BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig4109

Length=650
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009602919.1|  PREDICTED: galactose oxidase                       229   3e-68   Nicotiana tomentosiformis
ref|XP_009774166.1|  PREDICTED: galactose oxidase                       227   4e-67   Nicotiana sylvestris
ref|XP_004249644.1|  PREDICTED: galactose oxidase                       225   2e-66   Solanum lycopersicum
ref|XP_006349488.1|  PREDICTED: galactose oxidase-like                  224   3e-66   Solanum tuberosum [potatoes]
emb|CDP06561.1|  unnamed protein product                                221   1e-64   Coffea canephora [robusta coffee]
ref|XP_011094925.1|  PREDICTED: galactose oxidase                       219   2e-64   Sesamum indicum [beniseed]
ref|XP_010044010.1|  PREDICTED: galactose oxidase                       216   4e-63   Eucalyptus grandis [rose gum]
ref|XP_010262660.1|  PREDICTED: galactose oxidase                       214   3e-62   Nelumbo nucifera [Indian lotus]
ref|XP_012087985.1|  PREDICTED: galactose oxidase                       214   3e-62   
ref|XP_006429215.1|  hypothetical protein CICLE_v10011448mg             212   1e-61   Citrus clementina [clementine]
ref|XP_006480899.1|  PREDICTED: galactose oxidase-like                  211   3e-61   Citrus sinensis [apfelsine]
gb|KDO57956.1|  hypothetical protein CISIN_1g044265mg                   210   6e-61   Citrus sinensis [apfelsine]
ref|XP_002322929.1|  glyoxal oxidase-related family protein             208   3e-60   Populus trichocarpa [western balsam poplar]
ref|XP_008442498.1|  PREDICTED: LOW QUALITY PROTEIN: galactose ox...    207   1e-59   Cucumis melo [Oriental melon]
ref|XP_006403635.1|  hypothetical protein EUTSA_v100109141mg            197   1e-59   
ref|XP_011006630.1|  PREDICTED: galactose oxidase                       206   2e-59   Populus euphratica
dbj|BAH20389.1|  AT3G53950                                              201   2e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004137754.1|  PREDICTED: galactose oxidase                       206   4e-59   Cucumis sativus [cucumbers]
ref|XP_008240187.1|  PREDICTED: galactose oxidase                       205   6e-59   Prunus mume [ume]
ref|XP_008359690.1|  PREDICTED: LOW QUALITY PROTEIN: galactose ox...    205   7e-59   
gb|EYU41788.1|  hypothetical protein MIMGU_mgv1a004290mg                204   1e-58   Erythranthe guttata [common monkey flower]
gb|KJB36661.1|  hypothetical protein B456_006G169500                    204   1e-58   Gossypium raimondii
ref|XP_007208466.1|  hypothetical protein PRUPE_ppa003992mg             203   3e-58   Prunus persica
ref|XP_002876232.1|  hypothetical protein ARALYDRAFT_485786             202   5e-58   
ref|XP_010427056.1|  PREDICTED: galactose oxidase-like                  202   6e-58   Camelina sativa [gold-of-pleasure]
ref|NP_190963.1|  glyoxal oxidase-related protein                       202   8e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004305171.1|  PREDICTED: galactose oxidase                       202   9e-58   Fragaria vesca subsp. vesca
ref|XP_004507195.1|  PREDICTED: galactose oxidase-like                  202   1e-57   Cicer arietinum [garbanzo]
emb|CDY59162.1|  BnaC06g42590D                                          201   2e-57   Brassica napus [oilseed rape]
emb|CBI30475.3|  unnamed protein product                                197   2e-57   Vitis vinifera
ref|XP_010504181.1|  PREDICTED: galactose oxidase-like                  200   6e-57   Camelina sativa [gold-of-pleasure]
emb|CDX67577.1|  BnaA07g16170D                                          200   7e-57   
ref|XP_009103886.1|  PREDICTED: galactose oxidase                       199   9e-57   Brassica rapa
ref|XP_010515903.1|  PREDICTED: galactose oxidase-like                  199   1e-56   Camelina sativa [gold-of-pleasure]
ref|XP_007134016.1|  hypothetical protein PHAVU_010G012100g             197   4e-56   Phaseolus vulgaris [French bean]
ref|XP_009378871.1|  PREDICTED: galactose oxidase                       197   4e-56   
ref|XP_006290869.1|  hypothetical protein CARUB_v10016978mg             197   4e-56   Capsella rubella
gb|ACV49899.1|  glyoxal oxidase                                         196   8e-56   Vitis vinifera
gb|ACV49897.1|  glyoxal oxidase                                         196   9e-56   Vitis pseudoreticulata
gb|ABA42922.1|  glyoxal oxidase                                         196   9e-56   Vitis pseudoreticulata
ref|XP_010674911.1|  PREDICTED: uncharacterized protein LOC104890981    196   1e-55   Beta vulgaris subsp. vulgaris [field beet]
gb|ACV49898.1|  glyoxal oxidase                                         196   1e-55   Vitis vinifera
ref|XP_002274763.1|  PREDICTED: galactose oxidase                       196   1e-55   Vitis vinifera
ref|XP_010088559.1|  hypothetical protein L484_016951                   194   1e-54   Morus notabilis
gb|KFK34638.1|  hypothetical protein AALP_AA5G172000                    193   2e-54   Arabis alpina [alpine rockcress]
ref|XP_007026880.1|  Glyoxal oxidase-related protein                    194   1e-53   
gb|AFK44665.1|  unknown                                                 181   2e-53   Medicago truncatula
ref|XP_003516307.1|  PREDICTED: galactose oxidase-like                  190   4e-53   Glycine max [soybeans]
gb|KEH28959.1|  glyoxal oxidase amino-terminal protein                  188   1e-52   Medicago truncatula
ref|XP_010553274.1|  PREDICTED: galactose oxidase                       188   1e-52   Tarenaya hassleriana [spider flower]
ref|XP_003520957.1|  PREDICTED: uncharacterized protein LOC100776515    188   2e-52   Glycine max [soybeans]
gb|EPS61181.1|  glyoxal oxidase                                         187   2e-52   Genlisea aurea
ref|XP_010905399.1|  PREDICTED: LOW QUALITY PROTEIN: galactose ox...    186   1e-51   
ref|XP_006850437.1|  PREDICTED: galactose oxidase                       184   4e-51   Amborella trichopoda
ref|XP_008811510.1|  PREDICTED: galactose oxidase                       182   3e-50   Phoenix dactylifera
gb|KHN14867.1|  Galactose oxidase                                       175   6e-49   Glycine soja [wild soybean]
ref|XP_009421296.1|  PREDICTED: galactose oxidase                       177   2e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002972585.1|  hypothetical protein SELMODRAFT_97196              143   5e-36   Selaginella moellendorffii
ref|XP_002972039.1|  hypothetical protein SELMODRAFT_441651             142   8e-36   Selaginella moellendorffii
gb|AFG64082.1|  hypothetical protein 2_2702_01                          132   2e-35   Pinus taeda
gb|AEW08192.1|  hypothetical protein 2_2702_01                          131   6e-35   Pinus lambertiana
gb|AFG64084.1|  hypothetical protein 2_2702_01                          130   9e-35   Pinus taeda
ref|XP_002970607.1|  hypothetical protein SELMODRAFT_411320             138   1e-34   Selaginella moellendorffii
gb|AFG64090.1|  hypothetical protein 2_2702_01                          129   3e-34   Pinus taeda
ref|XP_001771982.1|  predicted protein                                  137   3e-34   
gb|AEW08193.1|  hypothetical protein 2_2702_01                          129   3e-34   Pinus radiata
ref|XP_002968444.1|  hypothetical protein SELMODRAFT_231119             137   4e-34   
ref|XP_001774194.1|  predicted protein                                  137   6e-34   
ref|XP_001774885.1|  predicted protein                                  137   6e-34   
ref|XP_001763031.1|  predicted protein                                  136   7e-34   
ref|XP_001759192.1|  predicted protein                                  136   1e-33   
ref|XP_001756237.1|  predicted protein                                  132   2e-32   
ref|XP_001764698.1|  predicted protein                                  128   4e-31   
ref|XP_002970610.1|  hypothetical protein SELMODRAFT_93556              128   6e-31   Selaginella moellendorffii
ref|XP_001759194.1|  predicted protein                                  126   2e-30   
ref|XP_001783776.1|  predicted protein                                  126   3e-30   
ref|XP_002968445.1|  hypothetical protein SELMODRAFT_89852              125   6e-30   Selaginella moellendorffii
gb|KFK26190.1|  hypothetical protein AALP_AA8G214300                    125   2e-29   Arabis alpina [alpine rockcress]
ref|XP_001772413.1|  predicted protein                                  123   4e-29   
gb|KJB16941.1|  hypothetical protein B456_002G255700                    122   5e-29   Gossypium raimondii
ref|XP_001774105.1|  predicted protein                                  122   8e-29   
ref|XP_001778975.1|  predicted protein                                  122   1e-28   
ref|XP_001767275.1|  predicted protein                                  121   1e-28   
ref|XP_001758038.1|  predicted protein                                  120   3e-28   
ref|XP_001782509.1|  predicted protein                                  120   4e-28   
ref|XP_001777189.1|  predicted protein                                  120   6e-28   
ref|XP_001769885.1|  predicted protein                                  119   1e-27   
gb|KFK44114.1|  hypothetical protein AALP_AA1G217400                    114   2e-27   Arabis alpina [alpine rockcress]
ref|XP_001760507.1|  predicted protein                                  118   2e-27   
ref|XP_006400518.1|  hypothetical protein EUTSA_v10012975mg             119   2e-27   Eutrema salsugineum [saltwater cress]
ref|XP_006400519.1|  hypothetical protein EUTSA_v10012975mg             119   2e-27   
ref|XP_001784508.1|  predicted protein                                  119   2e-27   
emb|CDY44928.1|  BnaA02g04330D                                          118   5e-27   Brassica napus [oilseed rape]
ref|XP_009126377.1|  PREDICTED: galactose oxidase-like                  117   6e-27   Brassica rapa
ref|XP_006392509.1|  hypothetical protein EUTSA_v10023396mg             117   7e-27   Eutrema salsugineum [saltwater cress]
ref|XP_010916153.1|  PREDICTED: galactose oxidase-like                  117   8e-27   Elaeis guineensis
gb|KFK35620.1|  hypothetical protein AALP_AA4G014800                    117   8e-27   Arabis alpina [alpine rockcress]
ref|XP_001757263.1|  predicted protein                                  117   9e-27   
ref|XP_008389005.1|  PREDICTED: galactose oxidase                       117   1e-26   Malus domestica [apple tree]
gb|KDP29261.1|  hypothetical protein JCGZ_16650                         113   1e-26   Jatropha curcas
ref|XP_002873953.1|  hypothetical protein ARALYDRAFT_488852             117   1e-26   
emb|CDY42279.1|  BnaC02g08850D                                          117   1e-26   Brassica napus [oilseed rape]
ref|XP_001751488.1|  predicted protein                                  116   1e-26   
ref|XP_008775019.1|  PREDICTED: galactose oxidase-like                  116   1e-26   Phoenix dactylifera
ref|XP_001762124.1|  predicted protein                                  116   1e-26   
emb|CDY12635.1|  BnaA02g13030D                                          110   2e-26   Brassica napus [oilseed rape]
ref|XP_001765643.1|  predicted protein                                  115   2e-26   
emb|CAN73409.1|  hypothetical protein VITISV_024374                     115   2e-26   Vitis vinifera
ref|XP_006381726.1|  hypothetical protein POPTR_0006s16390g             116   3e-26   Populus trichocarpa [western balsam poplar]
ref|XP_010493033.1|  PREDICTED: galactose oxidase-like                  116   3e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010504696.1|  PREDICTED: galactose oxidase-like                  115   3e-26   Camelina sativa [gold-of-pleasure]
gb|AAL84955.1|  AT5g19580/T20D1_100                                     115   4e-26   Arabidopsis thaliana [mouse-ear cress]
ref|NP_197459.1|  glyoxal oxidase-related protein                       115   4e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_012082614.1|  PREDICTED: galactose oxidase-like                  112   5e-26   
gb|KFK44113.1|  hypothetical protein AALP_AA1G217400                    114   6e-26   Arabis alpina [alpine rockcress]
ref|XP_001776127.1|  predicted protein                                  114   6e-26   
ref|XP_010470629.1|  PREDICTED: galactose oxidase-like isoform X1       115   6e-26   
ref|XP_006290310.1|  hypothetical protein CARUB_v10019204mg             114   6e-26   Capsella rubella
ref|XP_010454240.1|  PREDICTED: galactose oxidase-like                  115   6e-26   Camelina sativa [gold-of-pleasure]
emb|CDX92518.1|  BnaA10g15570D                                          115   6e-26   
emb|CDY58964.1|  BnaC09g38100D                                          114   7e-26   Brassica napus [oilseed rape]
ref|XP_009606830.1|  PREDICTED: galactose oxidase                       114   7e-26   Nicotiana tomentosiformis
ref|XP_008813838.1|  PREDICTED: galactose oxidase-like                  114   8e-26   Phoenix dactylifera
ref|XP_001762682.1|  predicted protein                                  114   8e-26   
emb|CDP08591.1|  unnamed protein product                                114   9e-26   Coffea canephora [robusta coffee]
ref|XP_006287335.1|  hypothetical protein CARUB_v10000533mg             114   1e-25   Capsella rubella
ref|XP_006471853.1|  PREDICTED: galactose oxidase-like                  114   1e-25   Citrus sinensis [apfelsine]
ref|XP_006382737.1|  glyoxal oxidase-related family protein             114   1e-25   Populus trichocarpa [western balsam poplar]
ref|XP_002876427.1|  hypothetical protein ARALYDRAFT_907231             114   1e-25   Arabidopsis lyrata subsp. lyrata
emb|CDY62245.1|  BnaC01g42480D                                          114   1e-25   Brassica napus [oilseed rape]
ref|XP_009364601.1|  PREDICTED: galactose oxidase                       113   2e-25   Pyrus x bretschneideri [bai li]
ref|XP_010424026.1|  PREDICTED: galactose oxidase-like                  113   2e-25   
ref|XP_009106213.1|  PREDICTED: galactose oxidase isoform X2            113   2e-25   Brassica rapa
emb|CDY47509.1|  BnaAnng09070D                                          113   2e-25   Brassica napus [oilseed rape]
emb|CDX73183.1|  BnaC06g36310D                                          113   2e-25   
ref|XP_010516382.1|  PREDICTED: galactose oxidase-like                  113   3e-25   Camelina sativa [gold-of-pleasure]
ref|XP_007208189.1|  hypothetical protein PRUPE_ppa020922mg             112   3e-25   
ref|XP_004304717.1|  PREDICTED: galactose oxidase                       112   3e-25   Fragaria vesca subsp. vesca
ref|XP_009106212.1|  PREDICTED: galactose oxidase isoform X1            113   3e-25   Brassica rapa
emb|CDY44816.1|  BnaCnng11720D                                          112   3e-25   Brassica napus [oilseed rape]
ref|XP_010420764.1|  PREDICTED: galactose oxidase-like isoform X1       113   3e-25   Camelina sativa [gold-of-pleasure]
gb|KDP29262.1|  hypothetical protein JCGZ_16651                         113   3e-25   Jatropha curcas
ref|XP_009119411.1|  PREDICTED: galactose oxidase                       112   3e-25   Brassica rapa
ref|XP_004239377.1|  PREDICTED: galactose oxidase-like                  112   3e-25   Solanum lycopersicum
gb|EPS72896.1|  hypothetical protein M569_01859                         112   3e-25   Genlisea aurea
ref|XP_011071032.1|  PREDICTED: galactose oxidase-like                  113   4e-25   Sesamum indicum [beniseed]
ref|XP_012082568.1|  PREDICTED: galactose oxidase-like isoform X2       113   4e-25   
ref|XP_012082567.1|  PREDICTED: galactose oxidase-like isoform X1       113   4e-25   
ref|XP_004298452.1|  PREDICTED: galactose oxidase-like                  112   4e-25   Fragaria vesca subsp. vesca
gb|KHN09108.1|  Galactose oxidase                                       108   4e-25   Glycine soja [wild soybean]
ref|XP_001762118.1|  predicted protein                                  112   4e-25   
gb|EYU23055.1|  hypothetical protein MIMGU_mgv1a021812mg                112   5e-25   Erythranthe guttata [common monkey flower]
gb|KDP29259.1|  hypothetical protein JCGZ_16648                         113   5e-25   Jatropha curcas
ref|XP_011009462.1|  PREDICTED: galactose oxidase-like                  112   5e-25   Populus euphratica
ref|XP_002888587.1|  hypothetical protein ARALYDRAFT_475824             112   5e-25   
ref|NP_191321.1|  glyoxal oxidase-related protein                       111   7e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010105253.1|  hypothetical protein L484_019396                   111   9e-25   Morus notabilis
gb|KFK37635.1|  hypothetical protein AALP_AA3G008700                    111   9e-25   Arabis alpina [alpine rockcress]
ref|XP_006300296.1|  hypothetical protein CARUB_v10021300mg             111   1e-24   Capsella rubella
gb|AET97563.1|  galactose oxidase                                       111   1e-24   Ziziphus jujuba [Chinese jujube]
emb|CBI34230.3|  unnamed protein product                                109   1e-24   Vitis vinifera
ref|XP_007030653.1|  Glyoxal oxidase-related protein                    110   2e-24   
ref|XP_006473606.1|  PREDICTED: galactose oxidase-like                  110   2e-24   Citrus sinensis [apfelsine]
gb|KDO84767.1|  hypothetical protein CISIN_1g009420mg                   110   2e-24   Citrus sinensis [apfelsine]
ref|XP_006435123.1|  hypothetical protein CICLE_v10003275mg             110   2e-24   
ref|XP_010670846.1|  PREDICTED: galactose oxidase-like                  110   2e-24   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006416454.1|  hypothetical protein EUTSA_v10007284mg             110   2e-24   Eutrema salsugineum [saltwater cress]
ref|XP_008218222.1|  PREDICTED: galactose oxidase                       110   2e-24   Prunus mume [ume]
ref|XP_009801814.1|  PREDICTED: galactose oxidase                       110   2e-24   Nicotiana sylvestris
ref|XP_009393211.1|  PREDICTED: galactose oxidase-like                  110   3e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010416451.1|  PREDICTED: galactose oxidase-like isoform X2       109   3e-24   Camelina sativa [gold-of-pleasure]
ref|NP_176897.1|  glyoxal oxidase-related protein                       110   3e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010660091.1|  PREDICTED: galactose oxidase                       109   4e-24   Vitis vinifera
ref|XP_009619752.1|  PREDICTED: galactose oxidase-like                  110   4e-24   Nicotiana tomentosiformis
emb|CDY51183.1|  BnaC02g45610D                                          110   4e-24   Brassica napus [oilseed rape]
ref|XP_009335433.1|  PREDICTED: galactose oxidase-like                  109   4e-24   Pyrus x bretschneideri [bai li]
ref|XP_009127543.1|  PREDICTED: galactose oxidase-like                  110   4e-24   Brassica rapa
ref|XP_010416450.1|  PREDICTED: galactose oxidase-like isoform X1       109   5e-24   Camelina sativa [gold-of-pleasure]
ref|XP_003519774.1|  PREDICTED: galactose oxidase-like                  109   5e-24   Glycine max [soybeans]
ref|XP_010670864.1|  PREDICTED: galactose oxidase-like                  110   5e-24   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB50703.1|  hypothetical protein B456_008G183000                    109   5e-24   Gossypium raimondii
ref|XP_010256224.1|  PREDICTED: galactose oxidase                       109   5e-24   Nelumbo nucifera [Indian lotus]
ref|XP_010471676.1|  PREDICTED: galactose oxidase-like isoform X2       109   5e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010471675.1|  PREDICTED: galactose oxidase-like isoform X1       109   5e-24   
ref|XP_009360496.1|  PREDICTED: LOW QUALITY PROTEIN: galactose ox...    109   7e-24   
gb|KJB38606.1|  hypothetical protein B456_006G263000                    108   7e-24   Gossypium raimondii
ref|XP_012071982.1|  PREDICTED: galactose oxidase-like                  108   7e-24   Jatropha curcas
ref|XP_010428587.1|  PREDICTED: galactose oxidase-like                  108   7e-24   Camelina sativa [gold-of-pleasure]
gb|KJB59770.1|  hypothetical protein B456_009G270800                    108   8e-24   Gossypium raimondii
emb|CBI19807.3|  unnamed protein product                                108   9e-24   Vitis vinifera
ref|XP_004237211.1|  PREDICTED: galactose oxidase-like                  108   9e-24   Solanum lycopersicum
ref|XP_006304793.1|  hypothetical protein CARUB_v10012343mg             108   1e-23   Capsella rubella
ref|XP_006833409.2|  PREDICTED: galactose oxidase                       108   1e-23   
ref|XP_002510488.1|  Galactose oxidase precursor, putative              108   1e-23   
ref|XP_009388162.1|  PREDICTED: galactose oxidase-like                  108   1e-23   
ref|XP_007157402.1|  hypothetical protein PHAVU_002G066900g             108   1e-23   Phaseolus vulgaris [French bean]
emb|CDY62590.1|  BnaA08g31280D                                          108   1e-23   Brassica napus [oilseed rape]
gb|KJB38605.1|  hypothetical protein B456_006G262900                    108   1e-23   Gossypium raimondii
ref|XP_006838081.2|  PREDICTED: galactose oxidase                       107   1e-23   
ref|XP_009603236.1|  PREDICTED: galactose oxidase-like                  108   2e-23   Nicotiana tomentosiformis
gb|ERN00650.1|  hypothetical protein AMTR_s00225p00021580               108   2e-23   Amborella trichopoda
ref|XP_010674901.1|  PREDICTED: galactose oxidase                       107   2e-23   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX83737.1|  BnaC08g19080D                                          104   2e-23   
gb|ERM98687.1|  hypothetical protein AMTR_s00109p00131490               108   2e-23   Amborella trichopoda
ref|XP_006577272.1|  PREDICTED: galactose oxidase-like                  107   2e-23   Glycine max [soybeans]
ref|XP_004243010.2|  PREDICTED: galactose oxidase                       107   2e-23   
ref|XP_006301879.1|  hypothetical protein CARUB_v10022352mg             108   2e-23   Capsella rubella
ref|XP_003527766.1|  PREDICTED: galactose oxidase-like                  107   2e-23   Glycine max [soybeans]
ref|XP_010462699.1|  PREDICTED: galactose oxidase-like                  103   2e-23   Camelina sativa [gold-of-pleasure]
ref|XP_011073112.1|  PREDICTED: galactose oxidase                       107   2e-23   Sesamum indicum [beniseed]
ref|XP_002280559.1|  PREDICTED: galactose oxidase                       107   2e-23   Vitis vinifera
ref|XP_010100623.1|  hypothetical protein L484_011554                   107   2e-23   
ref|XP_010535983.1|  PREDICTED: galactose oxidase-like                  107   2e-23   Tarenaya hassleriana [spider flower]
ref|XP_010061025.1|  PREDICTED: galactose oxidase-like                  107   2e-23   Eucalyptus grandis [rose gum]
ref|XP_009797022.1|  PREDICTED: galactose oxidase-like                  107   3e-23   Nicotiana sylvestris
ref|XP_007046239.1|  Glyoxal oxidase-related protein, putative          107   3e-23   
ref|XP_009766667.1|  PREDICTED: uncharacterized protein LOC104217988    107   3e-23   Nicotiana sylvestris
ref|XP_002324431.2|  hypothetical protein POPTR_0018s09110g             107   3e-23   
ref|XP_011048365.1|  PREDICTED: galactose oxidase                       107   3e-23   Populus euphratica
ref|XP_006389311.1|  glyoxal oxidase-related family protein             107   3e-23   
ref|XP_008387971.1|  PREDICTED: galactose oxidase-like                  107   4e-23   Malus domestica [apple tree]
ref|XP_004238618.1|  PREDICTED: galactose oxidase-like                  107   4e-23   Solanum lycopersicum
gb|KHN04050.1|  Galactose oxidase                                       106   4e-23   Glycine soja [wild soybean]
ref|NP_177692.1|  glyoxal oxidase-related protein                       107   4e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011003791.1|  PREDICTED: galactose oxidase-like                  106   5e-23   Populus euphratica
gb|KCW65018.1|  hypothetical protein EUGRSUZ_G02553                     106   5e-23   Eucalyptus grandis [rose gum]
gb|KDP33711.1|  hypothetical protein JCGZ_07282                         107   6e-23   Jatropha curcas
gb|KEH36231.1|  glyoxal oxidase amino-terminal protein                  106   6e-23   Medicago truncatula
ref|XP_012076744.1|  PREDICTED: galactose oxidase-like                  106   6e-23   
emb|CDP03295.1|  unnamed protein product                                107   7e-23   Coffea canephora [robusta coffee]
ref|XP_012077515.1|  PREDICTED: galactose oxidase-like                  107   7e-23   
ref|XP_006344285.1|  PREDICTED: galactose oxidase-like                  106   7e-23   Solanum tuberosum [potatoes]
ref|XP_010540180.1|  PREDICTED: galactose oxidase-like                  106   7e-23   Tarenaya hassleriana [spider flower]
gb|KDP33710.1|  hypothetical protein JCGZ_07281                         107   7e-23   Jatropha curcas
ref|XP_010533609.1|  PREDICTED: galactose oxidase-like                  106   8e-23   Tarenaya hassleriana [spider flower]
ref|XP_010688268.1|  PREDICTED: uncharacterized protein LOC104902254    106   8e-23   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN43222.1|  Galactose oxidase                                       105   8e-23   Glycine soja [wild soybean]
ref|XP_008347351.1|  PREDICTED: galactose oxidase-like                  105   8e-23   
gb|KHN45905.1|  Galactose oxidase                                       105   8e-23   Glycine soja [wild soybean]
gb|KJB45029.1|  hypothetical protein B456_007G286100                    105   9e-23   Gossypium raimondii
ref|XP_003523554.1|  PREDICTED: galactose oxidase-like                  105   9e-23   Glycine max [soybeans]
ref|XP_008357159.1|  PREDICTED: galactose oxidase-like                  104   9e-23   
ref|XP_009110252.1|  PREDICTED: galactose oxidase-like                  105   9e-23   Brassica rapa
gb|EYU22441.1|  hypothetical protein MIMGU_mgv1a024085mg                106   1e-22   Erythranthe guttata [common monkey flower]
ref|XP_004147869.1|  PREDICTED: galactose oxidase                       105   1e-22   Cucumis sativus [cucumbers]
ref|XP_009794042.1|  PREDICTED: galactose oxidase-like                  105   1e-22   Nicotiana sylvestris
gb|KJB58134.1|  hypothetical protein B456_009G196400                    105   1e-22   Gossypium raimondii
ref|XP_006357288.1|  PREDICTED: galactose oxidase-like                  105   1e-22   Solanum tuberosum [potatoes]
ref|XP_009607831.1|  PREDICTED: galactose oxidase-like                  105   1e-22   Nicotiana tomentosiformis
ref|XP_009779182.1|  PREDICTED: galactose oxidase-like                  105   1e-22   Nicotiana sylvestris
ref|XP_009337669.1|  PREDICTED: galactose oxidase-like                  105   1e-22   Pyrus x bretschneideri [bai li]
ref|XP_010107380.1|  hypothetical protein L484_003656                   105   1e-22   Morus notabilis
gb|KGN60011.1|  hypothetical protein Csa_3G866440                       105   1e-22   Cucumis sativus [cucumbers]
ref|XP_006857804.1|  PREDICTED: galactose oxidase                       105   2e-22   Amborella trichopoda
ref|XP_003626387.1|  Galactose oxidase                                  105   2e-22   Medicago truncatula
ref|XP_009337676.1|  PREDICTED: galactose oxidase-like                  105   2e-22   Pyrus x bretschneideri [bai li]
ref|XP_011010793.1|  PREDICTED: galactose oxidase                       105   2e-22   Populus euphratica
ref|XP_009782130.1|  PREDICTED: galactose oxidase-like                  105   2e-22   Nicotiana sylvestris
ref|XP_007225625.1|  hypothetical protein PRUPE_ppa003824mg             105   2e-22   Prunus persica
ref|XP_009381768.1|  PREDICTED: uncharacterized protein LOC103969853    105   2e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003553749.1|  PREDICTED: galactose oxidase-like                  105   2e-22   Glycine max [soybeans]
ref|XP_004494672.1|  PREDICTED: galactose oxidase-like                  105   2e-22   Cicer arietinum [garbanzo]
ref|XP_002520142.1|  conserved hypothetical protein                     105   2e-22   
gb|KJB38607.1|  hypothetical protein B456_006G263100                    104   2e-22   Gossypium raimondii
gb|KHN39443.1|  Galactose oxidase                                       101   3e-22   Glycine soja [wild soybean]
ref|XP_006342232.1|  PREDICTED: galactose oxidase-like                  104   3e-22   Solanum tuberosum [potatoes]
ref|XP_010670858.1|  PREDICTED: galactose oxidase-like                  104   3e-22   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010652487.1|  PREDICTED: galactose oxidase                       104   3e-22   
ref|XP_002889034.1|  hypothetical protein ARALYDRAFT_895435             104   3e-22   Arabidopsis lyrata subsp. lyrata
ref|XP_002975736.1|  hypothetical protein SELMODRAFT_232564             103   3e-22   
emb|CDY43429.1|  BnaC07g14960D                                          103   4e-22   Brassica napus [oilseed rape]
ref|XP_007160695.1|  hypothetical protein PHAVU_001G009200g             103   4e-22   Phaseolus vulgaris [French bean]
ref|XP_010105252.1|  hypothetical protein L484_019394                   103   4e-22   Morus notabilis
ref|XP_007017717.1|  Glyoxal oxidase-related protein                    103   4e-22   
ref|XP_007017716.1|  Glyoxal oxidase-related protein                    103   4e-22   
ref|XP_009594288.1|  PREDICTED: uncharacterized protein LOC104090813    104   4e-22   Nicotiana tomentosiformis
emb|CDP00283.1|  unnamed protein product                                103   4e-22   Coffea canephora [robusta coffee]
ref|XP_004489989.1|  PREDICTED: uncharacterized protein LOC101500908    104   4e-22   Cicer arietinum [garbanzo]
ref|XP_010541740.1|  PREDICTED: galactose oxidase-like                  104   4e-22   Tarenaya hassleriana [spider flower]
ref|XP_007136064.1|  hypothetical protein PHAVU_009G014800g             103   5e-22   
ref|XP_009797023.1|  PREDICTED: galactose oxidase-like                  103   5e-22   
ref|XP_009614398.1|  PREDICTED: galactose oxidase-like                  103   5e-22   
ref|XP_008221748.1|  PREDICTED: galactose oxidase                       104   5e-22   
ref|XP_004500954.1|  PREDICTED: galactose oxidase-like                  103   5e-22   
gb|AAG12543.1|AC007797_3  Unknown Protein                               103   5e-22   
ref|XP_010536368.1|  PREDICTED: galactose oxidase-like                  103   5e-22   
ref|XP_010459669.1|  PREDICTED: galactose oxidase-like                  103   5e-22   
ref|XP_006342233.1|  PREDICTED: galactose oxidase-like                  103   6e-22   
ref|XP_003613586.1|  hypothetical protein MTR_5g038410                  103   6e-22   
ref|XP_006475694.1|  PREDICTED: galactose oxidase-like                  103   6e-22   
ref|XP_008460895.1|  PREDICTED: galactose oxidase                       103   6e-22   
ref|XP_006351423.1|  PREDICTED: uncharacterized protein LOC102595893    103   6e-22   
ref|XP_008377171.1|  PREDICTED: galactose oxidase-like                  103   6e-22   
ref|XP_006391296.1|  hypothetical protein EUTSA_v10018300mg             103   6e-22   
gb|EYU38846.1|  hypothetical protein MIMGU_mgv1a027114mg                102   6e-22   
ref|XP_004236288.1|  PREDICTED: uncharacterized protein LOC101250105    103   7e-22   
ref|NP_173419.1|  glyoxal oxidase-related protein                       103   7e-22   
ref|XP_004984953.1|  PREDICTED: galactose oxidase-like                  103   7e-22   
ref|XP_006451231.1|  hypothetical protein CICLE_v10010756mg             103   7e-22   
ref|XP_006438575.1|  hypothetical protein CICLE_v10031195mg             103   8e-22   
ref|XP_010242442.1|  PREDICTED: galactose oxidase                       103   8e-22   
ref|XP_002973684.1|  hypothetical protein SELMODRAFT_413959             103   8e-22   
ref|XP_007136065.1|  hypothetical protein PHAVU_009G014900g             103   8e-22   
ref|XP_003589379.1|  Galactose oxidase                                  103   9e-22   
ref|XP_008387970.1|  PREDICTED: galactose oxidase-like                  103   9e-22   
ref|XP_010536366.1|  PREDICTED: galactose oxidase-like                  103   1e-21   
ref|XP_006390288.1|  hypothetical protein EUTSA_v10018361mg             102   1e-21   
gb|KDO82728.1|  hypothetical protein CISIN_1g048017mg                   102   1e-21   
ref|XP_009337697.1|  PREDICTED: galactose oxidase-like                  102   1e-21   
ref|XP_010111102.1|  hypothetical protein L484_008478                   102   1e-21   
ref|XP_009408991.1|  PREDICTED: galactose oxidase-like                  102   1e-21   
ref|XP_010511646.1|  PREDICTED: galactose oxidase-like                  102   1e-21   
emb|CDY01797.1|  BnaC06g28370D                                          102   1e-21   
emb|CDY29385.1|  BnaA06g14110D                                          102   1e-21   
ref|XP_004238325.1|  PREDICTED: galactose oxidase-like                  102   2e-21   
ref|XP_009337677.1|  PREDICTED: galactose oxidase-like                  102   2e-21   
ref|XP_006483245.1|  PREDICTED: galactose oxidase-like                  102   2e-21   
ref|XP_004513017.1|  PREDICTED: uncharacterized protein LOC101505637    102   2e-21   
ref|XP_006342711.1|  PREDICTED: galactose oxidase-like                  102   2e-21   
ref|XP_009335425.1|  PREDICTED: galactose oxidase-like                  102   2e-21   
ref|XP_004252835.1|  PREDICTED: galactose oxidase-like                  102   2e-21   
ref|XP_007017718.1|  Glyoxal oxidase-related protein                    102   2e-21   
ref|XP_011069750.1|  PREDICTED: galactose oxidase-like                  102   2e-21   
ref|XP_006341271.1|  PREDICTED: uncharacterized protein LOC102605018    102   2e-21   
ref|XP_009625411.1|  PREDICTED: LOW QUALITY PROTEIN: galactose ox...    102   2e-21   
gb|EYU36763.1|  hypothetical protein MIMGU_mgv1a004035mg                102   2e-21   
ref|XP_010532465.1|  PREDICTED: galactose oxidase-like                  102   2e-21   
ref|XP_009797024.1|  PREDICTED: galactose oxidase-like                  102   2e-21   
emb|CDY43432.1|  BnaC07g14990D                                          101   2e-21   
ref|XP_009149487.1|  PREDICTED: galactose oxidase                       102   2e-21   
ref|XP_006342231.1|  PREDICTED: galactose oxidase-like                  102   3e-21   
ref|XP_004139435.1|  PREDICTED: galactose oxidase-like                  102   3e-21   
ref|XP_002301997.2|  glyoxal oxidase-related family protein             101   3e-21   
ref|XP_001751285.1|  predicted protein                                  101   3e-21   
ref|XP_008348975.1|  PREDICTED: galactose oxidase-like                  101   3e-21   
ref|XP_007227672.1|  hypothetical protein PRUPE_ppa026498mg             101   3e-21   
ref|XP_002893079.1|  hypothetical protein ARALYDRAFT_472215             101   3e-21   
ref|XP_002468154.1|  hypothetical protein SORBIDRAFT_01g040550          101   3e-21   
ref|XP_010541897.1|  PREDICTED: galactose oxidase-like                  101   4e-21   
ref|XP_004291826.1|  PREDICTED: galactose oxidase-like                  101   4e-21   
gb|AEA52292.1|  glyoxal oxidase-related protein                         101   4e-21   
gb|KEH24796.1|  glyoxal oxidase amino-terminal protein                  101   4e-21   
ref|XP_003630749.1|  Galactose oxidase                                  101   4e-21   
ref|XP_004291825.1|  PREDICTED: galactose oxidase-like                  101   4e-21   
ref|XP_006342230.1|  PREDICTED: galactose oxidase-like                  101   4e-21   
emb|CDY01390.1|  BnaA07g11630D                                          100   4e-21   
ref|XP_011074991.1|  PREDICTED: galactose oxidase-like                  101   5e-21   
gb|KDO36610.1|  hypothetical protein CISIN_1g043381mg                 98.6    5e-21   
gb|KDO66474.1|  hypothetical protein CISIN_1g042303mg                   100   5e-21   
ref|XP_010477216.1|  PREDICTED: galactose oxidase-like                  100   5e-21   
ref|XP_003544396.1|  PREDICTED: uncharacterized protein LOC100791340    100   5e-21   
ref|XP_010254463.1|  PREDICTED: galactose oxidase                       101   5e-21   
ref|XP_010535981.1|  PREDICTED: galactose oxidase-like                  100   5e-21   
ref|XP_004292851.1|  PREDICTED: uncharacterized protein LOC101303486    100   6e-21   
ref|XP_004238617.1|  PREDICTED: galactose oxidase-like                  100   6e-21   
ref|XP_007147126.1|  hypothetical protein PHAVU_006G098100g             100   6e-21   
ref|XP_009367501.1|  PREDICTED: uncharacterized protein LOC103957133  99.0    7e-21   
ref|XP_007203106.1|  hypothetical protein PRUPE_ppa023837mg             101   7e-21   
tpg|DAA44471.1|  TPA: hypothetical protein ZEAMMB73_122663              100   7e-21   
ref|XP_007226541.1|  hypothetical protein PRUPE_ppa024999mg             100   7e-21   
ref|XP_008340335.1|  PREDICTED: uncharacterized protein LOC103403295    101   8e-21   
ref|XP_009103375.1|  PREDICTED: galactose oxidase-like                  100   8e-21   
ref|XP_004242940.2|  PREDICTED: uncharacterized protein LOC101252095    100   8e-21   
ref|NP_001149941.1|  glyoxal oxidase precursor                          100   8e-21   
tpg|DAA44472.1|  TPA: glyoxal oxidase                                   100   9e-21   
ref|XP_010476497.1|  PREDICTED: galactose oxidase-like                  100   9e-21   
ref|XP_011092656.1|  PREDICTED: galactose oxidase-like                  100   9e-21   
ref|XP_010458940.1|  PREDICTED: galactose oxidase-like                  100   9e-21   
ref|XP_010496071.1|  PREDICTED: galactose oxidase-like                  100   9e-21   
ref|XP_010271447.1|  PREDICTED: galactose oxidase-like                  100   1e-20   
dbj|BAL41451.1|  glyoxal oxidase 2                                      100   1e-20   
ref|XP_008444780.1|  PREDICTED: galactose oxidase-like                  100   1e-20   
ref|XP_007137990.1|  hypothetical protein PHAVU_009G171700g             100   1e-20   
ref|XP_008220102.1|  PREDICTED: uncharacterized protein LOC103320236    100   1e-20   
ref|XP_006383732.1|  hypothetical protein POPTR_0005s25680g           99.8    1e-20   
gb|KFK41129.1|  hypothetical protein AALP_AA2G089900                    100   1e-20   
ref|XP_004238324.1|  PREDICTED: galactose oxidase-like                  100   1e-20   
ref|XP_012086609.1|  PREDICTED: galactose oxidase-like                  100   1e-20   
ref|XP_009791893.1|  PREDICTED: galactose oxidase-like                  100   1e-20   
ref|XP_001776150.1|  predicted protein                                97.1    1e-20   
ref|XP_010498415.1|  PREDICTED: galactose oxidase                     99.8    1e-20   
ref|XP_011045140.1|  PREDICTED: galactose oxidase-like                99.4    1e-20   
ref|XP_004503455.1|  PREDICTED: uncharacterized protein LOC101501825    100   1e-20   
ref|XP_009103376.1|  PREDICTED: galactose oxidase-like                99.8    1e-20   
ref|XP_011069718.1|  PREDICTED: galactose oxidase-like                99.8    1e-20   
ref|XP_009774595.1|  PREDICTED: galactose oxidase-like                99.4    2e-20   
ref|XP_012091952.1|  PREDICTED: galactose oxidase                     99.4    2e-20   
emb|CDY13556.1|  BnaC02g23670D                                        99.4    2e-20   
ref|XP_010263908.1|  PREDICTED: galactose oxidase-like                99.4    2e-20   
emb|CDY39045.1|  BnaA02g17340D                                        99.4    2e-20   
ref|XP_008242563.1|  PREDICTED: uncharacterized protein LOC103340881  99.8    2e-20   
ref|XP_011045139.1|  PREDICTED: galactose oxidase-like                99.4    2e-20   
ref|XP_006433075.1|  hypothetical protein CICLE_v10000768mg           99.0    2e-20   
ref|XP_010539855.1|  PREDICTED: galactose oxidase-like                99.0    2e-20   
ref|XP_008466509.1|  PREDICTED: galactose oxidase-like                99.4    2e-20   
gb|KJB51134.1|  hypothetical protein B456_008G202800                  99.4    2e-20   
ref|XP_010271448.1|  PREDICTED: galactose oxidase-like                99.0    2e-20   
ref|XP_008221312.1|  PREDICTED: galactose oxidase-like                99.0    2e-20   
emb|CDY01391.1|  BnaA07g11640D                                        99.0    2e-20   
ref|XP_009117902.1|  PREDICTED: galactose oxidase-like                99.0    3e-20   
emb|CDY53551.1|  BnaA09g57100D                                        99.0    3e-20   
emb|CDX81637.1|  BnaC08g39640D                                        99.0    3e-20   
ref|XP_004969528.1|  PREDICTED: uncharacterized protein LOC101774211  99.4    3e-20   
ref|XP_009367892.1|  PREDICTED: uncharacterized protein LOC103957460  99.0    3e-20   
ref|XP_009105271.1|  PREDICTED: galactose oxidase                     99.0    3e-20   
emb|CDX96101.1|  BnaA07g26300D                                        99.0    3e-20   
ref|XP_008221311.1|  PREDICTED: galactose oxidase-like                98.6    3e-20   
ref|XP_007160315.1|  hypothetical protein PHAVU_002G311300g           99.0    4e-20   
ref|XP_008367692.1|  PREDICTED: uncharacterized protein LOC103431321  96.7    4e-20   
ref|XP_002281387.1|  PREDICTED: uncharacterized protein LOC100256065  98.6    4e-20   
gb|KEH35019.1|  glyoxal oxidase amino-terminal protein                98.2    4e-20   
ref|XP_006417012.1|  hypothetical protein EUTSA_v10007241mg           98.6    4e-20   
ref|XP_010051583.1|  PREDICTED: galactose oxidase-like                98.6    5e-20   
ref|XP_002890054.1|  hypothetical protein ARALYDRAFT_888820           98.2    5e-20   
ref|XP_009600286.1|  PREDICTED: galactose oxidase-like                98.2    5e-20   
ref|XP_007152887.1|  hypothetical protein PHAVU_004G168600g           98.6    5e-20   
ref|XP_009392205.1|  PREDICTED: galactose oxidase-like                98.2    6e-20   
gb|KJB29631.1|  hypothetical protein B456_005G111300                  97.8    6e-20   
ref|NP_172895.2|  glyoxal oxidase-related protein                     97.8    6e-20   
ref|XP_006649773.1|  PREDICTED: galactose oxidase-like                97.8    6e-20   
ref|XP_006343542.1|  PREDICTED: galactose oxidase-like                97.8    6e-20   
ref|XP_006580892.1|  PREDICTED: uncharacterized protein LOC102660794  94.7    7e-20   
gb|EYU17749.1|  hypothetical protein MIMGU_mgv1a003984mg              97.8    7e-20   
dbj|BAL41452.1|  glyoxal oxidase 3                                    98.2    8e-20   
ref|XP_003516476.1|  PREDICTED: uncharacterized protein LOC100797716  97.8    8e-20   
emb|CAN83495.1|  hypothetical protein VITISV_026965                   97.4    9e-20   
emb|CBI34589.3|  unnamed protein product                              97.4    9e-20   
ref|XP_008221409.1|  PREDICTED: galactose oxidase-like                97.4    1e-19   
ref|XP_002272723.2|  PREDICTED: uncharacterized protein LOC100259927  97.4    1e-19   
ref|XP_011069751.1|  PREDICTED: galactose oxidase-like                97.4    1e-19   
ref|XP_009336713.1|  PREDICTED: galactose oxidase-like                97.1    1e-19   
ref|XP_004289629.1|  PREDICTED: galactose oxidase-like                97.1    1e-19   
ref|XP_010535982.1|  PREDICTED: galactose oxidase-like                97.1    1e-19   
ref|XP_002514260.1|  Galactose oxidase precursor, putative            97.4    1e-19   
ref|XP_006848962.1|  PREDICTED: galactose oxidase                     97.1    1e-19   
ref|XP_004978797.1|  PREDICTED: galactose oxidase-like                97.1    1e-19   
ref|XP_008793761.1|  PREDICTED: galactose oxidase-like                97.1    1e-19   
dbj|BAL41453.1|  glyoxal oxidase 4                                    97.4    1e-19   
ref|XP_006378160.1|  glyoxal oxidase-related family protein           96.7    1e-19   
ref|XP_007039386.1|  Glyoxal oxidase-related protein                  97.1    1e-19   
ref|XP_004499224.1|  PREDICTED: galactose oxidase-like                96.7    1e-19   
ref|XP_004152661.2|  PREDICTED: galactose oxidase-like                96.7    2e-19   
ref|XP_006304526.1|  hypothetical protein CARUB_v10011386mg           96.7    2e-19   
ref|XP_007037788.1|  Glyoxal oxidase-related protein                  96.7    2e-19   
ref|XP_008367966.1|  PREDICTED: galactose oxidase-like                96.7    2e-19   
ref|XP_008338258.1|  PREDICTED: galactose oxidase-like                96.7    2e-19   
gb|KJB37454.1|  hypothetical protein B456_006G205600                  96.7    2e-19   
ref|XP_006420316.1|  hypothetical protein CICLE_v10006853mg           96.7    2e-19   
emb|CDP07430.1|  unnamed protein product                              96.7    2e-19   
ref|XP_006451228.1|  hypothetical protein CICLE_v10010177mg           96.7    2e-19   
ref|XP_006475693.1|  PREDICTED: galactose oxidase-like                96.7    2e-19   
gb|KDO66471.1|  hypothetical protein CISIN_1g035640mg                 96.7    2e-19   
ref|XP_010663077.1|  PREDICTED: uncharacterized protein LOC100253501  96.7    2e-19   
ref|XP_010532190.1|  PREDICTED: galactose oxidase                     96.3    2e-19   
ref|XP_002449081.1|  hypothetical protein SORBIDRAFT_05g004490        96.3    2e-19   
ref|XP_006849171.2|  PREDICTED: galactose oxidase                     96.3    2e-19   
gb|ERN10752.1|  hypothetical protein AMTR_s00027p00177380             96.3    3e-19   
ref|XP_010656292.1|  PREDICTED: galactose oxidase                     96.3    3e-19   
ref|XP_007222145.1|  hypothetical protein PRUPE_ppa004709mg           95.5    3e-19   
ref|XP_003527665.1|  PREDICTED: galactose oxidase-like                95.9    3e-19   
ref|XP_009128116.1|  PREDICTED: galactose oxidase-like                95.9    3e-19   
ref|XP_009367481.1|  PREDICTED: uncharacterized protein LOC103957109  96.3    3e-19   
ref|XP_002441894.1|  hypothetical protein SORBIDRAFT_08g004430        94.4    3e-19   
emb|CDP00282.1|  unnamed protein product                              95.5    3e-19   
ref|XP_010904553.1|  PREDICTED: galactose oxidase-like                95.9    3e-19   
ref|XP_008350495.1|  PREDICTED: galactose oxidase-like                95.9    3e-19   
ref|NP_001150444.1|  glyoxal oxidase precursor                        95.9    4e-19   
gb|KHN16621.1|  Galactose oxidase                                     95.9    4e-19   
ref|XP_008350494.1|  PREDICTED: galactose oxidase-like                95.5    4e-19   
emb|CBI28031.3|  unnamed protein product                              96.7    4e-19   
ref|XP_004299160.2|  PREDICTED: uncharacterized protein LOC101293...  95.9    4e-19   
ref|XP_011464174.1|  PREDICTED: uncharacterized protein LOC101293...  95.9    4e-19   
ref|XP_006584818.1|  PREDICTED: uncharacterized protein LOC100808336  95.9    4e-19   
ref|XP_008352131.1|  PREDICTED: LOW QUALITY PROTEIN: galactose ox...  94.0    4e-19   
ref|XP_004301024.2|  PREDICTED: uncharacterized protein LOC101293...  95.5    4e-19   
ref|XP_011464173.1|  PREDICTED: uncharacterized protein LOC101293...  95.5    4e-19   
ref|XP_011464176.1|  PREDICTED: uncharacterized protein LOC101293...  95.5    4e-19   
ref|XP_010041767.1|  PREDICTED: galactose oxidase                     95.1    5e-19   
ref|XP_011457694.1|  PREDICTED: galactose oxidase-like                95.1    5e-19   
ref|XP_010536365.1|  PREDICTED: galactose oxidase-like                95.1    6e-19   
ref|XP_006383733.1|  hypothetical protein POPTR_0005s25690g           95.1    6e-19   
emb|CDY44191.1|  BnaC05g15480D                                        95.9    6e-19   
ref|XP_008377179.1|  PREDICTED: galactose oxidase-like                94.7    7e-19   
ref|XP_011083592.1|  PREDICTED: galactose oxidase-like                94.7    7e-19   
ref|XP_008464498.1|  PREDICTED: uncharacterized protein LOC103502362  94.7    8e-19   
ref|XP_002518913.1|  Galactose oxidase precursor, putative            94.4    1e-18   
ref|XP_004298451.2|  PREDICTED: galactose oxidase-like                94.4    1e-18   
ref|XP_003561804.1|  PREDICTED: galactose oxidase-like                94.4    1e-18   
gb|KFK43688.1|  hypothetical protein AALP_AA1G160100                  94.0    2e-18   
ref|XP_003620657.1|  Galactose oxidase                                94.0    2e-18   
emb|CDP12684.1|  unnamed protein product                              94.0    2e-18   
ref|XP_009336933.1|  PREDICTED: galactose oxidase-like                94.0    2e-18   
ref|XP_010096335.1|  hypothetical protein L484_021082                 93.6    2e-18   
ref|XP_008367509.1|  PREDICTED: uncharacterized protein LOC103431143  93.6    2e-18   
ref|XP_003528130.2|  PREDICTED: uncharacterized protein LOC100814200  93.6    2e-18   
dbj|BAL41448.1|  glyoxal oxidase 1                                    93.6    2e-18   
ref|XP_010523439.1|  PREDICTED: galactose oxidase-like isoform X1     93.2    3e-18   
ref|XP_010251352.1|  PREDICTED: uncharacterized protein LOC104593293  93.2    3e-18   
gb|KDO54103.1|  hypothetical protein CISIN_1g039705mg                 93.2    3e-18   
gb|KCW83241.1|  hypothetical protein EUGRSUZ_B00180                   92.8    3e-18   



