BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig4053

Length=846
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006354418.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    328   1e-106   Solanum tuberosum [potatoes]
ref|XP_004243609.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     328   2e-106   Solanum lycopersicum
ref|XP_006357690.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    328   2e-106   Solanum tuberosum [potatoes]
ref|XP_004240171.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    326   2e-105   Solanum lycopersicum
gb|ADZ24701.1|  4-hydroxyphenylpyruvate dioxygenase 2                   324   6e-105   Solanum pennellii
ref|XP_009770088.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     324   7e-105   Nicotiana sylvestris
emb|CDY10210.1|  BnaC05g04530D                                          324   8e-105   Brassica napus [oilseed rape]
gb|AFB74218.1|  4-hydroxyphenylpyruvate dioxygenase                     324   1e-104   Brassica napus [oilseed rape]
ref|XP_002892349.1|  4-hydroxyphenylpyruvate dioxygenase                323   1e-104   Arabidopsis lyrata subsp. lyrata
ref|XP_011100558.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    325   1e-104   Sesamum indicum [beniseed]
ref|XP_009118533.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     322   6e-104   Brassica rapa
ref|XP_004303888.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     322   6e-104   Fragaria vesca subsp. vesca
ref|XP_010087866.1|  4-hydroxyphenylpyruvate dioxygenase                322   7e-104   Morus notabilis
ref|XP_002520369.1|  4-hydroxyphenylpyruvate dioxygenase, putative      322   7e-104   Ricinus communis
ref|XP_009587203.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     322   7e-104   Nicotiana tomentosiformis
pdb|1SQD|A  Chain A, Structural Basis For Inhibitor Selectivity R...    321   7e-104   Arabidopsis thaliana [mouse-ear cress]
sp|P93836.2|HPPD_ARATH  RecName: Full=4-hydroxyphenylpyruvate dio...    321   1e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010486350.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     321   1e-103   Camelina sativa [gold-of-pleasure]
ref|NP_172144.2|  4-hydroxyphenylpyruvate dioxygenase                   322   1e-103   
gb|AAM96960.1|  4-hydroxyphenylpyruvate dioxygenase HPD                 322   1e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006437130.1|  hypothetical protein CICLE_v10031587mg             320   2e-103   Citrus clementina [clementine]
ref|XP_006417901.1|  hypothetical protein EUTSA_v10007634mg             321   2e-103   Eutrema salsugineum [saltwater cress]
sp|O23920.1|HPPD_DAUCA  RecName: Full=4-hydroxyphenylpyruvate dio...    320   3e-103   Daucus carota [carrots]
ref|XP_002300867.2|  4-HYDROXYPHENYLPYRUVATE DIOXYGENASE family p...    320   4e-103   
ref|XP_010480368.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    320   4e-103   Camelina sativa [gold-of-pleasure]
ref|XP_011026229.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    320   5e-103   Populus euphratica
ref|XP_006307507.1|  hypothetical protein CARUB_v10009131mg             320   5e-103   Capsella rubella
ref|XP_008353631.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    320   5e-103   
ref|XP_010457787.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    319   8e-103   Camelina sativa [gold-of-pleasure]
ref|XP_009377128.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    318   1e-102   
sp|Q9ARF9.1|HPPD_PLESU  RecName: Full=4-hydroxyphenylpyruvate dio...    318   2e-102   Plectranthus scutellarioides
gb|AID81984.1|  hydroxyphenylpyruvate dioxygenase                       318   2e-102   Capsella bursa-pastoris
gb|KFK42972.1|  hypothetical protein AALP_AA1G063200                    318   2e-102   Arabis alpina [alpine rockcress]
dbj|BAF74636.1|  hydroxyphenylpyruvate dioxygenase                      317   3e-102   Coptis japonica var. dissecta
ref|XP_010480369.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    318   3e-102   Camelina sativa [gold-of-pleasure]
ref|XP_007215393.1|  hypothetical protein PRUPE_ppa005851mg             317   4e-102   
ref|XP_010542713.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     317   4e-102   Tarenaya hassleriana [spider flower]
ref|XP_008466793.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     318   6e-102   Cucumis melo [Oriental melon]
ref|XP_010053900.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    317   9e-102   Eucalyptus grandis [rose gum]
ref|XP_007048961.1|  Phytoene desaturation 1 isoform 1                  316   1e-101   
gb|ADO62712.1|  p-hydroxyphenylpyruvate dioxygenase                     315   2e-101   Mangifera indica
ref|XP_009351285.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    315   2e-101   
gb|ABO69440.1|  hydroxyphenylpyruvate dioxygenase                       317   2e-101   Salvia miltiorrhiza [Chinese salvia]
dbj|BAH10638.1|  4-hydroxyphenylpyruvate dioxygenase                    315   2e-101   Hevea brasiliensis [jebe]
ref|XP_004144629.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     315   5e-101   Cucumis sativus [cucumbers]
gb|EYU42802.1|  hypothetical protein MIMGU_mgv1a005210mg                316   5e-101   Erythranthe guttata [common monkey flower]
ref|XP_012082570.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     314   6e-101   Jatropha curcas
ref|XP_008229571.1|  PREDICTED: LOW QUALITY PROTEIN: 4-hydroxyphe...    316   6e-101   Prunus mume [ume]
gb|AGO59892.1|  hydroxyphenylpyruvate dioxygenase                       314   1e-100   Perilla frutescens [beefsteak-mint]
ref|XP_003617391.1|  4-hydroxyphenylpyruvate dioxygenase                312   3e-100   
ref|XP_010274102.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     314   3e-100   Nelumbo nucifera [Indian lotus]
gb|KJB08581.1|  hypothetical protein B456_001G092000                    311   1e-99    Gossypium raimondii
gb|AGG10562.1|  4-hydroxyphenylpyruvate dioxygenase                     310   1e-99    Amaranthus tuberculatus
ref|XP_010688905.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    310   2e-99    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004491317.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    310   2e-99    Cicer arietinum [garbanzo]
ref|XP_007048962.1|  Phytoene desaturation 1 isoform 2                  309   6e-99    
gb|EPS60251.1|  hydroxyphenylpyruvate dioxygenase                       307   8e-99    Genlisea aurea
emb|CAN71143.1|  hypothetical protein VITISV_033518                     308   2e-98    Vitis vinifera
ref|XP_002283275.2|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     309   3e-98    Vitis vinifera
gb|AFB74208.1|  4-hydroxyphenylpyruvate dioxygenase                     305   1e-97    Brassica napus [oilseed rape]
emb|CDY06652.1|  BnaA10g04310D                                          305   2e-97    
ref|XP_009119049.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     305   2e-97    Brassica rapa
ref|XP_008380188.1|  PREDICTED: LOW QUALITY PROTEIN: 4-hydroxyphe...    304   9e-97    
gb|ACN78586.1|  4-hydroxyphenylpyruvate dioxygenase                     303   2e-96    Lactuca sativa [cultivated lettuce]
emb|CDY09969.1|  BnaC08g44820D                                          301   4e-96    Brassica napus [oilseed rape]
gb|ADZ24700.1|  4-hydroxyphenylpyruvate dioxygenase 1                   301   5e-96    Solanum pennellii
gb|AFB74207.1|  4-hydroxyphenylpyruvate dioxygenase                     301   6e-96    Brassica napus [oilseed rape]
ref|XP_003617384.1|  4-hydroxyphenylpyruvate dioxygenase                300   1e-95    Medicago truncatula
ref|XP_010688906.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    298   4e-95    Beta vulgaris subsp. vulgaris [field beet]
gb|AIN39549.1|  4-hydroxyphenylpyruvate dioxygenase short isoform       300   4e-95    Glycine max [soybeans]
gb|AIN39550.1|  chloroplast 4-hydroxyphenylpyruvate dioxygenase l...    300   9e-95    Glycine max [soybeans]
ref|NP_001235148.1|  4-hydroxyphenylpyruvate dioxygenase                298   1e-94    
ref|XP_007141424.1|  hypothetical protein PHAVU_008G194300g             298   3e-94    Phaseolus vulgaris [French bean]
gb|ABK26783.1|  unknown                                                 287   1e-92    Picea sitchensis
ref|NP_001046010.1|  Os02g0168100                                       286   1e-92    
ref|XP_009419542.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     293   2e-92    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010909672.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     288   5e-92    
ref|XP_010053910.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    290   1e-91    Eucalyptus grandis [rose gum]
ref|XP_006648349.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    287   1e-91    Oryza brachyantha
ref|XP_010053920.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    290   1e-91    Eucalyptus grandis [rose gum]
dbj|BAD26248.1|  putative 4-hydroxyphenylpyruvate dioxygenase           290   3e-91    Oryza sativa Japonica Group [Japonica rice]
gb|KEH40154.1|  4-hydroxyphenylpyruvate dioxygenase                     288   6e-91    Medicago truncatula
gb|EAZ21880.1|  hypothetical protein OsJ_05532                          288   1e-90    Oryza sativa Japonica Group [Japonica rice]
gb|AAC62457.1|  p-hydroxyphenylpyruvate dioxygenase                     287   1e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008811120.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     288   2e-90    Phoenix dactylifera
ref|XP_004951787.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    287   3e-90    Setaria italica
ref|XP_003570001.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     285   1e-89    Brachypodium distachyon [annual false brome]
gb|EEC72567.1|  hypothetical protein OsI_06005                          288   4e-89    Oryza sativa Indica Group [Indian rice]
ref|XP_002453359.1|  hypothetical protein SORBIDRAFT_04g004560          283   6e-89    Sorghum bicolor [broomcorn]
gb|ERN14877.1|  hypothetical protein AMTR_s00032p00156310               277   2e-88    Amborella trichopoda
gb|EMS64157.1|  4-hydroxyphenylpyruvate dioxygenase                     275   2e-87    Triticum urartu
sp|O48604.1|HPPD_HORVU  RecName: Full=4-hydroxyphenylpyruvate dio...    279   2e-87    Hordeum vulgare [barley]
dbj|BAJ86732.1|  predicted protein                                      278   3e-87    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ95714.1|  predicted protein                                      278   3e-87    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK02084.1|  predicted protein                                      278   8e-87    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006853410.2|  PREDICTED: LOW QUALITY PROTEIN: 4-hydroxyphe...    278   8e-87    Amborella trichopoda
pdb|1SP8|A  Chain A, 4-hydroxyphenylpyruvate Dioxygenase                277   1e-86    Zea mays [maize]
ref|XP_007048964.1|  Phytoene desaturation 1 isoform 4                  276   1e-86    
ref|XP_001756086.1|  predicted protein                                  277   1e-86    
gb|ACN36372.1|  unknown                                                 276   3e-86    Zea mays [maize]
gb|AFW70252.1|  4-hydroxyphenylpyruvate dioxygenase 1                   276   4e-86    
ref|XP_001757940.1|  predicted protein                                  272   8e-85    
gb|AAN28922.1|  4-hydroxyphenylpyruvate dioxygenase                     269   2e-84    Abutilon theophrasti [butterprint]
gb|AAZ67144.1|  4-hydroxyphenylpyruvate dioxygenase                     270   9e-84    Triticum aestivum [Canadian hard winter wheat]
ref|NP_001105782.1|  4-hydroxyphenylpyruvate dioxygenase 1              267   2e-82    
gb|EMT09524.1|  4-hydroxyphenylpyruvate dioxygenase                     260   1e-81    
ref|XP_002974762.1|  hypothetical protein SELMODRAFT_174278             253   1e-76    
gb|KDO51876.1|  hypothetical protein CISIN_1g013898mg                   249   2e-76    Citrus sinensis [apfelsine]
ref|XP_002963674.1|  hypothetical protein SELMODRAFT_165961             251   5e-76    
ref|XP_011100559.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    249   1e-75    
ref|XP_007048963.1|  Phytoene desaturation 1 isoform 3                  244   3e-74    
ref|NP_001154311.1|  4-hydroxyphenylpyruvate dioxygenase                242   3e-73    Arabidopsis thaliana [mouse-ear cress]
gb|KJB08583.1|  hypothetical protein B456_001G092000                    241   4e-73    Gossypium raimondii
gb|KJB08582.1|  hypothetical protein B456_001G092000                    241   5e-73    Gossypium raimondii
ref|XP_004368015.1|  4hydroxyphenylpyruvate dioxygenase                 239   3e-72    Acanthamoeba castellanii str. Neff
gb|KDO16411.1|  4-hydroxyphenylpyruvate dioxygenase                     238   1e-71    Saprolegnia parasitica CBS 223.65
ref|XP_009825673.1|  4-hydroxyphenylpyruvate dioxygenase                238   1e-71    Aphanomyces astaci
ref|XP_001694722.1|  4-hydroxyphenylpyruvate dioxygenase                236   2e-71    Chlamydomonas reinhardtii
ref|XP_008863478.1|  4-hydroxyphenylpyruvate dioxygenase                236   1e-70    Aphanomyces invadans
ref|XP_008863477.1|  4-hydroxyphenylpyruvate dioxygenase                236   1e-70    Aphanomyces invadans
emb|CAR47957.1|  p-hydroxyphenylpyruvate dioxygenase                    235   2e-70    Chlamydomonas reinhardtii
ref|XP_009825674.1|  4-hydroxyphenylpyruvate dioxygenase                234   3e-70    Aphanomyces astaci
ref|XP_005650422.1|  p-hydroxyphenylpyruvate dioxigenase                234   3e-70    Coccomyxa subellipsoidea C-169
ref|XP_002952694.1|  4-hydroxyphenylpyruvate dioxygenase                234   4e-70    Volvox carteri f. nagariensis
ref|XP_001416712.1|  predicted protein                                  234   4e-70    Ostreococcus lucimarinus CCE9901
ref|XP_001694723.1|  4-hydroxyphenylpyruvate dioxygenase                234   5e-70    Chlamydomonas reinhardtii
ref|XP_003078281.1|  p-hydroxyphenylpyruvate dioxigenase (ISS)          233   8e-70    Ostreococcus tauri
ref|XP_008620054.1|  4-hydroxyphenylpyruvate dioxygenase                233   2e-69    Saprolegnia diclina VS20
gb|ETM00254.1|  4-hydroxyphenylpyruvate dioxygenase                     225   5e-69    Phytophthora parasitica
ref|XP_009825872.1|  4-hydroxyphenylpyruvate dioxygenase                232   9e-69    Aphanomyces astaci
ref|XP_007511204.1|  4-hydroxyphenylpyruvate dioxygenase                229   1e-67    Bathycoccus prasinos
ref|XP_009520219.1|  hypothetical protein PHYSODRAFT_539872             226   6e-67    Phytophthora sojae
ref|XP_008900424.1|  4-hydroxyphenylpyruvate dioxygenase                226   7e-67    Phytophthora parasitica INRA-310
gb|ETI53876.1|  4-hydroxyphenylpyruvate dioxygenase                     225   1e-66    Phytophthora parasitica P1569
gb|EWM23898.1|  4-hydroxyphenylpyruvate dioxygenase                     227   2e-66    Nannochloropsis gaditana
ref|XP_002901240.1|  4-hydroxyphenylpyruvate dioxygenase                224   2e-66    Phytophthora infestans T30-4
gb|EWM22209.1|  4-hydroxyphenylpyruvate dioxygenase                     224   5e-66    Nannochloropsis gaditana
ref|XP_008900422.1|  4-hydroxyphenylpyruvate dioxygenase                224   5e-66    Phytophthora parasitica INRA-310
ref|XP_005850767.1|  hypothetical protein CHLNCDRAFT_20078              224   8e-66    Chlorella variabilis
ref|XP_003055822.1|  predicted protein                                  223   1e-65    Micromonas pusilla CCMP1545
gb|ETM00251.1|  4-hydroxyphenylpyruvate dioxygenase                     212   9e-65    Phytophthora parasitica
ref|XP_003575746.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    221   1e-64    Brachypodium distachyon [annual false brome]
emb|CAJ29893.1|  4-hydroxyphenylpyruvate dioxygenase                    215   3e-63    Triticum aestivum [Canadian hard winter wheat]
ref|XP_002499380.1|  predicted protein                                  215   2e-62    Micromonas commoda
ref|XP_002990594.1|  hypothetical protein SELMODRAFT_161008             209   1e-60    
ref|XP_008360256.1|  PREDICTED: LOW QUALITY PROTEIN: 4-hydroxyphe...    205   6e-60    
ref|XP_002968708.1|  hypothetical protein SELMODRAFT_91092              209   8e-60    Selaginella moellendorffii
ref|XP_011402112.1|  4-hydroxyphenylpyruvate dioxygenase                214   9e-60    Auxenochlorella protothecoides
ref|XP_002287272.1|  4-hydroxyphenylpyruvate dioxygenase                206   3e-59    Thalassiosira pseudonana CCMP1335
ref|XP_008390582.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    203   9e-59    
gb|EWM22210.1|  4-hydroxyphenylpyruvate dioxygenase                     205   9e-59    Nannochloropsis gaditana
ref|XP_008653702.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    203   4e-58    Zea mays [maize]
emb|CDP16382.1|  unnamed protein product                                192   1e-57    Coffea canephora [robusta coffee]
emb|CBJ28697.1|  4-hydroxyphenylpyruvate dioxygenase, plastid pre...    203   2e-57    Ectocarpus siliculosus
ref|XP_002461829.1|  hypothetical protein SORBIDRAFT_02g008850          202   4e-57    Sorghum bicolor [broomcorn]
gb|AET00342.2|  4-hydroxyphenylpyruvate dioxygenase                     195   2e-56    Medicago truncatula
gb|KHN11980.1|  4-hydroxyphenylpyruvate dioxygenase                     188   3e-56    Glycine soja [wild soybean]
gb|KDO32258.1|  hypothetical protein SPRG_02737                         197   9e-56    Saprolegnia parasitica CBS 223.65
ref|XP_003617383.1|  4-hydroxyphenylpyruvate dioxygenase                196   2e-55    
ref|XP_007048965.1|  Phytoene desaturation 1                            193   1e-54    
gb|KIZ01637.1|  4-hydroxyphenylpyruvate dioxygenase                     189   6e-54    Monoraphidium neglectum
gb|EJK75816.1|  hypothetical protein THAOC_02448                        186   4e-51    Thalassiosira oceanica
ref|XP_007048969.1|  Phytoene desaturation 1, putative                  183   1e-50    
emb|CBI22086.3|  unnamed protein product                                172   6e-50    Vitis vinifera
ref|XP_005854172.1|  4-hydroxyphenylpyruvate dioxygenase                169   6e-45    Nannochloropsis gaditana CCMP526
gb|KDD74142.1|  hypothetical protein H632_c1538p1                       164   8e-44    Helicosporidium sp. ATCC 50920
ref|XP_002461838.1|  hypothetical protein SORBIDRAFT_02g008990          160   1e-41    
ref|XP_002902379.1|  4-hydroxyphenylpyruvate dioxygenase                150   5e-39    Phytophthora infestans T30-4
ref|WP_028069109.1|  4-hydroxyphenylpyruvate dioxygenase                150   2e-38    Sphingobacterium thalpophilum
ref|WP_021188075.1|  4-hydroxyphenylpyruvate dioxygenase                145   5e-37    Sphingobacterium sp. IITKGP-BTPF85
ref|WP_037440536.1|  4-hydroxyphenylpyruvate dioxygenase                145   7e-37    Pedobacter antarcticus
ref|WP_041885392.1|  4-hydroxyphenylpyruvate dioxygenase                144   2e-36    Pedobacter lusitanus
ref|WP_045851174.1|  4-hydroxyphenylpyruvate dioxygenase                144   3e-36    Domibacillus enclensis
ref|WP_031266144.1|  4-hydroxyphenylpyruvate dioxygenase                138   3e-36    Cytophagales bacterium B6
ref|WP_045752705.1|  4-hydroxyphenylpyruvate dioxygenase                143   4e-36    Sphingobacterium sp. PM2-P1-29
gb|EMT08063.1|  4-hydroxyphenylpyruvate dioxygenase                     142   7e-36    
ref|WP_026710094.1|  4-hydroxyphenylpyruvate dioxygenase                142   1e-35    Flavobacterium filum
ref|WP_038030064.1|  4-hydroxyphenylpyruvate dioxygenase                142   1e-35    Thermonema rossianum
gb|EPB65553.1|  4-hydroxyphenylpyruvate dioxygenase                     140   2e-35    Ancylostoma ceylanicum
ref|WP_015195378.1|  4-hydroxyphenylpyruvate dioxygenase                141   2e-35    Stanieria cyanosphaera
ref|WP_043066209.1|  4-hydroxyphenylpyruvate dioxygenase                141   2e-35    Aneurinibacillus migulanus
gb|KIE12076.1|  4-hydroxyphenylpyruvate dioxygenase                     141   2e-35    Tolypothrix bouteillei VB521301
ref|WP_039814073.1|  4-hydroxyphenylpyruvate dioxygenase                141   2e-35    
gb|AJD92913.1|  4-hydroxyphenylpyruvate dioxygenase                     141   2e-35    Jeotgalibacillus malaysiensis
ref|WP_021624803.1|  4-hydroxyphenylpyruvate dioxygenase                141   2e-35    Aneurinibacillus aneurinilyticus
ref|WP_015142185.1|  4-hydroxyphenylpyruvate dioxygenase                141   2e-35    Pleurocapsa minor
ref|WP_023577663.1|  hppD protein                                       141   3e-35    Flavobacterium saliperosum
ref|WP_038699940.1|  4-hydroxyphenylpyruvate dioxygenase                141   3e-35    Sphingobacterium sp. ML3W
ref|XP_004709651.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     140   3e-35    Echinops telfairi [lesser hedgehog tenrec]
ref|WP_021072238.1|  4-hydroxyphenylpyruvate dioxygenase                140   4e-35    Sphingobacterium paucimobilis
ref|WP_004428063.1|  4-hydroxyphenylpyruvate dioxygenase                140   4e-35    Bacillus alcalophilus
ref|WP_038267139.1|  4-hydroxyphenylpyruvate dioxygenase                140   5e-35    Zhouia amylolytica
ref|WP_026980463.1|  4-hydroxyphenylpyruvate dioxygenase                140   5e-35    Flavobacterium suncheonense
ref|WP_039865967.1|  4-hydroxyphenylpyruvate dioxygenase                140   7e-35    Pedobacter sp. BAL39
gb|EDM38745.1|  4-hydroxyphenylpyruvate dioxygenase                     140   8e-35    Pedobacter sp. BAL39
ref|WP_041966606.1|  4-hydroxyphenylpyruvate dioxygenase                139   9e-35    Bacillus selenatarsenatis
ref|WP_023614753.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...    139   1e-34    Bacillus
ref|WP_026849707.1|  4-hydroxyphenylpyruvate dioxygenase                139   1e-34    
ref|WP_034260207.1|  4-hydroxyphenylpyruvate dioxygenase                139   1e-34    Altibacter lentus
ref|WP_028567254.1|  4-hydroxyphenylpyruvate dioxygenase                139   1e-34    
ref|XP_002307562.2|  hypothetical protein POPTR_0005s22680g             137   1e-34    
emb|CEG27351.1|  4-hydroxyphenylpyruvate dioxygenase                    139   1e-34    Bacillus sp. B-jedd
ref|WP_035127658.1|  4-hydroxyphenylpyruvate dioxygenase                139   1e-34    Flavobacterium aquatile
ref|XP_008588978.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     139   2e-34    Galeopterus variegatus [Malayan flying lemur]
gb|AHG91240.1|  4-hydroxyphenylpyruvate dioxygenase                     139   2e-34    Gemmatirosa kalamazoonesis
ref|WP_002988933.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...    139   2e-34    Myroides odoratus
ref|NP_001165464.1|  4-hydroxyphenylpyruvate dioxygenase isoform 2      138   2e-34    Homo sapiens [man]
gb|ETZ23271.1|  4-hydroxyphenylpyruvate dioxygenase                     138   3e-34    Pedobacter sp. V48
ref|WP_034641974.1|  4-hydroxyphenylpyruvate dioxygenase                138   3e-34    Bacillus manliponensis
ref|XP_003832400.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    138   3e-34    Pan paniscus [bonobo]
ref|XP_004054097.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    138   3e-34    
gb|AIM09595.1|  4-hydroxyphenylpyruvate dioxygenase                     134   3e-34    Bacillus anthracis [anthrax]
ref|WP_041266432.1|  4-hydroxyphenylpyruvate dioxygenase                138   3e-34    
ref|WP_006257753.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...    138   3e-34    Myroides
ref|WP_006266112.1|  4-hydroxyphenylpyruvate dioxygenase                138   3e-34    Myroides
ref|WP_026728258.1|  4-hydroxyphenylpyruvate dioxygenase                138   3e-34    Flavobacterium denitrificans
ref|WP_011685885.1|  4-hydroxyphenylpyruvate dioxygenase                138   3e-34    Candidatus Solibacter usitatus
ref|WP_041518598.1|  4-hydroxyphenylpyruvate dioxygenase                138   3e-34    Flavobacterium hibernum
ref|WP_016873294.1|  4-hydroxyphenylpyruvate dioxygenase                138   3e-34    Chlorogloeopsis fritschii
ref|WP_026575026.1|  4-hydroxyphenylpyruvate dioxygenase                138   3e-34    
ref|WP_029270890.1|  4-hydroxyphenylpyruvate dioxygenase                138   3e-34    Flavobacterium sp. KJJ
ref|WP_017497444.1|  4-hydroxyphenylpyruvate dioxygenase                138   3e-34    Flavobacterium
ref|WP_016649995.1|  4-hydroxyphenylpyruvate dioxygenase                138   3e-34    Myroides odoratimimus
ref|WP_035681519.1|  4-hydroxyphenylpyruvate dioxygenase                138   4e-34    Flavobacterium reichenbachii
ref|WP_026134698.1|  4-hydroxyphenylpyruvate dioxygenase                137   4e-34    Scytonema hofmannii
ref|WP_035653039.1|  4-hydroxyphenylpyruvate dioxygenase                138   4e-34    Flavobacterium sp. Fl
gb|EEM07226.1|  4-hydroxyphenylpyruvate dioxygenase                     136   4e-34    Bacillus pseudomycoides
ref|WP_020060738.1|  4-hydroxyphenylpyruvate dioxygenase                138   4e-34    Bacillus sp. 123MFChir2
