>gb|ABK24304.1| unknown [Picea sitchensis]
Length=465

 Score =   269 bits (687),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 141/189 (75%), Positives = 162/189 (86%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEAS+I+SGLGFSGW++S PPKP WDRAKNVDILGVELAKS+ +LPLVWNIQ
Sbjct  263  KYYFIWSISEASVIVSGLGFSGWSDSEPPKPKWDRAKNVDILGVELAKSAAELPLVWNIQ  322

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLR+YVYERLI KGKKPGF QLLATQ VSAVWHGLY GY+IFF+ SAL IAGS+ IY
Sbjct  323  VSTWLRYYVYERLIQKGKKPGFAQLLATQIVSAVWHGLYAGYIIFFIHSALFIAGSKVIY  382

Query  418  RWQQGTGNAIL--KKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQQ     +L  +K L L N  YT L LNY+CVGF+VLSLHETLAAYGSV YVGT+VP+
Sbjct  383  RWQQAIPEKVLLGRKALILANMVYTALALNYACVGFMVLSLHETLAAYGSVSYVGTLVPI  442

Query  244  VLIMLGNII  218
             +I+LG+++
Sbjct  443  AMILLGSVL  451



>gb|KFK43529.1| hypothetical protein AALP_AA1G138000 [Arabis alpina]
Length=465

 Score =   268 bits (684),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 142/179 (79%), Positives = 157/179 (88%), Gaps = 2/179 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGFSGWT+ + PKP W+RAKNVDILGVELAKS+VQ+PLVWNIQ
Sbjct  264  KYYFIWSISEASIIISGLGFSGWTDDTSPKPKWERAKNVDILGVELAKSAVQIPLVWNIQ  323

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERL+  GKK GFFQLLATQTVSAVWHGLYPGYM+FFVQSALMI GSR IY
Sbjct  324  VSTWLRHYVYERLVRNGKKAGFFQLLATQTVSAVWHGLYPGYMMFFVQSALMIGGSRVIY  383

Query  418  RWQQGTGNAI--LKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVP  248
            RWQQ     +  L+K +  +NF YT+LVLNYS VGF+VLSLHETL AYGSVYY+GTI+P
Sbjct  384  RWQQAISPKLVMLRKSMVFINFLYTVLVLNYSAVGFMVLSLHETLTAYGSVYYIGTIIP  442



>gb|ERN19360.1| hypothetical protein AMTR_s00069p00124460 [Amborella trichopoda]
Length=463

 Score =   263 bits (672),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 140/179 (78%), Positives = 160/179 (89%), Gaps = 2/179 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGFSGW++++PPK LW+RAKNVDILGVE AKS+ +LPLVWNIQ
Sbjct  261  KYYFIWSISEASIIISGLGFSGWSDTNPPKSLWERAKNVDILGVEFAKSAAELPLVWNIQ  320

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLR+YVYERLI KGKKPGF QLLATQTVSAVWHGLY GY+IFFV SAL+IAGS+ IY
Sbjct  321  VSTWLRYYVYERLIQKGKKPGFLQLLATQTVSAVWHGLYAGYIIFFVHSALLIAGSKVIY  380

Query  418  RWQQG--TGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVP  248
            RWQQ      A++ K +A +NFAYTLLVLNY+C+GF VLS+HETLA+YGSVYY+GTIVP
Sbjct  381  RWQQAFPPKMAMVGKAMAFLNFAYTLLVLNYACIGFQVLSMHETLASYGSVYYIGTIVP  439



>gb|AGM15932.1| lysophosphatidylcholine acyltransferase 2 [Physaria fendleri]
Length=465

 Score =   263 bits (672),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 165/189 (87%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGFSGWT+ +  K  WDRAKNVDILGVELAKS+VQ+PL WNIQ
Sbjct  264  KYYFIWSISEASIIISGLGFSGWTDETQTKAKWDRAKNVDILGVELAKSAVQIPLYWNIQ  323

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYER++  GKK GFFQLLATQTVSAVWHGLYPGY+IFFVQSALMI GS+AIY
Sbjct  324  VSTWLRHYVYERIVKPGKKAGFFQLLATQTVSAVWHGLYPGYIIFFVQSALMIDGSKAIY  383

Query  418  RWQQGT--GNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQQ      A+L+ ++ L+NF YT+LVLNYS VGF+VLSLHET+ AY SVY++GT++P+
Sbjct  384  RWQQAIPPKMAMLRNVMVLINFLYTVLVLNYSAVGFMVLSLHETIVAYKSVYFIGTVIPI  443

Query  244  VLIMLGNII  218
            ++++L +++
Sbjct  444  IVLLLSSVV  452



>ref|XP_006857893.2| PREDICTED: lysophospholipid acyltransferase 1 [Amborella trichopoda]
Length=465

 Score =   263 bits (671),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 140/179 (78%), Positives = 160/179 (89%), Gaps = 2/179 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGFSGW++++PPK LW+RAKNVDILGVE AKS+ +LPLVWNIQ
Sbjct  263  KYYFIWSISEASIIISGLGFSGWSDTNPPKSLWERAKNVDILGVEFAKSAAELPLVWNIQ  322

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLR+YVYERLI KGKKPGF QLLATQTVSAVWHGLY GY+IFFV SAL+IAGS+ IY
Sbjct  323  VSTWLRYYVYERLIQKGKKPGFLQLLATQTVSAVWHGLYAGYIIFFVHSALLIAGSKVIY  382

Query  418  RWQQG--TGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVP  248
            RWQQ      A++ K +A +NFAYTLLVLNY+C+GF VLS+HETLA+YGSVYY+GTIVP
Sbjct  383  RWQQAFPPKMAMVGKAMAFLNFAYTLLVLNYACIGFQVLSMHETLASYGSVYYIGTIVP  441



>ref|XP_006391786.1| hypothetical protein EUTSA_v10023446mg [Eutrema salsugineum]
 gb|ESQ29072.1| hypothetical protein EUTSA_v10023446mg [Eutrema salsugineum]
Length=466

 Score =   262 bits (669),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 143/190 (75%), Positives = 164/190 (86%), Gaps = 3/190 (2%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWT-ESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNI  602
            KYY IWSISEASIIISGLGFSGWT E +  K  WDRAKNVDILGVELAKS+VQ+PL WNI
Sbjct  264  KYYFIWSISEASIIISGLGFSGWTDEKTQTKAKWDRAKNVDILGVELAKSAVQIPLFWNI  323

Query  601  QVSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAI  422
            QVSTWLRHYVYER++  GKK GFFQLLATQTVSAVWHGLYPGY+IFFVQSALMI GS+AI
Sbjct  324  QVSTWLRHYVYERIVKPGKKAGFFQLLATQTVSAVWHGLYPGYIIFFVQSALMIDGSKAI  383

Query  421  YRWQQGT--GNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVP  248
            YRWQQ      AIL+ I+ L+NF YT+LVLNYS VGF+VLSLHETL A+ SVYY+GT++P
Sbjct  384  YRWQQAMPPKMAILRNIMVLINFLYTVLVLNYSSVGFMVLSLHETLVAFKSVYYIGTVLP  443

Query  247  VVLIMLGNII  218
            +V+I+L  ++
Sbjct  444  IVVILLSCLV  453



>emb|CDY63224.1| BnaCnng41640D [Brassica napus]
Length=467

 Score =   262 bits (669),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 165/190 (87%), Gaps = 3/190 (2%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWT-ESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNI  602
            KYY IWSISEASIIISGLGFSGWT E++  K  WDRAKNVDILGVELAKS+VQ+PLVWNI
Sbjct  265  KYYFIWSISEASIIISGLGFSGWTDENTQTKAKWDRAKNVDILGVELAKSAVQIPLVWNI  324

Query  601  QVSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAI  422
            QVSTWLRHYVYER++  GKK GFFQLLATQTVSAVWHGLYPGY+IFFVQSALMI GS+AI
Sbjct  325  QVSTWLRHYVYERIVKPGKKAGFFQLLATQTVSAVWHGLYPGYIIFFVQSALMIDGSKAI  384

Query  421  YRWQQGT--GNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVP  248
            YRWQQ      A+L+ ++  +NF YT+LVLNYS VGF+VLSLHETL AY SVY++GT+VP
Sbjct  385  YRWQQAMPPKMAMLRSVMVFINFLYTVLVLNYSSVGFMVLSLHETLVAYKSVYFIGTVVP  444

Query  247  VVLIMLGNII  218
            +V+I+L  ++
Sbjct  445  IVVILLSYLV  454



>ref|XP_002886438.1| membrane bound O-acyl transferase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH62697.1| membrane bound O-acyl transferase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=465

 Score =   261 bits (667),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 163/189 (86%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGFSGWT+ +  K  WDRAKNVDILGVELAKS+VQ+PL WNIQ
Sbjct  264  KYYFIWSISEASIIISGLGFSGWTDETQTKAKWDRAKNVDILGVELAKSAVQIPLFWNIQ  323

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYER++  GKK GFFQLLATQTVSAVWHGLYPGY+IFFVQSALMI GS+AIY
Sbjct  324  VSTWLRHYVYERIVKPGKKAGFFQLLATQTVSAVWHGLYPGYIIFFVQSALMIDGSKAIY  383

Query  418  RWQQGT--GNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQQ      A+L+ +L L+NF YT+LVLNYS VGF+VLSLHET+ A+ SVYY+GT++P+
Sbjct  384  RWQQAIPPKMAMLRNVLVLINFLYTVLVLNYSSVGFMVLSLHETIVAFKSVYYIGTVIPI  443

Query  244  VLIMLGNII  218
             +++L  ++
Sbjct  444  AVLLLSYLV  452



>ref|NP_176493.1| lysophosphatidylcholine acyltransferase [Arabidopsis thaliana]
 sp|Q9CAN8.1|MBOA2_ARATH RecName: Full=Lysophospholipid acyltransferase 2; Short=AtLPLAT2; 
AltName: Full=1-acylglycerophosphocholine O-acyltransferase 
2; AltName: Full=1-acylglycerophosphoethanolamine O-acyltransferase; 
AltName: Full=1-acylglycerophosphoserine O-acyltransferase; 
AltName: Full=Lysophosphatidylcholine acyltransferase 
2; Short=LPCAT2; AltName: Full=Lysophosphatidylethanolamine 
acyltransferase; Short=LPEAT; AltName: Full=Lysophosphatidylglycerol 
acyltransferase; Short=LPGAT; AltName: Full=Lysophosphatidylserine 
acyltransferase; Short=LPSAT [Arabidopsis 
thaliana]
 gb|AAG51612.1|AC010795_16 unknown protein; 29405-27288 [Arabidopsis thaliana]
 gb|AAL59903.1| unknown protein [Arabidopsis thaliana]
 gb|AAM67512.1| unknown protein [Arabidopsis thaliana]
 gb|AEE34045.1| lysophosphatidylcholine acyltransferase [Arabidopsis thaliana]
Length=465

 Score =   261 bits (667),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 163/189 (86%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGFSGWT+ +  K  WDRAKNVDILGVELAKS+VQ+PL WNIQ
Sbjct  264  KYYFIWSISEASIIISGLGFSGWTDETQTKAKWDRAKNVDILGVELAKSAVQIPLFWNIQ  323

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYER++  GKK GFFQLLATQTVSAVWHGLYPGY+IFFVQSALMI GS+AIY
Sbjct  324  VSTWLRHYVYERIVKPGKKAGFFQLLATQTVSAVWHGLYPGYIIFFVQSALMIDGSKAIY  383

Query  418  RWQQGT--GNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQQ      A+L+ +L L+NF YT++VLNYS VGF+VLSLHETL A+ SVYY+GT++P+
Sbjct  384  RWQQAIPPKMAMLRNVLVLINFLYTVVVLNYSSVGFMVLSLHETLVAFKSVYYIGTVIPI  443

Query  244  VLIMLGNII  218
             +++L  ++
Sbjct  444  AVLLLSYLV  452



>ref|XP_009113025.1| PREDICTED: lysophospholipid acyltransferase 2 [Brassica rapa]
Length=467

 Score =   260 bits (664),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 164/190 (86%), Gaps = 3/190 (2%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWT-ESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNI  602
            KYY IWSISEASIIISGLGFSGWT E++  K  WDRAKNVDILGVELAKS+VQ+PLVWNI
Sbjct  265  KYYFIWSISEASIIISGLGFSGWTDENTQTKAKWDRAKNVDILGVELAKSAVQIPLVWNI  324

Query  601  QVSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAI  422
            QVSTWLRHYVYER++  GKK GFFQLLATQTVSAVWHGLYPGY+IFFVQSALMI GS+AI
Sbjct  325  QVSTWLRHYVYERIVKPGKKAGFFQLLATQTVSAVWHGLYPGYIIFFVQSALMIDGSKAI  384

Query  421  YRWQQGT--GNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVP  248
            YRWQQ      A+L+ ++  +NF YT+LVLNYS VGF+VLSLHETL AY SVY++GT+VP
Sbjct  385  YRWQQAMPPKMAMLRSVMVFINFLYTVLVLNYSSVGFMVLSLHETLVAYKSVYFIGTVVP  444

Query  247  VVLIMLGNII  218
            + +I+L  ++
Sbjct  445  IAVILLSYLV  454



>emb|CDY45972.1| BnaA09g12940D [Brassica napus]
Length=467

 Score =   260 bits (664),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 164/190 (86%), Gaps = 3/190 (2%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWT-ESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNI  602
            KYY IWSISEASIIISGLGFSGWT E++  K  WDRAKNVDILGVELAKS+VQ+PLVWNI
Sbjct  265  KYYFIWSISEASIIISGLGFSGWTDENTQTKAKWDRAKNVDILGVELAKSAVQIPLVWNI  324

Query  601  QVSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAI  422
            QVSTWLRHYVYER++  GKK GFFQLLATQTVSAVWHGLYPGY+IFFVQSALMI GS+AI
Sbjct  325  QVSTWLRHYVYERIVKPGKKAGFFQLLATQTVSAVWHGLYPGYIIFFVQSALMIDGSKAI  384

Query  421  YRWQQGT--GNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVP  248
            YRWQQ      A+L+ ++  +NF YT+LVLNYS VGF+VLSLHETL AY SVY++GT+VP
Sbjct  385  YRWQQSMPPKMAMLRSVMVFINFLYTVLVLNYSSVGFMVLSLHETLVAYKSVYFIGTVVP  444

Query  247  VVLIMLGNII  218
            + +I+L  ++
Sbjct  445  IAVILLSYLV  454



>ref|XP_006300445.1| hypothetical protein CARUB_v10020125mg [Capsella rubella]
 gb|EOA33343.1| hypothetical protein CARUB_v10020125mg [Capsella rubella]
Length=531

 Score =   260 bits (664),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 162/189 (86%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGFSGW + +  K  WDRAKNVDILGVELAKS+VQ+PL WNIQ
Sbjct  330  KYYFIWSISEASIIISGLGFSGWADETQTKAKWDRAKNVDILGVELAKSAVQIPLFWNIQ  389

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYER++  GKK GFFQLLATQTVSAVWHGLYPGY+IFFVQSALMI GS+AIY
Sbjct  390  VSTWLRHYVYERIVKPGKKAGFFQLLATQTVSAVWHGLYPGYIIFFVQSALMIDGSKAIY  449

Query  418  RWQQG--TGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQQ      A+L+ +L L+NF YT+LVLNYS VGF+VLSLHET+ A+ SVYY+GT++P+
Sbjct  450  RWQQAIPPKMAMLRHVLVLINFLYTVLVLNYSSVGFMVLSLHETIVAFKSVYYIGTVIPI  509

Query  244  VLIMLGNII  218
             +++L  ++
Sbjct  510  AVLLLSYLV  518



>gb|KFK40546.1| hypothetical protein AALP_AA2G010000 [Arabis alpina]
Length=467

 Score =   256 bits (655),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 162/186 (87%), Gaps = 3/186 (2%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWT-ESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNI  602
            KYY IWSISEASIIISGLGFSGWT E +  K  WDRAKNVDILGVELAKS+VQ+PLVWNI
Sbjct  264  KYYFIWSISEASIIISGLGFSGWTDEKTQTKAKWDRAKNVDILGVELAKSAVQIPLVWNI  323

Query  601  QVSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAI  422
            QVSTWLRHYVY+R++  GK+ GFFQLLATQTVSAVWHGLYPGY+IFFVQSALMI GS+AI
Sbjct  324  QVSTWLRHYVYDRIVKPGKRAGFFQLLATQTVSAVWHGLYPGYIIFFVQSALMIDGSKAI  383

Query  421  YRWQQGT--GNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVP  248
            YRWQQ      A+L+ ++  +NF YT+LVLNYS VGF+VLSLHETL AY SVY++GTI+P
Sbjct  384  YRWQQAMPPKMAMLRNLMVFVNFLYTVLVLNYSSVGFMVLSLHETLVAYKSVYFIGTILP  443

Query  247  VVLIML  230
            +V+I+L
Sbjct  444  IVVILL  449



>ref|XP_010473534.1| PREDICTED: lysophospholipid acyltransferase 2 [Camelina sativa]
Length=465

 Score =   256 bits (654),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 135/189 (71%), Positives = 161/189 (85%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWS+SEASIIISGLGFSGW + +  K  WDRAKNVDILGVELAKS+VQ+PL WNIQ
Sbjct  264  KYYFIWSVSEASIIISGLGFSGWADETLTKAKWDRAKNVDILGVELAKSAVQIPLYWNIQ  323

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYER++  GKK GFFQLLATQTVSAVWHGLYPGY+IFFVQSALMI GS+AIY
Sbjct  324  VSTWLRHYVYERIVKPGKKAGFFQLLATQTVSAVWHGLYPGYIIFFVQSALMIDGSKAIY  383

Query  418  RWQQG--TGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQQ      A L+ +L L+NF YT++VLNYS VGF+VLSLHET+ A+ SVYY+GT++P+
Sbjct  384  RWQQAIPPKMATLRNVLVLINFLYTVVVLNYSSVGFMVLSLHETIIAFKSVYYIGTVIPI  443

Query  244  VLIMLGNII  218
             +++L  ++
Sbjct  444  AVLLLSYLV  452



>ref|XP_010430382.1| PREDICTED: lysophospholipid acyltransferase 2-like [Camelina 
sativa]
Length=465

 Score =   255 bits (652),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 136/189 (72%), Positives = 161/189 (85%), Gaps = 2/189 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGFSGW + +  K  WDRAKNVDILGVELAKS+VQ+PL WNIQ
Sbjct  264  KYYFIWSISEASIIISGLGFSGWADETLTKAKWDRAKNVDILGVELAKSAVQIPLYWNIQ  323

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYER++  GKK GFFQLLATQTVSAVWHGLYPGY+IFFVQSALMI GS+AIY
Sbjct  324  VSTWLRHYVYERIVKPGKKAGFFQLLATQTVSAVWHGLYPGYIIFFVQSALMIDGSKAIY  383

Query  418  RWQQGT--GNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQQ      A L+ +L L+NF YT++VLNYS VGF+VLSLHET+ A+ SVYY+GT++P+
Sbjct  384  RWQQAIPPKMATLRNVLVLINFLYTVVVLNYSSVGFMVLSLHETIIAFKSVYYIGTVIPI  443

Query  244  VLIMLGNII  218
             +++L  ++
Sbjct  444  AVLLLSYLV  452



>gb|KJB68445.1| hypothetical protein B456_010G246400 [Gossypium raimondii]
Length=433

 Score =   248 bits (634),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 144/158 (91%), Gaps = 2/158 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEA++IISGLGFSGWTESSPPKP WDRAK VDILG ELAKSSV LPLVWNIQ
Sbjct  263  KYYFIWSISEAAMIISGLGFSGWTESSPPKPKWDRAKVVDILGFELAKSSVLLPLVWNIQ  322

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERL+ KGKKPGFFQLLATQTVSAVWHGLYPGY+IFFVQSALMIAGSR IY
Sbjct  323  VSTWLRHYVYERLVKKGKKPGFFQLLATQTVSAVWHGLYPGYIIFFVQSALMIAGSRVIY  382

Query  418  RWQQG--TGNAILKKILALMNFAYTLLVLNYSCVGFLV  311
            +W++   T  A++KK  A+MNFAYTLLVLNYSCVGF+V
Sbjct  383  QWEKAIPTNMALVKKAFAVMNFAYTLLVLNYSCVGFMV  420



>ref|XP_010418312.1| PREDICTED: lysophospholipid acyltransferase 2-like [Camelina 
sativa]
Length=465

 Score =   249 bits (635),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 153/178 (86%), Gaps = 2/178 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGFSGW + +  K  WDRAKNVDILGVELAKS+VQ+PL WNIQ
Sbjct  264  KYYFIWSISEASIIISGLGFSGWADETQTKAKWDRAKNVDILGVELAKSAVQIPLYWNIQ  323

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYER++  GKK GFFQLLATQTVSAVWHGLYPGY+IFFVQSALMI GS+AIY
Sbjct  324  VSTWLRHYVYERIVKPGKKAGFFQLLATQTVSAVWHGLYPGYIIFFVQSALMIDGSKAIY  383

Query  418  RWQQGT--GNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIV  251
            RWQQ      A L+ +L L+NF YT++VLNYS VGF+VLSLHET+ A+ SVYY+GT++
Sbjct  384  RWQQAIPPKMATLRNVLVLINFLYTVVVLNYSSVGFMVLSLHETIIAFKSVYYIGTVI  441



>ref|XP_004515798.1| PREDICTED: lysophospholipid acyltransferase 1-like isoform X1 
[Cicer arietinum]
Length=484

 Score =   243 bits (620),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 143/166 (86%), Gaps = 2/166 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGFSGWT+SSPPKP WDRAKNVDILGVELAKS+V +P VWNIQ
Sbjct  263  KYYFIWSISEASIIISGLGFSGWTDSSPPKPRWDRAKNVDILGVELAKSAVVIPAVWNIQ  322

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVYERLI  GKKPGF QLLATQTVSA+WHGLYPGY+IFFVQSALMIAGSR IY
Sbjct  323  VSTWLRHYVYERLIQTGKKPGFLQLLATQTVSAIWHGLYPGYIIFFVQSALMIAGSRVIY  382

Query  418  RWQQGT--GNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLA  287
            RWQQ      A++K  L   NFAYTLLVLNYS VGF+V SL  +L+
Sbjct  383  RWQQAVPPTMALVKNALVFTNFAYTLLVLNYSSVGFMVCSLSHSLS  428



>gb|EMT11337.1| hypothetical protein F775_10016 [Aegilops tauschii]
Length=374

 Score =   231 bits (588),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 135/154 (88%), Gaps = 0/154 (0%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEA+IIISGLGF+GW++SSPPK  WDRA NVDILGVELA S+ QLPL WNIQ
Sbjct  144  KYYFIWSISEAAIIISGLGFTGWSDSSPPKAKWDRAINVDILGVELAGSAAQLPLKWNIQ  203

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLR+YVYERLI KGKKPGF QLL TQTVSA+WHGLYPGYMIFFVQSALMI GS+ IY
Sbjct  204  VSTWLRYYVYERLIQKGKKPGFLQLLGTQTVSAIWHGLYPGYMIFFVQSALMINGSKVIY  263

Query  418  RWQQGTGNAILKKILALMNFAYTLLVLNYSCVGF  317
            RWQQ   N+  + IL+L+N AYT++VLNYSC+GF
Sbjct  264  RWQQAVSNSGFRTILSLLNCAYTMMVLNYSCIGF  297