>ref|XP_009602919.1| PREDICTED: galactose oxidase [Nicotiana tomentosiformis]
Length=536

 Score =   229 bits (585),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGR+LLAGSNPH+FYK+   FPT+L IEAFSPEYLSAD+ANIRPVLVE PEKV YR+ F
Sbjct  389  PDGRILLAGSNPHFFYKFAAEFPTELRIEAFSPEYLSADKANIRPVLVESPEKVKYREDF  448

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNA  289
            E A+TVELPVVG+VEVNFASAPFSTHSFSQGQRLVKL VTSAIPD  GKY+IGCTAP + 
Sbjct  449  EVAVTVELPVVGIVEVNFASAPFSTHSFSQGQRLVKLRVTSAIPDVAGKYKIGCTAPLDG  508

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQL  211
             VAPPGYYMVFAVNQGVPSVARWVQL
Sbjct  509  RVAPPGYYMVFAVNQGVPSVARWVQL  534



>ref|XP_009774166.1| PREDICTED: galactose oxidase [Nicotiana sylvestris]
Length=536

 Score =   227 bits (578),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGR+LLAGSNPH+FYK+   FPT+L IEAFSPEYL+AD+ANIRPVLVE PEKV Y + F
Sbjct  389  PDGRILLAGSNPHFFYKFATEFPTELRIEAFSPEYLAADKANIRPVLVESPEKVKYGEEF  448

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNA  289
            + A+TVELPVVG+VEVNFASAPFSTHSFSQGQRLVKL VTSAIPD  GKY+IGCTAPP+ 
Sbjct  449  DVAVTVELPVVGIVEVNFASAPFSTHSFSQGQRLVKLRVTSAIPDVAGKYKIGCTAPPDG  508

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQL  211
             VAPPGYYMVFAVNQGVPSVARWVQL
Sbjct  509  RVAPPGYYMVFAVNQGVPSVARWVQL  534



>ref|XP_004249644.1| PREDICTED: galactose oxidase [Solanum lycopersicum]
Length=568

 Score =   225 bits (574),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGR+LLAGSNPH+FYK+   FPT+L IEAFSPEYLSADRAN+RPVLVELPEK+ Y + F
Sbjct  421  PDGRILLAGSNPHFFYKFGVEFPTELRIEAFSPEYLSADRANLRPVLVELPEKLKYGEDF  480

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNA  289
              A+TVELPVVG++EVN ASAPFSTHSFSQGQRLVKL VTSAIPD  GKYRIGCTAPP+ 
Sbjct  481  GVAVTVELPVVGIIEVNIASAPFSTHSFSQGQRLVKLKVTSAIPDDAGKYRIGCTAPPDG  540

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQL  211
             VAPPGYYMVFAVNQGVP VARWVQ+
Sbjct  541  KVAPPGYYMVFAVNQGVPGVARWVQI  566



>ref|XP_006349488.1| PREDICTED: galactose oxidase-like [Solanum tuberosum]
Length=538

 Score =   224 bits (572),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGR+LLAGSNPH+FYK+   FPT+L IEAFSPEYLSADRAN+RPV+VE PEK+ Y + F
Sbjct  391  PDGRILLAGSNPHFFYKFAVEFPTELRIEAFSPEYLSADRANLRPVIVESPEKLKYGEDF  450

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNA  289
              A+TVELPVVG++EVN ASAPFSTHSFSQGQRLVKL VTSAIPD  GKYRIGCTAPP+ 
Sbjct  451  GVAVTVELPVVGIIEVNLASAPFSTHSFSQGQRLVKLKVTSAIPDDAGKYRIGCTAPPDG  510

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQL  211
             VAPPGYYMVFAVNQGVPSVARWVQL
Sbjct  511  KVAPPGYYMVFAVNQGVPSVARWVQL  536



>emb|CDP06561.1| unnamed protein product [Coffea canephora]
Length=541

 Score =   221 bits (562),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGR+L+AGSNPHYFY ++  FPT+L IE+FSPEYLSAD+AN+RPV VELPEKV Y  AF
Sbjct  394  PDGRILIAGSNPHYFYNFKRAFPTELRIESFSPEYLSADKANLRPVFVELPEKVAYGAAF  453

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNA  289
            +A +TVELPVVGVVEVN ASAPF+THSFSQGQRLVKL VTSAIP+G G+YRIGC APP+ 
Sbjct  454  DAVVTVELPVVGVVEVNMASAPFATHSFSQGQRLVKLSVTSAIPEGPGRYRIGCVAPPDG  513

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQLSA  205
             VAPPGYYMVFAVNQGVPS+A+WV L++
Sbjct  514  RVAPPGYYMVFAVNQGVPSIAQWVHLAS  541



>ref|XP_011094925.1| PREDICTED: galactose oxidase [Sesamum indicum]
Length=533

 Score =   219 bits (559),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGR+L+AGSNPHYFYK+   FPT+L IEAFSPEYLSAD+ANIRP LVELPE+VGY + F
Sbjct  386  PDGRILIAGSNPHYFYKFNAEFPTELRIEAFSPEYLSADKANIRPSLVELPERVGYGEVF  445

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNA  289
            EA +TVELPVVG+VEVNFASAPF+THSFSQGQR+VKL V +   +G G+YRI CTAPPN 
Sbjct  446  EAGVTVELPVVGIVEVNFASAPFATHSFSQGQRVVKLLVETPAVEGGGRYRIKCTAPPNG  505

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQLSA  205
             VAPPGYYMVFAVNQGVPSVA+WVQL A
Sbjct  506  KVAPPGYYMVFAVNQGVPSVAKWVQLVA  533



>ref|XP_010044010.1| PREDICTED: galactose oxidase [Eucalyptus grandis]
 gb|KCW86022.1| hypothetical protein EUGRSUZ_B02726 [Eucalyptus grandis]
Length=546

 Score =   216 bits (551),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGRVL+AGSNPHYFYK+   FPT+L IEAFSPEYLS DRAN+RP L E+P  V Y +AF
Sbjct  399  PDGRVLIAGSNPHYFYKFNAEFPTELRIEAFSPEYLSPDRANLRPALDEIPAAVRYGEAF  458

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNA  289
            +  ++V LPVVG+VEVN  SAPF+THSFSQGQRLVKL VTSA+PDG+G+YRIGCTAPPNA
Sbjct  459  DVYVSVPLPVVGIVEVNLNSAPFATHSFSQGQRLVKLAVTSAVPDGSGRYRIGCTAPPNA  518

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQLSA  205
            +VAPPGYYM FAVNQGVPSVA WVQL+A
Sbjct  519  VVAPPGYYMAFAVNQGVPSVACWVQLAA  546



>ref|XP_010262660.1| PREDICTED: galactose oxidase [Nelumbo nucifera]
Length=536

 Score =   214 bits (545),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGRVL+AGSNPHYFYK+ G FPT+L +EAFSPEYLS DRAN+RPV+ + P+++ Y  AF
Sbjct  389  PDGRVLVAGSNPHYFYKFEGDFPTELRLEAFSPEYLSQDRANLRPVIEDSPKRIRYGDAF  448

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNA  289
            E  I+V LPVV  VEVNFASAPF+THSFSQGQRLVKL V+SAIP+  G+YRI CT PP A
Sbjct  449  EVVISVSLPVVEKVEVNFASAPFATHSFSQGQRLVKLTVSSAIPESGGRYRISCTGPPGA  508

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQLS  208
             VAPPGYYM FAVNQGVPSVARW+QLS
Sbjct  509  KVAPPGYYMAFAVNQGVPSVARWIQLS  535



>ref|XP_012087985.1| PREDICTED: galactose oxidase [Jatropha curcas]
 gb|KDP24540.1| hypothetical protein JCGZ_25104 [Jatropha curcas]
Length=537

 Score =   214 bits (544),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGRVLLAGSNPH+FYK++  FPT+L IEAFSPEYLS DRAN+RPV+ E+P+ V Y + F
Sbjct  389  PDGRVLLAGSNPHFFYKFKAEFPTELRIEAFSPEYLSPDRANVRPVIEEIPDTVRYGEVF  448

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNA  289
               ++V LPVVG+VEVNF SAPF+THSFSQGQRLVKL V  ++PDG G+YRIGCTAPPN 
Sbjct  449  NVFVSVSLPVVGIVEVNFGSAPFATHSFSQGQRLVKLTVLPSVPDGNGRYRIGCTAPPNG  508

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQL  211
             VAPPGYYMVFAVNQGVPSVARWV L
Sbjct  509  AVAPPGYYMVFAVNQGVPSVARWVHL  534



>ref|XP_006429215.1| hypothetical protein CICLE_v10011448mg [Citrus clementina]
 gb|ESR42455.1| hypothetical protein CICLE_v10011448mg [Citrus clementina]
Length=535

 Score =   212 bits (540),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 124/148 (84%), Gaps = 0/148 (0%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGRVL+AGSNPHYFYK+   FPT+L IEAFSPEYLS+DRAN+RPV+ E+PE V Y +AF
Sbjct  388  PDGRVLIAGSNPHYFYKFNAEFPTELRIEAFSPEYLSSDRANLRPVIEEIPETVRYGEAF  447

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNA  289
            +  +TV LPVVG++EVN  +APFSTHSF QGQRLVKL VT ++PD  G+YR+GCTAPPN 
Sbjct  448  DVFVTVPLPVVGILEVNLGNAPFSTHSFQQGQRLVKLTVTPSVPDANGRYRVGCTAPPNG  507

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQLSA  205
             VAPPGYYM F VNQGVPSVARWV L A
Sbjct  508  AVAPPGYYMAFVVNQGVPSVARWVHLIA  535



>ref|XP_006480899.1| PREDICTED: galactose oxidase-like [Citrus sinensis]
Length=535

 Score =   211 bits (537),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 124/148 (84%), Gaps = 0/148 (0%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGRVL+AGSNPHYFYK+   FPT+L IEAFSPEYLS+DRAN+RPV+ E+PE V Y +AF
Sbjct  388  PDGRVLIAGSNPHYFYKFNAEFPTELRIEAFSPEYLSSDRANLRPVIEEIPETVRYGEAF  447

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNA  289
            +  +TV LPVVG++EVN  +APF+THSF QGQRLVKL VT ++PD  G+YR+GCTAPPN 
Sbjct  448  DVFVTVPLPVVGILEVNLGNAPFATHSFQQGQRLVKLTVTPSVPDANGRYRVGCTAPPNG  507

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQLSA  205
             VAPPGYYM F VNQGVPSVARWV L A
Sbjct  508  AVAPPGYYMAFVVNQGVPSVARWVHLIA  535



>gb|KDO57956.1| hypothetical protein CISIN_1g044265mg, partial [Citrus sinensis]
Length=517

 Score =   210 bits (534),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 124/148 (84%), Gaps = 0/148 (0%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGRVL+AGSNPHYFYK+   FPT+L IEAFSPEYLS+DRAN+RPV+ E+PE V Y +AF
Sbjct  370  PDGRVLIAGSNPHYFYKFNAEFPTELRIEAFSPEYLSSDRANLRPVIEEIPETVRYGEAF  429

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNA  289
            +  +TV LPVVG++EVN  +APF+THSF QGQRLVK+ VT ++PD  G+YR+GCTAPPN 
Sbjct  430  DVFVTVPLPVVGILEVNLGNAPFATHSFQQGQRLVKITVTPSVPDANGRYRVGCTAPPNG  489

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQLSA  205
             VAPPGYYM F VNQGVPSVARWV L A
Sbjct  490  AVAPPGYYMAFVVNQGVPSVARWVHLIA  517



>ref|XP_002322929.1| glyoxal oxidase-related family protein [Populus trichocarpa]
 gb|EEF04690.1| glyoxal oxidase-related family protein [Populus trichocarpa]
Length=528

 Score =   208 bits (530),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 126/148 (85%), Gaps = 0/148 (0%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGRVL+AGSNPH+FYK+   FPT+L IEAFSPEYLS DRAN+RPV+ E+P+ V + +AF
Sbjct  381  PDGRVLVAGSNPHFFYKFEAEFPTELRIEAFSPEYLSPDRANLRPVIEEIPDTVRFGEAF  440

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNA  289
            +  ++V LPVVG++EVNFASAPF+THSFSQGQRLVKL +T ++PD   +Y+IGC APPN 
Sbjct  441  DVFVSVTLPVVGLIEVNFASAPFATHSFSQGQRLVKLTITPSVPDSGNRYKIGCNAPPNG  500

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQLSA  205
             VAPPGYYMVFAVNQGVPSVARWV L A
Sbjct  501  AVAPPGYYMVFAVNQGVPSVARWVHLVA  528



>ref|XP_008442498.1| PREDICTED: LOW QUALITY PROTEIN: galactose oxidase [Cucumis melo]
Length=537

 Score =   207 bits (526),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 126/147 (86%), Gaps = 0/147 (0%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGR+L+AGSNPH+FYK+   FPT+L IEAFSPEYLSA++ANIRP +  +PE + Y   F
Sbjct  390  PDGRILIAGSNPHFFYKFEAEFPTELRIEAFSPEYLSAEKANIRPNIETIPETISYGAVF  449

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNA  289
            +  ++V+LPVVG+VEVN ASAPF+THSFSQGQRLVKL VT+++P+G G+YR+GCTAP N 
Sbjct  450  DVLVSVQLPVVGIVEVNLASAPFATHSFSQGQRLVKLAVTASVPNGDGQYRVGCTAPANG  509

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQLS  208
            MVAPPGYYM FAVNQGVPSVARW+ LS
Sbjct  510  MVAPPGYYMAFAVNQGVPSVARWIHLS  536



>ref|XP_006403635.1| hypothetical protein EUTSA_v100109141mg, partial [Eutrema salsugineum]
 gb|ESQ45088.1| hypothetical protein EUTSA_v100109141mg, partial [Eutrema salsugineum]
Length=204

 Score =   197 bits (502),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/146 (66%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGR+LLAGSNPHYFYK+   FPT+L IEAFSPEYLS DRAN+RP + E+P+ V Y + F
Sbjct  57   PDGRILLAGSNPHYFYKFNAEFPTELRIEAFSPEYLSLDRANLRPEIREIPQIVRYGEVF  116

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNA  289
            +  +TV LPVV  +++N+ +APF+THSFSQGQRLVKL V  +IPDG G+YRI CTAP N 
Sbjct  117  DVFVTVPLPVVETIQINWGNAPFATHSFSQGQRLVKLTVGPSIPDGVGRYRIQCTAPLNG  176

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQL  211
             V+PPGYYM FAVNQGVPS+ARW+++
Sbjct  177  AVSPPGYYMAFAVNQGVPSIARWIRI  202



>ref|XP_011006630.1| PREDICTED: galactose oxidase [Populus euphratica]
Length=528

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 104/148 (70%), Positives = 126/148 (85%), Gaps = 0/148 (0%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGRV++AGSNPH+FYK+   FPT+L IEAFSPEYLS DRAN+RPV+ E+P+ V + ++F
Sbjct  381  PDGRVVVAGSNPHFFYKFEAEFPTELRIEAFSPEYLSPDRANLRPVIEEIPDTVRFGESF  440

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNA  289
            +  ++V LPVVG+VEVNFASAPF+THSFSQGQRLVKL +T ++PD   +Y+IGC APPN 
Sbjct  441  DVFVSVTLPVVGLVEVNFASAPFATHSFSQGQRLVKLTITPSVPDSGNRYKIGCNAPPNG  500

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQLSA  205
             VAPPGYYMVFAVNQGVPSVARWV L A
Sbjct  501  AVAPPGYYMVFAVNQGVPSVARWVHLVA  528



>dbj|BAH20389.1| AT3G53950 [Arabidopsis thaliana]
Length=329

 Score =   201 bits (511),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 123/146 (84%), Gaps = 0/146 (0%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGR+LLAGSNPHYFYK+   FPT+L IEAFSPEYLS DRAN+RP + E+P+ + Y + F
Sbjct  182  PDGRILLAGSNPHYFYKFNAEFPTELRIEAFSPEYLSPDRANLRPEIQEIPQIIRYGEVF  241

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNA  289
            +  +TV LPVVG++++N+ SAPF+THSFSQGQRLVKL V  ++PDG G+YRI CTAPPN 
Sbjct  242  DVFVTVPLPVVGIIQMNWGSAPFATHSFSQGQRLVKLTVAPSVPDGVGRYRIQCTAPPNG  301

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQL  211
             V+PPGYYM FAVNQGVPS+ARW+++
Sbjct  302  AVSPPGYYMAFAVNQGVPSIARWIRI  327



>ref|XP_004137754.1| PREDICTED: galactose oxidase [Cucumis sativus]
 gb|KGN58827.1| hypothetical protein Csa_3G733320 [Cucumis sativus]
Length=535

 Score =   206 bits (523),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGR+L+AGSNPH+FYK+   FPT+L IEAFSPEYLSA++ANIRP +  +PE + Y   F
Sbjct  388  PDGRILVAGSNPHFFYKFEAEFPTELRIEAFSPEYLSAEKANIRPKIETIPETISYGGVF  447

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNA  289
            +  ++VELPVVG+VEVN  SAPF+THSFSQGQRLVKL VT++IP+G G+YR+GCTAP N 
Sbjct  448  DVLVSVELPVVGIVEVNLGSAPFATHSFSQGQRLVKLAVTASIPNGDGQYRVGCTAPANG  507

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQLS  208
            MVAPPGYYM FAVNQGVPSVARW+ LS
Sbjct  508  MVAPPGYYMAFAVNQGVPSVARWIHLS  534



>ref|XP_008240187.1| PREDICTED: galactose oxidase [Prunus mume]
Length=536

 Score =   205 bits (522),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 104/148 (70%), Positives = 123/148 (83%), Gaps = 0/148 (0%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGRVL+AGSNPHYFYK+   FPT+L +EAFSPEYL  DRAN+RPV+  +PE V Y + F
Sbjct  389  PDGRVLIAGSNPHYFYKFNAEFPTELRLEAFSPEYLGPDRANLRPVIEGVPETVRYGERF  448

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNA  289
            +  ++V LPVVG+VEVN  +APF+THSFSQGQRLVKL VT ++PDG G+YRI CTAPPN 
Sbjct  449  DVLVSVSLPVVGIVEVNLGNAPFATHSFSQGQRLVKLAVTPSVPDGDGRYRISCTAPPNG  508

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQLSA  205
            MVAPPGYYM FAVNQGVPSVARW+ L +
Sbjct  509  MVAPPGYYMAFAVNQGVPSVARWIHLGS  536



>ref|XP_008359690.1| PREDICTED: LOW QUALITY PROTEIN: galactose oxidase [Malus domestica]
Length=535

 Score =   205 bits (521),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGRVL+AGSNPHYFY++   FPT+L IEAFSPEYLS DRAN+RP+   +PE V Y ++F
Sbjct  388  PDGRVLIAGSNPHYFYRFDAEFPTELRIEAFSPEYLSPDRANLRPIFEGIPETVRYGESF  447

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNA  289
            +  ++V L VVG+  + F +APF+THSFSQGQRLVKL VT ++PDG G+YRI C APPN 
Sbjct  448  DVTVSVPLSVVGLWRLXFGNAPFATHSFSQGQRLVKLAVTPSVPDGEGRYRISCVAPPNG  507

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQL  211
            MVAPPGYYM FAVNQGVPSVARW+ L
Sbjct  508  MVAPPGYYMAFAVNQGVPSVARWIHL  533



>gb|EYU41788.1| hypothetical protein MIMGU_mgv1a004290mg [Erythranthe guttata]
Length=534

 Score =   204 bits (519),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 126/149 (85%), Gaps = 1/149 (1%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGRVL+AGSNPH+FY +   FPT+L IEAFSPEYL+AD+ANIRP LVELPE++GY + F
Sbjct  386  PDGRVLIAGSNPHFFYNFNSEFPTELRIEAFSPEYLAADKANIRPTLVELPERIGYGEVF  445

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPV-TSAIPDGTGKYRIGCTAPPN  292
            EA + VELPVVG+VEVN ASAPF+THSFSQGQRLVKL V T A  DG G+Y I CTAPP+
Sbjct  446  EAVMAVELPVVGIVEVNLASAPFATHSFSQGQRLVKLLVETPAAVDGGGRYSIKCTAPPS  505

Query  291  AMVAPPGYYMVFAVNQGVPSVARWVQLSA  205
              VAPPGYYM+FAVN GVPSVA+WVQL A
Sbjct  506  GKVAPPGYYMMFAVNLGVPSVAKWVQLVA  534



>gb|KJB36661.1| hypothetical protein B456_006G169500 [Gossypium raimondii]
Length=538

 Score =   204 bits (519),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 125/148 (84%), Gaps = 1/148 (1%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGRVL+AGSNPHYFYK+   FPT+L +E FSPEYLS DRAN+RPV+  +PE V Y +AF
Sbjct  392  PDGRVLIAGSNPHYFYKFGAEFPTELRLETFSPEYLSPDRANVRPVIEGIPETVRYGEAF  451

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNA  289
            +  ++V LPVVG++EVNF +APF+THSFSQGQRLVK+ VT ++PDG G+YRI CTAPPN 
Sbjct  452  DVFVSVSLPVVGIIEVNFGNAPFATHSFSQGQRLVKINVTPSVPDG-GRYRIKCTAPPNG  510

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQLSA  205
             VAPPGYYMVFAVNQGVPSVARWV L A
Sbjct  511  AVAPPGYYMVFAVNQGVPSVARWVHLVA  538



>ref|XP_007208466.1| hypothetical protein PRUPE_ppa003992mg [Prunus persica]
 gb|EMJ09665.1| hypothetical protein PRUPE_ppa003992mg [Prunus persica]
Length=536

 Score =   203 bits (517),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 122/148 (82%), Gaps = 0/148 (0%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGRVL+AGSNPHYFYK+   FPT+L +EAFSPEYL  DRAN+RPV+  +PE V Y + F
Sbjct  389  PDGRVLIAGSNPHYFYKFNAEFPTELRLEAFSPEYLGPDRANLRPVIEGVPETVRYGERF  448

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNA  289
            +  ++V LPVVG+VEVN  +APF+THSFSQGQRLVKL V  ++PDG G+YRI CTAPPN 
Sbjct  449  DVLVSVSLPVVGIVEVNLGNAPFATHSFSQGQRLVKLAVAPSVPDGDGRYRISCTAPPNG  508

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQLSA  205
            MVAPPGYYM FAVNQGVPSVARW+ L +
Sbjct  509  MVAPPGYYMAFAVNQGVPSVARWIHLGS  536



>ref|XP_002876232.1| hypothetical protein ARALYDRAFT_485786 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52491.1| hypothetical protein ARALYDRAFT_485786 [Arabidopsis lyrata subsp. 
lyrata]
Length=542

 Score =   202 bits (515),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 122/146 (84%), Gaps = 0/146 (0%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGR+LLAGSNPHYFYK+   FPT+L IEAFSPEYLS DRAN+RP + E+P+ V Y + F
Sbjct  395  PDGRILLAGSNPHYFYKFNAEFPTELRIEAFSPEYLSPDRANLRPEIREIPQIVRYGEVF  454

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNA  289
            +  +TV LPVV ++++N+ SAPF+THSFSQGQRLVKL V  ++PDG G+YRI CTAPPN 
Sbjct  455  DVFVTVPLPVVEIIQMNWGSAPFATHSFSQGQRLVKLTVAPSVPDGVGRYRIQCTAPPNG  514

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQL  211
             V+PPGYYM FAVNQGVPS+ARW+++
Sbjct  515  AVSPPGYYMAFAVNQGVPSIARWIRI  540



>ref|XP_010427056.1| PREDICTED: galactose oxidase-like [Camelina sativa]
Length=544

 Score =   202 bits (515),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 122/146 (84%), Gaps = 0/146 (0%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGR+LLAGSNPHYFYK+   FPT+L IEAFSPEYLS DRAN+RP + E+P+ V Y + F
Sbjct  397  PDGRILLAGSNPHYFYKFNAEFPTELRIEAFSPEYLSPDRANLRPEIREIPQIVRYGEVF  456

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNA  289
            +  +TV LPVV ++++N+ SAPF+THSFSQGQRLVKL V  ++PDG G+YRI CTAPPN 
Sbjct  457  DVFVTVPLPVVEIIQINWGSAPFATHSFSQGQRLVKLTVAPSVPDGVGRYRIQCTAPPNG  516

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQL  211
             V+PPGYYM FAVNQGVPSVARW+++
Sbjct  517  AVSPPGYYMAFAVNQGVPSVARWIRI  542



>ref|NP_190963.1| glyoxal oxidase-related protein [Arabidopsis thaliana]
 emb|CAB88357.1| putative protein [Arabidopsis thaliana]
 gb|AAL06866.1| AT3g53950/F5K20_250 [Arabidopsis thaliana]
 dbj|BAC41808.1| unknown protein [Arabidopsis thaliana]
 gb|AAO11608.1| At3g53950/F5K20_250 [Arabidopsis thaliana]
 gb|AEE79163.1| glyoxal oxidase-related protein [Arabidopsis thaliana]
Length=545

 Score =   202 bits (514),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 123/146 (84%), Gaps = 0/146 (0%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGR+LLAGSNPHYFYK+   FPT+L IEAFSPEYLS DRAN+RP + E+P+ + Y + F
Sbjct  398  PDGRILLAGSNPHYFYKFNAEFPTELRIEAFSPEYLSPDRANLRPEIQEIPQIIRYGEVF  457

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNA  289
            +  +TV LPVVG++++N+ SAPF+THSFSQGQRLVKL V  ++PDG G+YRI CTAPPN 
Sbjct  458  DVFVTVPLPVVGIIQMNWGSAPFATHSFSQGQRLVKLTVAPSVPDGVGRYRIQCTAPPNG  517

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQL  211
             V+PPGYYM FAVNQGVPS+ARW+++
Sbjct  518  AVSPPGYYMAFAVNQGVPSIARWIRI  543



>ref|XP_004305171.1| PREDICTED: galactose oxidase [Fragaria vesca subsp. vesca]
Length=535

 Score =   202 bits (513),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGRVL+AGSNPHYFYK+   FPT+L +EAFSPEYL  DRAN+RPV+ E+PE V Y + F
Sbjct  388  PDGRVLIAGSNPHYFYKFNAEFPTELRLEAFSPEYLGPDRANLRPVIEEVPETVRYGERF  447

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNA  289
            +  ++V L VVG++EVN  SAPF+THSFSQGQRL+KL VT ++PDG  +Y+I C  PPN 
Sbjct  448  DVLVSVPLSVVGIMEVNLGSAPFATHSFSQGQRLIKLAVTPSVPDGDARYKISCVGPPNG  507

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQL  211
            MVAPPGYYM FAVNQGVPSVARWV L
Sbjct  508  MVAPPGYYMAFAVNQGVPSVARWVHL  533



>ref|XP_004507195.1| PREDICTED: galactose oxidase-like [Cicer arietinum]
Length=536

 Score =   202 bits (513),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 123/147 (84%), Gaps = 0/147 (0%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGRVLLAGSNPH  Y++   FPT+L IEAFSPEYL  D+ANIRP ++E+ E V Y  +F
Sbjct  390  PDGRVLLAGSNPHVLYRFDVEFPTELRIEAFSPEYLGLDKANIRPEILEISETVSYGMSF  449