ref|NP_002141.1|  4-hydroxyphenylpyruvate dioxygenase isoform 1         138   4e-34    
ref|WP_026708430.1|  4-hydroxyphenylpyruvate dioxygenase                138   4e-34    Flavobacterium frigidarium
ref|XP_009246611.1|  PREDICTED: LOW QUALITY PROTEIN: 4-hydroxyphe...    138   4e-34    
ref|XP_528667.2|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase        138   4e-34    Pan troglodytes
ref|WP_026725162.1|  4-hydroxyphenylpyruvate dioxygenase                138   4e-34    Flavobacterium sasangense
dbj|BAH39165.1|  4-hydroxyphenylpyruvate dioxygenase                    138   4e-34    Gemmatimonas aurantiaca T-27
ref|XP_004054096.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    138   4e-34    Gorilla gorilla gorilla [lowland gorilla]
gb|AAC73008.1|  4-hydroxyphenylpyruvate-dioxygenase                     138   4e-34    Homo sapiens [man]
pdb|3ISQ|A  Chain A, Crystal Structure Of Human 4-Hydroxyphenylpy...    138   5e-34    Homo sapiens [man]
ref|XP_005572523.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     138   5e-34    Macaca fascicularis [crab eating macaque]
ref|WP_007807141.1|  4-hydroxyphenylpyruvate dioxygenase                138   5e-34    Flavobacterium sp. CF136
ref|WP_044219112.1|  4-hydroxyphenylpyruvate dioxygenase                137   5e-34    Flammeovirga pacifica
ref|WP_025124885.1|  4-hydroxyphenylpyruvate dioxygenase                137   5e-34    Myroides odoratimimus
ref|WP_010255704.1|  4-hydroxyphenylpyruvate dioxygenase                137   5e-34    Myroides injenensis
ref|XP_003994683.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     137   6e-34    Felis catus [cat]
ref|WP_015809084.1|  4-hydroxyphenylpyruvate dioxygenase                137   6e-34    Pedobacter heparinus
ref|WP_026445133.1|  4-hydroxyphenylpyruvate dioxygenase                137   6e-34    
ref|WP_006262560.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...    137   6e-34    Myroides
ref|WP_003205593.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...    137   6e-34    Bacillus
ref|WP_039108515.1|  4-hydroxyphenylpyruvate dioxygenase                137   6e-34    Flavobacterium sp. AED
ref|XP_002775900.1|  4-hydroxyphenylpyruvate dioxygenase, putative      138   6e-34    Perkinsus marinus ATCC 50983
ref|WP_041488236.1|  4-hydroxyphenylpyruvate dioxygenase                137   6e-34    Bacillus pseudomycoides
ref|WP_042981475.1|  4-hydroxyphenylpyruvate dioxygenase                137   6e-34    Bacillus
ref|WP_016117024.1|  4-hydroxyphenylpyruvate dioxygenase                137   6e-34    Bacillus cereus group
emb|CEY05930.1|  4-hydroxyphenylpyruvate dioxygenase                    136   6e-34    Streptococcus pneumoniae
ref|WP_007136987.1|  4-hydroxyphenylpyruvate dioxygenase                137   6e-34    Flavobacterium frigoris
ref|WP_014082837.1|  4-hydroxyphenylpyruvate dioxygenase                137   7e-34    Flavobacterium branchiophilum
ref|WP_043930760.1|  4-hydroxyphenylpyruvate dioxygenase                137   7e-34    Bacillus sp. EB01
ref|WP_012022818.1|  4-hydroxyphenylpyruvate dioxygenase                137   7e-34    Flavobacterium johnsoniae
ref|WP_035133201.1|  4-hydroxyphenylpyruvate dioxygenase                137   7e-34    Flavobacterium beibuense
ref|WP_011983355.1|  4-hydroxyphenylpyruvate dioxygenase                137   7e-34    Bacillus cytotoxicus
ref|XP_011803896.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    137   7e-34    Colobus angolensis palliatus
ref|WP_002663260.1|  4-hydroxyphenylpyruvate dioxygenase                137   8e-34    Bergeyella zoohelcum
ref|WP_004918456.1|  4-hydroxyphenylpyruvate dioxygenase                137   8e-34    Riemerella anatipestifer
ref|WP_027384241.1|  4-hydroxyphenylpyruvate dioxygenase                137   8e-34    Chryseobacterium caeni
ref|WP_031455069.1|  4-hydroxyphenylpyruvate dioxygenase                137   9e-34    Flavobacterium chungangense
gb|KFC60050.1|  4-hydroxyphenylpyruvate dioxygenase                     136   9e-34    Flavobacterium gilvum
ref|WP_035669240.1|  4-hydroxyphenylpyruvate dioxygenase                137   1e-33    Flavobacterium sp. 83
ref|WP_013061884.1|  4-hydroxyphenylpyruvate dioxygenase                137   1e-33    Salinibacter ruber
ref|WP_028396045.1|  4-hydroxyphenylpyruvate dioxygenase                137   1e-33    Bacillus sp. FJAT-14578
ref|WP_026592762.1|  4-hydroxyphenylpyruvate dioxygenase                137   1e-33    Bacillus
ref|WP_016990827.1|  4-hydroxyphenylpyruvate dioxygenase                137   1e-33    Flavobacterium sp. ACAM 123
ref|WP_011404122.1|  4-hydroxyphenylpyruvate dioxygenase                137   1e-33    Salinibacter ruber
ref|WP_000810914.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...    137   1e-33    Bacillus cereus group
ref|WP_000810919.1|  4-hydroxyphenylpyruvate dioxygenase                136   1e-33    Bacillus thuringiensis
ref|WP_008236696.1|  4-hydroxyphenylpyruvate dioxygenase                137   1e-33    Imtechella halotolerans
ref|WP_039113173.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...    137   1e-33    Flavobacterium
ref|WP_000810923.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...    136   1e-33    Bacillus
ref|XP_011803895.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    137   1e-33    Colobus angolensis palliatus
ref|XP_001096061.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    136   1e-33    
ref|WP_000810920.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...    136   1e-33    Bacillus
ref|WP_000810922.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...    136   1e-33    
ref|WP_026581629.1|  4-hydroxyphenylpyruvate dioxygenase                136   1e-33    
ref|WP_026565302.1|  4-hydroxyphenylpyruvate dioxygenase                136   1e-33    
gb|EEL19135.1|  4-hydroxyphenylpyruvate dioxygenase                     136   1e-33    
ref|WP_028376924.1|  4-hydroxyphenylpyruvate dioxygenase                136   1e-33    
ref|XP_004451379.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    137   1e-33    
ref|WP_035635554.1|  4-hydroxyphenylpyruvate dioxygenase                136   1e-33    
ref|WP_038414892.1|  4-hydroxyphenylpyruvate dioxygenase                136   1e-33    
ref|XP_004395936.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     137   1e-33    
ref|WP_008465353.1|  4-hydroxyphenylpyruvate dioxygenase                136   1e-33    
ref|WP_033677573.1|  4-hydroxyphenylpyruvate dioxygenase                136   1e-33    
ref|WP_021795997.1|  hypothetical protein                               136   1e-33    
ref|WP_020708625.1|  4-hydroxyphenylpyruvate dioxygenase                136   1e-33    
ref|WP_000810910.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...    136   1e-33    
ref|WP_000810918.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...    136   1e-33    
ref|WP_035617669.1|  4-hydroxyphenylpyruvate dioxygenase                136   1e-33    
ref|XP_003907344.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     136   1e-33    
ref|WP_029566295.1|  4-hydroxyphenylpyruvate dioxygenase                136   1e-33    
ref|WP_000810913.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...    136   1e-33    
ref|XP_003741420.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    136   1e-33    
ref|WP_034675941.1|  4-hydroxyphenylpyruvate dioxygenase                136   1e-33    
ref|XP_006903763.1|  PREDICTED: LOW QUALITY PROTEIN: 4-hydroxyphe...    137   2e-33    
ref|WP_038985894.1|  4-hydroxyphenylpyruvate dioxygenase                136   2e-33    
ref|WP_007086689.1|  4-hydroxyphenylpyruvate dioxygenase                136   2e-33    
ref|WP_000810911.1|  4-hydroxyphenylpyruvate dioxygenase                136   2e-33    
ref|WP_035325846.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...    136   2e-33    
ref|WP_029286431.1|  4-hydroxyphenylpyruvate dioxygenase                136   2e-33    
ref|WP_035432465.1|  4-hydroxyphenylpyruvate dioxygenase                136   2e-33    
ref|WP_000810925.1|  4-hydroxyphenylpyruvate dioxygenase                136   2e-33    
ref|XP_011803894.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    137   2e-33    
gb|EEM98379.1|  4-hydroxyphenylpyruvate dioxygenase                     136   2e-33    
ref|XP_003932210.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     136   2e-33    
gb|AFH81613.1|  4-hydroxyphenylpyruvate dioxygenase                     136   2e-33    
ref|WP_014166112.1|  4-hydroxyphenylpyruvate dioxygenase                136   2e-33    
ref|WP_026983648.1|  4-hydroxyphenylpyruvate dioxygenase                136   2e-33    
gb|AIM04210.1|  4-hydroxyphenylpyruvate dioxygenase                     136   2e-33    
gb|EEM85743.1|  4-hydroxyphenylpyruvate dioxygenase                     136   2e-33    
emb|CDN39245.1|  unnamed protein product                                136   2e-33    
ref|XP_004611096.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     135   2e-33    
gb|AGK44193.1|  4-hydroxyphenylpyruvate dioxygenase                     136   2e-33    
gb|ACU06906.1|  4-hydroxyphenylpyruvate dioxygenase                     135   2e-33    
gb|EEK52737.1|  4-hydroxyphenylpyruvate dioxygenase                     136   2e-33    
ref|WP_042565494.1|  4-hydroxyphenylpyruvate dioxygenase                136   2e-33    
gb|EEM49828.1|  4-hydroxyphenylpyruvate dioxygenase                     136   2e-33    
gb|EEK46877.1|  4-hydroxyphenylpyruvate dioxygenase                     136   2e-33    
ref|WP_026166657.1|  4-hydroxyphenylpyruvate dioxygenase                135   2e-33    
gb|EEM61947.1|  4-hydroxyphenylpyruvate dioxygenase                     136   2e-33    
ref|XP_011819872.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     136   2e-33    
ref|XP_001096175.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    136   2e-33    
ref|XP_003227978.2|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     137   2e-33    
gb|AHA08869.1|  4-hydroxyphenylpyruvate dioxygenase                     136   2e-33    
gb|EEL36476.1|  4-hydroxyphenylpyruvate dioxygenase                     136   2e-33    
gb|EAO55509.1|  4-hydroxyphenylpyruvate dioxygenase                     136   2e-33    
gb|EEM30895.1|  4-hydroxyphenylpyruvate dioxygenase                     136   2e-33    
gb|EEL24963.1|  4-hydroxyphenylpyruvate dioxygenase                     136   2e-33    
ref|XP_010366639.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    136   2e-33    
ref|WP_033694710.1|  4-hydroxyphenylpyruvate dioxygenase                135   2e-33    
ref|WP_000810912.1|  4-hydroxyphenylpyruvate dioxygenase                135   2e-33    
ref|WP_039343577.1|  4-hydroxyphenylpyruvate dioxygenase                136   2e-33    
ref|WP_035334766.1|  4-hydroxyphenylpyruvate dioxygenase                136   2e-33    
gb|ABK83632.1|  4-hydroxyphenylpyruvate dioxygenase                     136   2e-33    
ref|WP_000810915.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...    135   2e-33    
ref|WP_001975475.1|  4-hydroxyphenylpyruvate dioxygenase                135   2e-33    
ref|WP_045969995.1|  4-hydroxyphenylpyruvate dioxygenase                136   2e-33    
ref|WP_027377697.1|  4-hydroxyphenylpyruvate dioxygenase                135   3e-33    
ref|XP_008003203.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    135   3e-33    
ref|WP_000810924.1|  4-hydroxyphenylpyruvate dioxygenase                135   3e-33    
gb|EEK86219.1|  4-hydroxyphenylpyruvate dioxygenase                     135   3e-33    
ref|WP_045523940.1|  4-hydroxyphenylpyruvate dioxygenase                135   3e-33    
ref|WP_026953937.1|  4-hydroxyphenylpyruvate dioxygenase                135   3e-33    
ref|WP_041252425.1|  4-hydroxyphenylpyruvate dioxygenase                135   3e-33    
ref|WP_017154241.1|  4-hydroxyphenylpyruvate dioxygenase                135   3e-33    
ref|WP_013750370.1|  4-hydroxyphenylpyruvate dioxygenase                135   3e-33    
ref|XP_007079640.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     135   3e-33    
gb|EEK80866.1|  4-hydroxyphenylpyruvate dioxygenase                     135   3e-33    
ref|WP_021792273.1|  hypothetical protein                               135   3e-33    
ref|WP_027384831.1|  4-hydroxyphenylpyruvate dioxygenase                135   3e-33    
ref|XP_004690776.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     136   3e-33    
ref|WP_023573098.1|  hppD protein                                       135   3e-33    
ref|WP_020213884.1|  4-hydroxyphenylpyruvate dioxygenase                135   3e-33    
ref|WP_039351458.1|  4-hydroxyphenylpyruvate dioxygenase                135   4e-33    
ref|XP_010366638.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    136   4e-33    
ref|WP_031426681.1|  4-hydroxyphenylpyruvate dioxygenase                135   4e-33    
ref|WP_034697426.1|  4-hydroxyphenylpyruvate dioxygenase                135   4e-33    
ref|WP_009334741.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...    135   4e-33    
ref|XP_006746592.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     135   4e-33    
ref|WP_002984319.1|  4-hydroxyphenylpyruvate dioxygenase                135   4e-33    
ref|WP_029298941.1|  4-hydroxyphenylpyruvate dioxygenase                135   4e-33    
ref|WP_019421079.1|  4-hydroxyphenylpyruvate dioxygenase                135   4e-33    
ref|WP_009778508.1|  4-hydroxyphenylpyruvate dioxygenase                135   4e-33    
ref|WP_023571103.1|  hppD protein                                       135   4e-33    
ref|WP_034761020.1|  4-hydroxyphenylpyruvate dioxygenase                135   4e-33    
ref|WP_029071850.1|  4-hydroxyphenylpyruvate dioxygenase                135   4e-33    
ref|WP_027379233.1|  4-hydroxyphenylpyruvate dioxygenase                135   5e-33    
ref|XP_011224430.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     134   5e-33    
ref|WP_029997310.1|  4-hydroxyphenylpyruvate dioxygenase                135   5e-33    
ref|XP_008003202.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    135   5e-33    
ref|WP_026703724.1|  4-hydroxyphenylpyruvate dioxygenase                135   5e-33    
ref|WP_044202951.1|  4-hydroxyphenylpyruvate dioxygenase                134   5e-33    
ref|XP_853422.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase        135   5e-33    
ref|WP_021794122.1|  hypothetical protein                               134   6e-33    
ref|WP_010171291.1|  4-hydroxyphenylpyruvate dioxygenase                134   6e-33    
ref|WP_023578784.1|  hppD protein                                       135   6e-33    
ref|XP_007936338.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     134   6e-33    
ref|XP_011482032.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    134   6e-33    
ref|XP_006865456.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     134   6e-33    
ref|WP_008255156.1|  4-hydroxyphenylpyruvate dioxygenase                135   6e-33    
ref|WP_018676561.1|  4-hydroxyphenylpyruvate dioxygenase                134   6e-33    
ref|NP_001088204.1|  4-hydroxyphenylpyruvate dioxygenase                135   7e-33    
ref|XP_005926940.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    135   7e-33    
ref|XP_005926939.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    135   7e-33    
ref|WP_026443267.1|  4-hydroxyphenylpyruvate dioxygenase                134   7e-33    
ref|WP_007778924.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...    134   7e-33    
ref|XP_004544245.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    135   7e-33    
ref|WP_034756925.1|  4-hydroxyphenylpyruvate dioxygenase                134   7e-33    
gb|EFB19362.1|  hypothetical protein PANDA_000905                       134   7e-33    
ref|XP_004322992.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     135   7e-33    
ref|WP_027000962.1|  4-hydroxyphenylpyruvate dioxygenase                134   7e-33    
ref|XP_004276751.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     134   7e-33    
ref|WP_024980676.1|  4-hydroxyphenylpyruvate dioxygenase                134   7e-33    
ref|XP_005329642.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    134   7e-33    
ref|WP_042722980.1|  4-hydroxyphenylpyruvate dioxygenase                134   8e-33    
ref|WP_000810916.1|  4-hydroxyphenylpyruvate dioxygenase                134   8e-33    
ref|WP_014389737.1|  4-hydroxyphenylpyruvate dioxygenase                134   8e-33    
ref|WP_043097519.1|  4-hydroxyphenylpyruvate dioxygenase                134   9e-33    
ref|WP_034703907.1|  4-hydroxyphenylpyruvate dioxygenase                134   9e-33    
ref|WP_013686733.1|  4-hydroxyphenylpyruvate dioxygenase                134   9e-33    
ref|WP_035350816.1|  4-hydroxyphenylpyruvate dioxygenase                134   9e-33    
ref|XP_005800839.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    134   9e-33    
gb|EDL65287.1|  4-hydroxyphenylpyruvate dioxygenase                     134   9e-33    
ref|WP_016089597.1|  4-hydroxyphenylpyruvate dioxygenase                134   9e-33    
ref|XP_008248783.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     134   9e-33    
ref|WP_044022537.1|  4-hydroxyphenylpyruvate dioxygenase                134   9e-33    
ref|WP_036120629.1|  4-hydroxyphenylpyruvate dioxygenase                134   9e-33    
ref|XP_004076648.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    134   9e-33    
ref|XP_005729564.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    134   1e-32    
ref|WP_045080225.1|  4-hydroxyphenylpyruvate dioxygenase                134   1e-32    
ref|WP_026989882.1|  4-hydroxyphenylpyruvate dioxygenase                134   1e-32    
ref|WP_007646924.1|  4-hydroxyphenylpyruvate dioxygenase                134   1e-32    
ref|WP_040626239.1|  4-hydroxyphenylpyruvate dioxygenase                134   1e-32    
ref|WP_045493744.1|  4-hydroxyphenylpyruvate dioxygenase                134   1e-32    
ref|WP_002151375.1|  4-hydroxyphenylpyruvate dioxygenase                134   1e-32    
ref|WP_005835220.1|  4-hydroxyphenylpyruvate dioxygenase                134   1e-32    
ref|WP_027388528.1|  4-hydroxyphenylpyruvate dioxygenase                134   1e-32    
ref|WP_026357374.1|  4-hydroxyphenylpyruvate dioxygenase                134   1e-32    
ref|WP_000810926.1|  4-hydroxyphenylpyruvate dioxygenase                134   1e-32    
ref|WP_015898344.1|  4-hydroxyphenylpyruvate dioxygenase                134   1e-32    
gb|EEK69629.1|  4-hydroxyphenylpyruvate dioxygenase                     134   1e-32    
ref|WP_002115481.1|  4-hydroxyphenylpyruvate dioxygenase                134   1e-32    
ref|WP_005547721.1|  4-hydroxyphenylpyruvate dioxygenase                134   1e-32    
gb|EHQ28394.1|  4-hydroxyphenylpyruvate dioxygenase                     134   1e-32    
ref|WP_002175349.1|  4-hydroxyphenylpyruvate dioxygenase                134   1e-32    
ref|WP_002113414.1|  4-hydroxyphenylpyruvate dioxygenase                134   1e-32    
gb|KFM60386.1|  4-hydroxyphenylpyruvate dioxygenase                     134   1e-32    
ref|WP_040996642.1|  4-hydroxyphenylpyruvate dioxygenase                134   1e-32    
ref|WP_025151089.1|  4-hydroxyphenylpyruvate dioxygenase                134   1e-32    
ref|WP_016103358.1|  4-hydroxyphenylpyruvate dioxygenase                134   1e-32    
ref|XP_006015255.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    134   1e-32    
ref|XP_010994196.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     133   1e-32    
ref|WP_024028907.1|  4-hydroxyphenylpyruvate dioxygenase                134   1e-32    
ref|XP_006805917.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    134   1e-32    
ref|WP_027373845.1|  4-hydroxyphenylpyruvate dioxygenase                134   1e-32    
ref|WP_002091386.1|  4-hydroxyphenylpyruvate dioxygenase                134   1e-32    
ref|NP_999389.1|  4-hydroxyphenylpyruvate dioxygenase                   134   1e-32    
ref|WP_034737515.1|  4-hydroxyphenylpyruvate dioxygenase                134   1e-32    
ref|XP_010602694.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    133   1e-32    
ref|XP_010602695.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    133   1e-32    
ref|WP_033715568.1|  4-hydroxyphenylpyruvate dioxygenase                134   1e-32    
ref|XP_006258030.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     134   1e-32    
gb|ACO51111.1|  4-hydroxyphenylpyruvate dioxygenase                     129   1e-32    
ref|WP_028889874.1|  4-hydroxyphenylpyruvate dioxygenase                134   1e-32    
ref|WP_007841123.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...    134   1e-32    
ref|NP_001104220.1|  uncharacterized protein LOC100126650               134   1e-32    
ref|WP_013306092.1|  4-hydroxyphenylpyruvate dioxygenase                134   1e-32    
ref|WP_008200613.1|  4-hydroxyphenylpyruvate dioxygenase                133   1e-32    
ref|XP_006047225.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     134   1e-32    
ref|WP_034970195.1|  4-hydroxyphenylpyruvate dioxygenase                134   1e-32    
ref|WP_013069704.1|  4-hydroxyphenylpyruvate dioxygenase                134   2e-32    
ref|XP_003445580.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    134   2e-32    
ref|XP_007128853.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     134   2e-32    
ref|WP_002139868.1|  4-hydroxyphenylpyruvate dioxygenase                133   2e-32    
ref|WP_026576504.1|  4-hydroxyphenylpyruvate dioxygenase                133   2e-32    
ref|WP_002140158.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...    133   2e-32    
gb|KEZ79714.1|  4-hydroxyphenylpyruvate dioxygenase                     133   2e-32    
ref|WP_002124802.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...    133   2e-32    
ref|WP_000810917.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...    133   2e-32    
ref|XP_005080731.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     132   2e-32    
ref|NP_001091344.1|  uncharacterized protein LOC100037181               134   2e-32    
ref|XP_010893396.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    133   2e-32    
ref|WP_010194005.1|  4-hydroxyphenylpyruvate dioxygenase                133   2e-32    
ref|XP_006209618.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     134   2e-32    
gb|AKA49355.1|  4-hydroxyphenylpyruvate dioxygenase                     133   2e-32    
ref|XP_004668529.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     134   2e-32    
ref|XP_010602691.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    134   2e-32    
gb|EQB77355.1|  4-hydroxyphenylpyruvate dioxygenase                     134   2e-32    
ref|XP_010602693.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    133   2e-32    
gb|EEL08156.1|  4-hydroxyphenylpyruvate dioxygenase                     133   2e-32    
ref|WP_039364671.1|  4-hydroxyphenylpyruvate dioxygenase                133   2e-32    
ref|WP_034710537.1|  4-hydroxyphenylpyruvate dioxygenase                133   2e-32    
ref|WP_038335703.1|  4-hydroxyphenylpyruvate dioxygenase                133   2e-32    
ref|WP_015266773.1|  4-hydroxyphenylpyruvate dioxygenase                133   2e-32    
ref|WP_032085540.1|  4-hydroxyphenylpyruvate dioxygenase                133   2e-32    
ref|XP_010893395.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    133   2e-32    
gb|EEM01328.1|  4-hydroxyphenylpyruvate dioxygenase                     133   2e-32    
gb|EEL89883.1|  4-hydroxyphenylpyruvate dioxygenase                     133   2e-32    
ref|XP_010602692.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    133   2e-32    
ref|XP_008837565.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     133   2e-32    
ref|XP_007626321.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     132   2e-32    
ref|XP_004017393.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     133   2e-32    
gb|EEK75276.1|  4-hydroxyphenylpyruvate dioxygenase                     133   2e-32    
gb|ABX05402.1|  4-hydroxyphenylpyruvate dioxygenase                     133   2e-32    
gb|AGK44196.1|  4-hydroxyphenylpyruvate dioxygenase                     133   2e-32    
ref|WP_041306409.1|  4-hydroxyphenylpyruvate dioxygenase                133   2e-32    
ref|WP_026951577.1|  4-hydroxyphenylpyruvate dioxygenase                133   2e-32    
ref|WP_028401030.1|  4-hydroxyphenylpyruvate dioxygenase                133   2e-32    
ref|WP_035423065.1|  4-hydroxyphenylpyruvate dioxygenase                133   2e-32    
ref|WP_034673352.1|  4-hydroxyphenylpyruvate dioxygenase                133   2e-32    
ref|XP_010602690.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    134   2e-32    
ref|WP_034741798.1|  4-hydroxyphenylpyruvate dioxygenase                133   2e-32    
ref|WP_010517714.1|  4-hydroxyphenylpyruvate dioxygenase                133   2e-32    
ref|XP_007489935.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     132   2e-32    