>gb|EMS54344.1| hypothetical protein TRIUR3_33673 [Triticum urartu]
Length=386

 Score =   229 bits (584),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 134/154 (87%), Gaps = 0/154 (0%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWS+SEA+IIISGLGF+GW++SSPPK  WDRA NVDILGVELA S+ QLPL WNIQ
Sbjct  156  KYYFIWSVSEAAIIISGLGFTGWSDSSPPKAKWDRAINVDILGVELAGSAAQLPLKWNIQ  215

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLR+YVYERLI KGKKPGF QLL TQTVSA+WHGLYPGYM FFVQSALMI GS+ IY
Sbjct  216  VSTWLRYYVYERLIQKGKKPGFLQLLGTQTVSAIWHGLYPGYMFFFVQSALMINGSKVIY  275

Query  418  RWQQGTGNAILKKILALMNFAYTLLVLNYSCVGF  317
            RWQQ   N  L+ IL+L+N AYT++VLNYSC+GF
Sbjct  276  RWQQAVSNPGLRTILSLLNCAYTMMVLNYSCIGF  309



>ref|XP_001780460.1| predicted protein [Physcomitrella patens]
 gb|EDQ54750.1| predicted protein [Physcomitrella patens]
Length=468

 Score =   219 bits (557),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 122/192 (64%), Positives = 147/192 (77%), Gaps = 5/192 (3%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWT---ESSPPKPLWDRAKNVDILGVELAKSSVQLPLVW  608
            KYY IWSISE ++IISGLGFSGW    +    KPLW RAKNVDI+ VELAKS V+LP+ W
Sbjct  262  KYYFIWSISEVAVIISGLGFSGWATPDDDKKAKPLWTRAKNVDIMKVELAKSGVELPMCW  321

Query  607  NIQVSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSR  428
            N+ VSTWLRHYVYERL+ KG K GF+QLL TQ VSAVWHGLY GY+++FV SALMI+GSR
Sbjct  322  NVSVSTWLRHYVYERLVPKGGKAGFWQLLMTQVVSAVWHGLYMGYILYFVHSALMISGSR  381

Query  427  AIYRWQQG-TGNAILKKILA-LMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTI  254
             IY+WQ     NAI  + L  L+N  +  LV NYSC+GFL+LS HETL AY SV+YVGT+
Sbjct  382  VIYKWQSALPENAIWARRLGHLINGLFGALVNNYSCIGFLLLSYHETLQAYSSVHYVGTV  441

Query  253  VPVVLIMLGNII  218
            VPV +I+   ++
Sbjct  442  VPVAIILFDLVV  453



>ref|XP_001763507.1| predicted protein [Physcomitrella patens]
 gb|EDQ71696.1| predicted protein [Physcomitrella patens]
Length=466

 Score =   211 bits (536),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 113/192 (59%), Positives = 147/192 (77%), Gaps = 5/192 (3%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESS---PPKPLWDRAKNVDILGVELAKSSVQLPLVW  608
            KYY IWS+SEA+++ISG GFSGWT+S+     KP + RA+NVDIL VELA S+ ++P  W
Sbjct  260  KYYFIWSLSEAAVMISGFGFSGWTKSASSDESKPQFSRAQNVDILNVELATSAAEIPKYW  319

Query  607  NIQVSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSR  428
            NI VS WLRHYVYERL+ KG++PGF QLLATQ VSA+WHGLY GY++FFV SALMIAG+R
Sbjct  320  NIHVSVWLRHYVYERLVVKGRRPGFRQLLATQVVSAIWHGLYTGYLLFFVNSALMIAGAR  379

Query  427  AIYRWQQG--TGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTI  254
             +Y+WQQ     N +  K+ +   F YT+LVLN + +GFLVL   +T+ AY +VYY GT+
Sbjct  380  VLYKWQQAIPKSNFLAVKLGSFFGFFYTVLVLNLTVMGFLVLYFDDTITAYRTVYYSGTL  439

Query  253  VPVVLIMLGNII  218
            +PV LI+LG ++
Sbjct  440  LPVALILLGKVV  451



>ref|XP_001751825.1| predicted protein [Physcomitrella patens]
 gb|EDQ83260.1| predicted protein [Physcomitrella patens]
Length=469

 Score =   207 bits (527),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 144/192 (75%), Gaps = 5/192 (3%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSP---PKPLWDRAKNVDILGVELAKSSVQLPLVW  608
            KYY IWS+SEA+++ISG GFSGW + +P   PK  + RA+NVDIL VELA S+ ++P  W
Sbjct  263  KYYFIWSLSEAAVMISGFGFSGWVKPTPSDEPKAKFSRAENVDILNVELATSAAEIPKYW  322

Query  607  NIQVSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSR  428
            NI VS WLRHYVYERL+ KGK+PGF+QLLATQ VSA+WHGLY GY++FFV SALMIAG+R
Sbjct  323  NIHVSVWLRHYVYERLVVKGKRPGFWQLLATQVVSAIWHGLYAGYLLFFVNSALMIAGAR  382

Query  427  AIYRWQQG--TGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTI  254
             I++WQ+     N +   +  L  F YT+ VLN + +GFLVL   +T+  Y +VYY GT+
Sbjct  383  VIFKWQRSIPKSNFLAVNLGPLFGFVYTVFVLNLTVMGFLVLYFDDTITVYKTVYYSGTL  442

Query  253  VPVVLIMLGNII  218
            +PVV+I+LG  I
Sbjct  443  LPVVIILLGEFI  454



>gb|KDO63565.1| hypothetical protein CISIN_1g012501mg [Citrus sinensis]
Length=420

 Score =   204 bits (518),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 123/145 (85%), Gaps = 8/145 (6%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIII GLGFSGWTESSPPKP WDRAKNVDILGVE AKS+VQ+PLVWNIQ
Sbjct  260  KYYFIWSISEASIIICGLGFSGWTESSPPKPKWDRAKNVDILGVEFAKSAVQIPLVWNIQ  319

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVY+RLI  GKKPGFFQLLATQTVSAVWHGLYPGY+IFFVQSALMIAGSR   
Sbjct  320  VSTWLRHYVYDRLIQNGKKPGFFQLLATQTVSAVWHGLYPGYIIFFVQSALMIAGSR---  376

Query  418  RWQQGTGNAILKKILALMNFAYTLL  344
                GT   IL  IL L N  Y+LL
Sbjct  377  ----GTDLTIL-VILWLGNLFYSLL  396



>gb|KCW72087.1| hypothetical protein EUGRSUZ_E00532 [Eucalyptus grandis]
Length=391

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 108/121 (89%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIII GLGFSGWTESSPPKP WDRAKNVDILGVE A S+VQLPLVWNIQ
Sbjct  263  KYYFIWSISEASIIIGGLGFSGWTESSPPKPKWDRAKNVDILGVEFATSAVQLPLVWNIQ  322

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLRHYVY+RL+ KGKKPGFFQLLATQTVSAVWHGLYPGY+IFFVQSALMIAGSR  +
Sbjct  323  VSTWLRHYVYDRLVQKGKKPGFFQLLATQTVSAVWHGLYPGYIIFFVQSALMIAGSRGNH  382

Query  418  R  416
            R
Sbjct  383  R  383



>gb|KDO63566.1| hypothetical protein CISIN_1g012501mg [Citrus sinensis]
Length=387

 Score =   201 bits (510),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 107/117 (91%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIII GLGFSGWTESSPPKP WDRAKNVDILGVE AKS+VQ+PLVWNIQ
Sbjct  260  KYYFIWSISEASIIICGLGFSGWTESSPPKPKWDRAKNVDILGVEFAKSAVQIPLVWNIQ  319

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSR  428
            VSTWLRHYVY+RLI  GKKPGFFQLLATQTVSAVWHGLYPGY+IFFVQSALMIAGSR
Sbjct  320  VSTWLRHYVYDRLIQNGKKPGFFQLLATQTVSAVWHGLYPGYIIFFVQSALMIAGSR  376



>emb|CAA03955.1| unnamed protein product [Hordeum vulgare subsp. vulgare]
Length=135

 Score =   192 bits (487),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = -2

Query  730  GLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQVSTWLRHYVYERLISK  551
            GLGF+GW++SSPPK  WDRA NVDILGVELA S+ QLPL WNIQVSTWLR+YVYERLI K
Sbjct  8    GLGFTGWSDSSPPKAKWDRAINVDILGVELAGSAAQLPLKWNIQVSTWLRYYVYERLIQK  67

Query  550  GKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIYRWQQG  404
            GKKPGF QLL TQTVSA+WHGLYPGYMIFFVQSALMI GS+ IYRWQQ 
Sbjct  68   GKKPGFLQLLGTQTVSAIWHGLYPGYMIFFVQSALMINGSKVIYRWQQA  116



>ref|XP_008364537.1| PREDICTED: lysophospholipid acyltransferase 1-like [Malus domestica]
Length=460

 Score =   197 bits (501),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 107/117 (91%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASII+SGLGFSGWTESSPPKP WDRAKNVDI+GVE AKSSVQLPLVWNIQ
Sbjct  263  KYYFIWSISEASIILSGLGFSGWTESSPPKPGWDRAKNVDIIGVEFAKSSVQLPLVWNIQ  322

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSR  428
            VSTWLRHYVYERL+  GKK GFFQLLATQTVSAVWHGLYPGY+IFFVQSALMIAGSR
Sbjct  323  VSTWLRHYVYERLVKPGKKAGFFQLLATQTVSAVWHGLYPGYIIFFVQSALMIAGSR  379



>gb|EYU29841.1| hypothetical protein MIMGU_mgv1a0059781mg, partial [Erythranthe 
guttata]
Length=133

 Score =   183 bits (464),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = -2

Query  574  VYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIYRWQQGTGN  395
            VYERLI  GKKPGFFQLLATQTVSAVWHGLYPGY+IFFVQSA+MIAGSRAIYRWQQ +  
Sbjct  1    VYERLIQNGKKPGFFQLLATQTVSAVWHGLYPGYIIFFVQSAIMIAGSRAIYRWQQASQT  60

Query  394  AILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPVVLIMLGNIIk  215
             ++K +LAL NF YTL+VLNYS VGF+VLSLHETL AYGSVYY+GTI+P+ +I+LGNIIK
Sbjct  61   PMIKNLLALFNFVYTLVVLNYSSVGFMVLSLHETLVAYGSVYYIGTIIPIAIILLGNIIK  120

Query  214  pakparskarKDQ  176
            PA+ AR KARKDQ
Sbjct  121  PARAARPKARKDQ  133



>emb|CDY64621.1| BnaCnng44390D [Brassica napus]
Length=188

 Score =   174 bits (441),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 97/120 (81%), Positives = 107/120 (89%), Gaps = 1/120 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWT-ESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNI  602
            KYY IWSISEASIIISGLGFSGWT E++  K  WDRAKNVDILGVELAKS+VQ+PLVWNI
Sbjct  40   KYYFIWSISEASIIISGLGFSGWTDENTQTKAKWDRAKNVDILGVELAKSAVQIPLVWNI  99

Query  601  QVSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAI  422
            QVSTWLRHYVYER++  GK  GFF LLATQTVSA+WHGLYPGY+IFFVQSALMI GS+ +
Sbjct  100  QVSTWLRHYVYERIVKPGKTAGFFPLLATQTVSAMWHGLYPGYIIFFVQSALMIDGSKGM  159



>ref|XP_010934444.1| PREDICTED: lysophospholipid acyltransferase 1-like isoform X2 
[Elaeis guineensis]
Length=433

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 108/189 (57%), Positives = 129/189 (68%), Gaps = 34/189 (18%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGF+GW++SS  KP WDRAKNVDILG ELA S+VQLPLVWNIQ
Sbjct  263  KYYFIWSISEASIIISGLGFTGWSDSSHSKPQWDRAKNVDILGGELATSAVQLPLVWNIQ  322

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
            VSTWLR+++   +                      H ++    I            R   
Sbjct  323  VSTWLRYWLVSWI----------------------HDIFCSIGI----------DDRWFT  350

Query  418  RWQQGTG--NAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPV  245
            RWQQ     NA+L+K++A  NFAYTLLVLNYSC+GFLVLS+ ET+AAY SVY+VGTIVP+
Sbjct  351  RWQQAISPKNALLRKMMAFANFAYTLLVLNYSCIGFLVLSMKETVAAYRSVYFVGTIVPI  410

Query  244  VLIMLGNII  218
            VLI+LG+II
Sbjct  411  VLILLGHII  419



>ref|XP_007023110.1| MBOAT (membrane bound O-acyl transferase) family protein isoform 
5 [Theobroma cacao]
 gb|EOY25732.1| MBOAT (membrane bound O-acyl transferase) family protein isoform 
5 [Theobroma cacao]
Length=385

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 91/96 (95%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGFSGWTESSPPKP WDRAKNVDILGVELAKSSV LPLVWNIQ
Sbjct  262  KYYFIWSISEASIIISGLGFSGWTESSPPKPKWDRAKNVDILGVELAKSSVVLPLVWNIQ  321

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWH  491
            VSTWLRHYVYERLI+KG+KPGFFQLLATQTVSAVWH
Sbjct  322  VSTWLRHYVYERLITKGRKPGFFQLLATQTVSAVWH  357



>ref|XP_006440537.1| hypothetical protein CICLE_v10020062mg [Citrus clementina]
 gb|ESR53777.1| hypothetical protein CICLE_v10020062mg [Citrus clementina]
Length=359

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 89/96 (93%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGFSGWTESSPPKP WDRAKNVDILGVE AKS+VQ+PLVWNIQ
Sbjct  260  KYYFIWSISEASIIISGLGFSGWTESSPPKPKWDRAKNVDILGVEFAKSAVQIPLVWNIQ  319

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWH  491
            VSTWLRHYVYERLI  GKKPGFFQLLATQTVSAVWH
Sbjct  320  VSTWLRHYVYERLIQNGKKPGFFQLLATQTVSAVWH  355



>gb|KCW72088.1| hypothetical protein EUGRSUZ_E00532 [Eucalyptus grandis]
Length=388

 Score =   161 bits (407),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIII GLGFSGWTESSPPKP WDRAKNVDILGVE A S+VQLPLVWNIQ
Sbjct  263  KYYFIWSISEASIIIGGLGFSGWTESSPPKPKWDRAKNVDILGVEFATSAVQLPLVWNIQ  322

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWH  491
            VSTWLRHYVY+RL+ KGKKPGFFQLLATQTVSAVWH
Sbjct  323  VSTWLRHYVYDRLVQKGKKPGFFQLLATQTVSAVWH  358



>ref|XP_002500677.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO61935.1| predicted protein [Micromonas sp. RCC299]
Length=494

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 118/185 (64%), Gaps = 1/185 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KY+  W  +EA+ + +G+GFSG+   S   P W    NV  +GVE A + V++P  WN+Q
Sbjct  274  KYFFCWVWAEAACVAAGIGFSGYDHESG-APTWSGCTNVRPMGVEKAATFVEIPHHWNVQ  332

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
              TWLRHYVY+R   +GKKPGF Q+L TQ VS VWHGLY GY +FFV SA+ + GS++++
Sbjct  333  TGTWLRHYVYDRTTPRGKKPGFKQILITQVVSGVWHGLYAGYWLFFVSSAVFLQGSKSMF  392

Query  418  RWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPVVL  239
            RWQ+         ++   ++  T + LNY C  F++++  + +AA+GSVY++   + + +
Sbjct  393  RWQRAHWPRRWNFLIDFPHWLLTTVGLNYLCGAFMLVTYEQCMAAWGSVYFIPHWIVLFM  452

Query  238  IMLGN  224
            ++ G 
Sbjct  453  LVFGE  457



>ref|XP_003064354.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH51259.1| predicted protein [Micromonas pusilla CCMP1545]
Length=497

 Score =   149 bits (377),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 82/197 (42%), Positives = 120/197 (61%), Gaps = 10/197 (5%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPL-------WDRAKNVDILGVELAKSSVQL  620
            KY+  W  +EA+ + SG+GFSG  E      +       W+  KNV  +GVE A + VQ+
Sbjct  269  KYFFCWVWAEAACVASGIGFSGHEEKKGAGEVATTRVATWETGKNVRPMGVETAATFVQI  328

Query  619  PLVWNIQVSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMI  440
            P  WNIQ   WLRHYVY+R    GKKPGF QLL TQTVS VWHGLY GY +FFV SA+ I
Sbjct  329  PHHWNIQTGKWLRHYVYDRSTPAGKKPGFRQLLLTQTVSGVWHGLYAGYWLFFVSSAVFI  388

Query  439  AGSRAIYRWQQGT---GNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVY  269
             GS+++YRWQ        A    +++L ++    + LNY C  F++++  + + A+ SVY
Sbjct  389  EGSKSVYRWQSKHWLFSRAPASWLISLPHWLLATVGLNYLCGAFMLVTFRQCVDAWASVY  448

Query  268  YVGTIVPVVLIMLGNII  218
            ++  ++ V +++ G ++
Sbjct  449  FLPHLIIVAMVIFGRVV  465



>ref|XP_001422221.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP00538.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=402

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/187 (40%), Positives = 116/187 (62%), Gaps = 2/187 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY +W +++ +  +SGLGFSG+      K  WD A N+  +GVE + +   +PL WN++
Sbjct  207  KYYFVWMMADFAATVSGLGFSGYDAMG--KARWDTAANIYPIGVEKSVTLNAIPLSWNVK  264

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
               WLRHYVY+R+  KGKKPG  Q+L TQ VS VWHGL+ GY +FFV SA  +   R +Y
Sbjct  265  TGLWLRHYVYDRVTPKGKKPGLLQILITQIVSGVWHGLHAGYWLFFVSSAFAVNAGRLMY  324

Query  418  RWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPVVL  239
            RW+Q       + ++ +  +A+T + LNY C  F+++ L + + ++ S++Y G +   VL
Sbjct  325  RWKQTRVPEKYRVLVDVPLWAFTHVALNYMCAAFILVDLKQCIQSWSSMHYFGHVGIAVL  384

Query  238  IMLGNII  218
            ++ G + 
Sbjct  385  LVFGAVF  391



>ref|XP_005649636.1| membrane bound O-acyl transferase family protein [Coccomyxa subellipsoidea 
C-169]
 gb|EIE25092.1| membrane bound O-acyl transferase family protein [Coccomyxa subellipsoidea 
C-169]
Length=499

 Score =   132 bits (333),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 77/190 (41%), Positives = 113/190 (59%), Gaps = 6/190 (3%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY  W++SEA +I SG  F+G+++    +  WDR  N  I  VE   S+ +LP  WN  
Sbjct  274  KYYFAWAVSEAGLIFSGFCFNGFSDKGEAR--WDRYANTRIRKVEFGTSAAELPAHWNTC  331

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
               +LR YVYERL  +GKK  F  LL TQ VS +WHGL+ GY++FF  SA +   ++ IY
Sbjct  332  TGNFLRRYVYERLTPRGKKATFKTLLVTQLVSGIWHGLFAGYVLFFASSAFLFESAKVIY  391

Query  418  RWQQGTGN--AILKKI--LALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIV  251
            R++QG G     L+    L  + F YT  VLNYS V FL+L    ++ A+ SV+++G  +
Sbjct  392  RYEQGLGRRWDFLRTFPPLLFIKFLYTGFVLNYSAVAFLLLDFSVSMKAWKSVHFLGHFL  451

Query  250  PVVLIMLGNI  221
             + +I++  +
Sbjct  452  MLAIILVSMV  461



>emb|CDY57972.1| BnaC03g74130D [Brassica napus]
Length=426

 Score =   132 bits (331),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 75/105 (71%), Gaps = 19/105 (18%)
 Frame = -2

Query  730  GLGFSGWT-ESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQVSTWLRHYVYERLIS  554
            GLGFSGWT E++  K  WD AKNVDIL                  VSTWLRHYVYER++ 
Sbjct  154  GLGFSGWTDENTQTKAKWDLAKNVDIL------------------VSTWLRHYVYERIVK  195

Query  553  KGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
             GKK GFFQLLATQTVSAVWHGLYPGY+I FVQSALMI GS+A Y
Sbjct  196  HGKKAGFFQLLATQTVSAVWHGLYPGYIICFVQSALMIDGSKAKY  240



>ref|XP_003084126.1| Predicted membrane protein (ISS) [Ostreococcus tauri]
 emb|CAL58542.1| Membrane bound O-acyl transferase, MBOAT [Ostreococcus tauri]
Length=475

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 71/184 (39%), Positives = 107/184 (58%), Gaps = 2/184 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY +W +++ +  +SGLGFSG+      +  +D A N+  LG E A +    PL WN++
Sbjct  281  KYYFVWMMADFAATVSGLGFSGYDAKGVAR--FDTAANIHPLGCERAITLNSFPLSWNVK  338

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
               WLRHYVY+R+  KGKKPG  QLL TQ VS +WHGLY GY +FFV SA  +   R +Y
Sbjct  339  TGQWLRHYVYDRVTPKGKKPGLLQLLITQIVSGLWHGLYAGYWLFFVSSAFALNAGRLMY  398

Query  418  RWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPVVL  239
            RW+       L+  + +  +  T + +NY    F+++     + A+ SV+Y+  +  VV+
Sbjct  399  RWRSRRVPESLRIFVDVPLWLATQMTINYLVSAFMLVEYKSCMDAWASVHYIAHVGIVVM  458

Query  238  IMLG  227
             + G
Sbjct  459  SVFG  462



>ref|XP_005850438.1| hypothetical protein CHLNCDRAFT_20761 [Chlorella variabilis]
 gb|EFN58336.1| hypothetical protein CHLNCDRAFT_20761 [Chlorella variabilis]
Length=485

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/163 (40%), Positives = 95/163 (58%), Gaps = 2/163 (1%)
 Frame = -2

Query  709  TESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQVSTWLRHYVYERLISKGKKPGFF  530
            T   P +PLW+R  N  I  VE   S   L   WN+    WLRHYVYERL   GK+P F 
Sbjct  305  TAHMPGRPLWNRYINSRIRRVEFNASLPNLAANWNVCTGLWLRHYVYERLTPVGKRPTFG  364

Query  529  QLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIYRWQQGTGNAILKK--ILALMNFA  356
             L+ TQ VS VWHGL+PGY +FF  +A+M    + +YR  + +  A ++   +  L    
Sbjct  365  TLVTTQLVSGVWHGLFPGYWLFFATTAIMFEAGKTLYRRYEQSWPAAVRTFPVWVLAKLV  424

Query  355  YTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPVVLIMLG  227
            +  ++LNY+   F+VL LH+ L+ + SVY++G I  + +I++G
Sbjct  425  FNAIILNYAASSFIVLWLHDCLSIWRSVYFLGHISTLAIILVG  467



>ref|XP_002950776.1| hypothetical protein VOLCADRAFT_120919 [Volvox carteri f. nagariensis]
 gb|EFJ48091.1| hypothetical protein VOLCADRAFT_120919 [Volvox carteri f. nagariensis]
Length=625

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 114/188 (61%), Gaps = 2/188 (1%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            +YY  W I+EAS + +GL F G+  ++  +  W R +N   LGV LA S+  +PL WNI 
Sbjct  308  RYYFSWKITEASYVFAGLDFMGYDPATG-EAQWGRCRNCSFLGVWLADSARNVPLNWNIC  366

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
               +LR YVYER+  + +KPGF  LL TQ VSA+WHGLYPGY++FFV +A+ I  S+ +Y
Sbjct  367  TGNFLRRYVYERVAPRNRKPGFQSLLFTQLVSAIWHGLYPGYLMFFVGTAVWIFFSQIVY  426