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNA  289
            +  ++V LPVVG++EVN  SAPF+THSFSQGQRLVKL V+SA+PDG G++RIGCTAPP+ 
Sbjct  450  DVVVSVPLPVVGIIEVNLGSAPFATHSFSQGQRLVKLVVSSAVPDGDGRWRIGCTAPPSG  509

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQLS  208
            MVAPPGYYM FAVNQGVPSVARWV +S
Sbjct  510  MVAPPGYYMAFAVNQGVPSVARWVHVS  536



>emb|CDY59162.1| BnaC06g42590D [Brassica napus]
Length=540

 Score =   201 bits (512),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGR+LLAGSNPHYFYK+   FPT+L IEAFSPEYLS DRAN+RP L E+P+ V Y + F
Sbjct  393  PDGRILLAGSNPHYFYKFNAEFPTELRIEAFSPEYLSQDRANLRPELREIPQIVRYGEVF  452

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNA  289
            +  +TV LPVV  +++N+ SAPF+THSFSQGQRLVKL V  +IPDG G+YRI CTAP N 
Sbjct  453  DVFVTVPLPVVETIQINWGSAPFATHSFSQGQRLVKLTVGPSIPDGEGRYRIQCTAPLNG  512

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQL  211
             V+PPGYYM FAVNQGVPSVARW+++
Sbjct  513  AVSPPGYYMAFAVNQGVPSVARWIRI  538



>emb|CBI30475.3| unnamed protein product [Vitis vinifera]
Length=382

 Score =   197 bits (502),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGRVL+AGSNPHYFYK+   FPT+L IEAFSPEYL AD+ANIRPV+ E PE V + + F
Sbjct  235  PDGRVLIAGSNPHYFYKFAAEFPTELRIEAFSPEYLFADKANIRPVIDESPEMVRFGEQF  294

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNA  289
            +  ++V LPVVG +EVN ASAPF+THSFSQGQRLVKL V+  +PD   +YRI CTAPP  
Sbjct  295  DVFVSVSLPVVGSMEVNLASAPFATHSFSQGQRLVKLTVSPTVPDADERYRIVCTAPPGG  354

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQL  211
             +APPGYYM+FAVN GVPSVARWVQL
Sbjct  355  KIAPPGYYMMFAVNLGVPSVARWVQL  380



>ref|XP_010504181.1| PREDICTED: galactose oxidase-like [Camelina sativa]
Length=543

 Score =   200 bits (508),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 97/146 (66%), Positives = 121/146 (83%), Gaps = 0/146 (0%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGR+LLAGSNPHYFYK+   FPT+L IEAFSPEYLS DRAN+RP + E+P+ V Y + F
Sbjct  396  PDGRILLAGSNPHYFYKFNAEFPTELRIEAFSPEYLSPDRANLRPEIREIPQIVRYGEVF  455

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNA  289
            +  +TV LPVV ++++N+ SAPF+THSFSQGQRLVKL V  ++PDG G+Y I CTAPPN 
Sbjct  456  DVFVTVPLPVVEIIQINWGSAPFATHSFSQGQRLVKLTVAPSVPDGVGRYMIQCTAPPNG  515

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQL  211
             V+PPGYYM FAVNQGVPS+ARW+++
Sbjct  516  AVSPPGYYMAFAVNQGVPSIARWIRI  541



>emb|CDX67577.1| BnaA07g16170D [Brassica napus]
Length=542

 Score =   200 bits (508),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGR+LLAGSNPHYFYK+   FPT+L IEAFSPEYLS DRAN+RP + E+P+ V Y + F
Sbjct  395  PDGRILLAGSNPHYFYKFNAEFPTELRIEAFSPEYLSPDRANLRPEIREIPQIVRYGEVF  454

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNA  289
            +  +TV LPVV  +++N+ SAPF+THSFSQGQRLVKL V  +IPDG G+YRI CTAP N 
Sbjct  455  DVFVTVPLPVVETIQINWGSAPFATHSFSQGQRLVKLTVGPSIPDGEGRYRIQCTAPLNG  514

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQL  211
             V+PPGYYM FAVNQGVPSVARW+++
Sbjct  515  AVSPPGYYMAFAVNQGVPSVARWIRI  540



>ref|XP_009103886.1| PREDICTED: galactose oxidase [Brassica rapa]
Length=542

 Score =   199 bits (507),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGR+LLAGSNPHYFYK+   FPT+L IEAFSPEYLS DRAN+RP + E+P+ V Y + F
Sbjct  395  PDGRILLAGSNPHYFYKFNAEFPTELRIEAFSPEYLSPDRANLRPEIREIPQIVRYGEVF  454

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNA  289
            +  +TV LPVV  +++N+ SAPF+THSFSQGQRLVKL V  +IPDG G+YRI CTAP N 
Sbjct  455  DVFVTVPLPVVETIQINWGSAPFATHSFSQGQRLVKLTVGPSIPDGEGRYRIQCTAPLNG  514

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQL  211
             V+PPGYYM FAVNQGVPSVARW+++
Sbjct  515  AVSPPGYYMAFAVNQGVPSVARWIRI  540



>ref|XP_010515903.1| PREDICTED: galactose oxidase-like [Camelina sativa]
Length=544

 Score =   199 bits (506),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/146 (66%), Positives = 121/146 (83%), Gaps = 0/146 (0%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGR+LLAGSNPHYFYK+   FPT+L IEAFSPEYLS DRAN+RP + E+P+ V Y + F
Sbjct  397  PDGRILLAGSNPHYFYKFNAEFPTELRIEAFSPEYLSPDRANLRPEIREIPQIVRYGEVF  456

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNA  289
            +  +TV LPVV ++++N+ SAPF+THSFSQGQRLVKL V  ++PDG G+YRI CTAP N 
Sbjct  457  DVFVTVPLPVVEIIQINWGSAPFATHSFSQGQRLVKLTVAPSVPDGVGRYRIQCTAPHNG  516

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQL  211
             V+PPGYYM FAVNQGVPS+ARW+++
Sbjct  517  AVSPPGYYMAFAVNQGVPSIARWIRI  542



>ref|XP_007134016.1| hypothetical protein PHAVU_010G012100g [Phaseolus vulgaris]
 gb|ESW06010.1| hypothetical protein PHAVU_010G012100g [Phaseolus vulgaris]
Length=534

 Score =   197 bits (502),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGRVLLAGSNPH  Y++   +PT+L +EAFSPEYLS DRAN+RPV+ E+PE V +  +F
Sbjct  388  PDGRVLLAGSNPHVLYRFDAEYPTELRVEAFSPEYLSPDRANLRPVIEEVPETVRFGGSF  447

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNA  289
            +  ++V LPVVG+VEVN ASAPFSTHSFSQGQRLVKL V+SA+PDG G+YRIG TAPP+ 
Sbjct  448  DVVVSVPLPVVGIVEVNLASAPFSTHSFSQGQRLVKLAVSSAVPDGDGRYRIGVTAPPSG  507

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQLS  208
             VAPPGYYM FAVNQGVPS+A+W+ ++
Sbjct  508  TVAPPGYYMAFAVNQGVPSIAKWIHVA  534



>ref|XP_009378871.1| PREDICTED: galactose oxidase [Pyrus x bretschneideri]
Length=537

 Score =   197 bits (502),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 122/148 (82%), Gaps = 2/148 (1%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGRVLLAGSNPHYFY++   FPT+L IEAFSPEYLS DRAN+RP++  +PE V Y ++F
Sbjct  388  PDGRVLLAGSNPHYFYRFDAEFPTELRIEAFSPEYLSPDRANLRPIIEGIPETVRYGESF  447

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQ--RLVKLPVTSAIPDGTGKYRIGCTAPP  295
            + +++V L VVGVVEVN  +APF+THSFSQGQ  RLVKL VT ++PD  G+YRI C APP
Sbjct  448  DVSVSVPLSVVGVVEVNLGNAPFATHSFSQGQRLRLVKLAVTPSVPDAEGRYRISCVAPP  507

Query  294  NAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            N MVAPPGYYM FAVNQGVPSVARW+ L
Sbjct  508  NGMVAPPGYYMAFAVNQGVPSVARWIHL  535



>ref|XP_006290869.1| hypothetical protein CARUB_v10016978mg [Capsella rubella]
 gb|EOA23767.1| hypothetical protein CARUB_v10016978mg [Capsella rubella]
Length=538

 Score =   197 bits (502),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 121/146 (83%), Gaps = 0/146 (0%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGRVL+AGSNPHYFYK+   FPT+L IEAFSPEYLS DRAN+RP + E+P+ V Y + F
Sbjct  391  PDGRVLVAGSNPHYFYKFNAEFPTELRIEAFSPEYLSPDRANLRPEIQEIPQIVRYGEVF  450

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNA  289
            +  +TV LPVV ++++N+ +APF+THS+SQGQRLVKL V  ++PDG  +YRI CTAPPN 
Sbjct  451  DVFVTVALPVVEIIQINWGNAPFATHSYSQGQRLVKLTVAPSVPDGVSRYRIQCTAPPNG  510

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQL  211
             VAPPGYYM FAVNQGVPS+ARW+++
Sbjct  511  AVAPPGYYMAFAVNQGVPSMARWIRI  536



>gb|ACV49899.1| glyoxal oxidase [Vitis vinifera]
Length=523

 Score =   196 bits (499),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGRVL+AGSNPHYFYK+   FPT+L IEAFSPEYL AD+ANIRPV+ E PE V + + F
Sbjct  376  PDGRVLIAGSNPHYFYKFAAEFPTELRIEAFSPEYLFADKANIRPVIDESPEMVRFGEQF  435

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNA  289
            +  ++V LPVVG +EVN ASAPF+THSFSQGQRLVKL V+  +PD   +YRI CTAPP  
Sbjct  436  DVFVSVSLPVVGSMEVNLASAPFATHSFSQGQRLVKLTVSPTVPDANERYRIVCTAPPGG  495

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQL  211
             +APPGYYM+FAVN GVPSVARWVQL
Sbjct  496  KIAPPGYYMMFAVNLGVPSVARWVQL  521



>gb|ACV49897.1| glyoxal oxidase [Vitis pseudoreticulata]
Length=523

 Score =   196 bits (499),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGRVL+AGSNPHYFYK+   FPT+L IEAFSPEYL AD+ANIRPV+ E PE V + + F
Sbjct  376  PDGRVLIAGSNPHYFYKFAAEFPTELRIEAFSPEYLFADKANIRPVIDESPEMVRFGEQF  435

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNA  289
            +  ++V LPVVG +EVN ASAPF+THSFSQGQRLVKL V+  +PD   +YRI CTAPP  
Sbjct  436  DVFVSVSLPVVGSMEVNLASAPFATHSFSQGQRLVKLTVSPTVPDADERYRIVCTAPPGG  495

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQL  211
             +APPGYYM+FAVN GVPSVARWVQL
Sbjct  496  KIAPPGYYMMFAVNLGVPSVARWVQL  521



>gb|ABA42922.1| glyoxal oxidase [Vitis pseudoreticulata]
Length=523

 Score =   196 bits (499),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGRVL+AGSNPHYFYK+   FPT+L IEAFSPEYL AD+ANIRPV+ E PE V + + F
Sbjct  376  PDGRVLIAGSNPHYFYKFAAEFPTELRIEAFSPEYLFADKANIRPVIDESPEMVRFGEQF  435

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNA  289
            +  ++V LPVVG +EVN ASAPF+THSFSQGQRLVKL V+  +PD   +YRI CTAPP  
Sbjct  436  DVFVSVSLPVVGSMEVNLASAPFATHSFSQGQRLVKLTVSPTVPDADERYRIVCTAPPGG  495

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQL  211
             +APPGYYM+FAVN GVPSVARWVQL
Sbjct  496  KIAPPGYYMMFAVNLGVPSVARWVQL  521



>ref|XP_010674911.1| PREDICTED: uncharacterized protein LOC104890981 [Beta vulgaris 
subsp. vulgaris]
Length=536

 Score =   196 bits (499),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGR+LLAGSNPHYFY ++G F T+L +EAFSPEYLS DRAN+RP +   P+K+ Y   F
Sbjct  389  PDGRILLAGSNPHYFYTFKGEFQTELRLEAFSPEYLSLDRANLRPEIKVCPKKLKYGDEF  448

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNA  289
            E  ++V L VVGV+E+N  +APF+THSFSQGQRLVKL V  AIP+  G Y+I C APPN 
Sbjct  449  EVELSVPLSVVGVIEINLGNAPFATHSFSQGQRLVKLNVKPAIPNDNGGYKISCVAPPNG  508

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQL  211
            MVAPPGYYM+FAVNQGVPS+A+WVQL
Sbjct  509  MVAPPGYYMMFAVNQGVPSIAQWVQL  534



>gb|ACV49898.1| glyoxal oxidase [Vitis vinifera]
Length=523

 Score =   196 bits (498),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGRVL+AGSNPHYFYK+   FPT+L IEAFSPEYL AD+ANIRPV+ E PE V + + F
Sbjct  376  PDGRVLIAGSNPHYFYKFAAEFPTELRIEAFSPEYLFADKANIRPVIDESPEMVRFGEQF  435

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNA  289
            +  ++V LPVVG +EVN ASAPF+THSFSQGQRLVKL V+  +PD   +YRI CTAPP  
Sbjct  436  DVFVSVSLPVVGSMEVNLASAPFATHSFSQGQRLVKLTVSPTVPDADERYRIVCTAPPGG  495

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQL  211
             +APPGYYM+FAVN GVPSVARWVQL
Sbjct  496  KIAPPGYYMMFAVNLGVPSVARWVQL  521



>ref|XP_002274763.1| PREDICTED: galactose oxidase [Vitis vinifera]
Length=542

 Score =   196 bits (499),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGRVL+AGSNPHYFYK+   FPT+L IEAFSPEYL AD+ANIRPV+ E PE V + + F
Sbjct  395  PDGRVLIAGSNPHYFYKFAAEFPTELRIEAFSPEYLFADKANIRPVIDESPEMVRFGEQF  454

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNA  289
            +  ++V LPVVG +EVN ASAPF+THSFSQGQRLVKL V+  +PD   +YRI CTAPP  
Sbjct  455  DVFVSVSLPVVGSMEVNLASAPFATHSFSQGQRLVKLTVSPTVPDADERYRIVCTAPPGG  514

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQL  211
             +APPGYYM+FAVN GVPSVARWVQL
Sbjct  515  KIAPPGYYMMFAVNLGVPSVARWVQL  540



>ref|XP_010088559.1| hypothetical protein L484_016951 [Morus notabilis]
 gb|EXB36700.1| hypothetical protein L484_016951 [Morus notabilis]
Length=538

 Score =   194 bits (492),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGRVL+AGSNPH FYK+   FPT+L +EAFSPEYLS DRAN+RPV+  +PE V Y +AF
Sbjct  391  PDGRVLVAGSNPHVFYKFEVEFPTELRVEAFSPEYLSPDRANLRPVIEGIPETVRYGEAF  450

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNA  289
            +  ++V LPVVG+VEVN  SAPF+THSFSQGQRLVKL VT   P G G+Y+I CTAPP+ 
Sbjct  451  DVVVSVPLPVVGIVEVNLGSAPFATHSFSQGQRLVKLAVTPTAPAGDGRYKISCTAPPSG  510

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQL  211
             VAPPGYYM FAVNQGVPSVARW+ L
Sbjct  511  RVAPPGYYMAFAVNQGVPSVARWIHL  536



>gb|KFK34638.1| hypothetical protein AALP_AA5G172000 [Arabis alpina]
Length=541

 Score =   193 bits (490),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 117/146 (80%), Gaps = 0/146 (0%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGR+LLAGSNPHYFYK++  FPT+L IEAFSPEYLS DRAN+RP + E+P+ V Y + F
Sbjct  394  PDGRILLAGSNPHYFYKFKSEFPTELRIEAFSPEYLSPDRANLRPEIREIPQIVRYGEVF  453

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNA  289
            +  +TV LPVV  +++N+ +APF+THSFSQGQR+VKL V   +PDG  +YRI CTAP   
Sbjct  454  DVFVTVLLPVVETIQMNWGNAPFATHSFSQGQRMVKLTVGPTVPDGESRYRIQCTAPLKR  513

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQL  211
             V PPGYYM FAVNQGVPSVARW+++
Sbjct  514  AVTPPGYYMAFAVNQGVPSVARWIRI  539



>ref|XP_007026880.1| Glyoxal oxidase-related protein [Theobroma cacao]
 gb|EOY07382.1| Glyoxal oxidase-related protein [Theobroma cacao]
Length=783

 Score =   194 bits (492),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 123/146 (84%), Gaps = 1/146 (1%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGRVL+AGSNPHYFYK+    PT+L +EAF PEYLS DRANIRPV+  +PE V Y +AF
Sbjct  634  PDGRVLIAGSNPHYFYKFAVELPTELRLEAFWPEYLSPDRANIRPVIEGIPETVRYGEAF  693

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNA  289
            +  ++V LPVVG+VEVNFASAPF+THSFSQGQRLVKL V  ++P+  G+YRI CTAPP+ 
Sbjct  694  DVFVSVSLPVVGIVEVNFASAPFATHSFSQGQRLVKLNVAPSVPE-DGRYRIKCTAPPSG  752

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQL  211
             VAPPGYYMVFAVNQGVPSVARWV++
Sbjct  753  AVAPPGYYMVFAVNQGVPSVARWVRV  778



>gb|AFK44665.1| unknown [Medicago truncatula]
Length=167

 Score =   181 bits (458),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 118/148 (80%), Gaps = 1/148 (1%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRG-PFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQA  472
            PDGRVLLAGSNPH FY++    F T+L IEAFSPEYL +D+ANIRP ++E+PE V Y   
Sbjct  20   PDGRVLLAGSNPHVFYRFVDVEFATELKIEAFSPEYLDSDKANIRPKILEVPETVLYGVG  79

Query  471  FEAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPN  292
            F+  ++V LPVVG++EVN  SAPF+THSF QGQRL+KL V  A+ DG  ++RI CTAPP+
Sbjct  80   FDVVVSVPLPVVGIIEVNLGSAPFATHSFFQGQRLIKLGVAFAMVDGDQRWRIRCTAPPS  139

Query  291  AMVAPPGYYMVFAVNQGVPSVARWVQLS  208
             MVA PGYYM+FAVNQGVPSVARW+ +S
Sbjct  140  GMVASPGYYMLFAVNQGVPSVARWIHMS  167



>ref|XP_003516307.1| PREDICTED: galactose oxidase-like [Glycine max]
Length=547

 Score =   190 bits (482),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 123/149 (83%), Gaps = 2/149 (1%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRG-PFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQA  472
            PD RVLLAGSNPH  Y++    FPT+L +EAFSPEYLSADRAN+RPV+ E+PE V +   
Sbjct  399  PDARVLLAGSNPHVLYRFNDVEFPTELRVEAFSPEYLSADRANLRPVIEEVPETVRFGGK  458

Query  471  FEAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPD-GTGKYRIGCTAPP  295
            F+  ++V LPVVG+VEVN ASAPF+THSFSQGQRLVKL V+SA+PD G G+YRIG TAPP
Sbjct  459  FDVVVSVALPVVGIVEVNLASAPFATHSFSQGQRLVKLAVSSAVPDGGDGRYRIGVTAPP  518

Query  294  NAMVAPPGYYMVFAVNQGVPSVARWVQLS  208
            +  VAPPGYYM FAVNQGVPSVA+W+ +S
Sbjct  519  SGAVAPPGYYMAFAVNQGVPSVAKWIHVS  547



>gb|KEH28959.1| glyoxal oxidase amino-terminal protein [Medicago truncatula]
Length=532

 Score =   188 bits (478),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 121/148 (82%), Gaps = 1/148 (1%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRG-PFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQA  472
            PDGRVLLAGSNPH FY++    F T+L IEAFSPEYL +D+ANIRP ++E+PE V Y   
Sbjct  385  PDGRVLLAGSNPHVFYRFVDVEFATELKIEAFSPEYLDSDKANIRPKILEVPETVLYGVG  444

Query  471  FEAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPN  292
            F+  ++V LPVVG++EVN  SAPF+THSFSQGQRL+KL V SA+ DG  ++RI CTAPP+
Sbjct  445  FDVVVSVPLPVVGIIEVNLGSAPFATHSFSQGQRLIKLGVASAMVDGDQRWRIRCTAPPS  504

Query  291  AMVAPPGYYMVFAVNQGVPSVARWVQLS  208
             MVAPPGYYM+FAVNQGVPSVARW+ +S
Sbjct  505  GMVAPPGYYMLFAVNQGVPSVARWIHMS  532



>ref|XP_010553274.1| PREDICTED: galactose oxidase [Tarenaya hassleriana]
Length=537

 Score =   188 bits (478),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 118/147 (80%), Gaps = 1/147 (1%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGR+LLAGSNPHYFYK++  FPT+L IEAFSPEYLS DRAN+RP ++E+P  V Y + F
Sbjct  389  PDGRILLAGSNPHYFYKFKAEFPTELRIEAFSPEYLSPDRANLRPEILEIPVTVRYGEGF  448

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIP-DGTGKYRIGCTAPPN  292
            +  + V LPVVG++EVN  SAPF+THSFSQGQRLVKL V  + P  G GKY+I C APPN
Sbjct  449  DLLVNVPLPVVGIIEVNLGSAPFATHSFSQGQRLVKLNVQPSEPVAGEGKYKIRCMAPPN  508

Query  291  AMVAPPGYYMVFAVNQGVPSVARWVQL  211
              VAPPGYYM FAVNQGVPSVA WV++
Sbjct  509  GAVAPPGYYMAFAVNQGVPSVAHWVRI  535



>ref|XP_003520957.1| PREDICTED: uncharacterized protein LOC100776515 [Glycine max]
Length=539

 Score =   188 bits (477),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/149 (68%), Positives = 125/149 (84%), Gaps = 2/149 (1%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRG-PFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQA  472
            PD RVLLAGSNPH  Y++    FPT+L +EAFSPEYLSADRAN+RPV+ E+P+ V +   
Sbjct  391  PDARVLLAGSNPHVLYRFDDVEFPTELRLEAFSPEYLSADRANLRPVIEEVPQTVRFGGK  450

Query  471  FEAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGT-GKYRIGCTAPP  295
            F+  ++V+LPVVG+VEVN ASAPF+THSFSQGQRLVKL V+SA+PDG+ G+YRIG TAPP
Sbjct  451  FDVVVSVDLPVVGIVEVNLASAPFATHSFSQGQRLVKLTVSSAVPDGSDGRYRIGVTAPP  510

Query  294  NAMVAPPGYYMVFAVNQGVPSVARWVQLS  208
            +  VAPPGYYM FAVNQGVPS+A+W+ +S
Sbjct  511  SGAVAPPGYYMAFAVNQGVPSIAKWIHVS  539



>gb|EPS61181.1| glyoxal oxidase, partial [Genlisea aurea]
Length=526

 Score =   187 bits (476),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 114/146 (78%), Gaps = 0/146 (0%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGRVL+AGSN HYFYK+   FPT+L IEAFSPEYLS DRANIRP LV LP++V Y + F
Sbjct  380  PDGRVLIAGSNTHYFYKFDAQFPTELRIEAFSPEYLSWDRANIRPNLVNLPQRVAYGEVF  439

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNA  289
            EA  TV+LPVVG+ EVN ASAPF+THSFSQGQRLVKL V +      G YR+ C AP   
Sbjct  440  EATFTVDLPVVGIPEVNLASAPFATHSFSQGQRLVKLSVETPTAVDGGGYRMRCVAPAGG  499

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQL  211
             VAPPGYYMVF VN GVPSVA+W+QL
Sbjct  500  KVAPPGYYMVFVVNLGVPSVAQWIQL  525



>ref|XP_010905399.1| PREDICTED: LOW QUALITY PROTEIN: galactose oxidase [Elaeis guineensis]
Length=553

 Score =   186 bits (472),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 119/154 (77%), Gaps = 7/154 (5%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGRVL+AGSNPHYFY++ G FPT+L +EAFSPEYLS D+A++RP +   P+KVGY + F
Sbjct  399  PDGRVLVAGSNPHYFYRFEGEFPTELRVEAFSPEYLSPDKASLRPGIEAAPDKVGYGEGF  458

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKL----PVTSAIPDGTG---KYRIG  310
            E  I V LPVVGVVE N  SAPF+THSFSQGQR+V+L    PV  A   G G   +YRI 
Sbjct  459  ELEIEVALPVVGVVEANLLSAPFATHSFSQGQRMVRLSVSPPVDVASGGGDGAPYRYRIV  518

Query  309  CTAPPNAMVAPPGYYMVFAVNQGVPSVARWVQLS  208
            CTAPPN  VAPPGYYM FAVNQGVPS ARWVQL+
Sbjct  519  CTAPPNGRVAPPGYYMAFAVNQGVPSAARWVQLA  552



>ref|XP_006850437.1| PREDICTED: galactose oxidase [Amborella trichopoda]
 gb|ERN12018.1| hypothetical protein AMTR_s00165p00057230 [Amborella trichopoda]
Length=544

 Score =   184 bits (467),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 116/155 (75%), Gaps = 9/155 (6%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGR+L AGSNP+YFY ++G FPT+L IEAFSPEYLS DR N+RPV+ + P  + Y + F
Sbjct  388  PDGRILTAGSNPNYFYSFKGDFPTELRIEAFSPEYLSPDRQNLRPVISKTPSVIRYSEQF  447

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTG---------KYR  316
            E  I V LPVV VVE+NFASAPF+THSFSQGQRLVKL V+SA P  +G          Y 
Sbjct  448  EVQIKVPLPVVEVVEINFASAPFATHSFSQGQRLVKLSVSSAHPSISGAISADSGGYTYT  507

Query  315  IGCTAPPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            I CTAPPN  VAPP YYM+FAVNQGVPSVA W+ L
Sbjct  508  ISCTAPPNGAVAPPSYYMMFAVNQGVPSVASWIHL  542



>ref|XP_008811510.1| PREDICTED: galactose oxidase [Phoenix dactylifera]
Length=557

 Score =   182 bits (463),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 118/153 (77%), Gaps = 7/153 (5%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGRVL+AGSNPHYFY++ G FPT+L +EAFSPEYLS D+A++RP L   PEKVGY + F
Sbjct  403  PDGRVLVAGSNPHYFYRFEGEFPTELRVEAFSPEYLSPDKASLRPGLEAAPEKVGYGEGF  462

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVT--SAIPDGTG-----KYRIG  310
            E  + V LPVVGV+EVN  SAPF+THSFSQGQR+V+L V+  + +  G G     +YRI 
Sbjct  463  EVEVEVALPVVGVLEVNLLSAPFATHSFSQGQRMVRLAVSPPAEVASGGGDGAPHRYRIA  522

Query  309  CTAPPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            C APP+  VAPPGYYM F VNQGVPS ARWVQL
Sbjct  523  CKAPPDGRVAPPGYYMAFVVNQGVPSAARWVQL  555



>gb|KHN14867.1| Galactose oxidase, partial [Glycine soja]
Length=361

 Score =   175 bits (443),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 121/148 (82%), Gaps = 3/148 (2%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRG-PFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQA  472
            PD RVLLAGSNPH  Y++    FPT+L +EAFSPEYLSADRAN+RPV+ E+P+ V +   
Sbjct  216  PDARVLLAGSNPHVLYRFDDVEFPTELRLEAFSPEYLSADRANLRPVIEEVPQTVRFGGK  275

Query  471  FEAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPN  292
            F+  ++V+LPVVG+VEVN ASAPF+THSFSQGQRLVKL V+SA+PDG G  R G TAPP+
Sbjct  276  FDVVVSVDLPVVGIVEVNLASAPFATHSFSQGQRLVKLAVSSAVPDG-GDGR-GRTAPPS  333

Query  291  AMVAPPGYYMVFAVNQGVPSVARWVQLS  208
              VAPPGYYM FAVNQGVPS+A+W+ +S
Sbjct  334  GAVAPPGYYMAFAVNQGVPSIAKWIHVS  361



>ref|XP_009421296.1| PREDICTED: galactose oxidase [Musa acuminata subsp. malaccensis]
Length=559

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 117/153 (76%), Gaps = 7/153 (5%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGRVL+AGSNPHYFY++ G FPT+L +EAFSPEYL+AD+A++RPV++  PE+V Y   F
Sbjct  405  PDGRVLVAGSNPHYFYRFAGDFPTELRVEAFSPEYLAADKASLRPVIMAAPERVWYGDEF  464

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSA--IPDGTGK-----YRIG  310
               + V LP+VG++EVN  SAPF+THSFSQGQR+VKL V+ A  + DG G      YR G
Sbjct  465  VMEVEVPLPLVGLMEVNLLSAPFATHSFSQGQRMVKLAVSPAVTVADGGGDGTPYSYRFG  524

Query  309  CTAPPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            C APP+  VAPPGYYM F VNQ VPSVA WVQL
Sbjct  525  CKAPPDGRVAPPGYYMAFVVNQMVPSVAHWVQL  557



>ref|XP_002972585.1| hypothetical protein SELMODRAFT_97196 [Selaginella moellendorffii]
 gb|EFJ26671.1| hypothetical protein SELMODRAFT_97196 [Selaginella moellendorffii]
Length=551

 Score =   143 bits (360),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 98/146 (67%), Gaps = 0/146 (0%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PD RVL+AGSN HY+Y + G FPT+L +E FSPEYLS   A++RP ++  P  + Y   F
Sbjct  404  PDARVLIAGSNTHYYYTFTGSFPTELRVETFSPEYLSEGLASLRPTIIGSPVVLFYGLEF  463

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNA  289
               +TV LPV G +EV+  SAPF+THS+SQGQRLV L  T+ +  G   Y I  T PP  
Sbjct  464  TVTVTVPLPVTGTLEVSLVSAPFTTHSYSQGQRLVHLTSTTPVSIGDRTYTITGTGPPTG  523

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQL  211
             +AP  YYM+F VNQG+PS A WVQ+
Sbjct  524  NLAPQAYYMLFVVNQGIPSTAVWVQV  549



>ref|XP_002972039.1| hypothetical protein SELMODRAFT_441651 [Selaginella moellendorffii]
 gb|EFJ26956.1| hypothetical protein SELMODRAFT_441651 [Selaginella moellendorffii]
Length=550

 Score =   142 bits (358),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 98/146 (67%), Gaps = 0/146 (0%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PD RVL+AGSN HY+Y + G FPT+L +E FSPEYLS   A++RP ++  P  + Y   F
Sbjct  403  PDARVLIAGSNTHYYYTFTGSFPTELRVETFSPEYLSEGLASLRPTIIGSPVVLFYGLEF  462

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNA  289
               +TV LPV G +EV+  SAPF+THS+SQGQRLV L  T+ +  G   Y +  T PP  
Sbjct  463  TVTVTVPLPVTGTLEVSLVSAPFTTHSYSQGQRLVHLSSTTPVSIGDRTYTVTGTGPPTG  522

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQL  211
             +AP  YYM+F VNQG+PS A WVQ+
Sbjct  523  NLAPQAYYMLFVVNQGIPSTAVWVQV  548



>gb|AFG64082.1| hypothetical protein 2_2702_01, partial [Pinus taeda]
 gb|AFG64083.1| hypothetical protein 2_2702_01, partial [Pinus taeda]
 gb|AFG64085.1| hypothetical protein 2_2702_01, partial [Pinus taeda]
 gb|AFG64086.1| hypothetical protein 2_2702_01, partial [Pinus taeda]
 gb|AFG64087.1| hypothetical protein 2_2702_01, partial [Pinus taeda]
 gb|AFG64088.1| hypothetical protein 2_2702_01, partial [Pinus taeda]
 gb|AFG64089.1| hypothetical protein 2_2702_01, partial [Pinus taeda]
 gb|AFG64091.1| hypothetical protein 2_2702_01, partial [Pinus taeda]
 gb|AFG64092.1| hypothetical protein 2_2702_01, partial [Pinus taeda]
 gb|AFG64093.1| hypothetical protein 2_2702_01, partial [Pinus taeda]
 gb|AFG64094.1| hypothetical protein 2_2702_01, partial [Pinus taeda]
 gb|AFG64095.1| hypothetical protein 2_2702_01, partial [Pinus taeda]
 gb|AFG64096.1| hypothetical protein 2_2702_01, partial [Pinus taeda]
 gb|AFG64097.1| hypothetical protein 2_2702_01, partial [Pinus taeda]
 gb|AFG64098.1| hypothetical protein 2_2702_01, partial [Pinus taeda]
 gb|AFG64099.1| hypothetical protein 2_2702_01, partial [Pinus taeda]
Length=116

 Score =   132 bits (333),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 91/113 (81%), Gaps = 2/113 (2%)
 Frame = -3

Query  543  LSADRANIRPVLVELPEKVGYRQAFEAAITvelpvvgvveVNFASAPFSTHSFSQGQRLV  364
            L  +RAN+RP +++ P+ + Y  +F   ++VELPVVG++EVN ASAPFSTHSFSQGQRL+
Sbjct  1    LRTNRANLRPKIIKSPDVLNYGSSFIVQVSVELPVVGIIEVNMASAPFSTHSFSQGQRLI  60

Query  363  KLPVTSAIPDGTG--KYRIGCTAPPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            KL V+SAIPDG G   Y I  TAPPNA+VAPP YYMVFAVNQGVPS+A W+QL
Sbjct  61   KLDVSSAIPDGLGASTYTITATAPPNAIVAPPSYYMVFAVNQGVPSIAAWIQL  113



>gb|AEW08192.1| hypothetical protein 2_2702_01, partial [Pinus lambertiana]
Length=116

 Score =   131 bits (330),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 90/113 (80%), Gaps = 2/113 (2%)
 Frame = -3

Query  543  LSADRANIRPVLVELPEKVGYRQAFEAAITvelpvvgvveVNFASAPFSTHSFSQGQRLV  364
            L  +RAN+RP +++ P+ + Y  +F   ++VELPVVG++EVN ASAPFSTHSFSQGQRL+
Sbjct  1    LRTNRANLRPKIIKSPDVLNYGSSFSVQVSVELPVVGIIEVNMASAPFSTHSFSQGQRLI  60

Query  363  KLPVTSAIPDGTG--KYRIGCTAPPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            KL V+SAIPDG G   Y I  T PPNA+VAPP YYMVFAVNQGVPS+A W+QL
Sbjct  61   KLEVSSAIPDGPGASTYTITATGPPNAIVAPPSYYMVFAVNQGVPSIATWIQL  113



>gb|AFG64084.1| hypothetical protein 2_2702_01, partial [Pinus taeda]
Length=116

 Score =   130 bits (328),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 90/113 (80%), Gaps = 2/113 (2%)
 Frame = -3

Query  543  LSADRANIRPVLVELPEKVGYRQAFEAAITvelpvvgvveVNFASAPFSTHSFSQGQRLV  364
            L  +RAN+RP +++ P+ + Y  +F   ++VELPVVG++EVN ASAPFSTHSFSQGQRL+
Sbjct  1    LRTNRANLRPKIIKSPDVLNYGSSFVVQVSVELPVVGIIEVNMASAPFSTHSFSQGQRLI  60

Query  363  KLPVTSAIPD--GTGKYRIGCTAPPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            KL V+SAIPD  G   Y I  TAPPNA+VAPP YYMVFAVNQGVPS+A W+QL
Sbjct  61   KLDVSSAIPDSLGASTYTITATAPPNAIVAPPSYYMVFAVNQGVPSIAAWIQL  113



>ref|XP_002970607.1| hypothetical protein SELMODRAFT_411320 [Selaginella moellendorffii]
 gb|EFJ28737.1| hypothetical protein SELMODRAFT_411320 [Selaginella moellendorffii]
Length=529

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/148 (47%), Positives = 100/148 (68%), Gaps = 0/148 (0%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGRVL+AGSN  Y Y+Y GPFPT+L +E FSP YL A    +RP + + P  + Y   F
Sbjct  382  PDGRVLVAGSNTRYTYQYTGPFPTELRVETFSPAYLDATNDWLRPRIAKNPFTITYGMPF  441

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNA  289
               + +   +VG +++   S+PF+THSFSQGQR +KLPV +++      Y +  TAPP++
Sbjct  442  SVDVAIPGKLVGNIQLTLLSSPFTTHSFSQGQRQLKLPVAASVLSYANTYYVASTAPPSS  501

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQLSA  205
            +VAPP YYM+FA++ G+PS A WV +++
Sbjct  502  VVAPPSYYMLFALHNGIPSQAVWVLVTS  529



>gb|AFG64090.1| hypothetical protein 2_2702_01, partial [Pinus taeda]
Length=116

 Score =   129 bits (325),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 90/113 (80%), Gaps = 2/113 (2%)
 Frame = -3

Query  543  LSADRANIRPVLVELPEKVGYRQAFEAAITvelpvvgvveVNFASAPFSTHSFSQGQRLV  364
            L  +RAN+RP +++ P+ + Y  +F   ++VELPVVG++EVN ASAPFSTHSFSQGQRL+
Sbjct  1    LRTNRANLRPKMIKSPDVLNYGSSFIVQVSVELPVVGIIEVNMASAPFSTHSFSQGQRLI  60

Query  363  KLPVTSAIPDGTG--KYRIGCTAPPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            KL V+SA PDG G   Y I  TAPPNA+VAPP YYMVFAVNQGVPS+A W+QL
Sbjct  61   KLDVSSANPDGLGASTYTITATAPPNAIVAPPSYYMVFAVNQGVPSIAAWIQL  113



>ref|XP_001771982.1| predicted protein [Physcomitrella patens]
 gb|EDQ63243.1| predicted protein [Physcomitrella patens]
Length=550

 Score =   137 bits (346),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/148 (47%), Positives = 98/148 (66%), Gaps = 1/148 (1%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAFE  466
            DGRVLLAGSN H FY + G +PT+L I+AFSP YLS    +++P +   P ++ Y   F 
Sbjct  401  DGRVLLAGSNSHQFYTFTGDYPTELRIDAFSPPYLSPTLNDLKPTISVSPLQISYGTPFT  460

Query  465  AAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGK-YRIGCTAPPNA  289
              +     +  +V++N  SAPF+THS+SQGQRLV L V  ++       Y++  TAPP+ 
Sbjct  461  VTVITPTGMTTIVDLNLMSAPFNTHSYSQGQRLVSLNVAGSVQVAQASVYQVTATAPPSP  520

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQLSA  205
             VAPPGYYM+FAVNQ VPS A W+++++
Sbjct  521  QVAPPGYYMLFAVNQRVPSTAVWIRVAS  548



>gb|AEW08193.1| hypothetical protein 2_2702_01, partial [Pinus radiata]
Length=116

 Score =   129 bits (325),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 90/113 (80%), Gaps = 2/113 (2%)
 Frame = -3

Query  543  LSADRANIRPVLVELPEKVGYRQAFEAAITvelpvvgvveVNFASAPFSTHSFSQGQRLV  364
            L  +RAN+RP +++ P+ + Y  +F   ++VELPVVG++EVN ASAPFSTHSFSQGQRL+
Sbjct  1    LRTNRANLRPKIIKSPDVLNYGSSFIVQVSVELPVVGIIEVNMASAPFSTHSFSQGQRLI  60