>ref|XP_006354418.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Solanum 
tuberosum]
Length=442

 Score =   328 bits (842),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 178/189 (94%), Gaps = 0/189 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GTAESGLNSVVLANNDETV LP+NEPV+GTKRKSQIQTYLEHNEG G+QHLAL +EDIFR
Sbjct  252  GTAESGLNSVVLANNDETVLLPMNEPVYGTKRKSQIQTYLEHNEGAGVQHLALVTEDIFR  311

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RSG+GGFEFMPSPPPTYYKNLKSRAGDVLSDEQI+ CE+LGILVDRDDQGTLL
Sbjct  312  TLREMRKRSGVGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIQACEDLGILVDRDDQGTLL  371

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPT+FIEIIQR+GCM+K E+G+VYQKGGCGGFGKGNFSELF+SIEEYEKML
Sbjct  372  QIFTKPVGDRPTIFIEIIQRIGCMLKDENGQVYQKGGCGGFGKGNFSELFRSIEEYEKML  431

Query  305  EAKQAIHAA  279
            EAK     A
Sbjct  432  EAKHVNQVA  440



>ref|XP_004243609.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase [Solanum lycopersicum]
Length=441

 Score =   328 bits (841),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 166/189 (88%), Positives = 178/189 (94%), Gaps = 0/189 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GTAESGLNSVVLANNDETV  PLNEPV+GTKRKSQIQTYLEHNEG G+QHLAL +EDIFR
Sbjct  251  GTAESGLNSVVLANNDETVLFPLNEPVYGTKRKSQIQTYLEHNEGAGVQHLALVTEDIFR  310

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RSGIGGFEFMPSPPPTYYKNLK+RAGD+LSDEQI+ECEELGILVDRDDQGTLL
Sbjct  311  TLREMRKRSGIGGFEFMPSPPPTYYKNLKTRAGDILSDEQIQECEELGILVDRDDQGTLL  370

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPT+F+EIIQR+GCM+K E+GE+YQKGGCGGFGKGNFSELFKSIEEYEK L
Sbjct  371  QIFTKPVGDRPTIFLEIIQRIGCMLKNEEGELYQKGGCGGFGKGNFSELFKSIEEYEKTL  430

Query  305  EAKQAIHAA  279
            EAKQ    A
Sbjct  431  EAKQNTQVA  439



>ref|XP_006357690.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Solanum 
tuberosum]
Length=447

 Score =   328 bits (841),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 166/189 (88%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GTAESGLNSVVLANNDETV  PLNEPV+GTKRKSQIQTYLEHNEG G+QHLAL +EDIFR
Sbjct  257  GTAESGLNSVVLANNDETVLFPLNEPVYGTKRKSQIQTYLEHNEGAGVQHLALVTEDIFR  316

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RSGIGGFEFMPSPPPTYYKNLKSRAGD+LSDEQIKECEELGILVDRDDQGTLL
Sbjct  317  TLREMRKRSGIGGFEFMPSPPPTYYKNLKSRAGDILSDEQIKECEELGILVDRDDQGTLL  376

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPT+F+EIIQR+GCM++  +GE+YQKGGCGGFGKGNFSELFKSIEEYEK L
Sbjct  377  QIFTKPVGDRPTIFLEIIQRIGCMLQNAEGELYQKGGCGGFGKGNFSELFKSIEEYEKTL  436

Query  305  EAKQAIHAA  279
            EAKQ    A
Sbjct  437  EAKQNTQVA  445



>ref|XP_004240171.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Solanum 
lycopersicum]
Length=441

 Score =   326 bits (835),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 164/189 (87%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GTAESGLNSVVLANNDETV LPLNEPV+GTKRKSQIQTYLEHNEG G+QHLAL +EDIFR
Sbjct  250  GTAESGLNSVVLANNDETVLLPLNEPVYGTKRKSQIQTYLEHNEGAGVQHLALVTEDIFR  309

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREM  RSG+GGFEFMP+PPPTYYKNL+SRAGDVLSDEQI+ CEELGILVDRDDQGTLL
Sbjct  310  TLREMWKRSGVGGFEFMPAPPPTYYKNLRSRAGDVLSDEQIQACEELGILVDRDDQGTLL  369

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPT+FIEIIQR+GCM+K E G+VYQKGGCGGFGKGNFSELF+SIEEYEKML
Sbjct  370  QIFTKPVGDRPTIFIEIIQRIGCMLKDEKGQVYQKGGCGGFGKGNFSELFRSIEEYEKML  429

Query  305  EAKQAIHAA  279
            EAK     A
Sbjct  430  EAKHVNQVA  438



>gb|ADZ24701.1| 4-hydroxyphenylpyruvate dioxygenase 2 [Solanum pennellii]
Length=441

 Score =   324 bits (831),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GTAESGLNSVVLANNDETV LPLNEPV+GTKRKSQIQTYLEHNEG G+QHLAL +EDIFR
Sbjct  250  GTAESGLNSVVLANNDETVLLPLNEPVYGTKRKSQIQTYLEHNEGAGVQHLALVTEDIFR  309

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREM  RSG+GGFEFMP+PPPTYYKNL+SRAGDVLSDEQI+ CEELGILVDRDDQGTLL
Sbjct  310  TLREMWKRSGVGGFEFMPAPPPTYYKNLRSRAGDVLSDEQIQACEELGILVDRDDQGTLL  369

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPT+FIEIIQR+GCM+K E G+VYQKGGCGGFGKGNFSELF+SIEEYEKM 
Sbjct  370  QIFTKPVGDRPTIFIEIIQRIGCMLKDEKGQVYQKGGCGGFGKGNFSELFRSIEEYEKMF  429

Query  305  EAKQAIHAA  279
            EAK     A
Sbjct  430  EAKHVNQVA  438



>ref|XP_009770088.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase [Nicotiana sylvestris]
Length=447

 Score =   324 bits (831),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GTAESGLNS+VLANNDETV LPLNEPV+GTKRKSQIQTYLEHNEG G+QHLAL +EDIF+
Sbjct  257  GTAESGLNSMVLANNDETVLLPLNEPVYGTKRKSQIQTYLEHNEGAGVQHLALVTEDIFK  316

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TL EMR RSG+GGFEFMPSPPPTYYKNLK+RAGDVL+DEQI+ CEELGILVDRDDQGTLL
Sbjct  317  TLTEMRKRSGVGGFEFMPSPPPTYYKNLKNRAGDVLTDEQIQACEELGILVDRDDQGTLL  376

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPT+FIEIIQR+GCM+K E G+VYQKGGCGGFGKGNFSELF+SIEEYEK L
Sbjct  377  QIFTKPVGDRPTIFIEIIQRIGCMLKDEKGQVYQKGGCGGFGKGNFSELFRSIEEYEKTL  436

Query  305  EAKQAIHAA  279
            EAKQA   A
Sbjct  437  EAKQANQVA  445



>emb|CDY10210.1| BnaC05g04530D [Brassica napus]
Length=445

 Score =   324 bits (831),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 162/186 (87%), Positives = 174/186 (94%), Gaps = 0/186 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GTAESGLNS VLANNDETV LP+NEPVHGTKRKSQIQTYLEHNEG G+QHLAL SEDIF+
Sbjct  259  GTAESGLNSAVLANNDETVLLPVNEPVHGTKRKSQIQTYLEHNEGAGVQHLALMSEDIFK  318

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RSG+GGF+FMPSPPPTYYKNLK+R GDVLSDE+IKECEELGILVDRDDQGTLL
Sbjct  319  TLREMRKRSGVGGFDFMPSPPPTYYKNLKNRVGDVLSDEEIKECEELGILVDRDDQGTLL  378

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKP+GDRPT+FIEIIQR+GCM K E+G VYQ GGCGGFGKGNFSELFKSIEEYEK L
Sbjct  379  QIFTKPLGDRPTIFIEIIQRIGCMKKDEEGRVYQSGGCGGFGKGNFSELFKSIEEYEKTL  438

Query  305  EAKQAI  288
            EAKQ +
Sbjct  439  EAKQLV  444



>gb|AFB74218.1| 4-hydroxyphenylpyruvate dioxygenase [Brassica napus]
 emb|CDY06216.1| BnaA09g49870D [Brassica napus]
Length=440

 Score =   324 bits (830),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 163/186 (88%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GTAESGLNS VLANNDE V LP+NEPVHGTKRKSQIQT+LEHNEG GLQHLAL SEDIFR
Sbjct  254  GTAESGLNSAVLANNDEMVLLPVNEPVHGTKRKSQIQTFLEHNEGAGLQHLALMSEDIFR  313

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RSG+GGF+FMPSPPPTYYKNLK R GDVLSDEQI+ECEELGILVDRDDQGTLL
Sbjct  314  TLREMRKRSGVGGFDFMPSPPPTYYKNLKKRIGDVLSDEQIRECEELGILVDRDDQGTLL  373

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKP+GDRPT+FIEIIQRVGCM K E+G+VYQ GGCGGFGKGNFSELFKSIEEYEK L
Sbjct  374  QIFTKPLGDRPTIFIEIIQRVGCMKKDEEGKVYQSGGCGGFGKGNFSELFKSIEEYEKTL  433

Query  305  EAKQAI  288
            EAKQ +
Sbjct  434  EAKQLV  439



>ref|XP_002892349.1| 4-hydroxyphenylpyruvate dioxygenase [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68608.1| 4-hydroxyphenylpyruvate dioxygenase [Arabidopsis lyrata subsp. 
lyrata]
Length=445

 Score =   323 bits (829),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 164/186 (88%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GTAESGLNS VLANNDE V LP+NEPVHGTKRKSQIQTYLEHNEG GLQHLAL SEDIFR
Sbjct  259  GTAESGLNSAVLANNDEMVLLPINEPVHGTKRKSQIQTYLEHNEGAGLQHLALMSEDIFR  318

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RS IGGF+FMPSPPPTYY+NLK R GDVLSDEQIKECEELGILVDRDDQGTLL
Sbjct  319  TLREMRKRSSIGGFDFMPSPPPTYYQNLKKRVGDVLSDEQIKECEELGILVDRDDQGTLL  378

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKP+GDRPT+FIEIIQRVGCMMK E+G+ YQ GGCGGFGKGNFSELFKSIEEYEK L
Sbjct  379  QIFTKPLGDRPTIFIEIIQRVGCMMKDEEGKAYQSGGCGGFGKGNFSELFKSIEEYEKTL  438

Query  305  EAKQAI  288
            EAKQ +
Sbjct  439  EAKQLV  444



>ref|XP_011100558.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase isoform X1 [Sesamum 
indicum]
Length=496

 Score =   325 bits (834),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GTAESGLNSVVLANN+E V  PLNEPV+GTKRKSQIQTYLEHNEG G+QHLAL SEDIFR
Sbjct  306  GTAESGLNSVVLANNNENVLFPLNEPVYGTKRKSQIQTYLEHNEGSGVQHLALVSEDIFR  365

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RSGIGGFEFMPSPPPTYYKNLKSRAGDVL+DEQI+ECE+LGILVDRDDQGTLL
Sbjct  366  TLREMRKRSGIGGFEFMPSPPPTYYKNLKSRAGDVLTDEQIQECEKLGILVDRDDQGTLL  425

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPT+FIEIIQR+GCM+K E+G +YQKGGCGGFGKGNFSELFKSIEEYEKML
Sbjct  426  QIFTKPVGDRPTIFIEIIQRIGCMLKDEEGTLYQKGGCGGFGKGNFSELFKSIEEYEKML  485

Query  305  EAKQAIHAA  279
            EAK     A
Sbjct  486  EAKHVTETA  494



>ref|XP_009118533.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase [Brassica rapa]
Length=443

 Score =   322 bits (825),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 162/186 (87%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GTAESGLNS VLA+NDE V LP+NEPVHGTKRKSQIQT+LEHNEG GLQHLAL SEDIFR
Sbjct  257  GTAESGLNSAVLASNDEMVLLPVNEPVHGTKRKSQIQTFLEHNEGAGLQHLALMSEDIFR  316

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RSG+GGF+FMPSPPPTYYKNLK R GDVLSDEQI+ECEELGILVDRDDQGTLL
Sbjct  317  TLREMRKRSGVGGFDFMPSPPPTYYKNLKKRVGDVLSDEQIRECEELGILVDRDDQGTLL  376

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKP+GDRPT+FIEIIQRVGCM K E+G+VYQ GGCGGFGKGNFSELFKSIEEYEK L
Sbjct  377  QIFTKPLGDRPTIFIEIIQRVGCMKKDEEGKVYQSGGCGGFGKGNFSELFKSIEEYEKTL  436

Query  305  EAKQAI  288
            EAKQ +
Sbjct  437  EAKQLV  442



>ref|XP_004303888.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase [Fragaria vesca 
subsp. vesca]
Length=434

 Score =   322 bits (824),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 175/184 (95%), Gaps = 0/184 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT+ESGLNSVVLA+NDETV LP+NEPV+GTKRKSQIQTYLEHNEG G+QHLAL SEDIFR
Sbjct  244  GTSESGLNSVVLASNDETVLLPMNEPVYGTKRKSQIQTYLEHNEGAGVQHLALVSEDIFR  303

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RSGIGGF+FMPSPPPTYY+NLK RAGDVL+DEQIKECEELGILVDRDDQGTLL
Sbjct  304  TLREMRQRSGIGGFDFMPSPPPTYYRNLKKRAGDVLTDEQIKECEELGILVDRDDQGTLL  363

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPT+FIEIIQRVGCM+K E+G+ YQKGGCGGFGKGNFS LFKSIEEYEK L
Sbjct  364  QIFTKPVGDRPTIFIEIIQRVGCMLKNEEGKEYQKGGCGGFGKGNFSALFKSIEEYEKTL  423

Query  305  EAKQ  294
            EA+Q
Sbjct  424  EARQ  427



>ref|XP_010087866.1| 4-hydroxyphenylpyruvate dioxygenase [Morus notabilis]
 gb|EXB30302.1| 4-hydroxyphenylpyruvate dioxygenase [Morus notabilis]
Length=437

 Score =   322 bits (824),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 161/189 (85%), Positives = 180/189 (95%), Gaps = 0/189 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT+ESGLNSVVL+NNDETV +P+NEPV+GTKRKSQIQTYLEHNEG G+QHLAL SEDIFR
Sbjct  247  GTSESGLNSVVLSNNDETVLIPMNEPVYGTKRKSQIQTYLEHNEGAGVQHLALVSEDIFR  306

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR+RSG+GGFEFMPSPPPTYYKNL+ RA +VL++EQ+KEC+ELGILVDRDDQGTLL
Sbjct  307  TLREMRSRSGVGGFEFMPSPPPTYYKNLRHRAAEVLTEEQMKECQELGILVDRDDQGTLL  366

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPT+FIEIIQRVGCMMK E+G++YQKGGCGGFGKGNFSELFKSIEEYEK L
Sbjct  367  QIFTKPVGDRPTIFIEIIQRVGCMMKDEEGKLYQKGGCGGFGKGNFSELFKSIEEYEKTL  426

Query  305  EAKQAIHAA  279
            EAKQA  +A
Sbjct  427  EAKQAAGSA  435



>ref|XP_002520369.1| 4-hydroxyphenylpyruvate dioxygenase, putative [Ricinus communis]
 gb|EEF41985.1| 4-hydroxyphenylpyruvate dioxygenase, putative [Ricinus communis]
Length=441

 Score =   322 bits (824),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT+ESGLNSVVLANN+ETV +P+NEPV GTKRKSQIQTYLEHNEG G+QHLAL SEDIFR
Sbjct  251  GTSESGLNSVVLANNEETVLIPMNEPVFGTKRKSQIQTYLEHNEGAGVQHLALASEDIFR  310

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RSG+GGFEFMPSPPPTYYKNLK+RAGDVLSDEQIKECEELGILVDRDDQGTLL
Sbjct  311  TLREMRKRSGVGGFEFMPSPPPTYYKNLKNRAGDVLSDEQIKECEELGILVDRDDQGTLL  370

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPT+FIEIIQRVGCM+K + G+ YQKGGCGGFGKGNFSELFKSIEE+EK L
Sbjct  371  QIFTKPVGDRPTIFIEIIQRVGCMLKDDAGKEYQKGGCGGFGKGNFSELFKSIEEFEKTL  430

Query  305  EAKQAIHAA  279
            EA++   AA
Sbjct  431  EARRVTEAA  439



>ref|XP_009587203.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase [Nicotiana tomentosiformis]
Length=447

 Score =   322 bits (825),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 162/189 (86%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GTAESGLNS+VLANNDETV LPLNEPV+GTKRKSQIQTYLEHNEG G+QHLAL +EDIF+
Sbjct  257  GTAESGLNSMVLANNDETVLLPLNEPVYGTKRKSQIQTYLEHNEGAGVQHLALVTEDIFK  316

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TL EMR RSG+GGFEFMPSPPPTYYKNLK+RAGDVL+DEQI+ CEELGILVDRDDQGTLL
Sbjct  317  TLTEMRKRSGVGGFEFMPSPPPTYYKNLKNRAGDVLTDEQIQACEELGILVDRDDQGTLL  376

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPT+FIEIIQR+GCM+K E G+VYQKGGCGGFGKGNFSELF+SIEEYEK L
Sbjct  377  QIFTKPVGDRPTIFIEIIQRIGCMLKDEKGQVYQKGGCGGFGKGNFSELFRSIEEYEKTL  436

Query  305  EAKQAIHAA  279
            EAKQ    A
Sbjct  437  EAKQVNQVA  445



>pdb|1SQD|A Chain A, Structural Basis For Inhibitor Selectivity Revealed 
By Crystal Structures Of Plant And Mammalian 4- Hydroxyphenylpyruvate 
Dioxygenases
 pdb|1TFZ|A Chain A, Structural Basis For Herbicidal Inhibitor Selectivity 
Revealed By Comparison Of Crystal Structures Of Plant And 
Mammalian 4- Hydroxyphenylpyruvate Dioxygenases
 pdb|1TG5|A Chain A, Crystal Structures Of Plant 4-Hydroxyphenylpyruvate 
Dioxygenases Complexed With Das645
Length=424

 Score =   321 bits (823),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 162/186 (87%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GTAESGLNS VLA+NDE V LP+NEPVHGTKRKSQIQTYLEHNEG GLQHLAL SEDIFR
Sbjct  238  GTAESGLNSAVLASNDEMVLLPINEPVHGTKRKSQIQTYLEHNEGAGLQHLALMSEDIFR  297

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RS IGGF+FMPSPPPTYY+NLK R GDVLSD+QIKECEELGILVDRDDQGTLL
Sbjct  298  TLREMRKRSSIGGFDFMPSPPPTYYQNLKKRVGDVLSDDQIKECEELGILVDRDDQGTLL  357

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKP+GDRPT+FIEIIQRVGCMMK E+G+ YQ GGCGGFGKGNFSELFKSIEEYEK L
Sbjct  358  QIFTKPLGDRPTIFIEIIQRVGCMMKDEEGKAYQSGGCGGFGKGNFSELFKSIEEYEKTL  417

Query  305  EAKQAI  288
            EAKQ +
Sbjct  418  EAKQLV  423



>sp|P93836.2|HPPD_ARATH RecName: Full=4-hydroxyphenylpyruvate dioxygenase; AltName: Full=4-hydroxyphenylpyruvic 
acid oxidase; Short=4HPPD; Short=HPD; 
Short=HPPDase [Arabidopsis thaliana]
 pdb|1SP9|A Chain A, 4-hydroxyphenylpyruvate Dioxygenase
 pdb|1SP9|B Chain B, 4-hydroxyphenylpyruvate Dioxygenase
 gb|AAL16215.1|AF428446_1 At1g06570/F12K11_12 [Arabidopsis thaliana]
 gb|AAB58404.1| p-hydroxyphenylpyruvate dioxygenase [Arabidopsis thaliana]
 gb|AAB70025.1| p-hydroxyphenylpyruvate dioxygenase [Arabidopsis thaliana]
 gb|AAC15697.1| 4-hydroxyphenylpyruvate dioxygenase [Arabidopsis thaliana]
 gb|AAL61936.1| 4-hydroxyphenylpyruvate dioxygenase (HPD) [Arabidopsis thaliana]
 gb|AAM91145.1| 4-hydroxyphenylpyruvate dioxygenase (HPD) [Arabidopsis thaliana]
Length=445

 Score =   321 bits (823),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 162/186 (87%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GTAESGLNS VLA+NDE V LP+NEPVHGTKRKSQIQTYLEHNEG GLQHLAL SEDIFR
Sbjct  259  GTAESGLNSAVLASNDEMVLLPINEPVHGTKRKSQIQTYLEHNEGAGLQHLALMSEDIFR  318

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RS IGGF+FMPSPPPTYY+NLK R GDVLSD+QIKECEELGILVDRDDQGTLL
Sbjct  319  TLREMRKRSSIGGFDFMPSPPPTYYQNLKKRVGDVLSDDQIKECEELGILVDRDDQGTLL  378

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKP+GDRPT+FIEIIQRVGCMMK E+G+ YQ GGCGGFGKGNFSELFKSIEEYEK L
Sbjct  379  QIFTKPLGDRPTIFIEIIQRVGCMMKDEEGKAYQSGGCGGFGKGNFSELFKSIEEYEKTL  438

Query  305  EAKQAI  288
            EAKQ +
Sbjct  439  EAKQLV  444



>ref|XP_010486350.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase [Camelina sativa]
Length=450

 Score =   321 bits (823),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 161/186 (87%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GTAESGLNS VLA+NDE V LP+NEPVHGTKRKSQIQTYLEHNEG GLQHLAL SEDIFR
Sbjct  264  GTAESGLNSAVLASNDEMVLLPINEPVHGTKRKSQIQTYLEHNEGAGLQHLALMSEDIFR  323

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RS +GGF+FMPSPPPTYY+NLK R GDVLSDEQIKECEELGILVDRDDQGTLL
Sbjct  324  TLREMRKRSSVGGFDFMPSPPPTYYQNLKKRVGDVLSDEQIKECEELGILVDRDDQGTLL  383

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKP+GDRPT+FIEIIQRVGCMMK ++G+ YQ GGCGGFGKGNFSELFKSIEEYEK L
Sbjct  384  QIFTKPLGDRPTIFIEIIQRVGCMMKDDEGKAYQSGGCGGFGKGNFSELFKSIEEYEKTL  443