Query  418  RWQQGTGNAILKKIL-ALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPVV  242
            + +      + K +L   +   +T+ VLNY    F +L    ++ AY SV Y   IV VV
Sbjct  427  KTEAYLPAVVRKHLLYRAIKIIWTVFVLNYMACAFQLLDYKSSMEAYASVNYFPFIVMVV  486

Query  241  LIMLGNII  218
            + +LG+ +
Sbjct  487  VNVLGSFV  494



>gb|KDD76279.1| membrane-bound O-acyltransferase [Helicosporidium sp. ATCC 50920]
Length=522

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 75/191 (39%), Positives = 110/191 (58%), Gaps = 8/191 (4%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY  W ++EA +I SG  F+GW E    +PLW+R  N  +  VE   S  ++   WN++
Sbjct  280  KYYFAWGVAEAGLIASGQDFAGW-EPETGRPLWNRYVNARVRRVEFQASLAKIVADWNVR  338

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
               WLRHYVYER    G +PG + L+ TQTVS VWHGL+PGY  FF+ SALMI  S+ +Y
Sbjct  339  TGVWLRHYVYERATPAGDRPGLWTLVLTQTVSGVWHGLFPGYWGFFLTSALMIEMSKVLY  398

Query  418  RWQQGTGNAILK----KILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIV  251
            R++QG  + +      +IL  +  +Y   VLNYS + F VL        +  + + G  +
Sbjct  399  RYEQGWSSRLRDGMPWRILQALISSY---VLNYSAMAFAVLRWDAMWRVWRELAFTGHAI  455

Query  250  PVVLIMLGNII  218
               +++LG ++
Sbjct  456  IFGILLLGVVL  466



>ref|XP_007021531.1| MBOAT (membrane bound O-acyl transferase) family protein [Theobroma 
cacao]
 gb|EOY13056.1| MBOAT (membrane bound O-acyl transferase) family protein [Theobroma 
cacao]
Length=104

 Score =   110 bits (276),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = -2

Query  457  QSALMIAGSRAIYRWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYG  278
              ALMIAGS  IYRW+Q T  A++KK    MNFAYTLLVLNYS VGF+VL++HETLA+YG
Sbjct  12   SKALMIAGSIVIYRWEQATNMALVKKAFVFMNFAYTLLVLNYSAVGFMVLNMHETLASYG  71

Query  277  SVYYVGTIVPVVLIMLGNII  218
             VYY+G IVP+ L++LG II
Sbjct  72   CVYYIGIIVPIALLLLGYII  91



>gb|KIY98914.1| hypothetical protein MNEG_9048 [Monoraphidium neglectum]
Length=529

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 75/190 (39%), Positives = 102/190 (54%), Gaps = 6/190 (3%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            +YY  WS   AS+  +G  F  W +    + +W R  N   L VE   S   L   WNI 
Sbjct  264  RYYFAWSNGWASLAFAGFDFLQWDDKG--RAVWGRGCNSRPLKVEFCDSGRVLAAHWNIS  321

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
               +LR YVYERL     KP FF L+ATQ VSA+WHGLYPGY +FFV SA + A S   Y
Sbjct  322  TGMFLRRYVYERLTPPNGKPTFFTLVATQLVSALWHGLYPGYFLFFVGSAFLFAHSTVTY  381

Query  418  RWQQGTGNAILKKILALMNFAYTLLV----LNYSCVGFLVLSLHETLAAYGSVYYVGTIV  251
             W++   + +   + +L  +A  + +    L++    FLVL+  E L A+ SVYY+  I 
Sbjct  382  HWEKQAPSWLQPVVKSLPFWAVKVFITKQCLDFLASAFLVLTWRECLVAWASVYYIPLIW  441

Query  250  PVVLIMLGNI  221
             V ++ LG I
Sbjct  442  MVGVLALGQI  451



>gb|KHG30541.1| Lysophospholipid acyltransferase 7 [Gossypium arboreum]
Length=91

 Score =   109 bits (273),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 67/78 (86%), Gaps = 2/78 (3%)
 Frame = -2

Query  445  MIAGSRAIYRWQQG--TGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSV  272
            MIAGSR IY+W++   T  A++KK  A+MNFAYT+LVLNYSCVGF++LS HETLA+YGSV
Sbjct  1    MIAGSRVIYQWEKAIPTNMALVKKAFAVMNFAYTVLVLNYSCVGFMLLSKHETLASYGSV  60

Query  271  YYVGTIVPVVLIMLGNII  218
            YY+GT++P+ LI+LG II
Sbjct  61   YYIGTLIPIALIILGYII  78



>ref|XP_009850699.1| hypothetical protein NEUTE1DRAFT_100500 [Neurospora tetrasperma 
FGSC 2508]
 gb|EGO57598.1| hypothetical protein NEUTE1DRAFT_100500 [Neurospora tetrasperma 
FGSC 2508]
Length=593

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 72/182 (40%), Positives = 106/182 (58%), Gaps = 8/182 (4%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY +W ++E + I+SGLGF+G  + +  K  WDR +N+  +G+E A+++      WNI 
Sbjct  271  KYYGVWMMTEGACILSGLGFNG-VDPATGKVSWDRLQNIRPMGMETAQNTKAYLDNWNIN  329

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
             S WLR+YVY R+  +GKKPGF   LAT T SA WHG YPGY + FV ++ + A ++ + 
Sbjct  330  TSKWLRNYVYLRVTPRGKKPGFGATLATFTTSAFWHGFYPGYYLSFVLASFIQAAAKNVR  389

Query  418  R-----WQQGTGNAIL--KKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVG  260
            R     +      A L  KK   L ++  T L  N++   FLVL  HE++ A+  VY+  
Sbjct  390  RNIRPFFLDPKTQAPLPSKKWYDLASWLTTQLTFNFAVCPFLVLGFHESITAWSRVYFYA  449

Query  259  TI  254
             I
Sbjct  450  II  451



>gb|AIC75358.1| NCU06194-like protein [Neurospora crassa]
Length=603

 Score =   113 bits (282),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 72/182 (40%), Positives = 106/182 (58%), Gaps = 8/182 (4%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY +W ++E + I+SGLGF+G  + +  K  WDR +N+  +G+E A+++      WNI 
Sbjct  281  KYYGVWMMTEGACILSGLGFNG-VDPATGKVSWDRLQNIRPMGMETAQNTKAYLDNWNIN  339

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
             S WLR+YVY R+  +GKKPGF   LAT T SA WHG YPGY + FV ++ + A ++ + 
Sbjct  340  TSKWLRNYVYLRVTPRGKKPGFGATLATFTTSAFWHGFYPGYYLSFVLASFIQAAAKNVR  399

Query  418  R-----WQQGTGNAIL--KKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVG  260
            R     +      A L  KK   L ++  T L  N++   FLVL  HE++ A+  VY+  
Sbjct  400  RNIRPFFLDPKTQAPLPSKKWYDLASWLTTQLTFNFAVCPFLVLGFHESITAWSRVYFYA  459

Query  259  TI  254
             I
Sbjct  460  II  461



>ref|XP_963006.2| MBOAT family protein [Neurospora crassa OR74A]
 gb|EAA33770.2| MBOAT family protein [Neurospora crassa OR74A]
 gb|KHE87018.1| MBOAT-domain-containing protein [Neurospora crassa]
Length=603

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 72/182 (40%), Positives = 106/182 (58%), Gaps = 8/182 (4%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY +W ++E + I+SGLGF+G  + +  K  WDR +N+  +G+E A+++      WNI 
Sbjct  281  KYYGVWMMTEGACILSGLGFNG-VDPATGKVSWDRLQNIRPMGMETAQNTKAYLDNWNIN  339

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
             S WLR+YVY R+  +GKKPGF   LAT T SA WHG YPGY + FV ++ + A ++ + 
Sbjct  340  TSKWLRNYVYLRVTPRGKKPGFGATLATFTTSAFWHGFYPGYYLSFVLASFIQAAAKNVR  399

Query  418  R-----WQQGTGNAIL--KKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVG  260
            R     +      A L  KK   L ++  T L  N++   FLVL  HE++ A+  VY+  
Sbjct  400  RNIRPFFLDPKTQAPLPSKKWYDLASWLTTQLTFNFAVCPFLVLGFHESITAWSRVYFYA  459

Query  259  TI  254
             I
Sbjct  460  II  461



>gb|EGZ72137.1| MBOAT-domain-containing protein [Neurospora tetrasperma FGSC 
2509]
Length=603

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 72/182 (40%), Positives = 106/182 (58%), Gaps = 8/182 (4%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY +W ++E + I+SGLGF+G  + +  K  WDR +N+  +G+E A+++      WNI 
Sbjct  281  KYYGVWMMTEGACILSGLGFNG-VDPATGKVSWDRLQNIRPMGMETAQNTKAYLDNWNIN  339

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
             S WLR+YVY R+  +GKKPGF   LAT T SA WHG YPGY + FV ++ + A ++ + 
Sbjct  340  TSKWLRNYVYLRVTPRGKKPGFGATLATFTTSAFWHGFYPGYYLSFVLASFIQAAAKNVR  399

Query  418  R-----WQQGTGNAIL--KKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVG  260
            R     +      A L  KK   L ++  T L  N++   FLVL  HE++ A+  VY+  
Sbjct  400  RNIRPFFLDPKTQAPLPSKKWYDLASWLTTQLTFNFAVCPFLVLGFHESITAWSRVYFYA  459

Query  259  TI  254
             I
Sbjct  460  II  461



>ref|XP_003346472.1| hypothetical protein SMAC_05367 [Sordaria macrospora k-hell]
Length=592

 Score =   108 bits (270),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 71/188 (38%), Positives = 106/188 (56%), Gaps = 8/188 (4%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY +W ++E + I+SGLGF+G  + +  K  WDR +N+  + +E A+++      WNI 
Sbjct  266  KYYGVWMMTEGACILSGLGFNG-VDPATGKVSWDRLQNIRPVSMETAQNTKAYLDNWNIN  324

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
             S WLR+YVY R+  +GKKPGF   LAT T SA WHG YPGY + FV ++ + A ++ + 
Sbjct  325  TSKWLRNYVYFRVTPRGKKPGFSATLATFTTSAFWHGFYPGYYMSFVLASFIQAAAKNMR  384

Query  418  R------WQQGTGNAI-LKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVG  260
            R          T   +  KK   L ++  T L  N++   FLVL  HE++ A+  VY+  
Sbjct  385  RNVRPFFLDPKTQTPLPSKKWYDLASWLITQLTFNFAVCPFLVLGFHESVTAWSRVYFYA  444

Query  259  TIVPVVLI  236
             I   V +
Sbjct  445  IIHTAVAL  452



>ref|XP_003655647.1| hypothetical protein THITE_2119570 [Thielavia terrestris NRRL 
8126]
 gb|AEO69311.1| hypothetical protein THITE_2119570 [Thielavia terrestris NRRL 
8126]
Length=569

 Score =   108 bits (269),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 71/188 (38%), Positives = 109/188 (58%), Gaps = 8/188 (4%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY +W +SE + I++GLG++G  +++  K  WDR +N+D  GVELA+++      WNI 
Sbjct  281  KYYGVWMMSEGACILAGLGYNG-VDAATGKVSWDRLQNIDPWGVELAQNTRGYLEAWNIN  339

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
             + WLR+YVY R+  +GKKPGF   LAT T SA WHG YPGY + FV ++ +   ++ + 
Sbjct  340  TNKWLRNYVYLRVTPRGKKPGFRASLATFTTSAFWHGFYPGYYLSFVLASFIQTVAKNMR  399

Query  418  R------WQQGTGNAI-LKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVG  260
            R          TG  +  KK   L ++  T L  +++   FL+LSL  +L  +  VY+ G
Sbjct  400  RNFRPFFLDPKTGAPLPSKKYYDLASWLTTQLTFSFAAAPFLILSLSGSLQVWARVYFYG  459

Query  259  TIVPVVLI  236
             +    L+
Sbjct  460  VLGTAALM  467



>emb|CCC12295.1| unnamed protein product [Sordaria macrospora k-hell]
Length=607

 Score =   108 bits (269),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 70/182 (38%), Positives = 104/182 (57%), Gaps = 8/182 (4%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY +W ++E + I+SGLGF+G  + +  K  WDR +N+  + +E A+++      WNI 
Sbjct  281  KYYGVWMMTEGACILSGLGFNG-VDPATGKVSWDRLQNIRPVSMETAQNTKAYLDNWNIN  339

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
             S WLR+YVY R+  +GKKPGF   LAT T SA WHG YPGY + FV ++ + A ++ + 
Sbjct  340  TSKWLRNYVYFRVTPRGKKPGFSATLATFTTSAFWHGFYPGYYMSFVLASFIQAAAKNMR  399

Query  418  R------WQQGTGNAI-LKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVG  260
            R          T   +  KK   L ++  T L  N++   FLVL  HE++ A+  VY+  
Sbjct  400  RNVRPFFLDPKTQTPLPSKKWYDLASWLITQLTFNFAVCPFLVLGFHESVTAWSRVYFYA  459

Query  259  TI  254
             I
Sbjct  460  II  461



>gb|EXX59759.1| Ale1p [Rhizophagus irregularis DAOM 197198w]
Length=518

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 64/184 (35%), Positives = 104/184 (57%), Gaps = 6/184 (3%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY +W ++E + I+SGLGF+G+ +    K  W+R  NVDI+  E A +   L   WN+ 
Sbjct  272  KYYIVWLLAEGACILSGLGFNGYDDHGNAK--WNRVTNVDIIAYETADNIKSLLDTWNMN  329

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
             + WL++YVY R+   GKKP FF  +AT   SA+WHG YPGY + F+  A + +  R + 
Sbjct  330  TNKWLKNYVYLRVTPPGKKPNFFSTIATFGTSAIWHGFYPGYYLTFISGAFVQSVHRTLR  389

Query  418  RWQQ----GTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIV  251
            R  +        + LK +     + +T  +++Y  + F +LSL  TL  + S+Y+ G + 
Sbjct  390  RNIRPIFLTPKFSSLKPLYDFFGWLFTQTMIHYVVIPFNILSLRNTLTIWKSLYFYGHVA  449

Query  250  PVVL  239
             +++
Sbjct  450  IILV  453



>gb|ESA24244.1| hypothetical protein GLOINDRAFT_100689 [Rhizophagus irregularis 
DAOM 181602]
Length=544

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 64/184 (35%), Positives = 104/184 (57%), Gaps = 6/184 (3%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY +W ++E + I+SGLGF+G+ +    K  W+R  NVDI+  E A +   L   WN+ 
Sbjct  298  KYYIVWLLAEGACILSGLGFNGYDDHGNAK--WNRVTNVDIIAYETADNIKSLLDTWNMN  355

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
             + WL++YVY R+   GKKP FF  +AT   SA+WHG YPGY + F+  A + +  R + 
Sbjct  356  TNKWLKNYVYLRVTPPGKKPNFFSTIATFGTSAIWHGFYPGYYLTFISGAFVQSVHRTLR  415

Query  418  RWQQ----GTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIV  251
            R  +        + LK +     + +T  +++Y  + F +LSL  TL  + S+Y+ G + 
Sbjct  416  RNIRPIFLTPKFSSLKPLYDFFGWLFTQTMIHYVVIPFNILSLRNTLTIWKSLYFYGHVA  475

Query  250  PVVL  239
             +++
Sbjct  476  IILV  479



>ref|XP_011398849.1| Membrane-bound O-acyltransferase domain-containing protein 2 
[Auxenochlorella protothecoides]
 gb|KFM25953.1| Membrane-bound O-acyltransferase domain-containing protein 2 
[Auxenochlorella protothecoides]
Length=456

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 73/190 (38%), Positives = 107/190 (56%), Gaps = 7/190 (4%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY +WS++EA +I+SG  +SG ++    +  W R  N  I  VE       L   WNI 
Sbjct  231  KYYFVWSVAEAGLIMSGQCYSGLSQKG--RASWGRFVNTRIRAVEFQPYMSALAGNWNIC  288

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
               +LRH+VY+RL  KG++P     LATQ  S VWHGL+PGY  FF  SALM   S+ +Y
Sbjct  289  TGKFLRHHVYDRLTPKGRRPTVVTTLATQLTSGVWHGLFPGYWAFFATSALMFEASKVMY  348

Query  418  RWQQG---TGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVP  248
            R++QG      +      A M  A T  VLNY+ + FLVL+  +T   + SV + G  + 
Sbjct  349  RYEQGWPVWARSFWPWQAAKM--ALTSCVLNYAAMSFLVLTWQDTWNLWRSVGFYGHGLV  406

Query  247  VVLIMLGNII  218
            + ++++G ++
Sbjct  407  LAIMLVGAVL  416



>ref|XP_001229385.1| hypothetical protein CHGG_02869 [Chaetomium globosum CBS 148.51]
 gb|EAQ90934.1| hypothetical protein CHGG_02869 [Chaetomium globosum CBS 148.51]
Length=502

 Score =   105 bits (261),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 67/182 (37%), Positives = 107/182 (59%), Gaps = 8/182 (4%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY +W++SE + I++GLG++G  +    K  WDR +N+D  GVE A+++      WNI 
Sbjct  234  KYYGVWTLSEGACILAGLGYNG-VDPVTGKVSWDRLQNIDPWGVEFAQNTRGYLESWNIN  292

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
             + WLR+Y+Y R+  +GKKPGF   LAT T SA WHG YPGY + FV ++ +   ++ + 
Sbjct  293  TNKWLRNYIYLRVTPRGKKPGFRASLATFTTSAFWHGFYPGYYLSFVLASFIQTTAKNMR  352

Query  418  RW------QQGTGNAI-LKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVG  260
            R          TG A+  KK+  ++++  T L  +++   FL+LS  ++  A+  VY+  
Sbjct  353  RNFRPFFVDPKTGAALPSKKLYDVVSWLTTQLTFSFAVAPFLILSFSDSWTAWSRVYFYA  412

Query  259  TI  254
             I
Sbjct  413  II  414



>dbj|BAJ34298.1| unnamed protein product [Thellungiella halophila]
Length=339

 Score =   103 bits (256),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGFSGWT+ + PKP WDRAKNVDILGVELAKS+VQ+PLVWNIQ
Sbjct  264  KYYFIWSISEASIIISGLGFSGWTDDASPKPKWDRAKNVDILGVELAKSAVQIPLVWNIQ  323

Query  598  VSTWLRHYVY  569
            VSTWLRH  Y
Sbjct  324  VSTWLRHCKY  333



>ref|XP_007511041.1| predicted protein [Bathycoccus prasinos]
 emb|CCO66601.1| predicted protein [Bathycoccus prasinos]
Length=556

 Score =   105 bits (261),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 68/201 (34%), Positives = 104/201 (52%), Gaps = 15/201 (7%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGW------TESSPPKPLWDRAKNVDILGVELAKSSVQLP  617
            KYY +W  ++AS    GL ++G       T    P+  W+   NV   GV+ A +  ++P
Sbjct  339  KYYFVWMFADASAAACGLAYNGINAEKSITGREGPEE-WNAMTNVHPFGVDFANTFAEIP  397

Query  616  LVWNIQVSTWLRHYVYERLI--------SKGKKPGFFQLLATQTVSAVWHGLYPGYMIFF  461
              WNI+   WLRHY Y+R+          K +K G  +LL TQ VS +WHGL  GY +FF
Sbjct  398  AHWNIRTGIWLRHYCYDRIHRFRVRRSGDKNRKAGLVELLLTQLVSGIWHGLSAGYWMFF  457

Query  460  VQSALMIAGSRAIYRWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAY  281
              +AL+I  +R  Y+WQ+   +    K   L + A T L L Y    F ++   E++ A+
Sbjct  458  SSTALIIYCARKTYKWQRDYMSERFVKYWKLFSLAQTHLGLLYLTPAFHLVEFKESVRAW  517

Query  280  GSVYYVGTIVPVVLIMLGNII  218
              +Y+   ++ V LI L ++I
Sbjct  518  NGMYWFIHVLSVALIALTSLI  538



>ref|XP_003662929.1| hypothetical protein MYCTH_2304133 [Myceliophthora thermophila 
ATCC 42464]
 gb|AEO57684.1| hypothetical protein MYCTH_2304133 [Myceliophthora thermophila 
ATCC 42464]
Length=547

 Score =   105 bits (261),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 69/182 (38%), Positives = 106/182 (58%), Gaps = 8/182 (4%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY +W++SE + I++GLG++G  +    K  WDR KN+D  GVE A+++      WNI 
Sbjct  281  KYYGVWTMSEGACILAGLGYNG-VDPLTGKVSWDRLKNIDPWGVEFAQNTRGYLEAWNIN  339

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
             + WLR+YVY R+  +GKKPGF   LAT T SA WHG YPGY + FV ++ +   ++ + 
Sbjct  340  TNKWLRNYVYLRVTPRGKKPGFRASLATFTTSAFWHGFYPGYYLSFVLASFIQTVAKNMR  399

Query  418  R------WQQGTGNAI-LKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVG  260
            R          TG  +  KK   + ++  T L  +++ V FL+LS  ++L A+  +Y+  
Sbjct  400  RNFRPFFLDPKTGADLPSKKYYDVASWLTTQLTFSFAVVPFLILSFSDSLLAWSRLYFYA  459

Query  259  TI  254
             I
Sbjct  460  II  461



>dbj|GAM40820.1| membrane bound O-acyltransferase [Talaromyces cellulolyticus]
Length=553

 Score =   105 bits (261),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 65/182 (36%), Positives = 106/182 (58%), Gaps = 8/182 (4%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY  W ++E + I+SGLG++G+ ++   K  WDR +NV+  G+E A+++      WN  
Sbjct  283  KYYGSWYLTEGACILSGLGYNGF-DAKTGKVFWDRLENVNPWGLETAQNTRGYLENWNKN  341

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
             + WLR+YVY R+  KGKKPGF   LAT T SA WHG YPGY + F+ ++ +   ++   
Sbjct  342  TNHWLRNYVYLRVTPKGKKPGFRATLATFTTSAFWHGFYPGYYMAFILASFVQTVAKNFR  401

Query  418  RW-------QQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVG  260
            R          G+    LK    ++++  T L+++++   F++LS   T+A +G VY+ G
Sbjct  402  RHVRPFFLSPDGSKPTALKPYYDVVSWFVTQLIMSFTVAPFVLLSFKGTIAVWGHVYFYG  461

Query  259  TI  254
             +
Sbjct  462  IV  463



>emb|CCK72954.1| hypothetical protein KNAG_0M01010 [Kazachstania naganishii CBS 
8797]
Length=631

 Score =   105 bits (262),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 71/190 (37%), Positives = 102/190 (54%), Gaps = 8/190 (4%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY  W+I+E + I+ GLG++G+ ++   K  W+R +N+DI  VE+A+S+ Q    WN+ 
Sbjct  293  KYYAAWTIAEGACILCGLGYNGY-DAKTKKIKWNRVQNIDIWNVEMAQSTRQCLEAWNMN  351

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSAL-MIAGS---  431
             + WL++YVY R+  KGKKPGF   L T T SA WHG+ PGY + F   AL    G    
Sbjct  352  TNKWLKYYVYLRVTKKGKKPGFRSTLFTFTTSAFWHGVNPGYYLTFGTGALYQTCGKFYR  411

Query  430  ---RAIYRWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVG  260
               R ++    G      K I  L+      L   Y    FLVL   +++ A+ SVY+ G
Sbjct  412  RNFRPMFLKADGKTPTRAKWIYDLLGSYVIKLSFGYLVQPFLVLGFRDSIQAWKSVYFYG  471