Query  363  KLPVTSAIPDGTG--KYRIGCTAPPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            KL V+SA PDG G   Y I  TAPPNA+VAPP YYMVFAVNQGVPS+A W+QL
Sbjct  61   KLDVSSANPDGLGASTYTITATAPPNAIVAPPSYYMVFAVNQGVPSIAAWIQL  113



>ref|XP_002968444.1| hypothetical protein SELMODRAFT_231119 [Selaginella moellendorffii]
 gb|EFJ30698.1| hypothetical protein SELMODRAFT_231119 [Selaginella moellendorffii]
Length=520

 Score =   137 bits (345),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 69/148 (47%), Positives = 99/148 (67%), Gaps = 0/148 (0%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGRVL+AGSN  Y Y+Y GPFPT+L +E FSP YL A    +RP + + P  + Y   F
Sbjct  373  PDGRVLVAGSNTRYTYQYTGPFPTELRVETFSPAYLDATNDWLRPRIAKNPFTITYGMPF  432

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNA  289
               + +   +VG +++   S+PF+THSFSQGQR +KLPV +++      Y +  TAPP++
Sbjct  433  SVDVAIPGKLVGNIQLTLLSSPFTTHSFSQGQRQLKLPVAASVLSYANTYYVASTAPPSS  492

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQLSA  205
             VAPP YYM+FA++ G+PS A WV +++
Sbjct  493  GVAPPSYYMLFALHNGIPSQAVWVLVTS  520



>ref|XP_001774194.1| predicted protein [Physcomitrella patens]
 gb|EDQ60970.1| predicted protein [Physcomitrella patens]
Length=533

 Score =   137 bits (344),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 72/147 (49%), Positives = 95/147 (65%), Gaps = 2/147 (1%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGRVL+AGSN H FY Y G FPT+L +EA+SP YL ++  N+RP +  +P  + Y+ AF
Sbjct  389  PDGRVLVAGSNTHQFYTYSGEFPTELRVEAYSPAYLGSNFNNVRPQITGVPGVIKYKTAF  448

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNA  289
                       G  EVN  SAP+STHSFSQGQR +KL V + +  GTG   I  T PP+A
Sbjct  449  TVTFN-IGARTGGFEVNILSAPYSTHSFSQGQRAIKLAVVAPVRSGTGWSTI-VTGPPSA  506

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQLS  208
             VAP  +YM+F V  G+P  +RWV+++
Sbjct  507  NVAPQQHYMLFCVQNGIPGTSRWVRVA  533



>ref|XP_001774885.1| predicted protein [Physcomitrella patens]
 gb|EDQ60297.1| predicted protein [Physcomitrella patens]
Length=534

 Score =   137 bits (344),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 68/147 (46%), Positives = 92/147 (63%), Gaps = 5/147 (3%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGR+L AGSN H FY + G FPT+L I+AFSP YL   R  +     ++P  + Y  AF
Sbjct  393  PDGRILCAGSNTHQFYTFTGEFPTELRIDAFSPPYLGGTRPGL-----QVPGAMKYGDAF  447

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNA  289
               +T    +   V++N  S+P  THS++QGQRL+KL   + +  G GKY +   APP++
Sbjct  448  TGTVTYNGDISAGVQLNMVSSPLVTHSYAQGQRLLKLAAEAPVGSGAGKYTVASAAPPDS  507

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQLS  208
             +AP GYY VFA+  GVPS A WVQ+S
Sbjct  508  TIAPAGYYKVFAIVNGVPSWANWVQMS  534



>ref|XP_001763031.1| predicted protein [Physcomitrella patens]
 gb|EDQ72236.1| predicted protein [Physcomitrella patens]
Length=537

 Score =   136 bits (343),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 95/146 (65%), Gaps = 6/146 (4%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAFE  466
            DGR+L+AGSN H FY + G FPT+L IEAFSP YL  DR  +      +   +GY  AF 
Sbjct  396  DGRILVAGSNTHQFYTFNGEFPTELRIEAFSPPYLGGDRPEL-----AVGGALGYGDAFT  450

Query  465  AAIT-velpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNA  289
            A +T       G +++  ASAPF THS++ GQRL+ L VT+ +  G GKY +  TAPP++
Sbjct  451  ATVTYGGDLNGGNIDLTLASAPFVTHSYAMGQRLLWLGVTAPVAAGAGKYTVDATAPPSS  510

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQL  211
             +AP GYYM+FAV  GVPS A WV++
Sbjct  511  TIAPAGYYMLFAVANGVPSYASWVKV  536



>ref|XP_001759192.1| predicted protein [Physcomitrella patens]
 gb|EDQ75876.1| predicted protein [Physcomitrella patens]
Length=533

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 99/146 (68%), Gaps = 4/146 (3%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAFE  466
            DGRVL+AGSN H FY YRG  PT+L +EAF+P YLSA+  + RP ++E+P  +GYRQ F 
Sbjct  390  DGRVLVAGSNTHQFYTYRGTLPTELRVEAFAPAYLSANLNDCRPRIMEVPAAIGYRQKFN  449

Query  465  AAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGT-GKYRIGCTAPPNA  289
             A  +    VG VEVN  SAPF+THS+SQGQR +KL  T  +P  + G +    T PP++
Sbjct  450  VAF-LARSRVGYVEVNILSAPFTTHSYSQGQRAIKLAAT--VPGKSRGFWVTRVTGPPSS  506

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQL  211
             VAP  YYM+F +  GVPS A WV++
Sbjct  507  SVAPQQYYMLFCLQNGVPSRANWVRV  532



>ref|XP_001756237.1| predicted protein [Physcomitrella patens]
 gb|EDQ79103.1| predicted protein [Physcomitrella patens]
Length=535

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 92/146 (63%), Gaps = 5/146 (3%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGR+L AGSN H FY + G FPT+L I+A++P YL       RP L E+P  + Y  AF
Sbjct  394  PDGRILCAGSNTHQFYTFTGDFPTELRIDAYNPPYLGG----TRPAL-EIPGAIAYGGAF  448

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNA  289
             A +T        +++   ++PF THS++QGQRL+KL  +  +  G GKY +  T PP+A
Sbjct  449  TATVTYGGDFTVGIQLTMVNSPFVTHSYAQGQRLLKLAASVPVIVGGGKYTVDSTGPPDA  508

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQL  211
             +AP GYYM+FA+  GVPS A W ++
Sbjct  509  TIAPGGYYMLFAIVNGVPSWANWAKI  534



>ref|XP_001764698.1| predicted protein [Physcomitrella patens]
 gb|EDQ70397.1| predicted protein [Physcomitrella patens]
Length=453

 Score =   128 bits (322),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 91/145 (63%), Gaps = 2/145 (1%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGR+L+AGSN H FY YRG +PT+L +EAFSP YL+     ++P +   P+ + Y+Q F
Sbjct  308  PDGRILVAGSNTHQFYTYRGAYPTELRVEAFSPPYLAGGNGAVKPAIKAYPKALKYKQNF  367

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNA  289
                      VG VEVN  SAPF THSF+QGQRL+KL   + +  G   + +G TA P  
Sbjct  368  VITF-GIGRRVGGVEVNMLSAPFVTHSFAQGQRLMKLKTAAPVKAGA-NWSVGVTAVPGN  425

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQ  214
             +APP +YM F V  GVPS A W++
Sbjct  426  TIAPPAWYMFFVVQNGVPSKAVWIK  450



>ref|XP_002970610.1| hypothetical protein SELMODRAFT_93556 [Selaginella moellendorffii]
 gb|EFJ28740.1| hypothetical protein SELMODRAFT_93556 [Selaginella moellendorffii]
Length=535

 Score =   128 bits (322),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 94/147 (64%), Gaps = 0/147 (0%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGRVL+AGSN H +Y + G FPT+L +EAFSP YL       RP LV  P  + Y   F
Sbjct  388  PDGRVLVAGSNTHEYYTFTGAFPTELRVEAFSPAYLDPANDWQRPKLVNYPGVINYGMPF  447

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNA  289
               +++   + G +E+   SAPF+THSFSQGQR +KL V++ +      + +  +APP+A
Sbjct  448  SVDVSLPGNLTGDIELTLLSAPFTTHSFSQGQRQLKLAVSTPLRANGNTFTVKSSAPPSA  507

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQLS  208
            ++APP +YM+F ++ G+P  A WV ++
Sbjct  508  VIAPPSFYMLFPLHNGIPGTATWVMVT  534



>ref|XP_001759194.1| predicted protein [Physcomitrella patens]
 gb|EDQ75878.1| predicted protein [Physcomitrella patens]
Length=537

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/148 (46%), Positives = 91/148 (61%), Gaps = 4/148 (3%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRA---NIRPVLVELPEKVGYRQ  475
            DG VL+AGSN H FY Y GPFPT+L +EAFSP+YLSA +A    +RP + + P  + Y+Q
Sbjct  390  DGSVLVAGSNTHQFYTYTGPFPTELRVEAFSPDYLSARQALNNAVRPRITQYPRVMKYQQ  449

Query  474  AFEAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPP  295
            A++    V      V   N  SAPF+TH+F QGQR +KL V        G + +  TAPP
Sbjct  450  AYDVTFVVNTRRGVVAV-NLLSAPFATHNFLQGQRAIKLTVAVPRQASGGAWAVRTTAPP  508

Query  294  NAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            +A V P  YYM+F +  GVP  A W+++
Sbjct  509  SANVCPQQYYMMFCLQAGVPGRAVWIKM  536



>ref|XP_001783776.1| predicted protein [Physcomitrella patens]
 gb|EDQ51428.1| predicted protein [Physcomitrella patens]
Length=525

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 65/147 (44%), Positives = 89/147 (61%), Gaps = 3/147 (2%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAFE  466
            DGR+LLAGSN H +Y + G FPT+L I+AFSP YLS    NIRP + + P  +GY + F 
Sbjct  379  DGRILLAGSNTHQYYTFTGRFPTELRIDAFSPPYLSTRNNNIRPTMTKSPGSIGYGEKFA  438

Query  465  AAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGK--YRIGCTAPPN  292
               T      G  E+N  S PF THS++ GQR++KL VT  +     +  + +   APP 
Sbjct  439  ITFT-VAERHGGFELNMKSTPFVTHSYAMGQRMLKLEVTEPVASAATQNSFAVDVIAPPT  497

Query  291  AMVAPPGYYMVFAVNQGVPSVARWVQL  211
            A +APPGYYM++ V   +P  A WV++
Sbjct  498  AELAPPGYYMLWPVQDWIPGTAAWVKI  524



>ref|XP_002968445.1| hypothetical protein SELMODRAFT_89852 [Selaginella moellendorffii]
 gb|EFJ30699.1| hypothetical protein SELMODRAFT_89852 [Selaginella moellendorffii]
Length=535

 Score =   125 bits (315),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 93/147 (63%), Gaps = 0/147 (0%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGRVL+AGSN H +Y + G FPT+L +EAFSP YL       RP LV  P  + Y   F
Sbjct  388  PDGRVLVAGSNTHEYYTFTGEFPTELRVEAFSPAYLDPANDWQRPKLVNYPGVINYGMPF  447

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNA  289
               +++   + G +E+   SAPF+THSFSQGQR +KL V++ +      + +  +APP+A
Sbjct  448  SVDVSLPGNLTGDIELTLLSAPFTTHSFSQGQRQLKLAVSTPLRANGNTFTVKSSAPPSA  507

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQLS  208
            ++APP +YM+  ++ G+P  A WV ++
Sbjct  508  VIAPPSFYMLVPLHNGIPGTATWVMVT  534



>gb|KFK26190.1| hypothetical protein AALP_AA8G214300 [Arabis alpina]
Length=592

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 92/150 (61%), Gaps = 4/150 (3%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVE--LPEKVGYRQ  475
            PDG+VL+AGSN +  YKY   +PT+L +E FSP YL    AN+RP +V    P+++ Y Q
Sbjct  442  PDGKVLVAGSNTNDGYKYNVEYPTELRVEKFSPPYLDPALANLRPKIVANGTPKQIRYGQ  501

Query  474  AFEAAITvelp--vvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTA  301
             F+  + +         ++V   + PF+THS S   RL+ L V++  P G G + I   A
Sbjct  502  NFKVKVNLNQQGVTKQNLKVTMLAPPFTTHSISMNMRLLLLGVSAVTPAGAGTFEIQTLA  561

Query  300  PPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            PPN  +APPGYY++FAV QGVPS   W+Q+
Sbjct  562  PPNGNIAPPGYYLIFAVYQGVPSTGEWIQV  591



>ref|XP_001772413.1| predicted protein [Physcomitrella patens]
 gb|EDQ62884.1| predicted protein [Physcomitrella patens]
Length=531

 Score =   123 bits (308),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 68/146 (47%), Positives = 92/146 (63%), Gaps = 6/146 (4%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGR+L+AGSN H FY   G  PT+L IEAFSP YL+++R    P     P  + +   F
Sbjct  391  PDGRILVAGSNTHQFYTLTGYLPTELRIEAFSPPYLASNR----PTFTAAPGGLKHGAGF  446

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNA  289
             A  TV++     +E+N ASAP  THSF+QGQRL++L V + I  G GK+R+   APP +
Sbjct  447  TA--TVKVDNAKHIELNMASAPLVTHSFAQGQRLLQLQVGAPIAAGGGKFRVDSKAPPTS  504

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQL  211
             VAP GYYM+F +  G+   A WV++
Sbjct  505  AVAPAGYYMLFPLVDGIVGSASWVRI  530



>gb|KJB16941.1| hypothetical protein B456_002G255700 [Gossypium raimondii]
Length=473

 Score =   122 bits (307),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 80/97 (82%), Gaps = 1/97 (1%)
 Frame = -3

Query  501  LPEKVGYRQAFEAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGK  322
            +PE V Y +AF+  +TV LPVVGVVEVNF +APF+THSFSQGQRLVKL VT ++P   G+
Sbjct  376  IPETVRYGEAFDVFVTVPLPVVGVVEVNFGNAPFATHSFSQGQRLVKLTVTPSVP-VDGR  434

Query  321  YRIGCTAPPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            YRI CTAPPN  VAPPGYYM FAVNQGVPSVARWV L
Sbjct  435  YRIKCTAPPNGAVAPPGYYMAFAVNQGVPSVARWVHL  471



>ref|XP_001774105.1| predicted protein [Physcomitrella patens]
 gb|EDQ61019.1| predicted protein [Physcomitrella patens]
Length=530

 Score =   122 bits (306),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 90/145 (62%), Gaps = 4/145 (3%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAFE  466
            DGRVLLAGSN H FY Y G +PT+L +EAFSP YL A    +RP +   P+++ Y+Q F 
Sbjct  386  DGRVLLAGSNTHQFYTYNGQYPTELRVEAFSPPYLGAGFNGVRPAIQAYPKQIKYKQVFV  445

Query  465  AAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGK-YRIGCTAPPNA  289
               T      G VEVN  SAP+ THSF+QGQR +KL   +++P   G  + +  TA P  
Sbjct  446  MTFT-VGRRAGGVEVNMNSAPYVTHSFAQGQRQMKL--KTSVPAKAGNAWSVQVTAVPGN  502

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQ  214
             +APP YY++F V  G+PS   WV+
Sbjct  503  TIAPPAYYLLFVVQNGIPSKGVWVK  527



>ref|XP_001778975.1| predicted protein [Physcomitrella patens]
 gb|EDQ56230.1| predicted protein [Physcomitrella patens]
Length=534

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/148 (44%), Positives = 91/148 (61%), Gaps = 1/148 (1%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAFE  466
            DGR+ +AGSNP+ FY +   +PT+L +EAFSP YL+      RP +   P ++ Y   F 
Sbjct  387  DGRIFVAGSNPNQFYVFNVEYPTELKLEAFSPPYLAPSHDLQRPTVTVSPLQITYNTLFT  446

Query  465  AAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGK-YRIGCTAPPNA  289
              +   +P+   +E+N  +AP+STHS+ QGQRLV L V++ +       Y++  TAP   
Sbjct  447  ITVAFPVPLTSELEINLVNAPYSTHSYQQGQRLVGLAVSALVQVAQASVYQVTLTAPSTP  506

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQLSA  205
             VAPPGYYM+FAVNQ +PS   WV LS 
Sbjct  507  TVAPPGYYMLFAVNQAIPSKGVWVLLST  534



>ref|XP_001767275.1| predicted protein [Physcomitrella patens]
 gb|EDQ67956.1| predicted protein [Physcomitrella patens]
Length=490

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 92/146 (63%), Gaps = 0/146 (0%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGRVL+AGSN H  Y + G FPT+L +EAF P Y+     +I+P+ V  P  + Y   F
Sbjct  344  PDGRVLVAGSNCHIHYTFVGEFPTELRVEAFQPAYMDPIHDSIKPLFVSNPITISYGAPF  403

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNA  289
            +  +++  PV G+V +   S+PF+THS+SQGQR VKL ++  +   +  Y I    P NA
Sbjct  404  DVQVSIPGPVQGMVGLTLTSSPFTTHSYSQGQRQVKLAISPPMQLSSNVYSISTKGPLNA  463

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQL  211
             VAPP +YM+ A++Q +PS   WVQ+
Sbjct  464  NVAPPSWYMLHALHQQIPSYGVWVQV  489



>ref|XP_001758038.1| predicted protein [Physcomitrella patens]
 gb|EDQ77280.1| predicted protein [Physcomitrella patens]
Length=513

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 66/145 (46%), Positives = 89/145 (61%), Gaps = 6/145 (4%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAFE  466
            DGR+LLAGSN H FY   G  PT+L I+A+SP+YL A+     P    +P  +GY   F 
Sbjct  374  DGRILLAGSNTHQFYTLTGYLPTELRIQAYSPDYLGANP----PSFTTVPGGLGYGVDFT  429

Query  465  AAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNAM  286
            A +  +      +E+N  SAPF THS++ GQRL++L VT+   DG G Y +  T+PP+  
Sbjct  430  AVV--KATNPTKIELNLISAPFVTHSYAMGQRLLQLAVTAPADDGAGGYNVYSTSPPSQQ  487

Query  285  VAPPGYYMVFAVNQGVPSVARWVQL  211
            VAP GYYM+F V  GV   A WV++
Sbjct  488  VAPAGYYMLFPVADGVVGYAWWVKI  512



>ref|XP_001782509.1| predicted protein [Physcomitrella patens]
 gb|EDQ52661.1| predicted protein [Physcomitrella patens]
Length=518

 Score =   120 bits (301),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 86/144 (60%), Gaps = 2/144 (1%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAFE  466
            DGRV++AGSN H FY Y G FPT+L +EAFSP YL A+    RP +   P  + Y Q F 
Sbjct  374  DGRVIVAGSNTHQFYTYTGAFPTELRVEAFSPPYLGANYNAYRPAITGAPIALKYNQVFT  433

Query  465  AAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNAM  286
             A TV +    V      SAPF+THSFSQGQR + L  +  +  G G + +  TA PN  
Sbjct  434  MAFTVGVRRGAVTVYQ-NSAPFTTHSFSQGQRSLHLKTSVPVRAGAG-WSMQVTAAPNNS  491

Query  285  VAPPGYYMVFAVNQGVPSVARWVQ  214
            +APP +Y+ F V  G+PS  +W++
Sbjct  492  LAPPAWYIFFCVQNGIPSKGKWIK  515



>ref|XP_001777189.1| predicted protein [Physcomitrella patens]
 gb|EDQ57969.1| predicted protein [Physcomitrella patens]
Length=530

 Score =   120 bits (300),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 90/145 (62%), Gaps = 4/145 (3%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAFE  466
            DGRVLLAGSN H FY Y G +PT+L +EAFSP YL A    +RP +   P+++ Y+Q F 
Sbjct  386  DGRVLLAGSNTHQFYTYNGQYPTELRVEAFSPPYLGAGFNGVRPAIQGYPKQIKYKQVFI  445

Query  465  AAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGK-YRIGCTAPPNA  289
               T     VG VEVN  SAP+ THSF+QGQR +KL   +++P   G  + +   A P  
Sbjct  446  MTFT-VGKRVGGVEVNMNSAPYVTHSFAQGQRQLKL--KTSVPAKAGNAWSVQVAAVPGN  502

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQ  214
             +APP YY++F V  G+PS   WV+
Sbjct  503  TIAPPAYYLLFVVQNGIPSKGVWVK  527



>ref|XP_001769885.1| predicted protein [Physcomitrella patens]
 gb|EDQ65245.1| predicted protein [Physcomitrella patens]
Length=530

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 90/145 (62%), Gaps = 4/145 (3%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAFE  466
            DGRVLLAGSN H FY Y G +PT+L +EAFSP YL A    +RP +   P+ + Y+Q F 
Sbjct  386  DGRVLLAGSNTHQFYTYNGQYPTELRVEAFSPPYLGAGFNGVRPAIQGYPKFIKYKQVFV  445

Query  465  AAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGK-YRIGCTAPPNA  289
               T     VG VEVN  SAP+ THSF+QGQR +KL   +++P   G  + +  TA P  
Sbjct  446  MTFT-VGKRVGGVEVNMNSAPYVTHSFAQGQRQMKL--KTSVPAKAGNAWSVQVTAVPGN  502

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQ  214
             +APP YY++F +  G+PS   WV+
Sbjct  503  TIAPPAYYLLFVLQNGIPSKGVWVK  527



>gb|KFK44114.1| hypothetical protein AALP_AA1G217400 [Arabis alpina]
Length=218

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 88/149 (59%), Gaps = 4/149 (3%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGP-FPTQLSIEAFSPEYLSADRANIRPVLV--ELPEKVGYRQ  475
            DGRVL+ GSNPH FY + G  FPT+LS+EAFSP YL  + AN+RP ++  + P ++ YR 
Sbjct  69   DGRVLVGGSNPHAFYNFTGVLFPTELSLEAFSPVYLEPEFANLRPKIMSPKSPSRIKYRT  128

Query  474  AFEAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTG-KYRIGCTAP  298
            + +    V   V   V+V      F+THSFS  QRL+ L        G    Y +    P
Sbjct  129  SLKLQFKVTGEVKSPVKVTMVFPSFTTHSFSMNQRLLVLDNVKFTRKGKSMTYEVQVRTP  188

Query  297  PNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
             +A +APPGYYM+F VNQ +PS   WV+L
Sbjct  189  RSANIAPPGYYMIFVVNQNIPSEGVWVRL  217



>ref|XP_001760507.1| predicted protein [Physcomitrella patens]
 gb|EDQ74582.1| predicted protein [Physcomitrella patens]
Length=506

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 86/145 (59%), Gaps = 6/145 (4%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAFE  466
            DGR+L+AGSN H FY   G  PT+L ++ ++P+YL A+     P    LP  + Y +AF 
Sbjct  367  DGRILIAGSNTHQFYTLYGYLPTELRLQTYNPDYLGANP----PAFTTLPGGLAYGEAFT  422

Query  465  AAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNAM  286
            A +T   P    +  N  SAPF THS++ GQRL++L VT    +G G Y +   APP+  
Sbjct  423  AVLTANNPTNIEL--NLISAPFVTHSYAMGQRLLQLAVTKPADNGAGGYNVDSAAPPSQQ  480

Query  285  VAPPGYYMVFAVNQGVPSVARWVQL  211
            VAP GYYM+F V  GV   A WV++
Sbjct  481  VAPAGYYMLFPVADGVVGYAWWVKI  505



>ref|XP_006400518.1| hypothetical protein EUTSA_v10012975mg [Eutrema salsugineum]
 gb|ESQ41971.1| hypothetical protein EUTSA_v10012975mg [Eutrema salsugineum]
Length=595

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/150 (41%), Positives = 89/150 (59%), Gaps = 4/150 (3%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVE--LPEKVGYRQ  475
            PDG+VL+ GSN +  YKY   FPT+L +E FSP YL    AN+RP +V    P+++ Y Q
Sbjct  445  PDGKVLVGGSNTNDGYKYNVEFPTELRVEKFSPPYLDPALANLRPKIVNNATPKQIRYGQ  504

Query  474  AFEAAI--TvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTA  301
             F   +    +      ++V+  +  F+THS S   R++ L +    P G G + I   A
Sbjct  505  NFNVKVDLNQKDVTKENLKVHMLAPSFTTHSISMNMRMLFLGIVGVNPAGAGSFEIQTVA  564

Query  300  PPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            PPN  +APPGYY++FAV +GVPS+  W+Q+
Sbjct  565  PPNGNIAPPGYYLIFAVYKGVPSIGEWIQI  594



>ref|XP_006400519.1| hypothetical protein EUTSA_v10012975mg [Eutrema salsugineum]
 gb|ESQ41972.1| hypothetical protein EUTSA_v10012975mg [Eutrema salsugineum]
Length=622

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/150 (41%), Positives = 89/150 (59%), Gaps = 4/150 (3%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVE--LPEKVGYRQ  475
            PDG+VL+ GSN +  YKY   FPT+L +E FSP YL    AN+RP +V    P+++ Y Q
Sbjct  472  PDGKVLVGGSNTNDGYKYNVEFPTELRVEKFSPPYLDPALANLRPKIVNNATPKQIRYGQ  531

Query  474  AFEAAI--TvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTA  301
             F   +    +      ++V+  +  F+THS S   R++ L +    P G G + I   A
Sbjct  532  NFNVKVDLNQKDVTKENLKVHMLAPSFTTHSISMNMRMLFLGIVGVNPAGAGSFEIQTVA  591

Query  300  PPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            PPN  +APPGYY++FAV +GVPS+  W+Q+
Sbjct  592  PPNGNIAPPGYYLIFAVYKGVPSIGEWIQI  621



>ref|XP_001784508.1| predicted protein [Physcomitrella patens]
 gb|EDQ50675.1| predicted protein [Physcomitrella patens]
Length=558

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 92/149 (62%), Gaps = 3/149 (2%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEK-VGYRQAF  469
            DGR+++AGSN H +Y + G FPT+L +EAF P YL     +IRP +  L  K + Y   F
Sbjct  404  DGRIIVAGSNTHQYYTFSGDFPTELRVEAFDPPYLDPSYEDIRPSIFNLTTKRIRYSLTF  463

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDG-TGKYRIGCTAPPN  292
             A  T  +   G  E+N  S+PF+THSFSQGQR++KL +T  +  G  G Y+   TAPPN
Sbjct  464  TAVFT-VVNRTGDFELNLLSSPFTTHSFSQGQRMLKLNITEPVELGRRGMYQTTVTAPPN  522

Query  291  AMVAPPGYYMVFAVNQGVPSVARWVQLSA  205
            ++VAP  +Y+++ + + V     WVQ+ +
Sbjct  523  SIVAPESHYLLWPIQRKVAGKGVWVQIHS  551



>emb|CDY44928.1| BnaA02g04330D [Brassica napus]
Length=583

 Score =   118 bits (295),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 89/150 (59%), Gaps = 4/150 (3%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVE--LPEKVGYRQ  475
            PDG+VL+ GSN +  Y+Y   FPT+L +E FSP YL    AN+RP +V    P+++ Y +
Sbjct  433  PDGKVLVGGSNTNDGYRYNVEFPTELRVEKFSPPYLDPALANMRPKIVNNGTPKQIKYGK  492

Query  474  AFEAAI--TvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTA  301
             F+  +    +      ++ +  +  F+THS S   R++ L V S  P G   + I   A
Sbjct  493  VFKVKVELNQKDVTKENLKAHMLAPSFTTHSISMNMRMLLLGVASVNPSGGNSFEIQAAA  552

Query  300  PPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            PPN  +APPGYY++FAV +GVPSV  W+Q+
Sbjct  553  PPNGNLAPPGYYLIFAVYKGVPSVGEWIQI  582



>ref|XP_009126377.1| PREDICTED: galactose oxidase-like [Brassica rapa]
Length=583

 Score =   117 bits (294),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 89/150 (59%), Gaps = 4/150 (3%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVE--LPEKVGYRQ  475
            PDG+VL+ GSN +  Y+Y   FPT+L +E FSP YL    AN+RP +V    P+++ Y +
Sbjct  433  PDGKVLVGGSNTNDGYRYNVEFPTELRVEKFSPPYLDPALANMRPKIVNNGTPKQIKYGK  492

Query  474  AFEAAI--TvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTA  301
             F+  +    +      ++ +  +  F+THS S   R++ L V S  P G   + I   A
Sbjct  493  VFKVKVELNQKDVTKENLKAHMLAPSFTTHSISMNMRMLLLGVASVNPSGGNSFEIQAAA  552

Query  300  PPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            PPN  +APPGYY++FAV +GVPSV  W+Q+
Sbjct  553  PPNGNLAPPGYYLIFAVYKGVPSVGEWIQI  582



>ref|XP_006392509.1| hypothetical protein EUTSA_v10023396mg [Eutrema salsugineum]
 gb|ESQ29795.1| hypothetical protein EUTSA_v10023396mg [Eutrema salsugineum]
Length=548

 Score =   117 bits (293),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 90/149 (60%), Gaps = 3/149 (2%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRG-PFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQA  472
            PDGRVL+ GSNPH +Y +    +PT+LS+EA+SP YLS    +IRP ++   + V Y++ 
Sbjct  399  PDGRVLVGGSNPHIYYNFTNVEYPTELSLEAYSPPYLSFTSDSIRPKILTNDKVVSYKRL  458

Query  471  FEAAITvelpvvgvveVNFASAP-FSTHSFSQGQRLVKLPVTSAIPDG-TGKYRIGCTAP  298
            F    ++   +   +      AP F+THS +  QR+V L + S   +G T  YRI    P
Sbjct  459  FNVDFSIPQFLTTDLLSVRIVAPSFTTHSLAMNQRMVILKLLSVTREGLTNSYRINALGP  518

Query  297  PNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
              A +APPGYYM+F V+ GVPSV  WVQ+
Sbjct  519  STAEIAPPGYYMMFLVHAGVPSVGAWVQI  547



>ref|XP_010916153.1| PREDICTED: galactose oxidase-like [Elaeis guineensis]
Length=541

 Score =   117 bits (292),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 65/148 (44%), Positives = 87/148 (59%), Gaps = 3/148 (2%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRG-PFPTQLSIEAFSPEYLSADRANIRPVL--VELPEKVGYRQ  475
            DGRVL+ GSNPH +Y + G  FPT+LS+EAFSPEYLS++ +N RP +     P  + Y +
Sbjct  393  DGRVLVGGSNPHVYYNFTGVDFPTELSLEAFSPEYLSSENSNSRPKIDISASPISLNYGK  452

Query  474  AFEAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPP  295
             F     V     G V V  A+  FSTHSFS  QRL+ L   +A+      Y +   AP 
Sbjct  453  QFSMRFAVGAISGGGVTVTMAAPAFSTHSFSMNQRLLILETGTALSGDNSSYEVTAVAPA  512

Query  294  NAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            + ++AP GYY+VF VN G+PS   W  +
Sbjct  513  SGVLAPSGYYLVFVVNGGIPSEGVWAHI  540



>gb|KFK35620.1| hypothetical protein AALP_AA4G014800 [Arabis alpina]
Length=549

 Score =   117 bits (292),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 63/148 (43%), Positives = 89/148 (60%), Gaps = 3/148 (2%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRG-PFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            DGR+L+ GSNPH +Y +    +PT+LS+EA+SP YLS    +IRP ++   + V Y+  F
Sbjct  401  DGRILVGGSNPHVYYNFTNVEYPTELSLEAYSPPYLSFTSDSIRPKILTSGKVVNYKTLF  460

Query  468  EAAITvelpvvgvveVNFASAP-FSTHSFSQGQRLVKLPVTSAIPDG-TGKYRIGCTAPP  295
              + ++   +   +      AP F+THSF+  QR+V L + S   DG T  YRI    P 
Sbjct  461  NLSFSIAQFLTIDLLSVRIVAPSFTTHSFAMNQRMVILKLISVARDGLTNSYRINVLGPS  520

Query  294  NAMVAPPGYYMVFAVNQGVPSVARWVQL  211
             A +APPGYYM+F V+ GVPS   WVQ+
Sbjct  521  TAEIAPPGYYMMFLVHSGVPSSGTWVQI  548



>ref|XP_001757263.1| predicted protein [Physcomitrella patens]
 gb|EDQ77748.1| predicted protein [Physcomitrella patens]
Length=540

 Score =   117 bits (292),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 88/143 (62%), Gaps = 2/143 (1%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAFE  466
            DG+VL+AGSN H +Y   G FPT+L +E++SP YL+A   NIRP +   P  + Y Q F 
Sbjct  395  DGKVLVAGSNTHQYYTLTGQFPTELRVESYSPAYLAARSNNIRPTITTAPGTIRYGQTFP  454

Query  465  AAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGT-GKYRIGCTAPPNA  289
               T    + G +EV   +APF THS++ GQR++ L +T+ +   T G Y +  TAPP+ 
Sbjct  455  MTFT-VGALQGALEVKMVNAPFVTHSYAMGQRMLNLKLTAPVSAPTVGAYSVVVTAPPSN  513

Query  288  MVAPPGYYMVFAVNQGVPSVARW  220
            +VAP  YYM+F V  G+P  A W
Sbjct  514  VVAPSSYYMLFLVQDGIPGKAIW  536



>ref|XP_008389005.1| PREDICTED: galactose oxidase [Malus domestica]
Length=556

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 86/148 (58%), Gaps = 2/148 (1%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRG-PFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQA  472
            PDGR+L+ GSNPH +Y + G  +PT LS+EAFSP YLS +   +RP +  + +  GYRQ 
Sbjct  408  PDGRILVGGSNPHIYYNFTGVEYPTDLSLEAFSPPYLSDEYDPVRPRIAAIEDVFGYRQL  467

Query  471  FEAAITvelpvvgvveVNFASAP-FSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPP  295
                I V   +   V      AP F+THSF+  QR+V L +        G YR+    P 
Sbjct  468  ISVEILVPEFLSVRVLSARLVAPSFTTHSFAMNQRMVVLKLIGVTHVAAGTYRVSLVGPS  527

Query  294  NAMVAPPGYYMVFAVNQGVPSVARWVQL  211
             A +APPGYY++F V+  +PS A WV++
Sbjct  528  TAEIAPPGYYLLFVVHSDIPSSAAWVRV  555



>gb|KDP29261.1| hypothetical protein JCGZ_16650 [Jatropha curcas]
Length=235

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 87/149 (58%), Gaps = 3/149 (2%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQ--  475
            PDG++L+AGSN +  Y Y   +PT+L +E +SP YL A     RP +V + E++ Y Q  
Sbjct  88   PDGKILVAGSNTNNGYIYDAMYPTELRVEKYSPPYLDAAVITKRPEIVTINEQMTYAQNI  147

Query  474  AFEAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPP  295
              E  I       G V V   S  F+TH  +  QRL+ LP+   +P G G Y++G  +P 
Sbjct  148  DIEVKIAGGKVDHGDVRVTMYSPAFTTHGVNMNQRLILLPMREVVPAG-GNYKVGVISPI  206

Query  294  NAMVAPPGYYMVFAVNQGVPSVARWVQLS  208
            + +VAP GYYM+  V QGVPSV RWVQ+ 
Sbjct  207  SNLVAPVGYYMLSVVFQGVPSVTRWVQMK  235



>ref|XP_002873953.1| hypothetical protein ARALYDRAFT_488852 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50212.1| hypothetical protein ARALYDRAFT_488852 [Arabidopsis lyrata subsp. 
lyrata]
Length=596

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 89/150 (59%), Gaps = 5/150 (3%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVE--LPEKVGYRQ  475
            PDG+VL+ GSN +  YKY   FPT+L +E FSP YL    ANIRP +V    P+++ Y Q
Sbjct  447  PDGKVLVGGSNTNDGYKYNVEFPTELRVEKFSPPYLDPALANIRPKIVTTGTPKQIKYGQ  506

Query  474  AFEAAITvelpvvgvveVNFAS-AP-FSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTA  301
             F   + ++        +     AP F+THS S   R++ L V +  P G G Y I   A
Sbjct  507  FFNVKVDLKQKGATKQNLKVTMLAPAFTTHSISMNMRMLILGVANVKPAGAG-YDIQAVA  565

Query  300  PPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            PPN  +APPGYY++FA+++GVPS   W+Q+
Sbjct  566  PPNGNIAPPGYYLIFAIHKGVPSTGEWIQI  595



>emb|CDY42279.1| BnaC02g08850D [Brassica napus]
Length=583

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 89/150 (59%), Gaps = 4/150 (3%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVE--LPEKVGYRQ  475
            PDG+VL+ GSN +  Y+Y   FPT+L +E FSP YL    AN+RP +V    P+++ Y +
Sbjct  433  PDGKVLVGGSNTNDGYRYNVEFPTELRVEKFSPPYLDPALANMRPKIVNNATPKQIKYGK  492

Query  474  AFEAAI--TvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTA  301
             F+  +    +      ++ +  +  F+THS S   R++ L V S  P G   + I   A
Sbjct  493  VFKVKVELNQKDVTKENLKAHMLAPSFTTHSISMNMRMLLLGVASVNPSGGNSFEIQAAA  552

Query  300  PPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            PPN  +APPGYY++FAV +GVPS+  W+Q+
Sbjct  553  PPNGNLAPPGYYLLFAVYKGVPSIGEWIQI  582



>ref|XP_001751488.1| predicted protein [Physcomitrella patens]
 gb|EDQ83805.1| predicted protein [Physcomitrella patens]
Length=506

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 68/146 (47%), Positives = 88/146 (60%), Gaps = 6/146 (4%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGR+L+AGSN H FY   G  PT+L IE FSP Y+ A+R    P    +P  + Y   F
Sbjct  366  PDGRILVAGSNTHQFYTLTGYLPTELRIETFSPPYMGANR----PTYAAVPGGLKYGGGF  421

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNA  289
             A  TV+      +E+N  SAPF THS++QGQRL++L V++    G G Y +   APPNA
Sbjct  422  TA--TVKSAGAKNIELNMVSAPFVTHSYAQGQRLLQLEVSAPAAAGAGAYDVASKAPPNA  479

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQL  211
             VAP GYYM+F V  G    A WV++
Sbjct  480  AVAPGGYYMLFPVADGNVGYASWVKM  505



>ref|XP_008775019.1| PREDICTED: galactose oxidase-like [Phoenix dactylifera]
Length=544

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 88/149 (59%), Gaps = 4/149 (3%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRG-PFPTQLSIEAFSPEYLSADRANIRPVL--VELPEKVGYRQ  475
            DGRVL+ GSNPH +Y + G  FPT+LS+EAFSPEYL++  +N RP +     P  + Y +
Sbjct  395  DGRVLVGGSNPHVYYNFTGVEFPTELSLEAFSPEYLTSGSSNSRPKIDNSSSPISLNYGK  454

Query  474  AFEAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGT-GKYRIGCTAP  298
             F     V     G V V  A+  FSTH+FS  QRL+ L    A+  G  G Y +   AP
Sbjct  455  QFTLRFAVAAISGGGVSVTMAAPAFSTHAFSMNQRLLILETGKALAAGNNGSYEVTAVAP  514

Query  297  PNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
             + ++AP GYYMVF VN G+PS   W Q+
Sbjct  515  ASGILAPSGYYMVFVVNGGIPSEGVWAQI  543



>ref|XP_001762124.1| predicted protein [Physcomitrella patens]
 gb|EDQ72916.1| predicted protein [Physcomitrella patens]
Length=529