Query  305  EAKQAI  288
            EAKQ +
Sbjct  444  EAKQLV  449



>ref|NP_172144.2| 4-hydroxyphenylpyruvate dioxygenase [Arabidopsis thaliana]
 gb|AAF24813.1|AC007592_6 F12K11.9 [Arabidopsis thaliana]
 gb|AEE28006.1| 4-hydroxyphenylpyruvate dioxygenase [Arabidopsis thaliana]
Length=473

 Score =   322 bits (825),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 162/186 (87%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GTAESGLNS VLA+NDE V LP+NEPVHGTKRKSQIQTYLEHNEG GLQHLAL SEDIFR
Sbjct  287  GTAESGLNSAVLASNDEMVLLPINEPVHGTKRKSQIQTYLEHNEGAGLQHLALMSEDIFR  346

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RS IGGF+FMPSPPPTYY+NLK R GDVLSD+QIKECEELGILVDRDDQGTLL
Sbjct  347  TLREMRKRSSIGGFDFMPSPPPTYYQNLKKRVGDVLSDDQIKECEELGILVDRDDQGTLL  406

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKP+GDRPT+FIEIIQRVGCMMK E+G+ YQ GGCGGFGKGNFSELFKSIEEYEK L
Sbjct  407  QIFTKPLGDRPTIFIEIIQRVGCMMKDEEGKAYQSGGCGGFGKGNFSELFKSIEEYEKTL  466

Query  305  EAKQAI  288
            EAKQ +
Sbjct  467  EAKQLV  472



>gb|AAM96960.1| 4-hydroxyphenylpyruvate dioxygenase HPD [Arabidopsis thaliana]
Length=473

 Score =   322 bits (825),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 162/186 (87%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GTAESGLNS VLA+NDE V LP+NEPVHGTKRKSQIQTYLEHNEG GLQHLAL SEDIFR
Sbjct  287  GTAESGLNSAVLASNDEMVLLPINEPVHGTKRKSQIQTYLEHNEGAGLQHLALMSEDIFR  346

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RS IGGF+FMPSPPPTYY+NLK R GDVLSD+QIKECEELGILVDRDDQGTLL
Sbjct  347  TLREMRKRSSIGGFDFMPSPPPTYYQNLKKRVGDVLSDDQIKECEELGILVDRDDQGTLL  406

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKP+GDRPT+FIEIIQRVGCMMK E+G+ YQ GGCGGFGKGNFSELFKSIEEYEK L
Sbjct  407  QIFTKPLGDRPTIFIEIIQRVGCMMKDEEGKAYQSGGCGGFGKGNFSELFKSIEEYEKTL  466

Query  305  EAKQAI  288
            EAKQ +
Sbjct  467  EAKQLV  472



>ref|XP_006437130.1| hypothetical protein CICLE_v10031587mg [Citrus clementina]
 ref|XP_006484905.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Citrus sinensis]
 gb|ESR50370.1| hypothetical protein CICLE_v10031587mg [Citrus clementina]
 gb|KDO51875.1| hypothetical protein CISIN_1g013898mg [Citrus sinensis]
Length=434

 Score =   320 bits (821),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 162/189 (86%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT+ESGLNSVVLANNDE V LP+NEPV GTKRKSQIQTYLEHNEG G+QHLAL SEDIFR
Sbjct  244  GTSESGLNSVVLANNDEMVLLPMNEPVFGTKRKSQIQTYLEHNEGAGVQHLALVSEDIFR  303

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RSG+GGFEFMPSPPPTYYKNLK+RAGDVL+DEQIK+CEELG+LVDRDDQGTLL
Sbjct  304  TLREMRKRSGVGGFEFMPSPPPTYYKNLKNRAGDVLTDEQIKQCEELGVLVDRDDQGTLL  363

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPT+FIEIIQRVGCM+K E+G+ YQKGGCGGFGKGNFSELFKSIEEYEK L
Sbjct  364  QIFTKPVGDRPTIFIEIIQRVGCMLKDEEGKTYQKGGCGGFGKGNFSELFKSIEEYEKTL  423

Query  305  EAKQAIHAA  279
             AK     A
Sbjct  424  GAKPVAETA  432



>ref|XP_006417901.1| hypothetical protein EUTSA_v10007634mg [Eutrema salsugineum]
 dbj|BAJ34100.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ36254.1| hypothetical protein EUTSA_v10007634mg [Eutrema salsugineum]
Length=445

 Score =   321 bits (822),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 160/186 (86%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GTA+SGLNS VLANNDE V LP+NEPVHGTKRKSQIQTYLEHNEG GLQHLAL SEDIFR
Sbjct  260  GTADSGLNSAVLANNDEMVLLPINEPVHGTKRKSQIQTYLEHNEGAGLQHLALMSEDIFR  319

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RS +GGF+FMP+PPPTYY+NLK R GDVLSDEQIKECEELGILVDRDDQGTLL
Sbjct  320  TLREMRKRSSVGGFDFMPAPPPTYYQNLKKRVGDVLSDEQIKECEELGILVDRDDQGTLL  379

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKP+GDRPT+FIEIIQR+GCM K E+G+VYQ GGCGGFGKGNFSELFKSIEEYEK L
Sbjct  380  QIFTKPLGDRPTIFIEIIQRIGCMKKDEEGKVYQSGGCGGFGKGNFSELFKSIEEYEKTL  439

Query  305  EAKQAI  288
            EAKQ +
Sbjct  440  EAKQLV  445



>sp|O23920.1|HPPD_DAUCA RecName: Full=4-hydroxyphenylpyruvate dioxygenase; AltName: Full=4-hydroxyphenylpyruvic 
acid oxidase; Short=4HPPD; Short=HPD; 
Short=HPPDase [Daucus carota]
 gb|AAC49815.1| 4-hydroxyphenylpyruvate dioxygenase [Daucus carota]
Length=442

 Score =   320 bits (820),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 164/189 (87%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT ESGLNSVVLANN+E V LPLNEPV+GTKRKSQIQTYLEHNEG G+QHLAL SEDIFR
Sbjct  252  GTLESGLNSVVLANNEEMVLLPLNEPVYGTKRKSQIQTYLEHNEGAGVQHLALVSEDIFR  311

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RS +GGFEFMPSPPPTYYKNLK+R GDVLSDEQIKECE+LGILVDRDDQGTLL
Sbjct  312  TLREMRKRSCLGGFEFMPSPPPTYYKNLKNRVGDVLSDEQIKECEDLGILVDRDDQGTLL  371

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPTLFIEIIQRVGCM+K + G++YQKGGCGGFGKGNFSELFKSIEEYEK L
Sbjct  372  QIFTKPVGDRPTLFIEIIQRVGCMLKDDAGQMYQKGGCGGFGKGNFSELFKSIEEYEKTL  431

Query  305  EAKQAIHAA  279
            EAKQ   +A
Sbjct  432  EAKQITGSA  440



>ref|XP_002300867.2| 4-HYDROXYPHENYLPYRUVATE DIOXYGENASE family protein [Populus trichocarpa]
 gb|EEE80140.2| 4-HYDROXYPHENYLPYRUVATE DIOXYGENASE family protein [Populus trichocarpa]
Length=444

 Score =   320 bits (819),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT+ESGLNSVVLANN+ETV  P+NEPV GTKRKSQIQTYLEHNEG GLQHLAL SEDIFR
Sbjct  254  GTSESGLNSVVLANNEETVLFPMNEPVFGTKRKSQIQTYLEHNEGAGLQHLALVSEDIFR  313

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RS +GGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL
Sbjct  314  TLREMRKRSAVGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  373

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPT+FIEIIQRVGCM+K E G+ YQKGGCGGFGKGNFSELFKSIEEYEK L
Sbjct  374  QIFTKPVGDRPTMFIEIIQRVGCMLKDEKGKEYQKGGCGGFGKGNFSELFKSIEEYEKTL  433

Query  305  EAK  297
             AK
Sbjct  434  GAK  436



>ref|XP_010480368.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Camelina 
sativa]
Length=466

 Score =   320 bits (821),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 161/186 (87%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GTAESGLNS VLA+NDE V LP+NEPVHGTKRKSQIQTYLEHNEG GLQHLAL SEDIFR
Sbjct  280  GTAESGLNSAVLASNDEMVLLPINEPVHGTKRKSQIQTYLEHNEGAGLQHLALMSEDIFR  339

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RS +GGF+FMPSPPPTYY+NLK R GDVLSDEQIKECEELGILVDRDDQGTLL
Sbjct  340  TLREMRKRSSVGGFDFMPSPPPTYYQNLKKRVGDVLSDEQIKECEELGILVDRDDQGTLL  399

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKP+GDRPT+FIEIIQRVGCMMK ++G+ YQ GGCGGFGKGNFSELFKSIEEYEK L
Sbjct  400  QIFTKPLGDRPTIFIEIIQRVGCMMKDDEGKAYQSGGCGGFGKGNFSELFKSIEEYEKTL  459

Query  305  EAKQAI  288
            EAKQ +
Sbjct  460  EAKQLV  465



>ref|XP_011026229.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Populus 
euphratica]
Length=444

 Score =   320 bits (819),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT+ESGLNSVVLANN+ETV LP+NEPV GTKRKSQIQTYLEHNEG GLQHLAL SEDIFR
Sbjct  254  GTSESGLNSVVLANNEETVLLPMNEPVFGTKRKSQIQTYLEHNEGAGLQHLALVSEDIFR  313

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RS +GGFEFMPSPPPTYYKNLKSRAGDVLSDEQIK+CEELGILVDRDDQGTLL
Sbjct  314  TLREMRKRSAVGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKDCEELGILVDRDDQGTLL  373

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPT+FIEIIQRVGCM+K E G+ YQKGGCGGFGKGNFSELFKSIEEYEK L
Sbjct  374  QIFTKPVGDRPTIFIEIIQRVGCMLKDEKGKEYQKGGCGGFGKGNFSELFKSIEEYEKTL  433

Query  305  EAK  297
             AK
Sbjct  434  GAK  436



>ref|XP_006307507.1| hypothetical protein CARUB_v10009131mg [Capsella rubella]
 gb|EOA40405.1| hypothetical protein CARUB_v10009131mg [Capsella rubella]
Length=446

 Score =   320 bits (819),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 160/186 (86%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GTAESGLNS VLA+NDE V LP+NEPVHGTKRKSQIQTYLEHNEG GLQHLAL SEDIFR
Sbjct  260  GTAESGLNSAVLASNDEMVLLPINEPVHGTKRKSQIQTYLEHNEGAGLQHLALMSEDIFR  319

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RS +GGF+FMPSPPPTYY+NLK R GDVLSDEQIKECEELGILVDRDDQGTLL
Sbjct  320  TLREMRKRSSVGGFDFMPSPPPTYYQNLKKRVGDVLSDEQIKECEELGILVDRDDQGTLL  379

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKP+GDRPT+FIEIIQR+GCMMK ++G+ YQ GGCGGFGKGNFSELFKSIEEYEK L
Sbjct  380  QIFTKPLGDRPTIFIEIIQRIGCMMKDDEGKAYQSGGCGGFGKGNFSELFKSIEEYEKTL  439

Query  305  EAKQAI  288
            EAKQ +
Sbjct  440  EAKQLV  445



>ref|XP_008353631.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Malus domestica]
Length=457

 Score =   320 bits (820),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 175/184 (95%), Gaps = 0/184 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT+ESGLNSVVLANN+E V LP+NEPV+GTKRKSQIQTYLEHNEG GLQHLAL SEDIFR
Sbjct  267  GTSESGLNSVVLANNEEMVLLPMNEPVYGTKRKSQIQTYLEHNEGAGLQHLALVSEDIFR  326

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR+RS +GGF+FMP PPPTYY+NLK RAGDVL+DEQIKECEELGILVDRDDQGTLL
Sbjct  327  TLREMRSRSSVGGFQFMPKPPPTYYENLKKRAGDVLTDEQIKECEELGILVDRDDQGTLL  386

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPT+FIEIIQRVGCM+K E+G+V+QKGGCGGFGKGNFSELFKSIEEYEK L
Sbjct  387  QIFTKPVGDRPTMFIEIIQRVGCMLKNEEGKVHQKGGCGGFGKGNFSELFKSIEEYEKTL  446

Query  305  EAKQ  294
            EAKQ
Sbjct  447  EAKQ  450



>ref|XP_010457787.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Camelina 
sativa]
Length=450

 Score =   319 bits (818),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 160/186 (86%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GTAESGLNS VLA+NDE V LP+NEPVHGTKRKSQIQTYLEHNEG GLQHLAL SEDIFR
Sbjct  264  GTAESGLNSAVLASNDEMVLLPINEPVHGTKRKSQIQTYLEHNEGAGLQHLALMSEDIFR  323

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RS +GGF+FMPSPPPTYY+NLK R GDVLSDEQIKECEELGILVDRDDQGTLL
Sbjct  324  TLREMRKRSSVGGFDFMPSPPPTYYQNLKKRVGDVLSDEQIKECEELGILVDRDDQGTLL  383

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKP+GDRPT+FIEIIQRVGCMMK ++G+ YQ GGCG FGKGNFSELFKSIEEYEK L
Sbjct  384  QIFTKPLGDRPTIFIEIIQRVGCMMKDDEGKAYQSGGCGDFGKGNFSELFKSIEEYEKTL  443

Query  305  EAKQAI  288
            EAKQ +
Sbjct  444  EAKQLV  449



>ref|XP_009377128.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Pyrus x 
bretschneideri]
Length=440

 Score =   318 bits (816),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 162/189 (86%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT+ESGLNSVVLANN+E V LP+NEPV+GTKRKSQIQTYLEHNEG GLQHLAL SEDIFR
Sbjct  250  GTSESGLNSVVLANNEEMVLLPMNEPVYGTKRKSQIQTYLEHNEGAGLQHLALVSEDIFR  309

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR+RS +GGF+FMP PPPTYY NLK RAGDVL+DEQIKECEELGILVDRDDQGTLL
Sbjct  310  TLREMRSRSSVGGFQFMPKPPPTYYGNLKKRAGDVLTDEQIKECEELGILVDRDDQGTLL  369

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPT+FIEIIQRVGCM+K E+G+V+QKGGCGGFGKGNFSELFKSIEEYEK L
Sbjct  370  QIFTKPVGDRPTMFIEIIQRVGCMLKDEEGKVHQKGGCGGFGKGNFSELFKSIEEYEKTL  429

Query  305  EAKQAIHAA  279
            EAKQ    A
Sbjct  430  EAKQTAEPA  438



>sp|Q9ARF9.1|HPPD_PLESU RecName: Full=4-hydroxyphenylpyruvate dioxygenase; AltName: Full=4-hydroxyphenylpyruvic 
acid oxidase; Short=4HPPD; Short=HPD; 
Short=HPPDase [Solenostemon scutellarioides]
 emb|CAC37394.1| 4-hydroxyphenylpyruvate dioxygenase [Solenostemon scutellarioides]
Length=436

 Score =   318 bits (814),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 162/189 (86%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GTAESGLNSVVLANN+E V  PLNEPV+GTKRKSQIQTYL+HNEG G+QHLAL +EDIFR
Sbjct  246  GTAESGLNSVVLANNNENVLFPLNEPVYGTKRKSQIQTYLDHNEGAGVQHLALITEDIFR  305

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RS +GGFEFMPSPPPTYY+NLKSRAGDVLSDEQI+ECE+LGIL+DRDDQGTLL
Sbjct  306  TLREMRKRSEVGGFEFMPSPPPTYYRNLKSRAGDVLSDEQIEECEKLGILIDRDDQGTLL  365

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPTLFIEIIQRVGCMMK E+G++YQKGGCGGFGKGNFSELFKSIEEYEKML
Sbjct  366  QIFTKPVGDRPTLFIEIIQRVGCMMKDEEGKMYQKGGCGGFGKGNFSELFKSIEEYEKML  425

Query  305  EAKQAIHAA  279
            E+K     A
Sbjct  426  ESKLVTKTA  434



>gb|AID81984.1| hydroxyphenylpyruvate dioxygenase [Capsella bursa-pastoris]
Length=446

 Score =   318 bits (815),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 159/186 (85%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GTAESGLNS VLA+NDE V LP+NEPVHGTKRKSQIQTYLEHNEG GLQHLAL SEDIFR
Sbjct  260  GTAESGLNSAVLASNDEMVLLPINEPVHGTKRKSQIQTYLEHNEGAGLQHLALMSEDIFR  319

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RS +GGF+FMPSPPPTYY+NLK R GDVLSDEQIKECEELGILVDRDDQGTLL
Sbjct  320  TLREMRKRSSVGGFDFMPSPPPTYYQNLKKRVGDVLSDEQIKECEELGILVDRDDQGTLL  379

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKP+GDRPT+FIEIIQR+GCMMK ++G+ +Q GGCGGFGKGNFSELFKSIEEYEK L
Sbjct  380  QIFTKPLGDRPTIFIEIIQRIGCMMKDDEGKAFQSGGCGGFGKGNFSELFKSIEEYEKTL  439

Query  305  EAKQAI  288
            EAKQ +
Sbjct  440  EAKQLV  445



>gb|KFK42972.1| hypothetical protein AALP_AA1G063200 [Arabis alpina]
Length=439

 Score =   318 bits (814),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 159/186 (85%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GTAESGLNS VLA+NDE V LP+NEPVHGTKRKSQIQTYLEHNEG GLQHLAL SEDIF+
Sbjct  253  GTAESGLNSAVLASNDEMVLLPINEPVHGTKRKSQIQTYLEHNEGAGLQHLALMSEDIFK  312

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RS +GGF+FMPSPPPTYY+NLK+R GDVLSDE+IKECEELGILVDRDDQGTLL
Sbjct  313  TLREMRKRSSVGGFDFMPSPPPTYYRNLKNRVGDVLSDEKIKECEELGILVDRDDQGTLL  372

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKP+GDRPT+FIEIIQRVGCMMK E+G+VYQ GGCGGFGKGNFSELFKSIEEYEK L
Sbjct  373  QIFTKPLGDRPTIFIEIIQRVGCMMKDEEGKVYQSGGCGGFGKGNFSELFKSIEEYEKTL  432

Query  305  EAKQAI  288
            E K  +
Sbjct  433  EGKHLV  438



>dbj|BAF74636.1| hydroxyphenylpyruvate dioxygenase [Coptis japonica var. dissecta]
Length=430

 Score =   317 bits (813),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 160/189 (85%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT ESGLNS+VLA+NDE V LP+NEPV+GTKRKSQIQTYLEHNEG G+QHLAL SEDIF 
Sbjct  242  GTTESGLNSIVLASNDEMVLLPMNEPVYGTKRKSQIQTYLEHNEGAGVQHLALVSEDIFT  301

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RSG+GGFEFMPSPPPTYYKNLK+RAGDVLSDEQIKECEELGILVDRD QGTLL
Sbjct  302  TLREMRRRSGVGGFEFMPSPPPTYYKNLKNRAGDVLSDEQIKECEELGILVDRDAQGTLL  361

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPT+F+EIIQR+GCM+K E+G+ YQK GCGGFGKGNFSELFKSIEEYEK L
Sbjct  362  QIFTKPVGDRPTIFVEIIQRLGCMLKDEEGKTYQKAGCGGFGKGNFSELFKSIEEYEKTL  421

Query  305  EAKQAIHAA  279
            EAK  + AA
Sbjct  422  EAKANVVAA  430



>ref|XP_010480369.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Camelina 
sativa]
Length=466

 Score =   318 bits (816),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 160/186 (86%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GTAESGLNS VLA+NDE V LP+NEPVHGTKRKSQIQTYLEHNEG GLQHLAL SEDIFR
Sbjct  280  GTAESGLNSAVLASNDEMVLLPINEPVHGTKRKSQIQTYLEHNEGAGLQHLALMSEDIFR  339

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RS +GGF+FMPSPPPTYY+NLK R GDVLSDEQIKECEELGILVDRDDQGTLL
Sbjct  340  TLREMRKRSSVGGFDFMPSPPPTYYQNLKKRVGDVLSDEQIKECEELGILVDRDDQGTLL  399

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKP+GDRPT+FIEIIQRVGCMMK ++G+ YQ GGCG FGKGNFSELFKSIEEYEK L
Sbjct  400  QIFTKPLGDRPTIFIEIIQRVGCMMKDDEGKAYQSGGCGDFGKGNFSELFKSIEEYEKTL  459

Query  305  EAKQAI  288
            EAKQ +
Sbjct  460  EAKQLV  465



>ref|XP_007215393.1| hypothetical protein PRUPE_ppa005851mg [Prunus persica]
 gb|EMJ16592.1| hypothetical protein PRUPE_ppa005851mg [Prunus persica]
Length=440

 Score =   317 bits (813),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 159/189 (84%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT+ESGLNSVVLANN+E V  P+NEPV+GTKRKSQIQTYLEHNEG G+QHLAL SEDIF+
Sbjct  250  GTSESGLNSVVLANNEEMVLFPMNEPVYGTKRKSQIQTYLEHNEGAGVQHLALVSEDIFK  309

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR+RSGIGGF+FMPSPPPTYY+NLK RAGDVL+D+QIKECEELGILVDRDDQGTLL
Sbjct  310  TLREMRSRSGIGGFQFMPSPPPTYYRNLKKRAGDVLTDDQIKECEELGILVDRDDQGTLL  369

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPT+F+EIIQRVGCM+K E+G+V+QKGGCGGFGKGNFSELFKSIEEYEK L
Sbjct  370  QIFTKPVGDRPTIFVEIIQRVGCMLKDEEGKVHQKGGCGGFGKGNFSELFKSIEEYEKTL  429

Query  305  EAKQAIHAA  279
            EA+Q    A
Sbjct  430  EARQIAEPA  438



>ref|XP_010542713.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase [Tarenaya hassleriana]
Length=454

 Score =   317 bits (813),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GTAESGLNSVVLANN+ETV LPLNEPVHGTKRKSQIQTYLEHNEG GLQHLAL SEDIFR
Sbjct  262  GTAESGLNSVVLANNEETVLLPLNEPVHGTKRKSQIQTYLEHNEGAGLQHLALMSEDIFR  321

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RS +GGFEFMP+PPP YY+NLK R GDVLSDEQI ECE+LGILVDRDDQGTLL
Sbjct  322  TLREMRKRSSVGGFEFMPAPPPNYYRNLKKRVGDVLSDEQINECEKLGILVDRDDQGTLL  381

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKP+GDRPT+FIEIIQR+GCMMK E G+ YQKGGCGGFGKGNFSELFKSIEEYEK L
Sbjct  382  QIFTKPLGDRPTIFIEIIQRIGCMMKDEQGKEYQKGGCGGFGKGNFSELFKSIEEYEKTL  441

Query  305  EAKQ  294
            EAKQ
Sbjct  442  EAKQ  445



>ref|XP_008466793.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase [Cucumis melo]
Length=467

 Score =   318 bits (814),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 162/189 (86%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT+ESGLNS+VLANN+E V LP+NEPV GTKRKSQIQTYLEHNEG G+QHLAL SEDIFR
Sbjct  277  GTSESGLNSMVLANNEEMVLLPINEPVFGTKRKSQIQTYLEHNEGAGVQHLALMSEDIFR  336

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RS +GGFEFMPSPPPTYYKNLKSRAGDVL+DEQIKECEELGILVD+DDQGTLL
Sbjct  337  TLREMRKRSSVGGFEFMPSPPPTYYKNLKSRAGDVLTDEQIKECEELGILVDKDDQGTLL  396

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPT+FIEIIQR+GCMMK E+G+ YQKGGCGGFGKGNFSELFKSIEEYEK L
Sbjct  397  QIFTKPVGDRPTIFIEIIQRLGCMMKDEEGKAYQKGGCGGFGKGNFSELFKSIEEYEKTL  456

Query  305  EAKQAIHAA  279
            EAK+   +A
Sbjct  457  EAKRVSESA  465



>ref|XP_010053900.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Eucalyptus 
grandis]
 gb|KCW89762.1| hypothetical protein EUGRSUZ_A02022 [Eucalyptus grandis]
Length=448

 Score =   317 bits (811),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 161/189 (85%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT +SGLNS+VLANNDETV LP+NEPV GTKRKSQIQTYLEHNEG GLQHLALTSEDIFR
Sbjct  258  GTGDSGLNSLVLANNDETVLLPMNEPVFGTKRKSQIQTYLEHNEGAGLQHLALTSEDIFR  317