Query  259  TIVPVVLIML  230
             I+  V   L
Sbjct  472  HIIVAVSFFL  481



>ref|XP_006959253.1| MBOAT-domain-containing protein [Wallemia sebi CBS 633.66]
 gb|EIM20720.1| MBOAT-domain-containing protein [Wallemia sebi CBS 633.66]
Length=547

 Score =   104 bits (260),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 109/183 (60%), Gaps = 8/183 (4%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY +WSISE + IISGLGF+G+ E +  +  WDR +N+D+LGVELA++  +L   WN+ 
Sbjct  269  KYYAVWSISEGACIISGLGFNGYNEKNG-RTRWDRVRNIDVLGVELAQNVKELLDAWNMN  327

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
             + WLR  VY+R+ +KGKKPGF   L T   SA WHGL  GY + F+    + A  + + 
Sbjct  328  TNVWLRSCVYKRVTTKGKKPGFQSTLITFVTSAFWHGLPMGYYLTFIYGGFLQALGKLVR  387

Query  418  RWQQ----GTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIV  251
            +  +     T    L  +L+++    T +++N++ + F++L    +L  + SV   G IV
Sbjct  388  KNIRPFFIDTSKKPLYDVLSIVT---TQMLINFAIIPFMLLGFKNSLKGWYSVGGYGIIV  444

Query  250  PVV  242
             +V
Sbjct  445  VIV  447



>gb|KJE00353.1| lysophospholipid acyltransferase [Cryptococcus gattii NT-10]
Length=577

 Score =   105 bits (261),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 62/187 (33%), Positives = 106/187 (57%), Gaps = 9/187 (5%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY +WS+SE + I++G+GF+G+   +  + LW+R +N++I G+E A+S   L   WN +
Sbjct  279  KYYAVWSLSEGACILTGIGFNGYDHKTG-RTLWNRVRNINIKGIETAESFKILFDSWNCR  337

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
             + WLR  VY+R+  KGKKPGF + +AT   SA WHG+ PGY + F    L+ +  R   
Sbjct  338  TNVWLRDVVYKRVTKKGKKPGFKESMATFLTSAFWHGISPGYYLAFFMGGLVTSLGRQFR  397

Query  418  RW--------QQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYV  263
            R+         +     + K++  L+ +     +LNY    FL+L   +++ A+  +Y+ 
Sbjct  398  RYVRPYFLPLSETAQPGLAKRVYDLIGWISVQSILNYLVAPFLLLDFKDSIGAWNRMYWY  457

Query  262  GTIVPVV  242
            G +  ++
Sbjct  458  GHVAVII  464



>ref|XP_002509709.1| o-acyltransferase (membrane bound) domain containing protein, 
putative [Ricinus communis]
 gb|EEF51096.1| o-acyltransferase (membrane bound) domain containing protein, 
putative [Ricinus communis]
Length=338

 Score =   102 bits (255),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEASIIISGLGFSGWT++SPPKP WDRA+NVDILGVE AKS+ +LPLVWNIQ
Sbjct  263  KYYFIWSISEASIIISGLGFSGWTDTSPPKPQWDRARNVDILGVEFAKSAAELPLVWNIQ  322

Query  598  VSTWLRH  578
            VSTWLRH
Sbjct  323  VSTWLRH  329



>ref|XP_003192128.1| member of the MBOAT family of putative membrane-bound O-acyltransferases; 
Yor175cp [Cryptococcus gattii WM276]
 gb|ADV20341.1| Member of the MBOAT family of putative membrane-bound O-acyltransferases, 
putative; Yor175cp [Cryptococcus gattii WM276]
 gb|KIR77118.1| lysophospholipid acyltransferase [Cryptococcus gattii EJB2]
Length=577

 Score =   104 bits (260),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 62/187 (33%), Positives = 106/187 (57%), Gaps = 9/187 (5%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY +WS+SE + I++G+GF+G+   +  + LW+R +N++I G+E A+S   L   WN +
Sbjct  279  KYYAVWSLSEGACILTGIGFNGYDHKTG-RTLWNRVRNINIKGIETAESFKILFDSWNCR  337

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
             + WLR  VY+R+  KGKKPGF + +AT   SA WHG+ PGY + F    L+ +  R   
Sbjct  338  TNVWLRDVVYKRVTKKGKKPGFKESMATFLTSAFWHGISPGYYLAFFMGGLVTSLGRQFR  397

Query  418  RW--------QQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYV  263
            R+         +     + K++  L+ +     +LNY    FL+L   +++ A+  +Y+ 
Sbjct  398  RYVRPYFLPLSETAQPGLAKRVYDLIGWISVQSILNYLVAPFLLLDFKDSIGAWNRMYWY  457

Query  262  GTIVPVV  242
            G +  ++
Sbjct  458  GHVAVII  464



>gb|KIY36135.1| lysophospholipid acyltransferase [Cryptococcus gattii E566]
Length=577

 Score =   104 bits (260),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 62/187 (33%), Positives = 106/187 (57%), Gaps = 9/187 (5%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY +WS+SE + I++G+GF+G+   +  + LW+R +N++I G+E A+S   L   WN +
Sbjct  279  KYYAVWSLSEGACILTGIGFNGYDHKTG-RTLWNRVRNINIKGIETAESFKILFDSWNCR  337

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
             + WLR  VY+R+  KGKKPGF + +AT   SA WHG+ PGY + F    L+ +  R   
Sbjct  338  TNVWLRDVVYKRVTKKGKKPGFKESMATFLTSAFWHGISPGYYLAFFMGGLVTSLGRQFR  397

Query  418  RW--------QQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYV  263
            R+         +     + K++  L+ +     +LNY    FL+L   +++ A+  +Y+ 
Sbjct  398  RYVRPYFLPLSETAQPGLAKRVYDLIGWISVQSILNYLVAPFLLLDFKDSIGAWNRMYWY  457

Query  262  GTIVPVV  242
            G +  ++
Sbjct  458  GHVAVII  464



>gb|KIR67395.1| lysophospholipid acyltransferase [Cryptococcus gattii CA1873]
Length=577

 Score =   104 bits (260),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 62/187 (33%), Positives = 106/187 (57%), Gaps = 9/187 (5%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY +WS+SE + I++G+GF+G+   +  + LW+R +N++I G+E A+S   L   WN +
Sbjct  279  KYYAVWSLSEGACILTGIGFNGYDHKTG-RTLWNRVRNINIKGIETAESFKILFDSWNCR  337

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
             + WLR  VY+R+  KGKKPGF + +AT   SA WHG+ PGY + F    L+ +  R   
Sbjct  338  TNVWLRDVVYKRVTKKGKKPGFKESMATFLTSAFWHGISPGYYLAFFMGGLVTSLGRQFR  397

Query  418  RW--------QQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYV  263
            R+         +     + K++  L+ +     +LNY    FL+L   +++ A+  +Y+ 
Sbjct  398  RYVRPYFLPLSETAQPGLAKRVYDLIGWISVQSILNYLVAPFLLLDFKDSIGAWNRMYWY  457

Query  262  GTIVPVV  242
            G +  ++
Sbjct  458  GHVAVII  464



>gb|KJB68443.1| hypothetical protein B456_010G246400 [Gossypium raimondii]
Length=333

 Score =   102 bits (254),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 60/67 (90%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEA++IISGLGFSGWTESSPPKP WDRAK VDILG ELAKSSV LPLVWNIQ
Sbjct  263  KYYFIWSISEAAMIISGLGFSGWTESSPPKPKWDRAKVVDILGFELAKSSVLLPLVWNIQ  322

Query  598  VSTWLRH  578
            VSTWLRH
Sbjct  323  VSTWLRH  329



>gb|KIR55618.1| lysophospholipid acyltransferase [Cryptococcus gattii Ru294]
Length=577

 Score =   104 bits (260),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 62/187 (33%), Positives = 106/187 (57%), Gaps = 9/187 (5%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY +WS+SE + I++G+GF+G+   +  + LW+R +N++I G+E A+S   L   WN +
Sbjct  279  KYYAVWSLSEGACILTGIGFNGYDHKTG-RTLWNRVRNINIKGIETAESFKILFDSWNCR  337

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
             + WLR  VY+R+  KGKKPGF + +AT   SA WHG+ PGY + F    L+ +  R   
Sbjct  338  TNVWLRDVVYKRVTKKGKKPGFKESMATFLTSAFWHGISPGYYLAFFMGGLVTSLGRQFR  397

Query  418  RW--------QQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYV  263
            R+         +     + K++  L+ +     +LNY    FL+L   +++ A+  +Y+ 
Sbjct  398  RYVRPYFLPLSETAQPGLAKRVYDLIGWISVQSILNYLVAPFLLLDFKDSIGAWNRMYWY  457

Query  262  GTIVPVV  242
            G +  ++
Sbjct  458  GHVAVII  464



>gb|KIR50417.1| lysophospholipid acyltransferase [Cryptococcus gattii CA1280]
Length=577

 Score =   104 bits (259),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 62/187 (33%), Positives = 106/187 (57%), Gaps = 9/187 (5%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY +WS+SE + I++G+GF+G+   +  + LW+R +N++I G+E A+S   L   WN +
Sbjct  279  KYYAVWSLSEGACILTGIGFNGYDHKTG-RTLWNRVRNINIKGIETAESFKILFDSWNCR  337

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
             + WLR  VY+R+  KGKKPGF + +AT   SA WHG+ PGY + F    L+ +  R   
Sbjct  338  TNVWLRDVVYKRVTKKGKKPGFKESMATFLTSAFWHGISPGYYLAFFMGGLVTSLGRQFR  397

Query  418  RW--------QQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYV  263
            R+         +     + K++  L+ +     +LNY    FL+L   +++ A+  +Y+ 
Sbjct  398  RYVRPYFLPLSETAQPGLAKRVYDLIGWISVQSILNYLVAPFLLLDFKDSIGAWNRMYWY  457

Query  262  GTIVPVV  242
            G +  ++
Sbjct  458  GHVAIII  464



>gb|KJB68447.1| hypothetical protein B456_010G246400 [Gossypium raimondii]
Length=429

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEA++IISGLGFSGWTESSPPKP WDRAK VDILG ELAKSSV LPLVWNIQ
Sbjct  263  KYYFIWSISEAAMIISGLGFSGWTESSPPKPKWDRAKVVDILGFELAKSSVLLPLVWNIQ  322

Query  598  VSTWLRHYV  572
            VSTWLRH+ 
Sbjct  323  VSTWLRHWT  331


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 69/126 (55%), Gaps = 4/126 (3%)
 Frame = -1

Query  563  AYQQGQETWFLPVTGNADCQCCMA-WLISRVYDFLCTIRSDDCRFKSHLQMAARYWKCYP  387
             ++  + +  LP+  N      +  W +S V+  LC+I  DDC FKS+L M   Y   Y 
Sbjct  305  GFELAKSSVLLPLVWNIQVSTWLRHWTVSWVHHILCSISFDDCWFKSYLPMGKSYTHKYG  364

Query  386  *EDPSI--DELRLHPFGSQLLVCWFLGIESP*NTCCIRERVLCWNDCAGCVDHAREHH*T  213
              + SI  DEL LH FGS+LL+C   GI+   +TC I E VL WN  +  +D+   H+ T
Sbjct  365  SCEESICRDELCLHTFGSELLLCRLYGIKQARDTCIIWECVLYWNHHSDSIDYLGLHN-T  423

Query  212  SKTCEI  195
             KTC++
Sbjct  424  CKTCQV  429



>gb|AAB47420.1| O3635p, partial [Saccharomyces cerevisiae]
Length=350

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 73/191 (38%), Positives = 100/191 (52%), Gaps = 9/191 (5%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY  W+ISE S I+ GLG++G+ +S   K  WDR +N+DI  VE A+++ ++   WN+ 
Sbjct  19   KYYAAWTISEGSCILCGLGYNGY-DSKTQKIRWDRVRNIDIWTVETAQNTREMLEAWNMN  77

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSAL-MIAGS---  431
             + WL++ VY R+  KGKKPGF   L T   SA WHG  PGY + F   AL    G    
Sbjct  78   TNKWLKYSVYLRVTKKGKKPGFRSTLFTFLTSAFWHGTRPGYYLTFATGALYQTCGKIYR  137

Query  430  ---RAIYRWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVY-YV  263
               R I+  + G      KKI  L+      L   Y    F++L L  +L  +GSVY YV
Sbjct  138  RNFRPIFLREDGVTPLPSKKIYDLVGIYAIKLAFGYMVQPFIILDLKPSLMVWGSVYFYV  197

Query  262  GTIVPVVLIML  230
              IV     + 
Sbjct  198  HIIVAFSFFLF  208



>gb|EME43207.1| hypothetical protein DOTSEDRAFT_72556 [Dothistroma septosporum 
NZE10]
Length=563

 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 66/183 (36%), Positives = 104/183 (57%), Gaps = 8/183 (4%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY +W+++E S I++G+G+ G   S   KP W R  N++ LGVELA++S      WNI 
Sbjct  280  KYYGVWTLTEGSCILAGIGYKG-VNSKTGKPDWSRLTNINPLGVELAQNSHAYLGNWNIN  338

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALM---IAGSR  428
             + WLR+Y+Y R+  KGKKPGF   +AT   SA WHG  PGY + FV ++ +      SR
Sbjct  339  TNHWLRNYMYLRVTPKGKKPGFRASMATFVTSAFWHGFAPGYYMAFVLASFIQNVAKNSR  398

Query  427  AIYR----WQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVG  260
             + R       GT  A  K+    + +  T L+ +++   F++L++H++   +  VY+ G
Sbjct  399  RLLRPLFLTPDGTRPAPYKRYYDFLTWLATQLIFSFTTAPFILLTIHDSTLVWARVYFYG  458

Query  259  TIV  251
             + 
Sbjct  459  ILA  461



>gb|KIW49985.1| hypothetical protein PV05_11612 [Exophiala xenobiotica]
Length=599

 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 65/182 (36%), Positives = 101/182 (55%), Gaps = 8/182 (4%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY +WS++E + I++G+G++G  + S  KPLW+R +NV+  G+E A++S      WN  
Sbjct  277  KYYGVWSLTEGACIMAGIGYNG-MDPSTGKPLWNRLENVNAWGIETAQNSRAYLDNWNKN  335

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
             + WLR+YVY R+  KGKKPGF   LAT   SA WHG YPGY + FV  A +   ++   
Sbjct  336  TNKWLRNYVYLRVTPKGKKPGFRATLATFVTSAFWHGFYPGYYLTFVLGAFVQTVAKNSR  395

Query  418  RW-------QQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVG  260
            R+         GT +   K    +  +  T    ++    F++L  +++L A+  VY+  
Sbjct  396  RYIRPFFLTPDGTKSTKYKIYYDIAGYLATQFTFSFVTAPFVILGFNDSLKAWARVYFYA  455

Query  259  TI  254
             I
Sbjct  456  VI  457



>gb|KIR87840.1| lysophospholipid acyltransferase [Cryptococcus gattii IND107]
Length=577

 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 62/187 (33%), Positives = 105/187 (56%), Gaps = 9/187 (5%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY +WS+SE + I++G+GF+G+   +  + LW+R +N++I G+E A+S   L   WN +
Sbjct  279  KYYAVWSLSEGACILTGIGFNGYDHKTG-RTLWNRVRNINIKGIETAESFKILFDSWNCR  337

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
             + WLR  VY+R+  KGKKPGF + +AT   SA WHG+ PGY + F    L+ +  R   
Sbjct  338  TNVWLRDVVYKRVTKKGKKPGFKESMATFLTSAFWHGISPGYYLAFFMGGLVTSLGRQFR  397

Query  418  RW--------QQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYV  263
            R+         +     + K++  L+ +      LNY    FL+L   +++ A+  +Y+ 
Sbjct  398  RYVRPYFLPLSETAQPGLAKRVYDLIGWISVQSTLNYLVAPFLLLDFKDSIGAWNRMYWY  457

Query  262  GTIVPVV  242
            G +  ++
Sbjct  458  GHVAVII  464



>gb|KIW44575.1| hypothetical protein PV06_03035 [Exophiala oligosperma]
Length=599

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 63/182 (35%), Positives = 103/182 (57%), Gaps = 8/182 (4%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY +WS++E + I++G+G++G  + +  KPLW+R +NV+  G+E A++S      WN  
Sbjct  277  KYYGVWSLTEGACIMAGIGYNG-MDPNTGKPLWNRLENVNAWGIETAQNSRAYLDNWNKN  335

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
             + WLR+Y+Y R+  KGKKPGF   LAT   SA+WHG YPGY + F+  A +   ++   
Sbjct  336  TNKWLRNYIYLRVTPKGKKPGFRATLATFVTSALWHGFYPGYYLTFLLGAFVQTVAKNSR  395

Query  418  RW-------QQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVG  260
            R+         GT +   K    +  +  T    ++    F++L  +++L A+G VY+  
Sbjct  396  RYIRPFFLTPDGTKSTKYKIYYDIAGYLVTQFTFSFVTAPFVILGFNDSLKAWGRVYFYA  455

Query  259  TI  254
             I
Sbjct  456  II  457



>gb|KGB74382.1| endoplasmic reticulum protein [Cryptococcus gattii R265]
 gb|KIR74220.1| lysophospholipid acyltransferase [Cryptococcus gattii CA1014]
Length=577

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/187 (33%), Positives = 105/187 (56%), Gaps = 9/187 (5%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY +WS+SE + I++G+GF+G+   +  + LW+R +N++I G+E A+S   L   WN +
Sbjct  279  KYYAVWSLSEGACILTGIGFNGYDHKTG-RTLWNRVRNINIKGIETAESFKILFDSWNCR  337

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
             + WLR  VY+R+  KGKKPGF + +AT   SA WHG+ PGY + F    L+ +  R   
Sbjct  338  TNVWLRDVVYKRVTKKGKKPGFKESMATFLTSAFWHGISPGYYLAFFMGGLVTSLGRQFR  397

Query  418  RW--------QQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYV  263
            R+               + K++  L+ +     +LNY    FL+L   +++ A+  +Y+ 
Sbjct  398  RYVRPYFLPLSDTAQPGLPKRVYGLIGWISVQSILNYLVAPFLLLDFKDSIGAWNRMYWY  457

Query  262  GTIVPVV  242
            G +  ++
Sbjct  458  GHVAVII  464



>emb|CDI52297.1| endoplasmic reticulum protein [Melanopsichium pennsylvanicum 
4]
Length=566

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 67/198 (34%), Positives = 104/198 (53%), Gaps = 17/198 (9%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWS+++ + I+SGLG++G   +   K  WDR KNVDI  +E A +  +L   WN+ 
Sbjct  287  KYYGIWSLTDGACILSGLGYNG-VNAVNGKTRWDRCKNVDIAKIEFANNWKELLDAWNMN  345

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
             + WLR+ VY+R+   GKKPGF   + T   SA WHGL PGY + FV +  M + ++ + 
Sbjct  346  TNVWLRNNVYKRIARPGKKPGFKSTMTTFCTSAFWHGLEPGYYLSFVLAGFMQSAAKMLR  405

Query  418  RW-------QQGTGNAILKK---------ILALMNFAYTLLVLNYSCVGFLVLSLHETLA  287
            R        Q    N +            +    +   + L LNY+   F++L    ++A
Sbjct  406  RHVRPLFFAQPNVANPMFTNLHTFSAAQLVYCTASILVSQLTLNYAVAPFMLLEFKASIA  465

Query  286  AYGSVYYVGTIVPVVLIM  233
             + +VY+ G IV  V ++
Sbjct  466  GWKAVYFYGHIVTFVAMI  483



>gb|KIR33912.1| lysophospholipid acyltransferase [Cryptococcus gattii MMRL2647]
Length=577

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/187 (33%), Positives = 105/187 (56%), Gaps = 9/187 (5%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY +WS+SE + I++G+GF+G+   +  + LW+R +N++I G+E A+S   L   WN +
Sbjct  279  KYYAVWSLSEGACILTGIGFNGYDHKTG-RTLWNRVRNINIKGIETAESFKILFDSWNCR  337

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
             + WLR  VY+R+  KGKKPGF + +AT   SA WHG+ PGY + F    L+ +  R   
Sbjct  338  TNVWLRDVVYKRVTKKGKKPGFKESMATFLTSAFWHGISPGYYLAFFMGGLVTSLGRQFR  397

Query  418  RW--------QQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYV  263
            R+               + K++  L+ +     +LNY    FL+L   +++ A+  +Y+ 
Sbjct  398  RYVRPYFLPLSDTAQPGLPKRVYDLIGWISVQSILNYLVAPFLLLDFKDSIGAWNRMYWY  457

Query  262  GTIVPVV  242
            G +  ++
Sbjct  458  GHVAVII  464



>gb|KIR25106.1| lysophospholipid acyltransferase [Cryptococcus gattii LA55]
 gb|KIR94294.1| lysophospholipid acyltransferase [Cryptococcus gattii CBS 10090]
 gb|KIS01301.1| lysophospholipid acyltransferase [Cryptococcus gattii 2001/935-1]
Length=577

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/187 (33%), Positives = 105/187 (56%), Gaps = 9/187 (5%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY +WS+SE + I++G+GF+G+   +  + LW+R +N++I G+E A+S   L   WN +
Sbjct  279  KYYAVWSLSEGACILTGIGFNGYDHKTG-RTLWNRVRNINIKGIETAESFKILFDSWNCR  337

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
             + WLR  VY+R+  KGKKPGF + +AT   SA WHG+ PGY + F    L+ +  R   
Sbjct  338  TNVWLRDVVYKRVTKKGKKPGFKESMATFLTSAFWHGISPGYYLAFFMGGLVTSLGRQFR  397

Query  418  RW--------QQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYV  263
            R+               + K++  L+ +     +LNY    FL+L   +++ A+  +Y+ 
Sbjct  398  RYVRPYFLPLSDTAQPGLPKRVYDLIGWISVQSILNYLVAPFLLLDFKDSIGAWNRMYWY  457

Query  262  GTIVPVV  242
            G +  ++
Sbjct  458  GHVAVII  464



>gb|KIR40539.1| lysophospholipid acyltransferase [Cryptococcus gattii Ram5]
 gb|KIY54548.1| lysophospholipid acyltransferase [Cryptococcus gattii 99/473]
Length=577

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/187 (33%), Positives = 105/187 (56%), Gaps = 9/187 (5%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY +WS+SE + I++G+GF+G+   +  + LW+R +N++I G+E A+S   L   WN +
Sbjct  279  KYYAVWSLSEGACILTGIGFNGYDHKTG-RTLWNRVRNINIKGIETAESFKILFDSWNCR  337

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
             + WLR  VY+R+  KGKKPGF + +AT   SA WHG+ PGY + F    L+ +  R   
Sbjct  338  TNVWLRDVVYKRVTKKGKKPGFKESMATFLTSAFWHGISPGYYLAFFMGGLVTSLGRQFR  397

Query  418  RW--------QQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYV  263
            R+               + K++  L+ +     +LNY    FL+L   +++ A+  +Y+ 
Sbjct  398  RYVRPYFLPLSDTAQPGLPKRVYDLIGWISVQSILNYLVAPFLLLDFKDSIGAWNRMYWY  457

Query  262  GTIVPVV  242
            G +  ++
Sbjct  458  GHVAVII  464



>ref|XP_004178270.1| hypothetical protein TBLA_0A09670 [Tetrapisispora blattae CBS 
6284]
 emb|CCH58751.1| hypothetical protein TBLA_0A09670 [Tetrapisispora blattae CBS 
6284]
Length=634