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 73/147 (50%), Positives = 93/147 (63%), Gaps = 2/147 (1%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAFE  466
            DGR+LLAGSN H FY + G FPT+L I+AFSP YL+  +A  +P +   P  + Y   F 
Sbjct  381  DGRILLAGSNSHQFYTFTGDFPTELRIDAFSPPYLAPSQAGNKPTISVYPLVITYSAPFT  440

Query  465  AAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGK-YRIGCTAPPNA  289
              ++     +  V VN  SAP++THS+SQGQRLV L V   +       Y+I  TAPP+ 
Sbjct  441  VTVS-APLAMAGVSVNLISAPYNTHSYSQGQRLVSLNVGGIVQVAQASVYQITVTAPPSP  499

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQLS  208
             VAPPGYYM+ AVNQGVPS A W+Q S
Sbjct  500  SVAPPGYYMMVAVNQGVPSSAVWIQCS  526



>emb|CDY12635.1| BnaA02g13030D [Brassica napus]
Length=160

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 89/150 (59%), Gaps = 4/150 (3%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLV--ELPEKVGYRQ  475
            PDG+VL+ GSN +  Y+Y   +PT+L IE FSP YL    AN+RP +V  + P+++ + Q
Sbjct  10   PDGKVLIGGSNTNDGYRYDVEYPTELRIEKFSPPYLDPALANMRPKIVNTDTPKQIKFGQ  69

Query  474  AFEAAITvelpvvgvv--eVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTA  301
             F   I ++   V      V   + PF+TH+ S   RL+ L ++    +    ++I   A
Sbjct  70   TFNVKIELKQANVAKENVMVTMLAPPFTTHAVSMNMRLLLLGISDVKKEHGDVHQIQAVA  129

Query  300  PPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            PP+  VAPPGYY+++AV  GVPSV  W+Q+
Sbjct  130  PPSGNVAPPGYYLLYAVYNGVPSVGEWIQI  159



>ref|XP_001765643.1| predicted protein [Physcomitrella patens]
 gb|EDQ69482.1| predicted protein [Physcomitrella patens]
Length=535

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 68/148 (46%), Positives = 92/148 (62%), Gaps = 1/148 (1%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAFE  466
            DGR+ +AGSNPH FY +   +PT+L +EAFSP YL+      RP +   P ++ Y   F 
Sbjct  388  DGRIFIAGSNPHQFYVFDVDYPTELRLEAFSPHYLAPSHDLQRPTVTVSPLQITYNTPFT  447

Query  465  AAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGK-YRIGCTAPPNA  289
              ++  + + G  E+N  SAPFSTHS+ QGQR+V L V+S++       Y+I   AP   
Sbjct  448  VTVSAPVTLAGPPEINLVSAPFSTHSYQQGQRVVSLAVSSSVQIALATLYQITAVAPWGP  507

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQLSA  205
             +APPGYYM+FAVN+ VPS A WV LS 
Sbjct  508  TLAPPGYYMLFAVNEAVPSTAVWVLLST  535



>emb|CAN73409.1| hypothetical protein VITISV_024374 [Vitis vinifera]
Length=467

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 67/146 (46%), Positives = 77/146 (53%), Gaps = 56/146 (38%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGRVL+AG+           FPT+L IEAFSP+                          
Sbjct  376  PDGRVLIAGTE----------FPTELRIEAFSPD--------------------------  399

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNA  289
                                APF+THSFSQGQRLVKL V+  +PD   +YRI CTAPP  
Sbjct  400  --------------------APFATHSFSQGQRLVKLTVSPTVPDABERYRIVCTAPPGG  439

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQL  211
             +APPGYYM+FAVN GVPSVARWVQL
Sbjct  440  KIAPPGYYMMFAVNLGVPSVARWVQL  465



>ref|XP_006381726.1| hypothetical protein POPTR_0006s16390g [Populus trichocarpa]
 gb|ERP59523.1| hypothetical protein POPTR_0006s16390g [Populus trichocarpa]
Length=609

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 90/153 (59%), Gaps = 6/153 (4%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLV--ELPEKVGYRQ  475
            PDG+VL+AGSN +  Y Y   FPT+L +E FSP YL    A  RPV+V  + PEK+ Y +
Sbjct  457  PDGKVLVAGSNTNNGYVYNAMFPTELRVEKFSPPYLDPSVAVHRPVIVTDKAPEKISYDE  516

Query  474  AFEAAI--TvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGT--GKYRIGC  307
             F+  I  T        ++V   +  F+TH  S  QRL+ L +   I +    G + I  
Sbjct  517  TFQLQIKSTAVKVEKKDIKVTMYAPAFTTHGVSMNQRLLDLGLEDVIAENAFLGIHTITV  576

Query  306  TAPPNAMVAPPGYYMVFAVNQGVPSVARWVQLS  208
             +PP+  VAPPGYYM+F V+QGVPSV+ WVQ+ 
Sbjct  577  VSPPSGKVAPPGYYMLFVVHQGVPSVSTWVQIK  609



>ref|XP_010493033.1| PREDICTED: galactose oxidase-like [Camelina sativa]
Length=592

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 90/150 (60%), Gaps = 5/150 (3%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVE--LPEKVGYRQ  475
            PDG+VL+ GSN +  YKY   FPT+L +E FSP YL    AN+RP +V    P++V Y Q
Sbjct  443  PDGKVLVGGSNTNDGYKYNVEFPTELRVEKFSPPYLDPALANMRPKIVAAGTPKQVRYGQ  502

Query  474  AF--EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTA  301
             F  +A +  +      ++V   +  F+THS S   R++ L V    P G G Y I   A
Sbjct  503  FFNVKADLNQKGVTKENLKVTMLAPAFTTHSISMNMRMLILGVADVKPAGAG-YDIQAVA  561

Query  300  PPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            PPN  +APPGYY++FAV++GVPS   W+Q+
Sbjct  562  PPNGNIAPPGYYLLFAVHKGVPSTGEWIQV  591



>ref|XP_010504696.1| PREDICTED: galactose oxidase-like [Camelina sativa]
Length=547

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 89/149 (60%), Gaps = 3/149 (2%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRG-PFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQA  472
            PDGRVL+ GSNPH +Y +    +PT LS+EA+SP YLS     IRP ++   + +GY++ 
Sbjct  398  PDGRVLVGGSNPHVYYNFTNVEYPTDLSLEAYSPPYLSFTSDPIRPKILTSDKVLGYKRL  457

Query  471  FEAAITvelpvvgvveVNFASAP-FSTHSFSQGQRLVKLPVTSAIPDG-TGKYRIGCTAP  298
            F    ++   +   +      AP F+THSF+  QR+V L + S   D  T  YR+    P
Sbjct  458  FNVDFSIPQFLTVDLLSVRIVAPSFTTHSFAMNQRMVILKLLSVTRDQLTNSYRVSALGP  517

Query  297  PNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
              A +APPGYYM+F V+ G+PS A WVQ+
Sbjct  518  STAEIAPPGYYMMFLVHAGIPSSAAWVQI  546



>gb|AAL84955.1| AT5g19580/T20D1_100 [Arabidopsis thaliana]
 gb|AAN64541.1| At5g19580/T20D1_100 [Arabidopsis thaliana]
 dbj|BAE99231.1| hypothetical protein [Arabidopsis thaliana]
Length=594

 Score =   115 bits (289),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 88/150 (59%), Gaps = 5/150 (3%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVE--LPEKVGYRQ  475
            PDG+VL+ GSN +  YKY   FPT+L +E FSP YL    ANIRP +V    P++V Y Q
Sbjct  445  PDGKVLVGGSNTNDGYKYNVEFPTELRVEKFSPPYLDPALANIRPKIVTTGTPKQVKYGQ  504

Query  474  AFEAAITvelpvvgvveVNFAS-AP-FSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTA  301
             F   + ++        +     AP F+THS S   R++ L V +  P G G Y I   A
Sbjct  505  FFNVKVDLKEKGATKGNLKVTMLAPAFTTHSISMNMRMLILGVNNVKPAGAG-YDIQAVA  563

Query  300  PPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            PPN  +APPGYY++FA+ +GVPS   W+Q+
Sbjct  564  PPNGNIAPPGYYLIFAIYKGVPSTGEWIQV  593



>ref|NP_197459.1| glyoxal oxidase-related protein [Arabidopsis thaliana]
 gb|AED92727.1| glyoxal oxidase-related protein [Arabidopsis thaliana]
Length=594

 Score =   115 bits (289),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 88/150 (59%), Gaps = 5/150 (3%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVE--LPEKVGYRQ  475
            PDG+VL+ GSN +  YKY   FPT+L +E FSP YL    ANIRP +V    P++V Y Q
Sbjct  445  PDGKVLVGGSNTNDGYKYNVEFPTELRVEKFSPPYLDPALANIRPKIVTTGTPKQVKYGQ  504

Query  474  AFEAAITvelpvvgvveVNFAS-AP-FSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTA  301
             F   + ++        +     AP F+THS S   R++ L V +  P G G Y I   A
Sbjct  505  FFNVKVDLKEKGATKGNLKVTMLAPAFTTHSISMNMRMLILGVNNVKPAGAG-YDIQAVA  563

Query  300  PPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            PPN  +APPGYY++FA+ +GVPS   W+Q+
Sbjct  564  PPNGNIAPPGYYLIFAIYKGVPSTGEWIQV  593



>ref|XP_012082614.1| PREDICTED: galactose oxidase-like [Jatropha curcas]
Length=318

 Score =   112 bits (281),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 63/148 (43%), Positives = 87/148 (59%), Gaps = 3/148 (2%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQ--  475
            PDG++L+AGSN +  Y Y   +PT+L +E +SP YL A     RP +V + E++ Y Q  
Sbjct  171  PDGKILVAGSNTNNGYIYDAMYPTELRVEKYSPPYLDAAVITKRPEIVTINEQMTYAQNI  230

Query  474  AFEAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPP  295
              E  I       G V V   S  F+TH  +  QRL+ LP+   +P G G Y++G  +P 
Sbjct  231  DIEVKIAGGKVDHGDVRVTMYSPAFTTHGVNMNQRLILLPMREVVPAG-GNYKVGVISPI  289

Query  294  NAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            + +VAP GYYM+  V QGVPSV RWVQ+
Sbjct  290  SNLVAPVGYYMLSVVFQGVPSVTRWVQM  317



>gb|KFK44113.1| hypothetical protein AALP_AA1G217400 [Arabis alpina]
Length=508

 Score =   114 bits (285),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 88/149 (59%), Gaps = 4/149 (3%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGP-FPTQLSIEAFSPEYLSADRANIRPVLV--ELPEKVGYRQ  475
            DGRVL+ GSNPH FY + G  FPT+LS+EAFSP YL  + AN+RP ++  + P ++ YR 
Sbjct  359  DGRVLVGGSNPHAFYNFTGVLFPTELSLEAFSPVYLEPEFANLRPKIMSPKSPSRIKYRT  418

Query  474  AFEAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTG-KYRIGCTAP  298
            + +    V   V   V+V      F+THSFS  QRL+ L        G    Y +    P
Sbjct  419  SLKLQFKVTGEVKSPVKVTMVFPSFTTHSFSMNQRLLVLDNVKFTRKGKSMTYEVQVRTP  478

Query  297  PNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
             +A +APPGYYM+F VNQ +PS   WV+L
Sbjct  479  RSANIAPPGYYMIFVVNQNIPSEGVWVRL  507



>ref|XP_001776127.1| predicted protein [Physcomitrella patens]
 gb|EDQ59038.1| predicted protein [Physcomitrella patens]
Length=551

 Score =   114 bits (286),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 88/157 (56%), Gaps = 12/157 (8%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGP-FPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            DGR+LLAGSN H FY Y    FPT+LS+EAFSP YL+    + RP ++  P+ + Y   +
Sbjct  393  DGRILLAGSNTHQFYTYNDTLFPTELSLEAFSPPYLNIIFDSKRPTIIGWPKVMTYGSDY  452

Query  468  EAAITv-----------elpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGK  322
                TV                 +VE   +SAPF+THS++ GQR +KL         +  
Sbjct  453  LVTFTVPYTKQPRERSGRNQWQDLVEAKLSSAPFATHSYAMGQRQLKLKTVPLERQKSTS  512

Query  321  YRIGCTAPPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
              I  TAPPN+ VAPP YYM F VN G+P  ARWVQ+
Sbjct  513  RDIAVTAPPNSNVAPPQYYMFFIVNGGIPGKARWVQI  549



>ref|XP_010470629.1| PREDICTED: galactose oxidase-like isoform X1 [Camelina sativa]
 ref|XP_010470630.1| PREDICTED: galactose oxidase-like isoform X2 [Camelina sativa]
Length=597

 Score =   115 bits (288),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 90/150 (60%), Gaps = 4/150 (3%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVEL--PEKVGYRQ  475
            PDG+VL+ GSN +  Y+Y   +PT+L IE FSP YL    A +RP+++    P+++ Y Q
Sbjct  447  PDGKVLVGGSNTNDGYQYNVEYPTELRIEKFSPPYLDPALAIMRPIIINTATPKQIKYGQ  506

Query  474  AFEAAITvelpv--vgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTA  301
             F+  I ++ P      V +   + PF+THS S   RL+ L +      G  KY+I   A
Sbjct  507  MFDVNIELKQPNVPKENVMLTMLAPPFTTHSVSMNMRLLMLGIKDVKNVGGDKYKIEAVA  566

Query  300  PPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            PP+  VAPPGYY++FAV  GVPSV  W+Q+
Sbjct  567  PPSGNVAPPGYYVLFAVYNGVPSVGEWIQI  596



>ref|XP_006290310.1| hypothetical protein CARUB_v10019204mg [Capsella rubella]
 gb|EOA23208.1| hypothetical protein CARUB_v10019204mg [Capsella rubella]
Length=547

 Score =   114 bits (286),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 89/149 (60%), Gaps = 3/149 (2%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRG-PFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQA  472
            PDGRVL+ GSNPH +Y +    +PT LS+EA+SP YLS     IRP ++   + +GY++ 
Sbjct  398  PDGRVLVGGSNPHVYYNFTNVEYPTDLSLEAYSPPYLSFTSDPIRPKILTSDKVLGYKRL  457

Query  471  FEAAITvelpvvgvveVNFASAP-FSTHSFSQGQRLVKLPVTSAIPDG-TGKYRIGCTAP  298
            F    ++   +   +      AP F+THSF+  QR+V L + S   D  T  YR+    P
Sbjct  458  FNIDFSIPQFLTVDLLSVRIVAPSFTTHSFAMNQRMVILNLLSVTRDQLTNSYRVNVLGP  517

Query  297  PNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
              A +APPGYYM+F V+ G+PS A WVQ+
Sbjct  518  STAEIAPPGYYMMFLVHAGIPSSAAWVQI  546



>ref|XP_010454240.1| PREDICTED: galactose oxidase-like [Camelina sativa]
Length=590

 Score =   115 bits (287),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 89/150 (59%), Gaps = 5/150 (3%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVE--LPEKVGYRQ  475
            PDG+VL+ GSN +  YKY   FPT+L +E FSP YL    AN+RP +V    P++V Y Q
Sbjct  441  PDGKVLVGGSNTNDGYKYNVEFPTELRVEKFSPPYLDPALANMRPKIVAAGTPKQVRYGQ  500

Query  474  AFEAAI--TvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTA  301
             F   +    +      ++V   +  F+THS S   R++ L V +  P G G Y I   A
Sbjct  501  FFNVKVDLNQKGATKENLKVTMLAPAFTTHSISMNMRMLILGVANVKPAGAG-YDIQAVA  559

Query  300  PPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            PPN  +APPGYY++FAV++GVPS   W+Q+
Sbjct  560  PPNGNIAPPGYYLLFAVHKGVPSTGEWIQV  589



>emb|CDX92518.1| BnaA10g15570D [Brassica napus]
Length=564

 Score =   115 bits (287),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 85/148 (57%), Gaps = 2/148 (1%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDG+VL+AGSN +  YKY   FPT+L +E FSP YL    A +RP +   P+++ Y Q F
Sbjct  416  PDGKVLVAGSNTNDGYKYNVEFPTELRVEKFSPPYLDPALATLRPKIATSPKQIRYGQNF  475

Query  468  EAAITvelpvvgvveVNFAS-AP-FSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPP  295
               + +    V    +     AP F+THS S   R++ L V    P G   + I   APP
Sbjct  476  NVKVNLNQKDVTKQSLKLTMLAPSFTTHSISMNMRMLLLGVGGVNPAGGASFEIQTVAPP  535

Query  294  NAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            +  VAPPGYY++FAV +GVPS   W+Q+
Sbjct  536  SGNVAPPGYYLLFAVYKGVPSTGEWIQI  563



>emb|CDY58964.1| BnaC09g38100D [Brassica napus]
Length=571

 Score =   114 bits (286),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 85/148 (57%), Gaps = 2/148 (1%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDG+VL+AGSN +  YKY   FPT+L +E FSP YL    A +RP +   P+++ Y Q F
Sbjct  423  PDGKVLVAGSNTNDGYKYNVEFPTELRVEKFSPPYLDPALATLRPKIATSPKQIRYGQNF  482

Query  468  EAAITvelpvvgvveVNFAS-AP-FSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPP  295
               + +    V    +     AP F+THS S   R++ L V    P G   + I   APP
Sbjct  483  NVKVNLNQKDVTKQSLKLTMLAPSFTTHSISMNMRMLLLGVGGVNPAGGASFEIQTVAPP  542

Query  294  NAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            +  VAPPGYY++FAV +GVPS   W+Q+
Sbjct  543  SGNVAPPGYYLLFAVYKGVPSTGEWIQI  570



>ref|XP_009606830.1| PREDICTED: galactose oxidase [Nicotiana tomentosiformis]
Length=556

 Score =   114 bits (286),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 89/149 (60%), Gaps = 6/149 (4%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRG-PFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            DGRVL+ GSNPH FY + G  FPT LS+EAFSP YL+ + A ++P ++ + E + Y+Q F
Sbjct  404  DGRVLVGGSNPHKFYNFTGVEFPTDLSLEAFSPPYLAPEYAPLKPTVLSIDEILIYKQPF  463

Query  468  EAAITvelpvvgvveVNFASAP-FSTHSFSQGQRLVKLP--VTSAIPDGTGKYRIGCTAP  298
                TV   +   + +    AP F+THSFS  QR+V L     S + D T  YR     P
Sbjct  464  SVTFTVPKFLKMGIVLVRIVAPSFTTHSFSMNQRMVVLKSIAVSTVTDNT--YRFTAFGP  521

Query  297  PNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
                +APPGYYM+F V+ G+PS   WVQ+
Sbjct  522  STKEIAPPGYYMLFVVHAGIPSSGVWVQI  550



>ref|XP_008813838.1| PREDICTED: galactose oxidase-like [Phoenix dactylifera]
Length=548

 Score =   114 bits (285),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 88/150 (59%), Gaps = 5/150 (3%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRG-PFPTQLSIEAFSPEYLSADRANIRPVLVE--LPEKVGYRQ  475
            DGR+L+ GSNPH  Y + G  +PT+LS+EAFSP+YL A+ + +RP ++E   P  + Y +
Sbjct  398  DGRILVGGSNPHENYVFSGVDYPTELSLEAFSPDYLGAEHSILRPRIIEPRTPLMLNYGK  457

Query  474  AFEAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSA--IPDGTGKYRIGCTA  301
             F       L     V V   +  FSTHSFS  QRL+ L  + A  IP G+  + IG  A
Sbjct  458  QFSLRFKARLTSNEGVSVTMVAPSFSTHSFSMNQRLLILKSSKAATIPSGSSTHEIGAVA  517

Query  300  PPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            P + ++APPGYYM F VN  +P    WV +
Sbjct  518  PKSRILAPPGYYMFFIVNGRIPGEGIWVHI  547



>ref|XP_001762682.1| predicted protein [Physcomitrella patens]
 gb|EDQ72481.1| predicted protein [Physcomitrella patens]
Length=520

 Score =   114 bits (284),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 93/151 (62%), Gaps = 6/151 (4%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRG-PFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            DGR+LLAGSN H +Y ++  PFPT+L +EAFSP YL+ +  + RP ++  P K+ Y + +
Sbjct  368  DGRILLAGSNTHQYYTFKDTPFPTELRVEAFSPPYLNVNFDDQRPEIIVWPTKMKYGRRY  427

Query  468  EAAITvelpvvgv-veVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYR----IGCT  304
              + +V      V VEVN  SAPF THS++ GQR +KL        G  K +    +  T
Sbjct  428  LLSFSVATGQSSVPVEVNLNSAPFVTHSYAHGQRQLKLETLLVKKWGKRKQQNLQTLLVT  487

Query  303  APPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            APP+  VAPP YYM+F VN G+P  A WVQ+
Sbjct  488  APPSMTVAPPQYYMLFVVNGGIPGKAVWVQV  518



>emb|CDP08591.1| unnamed protein product [Coffea canephora]
Length=548

 Score =   114 bits (285),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 60/147 (41%), Positives = 85/147 (58%), Gaps = 2/147 (1%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRG-PFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            DGRVL+ GSNPH +YK+ G  FPT LS+EAFSP YL+     +RP +V + E + Y++ F
Sbjct  401  DGRVLVGGSNPHVYYKFTGVQFPTDLSLEAFSPPYLAQLHDPVRPRIVGMAENITYQRKF  460

Query  468  EAAITvelpvvgvveVNFASAP-FSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPN  292
                +V   +          AP F+THSFS  QR++ L    A+   +  YRI    P +
Sbjct  461  SVTFSVNNFLKVASLSVRIIAPSFTTHSFSMNQRMLILKFVEAVNVASSTYRITAIGPSS  520

Query  291  AMVAPPGYYMVFAVNQGVPSVARWVQL  211
              +AP GYYM+F V++ +PS   WV +
Sbjct  521  PEIAPKGYYMLFVVHEDIPSTGMWVNV  547



>ref|XP_006287335.1| hypothetical protein CARUB_v10000533mg [Capsella rubella]
 gb|EOA20233.1| hypothetical protein CARUB_v10000533mg [Capsella rubella]
Length=593

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 62/150 (41%), Positives = 89/150 (59%), Gaps = 5/150 (3%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVE--LPEKVGYRQ  475
            PDG+VL+ GSN +  YKY   FPT+L +E FSP YL    AN+RP +V    P+++ + Q
Sbjct  444  PDGKVLVGGSNTNDGYKYNVEFPTELRVEKFSPPYLDPALANMRPKIVATGTPKQIRFGQ  503

Query  474  AFEAAI--TvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTA  301
             F   +    +      ++V   +  F+THS S   R++ L V +  P G G Y I   A
Sbjct  504  FFNVKVDLNQKGATKDNLKVTMLAPAFTTHSISMNMRMLILGVANVKPAGAG-YDIQAVA  562

Query  300  PPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            PPN  +APPGYY++FAV++GVPS   W+Q+
Sbjct  563  PPNGNIAPPGYYLIFAVHKGVPSTGEWIQI  592



>ref|XP_006471853.1| PREDICTED: galactose oxidase-like [Citrus sinensis]
 gb|KDO53324.1| hypothetical protein CISIN_1g041651mg [Citrus sinensis]
Length=557

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 88/147 (60%), Gaps = 2/147 (1%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGP-FPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            DGRVL+ GSNPH +Y +    +PT LS+EA+SP YLSA+ A +RP ++ L E +GY+  F
Sbjct  410  DGRVLIGGSNPHIYYNFTNVVYPTDLSLEAYSPPYLSAEYATVRPKILSLNETIGYKATF  469

Query  468  EAAITvelpvvgvveVNFASAP-FSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPN  292
            +   +VE  +   V      AP F+THSF   QR+V L +       +  Y +   AP  
Sbjct  470  QVRFSVEEYLSAGVVSVRLIAPSFTTHSFGMNQRMVVLKILEVSHVTSYVYHLAAVAPST  529

Query  291  AMVAPPGYYMVFAVNQGVPSVARWVQL  211
            A +APPGYY++F V+  +PS   WV++
Sbjct  530  AEIAPPGYYLLFVVHAEIPSSGMWVKM  556



>ref|XP_006382737.1| glyoxal oxidase-related family protein [Populus trichocarpa]
 gb|ERP60534.1| glyoxal oxidase-related family protein [Populus trichocarpa]
Length=550

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 87/147 (59%), Gaps = 2/147 (1%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGP-FPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            DGRVL+ G NPH +Y +    +PT LS+E FSP YLS D A++RPV++ +   +   Q F
Sbjct  403  DGRVLVGGGNPHVYYNFTNVVYPTDLSLETFSPPYLSTDYASVRPVILSVDGTISRGQRF  462

Query  468  EAAITvelpvvgvveVNFASAP-FSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPN  292
              + +VE  +   V      AP F+THSFS  QR+V L +   I D T  Y      P +
Sbjct  463  LVSFSVEEYLTQSVLSVRIVAPSFTTHSFSMNQRMVVLKIDDIIYDDTSSYTSSVFGPSS  522

Query  291  AMVAPPGYYMVFAVNQGVPSVARWVQL  211
            + +APPGYYM+F V+ G+PS   WV++
Sbjct  523  SEIAPPGYYMLFVVHSGIPSSGVWVRI  549



>ref|XP_002876427.1| hypothetical protein ARALYDRAFT_907231 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52686.1| hypothetical protein ARALYDRAFT_907231 [Arabidopsis lyrata subsp. 
lyrata]
Length=547

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 89/150 (59%), Gaps = 4/150 (3%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRG-PFPTQLSIEAFSPEYLSADRANIRPVLVELPEKV-GYRQ  475
            PDGRVL+ GSNPH +Y +    +PT LS+EA+SP YLS     IRP ++   +KV  Y++
Sbjct  397  PDGRVLVGGSNPHVYYNFTNVEYPTDLSLEAYSPPYLSFTSDPIRPKILLTNDKVLSYKR  456

Query  474  AFEAAITvelpvvgvveVNFASAP-FSTHSFSQGQRLVKLPVTSAIPDG-TGKYRIGCTA  301
             F    ++   +   +      AP F+THSF+  QR+V L + S   D  T  YRI    
Sbjct  457  LFNVDFSIAQFLTVDLLSVRIVAPSFTTHSFAMNQRMVILKLLSVTRDQLTNSYRISALG  516

Query  300  PPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            P  A +APPGYYM+F V+ G+PS A WVQ+
Sbjct  517  PSTAEIAPPGYYMMFLVHAGIPSSAAWVQI  546



>emb|CDY62245.1| BnaC01g42480D [Brassica napus]
Length=552

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 89/149 (60%), Gaps = 3/149 (2%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRG-PFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQA  472
            PDGRVL+ GSNPH +Y +    +PT+LS+EA+SP YLS    +IRP ++   + + Y++ 
Sbjct  403  PDGRVLVGGSNPHIYYNFTNVEYPTELSLEAYSPPYLSFTSDSIRPHILTNDKVISYKRL  462

Query  471  FEAAITvelpvvgvveVNFASAP-FSTHSFSQGQRLVKLPVTSAI-PDGTGKYRIGCTAP  298
            F    ++   +   +      AP F+THSF+  QR+V L + S    D T  Y+I    P
Sbjct  463  FNVNFSIPQFLTIDLLSVRIVAPSFTTHSFAMNQRMVILKLLSVTHEDLTNSYKIDALGP  522

Query  297  PNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
              A +APPGYYM+F V+ G+PS   WVQ+
Sbjct  523  STAEIAPPGYYMIFLVHAGIPSSGFWVQI  551



>ref|XP_009364601.1| PREDICTED: galactose oxidase [Pyrus x bretschneideri]
Length=556

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 84/148 (57%), Gaps = 2/148 (1%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRG-PFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQA  472
            PDGR+L+ GSNPH +Y + G  + T LS+EAFSP YLS +   +RP +  +   +GYRQ 
Sbjct  408  PDGRILVGGSNPHAYYNFTGVEYQTDLSLEAFSPPYLSEEYDPVRPRIAAIDVVIGYRQL  467

Query  471  FEAAITvelpvvgvveVNFASAP-FSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPP  295
                I V       V      AP F+THSF+  QR+V L +        G YR+    P 
Sbjct  468  ISVEILVPESQSVRVLSARLVAPSFTTHSFAMNQRMVILKLIGVTHVAAGTYRVSLVGPS  527

Query  294  NAMVAPPGYYMVFAVNQGVPSVARWVQL  211
             A +APPGYY++F V+  +PS A WV++
Sbjct  528  TAEIAPPGYYLLFVVHADIPSSAAWVRV  555



>ref|XP_010424026.1| PREDICTED: galactose oxidase-like, partial [Camelina sativa]
Length=529

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 86/150 (57%), Gaps = 5/150 (3%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVL--VELPEKVGYRQ  475
            PDG+VL+ GSN +  YKY   FPT+L +E FSP YL    AN+RP +     P++V Y Q
Sbjct  380  PDGKVLVGGSNTNDGYKYNVEFPTELRVEKFSPPYLDPALANMRPKIFAAGTPKQVRYGQ  439

Query  474  AFEAAITvelpvvgvveVNFAS-AP-FSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTA  301
             F   + +         +     AP F+THS S   R++ L V    P G G Y I   A
Sbjct  440  FFNVKVDLNQKGATKENLKITMLAPAFTTHSISMNMRMLILGVADVKPAGAG-YDIQAVA  498

Query  300  PPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            PPN  +APPGYY++FAV++GVPS   W+Q+
Sbjct  499  PPNGNIAPPGYYLLFAVHKGVPSTGEWIQV  528



>ref|XP_009106213.1| PREDICTED: galactose oxidase isoform X2 [Brassica rapa]
Length=554

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 85/148 (57%), Gaps = 3/148 (2%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGP-FPTQLSIEAFSPEYLSADRANIRPVLVE--LPEKVGYRQ  475
            DGRVL+ GSNPH FY + G  FPT+L +EAFSP YL +   NIRP ++   L   V Y  
Sbjct  406  DGRVLVGGSNPHEFYNFTGVLFPTELRLEAFSPSYLESQYRNIRPRIMSPSLHSTVNYGG  465

Query  474  AFEAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPP  295
                   V   V   V+V  A   F+THSFS  QRL+ L   +++  G   Y +    P 
Sbjct  466  VLRLRFRVLGEVKTPVKVTMAFPSFTTHSFSMSQRLLVLDHVTSLRIGQWTYEVRVKTPR  525

Query  294  NAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            +A +APPGYYMVF VNQ +PS   WV+L
Sbjct  526  SANLAPPGYYMVFVVNQDIPSEGIWVRL  553



>emb|CDY47509.1| BnaAnng09070D [Brassica napus]
Length=554

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 85/148 (57%), Gaps = 3/148 (2%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGP-FPTQLSIEAFSPEYLSADRANIRPVLVE--LPEKVGYRQ  475
            DGRVL+ GSNPH FY + G  FPT+L +EAFSP YL +   NIRP ++   L   V Y  
Sbjct  406  DGRVLVGGSNPHEFYNFTGVLFPTELRLEAFSPSYLESQYRNIRPRIMSPSLHSTVNYGG  465

Query  474  AFEAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPP  295
                   V   V   V+V  A   F+THSFS  QRL+ L   +++  G   Y +    P 
Sbjct  466  VLRLRFRVLGEVKTPVKVTMAFPSFTTHSFSMSQRLLVLDHVTSLRIGQWTYEVRVKTPR  525

Query  294  NAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            +A +APPGYYMVF VNQ +PS   WV+L
Sbjct  526  SANLAPPGYYMVFVVNQDIPSEGIWVRL  553



>emb|CDX73183.1| BnaC06g36310D [Brassica napus]
Length=552

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 86/148 (58%), Gaps = 3/148 (2%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGP-FPTQLSIEAFSPEYLSADRANIRPVLVE--LPEKVGYRQ  475
            DGRVL+ GSNPH FY + G  FPT+L +EAFSP YL +   NIRP ++   L   V Y  
Sbjct  404  DGRVLVGGSNPHEFYNFTGVLFPTELRLEAFSPSYLESQYRNIRPRIMSPSLHSTVNYGG  463

Query  474  AFEAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPP  295
                   V   V   V+V  A   F+THSFS  QRL+ L   +++  G   Y +   +P 
Sbjct  464  VLRLRFRVLGGVKTPVKVTMAFPSFTTHSFSMSQRLLVLDHVTSLRIGQWTYEVRVKSPR  523

Query  294  NAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            +A +APPGYYMVF VNQ +PS   WV+L
Sbjct  524  SANLAPPGYYMVFVVNQDIPSEGIWVRL  551



>ref|XP_010516382.1| PREDICTED: galactose oxidase-like [Camelina sativa]
Length=546

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 88/149 (59%), Gaps = 3/149 (2%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRG-PFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQA  472
            PDGRVL+ GSNPH +Y +    +PT LS+EA+SP YLS     IRP ++   + + Y++ 
Sbjct  397  PDGRVLVGGSNPHVYYNFTNVEYPTDLSLEAYSPPYLSFTSDPIRPKILTSDKVLSYKRL  456

Query  471  FEAAITvelpvvgvveVNFASAP-FSTHSFSQGQRLVKLPVTSAIPDG-TGKYRIGCTAP  298
            F    ++   +   +      AP F+THSF+  QR+V L + S   D  T  YR+    P
Sbjct  457  FNVDFSIPQFLTVDLLSVRIVAPSFTTHSFAMNQRMVILKLLSVTRDQLTNSYRVSALGP  516

Query  297  PNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
              A +APPGYYM+F V+ G+PS A WVQ+
Sbjct  517  STAEIAPPGYYMMFLVHAGIPSSAAWVQI  545



>ref|XP_007208189.1| hypothetical protein PRUPE_ppa020922mg, partial [Prunus persica]
 gb|EMJ09388.1| hypothetical protein PRUPE_ppa020922mg, partial [Prunus persica]
Length=528

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 85/148 (57%), Gaps = 2/148 (1%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRG-PFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQA  472
            PDGRVL+ GSNPH +Y +    +PT LS+EAFSP Y+S +   +RP +V + E +GYRQ 
Sbjct  380  PDGRVLVGGSNPHVYYNFTCVEYPTDLSLEAFSPPYMSVEYEPVRPRIVSVKEVLGYRQF  439

Query  471  FEAAITvelpvvgvveVNFASAP-FSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPP  295
            F  A  V   +   V      AP F+THSF+  QR++ + +          Y I    P 
Sbjct  440  FSVAFAVPELLSVSVLSVRLVAPSFTTHSFAMNQRMIVMKLIGVTRVAPETYEISLVGPS  499

Query  294  NAMVAPPGYYMVFAVNQGVPSVARWVQL  211
               +APPGYY++F V+  +PS A WV+L
Sbjct  500  TGEIAPPGYYLLFVVHADIPSSAAWVKL  527



>ref|XP_004304717.1| PREDICTED: galactose oxidase [Fragaria vesca subsp. vesca]
Length=546

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 84/147 (57%), Gaps = 2/147 (1%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRG-PFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            DGRVL+ GSNPH  Y + G  +PT LS+EAFSP YL+ D   +RP +V + E +GYR+ F
Sbjct  399  DGRVLVGGSNPHVGYNFTGVDYPTDLSLEAFSPPYLARDYETVRPRIVSVLENIGYREQF  458

Query  468  EAAITvelpvvgvveVNFASAP-FSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPN  292
              A  V   V   V      AP F+THSF+  QR+V + +          Y +    P  
Sbjct  459  SVAFAVPEYVHSSVVSVTLVAPSFTTHSFAMNQRMVVMKLGEVRELSLDTYEVAVMGPSA  518

Query  291  AMVAPPGYYMVFAVNQGVPSVARWVQL  211
              +APPGYY++F V+  +PS A WV+L
Sbjct  519  KEIAPPGYYLLFVVHADIPSSAMWVKL  545



>ref|XP_009106212.1| PREDICTED: galactose oxidase isoform X1 [Brassica rapa]
Length=560

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 86/149 (58%), Gaps = 3/149 (2%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGP-FPTQLSIEAFSPEYLSADRANIRPVLVE--LPEKVGYRQ  475
            DGRVL+ GSNPH FY + G  FPT+L +EAFSP YL +   NIRP ++   L   V Y  
Sbjct  406  DGRVLVGGSNPHEFYNFTGVLFPTELRLEAFSPSYLESQYRNIRPRIMSPSLHSTVNYGG  465

Query  474  AFEAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPP  295
                   V   V   V+V  A   F+THSFS  QRL+ L   +++  G   Y +    P 
Sbjct  466  VLRLRFRVLGEVKTPVKVTMAFPSFTTHSFSMSQRLLVLDHVTSLRIGQWTYEVRVKTPR  525

Query  294  NAMVAPPGYYMVFAVNQGVPSVARWVQLS  208
            +A +APPGYYMVF VNQ +PS   W++L+
Sbjct  526  SANLAPPGYYMVFVVNQDIPSEGIWLRLT  554



>emb|CDY44816.1| BnaCnng11720D [Brassica napus]
Length=552

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 90/149 (60%), Gaps = 3/149 (2%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRG-PFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQA  472
            PDGRVL+ GSNPH +Y +    +PT+LS+EA+SP YLS    +IRP ++   + + Y++ 
Sbjct  403  PDGRVLVGGSNPHIYYNFTNVEYPTELSLEAYSPPYLSFTSDSIRPHILTNDKVISYKRL  462

Query  471  FEAAITvelpvvgvveVNFASAP-FSTHSFSQGQRLVKLPVTSAI-PDGTGKYRIGCTAP  298
            F    ++ L +   +      AP F+THSF+  QR+V L + S    D T  Y++    P
Sbjct  463  FNVHFSIPLFLTIDLLSVRIVAPSFTTHSFAMNQRMVILKLLSVTHEDLTNSYKLDALGP  522

Query  297  PNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
              A +APPGYYM+F V+ G+PS   WVQ+
Sbjct  523  STAEIAPPGYYMIFLVHAGIPSSGFWVQI  551



>ref|XP_010420764.1| PREDICTED: galactose oxidase-like isoform X1 [Camelina sativa]
 ref|XP_010420765.1| PREDICTED: galactose oxidase-like isoform X2 [Camelina sativa]
Length=588

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 86/150 (57%), Gaps = 5/150 (3%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVE--LPEKVGYRQ  475
            PDG+VL+ GSN +  YKY   FPT+L +E FSP YL    AN+RP +     P++V Y Q
Sbjct  439  PDGKVLVGGSNTNDGYKYNVEFPTELRVEKFSPPYLDPALANMRPKIFAAGTPKQVRYGQ  498

Query  474  AFEAAITvelpvvgvveVNFAS-AP-FSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTA  301
             F   + +         +     AP F+THS S   R++ L V    P G G Y I   A
Sbjct  499  FFNVKVDLNQKGATKENLKITMLAPAFTTHSISMNMRMLILGVADVKPAGAG-YDIQAVA  557

Query  300  PPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            PPN  +APPGYY++FAV++GVPS   W+Q+
Sbjct  558  PPNGNIAPPGYYLLFAVHKGVPSTGEWIQV  587



>gb|KDP29262.1| hypothetical protein JCGZ_16651 [Jatropha curcas]
Length=583

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 63/148 (43%), Positives = 88/148 (59%), Gaps = 3/148 (2%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQ--  475
            PDG++L+AGSN +  Y Y   +PT+L +E +SP YL A     RP +V + E++ Y Q  
Sbjct  436  PDGKILVAGSNTNNGYIYDAMYPTELRVEKYSPPYLDAAVITKRPEIVTINEQMTYAQNI  495