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RS +GGFEFMPSPPPTYY+NLK+RAGDVL+DEQIKECEELGILVDRDDQGTLL
Sbjct  318  TLREMRKRSSVGGFEFMPSPPPTYYRNLKARAGDVLTDEQIKECEELGILVDRDDQGTLL  377

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPT+FIEIIQRVGCM+  + G+ YQKGGCGGFGKGNFSELFKSIEEYEK L
Sbjct  378  QIFTKPVGDRPTIFIEIIQRVGCMLTDDHGKQYQKGGCGGFGKGNFSELFKSIEEYEKTL  437

Query  305  EAKQAIHAA  279
            EA++    A
Sbjct  438  EARRVSEPA  446



>ref|XP_007048961.1| Phytoene desaturation 1 isoform 1 [Theobroma cacao]
 gb|EOX93118.1| Phytoene desaturation 1 isoform 1 [Theobroma cacao]
Length=439

 Score =   316 bits (809),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 162/189 (86%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT ESGLNS+VLANNDE V LP+NEPV GTKRKSQIQTYLEHNEG G+QHLAL SEDIF+
Sbjct  249  GTTESGLNSLVLANNDEMVLLPMNEPVFGTKRKSQIQTYLEHNEGAGVQHLALVSEDIFK  308

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RS +GGFEFMPSPPPTYYKNLK+RAGDVLSDEQIK+CEELGILVDRDDQGTLL
Sbjct  309  TLREMRKRSLVGGFEFMPSPPPTYYKNLKTRAGDVLSDEQIKDCEELGILVDRDDQGTLL  368

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPT+FIEIIQRVGCM+K E G+ YQKGGCGGFGKGNFSELFKSIEEYEK L
Sbjct  369  QIFTKPVGDRPTIFIEIIQRVGCMLKDEQGKQYQKGGCGGFGKGNFSELFKSIEEYEKTL  428

Query  305  EAKQAIHAA  279
             AKQ   +A
Sbjct  429  GAKQIAESA  437



>gb|ADO62712.1| p-hydroxyphenylpyruvate dioxygenase [Mangifera indica]
Length=432

 Score =   315 bits (808),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 164/189 (87%), Positives = 177/189 (94%), Gaps = 1/189 (1%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT+ESGLNSVVLA+NDE V LPLNEPV GTKRKSQIQTYLEHNEG GLQHLAL SEDIF 
Sbjct  242  GTSESGLNSVVLASNDEMVLLPLNEPVFGTKRKSQIQTYLEHNEGAGLQHLALVSEDIFG  301

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREM+ RSG+GGFEFMPSPPPTYYKNLK+RAGDVL+DEQIKECEELGILVDRD+QGTLL
Sbjct  302  TLREMKKRSGVGGFEFMPSPPPTYYKNLKNRAGDVLTDEQIKECEELGILVDRDEQGTLL  361

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPT+FIEIIQRVGCM+K ++G+ YQKGGCGGFGKGNFSELFKSIEEYEK L
Sbjct  362  QIFTKPVGDRPTIFIEIIQRVGCMLKDDEGKTYQKGGCGGFGKGNFSELFKSIEEYEKTL  421

Query  305  EAKQAIHAA  279
            EA+Q I AA
Sbjct  422  EARQ-IEAA  429



>ref|XP_009351285.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Pyrus x 
bretschneideri]
Length=440

 Score =   315 bits (808),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 162/189 (86%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT+ESGLNSVVLANN+E V LP+NEPV+GTKRKSQIQTYLEHNEG GLQHLAL SEDIFR
Sbjct  250  GTSESGLNSVVLANNEEMVLLPMNEPVYGTKRKSQIQTYLEHNEGAGLQHLALVSEDIFR  309

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR+RS  GGF+FMP PPPTYY NLK RAGDVL+DEQIKECEELGILVDRDDQGTLL
Sbjct  310  TLREMRSRSSGGGFQFMPKPPPTYYGNLKKRAGDVLTDEQIKECEELGILVDRDDQGTLL  369

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPT+FIEIIQRVGCM+K E+G+V+QKGGCGGFGKGNFSELFKSIEEYEK L
Sbjct  370  QIFTKPVGDRPTMFIEIIQRVGCMLKDEEGKVHQKGGCGGFGKGNFSELFKSIEEYEKTL  429

Query  305  EAKQAIHAA  279
            EAKQ    A
Sbjct  430  EAKQTADPA  438



>gb|ABO69440.1| hydroxyphenylpyruvate dioxygenase [Salvia miltiorrhiza]
Length=481

 Score =   317 bits (812),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 159/189 (84%), Positives = 172/189 (91%), Gaps = 0/189 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GTAESGLNSVVLANN+E V  PLNEPV G KRKSQIQTYLEHNEG G+QHLAL SEDIF+
Sbjct  291  GTAESGLNSVVLANNNENVLFPLNEPVFGMKRKSQIQTYLEHNEGAGVQHLALVSEDIFK  350

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RS +GGF+FMP PPPTYY+NLKSRAGDVLSDEQI+ECE LGILVDRDDQGTLL
Sbjct  351  TLREMRKRSSVGGFDFMPLPPPTYYRNLKSRAGDVLSDEQIEECERLGILVDRDDQGTLL  410

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPT+FIEIIQR+GCMMK E+G++YQKG CGGFGKGNFSELF+SIEEYEKML
Sbjct  411  QIFTKPVGDRPTIFIEIIQRIGCMMKDEEGKIYQKGACGGFGKGNFSELFRSIEEYEKML  470

Query  305  EAKQAIHAA  279
            EAK    AA
Sbjct  471  EAKMGTRAA  479



>dbj|BAH10638.1| 4-hydroxyphenylpyruvate dioxygenase [Hevea brasiliensis]
Length=445

 Score =   315 bits (808),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 161/188 (86%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT+ESGLNS+VLANN++TV LPLNEPV GTKRKSQIQTYLEHNEG GLQHLAL SEDIF+
Sbjct  257  GTSESGLNSLVLANNEDTVLLPLNEPVFGTKRKSQIQTYLEHNEGAGLQHLALVSEDIFK  316

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RSG+GGF+FMPSPPPTYY+NLK+R GDVL+DEQIKECEELGILVDRDDQGTLL
Sbjct  317  TLREMRRRSGVGGFDFMPSPPPTYYRNLKNRVGDVLTDEQIKECEELGILVDRDDQGTLL  376

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPT+FIEIIQRVGCM+K E G+ YQKGGCGGFGKGNFSELFKSIEEYEK L
Sbjct  377  QIFTKPVGDRPTIFIEIIQRVGCMIKDETGKEYQKGGCGGFGKGNFSELFKSIEEYEKTL  436

Query  305  EAKQAIHA  282
            EAK+   A
Sbjct  437  EAKRNAEA  444



>ref|XP_004144629.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase [Cucumis sativus]
 gb|KGN54940.1| 4-hydroxyphenylpyruvate dioxygenase [Cucumis sativus]
Length=455

 Score =   315 bits (806),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 160/184 (87%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT+ESGLNS+VLANN+E V LP+NEPV GTKRKSQIQTYLEHNEG G+QHLAL SEDIFR
Sbjct  269  GTSESGLNSMVLANNEEMVLLPINEPVFGTKRKSQIQTYLEHNEGAGVQHLALMSEDIFR  328

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RS +GGFEFMPSPPPTYYKNLKSRAGDVL+DEQIKECEELGILVD+DDQGTLL
Sbjct  329  TLREMRKRSSVGGFEFMPSPPPTYYKNLKSRAGDVLTDEQIKECEELGILVDKDDQGTLL  388

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPT+FIEIIQR+GCMMK E+G+ +QKGGCGGFGKGNFSELFKSIEEYEK L
Sbjct  389  QIFTKPVGDRPTIFIEIIQRLGCMMKDEEGKAFQKGGCGGFGKGNFSELFKSIEEYEKTL  448

Query  305  EAKQ  294
            EAK+
Sbjct  449  EAKR  452



>gb|EYU42802.1| hypothetical protein MIMGU_mgv1a005210mg [Erythranthe guttata]
Length=493

 Score =   316 bits (810),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 163/185 (88%), Positives = 174/185 (94%), Gaps = 1/185 (1%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GTA+SGLNSVVLANNDE V LPLNEP+ GTKRKSQIQTYLEHNEG G+QHLAL SEDIF+
Sbjct  307  GTADSGLNSVVLANNDENVLLPLNEPIFGTKRKSQIQTYLEHNEGAGVQHLALVSEDIFK  366

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RS IGGF+FMPSPPPTYY+NLKSRAGDVLSDEQI+ECEELGILVDRDDQGTLL
Sbjct  367  TLREMRKRSCIGGFDFMPSPPPTYYRNLKSRAGDVLSDEQIQECEELGILVDRDDQGTLL  426

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPT+FIEIIQRVGCM+K E+G+ YQKGGCGGFGKGNFSELFKSIEEYEK L
Sbjct  427  QIFTKPVGDRPTIFIEIIQRVGCMLKDEEGKTYQKGGCGGFGKGNFSELFKSIEEYEKTL  486

Query  305  E-AKQ  294
            E AKQ
Sbjct  487  ESAKQ  491



>ref|XP_012082570.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase [Jatropha curcas]
 gb|KDP45435.1| hypothetical protein JCGZ_09684 [Jatropha curcas]
Length=442

 Score =   314 bits (805),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 162/189 (86%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT ESGLNSVVLANN+ETV LPLNEPV GTKRKSQIQTYLEHNEG G+QHLAL SE+IFR
Sbjct  254  GTNESGLNSVVLANNEETVLLPLNEPVFGTKRKSQIQTYLEHNEGAGVQHLALASENIFR  313

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RS IGGFEFMPSPPPTYYKNLK+R GDVL+D+QIKECEELGILVDRDD GTLL
Sbjct  314  TLREMRKRSCIGGFEFMPSPPPTYYKNLKNRVGDVLTDDQIKECEELGILVDRDDHGTLL  373

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKP+GDRPT+FIEIIQRVGCM+K E G+ YQKGGCGGFGKGNFSELFKSIEEYEK L
Sbjct  374  QIFTKPLGDRPTIFIEIIQRVGCMLKDEAGKEYQKGGCGGFGKGNFSELFKSIEEYEKTL  433

Query  305  EAKQAIHAA  279
            EAK+   AA
Sbjct  434  EAKRIAEAA  442



>ref|XP_008229571.1| PREDICTED: LOW QUALITY PROTEIN: 4-hydroxyphenylpyruvate dioxygenase 
[Prunus mume]
Length=506

 Score =   316 bits (810),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 158/184 (86%), Positives = 175/184 (95%), Gaps = 0/184 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT+ESGLNSVVLANN+E V  P+NEPV+GTKRKSQIQTYLEHNEG G+QHLAL SEDIF+
Sbjct  316  GTSESGLNSVVLANNEEMVLFPMNEPVYGTKRKSQIQTYLEHNEGAGVQHLALVSEDIFK  375

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR+RSGIGGF+FMPSPPPTYY+NLK RAGDVL+D QIKECEELGILVDRDDQGTLL
Sbjct  376  TLREMRSRSGIGGFQFMPSPPPTYYRNLKKRAGDVLTDNQIKECEELGILVDRDDQGTLL  435

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPT+F+EIIQRVGCM+K E+G+V+QKGGCGGFGKGNFSELFKSIEEYEK L
Sbjct  436  QIFTKPVGDRPTIFVEIIQRVGCMLKDEEGKVHQKGGCGGFGKGNFSELFKSIEEYEKTL  495

Query  305  EAKQ  294
            EA+Q
Sbjct  496  EARQ  499



>gb|AGO59892.1| hydroxyphenylpyruvate dioxygenase [Perilla frutescens]
Length=477

 Score =   314 bits (805),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 160/183 (87%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GTAESGLNSVVLANN+E V  PLNEPV GTKRKSQIQTYLEHNEG G+QHLAL SEDIFR
Sbjct  287  GTAESGLNSVVLANNNEDVLFPLNEPVFGTKRKSQIQTYLEHNEGAGVQHLALVSEDIFR  346

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RS +GGFEFMPSPPPTYY+ LKSRAGDVLSDEQI+ECE+LGILVDRDDQGTLL
Sbjct  347  TLREMRKRSLVGGFEFMPSPPPTYYRKLKSRAGDVLSDEQIEECEKLGILVDRDDQGTLL  406

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPT+FIEIIQR+GCMMK ++G++YQKGGCGGFGKGNFSELFKSIE YEKML
Sbjct  407  QIFTKPVGDRPTMFIEIIQRIGCMMKDKEGKIYQKGGCGGFGKGNFSELFKSIEGYEKML  466

Query  305  EAK  297
            EAK
Sbjct  467  EAK  469



>ref|XP_003617391.1| 4-hydroxyphenylpyruvate dioxygenase [Medicago truncatula]
 gb|AAX59006.1| 4-hydroxyphenylpyruvate dioxygenase [Medicago truncatula]
 gb|AET00350.1| 4-hydroxyphenylpyruvate dioxygenase [Medicago truncatula]
Length=437

 Score =   312 bits (800),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 158/184 (86%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT+ESGLNSVVLANN+ETV LP+NEPV+GTKRKSQI+TYLEHNEG GLQHLAL S DIFR
Sbjct  252  GTSESGLNSVVLANNEETVLLPMNEPVYGTKRKSQIETYLEHNEGAGLQHLALMSADIFR  311

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RSG+GGFEFMPSPP TYY+NLK+R GDVLSDEQIKECEELGILVDRDDQGTLL
Sbjct  312  TLREMRKRSGVGGFEFMPSPPVTYYRNLKNRVGDVLSDEQIKECEELGILVDRDDQGTLL  371

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKP+GDRPT+FIEIIQRVGCM+K E+G+ YQKGGCGGFGKGNFSELFKSIEEYEK L
Sbjct  372  QIFTKPIGDRPTIFIEIIQRVGCMLKDEEGKEYQKGGCGGFGKGNFSELFKSIEEYEKTL  431

Query  305  EAKQ  294
            E ++
Sbjct  432  ETRR  435



>ref|XP_010274102.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase [Nelumbo nucifera]
Length=507

 Score =   314 bits (805),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 157/186 (84%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT+ESGLNSVVLA+NDE V LP+NEPV GTKRKSQIQTYLEHNEGPG+QHLAL +EDIFR
Sbjct  316  GTSESGLNSVVLASNDEMVLLPMNEPVFGTKRKSQIQTYLEHNEGPGVQHLALVTEDIFR  375

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RS +GGFEFMPSPPPTYY+NLK+RAGDVL+DEQIKECE+LGILVDRDDQG LL
Sbjct  376  TLREMRRRSAVGGFEFMPSPPPTYYRNLKNRAGDVLTDEQIKECEDLGILVDRDDQGVLL  435

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPT+FIEIIQR+GCM+K E+G+ YQKGGCGGFGKGNFSELFKSIEEYEK L
Sbjct  436  QIFTKPVGDRPTIFIEIIQRIGCMVKDEEGKTYQKGGCGGFGKGNFSELFKSIEEYEKTL  495

Query  305  EAKQAI  288
            E  + I
Sbjct  496  EVAKQI  501



>gb|KJB08581.1| hypothetical protein B456_001G092000 [Gossypium raimondii]
Length=463

 Score =   311 bits (798),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 159/185 (86%), Positives = 173/185 (94%), Gaps = 0/185 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT+ESGLNSVVLANN+E V LP+NEPV GTKRKSQIQTYLEHNEG G+QHLAL SEDIF+
Sbjct  276  GTSESGLNSVVLANNEEMVLLPMNEPVFGTKRKSQIQTYLEHNEGAGVQHLALVSEDIFK  335

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RS +GGFEFMPSPPPTYYK LK RAGD+LSDEQIKECEELGILVDRDDQGTLL
Sbjct  336  TLREMRKRSFVGGFEFMPSPPPTYYKKLKQRAGDILSDEQIKECEELGILVDRDDQGTLL  395

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPT+FIEIIQR+GC++K E+G+ YQKGGCGGFGKGNFSELFKSIEEYEK L
Sbjct  396  QIFTKPVGDRPTIFIEIIQRIGCLVKDEEGKQYQKGGCGGFGKGNFSELFKSIEEYEKSL  455

Query  305  EAKQA  291
            EAKQ+
Sbjct  456  EAKQS  460



>gb|AGG10562.1| 4-hydroxyphenylpyruvate dioxygenase [Amaranthus tuberculatus]
Length=434

 Score =   310 bits (795),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT+ESGLNS VLANNDE V  P+NEPV+GTKRKSQIQTYLEHNEG G+QHLAL SEDIF 
Sbjct  244  GTSESGLNSAVLANNDEMVLFPMNEPVYGTKRKSQIQTYLEHNEGAGVQHLALMSEDIFW  303

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RSG+GGFEFMPSPPPTYY+NL++RA DVLS+EQ+KECEELGILVD+DDQGTLL
Sbjct  304  TLREMRKRSGLGGFEFMPSPPPTYYRNLRNRAADVLSEEQMKECEELGILVDKDDQGTLL  363

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKP+GDRPT+FIEIIQR+GCMMK EDG++YQKGGCGGFGKGNFSELFKSIEEYEK L
Sbjct  364  QIFTKPIGDRPTIFIEIIQRIGCMMKDEDGKMYQKGGCGGFGKGNFSELFKSIEEYEKTL  423

Query  305  EAKQAIHAA  279
            E KQ    A
Sbjct  424  ERKQVPDTA  432



>ref|XP_010688905.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Beta vulgaris 
subsp. vulgaris]
Length=434

 Score =   310 bits (794),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 155/183 (85%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT+ESGLNS V+ANNDETV  P+NEPV+GTKRKSQIQTYLEHNEG G+QHLAL SEDIF 
Sbjct  244  GTSESGLNSAVVANNDETVLFPMNEPVYGTKRKSQIQTYLEHNEGAGVQHLALMSEDIFW  303

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RSG+GGFEFMPSPPPTYY+NL++RA DVLS+EQ+KECEELGILVD+DDQGTLL
Sbjct  304  TLREMRKRSGLGGFEFMPSPPPTYYRNLRNRAADVLSEEQMKECEELGILVDKDDQGTLL  363

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKP+GDRPT+FIEIIQR+GCMMK E+G+VYQKGGCGGFGKGNFSELFKSIEEYEK L
Sbjct  364  QIFTKPIGDRPTMFIEIIQRIGCMMKDEEGKVYQKGGCGGFGKGNFSELFKSIEEYEKTL  423

Query  305  EAK  297
            E K
Sbjct  424  ERK  426



>ref|XP_004491317.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Cicer arietinum]
Length=434

 Score =   310 bits (794),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 158/184 (86%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT+ESGLNS VLANN+ETV LP+NEPV+GTKRKSQIQTYLEHNEG GLQHLAL S DIF+
Sbjct  249  GTSESGLNSTVLANNEETVLLPMNEPVYGTKRKSQIQTYLEHNEGAGLQHLALMSNDIFK  308

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RSGIGGFEFMPSPPPTYY NLK R GDVL+DEQIKECEELGILVD+DDQGTLL
Sbjct  309  TLREMRKRSGIGGFEFMPSPPPTYYSNLKKRVGDVLNDEQIKECEELGILVDKDDQGTLL  368

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPT+FIEIIQRVGCM+K ++G+ YQKGGCGGFGKGNFSELFKSIEEYEK L
Sbjct  369  QIFTKPVGDRPTIFIEIIQRVGCMLKDDEGKEYQKGGCGGFGKGNFSELFKSIEEYEKTL  428

Query  305  EAKQ  294
            E K+
Sbjct  429  EIKR  432



>ref|XP_007048962.1| Phytoene desaturation 1 isoform 2 [Theobroma cacao]
 gb|EOX93119.1| Phytoene desaturation 1 isoform 2 [Theobroma cacao]
Length=445

 Score =   309 bits (791),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 162/195 (83%), Positives = 173/195 (89%), Gaps = 6/195 (3%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT ESGLNS+VLANNDE V LP+NEPV GTKRKSQIQTYLEHNEG G+QHLAL SEDIF+
Sbjct  249  GTTESGLNSLVLANNDEMVLLPMNEPVFGTKRKSQIQTYLEHNEGAGVQHLALVSEDIFK  308

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RS +GGFEFMPSPPPTYYKNLK+RAGDVLSDEQIK+CEELGILVDRDDQGTLL
Sbjct  309  TLREMRKRSLVGGFEFMPSPPPTYYKNLKTRAGDVLSDEQIKDCEELGILVDRDDQGTLL  368

Query  485  QIFTKPVGD------RPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIE  324
            QIFTKPVGD      RPT+FIEIIQRVGCM+K E G+ YQKGGCGGFGKGNFSELFKSIE
Sbjct  369  QIFTKPVGDSWELFGRPTIFIEIIQRVGCMLKDEQGKQYQKGGCGGFGKGNFSELFKSIE  428

Query  323  EYEKMLEAKQAIHAA  279
            EYEK L AKQ   +A
Sbjct  429  EYEKTLGAKQIAESA  443



>gb|EPS60251.1| hydroxyphenylpyruvate dioxygenase, partial [Genlisea aurea]
Length=402

 Score =   307 bits (787),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 156/182 (86%), Positives = 169/182 (93%), Gaps = 0/182 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT ESGLNSVVLA+NDE V LPLNEPV GTKRKSQIQTYLEHNEG G+QHLAL SE+IF 
Sbjct  221  GTTESGLNSVVLASNDENVLLPLNEPVFGTKRKSQIQTYLEHNEGAGVQHLALVSENIFT  280

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREM  RSGIGGF+FMPSPPPTYY+NLKSRAGDVLSDEQI+EC +LGILVDRDDQGTLL
Sbjct  281  TLREMSKRSGIGGFDFMPSPPPTYYRNLKSRAGDVLSDEQIEECRKLGILVDRDDQGTLL  340

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPTLFIEIIQR+GCM+K E GE +QKGGCGGFGKGNF++LFKSIE+YEKML
Sbjct  341  QIFTKPVGDRPTLFIEIIQRIGCMVKDEKGEAFQKGGCGGFGKGNFAQLFKSIEDYEKML  400

Query  305  EA  300
            EA
Sbjct  401  EA  402



>emb|CAN71143.1| hypothetical protein VITISV_033518 [Vitis vinifera]
Length=445

 Score =   308 bits (789),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT+ESGLNSVVLA+N+E V LPLNEPV GTKRKSQIQTYLEHNEGPG+QHLAL S+DIFR
Sbjct  255  GTSESGLNSVVLASNNEMVLLPLNEPVFGTKRKSQIQTYLEHNEGPGVQHLALMSDDIFR  314

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RSG+GGF+FMPSPPPTYY+N+K RAGDVL+D+QIKECEELGILVD+DDQGTLL
Sbjct  315  TLREMRRRSGVGGFDFMPSPPPTYYRNVKKRAGDVLTDDQIKECEELGILVDKDDQGTLL  374

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKP+GDRPT+FIEIIQR+GCM+K ++G+V QKGGCGGFGKGNFSELFKSIEEYEK L
Sbjct  375  QIFTKPLGDRPTIFIEIIQRLGCMVKDDEGKVSQKGGCGGFGKGNFSELFKSIEEYEKTL  434

Query  305  EAKQAIHAA  279
             AK+ +  A
Sbjct  435  GAKRIVDPA  443



>ref|XP_002283275.2| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase [Vitis vinifera]
Length=491

 Score =   309 bits (791),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT+ESGLNSVVLA+N+E V LPLNEPV GTKRKSQIQTYLEHNEGPG+QHLAL S+DIFR
Sbjct  301  GTSESGLNSVVLASNNEMVLLPLNEPVFGTKRKSQIQTYLEHNEGPGVQHLALMSDDIFR  360

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RSG+GGF+FMPSPPPTYY+N+K RAGDVL+D+QIKECEELGILVD+DDQGTLL
Sbjct  361  TLREMRRRSGVGGFDFMPSPPPTYYRNVKKRAGDVLTDDQIKECEELGILVDKDDQGTLL  420

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKP+GDRPT+FIEIIQR+GCM+K ++G+V QKGGCGGFGKGNFSELFKSIEEYEK L
Sbjct  421  QIFTKPLGDRPTIFIEIIQRLGCMVKDDEGKVSQKGGCGGFGKGNFSELFKSIEEYEKTL  480

Query  305  EAKQAIHAA  279
             AK+ +  A
Sbjct  481  GAKRIVDPA  489



>gb|AFB74208.1| 4-hydroxyphenylpyruvate dioxygenase [Brassica napus]
Length=445

 Score =   305 bits (782),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 162/186 (87%), Positives = 174/186 (94%), Gaps = 0/186 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GTAESGLNS VLANNDETV LP+NEPVHGTKRKSQIQTYLEHNEG G+QHLAL SEDIFR
Sbjct  259  GTAESGLNSAVLANNDETVLLPVNEPVHGTKRKSQIQTYLEHNEGAGVQHLALMSEDIFR  318