 Score =   103 bits (256),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 72/191 (38%), Positives = 103/191 (54%), Gaps = 9/191 (5%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY  W+ISEAS I  GLG++G+ + +  K  WDR +N+DI GVE+A+S+ Q    WN+ 
Sbjct  288  KYYAAWTISEASCISCGLGYNGYDKKTQ-KIKWDRVQNIDIWGVEMAQSTHQSFESWNMN  346

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSAL-MIAGS---  431
             + WL++YVY R+   G+KPGF   L T   SA WHG  PGY + F   AL    G    
Sbjct  347  TNKWLKNYVYLRVTKPGQKPGFRATLFTFLTSAFWHGTRPGYYLSFATGALYQTCGKFFR  406

Query  430  ---RAIYRWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVY-YV  263
               R I+  + G      K I   + F    L   Y C  F++L   +++ A+ SVY Y+
Sbjct  407  RNIRPIFLAEDGVTPLRFKWIYDAICFYVIKLAFGYLCQPFVILDFKDSINAWKSVYFYI  466

Query  262  GTIVPVVLIML  230
              +V +V  + 
Sbjct  467  HFLVILVFFLF  477



>gb|KIW15251.1| hypothetical protein PV08_05296 [Exophiala spinifera]
Length=602

 Score =   103 bits (256),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 63/182 (35%), Positives = 101/182 (55%), Gaps = 8/182 (4%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY +WS++E + I++G+G++G  +    KPLW+R +NV+  G+E A++S      WN  
Sbjct  277  KYYGVWSLTEGACIMAGIGYNG-MDPKTGKPLWNRLENVNAWGIETAQNSRAYLDNWNKN  335

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
             + WLR+Y+Y R+  KGKKPGF   LAT   SA WHG YPGY + F+  A +   ++   
Sbjct  336  TNKWLRNYIYLRVTPKGKKPGFRATLATFVTSAFWHGFYPGYYLTFLLGAFVQTVAKNSR  395

Query  418  RW-------QQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVG  260
            R+         GT +   K    +  +  T    ++    F++L  +++L A+G VY+  
Sbjct  396  RYIRPFFLTPDGTKSTKYKIYYDIAGYLVTQFTFSFVTAPFVILGFNDSLKAWGRVYFYA  455

Query  259  TI  254
             I
Sbjct  456  VI  457



>gb|KKA19937.1| Uncharacterized protein T310_6051 [Rasamsonia emersonii CBS 393.64]
Length=513

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 69/182 (38%), Positives = 103/182 (57%), Gaps = 10/182 (5%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY +W+++E + I+SGLG++G+   +  K  WDR +NV+  G+E A++       WN  
Sbjct  265  KYYGVWALTEGACILSGLGYNGFDPKTG-KVYWDRLENVNPWGLETAQNVRGYVENWNKN  323

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGY-----MIFFVQSALMIAG  434
             + WLR+YVY R+  KGKKPGF   LAT T SA WHG YPGY     +  FVQ+   I  
Sbjct  324  TNHWLRNYVYLRVTPKGKKPGFRASLATFTTSAFWHGFYPGYYLTFILASFVQTVAKIED  383

Query  433  SRAIYR----WQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYY  266
             R   R       GT    LK     +++  T L+L+++ + FL+L  ++T+  +  VY+
Sbjct  384  FRRHVRPFFLTPDGTKPTPLKPYYDFVSWLTTQLILSFTVIPFLILYFNDTIHVWAHVYF  443

Query  265  VG  260
             G
Sbjct  444  YG  445



>ref|XP_002488149.1| MBOAT family protein, putative [Talaromyces stipitatus ATCC 10500]
 gb|EED12495.1| MBOAT family protein, putative [Talaromyces stipitatus ATCC 10500]
Length=553

 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 64/182 (35%), Positives = 105/182 (58%), Gaps = 8/182 (4%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY  W+++E + I+SGLG++G+   +  K  WDR +NV+  G+E A+++      WN  
Sbjct  283  KYYGCWALTEGACILSGLGYNGFDPKTG-KVFWDRLENVNPWGLETAQNTRGYLENWNKN  341

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
             + WLR+YVY R+  KGKKPGF   LAT + SA WHG YPGY + FV ++ +   ++   
Sbjct  342  TNHWLRNYVYLRVTPKGKKPGFRASLATFSTSAFWHGFYPGYYLAFVLASFVQTVAKNFR  401

Query  418  RW-------QQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVG  260
            R+         G+     K    + ++  T L+++++   F++LS   T+A +G VY+ G
Sbjct  402  RYVRPFFLSPDGSKPTAAKPYYDVASWVITQLIMSFTVAPFVLLSFSGTIAVWGHVYFYG  461

Query  259  TI  254
             +
Sbjct  462  IV  463



>emb|CCU77332.1| MBOAT family protein [Blumeria graminis f. sp. hordei DH14]
Length=441

 Score =   101 bits (251),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 61/190 (32%), Positives = 105/190 (55%), Gaps = 8/190 (4%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY +W++SE + I++G G+ G  +    K  W+R ++VD +GVE A+++      WNI 
Sbjct  186  KYYGVWALSEGACILAGYGYDG-IDPITKKASWNRLRHVDPIGVETAQNTRAYLGSWNIN  244

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
             S WLR+Y+Y R+   GKKPGF+  +AT   SA+WHG YPGY   F+ ++ +   ++   
Sbjct  245  TSNWLRNYIYLRVTPPGKKPGFWASMATFATSALWHGFYPGYYFTFILASFVQTAAKKCR  304

Query  418  RW-------QQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVG  260
            R+        Q +   +LK    +++F  T    ++    F+ L+ + +L  +  +Y+ G
Sbjct  305  RYFRPFFLDPQTSKPTVLKPYYDILSFVVTQATFSFVTAPFVFLTFNSSLKVWSGLYFYG  364

Query  259  TIVPVVLIML  230
             I   + I+L
Sbjct  365  VIGTALSILL  374



>dbj|GAA26490.1| K7_Yor175cbp, partial [Saccharomyces cerevisiae Kyokai no. 7]
Length=335

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 72/191 (38%), Positives = 99/191 (52%), Gaps = 9/191 (5%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY  W+ISE S I+ GLG++G+ +    K  WDR +N+DI  VE A+++ ++   WN+ 
Sbjct  4    KYYAAWTISEGSCILCGLGYNGY-DPKTQKIRWDRVRNIDIWTVETAQNTREMLEAWNMN  62

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSAL-MIAGS---  431
             + WL++ VY R+  KGKKPGF   L T   SA WHG  PGY + F   AL    G    
Sbjct  63   TNKWLKYSVYLRVTKKGKKPGFRSTLFTFLTSAFWHGTRPGYYLTFATGALYQTCGKIYR  122

Query  430  ---RAIYRWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVY-YV  263
               R I+  + G      KKI  L+      L   Y    F++L L  +L  +GSVY YV
Sbjct  123  RNFRPIFLREDGVTPLPSKKIYDLVGIYAIKLAFGYMVQPFIILDLKPSLMVWGSVYFYV  182

Query  262  GTIVPVVLIML  230
              IV     + 
Sbjct  183  HIIVAFSFFLF  193



>emb|CBQ70814.1| conserved hypothetical protein [Sporisorium reilianum SRZ2]
Length=541

 Score =   102 bits (253),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 67/198 (34%), Positives = 103/198 (52%), Gaps = 17/198 (9%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWS+++ + I+SGLG++G  ++   K  WDR +N+DI  +E A +  +L   WN+ 
Sbjct  276  KYYGIWSLTDGACILSGLGYNG-VDAKTGKTRWDRCRNIDIPKIEFANNWKELLDHWNMN  334

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
             + WLR+ VY+R+   GKKPGF   + T   SA WHGL PGY + F+ +  M + +R + 
Sbjct  335  TNVWLRNNVYKRIARPGKKPGFKSTMTTFFTSAFWHGLEPGYYLSFILAGFMQSAARQLR  394

Query  418  RW-------QQGTGNAILKKILALM--NFAY-------TLLVLNYSCVGFLVLSLHETLA  287
            R        Q    N      L       AY       +   LNY+   F++L L  +  
Sbjct  395  RHVRPLFFTQPNVPNPTFSNALTFTPAQLAYCTASVVVSQFTLNYAVAPFMLLELEASFR  454

Query  286  AYGSVYYVGTIVPVVLIM  233
             + +VY+ G +V  V I+
Sbjct  455  GWKAVYFYGHVVTFVAIL  472



>gb|EGA60489.1| Ale1p [Saccharomyces cerevisiae FostersO]
Length=526

 Score =   102 bits (253),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 73/191 (38%), Positives = 100/191 (52%), Gaps = 9/191 (5%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY  W+ISE S I+ GLG++G+ +S   K  WDR +N+DI  VE A+++ ++   WN+ 
Sbjct  195  KYYAAWTISEGSCILCGLGYNGY-DSKTQKIRWDRVRNIDIWTVETAQNTREMLEAWNMN  253

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSAL-MIAGS---  431
             + WL++ VY R+  KGKKPGF   L T   SA WHG  PGY + F   AL    G    
Sbjct  254  TNKWLKYSVYLRVTKKGKKPGFRSTLFTFLTSAFWHGTRPGYYLTFATGALYQTCGKIYR  313

Query  430  ---RAIYRWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVY-YV  263
               R I+  + G      KKI  L+      L   Y    F++L L  +L  +GSVY YV
Sbjct  314  RNFRPIFLREDGVTPLPSKKIYDLVGIYAIKLAFGYMVQPFIILDLKPSLMVWGSVYFYV  373

Query  262  GTIVPVVLIML  230
              IV     + 
Sbjct  374  HIIVAFSFFLF  384



>gb|KIY71758.1| endoplasmic reticulum protein [Cylindrobasidium torrendii FP15055 
ss-10]
Length=516

 Score =   101 bits (252),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 68/189 (36%), Positives = 103/189 (54%), Gaps = 15/189 (8%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY +W+++E + I++G GF+G+      K  W+ A NV  L VEL  +   +   WN++
Sbjct  273  KYYAVWTLTEGAAILTGFGFTGFNAKG--KSTWNGAANVKPLDVELPLNFKGILDSWNMK  330

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGS----  431
             + WLR  VY+R+  KGKKPGF   L T   SA WHG+YPGY + F    L+ A +    
Sbjct  331  TNVWLRECVYKRVTPKGKKPGFRSTLTTSLTSAFWHGVYPGYYLTFFLGGLITAAARLAR  390

Query  430  ---RAIYRWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHE------TLAAYG  278
               R  +   +G    + K+I  L     +L+VLNY+ + F++L++ +      TLA YG
Sbjct  391  QNFRPFFLPAEGQTTGLSKRIYDLAGGIVSLVVLNYATIPFILLTIDDSLKSWRTLAWYG  450

Query  277  SVYYVGTIV  251
                VG +V
Sbjct  451  HGIIVGGLV  459



>gb|KEY81407.1| hypothetical protein MBOAT [Aspergillus fumigatus var. RP-2014]
Length=555

 Score =   102 bits (253),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 66/190 (35%), Positives = 108/190 (57%), Gaps = 8/190 (4%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY +WS++E + I+SGLG++G+   +  K  W+R +N+D   +E A++S      WN  
Sbjct  280  KYYGVWSLTEGACILSGLGYNGFDPKTG-KVFWNRLENIDPWSLETAQNSHGYLGSWNKN  338

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
             + WLR+YVY R+  KGKKPGF   LAT T SA WHG YPGY + F+  + +  G++ I 
Sbjct  339  TNHWLRNYVYLRVTPKGKKPGFRASLATFTTSAFWHGFYPGYYMTFILGSFVQTGAKNIR  398

Query  418  RW-------QQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVG  260
            R+         G      K+   ++++  T L +++  + F+ LS   ++  + SVY+ G
Sbjct  399  RYIRPFFLTPDGAKPLPTKRYYDILSWLVTQLTMSFVVMPFIFLSFSSSIQVWRSVYFYG  458

Query  259  TIVPVVLIML  230
             I  ++ I+ 
Sbjct  459  IIGNIMSIIF  468



>gb|EST06028.1| hypothetical protein PSEUBRA_SCAF3g03529 [Pseudozyma brasiliensis 
GHG001]
Length=549

 Score =   102 bits (253),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 67/198 (34%), Positives = 107/198 (54%), Gaps = 17/198 (9%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWS+++ + I+SGLG++G  + +  K  W+R +NVDI  +E A +  +L   WN+ 
Sbjct  279  KYYGIWSLTDGACILSGLGYNG-VDPTSGKTRWNRCRNVDIPKIEFANNWKELLDAWNMN  337

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGS----  431
             + WLR+ VY+R+   GKKPGF   + T   SA WHGL PGY + FV +  M + +    
Sbjct  338  TNVWLRNNVYKRIARPGKKPGFKSTMTTFFTSAFWHGLEPGYYLSFVLAGFMQSAAKTLR  397

Query  430  ---RAIYRWQQGTGNAILKKI--LALMNFAY-------TLLVLNYSCVGFLVLSLHETLA  287
               R ++  Q    N     +   ++   AY       +   LNY+   F++L L  ++A
Sbjct  398  KHLRPVFFSQPNVANPTFANVHTFSVPQLAYCTASVLASQATLNYAVAPFMLLELRASIA  457

Query  286  AYGSVYYVGTIVPVVLIM  233
             + +VY+ G I+  V I+
Sbjct  458  GWKAVYFYGHILTFVTIL  475



>ref|XP_566668.1| endoplasmic reticulum protein [Cryptococcus neoformans var. neoformans 
JEC21]
 gb|AAW40849.1| endoplasmic reticulum protein, putative [Cryptococcus neoformans 
var. neoformans JEC21]
Length=592

 Score =   102 bits (254),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 63/191 (33%), Positives = 106/191 (55%), Gaps = 9/191 (5%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY +WS+SE + I++G+GF+G+   +  + LW+R +N++I G+E A+S   L   WN +
Sbjct  294  KYYAVWSLSEGACILTGIGFNGYDPKTG-RTLWNRVRNINIKGIETAESFKILFDSWNCR  352

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
             + WLR  VY+R+  KGKKPGF + +AT   SA WHG+ PGY + F    L+ +  R   
Sbjct  353  TNVWLRDVVYKRVTKKGKKPGFKESMATFLTSAFWHGISPGYYLAFFMGGLVTSLGRQFR  412

Query  418  RW--------QQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYV  263
            R+         +       K++  L+ +      LNY    FL+L+  +++ A+  +Y+ 
Sbjct  413  RYVRPYFLPPSETAQPGPPKRVYDLIGWISVQSTLNYLVAPFLLLNFKDSIGAWNRMYWY  472

Query  262  GTIVPVVLIML  230
            G +  ++ I  
Sbjct  473  GHVAVIISICF  483



>ref|XP_012046278.1| lysophospholipid acyltransferase [Cryptococcus neoformans var. 
grubii H99]
 gb|AFR92500.2| lysophospholipid acyltransferase [Cryptococcus neoformans var. 
grubii H99]
Length=577

 Score =   102 bits (253),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 66/181 (36%), Positives = 103/181 (57%), Gaps = 9/181 (5%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY +WS+SE + I++G+GF+G+   +  + LW+R +N++I G+E A+S   L   WN +
Sbjct  279  KYYAVWSLSEGACILTGIGFNGYDPKTG-RTLWNRVRNINIKGIETAESFKILFDSWNCR  337

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
             + WLR  VY+R+  KGKKPGF + +AT   SA WHG+ PGY + F    L+ +  R   
Sbjct  338  TNVWLRDVVYKRVTKKGKKPGFKESMATFLTSAFWHGISPGYYLAFFMGGLVTSLGRQFR  397

Query  418  RWQQ-------GTGNAIL-KKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYV  263
            R+ +       GT    L K+I  L+ +      LNY    FL+L    ++ A+  +Y+ 
Sbjct  398  RYVRPYFLPLSGTAQTGLPKRIYDLIGWISVQSTLNYLVAPFLLLDFKNSIDAWNRMYWY  457

Query  262  G  260
            G
Sbjct  458  G  458



>gb|EDP47498.1| MBOAT family protein, putative [Aspergillus fumigatus A1163]
Length=555

 Score =   102 bits (253),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 66/190 (35%), Positives = 108/190 (57%), Gaps = 8/190 (4%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY +WS++E + I+SGLG++G+   +  K  W+R +N+D   +E A++S      WN  
Sbjct  280  KYYGVWSLTEGACILSGLGYNGFDPKTG-KVFWNRLENIDPWSLETAQNSHGYLGSWNKN  338

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
             + WLR+YVY R+  KGKKPGF   LAT T SA WHG YPGY + F+  + +  G++ I 
Sbjct  339  TNHWLRNYVYLRVTPKGKKPGFRASLATFTTSAFWHGFYPGYYMTFILGSFVQTGAKNIR  398

Query  418  RW-------QQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVG  260
            R+         G      K+   ++++  T L +++  + F+ LS   ++  + SVY+ G
Sbjct  399  RYIRPFFLTPDGAKPLPTKRYYDILSWLVTQLTMSFVVMPFIFLSFSSSIQVWRSVYFYG  458

Query  259  TIVPVVLIML  230
             I  ++ I+ 
Sbjct  459  IIGNIMSIIF  468



>ref|XP_007724974.1| hypothetical protein A1O1_05900 [Capronia coronata CBS 617.96]
 gb|EXJ85536.1| hypothetical protein A1O1_05900 [Capronia coronata CBS 617.96]
Length=596

 Score =   102 bits (253),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 65/189 (34%), Positives = 105/189 (56%), Gaps = 9/189 (5%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY +W+++E + I++G+G++G  + +  K  WDR +NV+  GVE A++S      WN  
Sbjct  278  KYYGVWALTEGACIMAGIGYNG-IDPATGKARWDRTENVNPWGVESAQNSRAYLDSWNKN  336

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
             + WLR+Y+Y R+  KG+KPGF   LAT   SA WHG YPGY + F+  A +   ++   
Sbjct  337  TNKWLRNYIYLRVTPKGRKPGFRATLATFLTSAFWHGFYPGYYLAFLMGAFIQTVAKNCR  396

Query  418  RW-------QQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVG  260
            R+         GT     K    + ++  T LV  ++   F++L   ++L  +  VY+ G
Sbjct  397  RYFRPFFLTPDGTKTTKYKIYYDIASYVATQLVFCFTTAPFVILGFSDSLKVWARVYFYG  456

Query  259  TIVPVVLIM  233
             +V V+L M
Sbjct  457  -LVGVLLFM  464



>gb|EGA80860.1| Ale1p [Saccharomyces cerevisiae Lalvin QA23]
Length=578

 Score =   102 bits (253),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 73/191 (38%), Positives = 100/191 (52%), Gaps = 9/191 (5%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY  W+ISE S I+ GLG++G+ +S   K  WDR +N+DI  VE A+++ ++   WN+ 
Sbjct  209  KYYAAWTISEGSCILCGLGYNGY-DSKTQKIRWDRVRNIDIWTVETAQNTREMLEAWNMN  267

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSAL-MIAGS---  431
             + WL++ VY R+  KGKKPGF   L T   SA WHG  PGY + F   AL    G    
Sbjct  268  TNKWLKYSVYLRVTKKGKKPGFRSTLFTFLTSAFWHGTRPGYYLTFATGALYQTCGKIYR  327

Query  430  ---RAIYRWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVY-YV  263
               R I+  + G      KKI  L+      L   Y    F++L L  +L  +GSVY YV
Sbjct  328  RNFRPIFLREDGVTPLPSKKIYDLVGIYAIKLAFGYMVQPFIILDLKPSLMVWGSVYFYV  387

Query  262  GTIVPVVLIML  230
              IV     + 
Sbjct  388  HIIVAFSFFLF  398



>gb|AJT71605.1| Ale1p [Saccharomyces cerevisiae YJM193]
 gb|AJU11170.1| Ale1p [Saccharomyces cerevisiae YJM1478]
Length=619

 Score =   102 bits (253),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 73/184 (40%), Positives = 99/184 (54%), Gaps = 9/184 (5%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY  W+ISE S I+ GLG++G+ +S   K  WDR +N+DI  VE A+++ ++   WN+ 
Sbjct  288  KYYAAWTISEGSCILCGLGYNGY-DSKTQKIRWDRVRNIDIWTVETAQNTREMLEAWNMN  346

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSAL-MIAGS---  431
             + WL++ VY R+  KGKKPGF   L T   SA WHG  PGY + F   AL    G    
Sbjct  347  TNKWLKYSVYLRVTKKGKKPGFRSTLFTFLTSAFWHGTRPGYYLTFATGALYQTCGKIYR  406

Query  430  ---RAIYRWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVY-YV  263
               R I+  + G      KKI  L+      L   Y    F++L L  +L  +GSVY YV
Sbjct  407  RNFRPIFLREDGVTPLPSKKIYDLVGIYAIKLAFGYMVQPFIILDLKPSLMVWGSVYFYV  466

Query  262  GTIV  251
              IV
Sbjct  467  HIIV  470



>ref|XP_007364213.1| MBOAT-domain-containing protein [Dichomitus squalens LYAD-421 
SS1]
 gb|EJF62867.1| MBOAT-domain-containing protein [Dichomitus squalens LYAD-421 
SS1]
Length=545

 Score =   101 bits (252),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 67/191 (35%), Positives = 110/191 (58%), Gaps = 17/191 (9%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY +W+++E + I +GLGF+G+TES   K  W+ A NV+++ +E A+++  L   WN++
Sbjct  280  KYYAVWTLTEGASIQTGLGFTGYTESGSTK--WEGAANVNVMNIEFAENTKVLLDSWNMK  337

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMI-----FFVQSALMIAG  434
             + WLR  VY+R+  KGKKPGF   LAT   SA WHG+ PGY +      FVQ+   +A 
Sbjct  338  TNIWLRECVYKRVTPKGKKPGFRSSLATFATSAFWHGIAPGYYLSFFFYAFVQTTGRLAR  397

Query  433  S-------RAIYRWQQGT---GNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAA  284
            S        A Y  Q+G         K++  ++    T+++ NY  + F++L++ ++  A
Sbjct  398  SYLRPLVLPANYVAQRGAPPPPQTRKKQLYDVLGVITTVMLTNYGTLPFMLLNIDDSFVA  457

Query  283  YGSVYYVGTIV  251
            + +V + G  V
Sbjct  458  WNNVVWYGHFV  468



>gb|KIO30962.1| hypothetical protein M407DRAFT_68729, partial [Tulasnella calospora 
MUT 4182]
Length=380

 Score =   100 bits (248),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 54/183 (30%), Positives = 97/183 (53%), Gaps = 16/183 (9%)
 Frame = -2

Query  730  GLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQVSTWLRHYVYERLISK  551
            GLGF+G+ +      LWD+A N+D++ +E A +   L   WNI  +TWLR+ VY+RL   
Sbjct  117  GLGFNGFDKDG--STLWDKAANIDVMNIEFAPNVKVLLDNWNINTNTWLRNSVYKRLAPP  174

Query  550  GKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIYRWQQG-----------  404
            GKKPG    + T   SA+WHG+YPGY + F    L+ + +R +  + +            
Sbjct  175  GKKPGALVTMYTFMTSAIWHGIYPGYYLTFFLGGLVSSAARQVRTYIRPFFLPALLPPKS  234