Query  474  AFEAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPP  295
              E  IT      G V V   S  F+TH  +  QRL+ LP+   +P G G Y++G  +P 
Sbjct  496  DIEVKITGGKVDHGDVRVTMYSPAFTTHGINMNQRLILLPMREVVPAG-GNYKVGVISPI  554

Query  294  NAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            + +VAP GYYM+  V QGVPSV +WVQ+
Sbjct  555  SNLVAPVGYYMLSVVFQGVPSVTKWVQI  582



>ref|XP_009119411.1| PREDICTED: galactose oxidase [Brassica rapa]
Length=552

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 89/149 (60%), Gaps = 3/149 (2%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRG-PFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQA  472
            PDGRVL+ GSNPH +Y +    +PT+LS+EA+SP YLS    +IRP ++   + + Y++ 
Sbjct  403  PDGRVLVGGSNPHIYYNFTNVEYPTELSLEAYSPPYLSFTSDSIRPHILTNDKVISYKRL  462

Query  471  FEAAITvelpvvgvveVNFASAP-FSTHSFSQGQRLVKLPVTSAI-PDGTGKYRIGCTAP  298
            F    ++   +   +      AP F+THSF+  QR+V L + S    D T  Y++    P
Sbjct  463  FNVHFSIPQFLTIDLLSVRIVAPSFTTHSFAMNQRMVILKLLSVTHEDLTNSYKLDVLGP  522

Query  297  PNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
              A +APPGYYM+F V+ G+PS   WVQ+
Sbjct  523  STAEIAPPGYYMIFLVHAGIPSSGFWVQI  551



>ref|XP_004239377.1| PREDICTED: galactose oxidase-like [Solanum lycopersicum]
Length=567

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 86/148 (58%), Gaps = 2/148 (1%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRG-PFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQA  472
            PDGR+L+ GSNPH  Y + G  +PT+LS+EAF P YLS   +N+RP    +   V Y Q 
Sbjct  419  PDGRILVGGSNPHIRYNFTGVKYPTELSLEAFLPPYLSPHHSNLRPSNTTVEGPVSYGQE  478

Query  471  FEAAITvelpvvgvveVNFASAP-FSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPP  295
            F    T+ +       +    AP F+THSF+  QRL+ L +       +   +I   APP
Sbjct  479  FSITFTLGVSQDTNEVMVTMVAPSFTTHSFAMNQRLLILDIVKIQQVSSFDQKITVYAPP  538

Query  294  NAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            +  +APPGYYMVF V+QGVP  + WV++
Sbjct  539  SRNIAPPGYYMVFVVHQGVPGHSIWVKM  566



>gb|EPS72896.1| hypothetical protein M569_01859, partial [Genlisea aurea]
Length=516

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 86/147 (59%), Gaps = 2/147 (1%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRG-PFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            DGR+L+ GSNPH +Y + G  +PT LS+E+FSP YLS D  ++RP + +    + Y + F
Sbjct  370  DGRILVGGSNPHEYYNFTGVDYPTDLSLESFSPPYLSPDNDHLRPRITDADRILSYHKPF  429

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTG-KYRIGCTAPPN  292
                T E      V V   + PFSTHSFS  QR+V L + +   D +  +  +   AP  
Sbjct  430  TVDFTAESLNPSAVTVRLLAPPFSTHSFSMNQRMVVLKIAAISCDSSRMRCHVNAAAPST  489

Query  291  AMVAPPGYYMVFAVNQGVPSVARWVQL  211
            A +APPGYY++F V+  +PS   W+++
Sbjct  490  AEIAPPGYYLLFVVHCEIPSHGSWIKI  516



>ref|XP_011071032.1| PREDICTED: galactose oxidase-like [Sesamum indicum]
Length=607

 Score =   113 bits (282),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 94/152 (62%), Gaps = 6/152 (4%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRG-PFPTQLSIEAFSPEYLSADRANIRPVLV--ELPEK--VG  484
            PDGRVL+ GSNPH  Y + G  +PT+LS+EAFSP YL+++ A++RP ++  E P    + 
Sbjct  455  PDGRVLVGGSNPHVRYNFTGVRYPTELSLEAFSPPYLASEHAHLRPSILSTEGPSNNVIS  514

Query  483  YRQAFEAAITvelpvvgvveVNFASAP-FSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGC  307
            Y Q F    T+ +       +   +AP F+THSF+  QRL+ L V +A       +++  
Sbjct  515  YGQQFAITFTLGMYQHVGEYMVAMAAPSFTTHSFAMNQRLLVLYVVNAHQLSAFDHKVTV  574

Query  306  TAPPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
             APP A +APPGYYM+F V+QGVP    W+++
Sbjct  575  YAPPTANIAPPGYYMLFVVHQGVPGHCVWIRI  606



>ref|XP_012082568.1| PREDICTED: galactose oxidase-like isoform X2 [Jatropha curcas]
Length=605

 Score =   113 bits (282),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 63/148 (43%), Positives = 88/148 (59%), Gaps = 3/148 (2%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQ--  475
            PDG++L+AGSN +  Y Y   +PT+L +E +SP YL A     RP +V + E++ Y Q  
Sbjct  458  PDGKILVAGSNTNNGYIYDAMYPTELRVEKYSPPYLDAAVITKRPEIVTINEQMTYAQNI  517

Query  474  AFEAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPP  295
              E  IT      G V V   S  F+TH  +  QRL+ LP+   +P G G Y++G  +P 
Sbjct  518  DIEVKITGGKVDHGDVRVTMYSPAFTTHGVNMNQRLILLPMREVVPAG-GNYKVGVISPI  576

Query  294  NAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            + +VAP GYYM+  V QGVPSV +WVQ+
Sbjct  577  SNLVAPVGYYMLSVVFQGVPSVTKWVQI  604



>ref|XP_012082567.1| PREDICTED: galactose oxidase-like isoform X1 [Jatropha curcas]
Length=618

 Score =   113 bits (282),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 63/148 (43%), Positives = 88/148 (59%), Gaps = 3/148 (2%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQ--  475
            PDG++L+AGSN +  Y Y   +PT+L +E +SP YL A     RP +V + E++ Y Q  
Sbjct  471  PDGKILVAGSNTNNGYIYDAMYPTELRVEKYSPPYLDAAVITKRPEIVTINEQMTYAQNI  530

Query  474  AFEAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPP  295
              E  IT      G V V   S  F+TH  +  QRL+ LP+   +P G G Y++G  +P 
Sbjct  531  DIEVKITGGKVDHGDVRVTMYSPAFTTHGVNMNQRLILLPMREVVPAG-GNYKVGVISPI  589

Query  294  NAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            + +VAP GYYM+  V QGVPSV +WVQ+
Sbjct  590  SNLVAPVGYYMLSVVFQGVPSVTKWVQI  617



>ref|XP_004298452.1| PREDICTED: galactose oxidase-like [Fragaria vesca subsp. vesca]
Length=576

 Score =   112 bits (281),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 87/150 (58%), Gaps = 4/150 (3%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEK---VGYR  478
            PDGR+L+ GSNPH  Y +R  FPT+LS+EA+ P YLS+  A +RP ++ +  +   V Y 
Sbjct  426  PDGRILVGGSNPHEMYNFRRAFPTELSLEAYLPPYLSSTAAPLRPTIISIEARENIVSYG  485

Query  477  QAFEAAITvelpvvgvveVNFASAP-FSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTA  301
            Q F     + +    V       AP F+THS +  QR+V L V S        Y+I    
Sbjct  486  QEFSVNFGLSVYRPDVAISVALVAPSFTTHSLAMNQRVVVLEVASLKRLSVFDYKITARG  545

Query  300  PPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            PP++ VAPPGYYMVF V+ G+P  A WV++
Sbjct  546  PPSSTVAPPGYYMVFIVHAGIPGQALWVKV  575



>gb|KHN09108.1| Galactose oxidase [Glycine soja]
Length=228

 Score =   108 bits (271),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 62/150 (41%), Positives = 86/150 (57%), Gaps = 5/150 (3%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGP-FPTQLSIEAFSPEYLSADRANIRPVLV----ELPEKVGY  481
            DGRVL+AGSNPH +YK+    FPT+L +EAFSP YL    +++RP +V    +   K G 
Sbjct  78   DGRVLVAGSNPHIYYKFTNVLFPTELRLEAFSPWYLEPGFSSVRPTIVFPASQTKLKYGQ  137

Query  480  RQAFEAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTA  301
                   +     V   V V   S PF+THSFS  QR++ L        G   Y +  TA
Sbjct  138  TLRLRFEVMSATLVGDSVSVTMLSPPFNTHSFSMNQRMLVLEPHDLSKVGESTYEVEVTA  197

Query  300  PPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            P +A++APPG+Y++F V+Q +PS   WVQ+
Sbjct  198  PVSAVLAPPGFYLLFLVHQEIPSQGIWVQM  227



>ref|XP_001762118.1| predicted protein [Physcomitrella patens]
 gb|EDQ73222.1| predicted protein [Physcomitrella patens]
Length=529

 Score =   112 bits (280),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 67/146 (46%), Positives = 88/146 (60%), Gaps = 6/146 (4%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDGRV++AGSN H FY   G  PT+L IE FSP Y+ A+R    P   E+P  + Y   F
Sbjct  389  PDGRVMVAGSNTHQFYTLAGYLPTELRIETFSPPYMGANR----PTFAEVPGGLKYGGGF  444

Query  468  EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPNA  289
             A  TV+      +E+N  SAPF THS++QGQRL++L  ++    G G Y +   APP+A
Sbjct  445  TA--TVKAANPKNIELNLLSAPFVTHSYAQGQRLLQLEASAPAAAGGGAYTVDSKAPPSA  502

Query  288  MVAPPGYYMVFAVNQGVPSVARWVQL  211
             VAP GYYM+F V  G    A WV++
Sbjct  503  AVAPGGYYMLFPVADGNVGYASWVKI  528



>gb|EYU23055.1| hypothetical protein MIMGU_mgv1a021812mg, partial [Erythranthe 
guttata]
Length=517

 Score =   112 bits (279),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 63/148 (43%), Positives = 85/148 (57%), Gaps = 2/148 (1%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRG-PFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQA  472
            PDGRV + G NPH +Y + G  FPT LS+E+FSP YLS     +RP +VE+ E +GY   
Sbjct  369  PDGRVFVGGGNPHIYYNFSGVDFPTDLSLESFSPPYLSPHYDRLRPRIVEIEETLGYTAP  428

Query  471  FEAAITv-elpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPP  295
            F     V E   +  V V   + PF+THSFS  QR+V L    A   G   Y +    P 
Sbjct  429  FLVRFRVPEFRRMSEVSVRIVAPPFNTHSFSMNQRMVVLRWDEAAYIGGDVYEVAAFGPS  488

Query  294  NAMVAPPGYYMVFAVNQGVPSVARWVQL  211
             A +APPGYY++F V+ G+PS   W+++
Sbjct  489  TAEIAPPGYYLLFLVHSGIPSSGAWIKI  516



>gb|KDP29259.1| hypothetical protein JCGZ_16648 [Jatropha curcas]
Length=636

 Score =   113 bits (282),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 63/148 (43%), Positives = 88/148 (59%), Gaps = 3/148 (2%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQ--  475
            PDG++L+AGSN +  Y Y   +PT+L +E +SP YL A     RP +V + E++ Y Q  
Sbjct  489  PDGKILVAGSNTNNGYIYDAMYPTELRVEKYSPPYLDAAVITKRPEIVTINEQMTYAQNI  548

Query  474  AFEAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPP  295
              E  IT      G V V   S  F+TH  +  QRL+ LP+   +P G G Y++G  +P 
Sbjct  549  DIEVKITGGKVDHGDVRVTMYSPAFTTHGVNMNQRLILLPMREVVPAG-GNYKVGVISPI  607

Query  294  NAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            + +VAP GYYM+  V QGVPSV +WVQ+
Sbjct  608  SNLVAPVGYYMLSVVFQGVPSVTKWVQI  635



>ref|XP_011009462.1| PREDICTED: galactose oxidase-like [Populus euphratica]
Length=609

 Score =   112 bits (281),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 89/152 (59%), Gaps = 6/152 (4%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLV--ELPEKVGYRQ  475
            P+G+VL+AGSN +  Y Y   FPT+L +E FSP YL    A  RPV+V  + PE++ Y +
Sbjct  457  PNGKVLVAGSNTNNGYVYNAIFPTELRVEKFSPPYLDPSVAVHRPVIVTDKAPEQISYDE  516

Query  474  AFEAAI--TvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGT--GKYRIGC  307
             F+  I  T        + V   +  F+TH  S  QRL+ L +   I +    G + I  
Sbjct  517  TFQLQIKSTAVKVEKKDIIVTMYAPAFTTHGVSMNQRLLDLGLEDVIAENAFLGIHTITA  576

Query  306  TAPPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
             +PP+  VAPPGYYM+F V+QGVPSV+ WVQ+
Sbjct  577  VSPPSGKVAPPGYYMLFVVHQGVPSVSTWVQI  608



>ref|XP_002888587.1| hypothetical protein ARALYDRAFT_475824 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64846.1| hypothetical protein ARALYDRAFT_475824 [Arabidopsis lyrata subsp. 
lyrata]
Length=599

 Score =   112 bits (281),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 62/150 (41%), Positives = 87/150 (58%), Gaps = 4/150 (3%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVEL--PEKVGYRQ  475
            PDG+VL+ GSN +  Y+Y   +PT+L IE FSP YL    AN+RP +V    P+++ Y Q
Sbjct  449  PDGKVLVGGSNTNDGYQYNVEYPTELRIEKFSPPYLDPALANMRPRIVNTATPKQIKYGQ  508

Query  474  AFEAAI--TvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTA  301
             F+  I    +      V V   +  F+THS S   RL+ L + +    G   ++I   A
Sbjct  509  MFDVKIELKQQNVAKENVMVTMLAPSFTTHSVSMNMRLLMLGINNVKNVGGDNHQIQAVA  568

Query  300  PPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            PP+  VAPPGYY++FAV  GVPSV  W+Q+
Sbjct  569  PPSGKVAPPGYYLLFAVYNGVPSVGEWIQI  598



>ref|NP_191321.1| glyoxal oxidase-related protein [Arabidopsis thaliana]
 emb|CAB41193.1| putative protein [Arabidopsis thaliana]
 gb|AEE79679.1| glyoxal oxidase-related protein [Arabidopsis thaliana]
Length=547

 Score =   111 bits (278),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 88/150 (59%), Gaps = 4/150 (3%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRG-PFPTQLSIEAFSPEYLSADRANIRPVLVELPEKV-GYRQ  475
            PDGRVL+ GSNPH +Y +    +PT LS+EA+SP YL      IRP ++   +KV  Y++
Sbjct  397  PDGRVLVGGSNPHVYYNFTNVEYPTDLSLEAYSPPYLFFTSDPIRPKILLTSDKVLSYKR  456

Query  474  AFEAAITvelpvvgvveVNFASAP-FSTHSFSQGQRLVKLPVTSAIPDG-TGKYRIGCTA  301
             F    ++   +   +      AP F+THSF+  QR+V L + S   D  T  YR+    
Sbjct  457  LFNVDFSIAQFLTVDLLSVRIVAPSFTTHSFAMNQRMVILKLLSVTRDQLTNSYRVSALG  516

Query  300  PPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            P  A +APPGYYM+F V+ G+PS A WVQ+
Sbjct  517  PSTAEIAPPGYYMIFLVHAGIPSSAAWVQI  546



>ref|XP_010105253.1| hypothetical protein L484_019396 [Morus notabilis]
 gb|EXC04188.1| hypothetical protein L484_019396 [Morus notabilis]
Length=548

 Score =   111 bits (278),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 88/150 (59%), Gaps = 5/150 (3%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGP-FPTQLSIEAFSPEYLSADRANIRPVLVELPE--KVGY--  481
            DGRVL+ GSNPH +Y + G  FPT LS+E+FSP+YL A  +N+RP +V  P   KV Y  
Sbjct  398  DGRVLVGGSNPHIYYNFTGVLFPTDLSLESFSPQYLDAQFSNLRPKIVSPPSQSKVSYLN  457

Query  480  RQAFEAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTA  301
            + A    ++    + G V V   +  F+THSFS  QRL+ L   S    G   Y +  T 
Sbjct  458  KLAVRFTVSGATLLPGSVAVTMVAPSFTTHSFSMNQRLLVLSAESMTSLGKSTYEVRVTT  517

Query  300  PPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            P + ++AP GYY+ F V+Q +PS   WVQ+
Sbjct  518  PGSGILAPSGYYLWFVVHQEIPSDGIWVQI  547



>gb|KFK37635.1| hypothetical protein AALP_AA3G008700 [Arabis alpina]
Length=548

 Score =   111 bits (278),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 86/149 (58%), Gaps = 4/149 (3%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGP-FPTQLSIEAFSPEYLSADRANIRPVLVELPEK--VGYRQ  475
            DGR+L+ GSNPH FYK+    FPT+LS+EAFSP YL +  ++ RP +V L  +  + Y Q
Sbjct  399  DGRILVGGSNPHEFYKFTNVLFPTELSLEAFSPSYLESKHSSHRPRIVNLTSQSTINYGQ  458

Query  474  AFEAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPD-GTGKYRIGCTAP  298
                   V   V   V+V      F+THSFS  QRL+ L    A+   G   Y +    P
Sbjct  459  ILTLRFDVTGRVKSPVKVTMVFPSFNTHSFSMHQRLLILDHVFAVRRLGISSYEVKVKTP  518

Query  297  PNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
             +  +APPGYYMVF VNQG+PS   WV+L
Sbjct  519  RSVNLAPPGYYMVFVVNQGIPSEGVWVRL  547



>ref|XP_006300296.1| hypothetical protein CARUB_v10021300mg [Capsella rubella]
 gb|EOA33194.1| hypothetical protein CARUB_v10021300mg [Capsella rubella]
Length=547

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 89/148 (60%), Gaps = 3/148 (2%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGP-FPTQLSIEAFSPEYLSADRANIRPVLVE-LPEK-VGYRQ  475
            DGRVL+ GSNPH FY + G  FPT+LS+EAFSP YL +  +++RP +++ +P+  + Y +
Sbjct  399  DGRVLVGGSNPHAFYNFTGVLFPTELSLEAFSPSYLESQYSSLRPRIIDPMPQTTINYSR  458

Query  474  AFEAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPP  295
                  TV   V   V+V      F+THSFS  QRL+ L    +   G   Y +    P 
Sbjct  459  ILRLRFTVSGRVKSPVKVTMVYPSFTTHSFSMNQRLLVLDHVFSFRRGFRTYEVIVRTPS  518

Query  294  NAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            +A +APPGYYMVF VNQ +PS   W++L
Sbjct  519  SAELAPPGYYMVFVVNQDIPSEGVWLRL  546



>gb|AET97563.1| galactose oxidase [Ziziphus jujuba]
Length=545

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 65/149 (44%), Positives = 85/149 (57%), Gaps = 4/149 (3%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGP-FPTQLSIEAFSPEYLSADRANIRPVLVE--LPEKVGYRQ  475
            DGRVL+ GSNPH +Y + G  FPT LS+EAFSP YL A  +N+RP +V      K+ Y Q
Sbjct  396  DGRVLVGGSNPHVYYNFTGVIFPTDLSLEAFSPSYLEAQFSNLRPRIVSPTSQTKLAYAQ  455

Query  474  AFEAAITve-lpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAP  298
                  TV       +V V   S  F+THSFS  QRL+ L   S    G   Y +  T P
Sbjct  456  KLAVRFTVTGTVATKLVSVTMVSPSFTTHSFSMNQRLLVLGAESVRNLGKTTYEVQVTTP  515

Query  297  PNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
             +  +AP GYY++F V+Q +PS+  WVQ+
Sbjct  516  SSGNLAPSGYYLLFVVHQEIPSLGIWVQI  544



>emb|CBI34230.3| unnamed protein product [Vitis vinifera]
Length=432

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 57/148 (39%), Positives = 86/148 (58%), Gaps = 2/148 (1%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGP-FPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQA  472
            PDGR+L+ GSNPH +Y +    +PT LS+EA+SP Y S   +++RP ++ L E + Y Q+
Sbjct  284  PDGRILVGGSNPHVYYNFTNVLYPTDLSLEAYSPPYTSPAFSSLRPHILSLDENLLYGQS  343

Query  471  FEAAITvel-pvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPP  295
            F     V       V+  N  +  F+TH+ +  QR+V L V S + +    YR+    P 
Sbjct  344  FSIVFNVCEYTNDRVLSANIVAPSFTTHTVAMNQRMVVLRVESVMQEVGNTYRLSVVGPS  403

Query  294  NAMVAPPGYYMVFAVNQGVPSVARWVQL  211
               +APPGYYM+F V+ G+PS   WV++
Sbjct  404  TPEIAPPGYYMLFVVHSGIPSHGSWVKI  431



>ref|XP_007030653.1| Glyoxal oxidase-related protein [Theobroma cacao]
 gb|EOY11155.1| Glyoxal oxidase-related protein [Theobroma cacao]
Length=558

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/150 (41%), Positives = 91/150 (61%), Gaps = 5/150 (3%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRG-PFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            DGR+L+ GSNPH FY +    FPT LS+E+FSP YLS +   IRP ++ L EK+ Y ++F
Sbjct  408  DGRILVGGSNPHVFYNFTNVEFPTDLSLESFSPPYLSPEYDPIRPQILSLDEKIRYGKSF  467

Query  468  EAAITvelpvvgvveVNFASAP-FSTHSFSQGQRLVKLP---VTSAIPDGTGKYRIGCTA  301
              + +V+  +   V      AP F+THSF+  QR+V L    VT+ +P     Y +    
Sbjct  468  WLSFSVKDYLTASVLSVRIVAPSFTTHSFAMNQRMVVLKIVGVTTLLPPAPYAYGLSMVG  527

Query  300  PPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            P  A +APPGYY++F ++ G+PS   WV++
Sbjct  528  PSTAAIAPPGYYLLFVLHAGIPSSGMWVKI  557



>ref|XP_006473606.1| PREDICTED: galactose oxidase-like [Citrus sinensis]
Length=535

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 87/150 (58%), Gaps = 6/150 (4%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGP-FPTQLSIEAFSPEYLSADRANIRPVLVELPEK---VGYR  478
            DGRVL+ GSNPH +Y + G  FPT+LS+EAFSP YL A  AN+RP +V LPE    + Y+
Sbjct  386  DGRVLVGGSNPHAYYNFTGVLFPTELSLEAFSPYYLDAPFANLRPTIV-LPESQFTLKYK  444

Query  477  QAFEAAITvelpvvgvveVNFASAP-FSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTA  301
            Q F    +   PV          AP F+THSFS  QRL+ L   +    G   Y I   +
Sbjct  445  QKFRVRFSASGPVALNKVTVTMVAPSFNTHSFSMNQRLLVLASDTVTKLGNSGYEIVVNS  504

Query  300  PPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            P +  +AP GYY++F V+Q VPS   WV +
Sbjct  505  PGSGNLAPSGYYLLFVVHQDVPSEGIWVHV  534



>gb|KDO84767.1| hypothetical protein CISIN_1g009420mg [Citrus sinensis]
Length=535

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 87/150 (58%), Gaps = 6/150 (4%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGP-FPTQLSIEAFSPEYLSADRANIRPVLVELPEK---VGYR  478
            DGRVL+ GSNPH +Y + G  FPT+LS+EAFSP YL A  AN+RP +V LPE    + Y+
Sbjct  386  DGRVLVGGSNPHAYYNFTGVLFPTELSLEAFSPYYLDAPFANLRPTIV-LPESQFTLKYK  444

Query  477  QAFEAAITvelpvvgvveVNFASAP-FSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTA  301
            Q F    +   PV          AP F+THSFS  QRL+ L   +    G   Y I   +
Sbjct  445  QKFRVRFSASGPVALNKVTVTMVAPSFNTHSFSMNQRLLVLASDTVTKLGNSGYEIVVNS  504

Query  300  PPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            P +  +AP GYY++F V+Q VPS   WV +
Sbjct  505  PGSGNLAPSGYYLLFVVHQDVPSEGIWVHV  534



>ref|XP_006435123.1| hypothetical protein CICLE_v10003275mg [Citrus clementina]
 gb|ESR48363.1| hypothetical protein CICLE_v10003275mg [Citrus clementina]
Length=521

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 87/150 (58%), Gaps = 6/150 (4%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGP-FPTQLSIEAFSPEYLSADRANIRPVLVELPEK---VGYR  478
            DGRVL+ GSNPH +Y + G  FPT+LS+EAFSP YL A  AN+RP +V LPE    + Y+
Sbjct  372  DGRVLVGGSNPHAYYNFTGVLFPTELSLEAFSPYYLDAPFANLRPTIV-LPESQFTLKYK  430

Query  477  QAFEAAITvelpvvgvveVNFASAP-FSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTA  301
            Q F    +   PV          AP F+THSFS  QRL+ L   +    G   Y I   +
Sbjct  431  QKFRVRFSASGPVALNKVTVTMVAPSFNTHSFSMNQRLLVLASDTVTKLGNSGYEIVVNS  490

Query  300  PPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            P +  +AP GYY++F V+Q VPS   WV +
Sbjct  491  PGSGNLAPSGYYLLFVVHQDVPSEGIWVHV  520



>ref|XP_010670846.1| PREDICTED: galactose oxidase-like [Beta vulgaris subsp. vulgaris]
Length=538

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 93/151 (62%), Gaps = 5/151 (3%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGP-FPTQLSIEAFSPEYLSADRANIRPVLVE--LPEKVGYRQ  475
            DGRVL+ GSNPH FY +    FPT+LS+E FSP YL   +A +RPV+++     K+ Y +
Sbjct  388  DGRVLVGGSNPHQFYNFTNVLFPTELSLETFSPPYLDPTKARLRPVIIKPISSAKIKYGR  447

Query  474  AFEAAITve-lpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAI-PDGTGKYRIGCTA  301
                  +V  L  +  V+V    APF+THSFS  QRL+ L     + P G G++++    
Sbjct  448  FLTIKFSVSGLINLASVKVTMLRAPFNTHSFSMSQRLLVLTNRKLVSPTGQGRFQVRVRL  507

Query  300  PPNAMVAPPGYYMVFAVNQGVPSVARWVQLS  208
            P +A +APPG+YM+F V++ +PS   WVQL+
Sbjct  508  PGSANIAPPGFYMLFVVHRNIPSKGIWVQLT  538



>ref|XP_006416454.1| hypothetical protein EUTSA_v10007284mg [Eutrema salsugineum]
 gb|ESQ34807.1| hypothetical protein EUTSA_v10007284mg [Eutrema salsugineum]
Length=547

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 89/149 (60%), Gaps = 4/149 (3%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGP-FPTQLSIEAFSPEYLSADRANIRPVLV--ELPEKVGYRQ  475
            DGRVL+ GSNPH FY + G  FPT+LS+EAFSP YL  + AN+RP ++  +    + YR 
Sbjct  398  DGRVLVGGSNPHAFYNFTGVLFPTELSLEAFSPVYLEPEFANLRPKIMAPKSQSSIKYRM  457

Query  474  AFEAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDG-TGKYRIGCTAP  298
              +    V   V G V+V      F+THSFS  QRL+ L       +G +  Y +    P
Sbjct  458  NLKLKFKVAGEVKGPVKVTMVFPSFTTHSFSMNQRLLVLDNVKFTRNGKSTNYEVLVRTP  517

Query  297  PNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
             +A++APPGYYM+F VNQ +PS   WV+L
Sbjct  518  RSAIIAPPGYYMMFVVNQNIPSEGIWVRL  546



>ref|XP_008218222.1| PREDICTED: galactose oxidase [Prunus mume]
Length=553

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 84/148 (57%), Gaps = 2/148 (1%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRG-PFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQA  472
            PDGRVL++GSNPH +Y +    +PT LS+EAFSP Y S +    RP +V + E +GYRQ 
Sbjct  405  PDGRVLVSGSNPHVYYNFTCVEYPTDLSLEAFSPPYTSVEYEPARPRIVSVKEVLGYRQF  464

Query  471  FEAAITvelpvvgvveVNFASAP-FSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPP  295
            F  A  V   +   V      AP F+THSF+  QR++ + +          Y I    P 
Sbjct  465  FSVAFAVPELLSVSVLSVRLVAPSFTTHSFAMNQRMIVMKLIGVTRVAPETYEISLVGPS  524

Query  294  NAMVAPPGYYMVFAVNQGVPSVARWVQL  211
               +APPGYY++F V+  +PS A WV+L
Sbjct  525  TGEIAPPGYYLLFVVHADIPSSAAWVKL  552



>ref|XP_009801814.1| PREDICTED: galactose oxidase [Nicotiana sylvestris]
Length=560

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 88/149 (59%), Gaps = 6/149 (4%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRG-PFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            DGRVL+ GSNPH FY + G  FPT LS+E+FSP YL+ + A ++P ++ + + + Y+Q F
Sbjct  408  DGRVLVGGSNPHKFYNFTGVDFPTDLSLESFSPPYLAPEYAPLKPTVLSIDDILMYKQPF  467

Query  468  EAAITvelpvvgvveVNFASAP-FSTHSFSQGQRLVKLP--VTSAIPDGTGKYRIGCTAP  298
                TV   +   +      AP F+THSFS  QR+V L     S + D T  YR     P
Sbjct  468  SVTFTVPKFLKMGIVSVRIVAPSFTTHSFSMNQRMVVLKRVAISTVSDNT--YRFIAFGP  525

Query  297  PNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
                +APPGYYM+F V+ G+PS   WV++
Sbjct  526  STKEIAPPGYYMLFVVHAGIPSSGVWVKI  554



>ref|XP_009393211.1| PREDICTED: galactose oxidase-like [Musa acuminata subsp. malaccensis]
Length=542

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 85/150 (57%), Gaps = 5/150 (3%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRG-PFPTQLSIEAFSPEYLSADRANIRPVLV--ELPEKVGYRQ  475
            DGRVL+ GSNPH FY + G  FPT LS+EA+SP YL A  +N RP +     P ++ Y +
Sbjct  391  DGRVLVGGSNPHAFYNFTGVDFPTDLSLEAYSPAYLEAANSNARPTVTWAGTPVELNYAK  450

Query  474  AFEAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLP--VTSAIPDGTGKYRIGCTA  301
             F    +V       V V   +  F+THSFS  QRL+ L   + +A    +  Y +   A
Sbjct  451  PFSLRFSVAAMSEKGVLVTMVAPSFATHSFSMNQRLLILESELAAAADAESSLYVVDAMA  510

Query  300  PPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            P +  +APPGYYMVF VN G+PS   WV +
Sbjct  511  PSSTFMAPPGYYMVFVVNGGIPSEGVWVHI  540



>ref|XP_010416451.1| PREDICTED: galactose oxidase-like isoform X2 [Camelina sativa]
Length=516

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 91/149 (61%), Gaps = 4/149 (3%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGP-FPTQLSIEAFSPEYLSADRANIRPVLVE-LPEK-VGYRQ  475
            DGRV++ GSNPH +Y + G  FPT+LS+EAFSP YL +  +++RPV+++ +P+  + Y Q
Sbjct  367  DGRVIVGGSNPHAYYNFTGVLFPTELSLEAFSPSYLESKYSSLRPVIMDPMPQTTINYGQ  426

Query  474  AFEAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGK-YRIGCTAP  298
                  TV+  +   V+V      F+THSFS  QRL+ L     +  G  + Y +    P
Sbjct  427  ILRLRFTVQGRMKTPVKVTMVYPSFNTHSFSMSQRLLVLDHVLFLRIGLSRIYEVSVRTP  486

Query  297  PNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
             +  +APPGYYMVF VNQ +PS   WV+L
Sbjct  487  SSVNLAPPGYYMVFVVNQNIPSEGVWVRL  515



>ref|NP_176897.1| glyoxal oxidase-related protein [Arabidopsis thaliana]
 gb|AAG00252.1|AC002130_17 F1N21.11 [Arabidopsis thaliana]
 gb|AAO22637.1| putative glyoxal oxidase (glx1) [Arabidopsis thaliana]
 gb|AAO42437.1| putative glyoxal oxidase (glx1) [Arabidopsis thaliana]
 gb|AEE34623.1| glyoxal oxidase-related protein [Arabidopsis thaliana]
Length=615

 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 88/150 (59%), Gaps = 4/150 (3%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVEL--PEKVGYRQ  475
            PDG+VL+ GSN +  Y++   +PT+L IE FSP YL    AN+RP +V    P+++ Y Q
Sbjct  465  PDGKVLVGGSNTNNGYQFNVEYPTELRIEKFSPPYLDPALANMRPRIVNTATPKQIKYGQ  524

Query  474  AFEAAITvelpvvgvv--eVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTA  301
             F+  I ++   V      V   +  F+THS S   RL+ L + +    G   ++I   A
Sbjct  525  MFDVKIELKQQNVAKENVMVTMLAPSFTTHSVSMNMRLLMLGINNVKNVGGDNHQIQAVA  584

Query  300  PPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            PP+  +APPGYY++FAV  GVPSV  W+Q+
Sbjct  585  PPSGKLAPPGYYLLFAVYNGVPSVGEWIQI  614



>ref|XP_010660091.1| PREDICTED: galactose oxidase [Vitis vinifera]
Length=544

 Score =   109 bits (273),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 57/148 (39%), Positives = 86/148 (58%), Gaps = 2/148 (1%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGP-FPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQA  472
            PDGR+L+ GSNPH +Y +    +PT LS+EA+SP Y S   +++RP ++ L E + Y Q+
Sbjct  396  PDGRILVGGSNPHVYYNFTNVLYPTDLSLEAYSPPYTSPAFSSLRPHILSLDENLLYGQS  455

Query  471  FEAAITvel-pvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPP  295
            F     V       V+  N  +  F+TH+ +  QR+V L V S + +    YR+    P 
Sbjct  456  FSIVFNVCEYTNDRVLSANIVAPSFTTHTVAMNQRMVVLRVESVMQEVGNTYRLSVVGPS  515

Query  294  NAMVAPPGYYMVFAVNQGVPSVARWVQL  211
               +APPGYYM+F V+ G+PS   WV++
Sbjct  516  TPEIAPPGYYMLFVVHSGIPSHGSWVKI  543



>ref|XP_009619752.1| PREDICTED: galactose oxidase-like [Nicotiana tomentosiformis]
Length=598

 Score =   110 bits (274),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 59/148 (40%), Positives = 87/148 (59%), Gaps = 2/148 (1%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRG-PFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQA  472
            PDGR+L+ GSNPH  Y + G  +PT+LS+EAF P YL+ + +++RP ++ +   V Y Q 
Sbjct  450  PDGRILVGGSNPHIRYNFTGVQYPTELSLEAFRPPYLAPEHSHLRPSILTVEGPVSYGQK  509

Query  471  FEAAITvelpvvgvveVNFASAP-FSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPP  295
            F    T+         +    AP F+THSF+  QRL+ L V           +I   APP
Sbjct  510  FSITFTLGFFQPAKELMVSMIAPSFTTHSFAMNQRLLILDVVEVQRLSLFAQKITVCAPP  569

Query  294  NAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            +  +APPGYYMVF V++GVP  + W+++
Sbjct  570  SRNIAPPGYYMVFVVHKGVPGHSSWIRM  597



>emb|CDY51183.1| BnaC02g45610D [Brassica napus]
Length=592

 Score =   110 bits (274),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 89/150 (59%), Gaps = 4/150 (3%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLV--ELPEKVGYRQ  475
            PDG+VL+ GSN +  Y+Y   +PT+L IE FSP YL    AN+RP +V  + P+++ + Q
Sbjct  442  PDGKVLIGGSNTNDGYRYDVEYPTELRIEKFSPPYLDPALANMRPKIVHTDTPKQIKFGQ  501

Query  474  AFEAAITvelpvvgvv--eVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTA  301
             F   I ++   V      V   + PF+TH+ S   RL+ L ++    +    ++I   A
Sbjct  502  TFNVKIELKQANVAKENVMVTMLAPPFTTHAVSMNMRLLLLGISDVKKEHGDVHQIQAVA  561

Query  300  PPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            PP+  VAPPGYY+++AV  GVPSV  W+Q+
Sbjct  562  PPSGNVAPPGYYLLYAVYNGVPSVGEWIQI  591



>ref|XP_009335433.1| PREDICTED: galactose oxidase-like [Pyrus x bretschneideri]
Length=533

 Score =   109 bits (272),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 87/149 (58%), Gaps = 4/149 (3%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGP-FPTQLSIEAFSPEYLSADRANIRPVLV--ELPEKVGYRQ  475
            DGRVL+ GSNPH  Y++    FPT+L +EAFSP+YL A   N+RP +V      K+ Y +
Sbjct  384  DGRVLIGGSNPHDKYEFTNVLFPTELRLEAFSPDYLDATYNNLRPTIVAPNSQAKINYGK  443

Query  474  AFEAAITvelpvvgvveVNFASAP-FSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAP  298
                  +V+  +V         AP F+THSFS  QRL+ L   + I  GT  Y +  T P
Sbjct  444  KLSIQFSVKGNLVSKSVSVSMVAPSFNTHSFSMNQRLLVLGAENIIKGGTTTYEVQVTTP  503

Query  297  PNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
             +  +AP GYY+++ V+Q +PS A WVQ+
Sbjct  504  ASRNLAPSGYYLLYVVHQQIPSAAIWVQI  532



>ref|XP_009127543.1| PREDICTED: galactose oxidase-like [Brassica rapa]
Length=593

 Score =   110 bits (274),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 89/150 (59%), Gaps = 4/150 (3%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLV--ELPEKVGYRQ  475
            PDG+VL+ GSN +  Y+Y   +PT+L IE FSP YL    AN+RP +V  + P+++ + Q
Sbjct  443  PDGKVLIGGSNTNDGYRYDVEYPTELRIEKFSPPYLDPALANMRPKIVHTDTPKQIKFGQ  502

Query  474  AFEAAITvelpvvgvv--eVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTA  301
             F   I ++   V      V   + PF+TH+ S   RL+ L ++    +    ++I   A
Sbjct  503  TFNVKIELKQANVAKENVMVTMLAPPFTTHAVSMNMRLLLLGISDVKKEHGDVHQIQAVA  562

Query  300  PPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            PP+  VAPPGYY+++AV  GVPSV  W+Q+
Sbjct  563  PPSGNVAPPGYYLLYAVYNGVPSVGEWIQI  592



>ref|XP_010416450.1| PREDICTED: galactose oxidase-like isoform X1 [Camelina sativa]
Length=548

 Score =   109 bits (273),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 91/149 (61%), Gaps = 4/149 (3%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGP-FPTQLSIEAFSPEYLSADRANIRPVLVE-LPEK-VGYRQ  475
            DGRV++ GSNPH +Y + G  FPT+LS+EAFSP YL +  +++RPV+++ +P+  + Y Q
Sbjct  399  DGRVIVGGSNPHAYYNFTGVLFPTELSLEAFSPSYLESKYSSLRPVIMDPMPQTTINYGQ  458

Query  474  AFEAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGK-YRIGCTAP  298
                  TV+  +   V+V      F+THSFS  QRL+ L     +  G  + Y +    P
Sbjct  459  ILRLRFTVQGRMKTPVKVTMVYPSFNTHSFSMSQRLLVLDHVLFLRIGLSRIYEVSVRTP  518