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RSG+GGF+FMPSPPPTYYKNLK+R GDVLS+EQI+ECEELGILVDRDDQGTLL
Sbjct  319  TLREMRKRSGVGGFDFMPSPPPTYYKNLKNRVGDVLSEEQIEECEELGILVDRDDQGTLL  378

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKP+GDRPT+FIEIIQR+GCM K E+G VYQ GGCGGFGKGNFSELFKSIEEYEK L
Sbjct  379  QIFTKPLGDRPTIFIEIIQRIGCMKKDEEGRVYQSGGCGGFGKGNFSELFKSIEEYEKTL  438

Query  305  EAKQAI  288
            EAKQ +
Sbjct  439  EAKQLV  444



>emb|CDY06652.1| BnaA10g04310D [Brassica napus]
Length=445

 Score =   305 bits (782),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 162/186 (87%), Positives = 174/186 (94%), Gaps = 0/186 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GTAESGLNS VLANNDETV LP+NEPVHGTKRKSQIQTYLEHNEG G+QHLAL SEDIFR
Sbjct  259  GTAESGLNSAVLANNDETVLLPVNEPVHGTKRKSQIQTYLEHNEGAGVQHLALMSEDIFR  318

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RSG+GGF+FMPSPPPTYYKNLK+R GDVLS+EQI+ECEELGILVDRDDQGTLL
Sbjct  319  TLREMRKRSGVGGFDFMPSPPPTYYKNLKNRVGDVLSEEQIEECEELGILVDRDDQGTLL  378

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKP+GDRPT+FIEIIQR+GCM K E+G VYQ GGCGGFGKGNFSELFKSIEEYEK L
Sbjct  379  QIFTKPLGDRPTIFIEIIQRIGCMKKDEEGRVYQSGGCGGFGKGNFSELFKSIEEYEKTL  438

Query  305  EAKQAI  288
            EAKQ +
Sbjct  439  EAKQLV  444



>ref|XP_009119049.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase [Brassica rapa]
 gb|ABI63586.1| 4-hydroxyphenylpyruvate dioxygenase [Brassica rapa subsp. pekinensis]
Length=443

 Score =   305 bits (781),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 162/186 (87%), Positives = 174/186 (94%), Gaps = 0/186 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GTAESGLNS VLANNDETV LP+NEPVHGTKRKSQIQTYLEHNEG G+QHLAL SEDIFR
Sbjct  257  GTAESGLNSAVLANNDETVLLPVNEPVHGTKRKSQIQTYLEHNEGAGVQHLALMSEDIFR  316

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RSG+GGF+FMPSPPPTYYKNLK+R GDVLS+EQI+ECEELGILVDRDDQGTLL
Sbjct  317  TLREMRKRSGVGGFDFMPSPPPTYYKNLKNRVGDVLSEEQIEECEELGILVDRDDQGTLL  376

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKP+GDRPT+FIEIIQR+GCM K E+G VYQ GGCGGFGKGNFSELFKSIEEYEK L
Sbjct  377  QIFTKPLGDRPTIFIEIIQRIGCMKKDEEGRVYQSGGCGGFGKGNFSELFKSIEEYEKTL  436

Query  305  EAKQAI  288
            EAKQ +
Sbjct  437  EAKQLV  442



>ref|XP_008380188.1| PREDICTED: LOW QUALITY PROTEIN: 4-hydroxyphenylpyruvate dioxygenase 
[Malus domestica]
Length=457

 Score =   304 bits (778),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 156/193 (81%), Positives = 175/193 (91%), Gaps = 9/193 (5%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT+ESGLNSVVLANN+E V  P+NEPV+GTKRKSQIQTYLEHNEG G+QHLAL SEDIFR
Sbjct  258  GTSESGLNSVVLANNEEMVLFPMNEPVYGTKRKSQIQTYLEHNEGAGVQHLALGSEDIFR  317

Query  665  TLREMRNRSGIGGFEFMPS-PPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTL  489
            TLREMR+RSG+GGF+F+P+ PPPTYY+NLK R GDVL+DEQIKECEELGILVDRDDQGTL
Sbjct  318  TLREMRSRSGVGGFQFLPAPPPPTYYRNLKKRVGDVLTDEQIKECEELGILVDRDDQGTL  377

Query  488  LQIFTKPVGD--------RPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFK  333
            LQIFTKPVGD        RPT+F+EIIQRVGCM+K E+G+++QKGGCGGFGKGNFSELFK
Sbjct  378  LQIFTKPVGDSWFLYKMGRPTIFVEIIQRVGCMLKDEEGKIHQKGGCGGFGKGNFSELFK  437

Query  332  SIEEYEKMLEAKQ  294
            SIEEYEK LEAKQ
Sbjct  438  SIEEYEKTLEAKQ  450



>gb|ACN78586.1| 4-hydroxyphenylpyruvate dioxygenase [Lactuca sativa]
Length=446

 Score =   303 bits (775),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 154/183 (84%), Positives = 169/183 (92%), Gaps = 0/183 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT+ESGLNSVVLA N E V +P+NEPV+GTKRKSQIQTYLEHNEG G+QHLAL SEDIFR
Sbjct  255  GTSESGLNSVVLACNSEMVLIPMNEPVYGTKRKSQIQTYLEHNEGAGVQHLALASEDIFR  314

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RSGIGG EFMPSPPPTYY+NLK+R GDVL+DE+IKECEELGILVDRDDQGTLL
Sbjct  315  TLREMRKRSGIGGLEFMPSPPPTYYRNLKNRVGDVLTDEEIKECEELGILVDRDDQGTLL  374

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPT+FIEIIQRVGCM+K  +G+V QK GCGGFGKGNFSELFKSIEEYE+ L
Sbjct  375  QIFTKPVGDRPTIFIEIIQRVGCMVKDGEGKVQQKAGCGGFGKGNFSELFKSIEEYEETL  434

Query  305  EAK  297
            EA+
Sbjct  435  EAR  437



>emb|CDY09969.1| BnaC08g44820D [Brassica napus]
Length=440

 Score =   301 bits (772),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 161/186 (87%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GTAESGLNS VLANNDE V LP+NEPVHGTKRKSQIQT+LEHNEG GLQHLAL SEDIFR
Sbjct  254  GTAESGLNSAVLANNDEMVLLPINEPVHGTKRKSQIQTFLEHNEGAGLQHLALMSEDIFR  313

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RSG+GGF+FMPSPPPTYYKNLK R GDVLS+EQI+ECEELGILVDRDDQGTLL
Sbjct  314  TLREMRKRSGVGGFDFMPSPPPTYYKNLKKRVGDVLSEEQIEECEELGILVDRDDQGTLL  373

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKP+GDRPT+FIEIIQRVGCM + E+G+VYQ GGCGGFGKGNFSELFKSIEEYEK L
Sbjct  374  QIFTKPLGDRPTIFIEIIQRVGCMKRDEEGKVYQSGGCGGFGKGNFSELFKSIEEYEKTL  433

Query  305  EAKQAI  288
            EAKQ +
Sbjct  434  EAKQLV  439



>gb|ADZ24700.1| 4-hydroxyphenylpyruvate dioxygenase 1 [Solanum pennellii]
Length=420

 Score =   301 bits (770),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 152/170 (89%), Positives = 164/170 (96%), Gaps = 0/170 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GTAESGLNSVVLANNDETV  PLNEPV+GTKRKSQIQTYLEHNEG G+QHLAL +EDIFR
Sbjct  251  GTAESGLNSVVLANNDETVLFPLNEPVYGTKRKSQIQTYLEHNEGAGVQHLALVTEDIFR  310

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RSGIGGFEFMPSPPPTYYKNLK+RAGD+LSDEQI+ECEELGILVDRDDQGTLL
Sbjct  311  TLREMRKRSGIGGFEFMPSPPPTYYKNLKTRAGDILSDEQIQECEELGILVDRDDQGTLL  370

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELF  336
            QIFTKPVGDRPT+F+EIIQR+GCM+K E+GE+YQKGGCGGFGKGNFSELF
Sbjct  371  QIFTKPVGDRPTIFLEIIQRIGCMLKNEEGELYQKGGCGGFGKGNFSELF  420



>gb|AFB74207.1| 4-hydroxyphenylpyruvate dioxygenase [Brassica napus]
Length=440

 Score =   301 bits (771),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 161/186 (87%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GTAESGLNS VLANNDE V LP+NEPVHGTKRKSQIQT+LEHNEG GLQHLAL SEDIFR
Sbjct  254  GTAESGLNSAVLANNDEMVLLPINEPVHGTKRKSQIQTFLEHNEGAGLQHLALMSEDIFR  313

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RSG+GGF+FMPSPPPTYYKNLK R GDVLS+EQI+ECEELGILVDRDDQGTLL
Sbjct  314  TLREMRKRSGVGGFDFMPSPPPTYYKNLKKRVGDVLSEEQIEECEELGILVDRDDQGTLL  373

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKP+GDRPT+FIEIIQRVGCM + E+G+VYQ GGCGGFGKGNFSELFKSIEEYEK L
Sbjct  374  QIFTKPLGDRPTIFIEIIQRVGCMKRDEEGKVYQSGGCGGFGKGNFSELFKSIEEYEKTL  433

Query  305  EAKQAI  288
            EAKQ +
Sbjct  434  EAKQLV  439



>ref|XP_003617384.1| 4-hydroxyphenylpyruvate dioxygenase [Medicago truncatula]
 gb|AET00343.1| 4-hydroxyphenylpyruvate dioxygenase [Medicago truncatula]
Length=428

 Score =   300 bits (768),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 167/182 (92%), Gaps = 0/182 (0%)
 Frame = -2

Query  839  AESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRTL  660
             ESGLN+V LANNDETV LPL EPV+GTKRKS I+TYLEHNEG G QHLAL SEDIF+TL
Sbjct  245  VESGLNAVALANNDETVLLPLCEPVYGTKRKSTIETYLEHNEGAGFQHLALASEDIFKTL  304

Query  659  REMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLLQI  480
            REMR RSG+GGFEFMPSPP TYY+NLK+R GDVLSDEQIKECEELGILVDRDDQGTLLQI
Sbjct  305  REMRKRSGVGGFEFMPSPPVTYYRNLKNRVGDVLSDEQIKECEELGILVDRDDQGTLLQI  364

Query  479  FTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKMLEA  300
            FTKP+GDRPT+F+EIIQRVGCM+K E+G+ YQKGGCGGFGKGNFSELFKSIEEYEK LE 
Sbjct  365  FTKPIGDRPTIFLEIIQRVGCMLKDEEGKEYQKGGCGGFGKGNFSELFKSIEEYEKTLET  424

Query  299  KQ  294
            ++
Sbjct  425  RR  426



>ref|XP_010688906.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Beta vulgaris 
subsp. vulgaris]
Length=408

 Score =   298 bits (763),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 151/184 (82%), Positives = 168/184 (91%), Gaps = 0/184 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT+ESGLNS VLANNDETV + ++EPV+G KRKSQIQTYLEHNEG G+QHLAL SEDIF 
Sbjct  218  GTSESGLNSAVLANNDETVLVAMSEPVYGMKRKSQIQTYLEHNEGAGVQHLALMSEDIFW  277

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RSG+GGFEFMPSPPPTYY+NL+ RA DVLS+EQ+ ECEELGILVD+DDQGTLL
Sbjct  278  TLREMRKRSGLGGFEFMPSPPPTYYRNLRDRAMDVLSEEQMMECEELGILVDKDDQGTLL  337

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKP+GDRPT+FIEIIQR+GCMMK E G++YQKGGCGGFGKGNFSELFKSIEEYEK L
Sbjct  338  QIFTKPIGDRPTIFIEIIQRIGCMMKDEGGKLYQKGGCGGFGKGNFSELFKSIEEYEKTL  397

Query  305  EAKQ  294
            E K 
Sbjct  398  ERKN  401



>gb|AIN39549.1| 4-hydroxyphenylpyruvate dioxygenase short isoform [Glycine max]
Length=447

 Score =   300 bits (767),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 152/184 (83%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT+ESGLNSVVLANN ETV LPLNEPV+GTKRKSQI+TYLEHNEG G+QHLAL + DIF 
Sbjct  262  GTSESGLNSVVLANNSETVLLPLNEPVYGTKRKSQIETYLEHNEGAGVQHLALVTHDIFT  321

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RS +GGFEFMPSPPPTYY NL +RA DVL+ +QIK+CEELGILVDRDDQGTLL
Sbjct  322  TLREMRKRSFLGGFEFMPSPPPTYYANLHNRAADVLTVDQIKQCEELGILVDRDDQGTLL  381

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPT+FIEIIQR+GCM++ E+G+VYQKG CGGFGKGNFSELFKSIEEYEK L
Sbjct  382  QIFTKPVGDRPTIFIEIIQRIGCMVEDEEGKVYQKGACGGFGKGNFSELFKSIEEYEKTL  441

Query  305  EAKQ  294
            EAK+
Sbjct  442  EAKR  445



>gb|AIN39550.1| chloroplast 4-hydroxyphenylpyruvate dioxygenase long isoform 
[Glycine max]
Length=488

 Score =   300 bits (767),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 152/184 (83%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT+ESGLNSVVLANN ETV LPLNEPV+GTKRKSQI+TYLEHNEG G+QHLAL + DIF 
Sbjct  303  GTSESGLNSVVLANNSETVLLPLNEPVYGTKRKSQIETYLEHNEGAGVQHLALVTHDIFT  362

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RS +GGFEFMPSPPPTYY NL +RA DVL+ +QIK+CEELGILVDRDDQGTLL
Sbjct  363  TLREMRKRSFLGGFEFMPSPPPTYYANLHNRAADVLTVDQIKQCEELGILVDRDDQGTLL  422

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPT+FIEIIQR+GCM++ E+G+VYQKG CGGFGKGNFSELFKSIEEYEK L
Sbjct  423  QIFTKPVGDRPTIFIEIIQRIGCMVEDEEGKVYQKGACGGFGKGNFSELFKSIEEYEKTL  482

Query  305  EAKQ  294
            EAK+
Sbjct  483  EAKR  486



>ref|NP_001235148.1| 4-hydroxyphenylpyruvate dioxygenase [Glycine max]
 gb|ABQ96868.1| 4-hydroxyphenylpyruvate dioxygenase [Glycine max]
Length=443

 Score =   298 bits (762),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 151/184 (82%), Positives = 168/184 (91%), Gaps = 0/184 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT+ESGLNSVVLANN ETV LPLNEPV+GTKRKSQI+TYLEHNEG G+QHLAL + DIF 
Sbjct  258  GTSESGLNSVVLANNSETVLLPLNEPVYGTKRKSQIETYLEHNEGAGVQHLALVTHDIFT  317

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RS +GGFEFMPSPPPTYY NL +RA DVL+ +QIK+CEELGILVDRDDQGTLL
Sbjct  318  TLREMRKRSFLGGFEFMPSPPPTYYANLHNRAADVLTVDQIKQCEELGILVDRDDQGTLL  377

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPT+FI IIQR+GCM++ E+G+VYQKG CGGFGKGNFSELFKSIEEYEK L
Sbjct  378  QIFTKPVGDRPTIFIXIIQRIGCMVEDEEGKVYQKGACGGFGKGNFSELFKSIEEYEKTL  437

Query  305  EAKQ  294
            EAK+
Sbjct  438  EAKR  441



>ref|XP_007141424.1| hypothetical protein PHAVU_008G194300g [Phaseolus vulgaris]
 gb|ESW13418.1| hypothetical protein PHAVU_008G194300g [Phaseolus vulgaris]
Length=492

 Score =   298 bits (764),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 151/180 (84%), Positives = 166/180 (92%), Gaps = 0/180 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT+ESGLNSVV+ANN ETV LPLNEPV+GTKR+SQI+TYLEHNEG G+QHLAL S DIF 
Sbjct  305  GTSESGLNSVVMANNSETVLLPLNEPVYGTKRRSQIETYLEHNEGAGVQHLALVSNDIFT  364

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMRNRS IGGFEFMPSPPPTYY NL  RAGDVL+ +QIK+CEELGILVDRDDQGTLL
Sbjct  365  TLREMRNRSFIGGFEFMPSPPPTYYANLHKRAGDVLTVDQIKQCEELGILVDRDDQGTLL  424

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFT+PVGDRPTLFIEII+RVGCM++ E+G+VYQKG CGGFGKGNFSELFKSIEEYEK L
Sbjct  425  QIFTRPVGDRPTLFIEIIERVGCMVEDEEGKVYQKGACGGFGKGNFSELFKSIEEYEKTL  484



>gb|ABK26783.1| unknown [Picea sitchensis]
Length=263

 Score =   287 bits (734),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 144/183 (79%), Positives = 165/183 (90%), Gaps = 0/183 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GTAESGLNS+VLA+N+E V LP+NEPV GTKRKSQIQTYLEHNEGPGLQHLAL   DIF 
Sbjct  78   GTAESGLNSMVLASNNEMVLLPMNEPVFGTKRKSQIQTYLEHNEGPGLQHLALICSDIFS  137

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TL+EMR RS IGGFEFMP PPPTYYKNL++R  D+L+++Q++EC+ELGILVDRDDQG LL
Sbjct  138  TLKEMRMRSDIGGFEFMPKPPPTYYKNLRNRVADILTEKQMEECDELGILVDRDDQGVLL  197

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKP+GDRPT+FIEIIQRVGC++  E+G+ YQKGGCGGFGKGNFSELFKSIEEYEK L
Sbjct  198  QIFTKPIGDRPTIFIEIIQRVGCLLTDENGQAYQKGGCGGFGKGNFSELFKSIEEYEKTL  257

Query  305  EAK  297
            E +
Sbjct  258  EGR  260



>ref|NP_001046010.1| Os02g0168100 [Oryza sativa Japonica Group]
 dbj|BAF07924.1| Os02g0168100, partial [Oryza sativa Japonica Group]
Length=239

 Score =   286 bits (731),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 163/185 (88%), Gaps = 0/185 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GTAESGLNSVVLANN ETV LPLNEPVHGTKR+SQIQTYL+H+ GPG+QH+AL S+D+  
Sbjct  49   GTAESGLNSVVLANNAETVLLPLNEPVHGTKRRSQIQTYLDHHGGPGVQHIALASDDVLG  108

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RS +GGFEF+  PPP YY  ++ RAGDVLS+EQI EC+ELG+LVDRDDQG LL
Sbjct  109  TLREMRARSAMGGFEFLAPPPPNYYDGVRRRAGDVLSEEQINECQELGVLVDRDDQGVLL  168

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPT F+E+IQR+GCM K E G+ YQKGGCGGFGKGNFSELFKSIEEYEK L
Sbjct  169  QIFTKPVGDRPTFFLEMIQRIGCMEKDESGQEYQKGGCGGFGKGNFSELFKSIEEYEKSL  228

Query  305  EAKQA  291
            EAKQA
Sbjct  229  EAKQA  233



>ref|XP_009419542.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase [Musa acuminata 
subsp. malaccensis]
Length=474

 Score =   293 bits (751),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 147/185 (79%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GTAESGLNSVVLANN+ETV +PLNEPVHGTKR+SQIQTYL+HN G G+QHLAL S+D+ +
Sbjct  284  GTAESGLNSVVLANNEETVLVPLNEPVHGTKRRSQIQTYLDHNGGAGVQHLALASDDVLK  343

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RS +GGF+FMP PPP YY+ ++ RAGDVL++EQIKEC+ELG+LVDRDDQG LL
Sbjct  344  TLREMRARSRMGGFDFMPPPPPNYYQGVRRRAGDVLTEEQIKECQELGVLVDRDDQGVLL  403

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPT+FIEIIQR+GCM+K ++G+ YQKGGCGGFGKGNFSELFKSIEEYEK L
Sbjct  404  QIFTKPVGDRPTIFIEIIQRIGCMVKDKEGKEYQKGGCGGFGKGNFSELFKSIEEYEKSL  463

Query  305  EAKQA  291
            EAKQA
Sbjct  464  EAKQA  468



>ref|XP_010909672.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase [Elaeis guineensis]
Length=356

 Score =   288 bits (738),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 146/183 (80%), Positives = 165/183 (90%), Gaps = 0/183 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT ESGLNS+VLANN+ETV LPLNEPVHGTKR+SQIQTYL+HN G G+QHLAL S+D+ R
Sbjct  171  GTVESGLNSMVLANNEETVLLPLNEPVHGTKRRSQIQTYLDHNGGAGVQHLALASDDVLR  230

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREM+ +S IGGFEF+  PPPTYY+ ++ RAGDVL++EQIKECEELG+LVDRDDQG LL
Sbjct  231  TLREMQAKSAIGGFEFLAPPPPTYYEGVRRRAGDVLTEEQIKECEELGVLVDRDDQGVLL  290

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPT+F+EIIQRVGCMMK E+G  YQKGGCGGFGKGNFS LFKSIEEYEK L
Sbjct  291  QIFTKPVGDRPTIFLEIIQRVGCMMKDEEGREYQKGGCGGFGKGNFSALFKSIEEYEKSL  350

Query  305  EAK  297
            EAK
Sbjct  351  EAK  353



>ref|XP_010053910.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Eucalyptus 
grandis]
 gb|KCW89763.1| hypothetical protein EUGRSUZ_A02023 [Eucalyptus grandis]
Length=447

 Score =   290 bits (743),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT ESGLNSV LANNDETV LP+ EPV GTKR+S IQTYLEHNEGPG+QHLAL SEDIF 
Sbjct  257  GTDESGLNSVTLANNDETVLLPMTEPVFGTKRRSPIQTYLEHNEGPGVQHLALMSEDIFW  316

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TL+E+R +S +GGFEFMP PPPTYY+NLK R GDVL+DEQI+EC+ELGI+VDRDD+GTLL
Sbjct  317  TLKEVRKQSAVGGFEFMPPPPPTYYRNLKGRVGDVLTDEQIQECKELGIMVDRDDEGTLL  376

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPT+FIEIIQRVGCM+  + G++YQKG CGGFGKGNFSELFKS+EEYEK L
Sbjct  377  QIFTKPVGDRPTIFIEIIQRVGCMLTDDHGKLYQKGACGGFGKGNFSELFKSLEEYEKTL  436

Query  305  EAKQAIHAA  279
            +A++    A
Sbjct  437  DAQRVAALA  445



>ref|XP_006648349.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Oryza brachyantha]
Length=358

 Score =   287 bits (735),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 165/185 (89%), Gaps = 0/185 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            G AESGLNSVVLANN ETV LPLNEPVHGTKR+SQIQTYL+H+ GPG+QH+AL S+D+ R
Sbjct  168  GPAESGLNSVVLANNAETVLLPLNEPVHGTKRRSQIQTYLDHHGGPGVQHIALASDDVLR  227

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RS +GGFEF+  PPP YY  ++ RAGDVLS+EQIKEC+ELG+LVDRDDQG LL
Sbjct  228  TLREMRARSAMGGFEFLAPPPPNYYDGVRRRAGDVLSEEQIKECQELGVLVDRDDQGVLL  287

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKP+GDRPTLF+E+IQR+GCM K E G+ +QKGGCGGFGKGNFSELFKSIEEYEK L
Sbjct  288  QIFTKPIGDRPTLFLEMIQRIGCMEKDESGQEHQKGGCGGFGKGNFSELFKSIEEYEKSL  347

Query  305  EAKQA  291
            EAKQA
Sbjct  348  EAKQA  352



>ref|XP_010053920.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Eucalyptus 
grandis]
 gb|KCW89764.1| hypothetical protein EUGRSUZ_A02024 [Eucalyptus grandis]
Length=447

 Score =   290 bits (743),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 145/184 (79%), Positives = 168/184 (91%), Gaps = 0/184 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT ESGLNSV+LANN+E V LP++EPV GTKR+SQIQT+L+HNEGPG+QHLAL SEDIFR
Sbjct  257  GTDESGLNSVMLANNNEMVILPMSEPVFGTKRRSQIQTFLDHNEGPGVQHLALMSEDIFR  316

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RS +GGFEFMP PPPTYY+NLK R GDVL+DEQI+ECEELGI+VDRDD+GTLL
Sbjct  317  TLREMRKRSTVGGFEFMPPPPPTYYRNLKGRVGDVLTDEQIEECEELGIMVDRDDEGTLL  376