Query  403  ---TGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPVVLIM  233
                   ++K++  ++     L+++NY    F++L L  ++ A+ ++ + G +  +  ++
Sbjct  235  KVLPPPTLIKRVYDVLGTVACLVIINYMAAPFMLLELRPSIKAWTTLLWYGHVTVLGWLI  294

Query  232  LGN  224
            LG 
Sbjct  295  LGQ  297



>gb|EDV10758.1| hypothetical protein SCRG_01566 [Saccharomyces cerevisiae RM11-1a]
Length=616

 Score =   102 bits (253),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 73/184 (40%), Positives = 99/184 (54%), Gaps = 9/184 (5%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY  W+ISE S I+ GLG++G+ +S   K  WDR +N+DI  VE A+++ ++   WN+ 
Sbjct  288  KYYAAWTISEGSCILCGLGYNGY-DSKTQKIRWDRVRNIDIWTVETAQNTREMLEAWNMN  346

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSAL-MIAGS---  431
             + WL++ VY R+  KGKKPGF   L T   SA WHG  PGY + F   AL    G    
Sbjct  347  TNKWLKYSVYLRVTKKGKKPGFRSTLFTFLTSAFWHGTRPGYYLTFATGALYQTCGKIYR  406

Query  430  ---RAIYRWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVY-YV  263
               R I+  + G      KKI  L+      L   Y    F++L L  +L  +GSVY YV
Sbjct  407  RNFRPIFLREDGVTPLPSKKIYDLVGIYAIKLAFGYMVQPFIILDLKPSLMVWGSVYFYV  466

Query  262  GTIV  251
              IV
Sbjct  467  HIIV  470



>ref|NP_014818.1| Ale1p [Saccharomyces cerevisiae S288c]
 sp|Q08548.1|ALE1_YEAST RecName: Full=Lysophospholipid acyltransferase; Short=LPLAT; 
AltName: Full=1-acyl-sn-glycerol-3-phosphate acyltransferase; 
Short=AGPAT; AltName: Full=Lysophosphatidic acid acyltransferase; 
Short=LPAAT; AltName: Full=Lysophosphatidylcholine acyltransferase; 
Short=LPCAT; AltName: Full=Lysophosphatidylethanolamine 
acyltransferase; Short=LPEAT [Saccharomyces cerevisiae 
S288c]
 emb|CAA99384.1| unnamed protein product [Saccharomyces cerevisiae]
 dbj|BAF93897.1| lysophospholipid acyltransferase [Saccharomyces cerevisiae]
 emb|CAY86465.1| Ale1p [Saccharomyces cerevisiae EC1118]
 tpg|DAA10947.1| TPA: Ale1p [Saccharomyces cerevisiae S288c]
 gb|EIW07605.1| Ale1p [Saccharomyces cerevisiae CEN.PK113-7D]
 gb|EWG83269.1| Ale1p [Saccharomyces cerevisiae R008]
 gb|EWG88479.1| Ale1p [Saccharomyces cerevisiae P301]
 gb|EWG93602.1| Ale1p [Saccharomyces cerevisiae R103]
 gb|EWH15997.1| Ale1p [Saccharomyces cerevisiae P283]
 gb|AHY77464.1| Ale1p [Saccharomyces cerevisiae YJM993]
 gb|AJP41694.1| Ale1p [Saccharomyces cerevisiae YJM1078]
 gb|AJT72569.1| Ale1p [Saccharomyces cerevisiae YJM244]
 gb|AJT73064.1| Ale1p [Saccharomyces cerevisiae YJM248]
 gb|AJT73542.1| Ale1p [Saccharomyces cerevisiae YJM270]
 gb|AJT75505.1| Ale1p [Saccharomyces cerevisiae YJM428]
 gb|AJT76491.1| Ale1p [Saccharomyces cerevisiae YJM451]
 gb|AJT76986.1| Ale1p [Saccharomyces cerevisiae YJM453]
 gb|AJT77477.1| Ale1p [Saccharomyces cerevisiae YJM456]
 gb|AJT79929.1| Ale1p [Saccharomyces cerevisiae YJM627]
 gb|AJT82382.1| Ale1p [Saccharomyces cerevisiae YJM693]
 gb|AJT82874.1| Ale1p [Saccharomyces cerevisiae YJM969]
 gb|AJT83370.1| Ale1p [Saccharomyces cerevisiae YJM972]
 gb|AJT83856.1| Ale1p [Saccharomyces cerevisiae YJM975]
 gb|AJT84348.1| Ale1p [Saccharomyces cerevisiae YJM978]
 gb|AJT84840.1| Ale1p [Saccharomyces cerevisiae YJM981]
 gb|AJT85335.1| Ale1p [Saccharomyces cerevisiae YJM984]
 gb|AJT85824.1| Ale1p [Saccharomyces cerevisiae YJM987]
 gb|AJT86318.1| Ale1p [Saccharomyces cerevisiae YJM990]
 gb|AJT86813.1| Ale1p [Saccharomyces cerevisiae YJM996]
 gb|AJT87779.1| Ale1p [Saccharomyces cerevisiae YJM1129]
 gb|AJT91204.1| Ale1p [Saccharomyces cerevisiae YJM1244]
 gb|AJT92592.1| Ale1p [Saccharomyces cerevisiae YJM1252]
 gb|AJT93565.1| Ale1p [Saccharomyces cerevisiae YJM1304]
 gb|AJT95510.1| Ale1p [Saccharomyces cerevisiae YJM1332]
 gb|AJT96005.1| Ale1p [Saccharomyces cerevisiae YJM1336]
 gb|AJT98471.1| Ale1p [Saccharomyces cerevisiae YJM1356]
 gb|AJT99942.1| Ale1p [Saccharomyces cerevisiae YJM1385]
 gb|AJU04346.1| Ale1p [Saccharomyces cerevisiae YJM1415]
 gb|AJU09217.1| Ale1p [Saccharomyces cerevisiae YJM1450]
 gb|AJU12156.1| Ale1p [Saccharomyces cerevisiae YJM1526]
 gb|AJU12646.1| Ale1p [Saccharomyces cerevisiae YJM1527]
 gb|AJU14115.1| Ale1p [Saccharomyces cerevisiae YJM1574]
 gb|AJU15109.1| Ale1p [Saccharomyces cerevisiae YJM1615]
Length=619

 Score =   102 bits (253),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 73/184 (40%), Positives = 99/184 (54%), Gaps = 9/184 (5%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY  W+ISE S I+ GLG++G+ +S   K  WDR +N+DI  VE A+++ ++   WN+ 
Sbjct  288  KYYAAWTISEGSCILCGLGYNGY-DSKTQKIRWDRVRNIDIWTVETAQNTREMLEAWNMN  346

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSAL-MIAGS---  431
             + WL++ VY R+  KGKKPGF   L T   SA WHG  PGY + F   AL    G    
Sbjct  347  TNKWLKYSVYLRVTKKGKKPGFRSTLFTFLTSAFWHGTRPGYYLTFATGALYQTCGKIYR  406

Query  430  ---RAIYRWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVY-YV  263
               R I+  + G      KKI  L+      L   Y    F++L L  +L  +GSVY YV
Sbjct  407  RNFRPIFLREDGVTPLPSKKIYDLVGIYAIKLAFGYMVQPFIILDLKPSLMVWGSVYFYV  466

Query  262  GTIV  251
              IV
Sbjct  467  HIIV  470



>gb|EDN64033.1| acyltransferase for lyso-phosphatidylethanolamine [Saccharomyces 
cerevisiae YJM789]
 gb|AJT74525.1| Ale1p [Saccharomyces cerevisiae YJM320]
 gb|AJT78448.1| Ale1p [Saccharomyces cerevisiae YJM541]
 gb|AJT78945.1| Ale1p [Saccharomyces cerevisiae YJM554]
 gb|AJT81398.1| Ale1p [Saccharomyces cerevisiae YJM683]
 gb|AJT81900.1| Ale1p [Saccharomyces cerevisiae YJM689]
 gb|AJT89733.1| Ale1p [Saccharomyces cerevisiae YJM1202]
 gb|AJT95023.1| Ale1p [Saccharomyces cerevisiae YJM1326]
Length=619

 Score =   102 bits (253),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 73/184 (40%), Positives = 99/184 (54%), Gaps = 9/184 (5%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY  W+ISE S I+ GLG++G+ +S   K  WDR +N+DI  VE A+++ ++   WN+ 
Sbjct  288  KYYAAWTISEGSCILCGLGYNGY-DSKTQKIRWDRVRNIDIWTVETAQNTREMLEAWNMN  346

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSAL-MIAGS---  431
             + WL++ VY R+  KGKKPGF   L T   SA WHG  PGY + F   AL    G    
Sbjct  347  TNKWLKYSVYLRVTKKGKKPGFRSTLFTFLTSAFWHGTRPGYYLTFATGALYQTCGKIYR  406

Query  430  ---RAIYRWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVY-YV  263
               R I+  + G      KKI  L+      L   Y    F++L L  +L  +GSVY YV
Sbjct  407  RNFRPIFLREDGVTPLPSKKIYDLVGIYAIKLAFGYMVQPFIILDLKPSLMVWGSVYFYV  466

Query  262  GTIV  251
              IV
Sbjct  467  HIIV  470



>ref|XP_747591.2| MBOAT family protein [Aspergillus fumigatus Af293]
 gb|EAL85553.2| MBOAT family protein, putative [Aspergillus fumigatus Af293]
Length=555

 Score =   101 bits (252),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 66/190 (35%), Positives = 107/190 (56%), Gaps = 8/190 (4%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY +WS++E + I+SGLG++G+   +  K  W+R  N+D   +E A++S      WN  
Sbjct  280  KYYGVWSLTEGACILSGLGYNGFDPKTG-KVFWNRLDNIDPWSLETAQNSHGYLGSWNKN  338

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
             + WLR+YVY R+  KGKKPGF   LAT T SA WHG YPGY + F+  + +  G++ I 
Sbjct  339  TNHWLRNYVYLRVTPKGKKPGFRASLATFTTSAFWHGFYPGYYMTFILGSFVQTGAKNIR  398

Query  418  RW-------QQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVG  260
            R+         G      K+   ++++  T L +++  + F+ LS   ++  + SVY+ G
Sbjct  399  RYIRPFFLTPDGAKPLPTKRYYDILSWLVTQLTMSFVVMPFIFLSFSSSIQVWRSVYFYG  458

Query  259  TIVPVVLIML  230
             I  ++ I+ 
Sbjct  459  IIGNIMSIIF  468



>gb|EYU29840.1| hypothetical protein MIMGU_mgv1a0059782mg, partial [Erythranthe 
guttata]
Length=328

 Score = 99.4 bits (246),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 56/67 (84%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWSISEAS IISGLGFSGW+ S P KPLWDRAKNVD+LG+ELA S+VQ+PLVWNIQ
Sbjct  262  KYYFIWSISEASTIISGLGFSGWSNSDPNKPLWDRAKNVDVLGLELATSAVQIPLVWNIQ  321

Query  598  VSTWLRH  578
            VSTWLRH
Sbjct  322  VSTWLRH  328



>dbj|GAC74527.1| predicted membrane protein [Pseudozyma antarctica T-34]
Length=531

 Score =   101 bits (251),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 69/198 (35%), Positives = 104/198 (53%), Gaps = 19/198 (10%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWS+++ + I+SGLG++G       K  W+R  NVDI  +ELA +  +L   WN+ 
Sbjct  269  KYYGIWSLTDGACILSGLGYNGVQNG---KTRWNRCSNVDIPKIELANNWKELLDHWNMN  325

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
             + WLR+ VY+R+   GKKPGF   + T   SA WHGL PGY + F+ +  M + ++ + 
Sbjct  326  TNVWLRNNVYKRIARPGKKPGFKSTMTTFFTSAFWHGLEPGYYLSFILAGFMQSAAKMLR  385

Query  418  RW-------QQGTGNAILKKI--LALMNFAYTLL-------VLNYSCVGFLVLSLHETLA  287
            R        Q    N     +   +    AY  L        LNY+   F++L L  ++A
Sbjct  386  RHVRPVFFAQPNVANPTFSNVHTFSAGQLAYCTLSVAVSQATLNYAVAPFMLLELRASIA  445

Query  286  AYGSVYYVGTIVPVVLIM  233
             + +VY+ G IV  V I+
Sbjct  446  GWKAVYFYGHIVTAVAIL  463



>gb|ETS62438.1| hypothetical protein PaG_03055 [Pseudozyma aphidis DSM 70725]
Length=531

 Score =   101 bits (251),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 69/198 (35%), Positives = 104/198 (53%), Gaps = 19/198 (10%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWS+++ + I+SGLG++G       K  W+R  NVDI  +ELA +  +L   WN+ 
Sbjct  269  KYYGIWSLTDGACILSGLGYNGVQNG---KTRWNRCSNVDIPKIELANNWKELLDHWNMN  325

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
             + WLR+ VY+R+   GKKPGF   + T   SA WHGL PGY + F+ +  M + ++ + 
Sbjct  326  TNVWLRNNVYKRIARPGKKPGFKSTMTTFFTSAFWHGLEPGYYLSFILAGFMQSAAKMLR  385

Query  418  RW-------QQGTGNAILKKI--LALMNFAYTLL-------VLNYSCVGFLVLSLHETLA  287
            R        Q    N     +   +    AY  L        LNY+   F++L L  ++A
Sbjct  386  RHVRPVFFAQPNVANPTFSNVHTFSAGQLAYCTLSVAVSQATLNYAVAPFMLLELRASIA  445

Query  286  AYGSVYYVGTIVPVVLIM  233
             + +VY+ G IV  V I+
Sbjct  446  GWKAVYFYGHIVTAVAIL  463



>ref|XP_001396584.2| MBOAT family protein [Aspergillus niger CBS 513.88]
Length=555

 Score =   101 bits (252),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 62/182 (34%), Positives = 105/182 (58%), Gaps = 8/182 (4%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY +WS++E + I+SG+G++G+   S  K  W+R +N+D   +E A++S      WN  
Sbjct  280  KYYGVWSLTEGACILSGMGYNGFDPKSG-KVFWNRLENIDPWSLETAQNSHGYLGSWNKN  338

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
             + WLR+YVY R+  +GKKPGF   LAT T SA WHG YPGY + F+  + +  G++   
Sbjct  339  TNHWLRNYVYLRVTPRGKKPGFRASLATFTTSAFWHGFYPGYYLTFILGSFIQTGAKNFR  398

Query  418  RW-------QQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVG  260
            R+         G+     K+   +M++  T + L+++ + F+ L   +++  + SVY+ G
Sbjct  399  RYVRPFFLTPDGSKPTPYKRYYDIMSWFVTQVTLSFTVMPFIFLGFSKSIGVWQSVYFYG  458

Query  259  TI  254
             +
Sbjct  459  IV  460



>emb|CAK42214.1| unnamed protein product [Aspergillus niger]
Length=540

 Score =   101 bits (251),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 62/182 (34%), Positives = 105/182 (58%), Gaps = 8/182 (4%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY +WS++E + I+SG+G++G+   S  K  W+R +N+D   +E A++S      WN  
Sbjct  265  KYYGVWSLTEGACILSGMGYNGFDPKSG-KVFWNRLENIDPWSLETAQNSHGYLGSWNKN  323

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
             + WLR+YVY R+  +GKKPGF   LAT T SA WHG YPGY + F+  + +  G++   
Sbjct  324  TNHWLRNYVYLRVTPRGKKPGFRASLATFTTSAFWHGFYPGYYLTFILGSFIQTGAKNFR  383

Query  418  RW-------QQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVG  260
            R+         G+     K+   +M++  T + L+++ + F+ L   +++  + SVY+ G
Sbjct  384  RYVRPFFLTPDGSKPTPYKRYYDIMSWFVTQVTLSFTVMPFIFLGFSKSIGVWQSVYFYG  443

Query  259  TI  254
             +
Sbjct  444  IV  445



>emb|CCF54383.1| uncharacterized protein UHOR_02112 [Ustilago hordei]
Length=554

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 68/208 (33%), Positives = 111/208 (53%), Gaps = 22/208 (11%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWS+++ + I+SGLG++G  +    +  W+R +N+DI  +E A +  +L   WN+ 
Sbjct  279  KYYGIWSLTDGACILSGLGYNG-IDGQTGQTKWNRCRNIDIPKIEFANNWKELLDHWNMN  337

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGS----  431
             + WLR+ VY+R+   GKKPGF   + T   SA WHGL PGY + F+ +A M + +    
Sbjct  338  TNVWLRNNVYKRIARPGKKPGFKSTMTTFFTSAFWHGLEPGYYLSFILAAFMQSAAKMLR  397

Query  430  ---RAIYRWQQGTGNAILKKI---------LALMNFAYTLLVLNYSCVGFLVLSLHETLA  287
               R I+  Q    N     +           + +   + L LNY+   F++L L  ++A
Sbjct  398  RHLRPIFFAQPNVANPTFSNVSTYSPEQLLYCIASVIVSQLTLNYAVAPFMLLELKASIA  457

Query  286  AYGSVYYVGTIVPVVLIM-----LGNII  218
            A+ +VY+ G ++  + IM     LGN +
Sbjct  458  AWKAVYFYGHVLTFLAIMAFQNGLGNAL  485



>ref|XP_002497049.1| ZYRO0D14212p [Zygosaccharomyces rouxii]
 emb|CAR28116.1| ZYRO0D14212p [Zygosaccharomyces rouxii]
Length=607

 Score =   101 bits (252),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 66/179 (37%), Positives = 98/179 (55%), Gaps = 8/179 (4%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY  W+I+EAS I+ GLG++G+ +S   K  W+R +N+ I G+E+ ++  +    WN+ 
Sbjct  283  KYYAAWTIAEASCILCGLGYNGY-DSKTQKTKWNRVQNISIWGMEMGQNCHETLEAWNMN  341

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGS----  431
             + WL++YVY R+  KGKKPGF   + T   SA WHG  PGY + F   AL         
Sbjct  342  TNKWLKYYVYLRVARKGKKPGFRSTMFTFLTSAFWHGTRPGYYLTFATGALCQTCGKFFR  401

Query  430  ---RAIYRWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYV  263
               R I+  + G      K I  ++ F  T +   Y    F+VL   E++ A+GSVY+V
Sbjct  402  RHLRPIFLAEDGITPVSYKWIYDVVCFYVTKITFGYMVQPFIVLGFKESIYAWGSVYFV  460



>ref|XP_448977.1| hypothetical protein [Candida glabrata CBS 138]
 emb|CAG61947.1| unnamed protein product [Candida glabrata]
Length=622

 Score =   101 bits (252),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 64/183 (35%), Positives = 98/183 (54%), Gaps = 8/183 (4%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY  W+I+E + I+ GLG++G+ +    K  W+R +N+D+  VE A+S+ +    WN+ 
Sbjct  286  KYYAAWTIAEGACILCGLGYNGY-DPKTKKIKWNRVQNIDVYHVEFAQSTKECLEAWNMN  344

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSAL-MIAGS---  431
             + WL++Y+Y R+  KGKKPGF   L T   SA WHG  PGY + F   AL    G    
Sbjct  345  TNKWLKYYIYLRVAKKGKKPGFRSTLFTFLTSAFWHGTRPGYYMTFATGALYQTCGKFYR  404

Query  430  ---RAIYRWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVG  260
               R I+    G   A  K +  L+ F    L   Y  + F++L    ++ A+ +VY+ G
Sbjct  405  RNFRPIFLQADGKTAAASKWLYDLICFYVIKLSFGYLVIPFIILDFKTSMQAWSTVYFYG  464

Query  259  TIV  251
             I+
Sbjct  465  HII  467



>ref|XP_664134.1| hypothetical protein AN6530.2 [Aspergillus nidulans FGSC A4]
 gb|EAA57870.1| hypothetical protein AN6530.2 [Aspergillus nidulans FGSC A4]
 tpe|CBF70925.1| TPA: MBOAT family protein, putative (AFU_orthologue; AFUA_6G04860) 
[Aspergillus nidulans FGSC A4]
Length=463

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 65/182 (36%), Positives = 104/182 (57%), Gaps = 8/182 (4%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY +WS++E + I+SG+G++G+   +  K  W+R +N+D   +E A++S      WN  
Sbjct  187  KYYGVWSLTEGACILSGMGYNGFDPKTG-KVFWNRLQNIDPWKLETAQNSHAYLGNWNKN  245

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
             + WLR+YVY R+  KGKKPGF   +AT T SA WHG YPGY   FV  + +   ++   
Sbjct  246  TNHWLRNYVYLRVTPKGKKPGFRASMATFTTSAFWHGFYPGYYFSFVLGSFVQTVAKNFR  305

Query  418  RW-------QQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVG  260
            R+         GT     K+   ++++  T  V+++  + F+ LS  +++  +GSVYY G
Sbjct  306  RYVRPFFLSTDGTTPGPYKRYYDVVSWLVTQAVMSFVVLPFIYLSFSDSIHVWGSVYYYG  365

Query  259  TI  254
             I
Sbjct  366  II  367



>ref|XP_008601653.1| MBOAT family protein [Beauveria bassiana ARSEF 2860]
 gb|EJP62619.1| MBOAT family protein [Beauveria bassiana ARSEF 2860]
Length=538

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 64/178 (36%), Positives = 104/178 (58%), Gaps = 8/178 (4%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY +W+++E + I++GLG++G  +S   K  W+R +N+D +GVE A++       WN+ 
Sbjct  281  KYYGVWTLTEGACILAGLGYNG-VDSVTGKVSWNRLQNIDPIGVETAQNPRAYLGGWNMN  339

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
             + WLR+YVY R+  +GKKPGF   + T   SA+WHG YPGY + F+ ++L+   ++   
Sbjct  340  TNHWLRNYVYLRVTPRGKKPGFRASMITFATSALWHGFYPGYYLTFILASLIQTAAKNFR  399

Query  418  R------WQQGTGNAIL-KKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYY  266
            R       +  TG     KK   L +F  T +  +++ + FLVLS   +L A+  VY+
Sbjct  400  RHVRPFFLEANTGEPTKNKKYYDLASFFITQVTFSFATMPFLVLSFRGSLLAWSRVYF  457



>gb|EPS26117.1| hypothetical protein PDE_01053 [Penicillium oxalicum 114-2]
Length=556

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 67/190 (35%), Positives = 106/190 (56%), Gaps = 8/190 (4%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY +WS++E + I+SG+G++G+   S  K  W+R +NVD   +E A++S      WN  
Sbjct  280  KYYGVWSLTEGACILSGIGYNGFDPKSG-KVFWNRLENVDPWSLETAQNSYGYLGSWNKN  338

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
             + WLR+YVY R+  KGKKPGF   LAT   SA+WHG YPGY + FV  + +   ++   
Sbjct  339  TNHWLRNYVYLRVTPKGKKPGFRASLATFATSALWHGFYPGYYLTFVLGSFIQTVAKRFR  398

Query  418  RW-------QQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVG  260
            R+         GT     K+   ++++  T L L ++ + F+ L   +++A +  VY+ G
Sbjct  399  RYVRPFFMTPDGTKPTPYKRYYDILSWLATQLTLGFAVLPFIYLGFADSVAVWSRVYFYG  458

Query  259  TIVPVVLIML  230
             I     IM+
Sbjct  459  IIGTASSIMM  468



>gb|KGQ08072.1| Lysophospholipid acyltransferase [Beauveria bassiana D1-5]
Length=538

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 64/178 (36%), Positives = 104/178 (58%), Gaps = 8/178 (4%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY +W+++E + I++GLG++G  +S   K  W+R +N+D +GVE A++       WN+ 
Sbjct  281  KYYGVWTLTEGACILAGLGYNG-VDSVTGKVSWNRLQNIDPIGVETAQNPRAYLGGWNMN  339