Query  297  PNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
             +  +APPGYYMVF VNQ +PS   WV+L
Sbjct  519  SSVNLAPPGYYMVFVVNQNIPSEGVWVRL  547



>ref|XP_003519774.1| PREDICTED: galactose oxidase-like [Glycine max]
Length=560

 Score =   109 bits (273),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 89/150 (59%), Gaps = 4/150 (3%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYR-GPFPTQLSIEAFSPEYLSADRANIRPVLVELPEK---VGY  481
            PDGRVL+ GSNPH  Y +R  P+PT+LS++A+ PEYL  +  N++P ++ +  +     Y
Sbjct  410  PDGRVLVGGSNPHRVYDFRANPYPTELSMDAYYPEYLGVEFENLKPSILTVEAENNTASY  469

Query  480  RQAFEAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTA  301
             + F     ++    G V V   +  F+THSF+  QR++ L V +        Y++    
Sbjct  470  GRLFAVTFELKEYREGGVGVTLVAPSFTTHSFAMNQRVLVLDVVAVQEVAKFGYKVVARG  529

Query  300  PPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            PP+  VAPPGYYM+F V+ GVPS A WVQ+
Sbjct  530  PPSLAVAPPGYYMLFIVHAGVPSAAVWVQV  559



>ref|XP_010670864.1| PREDICTED: galactose oxidase-like [Beta vulgaris subsp. vulgaris]
Length=617

 Score =   110 bits (274),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 91/151 (60%), Gaps = 6/151 (4%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGP-FPTQLSIEAFSPEYLSADRANIRPVLV--ELPEKVGYRQ  475
            DGRVL+ GSNPH   ++    +PT+LS+EAFSP YL+ ++  +RP+++  +   KV Y Q
Sbjct  466  DGRVLVGGSNPHMVNRFTHVLYPTELSLEAFSPPYLNPNKTVLRPIIITPDSGSKVQYAQ  525

Query  474  AFEAA-ITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVT--SAIPDGTGKYRIGCT  304
              E   +   L     + V     PF+THSFS  QRL+ L  T  SA   G  ++++  T
Sbjct  526  VLEVKFLVFGLIDQASIMVTMLRPPFNTHSFSMSQRLLVLTNTMQSATSIGPNQFQVNVT  585

Query  303  APPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
             P +  ++PPGYY++F V+QG+PS   WVQ+
Sbjct  586  TPESTNISPPGYYLLFVVHQGIPSTGIWVQI  616



>gb|KJB50703.1| hypothetical protein B456_008G183000 [Gossypium raimondii]
Length=559

 Score =   109 bits (272),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 87/148 (59%), Gaps = 2/148 (1%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRP--VLVELPEKVGYRQ  475
            PDGR+L+AG NPH  Y + G +PT+LS+EA++P YL A   ++RP  + VE    V Y +
Sbjct  411  PDGRILVAGGNPHTTYVFTGLYPTELSLEAYNPYYLDAKFNSLRPSIISVESGSTVSYGR  470

Query  474  AFEAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPP  295
             F  + +V L   G V V      F+THS    QR+V L   S +      +++    P 
Sbjct  471  RFGVSFSVSLFRQGTVSVALIWPSFTTHSTGMSQRMVVLNTASVVQLSMANFKLVVDGPT  530

Query  294  NAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            NA VAPPGYYM+F V+ G+PS A WV++
Sbjct  531  NANVAPPGYYMLFVVHSGIPSHAVWVKV  558



>ref|XP_010256224.1| PREDICTED: galactose oxidase [Nelumbo nucifera]
Length=554

 Score =   109 bits (272),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 59/148 (40%), Positives = 85/148 (57%), Gaps = 2/148 (1%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRG-PFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQA  472
            PDGR+L+ GSNPH  Y++ G  +PT LS+E+FSP YL+ + A  RP +V   E + Y + 
Sbjct  406  PDGRILVGGSNPHPIYRFTGAEYPTDLSLESFSPPYLAREHAETRPTIVATGEVLKYGEL  465

Query  471  FEAAITvelpvvgvveVNFASAP-FSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPP  295
                 TV+             AP F+THS +  QRLV L V         +Y++    PP
Sbjct  466  LTVDFTVQEYQSATALSVTIVAPSFTTHSVAMNQRLVVLRVADVSHISAHRYQLKAHGPP  525

Query  294  NAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            +A +AP GYY++F V+ G+PS A WV++
Sbjct  526  SATIAPSGYYLLFVVHAGIPSSAVWVKI  553



>ref|XP_010471676.1| PREDICTED: galactose oxidase-like isoform X2 [Camelina sativa]
Length=548

 Score =   109 bits (272),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 91/149 (61%), Gaps = 4/149 (3%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGP-FPTQLSIEAFSPEYLSADRANIRPVLVE-LPEK-VGYRQ  475
            DGRV++ GSNPH +Y + G  FPT+LS+EAFSP YL +  +++RPV+++ +P+  + Y Q
Sbjct  399  DGRVIVGGSNPHAYYNFTGVLFPTELSLEAFSPSYLESKYSSLRPVIMDPMPQTTINYGQ  458

Query  474  AFEAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGK-YRIGCTAP  298
                  TV+  V   V+V      F+THSFS  QRL+ L     +  G  + Y +    P
Sbjct  459  ILRLRFTVQGRVKTPVKVTMVYPSFNTHSFSMSQRLLVLDHVLFLRIGLSRIYEVSVRTP  518

Query  297  PNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
             +  +APPGYYMVF VNQ +PS   WV+L
Sbjct  519  SSVNLAPPGYYMVFVVNQDIPSEGVWVRL  547



>ref|XP_010471675.1| PREDICTED: galactose oxidase-like isoform X1 [Camelina sativa]
Length=548

 Score =   109 bits (272),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 91/149 (61%), Gaps = 4/149 (3%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGP-FPTQLSIEAFSPEYLSADRANIRPVLVE-LPEK-VGYRQ  475
            DGRV++ GSNPH +Y + G  FPT+LS+EAFSP YL +  +++RPV+++ +P+  + Y Q
Sbjct  399  DGRVIVGGSNPHAYYNFTGVLFPTELSLEAFSPSYLESKYSSLRPVIMDPMPQTTINYGQ  458

Query  474  AFEAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGK-YRIGCTAP  298
                  TV+  V   V+V      F+THSFS  QRL+ L     +  G  + Y +    P
Sbjct  459  ILRLRFTVQGRVKTPVKVTMVYPSFNTHSFSMSQRLLVLDHVLFLRIGLSRIYEVSVRTP  518

Query  297  PNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
             +  +APPGYYMVF VNQ +PS   WV+L
Sbjct  519  SSVNLAPPGYYMVFVVNQDIPSEGVWVRL  547



>ref|XP_009360496.1| PREDICTED: LOW QUALITY PROTEIN: galactose oxidase [Pyrus x bretschneideri]
Length=579

 Score =   109 bits (272),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 61/150 (41%), Positives = 85/150 (57%), Gaps = 4/150 (3%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVEL---PEKVGYR  478
            PDGRVL+ GSNPH  Y ++  FPT LS+EAF P YL+   A++RP ++ +    + V Y 
Sbjct  429  PDGRVLVGGSNPHEMYSFKRAFPTDLSLEAFHPPYLAPLFASLRPSILTVETRDDTVSYG  488

Query  477  QAFEAA-ITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTA  301
            Q F    +  E      + V   +  F+THSF+  QR+V L V   +   T  Y+I    
Sbjct  489  QEFSVTFVLSEYRADPGITVALVTPSFTTHSFAMNQRMVVLDVARLVHLSTSAYKITAYG  548

Query  300  PPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            PP   VAPPGYY++F V+ G PS   WV++
Sbjct  549  PPKNTVAPPGYYLLFLVHAGTPSHGVWVRV  578



>gb|KJB38606.1| hypothetical protein B456_006G263000 [Gossypium raimondii]
Length=549

 Score =   108 bits (271),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 61/150 (41%), Positives = 83/150 (55%), Gaps = 5/150 (3%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGP-FPTQLSIEAFSPEYLSADRANIRPVLVELPEKVG--YRQ  475
            DGRVL+ GSNPH FY + G  FPT+LS+EAFSP YL A    +RP ++      G  YR+
Sbjct  399  DGRVLVGGSNPHAFYNFTGVLFPTELSLEAFSPAYLDAKFDKLRPTIIASKSMSGIRYRK  458

Query  474  AF--EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTA  301
             +  +  I         V V   +  F+THSFS  QRL+ L        G   Y +  T 
Sbjct  459  KYTIQVVINSNKVDESSVSVTMFAPAFNTHSFSMNQRLLVLGNEKVTAVGNSMYNVEATT  518

Query  300  PPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            P +  +AP G+Y++F V+QG+PS   WV+L
Sbjct  519  PKSGNLAPSGFYLLFVVHQGIPSQGIWVRL  548



>ref|XP_012071982.1| PREDICTED: galactose oxidase-like [Jatropha curcas]
 gb|KDP38596.1| hypothetical protein JCGZ_04521 [Jatropha curcas]
Length=550

 Score =   108 bits (271),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 83/149 (56%), Gaps = 4/149 (3%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGP-FPTQLSIEAFSPEYLSADRANIRPVLVE--LPEKVGYRQ  475
            DGRVL+ GSNPH +Y + G  FPT+LS+EAF P YL +   N+R  +V      K+GY Q
Sbjct  401  DGRVLVGGSNPHIYYNFTGVLFPTELSLEAFYPPYLDSQNNNLRLTIVSPASKAKIGYAQ  460

Query  474  AFEAAITvelpvvgvveVNFASAP-FSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAP  298
                   V   +          AP F+THSFS  QRL+ L        GT  Y +  TAP
Sbjct  461  KLLVRFKVAGRLDTNTVSVTMIAPSFTTHSFSMNQRLLVLENEKVTNVGTATYNVEVTAP  520

Query  297  PNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
             +  +APPGYY+++ V+Q +PS   WVQ+
Sbjct  521  RSPNIAPPGYYLLYVVHQDIPSEGIWVQI  549



>ref|XP_010428587.1| PREDICTED: galactose oxidase-like [Camelina sativa]
Length=548

 Score =   108 bits (271),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 65/149 (44%), Positives = 92/149 (62%), Gaps = 4/149 (3%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGP-FPTQLSIEAFSPEYLSADRANIRPVLVE-LPEK-VGYRQ  475
            DGRV++ GSNPH +Y + G  FPT+LS+EAFSP YL +  +++RPV+++ +P+  + Y Q
Sbjct  399  DGRVIVGGSNPHAYYNFTGVLFPTELSLEAFSPSYLESKYSSLRPVIMDPMPQTTINYGQ  458

Query  474  AFEAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLP-VTSAIPDGTGKYRIGCTAP  298
                  TV+  V   V+VN     F+THSFS  QRL+ L  V  +    +  Y +    P
Sbjct  459  ILRLRFTVQGRVKTPVKVNMVYPSFNTHSFSMNQRLLVLDHVLFSRIGFSSTYEVRVRTP  518

Query  297  PNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
             +  +APPGYYMVF VNQ +PS   WV+L
Sbjct  519  SSVNLAPPGYYMVFVVNQDIPSEGVWVRL  547



>gb|KJB59770.1| hypothetical protein B456_009G270800 [Gossypium raimondii]
Length=547

 Score =   108 bits (271),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 65/151 (43%), Positives = 84/151 (56%), Gaps = 8/151 (5%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGP-FPTQLSIEAFSPEYLSADRANIRPVLVELPE-----KVG  484
            DGRVL+ GSNPH FY   G  FPT+LS+EAFSP YL     NIRP +   P+     K G
Sbjct  398  DGRVLVGGSNPHAFYNLTGVLFPTELSLEAFSPAYLDTKFNNIRPTITA-PKSMSGIKYG  456

Query  483  YRQAFEAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCT  304
             +      IT ++    V     A A F+THSFS  QRL+ L     +  G   Y I  T
Sbjct  457  TKLTVRVVITGKVAKNQVSVTMVAPA-FNTHSFSMNQRLLVLGNDKVVALGKATYDIDVT  515

Query  303  APPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
             P +  +AP G+Y++F V+QG+PS   WV+L
Sbjct  516  TPRSGNLAPSGFYLLFVVHQGIPSKGIWVKL  546



>emb|CBI19807.3| unnamed protein product [Vitis vinifera]
Length=486

 Score =   108 bits (269),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 86/149 (58%), Gaps = 4/149 (3%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGP-FPTQLSIEAFSPEYLSADRANIRPVLVE--LPEKVGYRQ  475
            DGRVL+ GSNPH +YK+ G  +PT+L +EAFSPEYL +   N+RP ++      K+GY +
Sbjct  337  DGRVLVGGSNPHIYYKFTGVLYPTELRLEAFSPEYLDSGFKNLRPTIISPTSQAKIGYGK  396

Query  474  AFEAAITvelpvvgvveVNFASAP-FSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAP  298
                  +V   +          AP F+THS S  QRL+ L   +        + I  T P
Sbjct  397  DLTVRFSVTGTLDPDTVSVTMLAPSFTTHSLSMNQRLLVLGSGNVKNAEKSTFAIAVTTP  456

Query  297  PNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
             +A++AP GYY++F V+QG+PS   WVQ+
Sbjct  457  ASAILAPSGYYVLFVVHQGIPSEGIWVQI  485



>ref|XP_004237211.1| PREDICTED: galactose oxidase-like [Solanum lycopersicum]
Length=572

 Score =   108 bits (271),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 89/150 (59%), Gaps = 4/150 (3%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRG-PFPTQLSIEAFSPEYLSADRANIRPV--LVELPEKVGYR  478
            PDGR+L+ GSNPH  Y + G  +PT+LS+EAFSP YL+   A++RP+   +++ + + Y 
Sbjct  422  PDGRILVGGSNPHATYNFTGVKYPTELSLEAFSPPYLATQYAHLRPLNQAIDVGQVISYD  481

Query  477  QAFEAAITvelpv-vgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTA  301
            Q F    T+  P       V+     F+THSF   QRL+ L +          YR+   A
Sbjct  482  QQFSITFTLPFPQPDAEFMVSMIPPSFTTHSFGMNQRLLFLEIVRVERFFMFGYRVIVFA  541

Query  300  PPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            PP   VAPPGYYMVF V+QGVPS + WV++
Sbjct  542  PPTRNVAPPGYYMVFVVHQGVPSHSVWVKI  571



>ref|XP_006304793.1| hypothetical protein CARUB_v10012343mg [Capsella rubella]
 gb|EOA37691.1| hypothetical protein CARUB_v10012343mg [Capsella rubella]
Length=549

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 89/150 (59%), Gaps = 6/150 (4%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGP-FPTQLSIEAFSPEYLSADRANIRPVLVELPE---KVGYR  478
            DGRVL+ GSNPH FY++ G  FPT+L +EAFSP YL    A +RP  ++ P+   ++ Y 
Sbjct  400  DGRVLVGGSNPHAFYEFTGVLFPTELRLEAFSPAYLEPKFATLRPK-IQTPKSQSRIKYG  458

Query  477  QAFEAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDG-TGKYRIGCTA  301
               +   TV   V G V+V   S  F+THSFS  QRL+ L        G +  Y +    
Sbjct  459  TNLKLKFTVIGEVKGQVKVTMVSPSFTTHSFSMNQRLLVLDNVKFTRKGRSTTYEVQVRT  518

Query  300  PPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            P +A++APPGYYM+F VNQ +PS   WV+L
Sbjct  519  PKSAIIAPPGYYMMFVVNQNIPSEGVWVRL  548



>ref|XP_006833409.2| PREDICTED: galactose oxidase [Amborella trichopoda]
Length=530

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 63/151 (42%), Positives = 93/151 (62%), Gaps = 4/151 (3%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRP-VLVEL-PEKVGYRQ  475
            PDG+VL+AGSN +  Y Y   +PT+L  E FSP YL    A+ RP +L EL P+ + Y  
Sbjct  380  PDGKVLIAGSNTNPKYNYTSLYPTELRAEKFSPPYLDPSLASHRPNILTELMPKALAYGG  439

Query  474  AFEAAITvelpvvgvveVNFA--SAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTA  301
             F+  I++   +V   +++    + PF+THS+SQ QR++ L +        G Y+I   A
Sbjct  440  GFKIQISLSDQIVADTDLSVTMYAPPFTTHSYSQNQRMLVLRMNDVEQVAPGTYQISVVA  499

Query  300  PPNAMVAPPGYYMVFAVNQGVPSVARWVQLS  208
            PP+A+VAPPGYY++F V+ GVPS   WV ++
Sbjct  500  PPSAVVAPPGYYLLFVVHFGVPSEGVWVHIN  530



>ref|XP_002510488.1| Galactose oxidase precursor, putative [Ricinus communis]
 gb|EEF52675.1| Galactose oxidase precursor, putative [Ricinus communis]
Length=547

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/150 (41%), Positives = 82/150 (55%), Gaps = 5/150 (3%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGP--FPTQLSIEAFSPEYLSADRANIRPVLVELPEK--VGYR  478
            DGRVL+ GSNPH  Y +     FPT+L +EAFSP YL     N+RP ++    K  +GY 
Sbjct  397  DGRVLVGGSNPHINYNFSKDVFFPTELRLEAFSPAYLDTANNNLRPTIISPASKSRLGYA  456

Query  477  QAFEAAITvelpvvgvveVNFASAP-FSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTA  301
            Q       V   +          AP F+THSFS  QRL+ L        GTG Y +  TA
Sbjct  457  QKLAVRFKVTGRLTENTVSVTMVAPSFTTHSFSMNQRLLVLDNEKVTDVGTGTYDVQVTA  516

Query  300  PPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            P +  +APPG+Y++F V++ +PS   WVQ+
Sbjct  517  PRSTNLAPPGFYLLFVVHEDIPSEGIWVQV  546



>ref|XP_009388162.1| PREDICTED: galactose oxidase-like [Musa acuminata subsp. malaccensis]
Length=544

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 86/149 (58%), Gaps = 4/149 (3%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRG-PFPTQLSIEAFSPEYLSADRANIRPVLVELPE--KVGYRQ  475
            DGRVL+ GSNP+  Y + G  FPT+LS+EAFSP YLS   +  RP +V  P   ++ Y +
Sbjct  395  DGRVLVGGSNPNVNYNFSGVEFPTELSLEAFSPAYLSPAHSARRPRIVTSPSPLRLSYGK  454

Query  474  AFEAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDG-TGKYRIGCTAP  298
             F    T        V V   +  F+THSFS  QRL+ L   +A     +G Y++   AP
Sbjct  455  RFSLQFTAGAVGDEGVRVTMVAPSFATHSFSMNQRLLVLETEAAAKAADSGTYQVMAMAP  514

Query  297  PNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
             +A++AP GYYMVF VN GVPS + W  +
Sbjct  515  ASAILAPSGYYMVFVVNGGVPSESNWAHI  543



>ref|XP_007157402.1| hypothetical protein PHAVU_002G066900g [Phaseolus vulgaris]
 gb|ESW29396.1| hypothetical protein PHAVU_002G066900g [Phaseolus vulgaris]
Length=515

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 90/150 (60%), Gaps = 4/150 (3%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYR-GPFPTQLSIEAFSPEYLSADRANIRPVLVELP---EKVGY  481
            PDGRVL+ GSNPH  Y +R  P+PT+LS++A+ PEYL     ++RP +V +        Y
Sbjct  365  PDGRVLVGGSNPHRVYDFRANPYPTELSLDAYYPEYLGIQFDSLRPSIVAVEAVNNTASY  424

Query  480  RQAFEAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTA  301
             + F   I++    VG + V   +  F+THSF+  QRL+ L V +     T  YR+    
Sbjct  425  GRVFAVNISLWDYRVGGLGVTLVAPSFTTHSFAMNQRLLLLQVLAVQQVATSGYRVVARG  484

Query  300  PPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            PP+  VAPPG+YM+F V+ GVPS A WVQ+
Sbjct  485  PPSQAVAPPGFYMLFVVHAGVPSTAVWVQV  514



>emb|CDY62590.1| BnaA08g31280D [Brassica napus]
Length=547

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 65/148 (44%), Positives = 85/148 (57%), Gaps = 3/148 (2%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGP-FPTQLSIEAFSPEYLSADRANIRPVLV--ELPEKVGYRQ  475
            DGRVL+ GSNPH FY + G  FPT+LS+EAFSP YL  + A +RP +V  +    + YR+
Sbjct  399  DGRVLVGGSNPHGFYNFTGVLFPTELSLEAFSPVYLEPEFAKLRPKIVSPKSQTTITYRK  458

Query  474  AFEAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPP  295
              +    V   V G V+V      F+THSFS  QRL+ L         +  Y +    P 
Sbjct  459  TMKLKFKVVGEVKGPVKVTMVFPSFTTHSFSMNQRLLVLDNVKFKRSKSTNYEVQVRTPR  518

Query  294  NAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            +A VAPPGYYM+F VN  +PS   WV+L
Sbjct  519  SAFVAPPGYYMMFVVNDNIPSEGIWVRL  546



>gb|KJB38605.1| hypothetical protein B456_006G262900 [Gossypium raimondii]
Length=548

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/150 (41%), Positives = 84/150 (56%), Gaps = 5/150 (3%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGP-FPTQLSIEAFSPEYLSADRANIRPVLVELPEKVG--YRQ  475
            DGRVL+ GSNPH FY + G  FPT+LS+EAFSP YL A    +RP ++      G  YR+
Sbjct  398  DGRVLVGGSNPHAFYNFTGVLFPTELSLEAFSPAYLDAKFDKMRPTIIAPKSMSGIRYRK  457

Query  474  AF--EAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTA  301
             +  +  I  +      V V   +  F+THSFS  QRL+ L        G   Y I  T 
Sbjct  458  KYTIQVVINSDKVDESSVSVTMFAPAFNTHSFSMNQRLLVLGNEKVTAVGNSIYNIEATT  517

Query  300  PPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            P +  +AP G+Y++F V+QG+PS   WV+L
Sbjct  518  PKSGNLAPSGFYLLFVVHQGIPSQGIWVRL  547



>ref|XP_006838081.2| PREDICTED: galactose oxidase [Amborella trichopoda]
Length=527

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 64/153 (42%), Positives = 90/153 (59%), Gaps = 5/153 (3%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGP-FPTQLSIEAFSPEYLSADRANIRPVLV---ELPEKVGY  481
            PDGR+L+ GSNPH +Y + G  FPT+L +E+FSP YLS   + +RP ++     P  + +
Sbjct  375  PDGRILVGGSNPHVYYNFSGVLFPTELRLESFSPPYLSPQFSRLRPNIIFPASNPATIRF  434

Query  480  RQAFEAAITvelpvvgvveVNFASAP-FSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCT  304
             Q F+   +VE  V          AP F+THSFS  QRL+ L  T         Y+    
Sbjct  435  GQQFQVRFSVESMVGAEGITVTMVAPSFTTHSFSMNQRLLVLQNTMLTVLSPNVYQANTV  494

Query  303  APPNAMVAPPGYYMVFAVNQGVPSVARWVQLSA  205
            AP + ++APPGYY++F V+QGVPS A W ++SA
Sbjct  495  APQSPLLAPPGYYLIFVVHQGVPSSAIWSRISA  527



>ref|XP_009603236.1| PREDICTED: galactose oxidase-like [Nicotiana tomentosiformis]
Length=564

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 89/151 (59%), Gaps = 7/151 (5%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGP-FPTQLSIEAFSPEYLSADRANIRPVLVELPE--KVGYRQ  475
            DGRVL+ GSNP+  Y + G  FPT LS+EAFSP YL  + AN+RP ++      K  Y Q
Sbjct  414  DGRVLVGGSNPNELYNFTGVLFPTDLSLEAFSPSYLDPESANLRPRIISPASHLKFTYGQ  473

Query  474  AFEAAITvelpvvgvveVNFASAP-FSTHSFSQGQRLVKLPVTSAIPDGTGK--YRIGCT  304
              +   T    +   +      AP F+THSF+  QR++ LP  S I    G+  Y+I C 
Sbjct  474  RVDIRFTASRLLNRDLVKVTMVAPGFNTHSFTMNQRMLVLP-RSGIVRQVGRFVYQISCV  532

Query  303  APPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
             P +A+ APPGYY++F V+Q +PS A WV++
Sbjct  533  FPKSAIFAPPGYYLLFVVHQDIPSEAIWVRI  563



>gb|ERN00650.1| hypothetical protein AMTR_s00225p00021580 [Amborella trichopoda]
Length=546

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/153 (42%), Positives = 90/153 (59%), Gaps = 5/153 (3%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGP-FPTQLSIEAFSPEYLSADRANIRPVLV---ELPEKVGY  481
            PDGR+L+ GSNPH +Y + G  FPT+L +E+FSP YLS   + +RP ++     P  + +
Sbjct  394  PDGRILVGGSNPHVYYNFSGVLFPTELRLESFSPPYLSPQFSRLRPNIIFPASNPATIRF  453

Query  480  RQAFEAAITvelpvvgvveVNFASAP-FSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCT  304
             Q F+   +VE  V          AP F+THSFS  QRL+ L  T         Y+    
Sbjct  454  GQQFQVRFSVESMVGAEGITVTMVAPSFTTHSFSMNQRLLVLQNTMLTVLSPNVYQANTV  513

Query  303  APPNAMVAPPGYYMVFAVNQGVPSVARWVQLSA  205
            AP + ++APPGYY++F V+QGVPS A W ++SA
Sbjct  514  APQSPLLAPPGYYLIFVVHQGVPSSAIWSRISA  546



>ref|XP_010674901.1| PREDICTED: galactose oxidase [Beta vulgaris subsp. vulgaris]
Length=549

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/147 (39%), Positives = 86/147 (59%), Gaps = 2/147 (1%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRG-PFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            DGR+L+ GSNPH +Y +    +PT LS+EA+SP YL+ + A +RP ++   + VGY Q F
Sbjct  402  DGRILVGGSNPHIYYNFTNVEYPTDLSLEAYSPPYLAIEYAPMRPNIIYGDQVVGYEQPF  461

Query  468  EAAITvel-pvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPN  292
                 V+      VV VN  +  F+THS +  QR+V L ++       G + +G   P  
Sbjct  462  TVTFNVQQYQADEVVSVNLVAPSFTTHSLAMNQRMVVLRISKISQLSLGMFNVGLMGPTT  521

Query  291  AMVAPPGYYMVFAVNQGVPSVARWVQL  211
              +APPGYY++F V+ G+PS   WV++
Sbjct  522  TNIAPPGYYLLFVVHAGIPSSGLWVKI  548



>emb|CDX83737.1| BnaC08g19080D [Brassica napus]
Length=223

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 84/148 (57%), Gaps = 3/148 (2%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGP-FPTQLSIEAFSPEYLSADRANIRPVLV--ELPEKVGYRQ  475
            DG+VL+ GSNPH FY + G  FPT+LS+EAFSP YL  + A +RP +V  +    + YR+
Sbjct  75   DGKVLVGGSNPHGFYNFTGVLFPTELSLEAFSPVYLEPEFAKLRPKIVSPKSQTTITYRK  134

Query  474  AFEAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPP  295
              +    V   V G V+V      F+THSFS  QRL+ L         +  Y +    P 
Sbjct  135  TMKLKFKVVGEVKGPVKVTMVFPSFTTHSFSMNQRLLVLDNVKFKRSKSTNYEVQVRTPR  194

Query  294  NAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            +A +AP GYYM+F VN  +PS   WV+L
Sbjct  195  SAFIAPSGYYMMFVVNDNIPSEGIWVRL  222



>gb|ERM98687.1| hypothetical protein AMTR_s00109p00131490 [Amborella trichopoda]
Length=603

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/151 (42%), Positives = 93/151 (62%), Gaps = 4/151 (3%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRP-VLVEL-PEKVGYRQ  475
            PDG+VL+AGSN +  Y Y   +PT+L  E FSP YL    A+ RP +L EL P+ + Y  
Sbjct  453  PDGKVLIAGSNTNPKYNYTSLYPTELRAEKFSPPYLDPSLASHRPNILTELMPKALAYGG  512

Query  474  AFEAAITvelpvvgvveVNFA--SAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTA  301
             F+  I++   +V   +++    + PF+THS+SQ QR++ L +        G Y+I   A
Sbjct  513  GFKIQISLSDQIVADTDLSVTMYAPPFTTHSYSQNQRMLVLRMNDVEQVAPGTYQISVVA  572

Query  300  PPNAMVAPPGYYMVFAVNQGVPSVARWVQLS  208
            PP+A+VAPPGYY++F V+ GVPS   WV ++
Sbjct  573  PPSAVVAPPGYYLLFVVHFGVPSEGVWVHIN  603



>ref|XP_006577272.1| PREDICTED: galactose oxidase-like [Glycine max]
Length=550

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 84/149 (56%), Gaps = 4/149 (3%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRG-PFPTQLSIEAFSPEYLSADRANIRPVLVELPEK--VGYRQ  475
            DGRVL+ GSNPH FY + G  +PT LS+EAFSP YL+ D A +RPV+  +     +GYR 
Sbjct  401  DGRVLVGGSNPHVFYNFTGVEYPTDLSLEAFSPPYLAPDFAPVRPVIRYITNNNVLGYRV  460

Query  474  AFEAAITvelpvvgvveVNFASAP-FSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAP  298
                  TV              AP F+THSF Q QR+V L +++        Y      P
Sbjct  461  FCYVTFTVPNYASVSEVSIRIVAPSFTTHSFGQNQRMVVLKLSAVTYLAGEAYYATVMGP  520

Query  297  PNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
              A +APPGYY++F V++GVPS   WVQ+
Sbjct  521  STAEIAPPGYYLLFVVHKGVPSWGSWVQV  549



>ref|XP_004243010.2| PREDICTED: galactose oxidase [Solanum lycopersicum]
Length=527

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 85/147 (58%), Gaps = 2/147 (1%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRG-PFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            DGRVL+ GSNP  +Y + G  FPT LS+EAFSP YL+   ++++P ++ + E + Y+ +F
Sbjct  377  DGRVLVGGSNPQEYYNFTGVEFPTDLSLEAFSPPYLARKHSHLKPTVLSIDEILTYKSSF  436

Query  468  EAAITvelpvvgvveVNFASAP-FSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPN  292
             A  TV   +          AP F+THSFS  QR+V L     +      Y+    AP  
Sbjct  437  SATFTVPTFLRIGTVSIRIIAPSFTTHSFSMNQRMVVLKGVVVVAISDNSYKFTAFAPST  496

Query  291  AMVAPPGYYMVFAVNQGVPSVARWVQL  211
              +APPGYYM+F V+ G+PS   WV++
Sbjct  497  KEIAPPGYYMLFVVHAGIPSSGVWVKI  523



>ref|XP_006301879.1| hypothetical protein CARUB_v10022352mg [Capsella rubella]
 gb|EOA34777.1| hypothetical protein CARUB_v10022352mg [Capsella rubella]
Length=763

 Score =   108 bits (271),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 57/148 (39%), Positives = 85/148 (57%), Gaps = 2/148 (1%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            PDG+VL+ GSN +  Y+Y   +PT+L +E FSP YL    AN+RP ++  P+++ Y + F
Sbjct  615  PDGKVLIGGSNTNDGYQYNVEYPTELRVEKFSPPYLDPALANMRPRIITAPKQIKYGKPF  674

Query  468  EAAI--TvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPP  295
            +  I    +      V +   +  F+THS S   RL+ L + +    G   ++I   APP
Sbjct  675  DVRIELKQQNVAKENVMLTMLAPAFTTHSVSMNMRLLMLGIMNVKNVGGDNHQIQAVAPP  734

Query  294  NAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            +  VAPPGYY+  AV  GVPSV  W+Q+
Sbjct  735  SGNVAPPGYYIFSAVYNGVPSVGEWIQI  762



>ref|XP_003527766.1| PREDICTED: galactose oxidase-like [Glycine max]
Length=558

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/150 (41%), Positives = 86/150 (57%), Gaps = 5/150 (3%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGP-FPTQLSIEAFSPEYLSADRANIRPVLV----ELPEKVGY  481
            DGRVL+AGSNPH +YK+    FPT+L +EAFSP YL    +++RP +V    +   K G 
Sbjct  408  DGRVLVAGSNPHIYYKFTNVLFPTELRLEAFSPWYLEPGFSSVRPTIVFPASQTKLKYGQ  467

Query  480  RQAFEAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTA  301
                   +     V   V V   S PF+THSFS  QR++ L        G   Y +  TA
Sbjct  468  TLRLRFEVMSATLVGDSVSVTMLSPPFNTHSFSMNQRMLVLEPHDLSKVGESTYEVEVTA  527

Query  300  PPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            P +A++APPG+Y++F V+Q +PS   WVQ+
Sbjct  528  PVSAVLAPPGFYLLFLVHQEIPSQGIWVQM  557



>ref|XP_010462699.1| PREDICTED: galactose oxidase-like [Camelina sativa]
Length=191

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 84/150 (56%), Gaps = 5/150 (3%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRG-PFPTQLSIEAFSPEYLSADRANIRPVL--VELPEKVGYRQ  475
            DGRVL+ GSNPH  Y +   P+PT+LS+EA+ P YL      +RP +  VEL   + Y Q
Sbjct  42   DGRVLVGGSNPHRNYNFTARPYPTELSLEAYLPRYLDPQYVRVRPTIITVELAGNMLYGQ  101

Query  474  AFEA--AITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTA  301
             F    AI       G V V   +  FSTHS +  QR++ L V          Y+     
Sbjct  102  GFAVTFAIPAFGMFDGGVSVRLVAPSFSTHSTAMNQRMLVLRVRRVSQLSVFAYKADVEG  161

Query  300  PPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            P N+ VAPPGYYM+F V++G+PSVA WV++
Sbjct  162  PTNSYVAPPGYYMMFVVHRGIPSVAVWVKI  191



>ref|XP_011073112.1| PREDICTED: galactose oxidase [Sesamum indicum]
Length=549

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 84/147 (57%), Gaps = 2/147 (1%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRG-PFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            DGR+L+ GSNPH +Y + G  +PT LS+E+FSP YLS     +RP ++   E + Y+ AF
Sbjct  402  DGRILVGGSNPHKYYNFTGVDYPTDLSLESFSPPYLSPVYDRLRPRIIRTYEIIRYKNAF  461

Query  468  EAAITvelpvvgvveVNFASAP-FSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPPN  292
                TV+  V          AP F+THSFS  QR+V L        G   YR+  + P  
Sbjct  462  SLTFTVQRFVKTSAVSVRIVAPSFNTHSFSMNQRMVVLKGARVSRVGPNVYRVAASGPSK  521

Query  291  AMVAPPGYYMVFAVNQGVPSVARWVQL  211
              +APPGYY++F ++ G+PS   WV++
Sbjct  522  PEIAPPGYYLLFLLHAGIPSSGMWVKI  548



>ref|XP_002280559.1| PREDICTED: galactose oxidase [Vitis vinifera]
Length=553

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 86/149 (58%), Gaps = 4/149 (3%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGP-FPTQLSIEAFSPEYLSADRANIRPVLVE--LPEKVGYRQ  475
            DGRVL+ GSNPH +YK+ G  +PT+L +EAFSPEYL +   N+RP ++      K+GY +
Sbjct  404  DGRVLVGGSNPHIYYKFTGVLYPTELRLEAFSPEYLDSGFKNLRPTIISPTSQAKIGYGK  463

Query  474  AFEAAITvelpvvgvveVNFASAP-FSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAP  298
                  +V   +          AP F+THS S  QRL+ L   +        + I  T P
Sbjct  464  DLTVRFSVTGTLDPDTVSVTMLAPSFTTHSLSMNQRLLVLGSGNVKNAEKSTFAIAVTTP  523

Query  297  PNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
             +A++AP GYY++F V+QG+PS   WVQ+
Sbjct  524  ASAILAPSGYYVLFVVHQGIPSEGIWVQI  552



>ref|XP_010100623.1| hypothetical protein L484_011554 [Morus notabilis]
 gb|EXB83260.1| hypothetical protein L484_011554 [Morus notabilis]
Length=505

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/148 (43%), Positives = 82/148 (55%), Gaps = 2/148 (1%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRG-PFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQA  472
            PDG+VL+ GSNPH FY + G  +PT+LS+EAFSP YLSA+   +RP ++      GY Q 
Sbjct  357  PDGQVLVGGSNPHVFYNFTGVEYPTELSLEAFSPPYLSAENGLVRPKILAATGVFGYGQF  416

Query  471  FEAAITvelpvvgvveVNFASAP-FSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPP  295
            F    TV L            AP F+THSF   QR+V + V +        Y      P 
Sbjct  417  FSVVFTVPLYNGADAVSFRLIAPSFTTHSFGMSQRMVVMKVGTVSQVARFAYNATVIGPW  476

Query  294  NAMVAPPGYYMVFAVNQGVPSVARWVQL  211
             A +APPGYYM+F V+  +PS   WV+L
Sbjct  477  TAEIAPPGYYMLFVVHCEIPSFGAWVKL  504



>ref|XP_010535983.1| PREDICTED: galactose oxidase-like [Tarenaya hassleriana]
Length=588

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 66/151 (44%), Positives = 89/151 (59%), Gaps = 5/151 (3%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVE--LPEKVGYRQ  475
            PDG+VL+AGSN +  YKY   +PT+L +E FSP YL    AN RP +V    P+K+ Y Q
Sbjct  437  PDGKVLVAGSNTNNGYKYNVEYPTELRVEKFSPPYLDPALANQRPKIVAGGNPKKIKYGQ  496

Query  474  AFEAAITvelpvvgvveVNFAS-AP-FSTHSFSQGQRLVKLPVTSAIPD-GTGKYRIGCT  304
             F   I +  P     +V     AP F+THS S   R++ L ++    + G   + I   
Sbjct  497  KFTVKIQLNQPKFWRNDVKLTMLAPSFTTHSISMNMRMLLLGISGVTNNVGPNFHDIQAM  556

Query  303  APPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            APPN  VAPPGYY++FAV +GVPSV  W+Q+
Sbjct  557  APPNGNVAPPGYYLLFAVYKGVPSVGEWIQI  587



>ref|XP_010061025.1| PREDICTED: galactose oxidase-like [Eucalyptus grandis]
Length=565

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 85/149 (57%), Gaps = 4/149 (3%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGP-FPTQLSIEAFSPEYLSADRANIRPVLV--ELPEKVGYRQ  475
            DGRVL+ GSNPH FY + G  FPT+L +EAF P YL  + +  RP ++      K+GY Q
Sbjct  416  DGRVLVGGSNPHIFYNFTGVIFPTELRLEAFRPPYLDPEHSGSRPRIIYPTSQAKIGYSQ  475

Query  474  AFEAAITve-lpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAP  298
             F    TV     +  V V   + PF+THSFS  QRL+ +   + +  G   Y     AP
Sbjct  476  KFSVRFTVTGNVSLDAVAVTMVAPPFNTHSFSMNQRLLVIGSGTVVKVGNSAYAAQAVAP  535

Query  297  PNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
             +  +AP GYY++F V+QG+PS   WVQ+
Sbjct  536  GSHNLAPAGYYLLFVVHQGIPSEGIWVQI  564



>ref|XP_009797022.1| PREDICTED: galactose oxidase-like [Nicotiana sylvestris]
Length=551