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPTLF+EIIQR+GCM+K +  ++YQKGGCGGFGKGN SELFKS+EEYEK L
Sbjct  377  QIFTKPVGDRPTLFLEIIQRLGCMLKDDHRKLYQKGGCGGFGKGNLSELFKSVEEYEKTL  436

Query  305  EAKQ  294
            E ++
Sbjct  437  EGRR  440



>dbj|BAD26248.1| putative 4-hydroxyphenylpyruvate dioxygenase [Oryza sativa Japonica 
Group]
 dbj|BAD25710.1| putative 4-hydroxyphenylpyruvate dioxygenase [Oryza sativa Japonica 
Group]
Length=446

 Score =   290 bits (741),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 163/185 (88%), Gaps = 0/185 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GTAESGLNSVVLANN ETV LPLNEPVHGTKR+SQIQTYL+H+ GPG+QH+AL S+D+  
Sbjct  256  GTAESGLNSVVLANNAETVLLPLNEPVHGTKRRSQIQTYLDHHGGPGVQHIALASDDVLG  315

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RS +GGFEF+  PPP YY  ++ RAGDVLS+EQI EC+ELG+LVDRDDQG LL
Sbjct  316  TLREMRARSAMGGFEFLAPPPPNYYDGVRRRAGDVLSEEQINECQELGVLVDRDDQGVLL  375

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPT F+E+IQR+GCM K E G+ YQKGGCGGFGKGNFSELFKSIEEYEK L
Sbjct  376  QIFTKPVGDRPTFFLEMIQRIGCMEKDESGQEYQKGGCGGFGKGNFSELFKSIEEYEKSL  435

Query  305  EAKQA  291
            EAKQA
Sbjct  436  EAKQA  440



>gb|KEH40154.1| 4-hydroxyphenylpyruvate dioxygenase [Medicago truncatula]
Length=428

 Score =   288 bits (737),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 147/184 (80%), Positives = 166/184 (90%), Gaps = 0/184 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT+ESGLN+VVLA+NDETV LP+ EP++GTKRKS I+TYLEHNEG G QHLAL SEDIFR
Sbjct  243  GTSESGLNNVVLASNDETVLLPICEPIYGTKRKSPIETYLEHNEGAGFQHLALASEDIFR  302

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR +SG+GGFEFM  PP TYY+NLK+R  DVLSDEQIKECEELGILVDRDDQGT+L
Sbjct  303  TLREMRKKSGVGGFEFMAPPPVTYYRNLKNRVVDVLSDEQIKECEELGILVDRDDQGTIL  362

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPT+ IEIIQRVGCM+K E+ + YQ+GGCGGFGKGNFSELFKSIEEYEK L
Sbjct  363  QIFTKPVGDRPTVLIEIIQRVGCMLKDEEEKEYQRGGCGGFGKGNFSELFKSIEEYEKTL  422

Query  305  EAKQ  294
            E ++
Sbjct  423  ETRR  426



>gb|EAZ21880.1| hypothetical protein OsJ_05532 [Oryza sativa Japonica Group]
Length=447

 Score =   288 bits (736),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 163/185 (88%), Gaps = 0/185 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GTAESGLNSVVLANN ETV LPLNEPVHGTKR+SQIQTYL+H+ GPG+QH+AL S+D+  
Sbjct  257  GTAESGLNSVVLANNAETVLLPLNEPVHGTKRRSQIQTYLDHHGGPGVQHIALASDDVLG  316

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RS +GGFEF+  PPP YY  ++ RAGDVLS+EQI EC+ELG+LVDRDDQG LL
Sbjct  317  TLREMRARSAMGGFEFLAPPPPNYYDGVRRRAGDVLSEEQINECQELGVLVDRDDQGVLL  376

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPT F+E+IQR+GCM K E G+ YQKGGCGGFGKGNFSELFKSIEEYEK L
Sbjct  377  QIFTKPVGDRPTFFLEMIQRIGCMEKDESGQEYQKGGCGGFGKGNFSELFKSIEEYEKSL  436

Query  305  EAKQA  291
            EAKQA
Sbjct  437  EAKQA  441



>gb|AAC62457.1| p-hydroxyphenylpyruvate dioxygenase [Arabidopsis thaliana]
Length=419

 Score =   287 bits (734),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 134/154 (87%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GTAESGLNS VLA+NDE V LP+NEPVHGTKRKSQIQTYLEHNEG GLQHLAL SEDIFR
Sbjct  259  GTAESGLNSAVLASNDEMVLLPINEPVHGTKRKSQIQTYLEHNEGAGLQHLALMSEDIFR  318

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RS IGGF+FMPSPPPTYY+NLK R GDVLSD+QIKECEELGILVDRDDQGTLL
Sbjct  319  TLREMRKRSSIGGFDFMPSPPPTYYQNLKKRVGDVLSDDQIKECEELGILVDRDDQGTLL  378

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQ  384
            QIFTKP+GDRPT+FIEIIQRVGCMMK E+G+ YQ
Sbjct  379  QIFTKPLGDRPTIFIEIIQRVGCMMKDEEGKAYQ  412



>ref|XP_008811120.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase [Phoenix dactylifera]
Length=451

 Score =   288 bits (736),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 143/184 (78%), Positives = 167/184 (91%), Gaps = 0/184 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GTAESGLNS+VLANN+ETV LP+NEPVHGTKR+SQIQTYL+HN G GLQHLAL S+D+ R
Sbjct  261  GTAESGLNSMVLANNEETVLLPVNEPVHGTKRRSQIQTYLDHNGGAGLQHLALASDDVLR  320

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREM+ +S +GGFEF+  PPP YY+ ++ RAGDVL++EQIKEC+ELG+LVDRDDQG LL
Sbjct  321  TLREMKAKSEMGGFEFLAPPPPNYYQGVRRRAGDVLTEEQIKECQELGVLVDRDDQGVLL  380

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKP+GDRPT+F+EIIQR+GCMMK E+G  YQKGGCGGFGKGNF+ELFKSIEEYEK L
Sbjct  381  QIFTKPIGDRPTIFLEIIQRIGCMMKDEEGREYQKGGCGGFGKGNFAELFKSIEEYEKSL  440

Query  305  EAKQ  294
            EAKQ
Sbjct  441  EAKQ  444



>ref|XP_004951787.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Setaria 
italica]
Length=441

 Score =   287 bits (734),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 142/185 (77%), Positives = 166/185 (90%), Gaps = 0/185 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GTAESGLNS+VLANN ETV +PLNEPVHGTKR+SQIQT+L+HN GPG+QH+AL S+D+ R
Sbjct  251  GTAESGLNSMVLANNSETVLIPLNEPVHGTKRRSQIQTFLDHNGGPGVQHIALASDDVLR  310

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREM+ RS +GGFEFM +PPP YY+ ++ RAGDVLS+ QIKEC+ELG+LVDRDDQG LL
Sbjct  311  TLREMQARSAMGGFEFMAAPPPDYYEGVRRRAGDVLSEAQIKECQELGVLVDRDDQGVLL  370

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDR TLF+EIIQR+GCM K E G+ YQKGGCGGFGKGNFS+LFKSIE+YEK L
Sbjct  371  QIFTKPVGDRQTLFLEIIQRIGCMEKDEQGQEYQKGGCGGFGKGNFSQLFKSIEDYEKSL  430

Query  305  EAKQA  291
            E+KQA
Sbjct  431  ESKQA  435



>ref|XP_003570001.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase [Brachypodium 
distachyon]
Length=436

 Score =   285 bits (729),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 142/185 (77%), Positives = 163/185 (88%), Gaps = 0/185 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GTA+SGLNSVVLANN E V LPLNEPVHGTKR+SQIQTYL+H+ GPG+QH+AL S+D+ R
Sbjct  246  GTADSGLNSVVLANNSERVLLPLNEPVHGTKRRSQIQTYLDHHGGPGVQHIALASDDVLR  305

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RS +GGFEF+  PPP YY  ++ RAGDVLS+ QIKEC+ELG+LVDRDDQG LL
Sbjct  306  TLREMRARSAMGGFEFLAPPPPNYYDGVRRRAGDVLSEAQIKECQELGVLVDRDDQGVLL  365

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPTLF+E+IQR+GCM K E G+  QKGGCGGFGKGNFSELF+SIEEYEK L
Sbjct  366  QIFTKPVGDRPTLFLEMIQRIGCMEKDEIGQEQQKGGCGGFGKGNFSELFRSIEEYEKSL  425

Query  305  EAKQA  291
            EAKQ+
Sbjct  426  EAKQS  430



>gb|EEC72567.1| hypothetical protein OsI_06005 [Oryza sativa Indica Group]
Length=601

 Score =   288 bits (738),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 163/185 (88%), Gaps = 0/185 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GTAESGLNSVVLANN ETV LPLNEPVHGTKR+SQIQTYL+H+ GPG+QH+AL S+D+  
Sbjct  411  GTAESGLNSVVLANNAETVLLPLNEPVHGTKRRSQIQTYLDHHGGPGVQHIALASDDVLG  470

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RS +GGFEF+  PPP YY  ++ RAGDVLS+EQI EC+ELG+LVDRDDQG LL
Sbjct  471  TLREMRARSAMGGFEFLAPPPPNYYDGVRRRAGDVLSEEQINECQELGVLVDRDDQGVLL  530

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPT F+E+IQR+GCM K E G+ YQKGGCGGFGKGNFSELFKSIEEYEK L
Sbjct  531  QIFTKPVGDRPTFFLEMIQRIGCMEKDESGQEYQKGGCGGFGKGNFSELFKSIEEYEKSL  590

Query  305  EAKQA  291
            EAKQA
Sbjct  591  EAKQA  595



>ref|XP_002453359.1| hypothetical protein SORBIDRAFT_04g004560 [Sorghum bicolor]
 gb|EES06335.1| hypothetical protein SORBIDRAFT_04g004560 [Sorghum bicolor]
Length=440

 Score =   283 bits (725),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 142/188 (76%), Positives = 163/188 (87%), Gaps = 0/188 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT ESGLNS+VLANN E V LPLNEPVHGTKR+SQIQTYL+H+ GPG+QH+AL S+D+ R
Sbjct  250  GTTESGLNSMVLANNAENVLLPLNEPVHGTKRRSQIQTYLDHHGGPGVQHMALASDDVLR  309

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREM+ RS +GGFEFM  P P YY  ++ RAGDVL++ QIKEC+ELG+LVDRDDQG LL
Sbjct  310  TLREMQARSAMGGFEFMAPPAPEYYDGVRRRAGDVLTEAQIKECQELGVLVDRDDQGVLL  369

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPTLF+EIIQR+GCM K E G+ YQKGGCGGFGKGNFS+LFKSIE+YEK L
Sbjct  370  QIFTKPVGDRPTLFLEIIQRIGCMEKDEKGQEYQKGGCGGFGKGNFSQLFKSIEDYEKSL  429

Query  305  EAKQAIHA  282
            EAKQA  A
Sbjct  430  EAKQAAAA  437



>gb|ERN14877.1| hypothetical protein AMTR_s00032p00156310 [Amborella trichopoda]
Length=283

 Score =   277 bits (708),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GTAESGLNS+VLANN+ETV +PLNEPVHGTKR+SQIQTYLE+N+GPG+QHLAL  ++IF 
Sbjct  92   GTAESGLNSMVLANNNETVLMPLNEPVHGTKRRSQIQTYLEYNQGPGVQHLALVCDNIFE  151

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR R   GG EFMP PPPTYYKNL  RAGDVL+ EQ+K CEEL +LVDRD+QGTLL
Sbjct  152  TLREMRKRGKEGGLEFMPGPPPTYYKNLPGRAGDVLTQEQMKLCEELEVLVDRDEQGTLL  211

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKP+GDRPT+FIEIIQR+GCM+K E G  YQK  CGGFGKGNFSELF+SIEEYEK L
Sbjct  212  QIFTKPLGDRPTIFIEIIQRLGCMLKDEQGNDYQKPACGGFGKGNFSELFRSIEEYEKSL  271

Query  305  E  303
            E
Sbjct  272  E  272



>gb|EMS64157.1| 4-hydroxyphenylpyruvate dioxygenase [Triticum urartu]
Length=314

 Score =   275 bits (703),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 140/185 (76%), Positives = 162/185 (88%), Gaps = 0/185 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GTAESGLNS+VLANN E V LPLNEPVHGTKR+SQIQT+LEH+ G G+QH+A+ S D+ R
Sbjct  124  GTAESGLNSMVLANNSEGVLLPLNEPVHGTKRRSQIQTFLEHHGGSGVQHIAVASSDVLR  183

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RS +GGF+F+P P P YY+ ++  AGDVLS+ QIKEC+ELG+LVDRDDQG LL
Sbjct  184  TLREMRARSAMGGFDFLPPPLPKYYEGVRRIAGDVLSEAQIKECQELGVLVDRDDQGVLL  243

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPTLF+E+IQR+GCM K E GE YQKGGCGGFGKGNFSELFKSIE+YEK L
Sbjct  244  QIFTKPVGDRPTLFLEMIQRIGCMEKDERGEEYQKGGCGGFGKGNFSELFKSIEDYEKSL  303

Query  305  EAKQA  291
            EAKQ+
Sbjct  304  EAKQS  308



>sp|O48604.1|HPPD_HORVU RecName: Full=4-hydroxyphenylpyruvate dioxygenase; AltName: Full=4-hydroxyphenylpyruvic 
acid oxidase; Short=4HPPD; Short=HPD; 
Short=HPPDase [Hordeum vulgare]
 emb|CAA04245.1| 4-hydroxyphenylpyruvate dioxygenase [Hordeum vulgare subsp. vulgare]
Length=434

 Score =   279 bits (714),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 140/185 (76%), Positives = 162/185 (88%), Gaps = 0/185 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT ESGLNSVVLANN E V LPLNEPVHGTKR+SQIQT+LEH+ GPG+QH+A+ S D+ R
Sbjct  244  GTTESGLNSVVLANNSEGVLLPLNEPVHGTKRRSQIQTFLEHHGGPGVQHIAVASSDVLR  303

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLR+MR RS +GGF+F+P P P YY+ ++  AGDVLS+ QIKEC+ELG+LVDRDDQG LL
Sbjct  304  TLRKMRARSAMGGFDFLPPPLPKYYEGVRRLAGDVLSEAQIKECQELGVLVDRDDQGVLL  363

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPTLF+E+IQR+GCM K E GE YQKGGCGGFGKGNFSELFKSIE+YEK L
Sbjct  364  QIFTKPVGDRPTLFLEMIQRIGCMEKDERGEEYQKGGCGGFGKGNFSELFKSIEDYEKSL  423

Query  305  EAKQA  291
            EAKQ+
Sbjct  424  EAKQS  428



>dbj|BAJ86732.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86970.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91713.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=434

 Score =   278 bits (712),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 140/185 (76%), Positives = 162/185 (88%), Gaps = 0/185 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT ESGLNSVVLANN E V LPLNEPVHGTKR+SQIQT+LEH+ GPG+QH+A+ S D+ R
Sbjct  244  GTTESGLNSVVLANNSEGVLLPLNEPVHGTKRRSQIQTFLEHHGGPGVQHIAVASSDVLR  303

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLR+MR RS +GGF+F+P P P YY+ ++  AGDVLS+ QIKEC+ELG+LVDRDDQG LL
Sbjct  304  TLRKMRARSAMGGFDFLPPPLPKYYEGVRRLAGDVLSEAQIKECQELGVLVDRDDQGVLL  363

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPTLF+E+IQR+GCM K E GE YQKGGCGGFGKGNFSELFKSIE+YEK L
Sbjct  364  QIFTKPVGDRPTLFLEMIQRIGCMEKDERGEEYQKGGCGGFGKGNFSELFKSIEDYEKSL  423

Query  305  EAKQA  291
            EAKQ+
Sbjct  424  EAKQS  428



>dbj|BAJ95714.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=434

 Score =   278 bits (712),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 140/185 (76%), Positives = 162/185 (88%), Gaps = 0/185 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT ESGLNSVVLANN E V LPLNEPVHGTKR+SQIQT+LEH+ GPG+QH+A+ S D+ R
Sbjct  244  GTTESGLNSVVLANNSEGVLLPLNEPVHGTKRRSQIQTFLEHHGGPGVQHIAVASSDVLR  303

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLR+MR RS +GGF+F+P P P YY+ ++  AGDVLS+ QIKEC+ELG+LVDRDDQG LL
Sbjct  304  TLRKMRARSAMGGFDFLPPPLPKYYEGVRRLAGDVLSEAQIKECQELGVLVDRDDQGVLL  363

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPTLF+E+IQR+GCM K E GE YQKGGCGGFGKGNFSELFKSIE+YEK L
Sbjct  364  QIFTKPVGDRPTLFLEMIQRIGCMEKDERGEEYQKGGCGGFGKGNFSELFKSIEDYEKSL  423

Query  305  EAKQA  291
            EAKQ+
Sbjct  424  EAKQS  428



>dbj|BAK02084.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=459

 Score =   278 bits (712),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 140/185 (76%), Positives = 162/185 (88%), Gaps = 0/185 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT ESGLNSVVLANN E V LPLNEPVHGTKR+SQIQT+LEH+ GPG+QH+A+ S D+ R
Sbjct  269  GTTESGLNSVVLANNSEGVLLPLNEPVHGTKRRSQIQTFLEHHGGPGVQHIAVASSDVLR  328

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLR+MR RS +GGF+F+P P P YY+ ++  AGDVLS+ QIKEC+ELG+LVDRDDQG LL
Sbjct  329  TLRKMRARSAMGGFDFLPPPLPKYYEGVRRLAGDVLSEAQIKECQELGVLVDRDDQGVLL  388

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPTLF+E+IQR+GCM K E GE YQKGGCGGFGKGNFSELFKSIE+YEK L
Sbjct  389  QIFTKPVGDRPTLFLEMIQRIGCMEKDERGEEYQKGGCGGFGKGNFSELFKSIEDYEKSL  448

Query  305  EAKQA  291
            EAKQ+
Sbjct  449  EAKQS  453



>ref|XP_006853410.2| PREDICTED: LOW QUALITY PROTEIN: 4-hydroxyphenylpyruvate dioxygenase 
[Amborella trichopoda]
Length=442

 Score =   278 bits (710),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GTAESGLNS+VLANN+ETV +PLNEPVHGTKR+SQIQTYLE+N+GPG+QHLAL  ++IF 
Sbjct  251  GTAESGLNSMVLANNNETVLMPLNEPVHGTKRRSQIQTYLEYNQGPGVQHLALVCDNIFE  310

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR R   GG EFMP PPPTYYKNL  RAGDVL+ EQ+K CEEL +LVDRD+QGTLL
Sbjct  311  TLREMRKRGKEGGLEFMPGPPPTYYKNLPGRAGDVLTQEQMKLCEELEVLVDRDEQGTLL  370

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKP+GDRPT+FIEIIQR+GCM+K E G  YQK  CGGFGKGNFSELF+SIEEYEK L
Sbjct  371  QIFTKPLGDRPTIFIEIIQRLGCMLKDEQGNDYQKPACGGFGKGNFSELFRSIEEYEKSL  430

Query  305  E  303
            E
Sbjct  431  E  431



>pdb|1SP8|A Chain A, 4-hydroxyphenylpyruvate Dioxygenase
 pdb|1SP8|B Chain B, 4-hydroxyphenylpyruvate Dioxygenase
 pdb|1SP8|C Chain C, 4-hydroxyphenylpyruvate Dioxygenase
 pdb|1SP8|D Chain D, 4-hydroxyphenylpyruvate Dioxygenase
Length=418

 Score =   277 bits (708),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 161/184 (88%), Gaps = 0/184 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GTAESGLNS+VLANN E V LPLNEPVHGTKR+SQIQT+L+H+ GPG+QH+AL S+D+ R
Sbjct  235  GTAESGLNSMVLANNSENVLLPLNEPVHGTKRRSQIQTFLDHHGGPGVQHMALASDDVLR  294

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREM+ RS +GGFEFM  P   YY  ++ RAGDVL++ QIKEC+ELG+LVDRDDQG LL
Sbjct  295  TLREMQARSAMGGFEFMAPPTSDYYDGVRRRAGDVLTEAQIKECQELGVLVDRDDQGVLL  354

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPTLF+EIIQR+GCM K E G+ YQKGGCGGFGKGNFS+LFKSIE+YEK L
Sbjct  355  QIFTKPVGDRPTLFLEIIQRIGCMEKDEKGQEYQKGGCGGFGKGNFSQLFKSIEDYEKSL  414

Query  305  EAKQ  294
            EAKQ
Sbjct  415  EAKQ  418



>ref|XP_007048964.1| Phytoene desaturation 1 isoform 4, partial [Theobroma cacao]
 gb|EOX93121.1| Phytoene desaturation 1 isoform 4, partial [Theobroma cacao]
Length=396

 Score =   276 bits (706),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 129/148 (87%), Positives = 138/148 (93%), Gaps = 0/148 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT ESGLNS+VLANNDE V LP+NEPV GTKRKSQIQTYLEHNEG G+QHLAL SEDIF+
Sbjct  249  GTTESGLNSLVLANNDEMVLLPMNEPVFGTKRKSQIQTYLEHNEGAGVQHLALVSEDIFK  308

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RS +GGFEFMPSPPPTYYKNLK+RAGDVLSDEQIK+CEELGILVDRDDQGTLL
Sbjct  309  TLREMRKRSLVGGFEFMPSPPPTYYKNLKTRAGDVLSDEQIKDCEELGILVDRDDQGTLL  368

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKE  402
            QIFTKPVGDRPT F+EIIQRVGCM+K E
Sbjct  369  QIFTKPVGDRPTFFLEIIQRVGCMLKDE  396



>ref|XP_001756086.1| predicted protein [Physcomitrella patens]
 gb|EDQ78952.1| predicted protein [Physcomitrella patens]
Length=433

 Score =   277 bits (709),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 141/188 (75%), Positives = 161/188 (86%), Gaps = 1/188 (1%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT ESGLNS+V+A+N+E V LP+NEP  GTKRKSQIQTYLEHNEGPGLQHLAL  ++IF 
Sbjct  246  GTTESGLNSMVVASNNEMVLLPINEPTFGTKRKSQIQTYLEHNEGPGLQHLALICDNIFS  305

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR R+ IGGF+FMP PPPTYYKNL +R GD+L+ EQIKEC+ELGILVD+DDQG LL
Sbjct  306  TLREMRTRTHIGGFDFMPKPPPTYYKNLANRVGDILTAEQIKECDELGILVDKDDQGVLL  365

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKED-GEVYQkggcggfgkGNFSELFKSIEEYEKM  309
            QIFTKPVGDRP++F+EIIQR+GCM K E  G   QKGGCGGFGKGNFSELFKSIEEYEK 
Sbjct  366  QIFTKPVGDRPSIFVEIIQRIGCMDKDESTGATVQKGGCGGFGKGNFSELFKSIEEYEKT  425

Query  308  LEAKQAIH  285
            L+    +H
Sbjct  426  LDGTLKVH  433



>gb|ACN36372.1| unknown [Zea mays]
Length=426

 Score =   276 bits (705),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 161/184 (88%), Gaps = 0/184 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GTAESGLNS+VLANN E V LPLNEPVHGTKR+SQIQT+L+H+ GPG+QH+AL S+D+ R
Sbjct  233  GTAESGLNSMVLANNSENVLLPLNEPVHGTKRRSQIQTFLDHHGGPGVQHMALASDDVLR  292

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREM+ RS +GGFEFM  P   YY  ++ RAGDVL++ QIKEC+ELG+LVDRDDQG LL
Sbjct  293  TLREMQARSAMGGFEFMAPPTSDYYDGVRRRAGDVLTEAQIKECQELGVLVDRDDQGVLL  352

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPTLF+EIIQR+GCM K E G+ YQKGGCGGFGKGNFS+LFKSIE+YEK L
Sbjct  353  QIFTKPVGDRPTLFLEIIQRIGCMEKDEKGQEYQKGGCGGFGKGNFSQLFKSIEDYEKSL  412

Query  305  EAKQ  294
            EAKQ
Sbjct  413  EAKQ  416



>gb|AFW70252.1| 4-hydroxyphenylpyruvate dioxygenase 1 [Zea mays]
Length=444

 Score =   276 bits (706),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 161/184 (88%), Gaps = 0/184 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GTAESGLNS+VLANN E V LPLNEPVHGTKR+SQIQT+L+H+ GPG+QH+AL S+D+ R
Sbjct  251  GTAESGLNSMVLANNSENVLLPLNEPVHGTKRRSQIQTFLDHHGGPGVQHMALASDDVLR  310