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
             + WLR+YVY R+  +GKKPGF   + T   SA+WHG YPGY + F+ ++L+   ++   
Sbjct  340  TNHWLRNYVYLRVTPRGKKPGFRASMITFATSALWHGFYPGYYLTFILASLIQTAAKNFR  399

Query  418  R------WQQGTGNAIL-KKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYY  266
            R       +  TG     KK   L +F  T +  +++ + FLVLS   +L A+  VY+
Sbjct  400  RHVRPFFLEANTGEPTKNKKYYDLASFFITQVTFSFATMPFLVLSFRGSLLAWSRVYF  457



>dbj|GAA92222.1| MBOAT family protein [Aspergillus kawachii IFO 4308]
Length=555

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 62/182 (34%), Positives = 105/182 (58%), Gaps = 8/182 (4%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY +WS++E + I+SG+G++G+   S  K  W+R +N+D   +E A++S      WN  
Sbjct  280  KYYGVWSLTEGACILSGMGYNGFDPKSG-KVFWNRLENIDPWALETAQNSHGYLGSWNKN  338

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
             + WLR+YVY R+  +GKKPGF   LAT T SA WHG YPGY + F+  + +  G++   
Sbjct  339  TNHWLRNYVYLRVTPRGKKPGFRASLATFTTSAFWHGFYPGYYLTFILGSFIQTGAKNFR  398

Query  418  RW-------QQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVG  260
            R+         G+     K+   +M++  T + L+++ + F+ L    +++ + SVY+ G
Sbjct  399  RYVRPFFLTPDGSKPTPYKRYYDIMSWFATQVTLSFTVMPFIFLGFSASISVWRSVYFYG  458

Query  259  TI  254
             +
Sbjct  459  IV  460



>gb|EHA24428.1| hypothetical protein ASPNIDRAFT_40328 [Aspergillus niger ATCC 
1015]
Length=571

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 62/182 (34%), Positives = 105/182 (58%), Gaps = 8/182 (4%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY +WS++E + I+SG+G++G+   S  K  W+R +N+D   +E A++S      WN  
Sbjct  296  KYYGVWSLTEGACILSGMGYNGFDPKSG-KVFWNRLENIDPWSLETAQNSHGYLGSWNKN  354

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
             + WLR+YVY R+  +GKKPGF   LAT T SA WHG YPGY + F+  + +  G++   
Sbjct  355  TNHWLRNYVYLRVTPRGKKPGFRASLATFTTSAFWHGFYPGYYLTFILGSFIQTGAKNFR  414

Query  418  RW-------QQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVG  260
            R+         G+     K+   +M++  T + L+++ + F+ L   +++  + SVY+ G
Sbjct  415  RYVRPFFLTPDGSKPTPYKRYYDIMSWFVTQVTLSFTVMPFIFLGFSKSIGVWQSVYFYG  474

Query  259  TI  254
             +
Sbjct  475  IV  476



>ref|XP_008893288.1| hypothetical protein PPTG_01660 [Phytophthora parasitica INRA-310]
 gb|ETK85108.1| hypothetical protein L915_09980 [Phytophthora parasitica]
 gb|ETL91653.1| hypothetical protein L917_09807 [Phytophthora parasitica]
 gb|ETN21500.1| hypothetical protein PPTG_01660 [Phytophthora parasitica INRA-310]
 gb|ETO73759.1| hypothetical protein F444_10301 [Phytophthora parasitica P1976]
 gb|ETP43023.1| hypothetical protein F442_10107 [Phytophthora parasitica P10297]
Length=482

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 66/184 (36%), Positives = 100/184 (54%), Gaps = 10/184 (5%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY  W ++E + +++G GF G+ E + PK  WD   NVDILG EL  +  ++   WN  
Sbjct  292  KYYVAWKLAEGATVLTGTGFEGFDEQNNPKG-WDGVSNVDILGFELGANVREISRAWNKG  350

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
               WL  YVY R  +         LLAT +VSA+WHG YPGY +FF+   L  + +R   
Sbjct  351  TQNWLERYVYTRTGN--------SLLATYSVSALWHGFYPGYYLFFLTVPLATSVNRLAR  402

Query  418  RWQQG-TGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPVV  242
            R  +    ++ +K +  L+    T +V+NY  V F+VLS  + +A + S+ + G +  VV
Sbjct  403  RHVRPYVVDSPIKPLYDLVGMICTAMVVNYLAVSFVVLSWEDAVAGFRSMRFAGHVGLVV  462

Query  241  LIML  230
              +L
Sbjct  463  CYLL  466



>gb|ETI45133.1| hypothetical protein F443_10202 [Phytophthora parasitica P1569]
 gb|ETL38528.1| hypothetical protein L916_09891 [Phytophthora parasitica]
 gb|ETM44944.1| hypothetical protein L914_09862 [Phytophthora parasitica]
 gb|ETP14951.1| hypothetical protein F441_10143 [Phytophthora parasitica CJ01A1]
Length=482

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 66/184 (36%), Positives = 100/184 (54%), Gaps = 10/184 (5%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY  W ++E + +++G GF G+ E + PK  WD   NVDILG EL  +  ++   WN  
Sbjct  292  KYYVAWKLAEGATVLTGTGFEGFDEQNNPKG-WDGVSNVDILGFELGANVREISRAWNKG  350

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
               WL  YVY R  +         LLAT +VSA+WHG YPGY +FF+   L  + +R   
Sbjct  351  TQNWLERYVYTRTGN--------SLLATYSVSALWHGFYPGYYLFFLTVPLATSVNRLAR  402

Query  418  RWQQG-TGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPVV  242
            R  +    ++ +K +  L+    T +V+NY  V F+VLS  + +A + S+ + G +  VV
Sbjct  403  RHVRPYVVDSPIKPLYDLVGMICTAMVVNYLAVSFVVLSWEDAVAGFRSMRFAGHVGLVV  462

Query  241  LIML  230
              +L
Sbjct  463  CYLL  466



>ref|XP_001907785.1| hypothetical protein [Podospora anserina S mat+]
 emb|CAP68458.1| unnamed protein product [Podospora anserina S mat+]
 emb|CDP31930.1| Putative O-acyltransferase [Podospora anserina S mat+]
Length=558

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 68/189 (36%), Positives = 106/189 (56%), Gaps = 17/189 (9%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY +W+++E + I++GLGF G  +    K  W+R +N+D   VE A+++      WNI 
Sbjct  281  KYYGVWTMTEGACILAGLGFKG-VDPKTGKVSWERLRNIDPWEVEFAQNTRGYLGAWNIN  339

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
             + WLR+YVY R+  +GKKPGF   LAT T SA WHG YPGY + FV ++ +   ++ + 
Sbjct  340  TNQWLRNYVYLRVTPRGKKPGFRASLATFTTSAFWHGFYPGYYLSFVLASFIQTVAKKLR  399

Query  418  RW----------QQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVY  269
            R+          QQ   +   KK+    ++  T L  +Y+   FL+LS   ++  +  VY
Sbjct  400  RFFRPFFLDPKTQQPLPS---KKLYDFASWITTQLTFSYAAAPFLILSFSGSVTVWARVY  456

Query  268  Y---VGTIV  251
            +   VGT+V
Sbjct  457  FYAVVGTLV  465



>dbj|GAC96833.1| endoplasmic reticulum protein [Pseudozyma hubeiensis SY62]
Length=536

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 66/198 (33%), Positives = 104/198 (53%), Gaps = 23/198 (12%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWS+++++ I+SGLG++G          WDR +N+DI  +E A +  +L   WN+ 
Sbjct  276  KYYGIWSLTDSACIVSGLGYNGGDR-------WDRCRNIDIPKIEFANNWKELLDAWNMN  328

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
             + WLR+ VY+R+   GKKPGF   + T   SA WHGL PGY + FV +  M + ++ + 
Sbjct  329  TNVWLRNNVYKRIARPGKKPGFKSTMTTFFTSAFWHGLEPGYYMSFVLAGFMQSAAKMLR  388

Query  418  RW-------QQGTGNAILKKILAL--MNFAY-------TLLVLNYSCVGFLVLSLHETLA  287
            R        Q    N     +L       AY       + + LNY+   F++L    +LA
Sbjct  389  RHVRPLFFSQPNVPNPTFSNVLTFSPAQLAYCTASVIVSQITLNYAVAPFMLLEFKASLA  448

Query  286  AYGSVYYVGTIVPVVLIM  233
             + +VY+ G ++  V I+
Sbjct  449  GWKAVYFYGHVLTFVAIV  466



>gb|EPQ63874.1| Lysophospholipid acyltransferase [Blumeria graminis f. sp. tritici 
96224]
Length=436

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/182 (33%), Positives = 101/182 (55%), Gaps = 8/182 (4%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY +W++SE + I++G G+ G  +    K  W+R ++VD +GVE A+++      WNI 
Sbjct  186  KYYGVWALSEGACILAGYGYDG-IDPITGKASWNRLRHVDPIGVETAQNTRAYLGSWNIN  244

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
             S WLR+Y+Y R+   GKKPGF+  +AT   SA+WHG YPGY   F+ ++ +   ++   
Sbjct  245  TSNWLRNYIYLRVTPPGKKPGFWASMATFATSALWHGFYPGYYFTFILASFVQTAAKKCR  304

Query  418  RW-------QQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVG  260
            R+        Q +   +LK    +++F  T    ++    F+ L+L  +L  +  +Y+ G
Sbjct  305  RYFRPFFLDPQTSNPTVLKPYYDILSFLVTQATFSFVTAPFVFLTLDSSLKIWSGLYFYG  364

Query  259  TI  254
             I
Sbjct  365  VI  366



>ref|XP_002908002.1| lysophospholipid acyltransferase, putative [Phytophthora infestans 
T30-4]
 gb|EEY61085.1| lysophospholipid acyltransferase, putative [Phytophthora infestans 
T30-4]
Length=520

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 65/176 (37%), Positives = 96/176 (55%), Gaps = 10/176 (6%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY  W ++E + +++G GF G+ E + PK  WD   NVDILG EL  +  ++   WN  
Sbjct  330  KYYVAWKLAEGATVLTGTGFEGFDEQNNPKG-WDGVSNVDILGFELGANVREISRAWNKG  388

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
               WL  YVY R  +         LLAT +VSA+WHG YPGY +FF+   L  + +R   
Sbjct  389  TQNWLERYVYTRTGNS--------LLATYSVSALWHGFYPGYYLFFLTVPLATSVNRLAR  440

Query  418  RWQQG-TGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTI  254
            R  +    ++ LK +  L+    T LV+NY  V F+VLS  + +A + S+ + G +
Sbjct  441  RHVRPYVVDSPLKPLYDLVGMICTALVVNYLAVSFVVLSWEDAVAGFRSMRFTGHV  496



>ref|NP_596779.1| membrane bound O-acyltransferase, MBOAT (predicted) [Schizosaccharomyces 
pombe 972h-]
 sp|O42916.1|ALE1_SCHPO RecName: Full=Lysophospholipid acyltransferase; Short=LPLAT; 
AltName: Full=1-acyl-sn-glycerol-3-phosphate acyltransferase; 
Short=AGPAT; AltName: Full=Lysophosphatidic acid acyltransferase; 
Short=LPAAT; AltName: Full=Lysophosphatidylcholine acyltransferase; 
Short=LPCAT; AltName: Full=Lysophosphatidylethanolamine 
acyltransferase; Short=LPEAT [Schizosaccharomyces 
pombe 972h-]
 emb|CAA16861.1| membrane bound O-acyltransferase, MBOAT (predicted) [Schizosaccharomyces 
pombe]
 dbj|BAF93898.1| lysophospholipid acyltransferase [Schizosaccharomyces pombe]
Length=509

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 63/192 (33%), Positives = 105/192 (55%), Gaps = 9/192 (5%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY  W +S+ + I+SG+G++G   S  P+  WDR KN+D +  E A +       WN+ 
Sbjct  270  KYYGAWELSDGACILSGIGYNGLDSSKHPR--WDRVKNIDPIKFEFADNIKCALEAWNMN  327

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGS----  431
             + WLR+YVY R+  KGK+PGF   L+T TVSA+WHG+  GY + FV +A +   +    
Sbjct  328  TNKWLRNYVYLRVAKKGKRPGFKSTLSTFTVSAMWHGVSAGYYLTFVSAAFIQTVAKYTR  387

Query  430  ---RAIYRWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVG  260
               R  +           K++  ++    T L L+Y  + FL+L+L E++  +  +Y++ 
Sbjct  388  RHVRPFFLKPDMETPGPFKRVYDVIGMVATNLSLSYLIISFLLLNLKESIHVWKELYFIV  447

Query  259  TIVPVVLIMLGN  224
             I  ++ + + N
Sbjct  448  HIYILIALAVFN  459



>ref|XP_003713879.1| membrane-bound O-acyltransferase domain-containing protein 1 
[Magnaporthe oryzae 70-15]
 gb|EHA54072.1| membrane-bound O-acyltransferase domain-containing protein 1 
[Magnaporthe oryzae 70-15]
 gb|ELQ42130.1| membrane-bound O-acyltransferase domain-containing protein 1 
[Magnaporthe oryzae Y34]
 gb|ELQ66381.1| membrane-bound O-acyltransferase domain-containing protein 1 
[Magnaporthe oryzae P131]
Length=553

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 70/187 (37%), Positives = 106/187 (57%), Gaps = 17/187 (9%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY  WS+SE S I++GLG++G  +    K  W R +N++ LGVELA+++      WNI+
Sbjct  283  KYYGAWSLSEGSCILAGLGYNG-VDPVTGKVSWTRVQNINPLGVELAQNTRAYLENWNIK  341

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
             + WLR+YVY R+  +GKKPGF   +AT   SAVWHG YPGY + FV ++ +   ++   
Sbjct  342  TNMWLRNYVYLRVTPRGKKPGFRASMATFVTSAVWHGFYPGYYLSFVLASFIQTVAKNCR  401

Query  418  RW----------QQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVY  269
            R+          Q+   N   K+   +++F  T L   ++   FL+L L  ++  +  VY
Sbjct  402  RYFRPFFMDPTTQKALPN---KRFYDIVSFFATQLTFTFATTPFLLLRLGPSILVWSRVY  458

Query  268  Y---VGT  257
            Y   VGT
Sbjct  459  YYAIVGT  465



>ref|XP_002378255.1| MBOAT family protein, putative [Aspergillus flavus NRRL3357]
 gb|EED51248.1| MBOAT family protein, putative [Aspergillus flavus NRRL3357]
Length=461

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 64/186 (34%), Positives = 103/186 (55%), Gaps = 8/186 (4%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY +W ++E + ++SG+G++G+   S  K  W+R +NVD   +E A++S      WN  
Sbjct  187  KYYGVWYLTEGACVLSGMGYNGFDPKSG-KVFWNRLENVDPWSLETAQNSHGYLGSWNKN  245

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
             + WLR+YVY R+  KGKKPGF   LAT   SA WHG YPGY + FV  + +   ++   
Sbjct  246  TNHWLRNYVYLRVTPKGKKPGFRASLATFVTSAFWHGFYPGYYLTFVLGSFIQTVAKNFR  305

Query  418  RW-------QQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVG  260
            R          G+     KK   + ++  T L L+++ + F+ LS  +++  + SVY+ G
Sbjct  306  RHVRPFFLTPDGSRPTAYKKYYDIASYVVTQLTLSFAVMPFIFLSFGDSIKVWHSVYFYG  365

Query  259  TIVPVV  242
             +  +V
Sbjct  366  IVGNIV  371



>gb|KIV89225.1| hypothetical protein PV10_08811 [Exophiala mesophila]
Length=604

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 64/182 (35%), Positives = 98/182 (54%), Gaps = 8/182 (4%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY +W+++E + I+SGLG++G T+    K  WDR +NVD  G+E A++S      WN  
Sbjct  277  KYYAVWTMTEGACILSGLGYNG-TDPITGKARWDRLENVDAWGIETAQNSRAYLDSWNKN  335

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
             + WLR+YVY R+  KGKKPGF   LAT   SA WHG YPGY + FV  A +   ++   
Sbjct  336  TNKWLRNYVYLRVTPKGKKPGFRATLATFITSAFWHGFYPGYYLTFVLGAFIQTVAKNFR  395

Query  418  RW-------QQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVG  260
            R+         GT     K    + ++  T     ++   F++L  ++++  +  VY+  
Sbjct  396  RYVRPFFLTPDGTKPTKYKIYYDIASYFITQTAFCFTTAPFVILGFNDSILVWARVYFYA  455

Query  259  TI  254
             I
Sbjct  456  VI  457



>gb|KIO15837.1| hypothetical protein M407DRAFT_34555 [Tulasnella calospora MUT 
4182]
Length=505

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/183 (30%), Positives = 97/183 (53%), Gaps = 16/183 (9%)
 Frame = -2

Query  730  GLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQVSTWLRHYVYERLISK  551
            GLGF+G+ +      LWD+A N+D++ +E A +   L   WNI  +TWLR+ VY+RL   
Sbjct  289  GLGFNGFDKDG--STLWDKAANIDVMNIEFAPNVKVLLDNWNINTNTWLRNSVYKRLAPP  346

Query  550  GKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIYRWQQG-----------  404
            GKKPG    + T   SA+WHG+YPGY + F    L+ + +R +  + +            
Sbjct  347  GKKPGALVTMYTFMTSAIWHGIYPGYYLTFFLGGLVSSAARQVRTYIRPFFLPALLPPKS  406

Query  403  ---TGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPVVLIM  233
                   ++K++  ++     L+++NY    F++L L  ++ A+ ++ + G +  +  ++
Sbjct  407  KVLPPPTLIKRVYDVLGTVACLVIINYMAAPFMLLELRPSIKAWTTLLWYGHVTVLGWLI  466

Query  232  LGN  224
            LG 
Sbjct  467  LGQ  469



>gb|AJT74034.1| Ale1p [Saccharomyces cerevisiae YJM271]
Length=619

 Score =   100 bits (249),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 98/184 (53%), Gaps = 9/184 (5%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY  W+ISE S I+ GLG++G+ +    K  WDR +N+DI  VE A+++ ++   WN+ 
Sbjct  288  KYYAAWTISEGSCILCGLGYNGY-DPKTQKIRWDRVRNIDIWTVETAQNTREMLEAWNMN  346

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSAL-MIAGS---  431
             + WL++ VY R+  KGKKPGF   L T   SA WHG  PGY + F   AL    G    
Sbjct  347  TNKWLKYSVYLRVTKKGKKPGFRSTLFTFLTSAFWHGTRPGYYLTFATGALYQTCGKIYR  406

Query  430  ---RAIYRWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVY-YV  263
               R I+  + G      KKI  L+      L   Y    F++L L  +L  +GSVY YV
Sbjct  407  RNFRPIFLREDGVTPLPSKKIYDLVGIYAIKLAFGYMVQPFIILDLKPSLMVWGSVYFYV  466

Query  262  GTIV  251
              IV
Sbjct  467  HIIV  470



>gb|AJU10190.1| Ale1p [Saccharomyces cerevisiae YJM1463]
Length=619

 Score =   100 bits (248),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 98/184 (53%), Gaps = 9/184 (5%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY  W+ISE S I+ GLG++G+ +    K  WDR +N+DI  VE A+++ ++   WN+ 
Sbjct  288  KYYAAWTISEGSCILCGLGYNGY-DPKTQKIRWDRVRNIDIWTVETAQNTREMLEAWNMN  346

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSAL-MIAGS---  431
             + WL++ VY R+  KGKKPGF   L T   SA WHG  PGY + F   AL    G    
Sbjct  347  TNKWLKYSVYLRVTKKGKKPGFRSTLFTFLTSAFWHGTRPGYYLTFATGALYQTCGKIYR  406

Query  430  ---RAIYRWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVY-YV  263
               R I+  + G      KKI  L+      L   Y    F++L L  +L  +GSVY YV
Sbjct  407  RNFRPIFLREDGVTPLPSKKIYDLVGIYAIKLAFGYMVQPFIILDLKPSLMVWGSVYFYV  466

Query  262  GTIV  251
              IV
Sbjct  467  HIIV  470



>gb|AJU03859.1| Ale1p [Saccharomyces cerevisiae YJM1402]
 gb|AJU13624.1| Ale1p [Saccharomyces cerevisiae YJM1573]
Length=619

 Score =   100 bits (248),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 98/184 (53%), Gaps = 9/184 (5%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY  W+ISE S I+ GLG++G+ +    K  WDR +N+DI  VE A+++ ++   WN+ 
Sbjct  288  KYYAAWTISEGSCILCGLGYNGY-DPKTQKIRWDRVRNIDIWTVETAQNTREMLEAWNMN  346

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSAL-MIAGS---  431
             + WL++ VY R+  KGKKPGF   L T   SA WHG  PGY + F   AL    G    
Sbjct  347  TNKWLKYSVYLRVTKKGKKPGFRSTLFTFLTSAFWHGTRPGYYLTFATGALYQTCGKIYR  406

Query  430  ---RAIYRWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVY-YV  263
               R I+  + G      KKI  L+      L   Y    F++L L  +L  +GSVY YV
Sbjct  407  RNFRPIFLREDGVTPLPSKKIYDLVGIYAIKLAFGYMVQPFIILDLKPSLMVWGSVYFYV  466

Query  262  GTIV  251
              IV
Sbjct  467  HIIV  470



>gb|AJU02867.1| Ale1p [Saccharomyces cerevisiae YJM1400]
 gb|AJU11661.1| Ale1p [Saccharomyces cerevisiae YJM1479]
Length=619

 Score =   100 bits (248),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 98/184 (53%), Gaps = 9/184 (5%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY  W+ISE S I+ GLG++G+ +    K  WDR +N+DI  VE A+++ ++   WN+ 
Sbjct  288  KYYAAWTISEGSCILCGLGYNGY-DPKTQKIRWDRVRNIDIWTVETAQNTREMLEAWNMN  346

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSAL-MIAGS---  431
             + WL++ VY R+  KGKKPGF   L T   SA WHG  PGY + F   AL    G    
Sbjct  347  TNKWLKYSVYLRVTKKGKKPGFRSTLFTFLTSAFWHGTRPGYYLTFATGALYQTCGKIYR  406

Query  430  ---RAIYRWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVY-YV  263
               R I+  + G      KKI  L+      L   Y    F++L L  +L  +GSVY YV
Sbjct  407  RNFRPIFLREDGVTPLPSKKIYDLVGIYAIKLAFGYMVQPFIILDLKPSLMVWGSVYFYV  466

Query  262  GTIV  251
              IV
Sbjct  467  HIIV  470



>gb|AJT92097.1| Ale1p [Saccharomyces cerevisiae YJM1250]
Length=619

 Score =   100 bits (248),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 98/184 (53%), Gaps = 9/184 (5%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY  W+ISE S I+ GLG++G+ +    K  WDR +N+DI  VE A+++ ++   WN+ 
Sbjct  288  KYYAAWTISEGSCILCGLGYNGY-DPKTQKIRWDRVRNIDIWTVETAQNTREMLEAWNMN  346

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSAL-MIAGS---  431
             + WL++ VY R+  KGKKPGF   L T   SA WHG  PGY + F   AL    G    
Sbjct  347  TNKWLKYSVYLRVTKKGKKPGFRSTLFTFLTSAFWHGTRPGYYLTFATGALYQTCGKIYR  406