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 61/150 (41%), Positives = 87/150 (58%), Gaps = 5/150 (3%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGP-FPTQLSIEAFSPEYLSADRANIRPVLVELPE--KVGYRQ  475
            DGRVL+ GSNP+  Y + G  FPT LS+EAFSP YL  + AN+RP ++      K  Y Q
Sbjct  401  DGRVLVGGSNPNELYNFTGVLFPTDLSLEAFSPSYLDQESANLRPRIISPASHLKYTYGQ  460

Query  474  AFEAAITvelpvvgvveVNFASAP-FSTHSFSQGQRLVKLPVTSAIPD-GTGKYRIGCTA  301
              +   T    +   +      AP F+THSF+  QR++ LP +  +   G   Y+I C  
Sbjct  461  RVDIRFTASGLLNTDLVKVTMVAPGFNTHSFTMNQRMLVLPRSGMVRQVGRFVYQISCVF  520

Query  300  PPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            P + + APPGYY++F V+Q +PS A WV++
Sbjct  521  PKSGIFAPPGYYLLFVVHQDIPSEAIWVRI  550



>ref|XP_007046239.1| Glyoxal oxidase-related protein, putative [Theobroma cacao]
 gb|EOY02071.1| Glyoxal oxidase-related protein, putative [Theobroma cacao]
Length=557

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 86/148 (58%), Gaps = 2/148 (1%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELP--EKVGYRQ  475
            PDGR+L+ GSNPH  Y + GP+PT LS+EA++P Y+     ++RP ++ L     + Y Q
Sbjct  409  PDGRILVGGSNPHTRYVFTGPYPTDLSLEAYNPYYMDPKFNSLRPSVLSLEPGNALVYGQ  468

Query  474  AFEAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPP  295
             F  + ++ L   G   V   +  F+THS    QR+V L   S +      +++    P 
Sbjct  469  RFGVSFSLPLYKQGAAYVALVAPSFTTHSIGMNQRVVILSTASVVQLSMFNHKLVVVGPT  528

Query  294  NAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            NA VAPPGYYM+F V+ G+PS A WV++
Sbjct  529  NASVAPPGYYMLFVVHSGIPSHAVWVKV  556



>ref|XP_009766667.1| PREDICTED: uncharacterized protein LOC104217988 [Nicotiana sylvestris]
Length=624

 Score =   107 bits (268),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 91/150 (61%), Gaps = 8/150 (5%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVE--LPEKVGYRQ  475
            PDG++L+AGSN H  Y Y+  +PT+L +E FSP YL+ +    RP ++E    +++ Y Q
Sbjct  479  PDGKILVAGSNTHALYDYQAKYPTELRVEKFSPPYLAPELDQQRPQILENGANKEMRYGQ  538

Query  474  AFEAAITvelpvvgvv-eVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAP  298
             F   I ++  V     +V   + PF+TH +SQGQRL+ L + SA        ++   AP
Sbjct  539  EFSVNIKLDEVVDETDIKVTMYAPPFTTHGYSQGQRLLILQLKSAT-----NQQVAVVAP  593

Query  297  PNAMVAPPGYYMVFAVNQGVPSVARWVQLS  208
            P+  +APPGYY++F V++GVPS   WV++ 
Sbjct  594  PSGKLAPPGYYLLFVVHRGVPSHGMWVRID  623



>ref|XP_002324431.2| hypothetical protein POPTR_0018s09110g [Populus trichocarpa]
 gb|EEF02996.2| hypothetical protein POPTR_0018s09110g [Populus trichocarpa]
Length=608

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 62/153 (41%), Positives = 88/153 (58%), Gaps = 6/153 (4%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLV--ELPEKVGYRQ  475
            PDG++L+AGSN +  Y Y   FPT+L +E F P YL       RPV++  + P ++GY  
Sbjct  456  PDGKILVAGSNTNNGYVYNAMFPTELRVEKFLPPYLDPSVIGRRPVIIADKAPNQIGYNN  515

Query  474  AFEAAITvelpvvgvveVNFAS-AP-FSTHSFSQGQRLVKLPVTSAIPDGT--GKYRIGC  307
             F+  I  +   V   ++     AP F+TH  S  QRL+ L +   I +    G + I  
Sbjct  516  LFKLYIKSKALKVEKKDIQVTMYAPAFTTHGVSMNQRLLDLGLEDVITENAFLGIHAITA  575

Query  306  TAPPNAMVAPPGYYMVFAVNQGVPSVARWVQLS  208
             +PP+  VAPPGYYM+F V+QGVPSV+ WVQ+ 
Sbjct  576  VSPPSGRVAPPGYYMLFVVHQGVPSVSSWVQIK  608



>ref|XP_011048365.1| PREDICTED: galactose oxidase [Populus euphratica]
Length=606

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 89/153 (58%), Gaps = 6/153 (4%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLV--ELPEKVGYRQ  475
            PDG++L+AGSN +  Y Y   FPT+L +E F P YL       RPV++  + P+++G+  
Sbjct  454  PDGKILVAGSNTNNGYVYNAMFPTELRVEKFLPPYLDPSVIGRRPVIIADKAPKQIGFNN  513

Query  474  AFEAAITvelpvvgvveVNFAS-AP-FSTHSFSQGQRLVKLPVTSAIPDGT--GKYRIGC  307
             F+  I  +   V   ++     AP F+TH  S  QRL+ L +   I +    G + I  
Sbjct  514  LFKLLIKSKALKVEKKDIKVTMYAPAFTTHGVSMNQRLLDLGLEDVITENAFLGIHTITA  573

Query  306  TAPPNAMVAPPGYYMVFAVNQGVPSVARWVQLS  208
             +PP+  VAPPGYYM+F V+QGVPSV+ WVQ+ 
Sbjct  574  VSPPSGKVAPPGYYMLFVVHQGVPSVSSWVQIK  606



>ref|XP_006389311.1| glyoxal oxidase-related family protein [Populus trichocarpa]
 gb|ERP48225.1| glyoxal oxidase-related family protein [Populus trichocarpa]
Length=551

 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 88/148 (59%), Gaps = 3/148 (2%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGPF-PTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            DGRVL+ G NPH +Y +   F PT LS+E FSP YLS   A+IRPV++ + + V   Q F
Sbjct  403  DGRVLVGGGNPHIYYNFSDVFYPTDLSLETFSPPYLSTQYASIRPVILSVDDTVSPGQRF  462

Query  468  EAAITvelpvvgvveVNFASAP-FSTHSFSQGQRLVKLPVTSAIPDGTGK-YRIGCTAPP  295
              + +V   + G V      AP F+THS+S  QR+V L +   I + T   Y +    P 
Sbjct  463  LLSFSVGEYIAGSVLSVRIVAPSFTTHSYSMNQRMVVLRIDEIIDNETSSSYTLSVVGPS  522

Query  294  NAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            +A +APPGYY+++ V+ G+PS   WV+L
Sbjct  523  SAEIAPPGYYLLYVVHSGIPSSGVWVRL  550



>ref|XP_008387971.1| PREDICTED: galactose oxidase-like [Malus domestica]
Length=533

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 62/150 (41%), Positives = 89/150 (59%), Gaps = 6/150 (4%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGP-FPTQLSIEAFSPEYLSADRANIRPVLVELPE---KVGYR  478
            DGRVL+ GSNPH  Y++    FPT+L +EAFSP+YL A   N+RP  +  P+   K+ Y 
Sbjct  384  DGRVLVGGSNPHDKYEFTNVLFPTELRLEAFSPDYLDAKYNNLRPK-INAPKSQAKINYG  442

Query  477  QAFEAAITvelpvvgvveVNFASAP-FSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTA  301
            +      +V+  +V        +AP F+THSFS  QRL+ L   + I  GT  Y +  T 
Sbjct  443  KKLSIQFSVKGNLVTKSVSVSMAAPSFNTHSFSMNQRLLVLEAENIIKGGTTTYEVQVTT  502

Query  300  PPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            P +  +AP GYY+++ V+Q +PS A WVQ+
Sbjct  503  PASRNLAPSGYYLLYVVHQEIPSAAIWVQI  532



>ref|XP_004238618.1| PREDICTED: galactose oxidase-like [Solanum lycopersicum]
Length=553

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 88/149 (59%), Gaps = 4/149 (3%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGP-FPTQLSIEAFSPEYLSADRANIRPVLVE--LPEKVGYR-  478
            DGRVL+ GSNPH  Y + G  +PT+LS+EAFSP YL +D AN+RP ++      KV Y  
Sbjct  405  DGRVLVGGSNPHGLYNFTGVLYPTELSLEAFSPSYLDSDSANLRPQIISPASRRKVKYGG  464

Query  477  QAFEAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAP  298
            Q     I        +V+V   +  F+THSF+  QR++ L   +    GT  Y+I    P
Sbjct  465  QVNIRFIVPGPINRNLVKVTMVAPGFNTHSFTMNQRILVLSSGNVTQVGTSTYKINSIFP  524

Query  297  PNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
             ++ +APPGYYM+F V+Q +PS   W+++
Sbjct  525  NSSKLAPPGYYMLFVVHQDIPSEGIWIRI  553



>gb|KHN04050.1| Galactose oxidase [Glycine soja]
Length=507

 Score =   106 bits (265),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 84/149 (56%), Gaps = 4/149 (3%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRG-PFPTQLSIEAFSPEYLSADRANIRPVLVELPEK--VGYRQ  475
            DGRVL+ GSNPH +Y + G  +PT LS+EAFSP YL+ D A +RPV+  +     +GYR 
Sbjct  358  DGRVLVGGSNPHVYYNFTGVEYPTDLSLEAFSPPYLAPDFAPVRPVIRYITNNNVLGYRV  417

Query  474  AFEAAITvelpvvgvveVNFASAP-FSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAP  298
                  TV              AP F+THSF Q QR+V L +++        Y      P
Sbjct  418  FCYVTFTVPNYASVSEVSIRIVAPSFTTHSFGQNQRMVVLKLSAVTYLAGEAYYATVMGP  477

Query  297  PNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
              A +APPGYY++F V++GVPS   WVQ+
Sbjct  478  STAEIAPPGYYLLFVVHKGVPSWGSWVQV  506



>ref|NP_177692.1| glyoxal oxidase-related protein [Arabidopsis thaliana]
 gb|AAF87115.1|AC006434_11 F10A5.18 [Arabidopsis thaliana]
 gb|AEE35738.1| glyoxal oxidase-related protein [Arabidopsis thaliana]
Length=547

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 65/149 (44%), Positives = 87/149 (58%), Gaps = 4/149 (3%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGP-FPTQLSIEAFSPEYLSADRANIRPVLVE-LPEK-VGYRQ  475
            DGR+L+ GSNPH FY + G  FPT+L +EAFSP YL    +++RP +V+  P+  V Y +
Sbjct  398  DGRILVGGSNPHAFYNFTGVLFPTELRLEAFSPSYLDTKYSSLRPSIVDPRPQTTVNYGR  457

Query  474  AFEAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGK-YRIGCTAP  298
                   V   V   V+V      F+THSFS  QRL+ L    +   G  K Y +    P
Sbjct  458  VLRLRFIVSGRVKSPVKVTMLFPSFTTHSFSMHQRLLVLDHVISFKLGISKIYEVRVRTP  517

Query  297  PNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
             +A++APPGYYMVF VNQ +PS   WV+L
Sbjct  518  SSAILAPPGYYMVFVVNQDIPSEGLWVRL  546



>ref|XP_011003791.1| PREDICTED: galactose oxidase-like [Populus euphratica]
Length=551

 Score =   106 bits (265),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 88/148 (59%), Gaps = 3/148 (2%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGPF-PTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQAF  469
            DGRVL+ G NPH +Y +   F PT LS+E FSP YLS   A+IRPV++ + + V   Q F
Sbjct  403  DGRVLVGGGNPHIYYNFSDVFYPTDLSLETFSPPYLSTQYASIRPVILSVDDTVSPGQRF  462

Query  468  EAAITvelpvvgvveVNFASAP-FSTHSFSQGQRLVKLPVTSAIPDGTGK-YRIGCTAPP  295
              + +V   + G V      AP F+THS+S  QR+V L +   I + T   Y +    P 
Sbjct  463  LLSFSVGEYIAGSVLSVRIVAPSFTTHSYSMNQRMVVLRIDGIIHNETSSSYTLSVVGPS  522

Query  294  NAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            +A +APPGYY+++ V+ G+PS   WV+L
Sbjct  523  SAEIAPPGYYLLYVVHSGIPSSGVWVRL  550



>gb|KCW65018.1| hypothetical protein EUGRSUZ_G02553 [Eucalyptus grandis]
Length=575

 Score =   106 bits (265),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 62/150 (41%), Positives = 84/150 (56%), Gaps = 5/150 (3%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRG-PFPTQLSIEAFSPEYLSADRANIRPVLVELP---EKVGY  481
            PDGRVL+ GSNPH  Y +   P+PT LS+EAF P YLS   A +RP ++ L    + V Y
Sbjct  384  PDGRVLVGGSNPHSKYNFTAYPYPTDLSLEAFYPPYLSPQFAILRPSILSLEAVEQTVSY  443

Query  480  RQAFEAA-ITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCT  304
             + F    I         + V   + PF+THSF+  QR + L V   +   +  Y I   
Sbjct  444  SEQFSVNFIVTMFGPSREISVGLLAPPFTTHSFAMNQRFLWLDVLGVVRLSSFAYSITVA  503

Query  303  APPNAMVAPPGYYMVFAVNQGVPSVARWVQ  214
            APP+A VAPPGYYM+F V+  +PS   W++
Sbjct  504  APPSATVAPPGYYMLFVVHSDIPSRGVWLR  533



>gb|KDP33711.1| hypothetical protein JCGZ_07282 [Jatropha curcas]
Length=624

 Score =   107 bits (266),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 86/148 (58%), Gaps = 3/148 (2%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQ--  475
            PDG+VL+AGSN +  Y Y   +PT+L +E +SP YL+A     RP +V   EK+ Y Q  
Sbjct  477  PDGKVLIAGSNTNNGYIYDAMYPTELRVEKYSPPYLNAAVIQKRPEIVTFNEKMTYAQNI  536

Query  474  AFEAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPP  295
              E  I       G V+V   S  F+TH  +  QRL++L +   +P   G +++G  +P 
Sbjct  537  DIEVKIAGGKVEQGDVKVTMYSPAFTTHGINMNQRLIQLGLREVVP-ANGNFKVGAISPI  595

Query  294  NAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            +  VAP GYYM+  V QGVPS+ +WVQ+
Sbjct  596  SNKVAPVGYYMLSVVFQGVPSITKWVQI  623



>gb|KEH36231.1| glyoxal oxidase amino-terminal protein [Medicago truncatula]
Length=555

 Score =   106 bits (265),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 62/154 (40%), Positives = 90/154 (58%), Gaps = 9/154 (6%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLV----ELPEKVGYR  478
            DGRVL+AGSNPH  Y +   FPT+L +EAFSP YL     ++RP++V    +   K+ Y 
Sbjct  401  DGRVLVAGSNPHVNYNFTRLFPTELRLEAFSPSYLELGFNDVRPIMVFPAPQSQTKLKYA  460

Query  477  QAFEAAITvelpvvgvveVNFASAP-FSTHSFSQGQRLVKLPVTSA----IPDGTGKYRI  313
            Q  +    V+  ++  +      AP F+THSFS  QRL+ L   S+    + + T  Y++
Sbjct  461  QKLKVRFQVKATLMKNMVSVTMYAPSFNTHSFSMNQRLLVLDELSSSKNVVGESTSTYQV  520

Query  312  GCTAPPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
                P + ++APPGYY++F V+Q VPS   WVQL
Sbjct  521  EVAIPNSPILAPPGYYLLFVVHQEVPSQGVWVQL  554



>ref|XP_012076744.1| PREDICTED: galactose oxidase-like [Jatropha curcas]
Length=600

 Score =   106 bits (265),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 85/148 (57%), Gaps = 3/148 (2%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQ--  475
            PDG++L+AGSN +  Y Y   +PT+L +E +SP YL+A     RP +V   E++ Y Q  
Sbjct  453  PDGKILVAGSNTNNGYIYDAMYPTELRVEKYSPPYLNAAVIQKRPEIVTFNEQMTYAQNI  512

Query  474  AFEAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPP  295
              EA I  +      V V   S  F+TH  +  QRL+ L V   IP   G ++I  TAP 
Sbjct  513  DIEAKIAGDKVQKQNVCVTMYSPAFTTHGVNMNQRLIVLGVKEVIP-ANGNFKISATAPI  571

Query  294  NAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            +  VAP GYYM+  + +GVPS+ +WVQ+
Sbjct  572  SNAVAPVGYYMLSVIFEGVPSITKWVQI  599



>emb|CDP03295.1| unnamed protein product [Coffea canephora]
Length=897

 Score =   107 bits (268),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 88/148 (59%), Gaps = 8/148 (5%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVE--LPEKVGYRQA  472
            DG++L+AGSNPH FY +   +PT+L +E F+P YL+ +    RPV+VE    +++ Y Q 
Sbjct  451  DGKILVAGSNPHQFYTFNVKYPTELRVEKFTPPYLAPELDKHRPVIVEDASDKELKYGQQ  510

Query  471  FEAAITvelpvvgvv-eVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPP  295
            F   I ++  V     +V     PF+TH FSQ QRL+ L +T          +I   APP
Sbjct  511  FVVNINLDDQVDASDIKVTMYPPPFTTHGFSQSQRLLVLGLTQVT-----NQQITAVAPP  565

Query  294  NAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            +  +APPGYYM+F V++GVPS   WV +
Sbjct  566  SGKIAPPGYYMLFVVHRGVPSRGMWVHI  593



>ref|XP_012077515.1| PREDICTED: galactose oxidase-like [Jatropha curcas]
Length=653

 Score =   107 bits (266),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 86/148 (58%), Gaps = 3/148 (2%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQ--  475
            PDG+VL+AGSN +  Y Y   +PT+L +E +SP YL+A     RP +V   EK+ Y Q  
Sbjct  506  PDGKVLIAGSNTNNGYIYDAMYPTELRVEKYSPPYLNAAVIQKRPEIVTFNEKMTYAQNI  565

Query  474  AFEAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPP  295
              E  I       G V+V   S  F+TH  +  QRL++L +   +P   G +++G  +P 
Sbjct  566  DIEVKIAGGKVEQGDVKVTMYSPAFTTHGINMNQRLIQLGLREVVP-ANGNFKVGAISPI  624

Query  294  NAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            +  VAP GYYM+  V QGVPS+ +WVQ+
Sbjct  625  SNKVAPVGYYMLSVVFQGVPSITKWVQI  652



>ref|XP_006344285.1| PREDICTED: galactose oxidase-like [Solanum tuberosum]
Length=574

 Score =   106 bits (265),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 88/150 (59%), Gaps = 4/150 (3%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRG-PFPTQLSIEAFSPEYLSADRANIRPV--LVELPEKVGYR  478
            PDGR+L+ GSNPH  Y + G  +PT+LS+EAFSP YL+   A++RP+   V++ + + Y 
Sbjct  424  PDGRILVGGSNPHATYNFTGVKYPTELSLEAFSPPYLATQYAHLRPLNQAVDVGQVLSYG  483

Query  477  QAFEAAITvelpv-vgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTA  301
            Q F    T+  P       V+     F+THSF   QRL+ L +          YR+   A
Sbjct  484  QQFSITFTLPFPQPDAEFMVSMIPPSFTTHSFGMNQRLLFLEIVGVERLFMFGYRVIVFA  543

Query  300  PPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            PP   +APPGYYMVF V+QGVP  + WV++
Sbjct  544  PPTRNIAPPGYYMVFVVHQGVPGHSVWVKI  573



>ref|XP_010540180.1| PREDICTED: galactose oxidase-like [Tarenaya hassleriana]
Length=565

 Score =   106 bits (264),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 87/159 (55%), Gaps = 14/159 (9%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGP-FPTQLSIEAFSPEYLSADRANIRPVLV--ELPEKVGYRQ  475
            DGRVL+ GSNPH FY + G  FPT+LS+EAF P YL    +N+RP++   +   K+ Y  
Sbjct  406  DGRVLVGGSNPHAFYNFTGVLFPTELSLEAFLPSYLDQQFSNLRPMITSPKSQVKIKYNM  465

Query  474  AFEAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLP--VTSAIPD---------GT  328
              +   TV   V   V+V      F+THSFS  QR++ L    T  I D          T
Sbjct  466  KLKLKFTVSGEVKSPVKVTMVFPSFTTHSFSMNQRVLVLDNIKTPKIWDFFNFLRKGKST  525

Query  327  GKYRIGCTAPPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
              Y +    P +A +APPGYYM+F VNQ +PS   WVQL
Sbjct  526  STYEVEVKTPRSANIAPPGYYMMFVVNQDIPSEGIWVQL  564



>gb|KDP33710.1| hypothetical protein JCGZ_07281 [Jatropha curcas]
Length=711

 Score =   107 bits (266),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 85/148 (57%), Gaps = 3/148 (2%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRGPFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQ--  475
            PDG++L+AGSN +  Y Y   +PT+L +E +SP YL+A     RP +V   E++ Y Q  
Sbjct  564  PDGKILVAGSNTNNGYIYDAMYPTELRVEKYSPPYLNAAVIQKRPEIVTFNEQMTYAQNI  623

Query  474  AFEAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPP  295
              EA I  +      V V   S  F+TH  +  QRL+ L V   IP   G ++I  TAP 
Sbjct  624  DIEAKIAGDKVQKQNVCVTMYSPAFTTHGVNMNQRLIVLGVKEVIP-ANGNFKISATAPI  682

Query  294  NAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            +  VAP GYYM+  + +GVPS+ +WVQ+
Sbjct  683  SNAVAPVGYYMLSVIFEGVPSITKWVQI  710



>ref|XP_010533609.1| PREDICTED: galactose oxidase-like [Tarenaya hassleriana]
Length=559

 Score =   106 bits (264),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 86/153 (56%), Gaps = 9/153 (6%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGP-FPTQLSIEAFSPEYLSADRANIRPVLV--ELPEKVGYRQ  475
            DGRVL+ GSNPH +Y + G  FPT LS+EAFSP YL  + +N+RP ++  +   K+ Y  
Sbjct  407  DGRVLVGGSNPHRYYNFTGVLFPTDLSLEAFSPSYLDQEFSNLRPKIIAPKSQSKIKYDT  466

Query  474  AFEAAITvelpvvgvveVNFASAPFSTHSFSQGQRL-----VKLPVTSAIPDGTGKYRIG  310
              +   TV   V   V+V      F+THSFS  QR+     VK    S     T  Y + 
Sbjct  467  KLKLRFTVSDEVKSPVKVTMVYPSFATHSFSMNQRVLFLDNVKFTTRSKTARKT-TYGVE  525

Query  309  CTAPPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
               P +A VAPPGYYM+F VNQ +PS   WV+L
Sbjct  526  VKTPRSANVAPPGYYMMFVVNQHIPSKGVWVRL  558



>ref|XP_010688268.1| PREDICTED: uncharacterized protein LOC104902254 [Beta vulgaris 
subsp. vulgaris]
Length=551

 Score =   106 bits (264),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 84/149 (56%), Gaps = 4/149 (3%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRG-PFPTQLSIEAFSPEYLSADRANIRPVLVELPEKV-GYRQA  472
            +G++L+AGSN +  YK++G  FPT+L +E FSP YL       +P  V L  KV GY Q 
Sbjct  402  EGKILVAGSNTNPGYKFQGVKFPTELRVEKFSPPYLDPALDKFKPKKVHLGNKVIGYAQT  461

Query  471  FE--AAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAP  298
             +    I         + V     PF+TH +S  QRL+ L VTS +P     Y++   AP
Sbjct  462  IQITCNIFAPAVQQKDIMVTLYKPPFTTHGYSMNQRLLVLKVTSVVPQQRAAYQLQVEAP  521

Query  297  PNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            P+  VAPPGYY++F   +GVP  A W+QL
Sbjct  522  PSGEVAPPGYYLLFVNYRGVPGAASWIQL  550



>gb|KHN43222.1| Galactose oxidase [Glycine soja]
Length=457

 Score =   105 bits (261),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 81/149 (54%), Gaps = 4/149 (3%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRG-PFPTQLSIEAFSPEYLSADRANIRPVLVELPEK--VGYRQ  475
            DGRVL+ GSNPH FY + G  +PT LS+EAFSP YL+ D   +RP +  +     +GYR 
Sbjct  308  DGRVLVGGSNPHVFYNFTGVEYPTDLSLEAFSPPYLALDFDPVRPTIRYITNNNVLGYRV  367

Query  474  AFEAAITvelpvvgvveVNFASAP-FSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAP  298
                  TV              AP F+THSF Q QR+V L ++         Y      P
Sbjct  368  FCYVTFTVPNFASASEVSVKIVAPSFTTHSFGQNQRMVVLKLSGVTYLAGEAYYATVVGP  427

Query  297  PNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
              A +APPGYY++F V++GVPS   WVQ+
Sbjct  428  STAEIAPPGYYLLFVVHKGVPSSGSWVQV  456



>ref|XP_008347351.1| PREDICTED: galactose oxidase-like [Malus domestica]
Length=533

 Score =   105 bits (263),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 86/149 (58%), Gaps = 4/149 (3%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGP-FPTQLSIEAFSPEYLSADRANIRPVLVE--LPEKVGYRQ  475
            DGRVL+ GSNPH  Y++    FPT+L +EAFSP+YL A   N+RP +V      K+ Y +
Sbjct  384  DGRVLVGGSNPHXKYEFTBVLFPTELRLEAFSPDYLDAKYNNLRPQIVAPISQAKINYGK  443

Query  474  AFEAAITvelpvvgvveVNFASAP-FSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAP  298
                  +V+  +          AP F+THSFS  QRL+ L   +    GT  Y++  T P
Sbjct  444  KLSIQFSVKGNLATQSVSVSMVAPSFNTHSFSMNQRLLVLEAENVKKVGTTAYQVQVTTP  503

Query  297  PNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
             +  +AP GYY+++ V+Q +PS A WVQ+
Sbjct  504  ASGNLAPSGYYLLYVVHQKIPSAAIWVQI  532



>gb|KHN45905.1| Galactose oxidase [Glycine soja]
Length=530

 Score =   105 bits (263),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 65/149 (44%), Positives = 88/149 (59%), Gaps = 4/149 (3%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKY-RGPFPTQLSIEAFSPEYLSADRANIRPVLVE--LPEKVGYRQ  475
            DGRVLLAGSNPH +Y + +  FPT+L +EAFSP YL    +N+RP +V      K+ Y Q
Sbjct  381  DGRVLLAGSNPHTYYNFTKVLFPTELRLEAFSPWYLEPGFSNVRPAIVSPASQTKLKYGQ  440

Query  474  AFEAAITvelpvv-gvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAP  298
                   V   +V   V V   + PF+THSFS  QRL+ L        G   + +  TAP
Sbjct  441  TLRLRFKVSATLVGDSVSVTMLAPPFNTHSFSMNQRLLVLKPHHLSGVGESTHEVEVTAP  500

Query  297  PNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
             +A++APPG+Y++F V+Q VPS   WVQ+
Sbjct  501  ASAVLAPPGFYLLFVVHQEVPSHGIWVQM  529



>gb|KJB45029.1| hypothetical protein B456_007G286100 [Gossypium raimondii]
Length=547

 Score =   105 bits (263),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 86/148 (58%), Gaps = 3/148 (2%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRG-PFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYR-QA  472
            DGR+L++GSNPH +Y +    +PT LS+E+FSP YLS +   IRP ++   EK+GY  + 
Sbjct  399  DGRILVSGSNPHVYYNFTNVEYPTDLSMESFSPPYLSPEYDPIRPRILSADEKMGYGGKL  458

Query  471  FEAAITvelpvvgvveVNFASAP-FSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPP  295
            F  +  V+  +   V      AP F+THSFS  QR+V L +          Y +    P 
Sbjct  459  FWLSFQVQAYLTANVLSVTIVAPSFATHSFSMNQRMVLLKIAGVTDIAPSTYNLVVAGPS  518

Query  294  NAMVAPPGYYMVFAVNQGVPSVARWVQL  211
             A +APPGYYM+F V+  VPS  RWV++
Sbjct  519  TAEIAPPGYYMMFVVHAHVPSYGRWVKI  546



>ref|XP_003523554.1| PREDICTED: galactose oxidase-like [Glycine max]
Length=530

 Score =   105 bits (263),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 65/149 (44%), Positives = 88/149 (59%), Gaps = 4/149 (3%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKY-RGPFPTQLSIEAFSPEYLSADRANIRPVLVE--LPEKVGYRQ  475
            DGRVLLAGSNPH +Y + +  FPT+L +EAFSP YL    +N+RP +V      K+ Y Q
Sbjct  381  DGRVLLAGSNPHTYYNFTKVLFPTELRLEAFSPWYLEPGFSNVRPAIVSPASQTKLKYGQ  440

Query  474  AFEAAITvelpvv-gvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAP  298
                   V   +V   V V   + PF+THSFS  QRL+ L        G   + +  TAP
Sbjct  441  TLRLRFKVSATLVGDSVSVTMLAPPFNTHSFSMNQRLLVLKPHHLSGVGESTHEVEVTAP  500

Query  297  PNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
             +A++APPG+Y++F V+Q VPS   WVQ+
Sbjct  501  ASAVLAPPGFYLLFVVHQEVPSHGIWVQM  529



>ref|XP_008357159.1| PREDICTED: galactose oxidase-like [Malus domestica]
Length=401

 Score =   104 bits (259),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 85/149 (57%), Gaps = 4/149 (3%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGP-FPTQLSIEAFSPEYLSADRANIRPVLVE--LPEKVGYRQ  475
            DGRVL+ GSNPH  Y++    FPT+L +EAFSP+YL A   N+RP +V      K+ Y +
Sbjct  252  DGRVLVGGSNPHXKYEFTBVLFPTELRLEAFSPDYLDAKYNNLRPQIVAPISQAKINYGK  311

Query  474  AFEAAITvelpvvgvveVNFASAP-FSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAP  298
                  +V+  +          AP F+ HSFS  QRL+ L   +    GT  Y++  T P
Sbjct  312  KLSIQFSVKGNLATXSVSVSMVAPSFNXHSFSMNQRLLVLXAENVKKVGTTAYQVQVTTP  371

Query  297  PNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
             +  +AP GYY+++ V+Q +PS A WVQ+
Sbjct  372  ASGNLAPSGYYLLYVVHQKIPSAAIWVQI  400



>ref|XP_009110252.1| PREDICTED: galactose oxidase-like [Brassica rapa]
Length=547

 Score =   105 bits (263),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 84/148 (57%), Gaps = 3/148 (2%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGP-FPTQLSIEAFSPEYLSADRANIRPVLV--ELPEKVGYRQ  475
            DGRVL  GSNPH FY + G  FPT+LS+EAFSP YL  + A +RP +V  +    + YR+
Sbjct  399  DGRVLGGGSNPHGFYNFTGVLFPTELSLEAFSPVYLEPEFAKLRPKIVSPKSQTTITYRK  458

Query  474  AFEAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPP  295
              +    V   V G V+V      F+THSFS  QRL+ L         +  Y +    P 
Sbjct  459  TMKLKFKVVGEVKGPVKVTMVFPSFTTHSFSMNQRLLVLDNVKFKRSKSTNYEVQVRTPR  518

Query  294  NAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            +A +APPGYYM+F VN  +PS   WV+L
Sbjct  519  SAFIAPPGYYMMFVVNDNIPSEGIWVRL  546



>gb|EYU22441.1| hypothetical protein MIMGU_mgv1a024085mg [Erythranthe guttata]
Length=596

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/153 (39%), Positives = 89/153 (58%), Gaps = 7/153 (5%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRG-PFPTQLSIEAFSPEYLSADRANIRPVLVELP----EKVG  484
            PDGR+L+ GSNPH  Y +    +PT LS+EA+SP YL  + A++RP ++ +       V 
Sbjct  442  PDGRILVGGSNPHVKYNFTAEKYPTDLSLEAYSPPYLGTEYAHLRPSILSIDGTEDNAVA  501

Query  483  YRQAFEAAITvelpvvg--vveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIG  310
            Y Q F  + ++    +      V   +  F+THSF+  QRL+ L V++        Y++ 
Sbjct  502  YGQQFTISFSLGGFQLVPGEYLVTMVAPSFTTHSFAMNQRLLVLYVSAEQQIAPFAYKVT  561

Query  309  CTAPPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
              APP A +APPGYYM+F V+QGVP  + W++L
Sbjct  562  VNAPPTANIAPPGYYMLFVVHQGVPCHSVWIKL  594



>ref|XP_004147869.1| PREDICTED: galactose oxidase [Cucumis sativus]
Length=548

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 87/151 (58%), Gaps = 6/151 (4%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGP-FPTQLSIEAFSPEYLSADRANIRPVLVELPE---KVGYR  478
            DGRVL+ GSNPH  Y + G  FPT+L +EAFSP YL  + A +RP  ++ P    K+ + 
Sbjct  396  DGRVLVGGSNPHSSYNFTGVLFPTELRLEAFSPSYLDPEFAYLRPA-IQFPASSVKLRHG  454

Query  477  QAFEAAITv-elpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTA  301
            QA +   TV        + V   S  F+THSFS  QRL+ L  T     G  KY +  T 
Sbjct  455  QALKVGFTVPGKVDSTRLSVTILSPSFNTHSFSMNQRLLILSTTKYRLRGNKKYEVEVTI  514

Query  300  PPNAMVAPPGYYMVFAVNQGVPSVARWVQLS  208
            P +  VAP GYY+++ V++ +PS+  WVQLS
Sbjct  515  PGSGNVAPSGYYILYLVHKEIPSIGIWVQLS  545



>ref|XP_009794042.1| PREDICTED: galactose oxidase-like [Nicotiana sylvestris]
Length=553

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 86/149 (58%), Gaps = 4/149 (3%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGP-FPTQLSIEAFSPEYLSADRANIRPVLVELPEK--VGYRQ  475
            DGRVL+ GSNPH +Y + G  FPT+LS+EAFSP YL  +   +RP ++    +  +GY Q
Sbjct  404  DGRVLIGGSNPHIYYNFTGVLFPTELSLEAFSPSYLDPESEYLRPQIISPASQYTIGYGQ  463

Query  474  AFEAAITvelpvvgvveVNFASAP-FSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAP  298
                   V   V   +      AP F+THSF+Q QRL+ L   +    G   Y+I    P
Sbjct  464  RVPVRFKVSGRVNRNLVTVTMVAPGFNTHSFTQNQRLLVLASENVKLLGEKAYQINVVTP  523

Query  297  PNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
             +A +APPGYY++F V+Q +PS   WV++
Sbjct  524  NSATLAPPGYYLLFVVHQDIPSEGIWVKI  552



>gb|KJB58134.1| hypothetical protein B456_009G196400 [Gossypium raimondii]
Length=549

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 61/150 (41%), Positives = 82/150 (55%), Gaps = 6/150 (4%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGP-FPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYR---  478
            DGRVL+ GSNPH FY +    FPT+LS+EAFSP YL +   ++RP ++      G R   
Sbjct  400  DGRVLVGGSNPHAFYNFTSVLFPTELSLEAFSPAYLDSKFNDLRPKIITPKSMSGIRYNK  459

Query  477  -QAFEAAITvelpvvgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTA  301
                +  IT ++    V     A A F+THSFS  QRL+ L        G   Y I  T 
Sbjct  460  RTNIQVVITGKVAENLVSATMLAPA-FNTHSFSMNQRLLVLGNDKVTTCGNSAYNIEVTT  518

Query  300  PPNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            P    +APPG+Y++F V+Q +PS   WV+L
Sbjct  519  PSTHNLAPPGFYLLFVVHQNIPSQGIWVKL  548



>ref|XP_006357288.1| PREDICTED: galactose oxidase-like [Solanum tuberosum]
Length=570

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/148 (40%), Positives = 84/148 (57%), Gaps = 2/148 (1%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRG-PFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQA  472
            PDGR+L+ GSNPH  Y + G  +PT+LS+EAF P YLS   + +RP    +   V Y Q 
Sbjct  422  PDGRILVGGSNPHIRYNFTGVKYPTELSLEAFMPPYLSPHHSQLRPSNTTVEGPVSYGQK  481

Query  471  FEAAITvelpvvgvveVNFASAP-FSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPP  295
            F    T+ +       +    AP F+THSF+  QRL+ L +       +   +I   APP
Sbjct  482  FSVTFTLGVSQDMKEVMVTMIAPSFTTHSFAMNQRLLILDIVEIQQLSSFTQKIMVYAPP  541

Query  294  NAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            +  +AP GYYMVF V++GVP  + WV++
Sbjct  542  SRNIAPLGYYMVFVVHKGVPGHSIWVKM  569



>ref|XP_009607831.1| PREDICTED: galactose oxidase-like [Nicotiana tomentosiformis]
Length=558

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 85/149 (57%), Gaps = 4/149 (3%)
 Frame = -3

Query  645  DGRVLLAGSNPHYFYKYRGP-FPTQLSIEAFSPEYLSADRANIRPVLVELP--EKVGYRQ  475
            DGRVL+ GSNP+ FY + G  FPT+LS+EAFSP YL ++ AN+RP ++      K  Y Q
Sbjct  409  DGRVLVGGSNPNEFYNFTGVLFPTELSLEAFSPSYLDSESANLRPQIISSTSRHKFKYGQ  468

Query  474  AFEAAITvelpvvgvveVNFASAP-FSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAP  298
                  TV   V   +      AP F+THSF+  QR++ L        G   Y++    P
Sbjct  469  GVNIQFTVSGLVNRDLIKVTMVAPGFNTHSFTMNQRMLVLSSGDVRLIGKFVYQVSLVFP  528

Query  297  PNAMVAPPGYYMVFAVNQGVPSVARWVQL  211
             +  +APPGYYM+F V+Q +PS   WV++
Sbjct  529  KSGKLAPPGYYMLFVVHQDIPSEGIWVRI  557



>ref|XP_009779182.1| PREDICTED: galactose oxidase-like [Nicotiana sylvestris]
Length=596

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/148 (39%), Positives = 87/148 (59%), Gaps = 2/148 (1%)
 Frame = -3

Query  648  PDGRVLLAGSNPHYFYKYRG-PFPTQLSIEAFSPEYLSADRANIRPVLVELPEKVGYRQA  472
            PDGR+++ GSNPH  Y + G  +PT+LS+EAF P YL+ + +++RP ++ +   V Y Q 
Sbjct  448  PDGRIVVGGSNPHIRYNFTGVQYPTELSLEAFRPPYLAPEHSHLRPSILTVEGPVSYGQK  507

Query  471  FEAAITvelpv-vgvveVNFASAPFSTHSFSQGQRLVKLPVTSAIPDGTGKYRIGCTAPP  295
            F    T+        + V+     F+THSF+  QRL+ L V           +I   APP
Sbjct  508  FSITFTLGFYQPAKELMVSMIPPSFTTHSFAMNQRLLILDVVGVQRLSLFAQKITVCAPP  567

Query  294  NAMVAPPGYYMVFAVNQGVPSVARWVQL  211
            +  +APPGYYMVF V++GVP  + W+++
Sbjct  568  SRNIAPPGYYMVFVVHRGVPGHSSWIRM  595



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1026237057824