Query  430  ---RAIYRWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVY-YV  263
               R I+  + G      KKI  L+      L   Y    F++L L  +L  +GSVY YV
Sbjct  407  RNFRPIFLREDGVTPLPSKKIYDLVGIYAIKLAFGYMVQPFIILDLKPSLMVWGSVYFYV  466

Query  262  GTIV  251
              IV
Sbjct  467  HIIV  470



>gb|EEU07750.1| Ale1p [Saccharomyces cerevisiae JAY291]
 gb|AJT71116.1| Ale1p [Saccharomyces cerevisiae YJM189]
 gb|AJT75016.1| Ale1p [Saccharomyces cerevisiae YJM326]
 gb|AJT75990.1| Ale1p [Saccharomyces cerevisiae YJM450]
 gb|AJT77959.1| Ale1p [Saccharomyces cerevisiae YJM470]
 gb|AJT79431.1| Ale1p [Saccharomyces cerevisiae YJM555]
 gb|AJT80410.1| Ale1p [Saccharomyces cerevisiae YJM681]
 gb|AJT80906.1| Ale1p [Saccharomyces cerevisiae YJM682]
 gb|AJT87287.1| Ale1p [Saccharomyces cerevisiae YJM1083]
 gb|AJT89254.1| Ale1p [Saccharomyces cerevisiae YJM1199]
 gb|AJT90237.1| Ale1p [Saccharomyces cerevisiae YJM1208]
 gb|AJT90722.1| Ale1p [Saccharomyces cerevisiae YJM1242]
 gb|AJT93086.1| Ale1p [Saccharomyces cerevisiae YJM1273]
 gb|AJT94534.1| Ale1p [Saccharomyces cerevisiae YJM1311]
 gb|AJT96493.1| Ale1p [Saccharomyces cerevisiae YJM1338]
 gb|AJT96988.1| Ale1p [Saccharomyces cerevisiae YJM1341]
 gb|AJT97484.1| Ale1p [Saccharomyces cerevisiae YJM1342]
 gb|AJT97981.1| Ale1p [Saccharomyces cerevisiae YJM1355]
 gb|AJT98960.1| Ale1p [Saccharomyces cerevisiae YJM1381]
 gb|AJU02378.1| Ale1p [Saccharomyces cerevisiae YJM1399]
 gb|AJU03360.1| Ale1p [Saccharomyces cerevisiae YJM1401]
 gb|AJU04836.1| Ale1p [Saccharomyces cerevisiae YJM1417]
 gb|AJU05339.1| Ale1p [Saccharomyces cerevisiae YJM1418]
 gb|AJU05798.1| Ale1p [Saccharomyces cerevisiae YJM1419]
 gb|AJU06291.1| Ale1p [Saccharomyces cerevisiae YJM1433]
 gb|AJU06794.1| Ale1p [Saccharomyces cerevisiae YJM1434]
 gb|AJU07773.1| Ale1p [Saccharomyces cerevisiae YJM1443]
 gb|AJU08263.1| Ale1p [Saccharomyces cerevisiae YJM1444]
 gb|AJU08743.1| Ale1p [Saccharomyces cerevisiae YJM1447]
 gb|AJU10678.1| Ale1p [Saccharomyces cerevisiae YJM1477]
 gb|AJU13126.1| Ale1p [Saccharomyces cerevisiae YJM1549]
Length=619

 Score =   100 bits (248),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 98/184 (53%), Gaps = 9/184 (5%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY  W+ISE S I+ GLG++G+ +    K  WDR +N+DI  VE A+++ ++   WN+ 
Sbjct  288  KYYAAWTISEGSCILCGLGYNGY-DPKTQKIRWDRVRNIDIWTVETAQNTREMLEAWNMN  346

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSAL-MIAGS---  431
             + WL++ VY R+  KGKKPGF   L T   SA WHG  PGY + F   AL    G    
Sbjct  347  TNKWLKYSVYLRVTKKGKKPGFRSTLFTFLTSAFWHGTRPGYYLTFATGALYQTCGKIYR  406

Query  430  ---RAIYRWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVY-YV  263
               R I+  + G      KKI  L+      L   Y    F++L L  +L  +GSVY YV
Sbjct  407  RNFRPIFLREDGVTPLPSKKIYDLVGIYAIKLAFGYMVQPFIILDLKPSLMVWGSVYFYV  466

Query  262  GTIV  251
              IV
Sbjct  467  HIIV  470



>gb|AJT94055.1| Ale1p [Saccharomyces cerevisiae YJM1307]
 gb|AJU00919.1| Ale1p [Saccharomyces cerevisiae YJM1387]
 gb|AJU01407.1| Ale1p [Saccharomyces cerevisiae YJM1388]
 gb|AJU01890.1| Ale1p [Saccharomyces cerevisiae YJM1389]
 gb|AJU09705.1| Ale1p [Saccharomyces cerevisiae YJM1460]
 gb|AJU14607.1| Ale1p [Saccharomyces cerevisiae YJM1592]
Length=619

 Score =   100 bits (248),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 98/184 (53%), Gaps = 9/184 (5%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY  W+ISE S I+ GLG++G+ +    K  WDR +N+DI  VE A+++ ++   WN+ 
Sbjct  288  KYYAAWTISEGSCILCGLGYNGY-DPKTQKIRWDRVRNIDIWTVETAQNTREMLEAWNMN  346

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSAL-MIAGS---  431
             + WL++ VY R+  KGKKPGF   L T   SA WHG  PGY + F   AL    G    
Sbjct  347  TNKWLKYSVYLRVTKKGKKPGFRSTLFTFLTSAFWHGTRPGYYLTFATGALYQTCGKIYR  406

Query  430  ---RAIYRWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVY-YV  263
               R I+  + G      KKI  L+      L   Y    F++L L  +L  +GSVY YV
Sbjct  407  RNFRPIFLREDGVTPLPSKKIYDLVGIYAIKLAFGYMVQPFIILDLKPSLMVWGSVYFYV  466

Query  262  GTIV  251
              IV
Sbjct  467  HIIV  470



>ref|XP_001209647.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
 gb|EAU32345.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
Length=555

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 66/182 (36%), Positives = 102/182 (56%), Gaps = 8/182 (4%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY +WS++E + I+SG+G++G+   S  K  W+R +N+D  G+E A++S      WN  
Sbjct  280  KYYGVWSLTEGACILSGMGYNGFDPKSG-KVFWNRLENIDPWGLETAQNSHAYLGSWNKN  338

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
             + WLR+YVY R+  KGKKPGF   LAT   SA WHG YPGY + FV  + +   ++   
Sbjct  339  TNHWLRNYVYLRVTPKGKKPGFRASLATFATSAFWHGFYPGYYMTFVLGSFIQTVAKNFR  398

Query  418  RW-------QQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVG  260
            R+         G+     KK   + ++  T   L+++ V F+ LS   ++  + SVYY G
Sbjct  399  RYVRPFFLSPDGSKPTAYKKYYDIFSWFVTQATLSFAVVPFIFLSFGTSVRIWQSVYYYG  458

Query  259  TI  254
             +
Sbjct  459  IV  460



>gb|AJT88264.1| Ale1p [Saccharomyces cerevisiae YJM1133]
 gb|AJT88757.1| Ale1p [Saccharomyces cerevisiae YJM1190]
Length=619

 Score =   100 bits (248),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 98/184 (53%), Gaps = 9/184 (5%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY  W+ISE S I+ GLG++G+ +    K  WDR +N+DI  VE A+++ ++   WN+ 
Sbjct  288  KYYAAWTISEGSCILCGLGYNGY-DPKTQKIRWDRVRNIDIWTVETAQNTREMLEAWNMN  346

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSAL-MIAGS---  431
             + WL++ VY R+  KGKKPGF   L T   SA WHG  PGY + F   AL    G    
Sbjct  347  TNKWLKYSVYLRVTKKGKKPGFRSTLFTFLTSAFWHGTRPGYYLTFATGALYQTCGKIYR  406

Query  430  ---RAIYRWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVY-YV  263
               R I+  + G      KKI  L+      L   Y    F++L L  +L  +GSVY YV
Sbjct  407  RNFRPIFLREDGVTPLPSKKIYDLVGIYAIKLAFGYMVQPFIILDLKPSLMVWGSVYFYV  466

Query  262  GTIV  251
              IV
Sbjct  467  HIIV  470



>ref|XP_003958417.1| hypothetical protein KAFR_0G02490 [Kazachstania africana CBS 
2517]
 emb|CCF59282.1| hypothetical protein KAFR_0G02490 [Kazachstania africana CBS 
2517]
Length=616

 Score =   100 bits (248),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 69/186 (37%), Positives = 98/186 (53%), Gaps = 8/186 (4%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY  W ISE++ I+ GLG++G ++    K  WDR +N+DI  VE A+S+      WN+ 
Sbjct  278  KYYAAWIISESACILCGLGYNG-SDVKTGKIKWDRVRNIDIWAVEFAESTRDCLEAWNMN  336

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSAL-MIAGS---  431
             + WL++YVY R+  KGKKPGF   L T   SA WHG   GY + F   AL    G    
Sbjct  337  TNRWLKYYVYFRVAKKGKKPGFRSTLFTFLTSAFWHGFSAGYYLTFATGALYQTCGKFYR  396

Query  430  ---RAIYRWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVG  260
               R I+    G+     K I  +M +    L   Y  + FL L+  +++  + SVY+ G
Sbjct  397  RNFRPIFLSSDGSTAGKFKWIYDVMCWYVIKLSFGYLVMPFLALNFKDSILIWKSVYFYG  456

Query  259  TIVPVV  242
             I+ VV
Sbjct  457  HIIIVV  462



>ref|XP_001257694.1| MBOAT family protein [Neosartorya fischeri NRRL 181]
 gb|EAW15797.1| MBOAT family protein [Neosartorya fischeri NRRL 181]
Length=555

 Score = 99.8 bits (247),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 65/190 (34%), Positives = 106/190 (56%), Gaps = 8/190 (4%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY +WS++E + I+SGLG++G+   +  K  W+R +N+D   +E A++S      WN  
Sbjct  280  KYYGVWSLTEGACILSGLGYNGFDPKTG-KVFWNRLENIDPWSLETAQNSHGYLGSWNKN  338

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
             + WLR+YVY R+  KGKKPGF   LAT T SA WHG YPGY + F+  + +  G++   
Sbjct  339  TNHWLRNYVYLRVTPKGKKPGFRASLATFTTSAFWHGFYPGYYMTFILGSFVQTGAKNFR  398

Query  418  RW-------QQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVG  260
            R+         G      K+   + ++  T L +++  + F+ LS   ++  + SVY+ G
Sbjct  399  RYIRPFFLTPDGAKPLPTKRYYDIFSWFVTQLTMSFVVMPFIFLSFSSSIQVWRSVYFYG  458

Query  259  TIVPVVLIML  230
             I  ++ I+ 
Sbjct  459  IIGNILSIIF  468



>gb|AJT72094.1| Ale1p [Saccharomyces cerevisiae YJM195]
 gb|AJT91697.1| Ale1p [Saccharomyces cerevisiae YJM1248]
 gb|AJT99452.1| Ale1p [Saccharomyces cerevisiae YJM1383]
 gb|AJU00430.1| Ale1p [Saccharomyces cerevisiae YJM1386]
 gb|AJU07283.1| Ale1p [Saccharomyces cerevisiae YJM1439]
Length=619

 Score =   100 bits (248),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 98/184 (53%), Gaps = 9/184 (5%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY  W+ISE S I+ GLG++G+ +    K  WDR +N+DI  VE A+++ ++   WN+ 
Sbjct  288  KYYAAWTISEGSCILCGLGYNGY-DPKTQKIKWDRVRNIDIWTVETAQNTREMLEAWNMN  346

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSAL-MIAGS---  431
             + WL++ VY R+  KGKKPGF   L T   SA WHG  PGY + F   AL    G    
Sbjct  347  TNKWLKYSVYLRVTKKGKKPGFRSTLFTFLTSAFWHGTRPGYYLTFATGALYQTCGKIYR  406

Query  430  ---RAIYRWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVY-YV  263
               R I+  + G      KKI  L+      L   Y    F++L L  +L  +GSVY YV
Sbjct  407  RNFRPIFLREDGVTPLPSKKIYDLVGIYAIKLAFGYMVQPFIILDLKPSLMVWGSVYFYV  466

Query  262  GTIV  251
              IV
Sbjct  467  HIIV  470



>gb|EPX73246.1| membrane bound O-acyltransferase [Schizosaccharomyces octosporus 
yFS286]
Length=512

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 59/176 (34%), Positives = 93/176 (53%), Gaps = 9/176 (5%)
 Frame = -2

Query  730  GLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQVSTWLRHYVYERLISK  551
            G+G++G  E    +P WDR KN+D  G E A +       WN+  + WLR+YVY R+  K
Sbjct  286  GIGYNGVDELK--RPRWDRVKNIDPFGFEFAYNIKGALEAWNMNTNKWLRNYVYLRVAKK  343

Query  550  GKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGS-------RAIYRWQQGTGNA  392
            GK+PGF   L+T TVSA+WHG+ PGY + FV +A +   +       R  +         
Sbjct  344  GKRPGFKSTLSTFTVSALWHGVSPGYYMTFVSAAFIQTIAKYHRRFIRPFFLQPDMKTPG  403

Query  391  ILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVGTIVPVVLIMLGN  224
              K I  ++    T L ++Y  V FL+L+L E+   +  + ++  I  ++ I++ N
Sbjct  404  PFKSIYDIVGIVATNLSVSYLIVSFLLLTLKESFYVWSKLRFLIHIYTLLSIVIFN  459



>dbj|GAK64886.1| endoplasmic reticulum protein [Pseudozyma antarctica]
Length=531

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 68/198 (34%), Positives = 104/198 (53%), Gaps = 19/198 (10%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY IWS+++ + I+SGLG++G       +  W+R  NVDI  +ELA +  +L   WN+ 
Sbjct  269  KYYGIWSLTDGACILSGLGYNGVQNG---RTRWNRCSNVDIPKIELANNWKELLDHWNMN  325

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
             + WLR+ VY+R+   GKKPGF   + T   SA WHGL PGY + F+ +  M + ++ + 
Sbjct  326  TNVWLRNNVYKRIARPGKKPGFKSTMTTFFTSAFWHGLEPGYYLSFILAGFMQSAAKMLR  385

Query  418  RW-------QQGTGNAILKKI--LALMNFAYTLL-------VLNYSCVGFLVLSLHETLA  287
            R        Q    N     +   +    AY  L        LNY+   F++L L  ++A
Sbjct  386  RHVRPVFFAQPNVPNPTFSNVHTFSAGQLAYCTLSVAVSQATLNYAVAPFMLLELRASIA  445

Query  286  AYGSVYYVGTIVPVVLIM  233
             + +VY+ G IV  V I+
Sbjct  446  GWKAVYFYGHIVTAVAIL  463



>gb|EPE07275.1| mboat family protein [Ophiostoma piceae UAMH 11346]
Length=618

 Score =   100 bits (248),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 63/186 (34%), Positives = 108/186 (58%), Gaps = 11/186 (6%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY +WS++E + I++GLGF+G  + +  +  W+R  N+D  GVE A+++      WN++
Sbjct  281  KYYGVWSLTEGACILTGLGFNG-VDPATGRISWNRVANIDPWGVESAQNTRAYLENWNMK  339

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALM---IAGSR  428
             ++WLR+YVY R+  +GKKPGF   +AT   SA WHG +PGY + FV ++ +       R
Sbjct  340  TNSWLRNYVYLRVTPRGKKPGFRASMATFVTSAFWHGFFPGYYLSFVLASFIQTVAKNCR  399

Query  427  AIYRWQQGTGNAILKKILALMNFAY-------TLLVLNYSCVGFLVLSLHETLAAYGSVY  269
             ++R    +  A LKK L    + Y       T L+ +++   F++L++H++  A+  VY
Sbjct  400  RLFRPFFFSDPATLKKPLPSKAWLYDPLSWLSTQLIFSFAVAPFVLLNMHDSFLAWSRVY  459

Query  268  YVGTIV  251
            +   + 
Sbjct  460  FYAVVA  465



>gb|KIV80618.1| hypothetical protein, variant [Exophiala sideris]
Length=514

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 65/189 (34%), Positives = 102/189 (54%), Gaps = 9/189 (5%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY +W+++E + I++G+G++G  + +  KP WDR +NV+  G+E A++S      WN  
Sbjct  184  KYYAVWALTEGACIMAGIGYNG-IDPATGKPRWDRLENVNAWGIESAQNSRAYLDNWNKN  242

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
             + WLR+YVY R+  KGKKPGF   LAT   SAVWHG YPGY + FV  A +   ++   
Sbjct  243  TNKWLRNYVYLRVTPKGKKPGFRATLATFITSAVWHGFYPGYYLTFVLGAFVQTVAKNSR  302

Query  418  RW-------QQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVG  260
            R+         G  +   K    +  +  T L   +    F++L   ++L  +  VY+  
Sbjct  303  RYIRPFFLTPDGKKSTSYKIYYDIAGYIATQLTFCFVTAPFVLLGFSDSLKVWARVYFYA  362

Query  259  TIVPVVLIM  233
             I+ V + M
Sbjct  363  -IIEVAVAM  370



>gb|KIW88666.1| hypothetical protein Z519_10712 [Cladophialophora bantiana CBS 
173.52]
Length=592

 Score = 99.8 bits (247),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 66/189 (35%), Positives = 103/189 (54%), Gaps = 9/189 (5%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY +WS++E + I++G+ ++G  E +  K  WD  +NV+  G+E+A++S      WN  
Sbjct  278  KYYGVWSLTEGACIMAGISYNGIDEKTG-KAKWDHLENVNPWGIEMAQNSRAYLDNWNKN  336

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
             + WLR+Y+Y R+  KGKKPGF   LAT   SA+WHG YPGY + FV +A +   ++   
Sbjct  337  TNKWLRNYIYLRVTPKGKKPGFRATLATFLTSALWHGFYPGYYLTFVLAAFIQTVAKNFR  396

Query  418  RW-------QQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVG  260
            R+         GT     K     + +  T L   ++   F+VL  H++L  +  VY+  
Sbjct  397  RYVRPFFLTPDGTRPTRYKIYYDALGYVATQLAFCFTTAPFVVLGFHDSLKVWARVYFY-  455

Query  259  TIVPVVLIM  233
            T+V V   M
Sbjct  456  TVVGVCASM  464



>gb|EPY50263.1| membrane bound O-acyltransferase [Schizosaccharomyces cryophilus 
OY26]
Length=512

 Score = 99.0 bits (245),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 64/180 (36%), Positives = 103/180 (57%), Gaps = 11/180 (6%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY  W +S+ + I+SG+G++G  E    +P WDR KN+D +G E A +       WN  
Sbjct  270  KYYGAWELSDGACILSGIGYNGVDELK--RPRWDRVKNIDPIGFEFASNIKGALEAWNKN  327

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIAGSRAIY  419
             + WLR+YVY R+  KGK+PGF   L+T TVSA+WHG+ PGY   FV +A +   ++   
Sbjct  328  TNKWLRNYVYLRVAKKGKRPGFKSTLSTFTVSALWHGVSPGYYTTFVSAAFVQTIAKYHR  387

Query  418  RW------QQG--TGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYV  263
            R+      QQ   T N+  KK+   +    T + ++Y  + FL+L+L +++  +  + ++
Sbjct  388  RYIRPFFLQQDMKTPNS-FKKVYDFVGVVATNITVSYLIISFLLLTLSDSIYVWSKLRFL  446



>gb|KIM67661.1| hypothetical protein SCLCIDRAFT_13849 [Scleroderma citrinum Foug 
A]
Length=510

 Score = 99.0 bits (245),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 62/170 (36%), Positives = 94/170 (55%), Gaps = 9/170 (5%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY  W ++E +II++G GF+G+  S   + LW+ A NV  L +E   +   L   WNI 
Sbjct  264  KYYAAWILTEGAIILTGYGFTGYNPSG--ESLWEGAANVRFLNIEFPPNFKVLLDSWNIN  321

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALMIA------  437
             + WLR  VY+R+ SKGKKPGF   + T   SA WHG+ PGY + FV  A +        
Sbjct  322  TNVWLRECVYKRVTSKGKKPGFKSSMLTSLTSAFWHGIAPGYYLTFVFGAFVTTAARLCR  381

Query  436  -GSRAIYRWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETL  290
             G R +     G    I K++  ++    T+L++NY+ + F++L L ++L
Sbjct  382  VGFRPLVLPPPGAPTTIAKRVYDILGTVVTILLVNYAAMPFILLDLKDSL  431



>ref|XP_003676874.1| hypothetical protein NCAS_0F00340 [Naumovozyma castellii CBS 
4309]
 emb|CCC70518.1| hypothetical protein NCAS_0F00340 [Naumovozyma castellii CBS 
4309]
Length=615

 Score = 99.4 bits (246),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 68/183 (37%), Positives = 99/183 (54%), Gaps = 8/183 (4%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY  W+I+EAS I  GLG++G+ ++   K  W+R +N+DI  VE+A+++ Q    WN+ 
Sbjct  288  KYYAAWTIAEASCISCGLGYNGY-DTKTQKIKWNRVQNIDIWNVEMAQNTRQCLEGWNMN  346

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSAL-MIAGS---  431
             + WL++ VY R++ KGKKPGF   + T   SA WHG  PGY + F   AL    G    
Sbjct  347  TNKWLKYTVYLRVVKKGKKPGFRATMFTFLTSAFWHGTRPGYYLTFATGALYQTCGKFYR  406

Query  430  ---RAIYRWQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVYYVG  260
               R I+    G      K +  ++      +   Y    FL+L   E+L A+GSVY+ G
Sbjct  407  RNFRPIFLASDGVTPLPYKWVYDVVGMWVIKISFGYLVEPFLLLDFKESLVAWGSVYFYG  466

Query  259  TIV  251
             IV
Sbjct  467  HIV  469



>gb|KJX99558.1| mboat family protein [Zymoseptoria brevis]
Length=473

 Score = 98.6 bits (244),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 68/185 (37%), Positives = 100/185 (54%), Gaps = 14/185 (8%)
 Frame = -2

Query  778  KYYxiwsiseasiiiSGLGFSGWTESSPPKPLWDRAKNVDILGVELAKSSVQLPLVWNIQ  599
            KYY +W+++E + I+SG+G+ G  +    KP WDR  N+  LGVELA++S      WNI 
Sbjct  187  KYYGVWTLTEGACILSGIGYKG-IDPKTGKPNWDRLTNIKPLGVELAQNSHAYLGNWNIN  245

Query  598  VSTWLRHYVYERLISKGKKPGFFQLLATQTVSAVWHGLYPGYMIFFVQSALM---IAGSR  428
             + WLR+Y+Y R+  KGKKPGF   +AT   SA WHG  PGY + FV ++ +      SR
Sbjct  246  TNHWLRNYMYLRVTPKGKKPGFRASMATFVTSAFWHGFAPGYYMSFVLASFIQNVAKNSR  305

Query  427  AIYR-------WQQGTGNAILKKILALMNFAYTLLVLNYSCVGFLVLSLHETLAAYGSVY  269
             + R         Q T N I   I   +    T LV +++   F++LS+  +   +  VY
Sbjct  306  RLLRPFFLTPDGSQATSNKIYYDIFTWL---VTQLVFSFTTAPFILLSIRSSTLVWARVY  362

Query  268  YVGTI  254
            +   I
Sbjct  363  FYAII  367



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1559042875252