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREM+ RS +GGFEFM  P   YY  ++ RAGDVL++ QIKEC+ELG+LVDRDDQG LL
Sbjct  311  TLREMQARSAMGGFEFMAPPTSDYYDGVRRRAGDVLTEAQIKECQELGVLVDRDDQGVLL  370

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPTLF+EIIQR+GCM K E G+ YQKGGCGGFGKGNFS+LFKSIE+YEK L
Sbjct  371  QIFTKPVGDRPTLFLEIIQRIGCMEKDEKGQEYQKGGCGGFGKGNFSQLFKSIEDYEKSL  430

Query  305  EAKQ  294
            EAKQ
Sbjct  431  EAKQ  434



>ref|XP_001757940.1| predicted protein [Physcomitrella patens]
 gb|EDQ77182.1| predicted protein [Physcomitrella patens]
Length=432

 Score =   272 bits (696),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 140/183 (77%), Positives = 160/183 (87%), Gaps = 1/183 (1%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT+ESGLNS+VLA+N+E V LPLNEP  GTKRKSQIQTYLEHNEGPGLQHLAL  ++IF 
Sbjct  246  GTSESGLNSMVLASNNEMVLLPLNEPTFGTKRKSQIQTYLEHNEGPGLQHLALICDNIFS  305

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TL+EMR R+ IGGF+FMP PP TYYKNL +R GD+L++EQIK+C+ELGILVD+DDQG LL
Sbjct  306  TLKEMRTRTHIGGFDFMPKPPATYYKNLANRVGDILTEEQIKQCDELGILVDKDDQGVLL  365

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKE-DGEVYQkggcggfgkGNFSELFKSIEEYEKM  309
            QIFTKPVGDRPT+FIEIIQR+GCM K E  G   Q+GGCGGFGKGNFSELFKSIEEYEK 
Sbjct  366  QIFTKPVGDRPTIFIEIIQRIGCMEKDETTGVSVQRGGCGGFGKGNFSELFKSIEEYEKT  425

Query  308  LEA  300
            L+ 
Sbjct  426  LDG  428



>gb|AAN28922.1| 4-hydroxyphenylpyruvate dioxygenase [Abutilon theophrasti]
Length=363

 Score =   269 bits (688),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT+ESGLNSV+LANN+E V +P+ EPV+GTKRKSQ+QTYLEHNEG G+QHLAL SEDIFR
Sbjct  205  GTSESGLNSVILANNNEMVLMPIAEPVYGTKRKSQVQTYLEHNEGAGVQHLALLSEDIFR  264

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RS +GGFEFMPSPPPTYY+ LK R GD+LSDEQIKECEELGI+VDRDDQGTLL
Sbjct  265  TLREMRKRSFVGGFEFMPSPPPTYYEKLKQRVGDILSDEQIKECEELGIMVDRDDQGTLL  324

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQ  384
            QIFTKP+GDRPT+ +EIIQR+GCM+K E+G+ YQ
Sbjct  325  QIFTKPIGDRPTILLEIIQRIGCMVKDEEGKQYQ  358



>gb|AAZ67144.1| 4-hydroxyphenylpyruvate dioxygenase [Triticum aestivum]
Length=436

 Score =   270 bits (690),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 160/185 (86%), Gaps = 0/185 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GTAESGLNS+VLANN E V LPLNEPVHGTKR+SQIQT+LEH+ G G+QH+A+ S D+ R
Sbjct  246  GTAESGLNSMVLANNSEGVLLPLNEPVHGTKRRSQIQTFLEHHGGSGVQHIAVASSDVLR  305

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RS +GGF+F+P     YY+ ++  AGDVLS+ QIKEC+ELG+LVDRDDQG LL
Sbjct  306  TLREMRARSAMGGFDFLPPRCRKYYEGVRRIAGDVLSEAQIKECQELGVLVDRDDQGVLL  365

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPTLF+E+IQR+GCM K E GE YQKGGCGGFGKGNFSELFKSIE+YEK L
Sbjct  366  QIFTKPVGDRPTLFLEMIQRIGCMEKDERGEEYQKGGCGGFGKGNFSELFKSIEDYEKSL  425

Query  305  EAKQA  291
            EAKQ+
Sbjct  426  EAKQS  430



>ref|NP_001105782.1| 4-hydroxyphenylpyruvate dioxygenase 1 [Zea mays]
 emb|CAG25475.1| putative p-hydroxyphenylpyruvate dioxygenase [Zea mays]
Length=444

 Score =   267 bits (682),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GTAESGLNS+VLANN E V LPLNEPVHGTKR+SQIQT+L+H+ GPG+QH+AL S+D+ R
Sbjct  251  GTAESGLNSMVLANNSENVLLPLNEPVHGTKRRSQIQTFLDHHGGPGVQHMALASDDVLR  310

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREM+ RS +GGFEFM  P   YY  ++ RAGDVL++ QIKEC+ELG+LVDRDDQG LL
Sbjct  311  TLREMQARSAMGGFEFMAPPTSDYYDGVRRRAGDVLTEAQIKECQELGVLVDRDDQGVLL  370

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIF KPVGDRPTLF+EIIQR+GCM + E G+ YQKGGCGGFGKGNFS+LFKSIE+YEK L
Sbjct  371  QIFPKPVGDRPTLFLEIIQRIGCMERDEKGQEYQKGGCGGFGKGNFSQLFKSIEDYEKSL  430

Query  305  E  303
            E
Sbjct  431  E  431



>gb|EMT09524.1| 4-hydroxyphenylpyruvate dioxygenase [Aegilops tauschii]
Length=315

 Score =   260 bits (665),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 141/216 (65%), Positives = 163/216 (75%), Gaps = 31/216 (14%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GTAESGLNS+VLANN E V LPLNEPVHGTKR+SQIQT+LEH+ GPG+QH+A+ S D+ R
Sbjct  94   GTAESGLNSMVLANNSEGVLLPLNEPVHGTKRRSQIQTFLEHHGGPGVQHIAVASSDVLR  153

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RS +GGF+F+P P P YY+ ++  AGDVLS+ QIKEC+ELG+LVDRDDQG LL
Sbjct  154  TLREMRARSAMGGFDFLPPPLPKYYEGVRRIAGDVLSEAQIKECQELGVLVDRDDQGVLL  213

Query  485  QIFTKPVGD-------------------------------RPTLFIEIIQRVGCMMKKED  399
            QIFTKPVGD                               RPTLF+E+IQR+GCM K E 
Sbjct  214  QIFTKPVGDSDLRFGPLINSGCIFALLRVLPNLTASAIMFRPTLFLEMIQRIGCMEKDER  273

Query  398  GEVYQkggcggfgkGNFSELFKSIEEYEKMLEAKQA  291
            GE YQKGGCGGFGKGNFSELFKSIE+YEK LEAKQ+
Sbjct  274  GEEYQKGGCGGFGKGNFSELFKSIEDYEKSLEAKQS  309



>ref|XP_002974762.1| hypothetical protein SELMODRAFT_174278 [Selaginella moellendorffii]
 gb|EFJ24282.1| hypothetical protein SELMODRAFT_174278 [Selaginella moellendorffii]
Length=495

 Score =   253 bits (646),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 151/181 (83%), Gaps = 5/181 (3%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT ESGLNS+VLA+N+E V LP+NEPVHGT+RKSQIQTYL+HNEGPGLQHLA++  DIF 
Sbjct  319  GTCESGLNSMVLASNNEMVLLPMNEPVHGTRRKSQIQTYLDHNEGPGLQHLAISCRDIFH  378

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RS IGGFEFMP P   YYK+L  R G  L+ EQ++ CEELGILVD+DDQG LL
Sbjct  379  TLREMRMRSHIGGFEFMPRPNKKYYKDLPERIGSSLTPEQVEMCEELGILVDKDDQGILL  438

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPTLF+EIIQRVGCM      E  Q+GGCGGFGKGNFS LFKSIE+YEK L
Sbjct  439  QIFTKPVGDRPTLFLEIIQRVGCME-----ENVQRGGCGGFGKGNFSALFKSIEDYEKTL  493

Query  305  E  303
            E
Sbjct  494  E  494



>gb|KDO51876.1| hypothetical protein CISIN_1g013898mg [Citrus sinensis]
Length=389

 Score =   249 bits (637),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/130 (89%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT+ESGLNSVVLANNDE V LP+NEPV GTKRKSQIQTYLEHNEG G+QHLAL SEDIFR
Sbjct  244  GTSESGLNSVVLANNDEMVLLPMNEPVFGTKRKSQIQTYLEHNEGAGVQHLALVSEDIFR  303

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RSG+GGFEFMPSPPPTYYKNLK+RAGDVL+DEQIK+CEELG+LVDRDDQGTLL
Sbjct  304  TLREMRKRSGVGGFEFMPSPPPTYYKNLKNRAGDVLTDEQIKQCEELGVLVDRDDQGTLL  363

Query  485  QIFTKPVGDR  456
            QIFTKPVGDR
Sbjct  364  QIFTKPVGDR  373



>ref|XP_002963674.1| hypothetical protein SELMODRAFT_165961 [Selaginella moellendorffii]
 gb|EFJ35545.1| hypothetical protein SELMODRAFT_165961 [Selaginella moellendorffii]
Length=495

 Score =   251 bits (642),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 151/181 (83%), Gaps = 5/181 (3%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT ESGLNS+VLA+N+E V LP+NEPVHGT+RKSQIQTYL+HNEGPGLQHLA++  DIF 
Sbjct  319  GTCESGLNSMVLASNNEMVLLPMNEPVHGTRRKSQIQTYLDHNEGPGLQHLAISCRDIFH  378

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RS IGGFEFMP P   YY++L  R G  L+ EQ++ CEELGILVD+DDQG LL
Sbjct  379  TLREMRMRSHIGGFEFMPRPNKKYYRDLPERIGSSLTPEQVEMCEELGILVDKDDQGILL  438

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPTLF+EIIQRVGCM      E  Q+GGCGGFGKGNF+ LFKSIE+YEK L
Sbjct  439  QIFTKPVGDRPTLFLEIIQRVGCME-----ENVQRGGCGGFGKGNFAALFKSIEDYEKTL  493

Query  305  E  303
            E
Sbjct  494  E  494



>ref|XP_011100559.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase isoform X2 [Sesamum 
indicum]
Length=442

 Score =   249 bits (636),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/130 (91%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GTAESGLNSVVLANN+E V  PLNEPV+GTKRKSQIQTYLEHNEG G+QHLAL SEDIFR
Sbjct  306  GTAESGLNSVVLANNNENVLFPLNEPVYGTKRKSQIQTYLEHNEGSGVQHLALVSEDIFR  365

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RSGIGGFEFMPSPPPTYYKNLKSRAGDVL+DEQI+ECE+LGILVDRDDQGTLL
Sbjct  366  TLREMRKRSGIGGFEFMPSPPPTYYKNLKSRAGDVLTDEQIQECEKLGILVDRDDQGTLL  425

Query  485  QIFTKPVGDR  456
            QIFTKPVGDR
Sbjct  426  QIFTKPVGDR  435



>ref|XP_007048963.1| Phytoene desaturation 1 isoform 3 [Theobroma cacao]
 gb|EOX93120.1| Phytoene desaturation 1 isoform 3 [Theobroma cacao]
Length=389

 Score =   244 bits (622),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT ESGLNS+VLANNDE V LP+NEPV GTKRKSQIQTYLEHNEG G+QHLAL SEDIF+
Sbjct  249  GTTESGLNSLVLANNDEMVLLPMNEPVFGTKRKSQIQTYLEHNEGAGVQHLALVSEDIFK  308

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RS +GGFEFMPSPPPTYYKNLK+RAGDVLSDEQIK+CEELGILVDRDDQGTLL
Sbjct  309  TLREMRKRSLVGGFEFMPSPPPTYYKNLKTRAGDVLSDEQIKDCEELGILVDRDDQGTLL  368

Query  485  QIFTKPVGDR  456
            QIFTKPVGDR
Sbjct  369  QIFTKPVGDR  378



>ref|NP_001154311.1| 4-hydroxyphenylpyruvate dioxygenase [Arabidopsis thaliana]
 gb|AEE28007.1| 4-hydroxyphenylpyruvate dioxygenase [Arabidopsis thaliana]
Length=418

 Score =   242 bits (618),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GTAESGLNS VLA+NDE V LP+NEPVHGTKRKSQIQTYLEHNEG GLQHLAL SEDIFR
Sbjct  287  GTAESGLNSAVLASNDEMVLLPINEPVHGTKRKSQIQTYLEHNEGAGLQHLALMSEDIFR  346

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RS IGGF+FMPSPPPTYY+NLK R GDVLSD+QIKECEELGILVDRDDQGTLL
Sbjct  347  TLREMRKRSSIGGFDFMPSPPPTYYQNLKKRVGDVLSDDQIKECEELGILVDRDDQGTLL  406

Query  485  QIFTKPVGDR  456
            QIFTKP+G R
Sbjct  407  QIFTKPLGRR  416



>gb|KJB08583.1| hypothetical protein B456_001G092000 [Gossypium raimondii]
Length=396

 Score =   241 bits (615),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT+ESGLNSVVLANN+E V LP+NEPV GTKRKSQIQTYLEHNEG G+QHLAL SEDIF+
Sbjct  249  GTSESGLNSVVLANNEEMVLLPMNEPVFGTKRKSQIQTYLEHNEGAGVQHLALVSEDIFK  308

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RS +GGFEFMPSPPPTYYK LK RAGD+LSDEQIKECEELGILVDRDDQGTLL
Sbjct  309  TLREMRKRSFVGGFEFMPSPPPTYYKKLKQRAGDILSDEQIKECEELGILVDRDDQGTLL  368

Query  485  QIFTKPVGDR  456
            QIFTKPVGDR
Sbjct  369  QIFTKPVGDR  378



>gb|KJB08582.1| hypothetical protein B456_001G092000 [Gossypium raimondii]
Length=413

 Score =   241 bits (616),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT+ESGLNSVVLANN+E V LP+NEPV GTKRKSQIQTYLEHNEG G+QHLAL SEDIF+
Sbjct  249  GTSESGLNSVVLANNEEMVLLPMNEPVFGTKRKSQIQTYLEHNEGAGVQHLALVSEDIFK  308

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RS +GGFEFMPSPPPTYYK LK RAGD+LSDEQIKECEELGILVDRDDQGTLL
Sbjct  309  TLREMRKRSFVGGFEFMPSPPPTYYKKLKQRAGDILSDEQIKECEELGILVDRDDQGTLL  368

Query  485  QIFTKPVGDR  456
            QIFTKPVGDR
Sbjct  369  QIFTKPVGDR  378



>ref|XP_004368015.1| 4hydroxyphenylpyruvate dioxygenase [Acanthamoeba castellanii 
str. Neff]
 gb|ELR25260.1| 4hydroxyphenylpyruvate dioxygenase [Acanthamoeba castellanii 
str. Neff]
Length=420

 Score =   239 bits (610),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 144/180 (80%), Gaps = 0/180 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT +SGLNS+V+A+N+E V LP NEP  GTKRKSQIQTYLE N+G GLQHLAL ++DIF 
Sbjct  239  GTVDSGLNSMVMASNNEMVLLPFNEPTFGTKRKSQIQTYLEQNDGEGLQHLALKTDDIFA  298

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            T+R+++  + +GGF+FMP   P YYKNL  + GD L+ +Q KE EELG+L D+DDQG LL
Sbjct  299  TMRKLKAATNLGGFDFMPPASPAYYKNLPEKIGDALTPDQYKELEELGLLADKDDQGVLL  358

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKP  DRPT FIEIIQR+GCM K + GE  Q GGCGGFGKGNFSELFKSIE+YEK L
Sbjct  359  QIFTKPCSDRPTFFIEIIQRIGCMTKNQKGEEEQTGGCGGFGKGNFSELFKSIEDYEKTL  418



>gb|KDO16411.1| 4-hydroxyphenylpyruvate dioxygenase [Saprolegnia parasitica CBS 
223.65]
Length=417

 Score =   238 bits (607),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 148/181 (82%), Gaps = 1/181 (1%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT +SGLNS+VLANN E + LP+NEP  GTKRKSQIQT+LE NEGPGLQH+AL + DIF 
Sbjct  237  GTVDSGLNSMVLANNSEMILLPMNEPTFGTKRKSQIQTFLEQNEGPGLQHMALKTNDIFH  296

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TL EMR R+ +GGF+FMP P   YYKNL ++ GD+ + +Q K+ EELG+LVD+DDQG LL
Sbjct  297  TLAEMRKRTHLGGFDFMPKPSDAYYKNLPAKIGDIFTADQYKKIEELGLLVDKDDQGILL  356

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKP+GDRPT F EII+RVGC M++ +G + Q  GCGGFGKGNFSELFKSIE+YE+ L
Sbjct  357  QIFTKPLGDRPTCFFEIIERVGC-MEELNGRLEQAAGCGGFGKGNFSELFKSIEDYERTL  415

Query  305  E  303
            +
Sbjct  416  D  416



>ref|XP_009825673.1| 4-hydroxyphenylpyruvate dioxygenase [Aphanomyces astaci]
 gb|ETV83981.1| 4-hydroxyphenylpyruvate dioxygenase [Aphanomyces astaci]
Length=422

 Score =   238 bits (607),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 122/181 (67%), Positives = 147/181 (81%), Gaps = 1/181 (1%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT +SGLNS+VLANN ET+ LP+NEP  GTKRKSQIQT+LE NEGPGLQH+AL + DIF 
Sbjct  242  GTVDSGLNSMVLANNTETILLPMNEPTFGTKRKSQIQTFLEQNEGPGLQHMALKTNDIFH  301

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TL EMR R+ +GGF+FMP P   YYKNL ++ GDV +  Q ++ E+LG+LVD+DDQG LL
Sbjct  302  TLAEMRKRTHLGGFDFMPKPSAAYYKNLPAKIGDVFTAAQYEKIEQLGLLVDKDDQGILL  361

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKP+GDRPT F EII+RVGC M++  G + Q  GCGGFGKGNFSELFKSIEEYE+ L
Sbjct  362  QIFTKPLGDRPTCFFEIIERVGC-MEEIGGRLEQAAGCGGFGKGNFSELFKSIEEYERTL  420

Query  305  E  303
            +
Sbjct  421  D  421



>ref|XP_001694722.1| 4-hydroxyphenylpyruvate dioxygenase [Chlamydomonas reinhardtii]
 gb|EDP02306.1| 4-hydroxyphenylpyruvate dioxygenase [Chlamydomonas reinhardtii]
Length=372

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 148/186 (80%), Gaps = 6/186 (3%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT +SGLNS+VLANN+ET+ +P+NEP  GT RKSQIQTYLE NEGPGLQHLAL S DIF 
Sbjct  185  GTVDSGLNSMVLANNEETILMPVNEPTFGTPRKSQIQTYLEQNEGPGLQHLALLSNDIFT  244

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RS +GGFEFMP     YYK++ +R GD L+ +Q +E EELGILVD+DDQG LL
Sbjct  245  TLREMRARSELGGFEFMPRANAKYYKDMYARIGDSLTPQQYREVEELGILVDKDDQGVLL  304

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKED---GEVY---QkggcggfgkGNFSELFKSIE  324
            QIFTKP+GDRPT+FIEIIQRVGCM + ++   G V    Q  GCGGFGKGNF  LFKSIE
Sbjct  305  QIFTKPLGDRPTVFIEIIQRVGCMREVKEPATGAVVGTEQAAGCGGFGKGNFGALFKSIE  364

Query  323  EYEKML  306
            +YE+ L
Sbjct  365  DYERTL  370



>ref|XP_008863478.1| 4-hydroxyphenylpyruvate dioxygenase [Aphanomyces invadans]
 gb|ETW07385.1| 4-hydroxyphenylpyruvate dioxygenase [Aphanomyces invadans]
Length=420

 Score =   236 bits (601),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 119/181 (66%), Positives = 146/181 (81%), Gaps = 1/181 (1%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT +SGLNS+VLANN E + LP+NEP  GTKRKSQIQT+LE NEGPGLQH+AL + DIF 
Sbjct  240  GTVDSGLNSMVLANNSEMILLPMNEPTFGTKRKSQIQTFLEQNEGPGLQHMALKTNDIFH  299

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            T+ EMR R+ +GGF+FMP P   YYKNL ++ GDV +  Q ++ E+LG+LVD+DDQG LL
Sbjct  300  TMSEMRKRTHLGGFDFMPKPSAAYYKNLPTKIGDVFTAAQYEQIEQLGLLVDKDDQGILL  359

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKP+GDRPT F EII+RVGC M++  G + Q  GCGGFGKGNFSELFKSIE+YE+ L
Sbjct  360  QIFTKPLGDRPTCFFEIIERVGC-MEEVAGRLEQAAGCGGFGKGNFSELFKSIEDYERTL  418

Query  305  E  303
            +
Sbjct  419  D  419



>ref|XP_008863477.1| 4-hydroxyphenylpyruvate dioxygenase [Aphanomyces invadans]
 gb|ETW07384.1| 4-hydroxyphenylpyruvate dioxygenase [Aphanomyces invadans]
Length=445

 Score =   236 bits (602),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 146/181 (81%), Gaps = 1/181 (1%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT +SGLNS+VLANN E + LP+NEP  GTKRKSQIQT+LE NEGPGLQH+AL + DIF 
Sbjct  265  GTVDSGLNSMVLANNSEMILLPMNEPTFGTKRKSQIQTFLEQNEGPGLQHMALKTNDIFH  324

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            T+ EMR R+ +GGF+FMP P   YYKNL ++ GDV +  Q ++ E+LG+LVD+DDQG LL
Sbjct  325  TMSEMRKRTHLGGFDFMPKPSAAYYKNLPTKIGDVFTAAQYEQIEQLGLLVDKDDQGILL  384

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKP+GDRPT F EII+RVGC M++  G + Q  GCGGFGKGNFSELFKSIEEYE+ L
Sbjct  385  QIFTKPLGDRPTCFFEIIERVGC-MEEVAGRLEQAAGCGGFGKGNFSELFKSIEEYERTL  443

Query  305  E  303
            +
Sbjct  444  D  444



>emb|CAR47957.1| p-hydroxyphenylpyruvate dioxygenase [Chlamydomonas reinhardtii]
Length=432

 Score =   235 bits (599),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 147/186 (79%), Gaps = 6/186 (3%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT +SGLNS+VLA+N+E V LP+NEP  GT RKSQIQTYLE NEGPGLQHLAL S DIF 
Sbjct  245  GTVDSGLNSMVLASNNEAVLLPVNEPTFGTPRKSQIQTYLEQNEGPGLQHLALLSNDIFT  304

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RS +GGFEFMP     YYK++ +R GD L+ +Q +E EELGILVD+DDQG LL
Sbjct  305  TLREMRARSELGGFEFMPRANAKYYKDMYARIGDSLTSQQYREVEELGILVDKDDQGVLL  364

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKED---GEVY---QkggcggfgkGNFSELFKSIE  324
            QIFTKP+GDRPT+FIEIIQRVGCM + ++   G V    Q  GCGGFGKGNF  LFKSIE
Sbjct  365  QIFTKPLGDRPTVFIEIIQRVGCMREVKEPATGAVVGTEQAAGCGGFGKGNFGALFKSIE  424

Query  323  EYEKML  306
            +YE+ L
Sbjct  425  DYERTL  430



>ref|XP_009825674.1| 4-hydroxyphenylpyruvate dioxygenase [Aphanomyces astaci]
 gb|ETV83982.1| 4-hydroxyphenylpyruvate dioxygenase [Aphanomyces astaci]
Length=420

 Score =   234 bits (598),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 119/181 (66%), Positives = 147/181 (81%), Gaps = 1/181 (1%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT +SGLNS+VLANN ET+ LP+NEP  GTKRKSQIQT+LE NEG GLQH+AL ++DIF 
Sbjct  240  GTVDSGLNSMVLANNTETILLPMNEPTFGTKRKSQIQTFLEQNEGAGLQHMALKTDDIFH  299

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            T+ EMR R+ +GGF+FMP P   YYKNL ++ GDV +  Q ++ E+LG+LVD+DDQG LL
Sbjct  300  TMSEMRKRTHLGGFDFMPKPSAAYYKNLPAKIGDVFTAAQYEKIEQLGLLVDKDDQGILL  359

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKP+GDRPT F EII+RVGC M++  G + Q  GCGGFGKGNFSELFKSIE+YE+ L
Sbjct  360  QIFTKPLGDRPTCFFEIIERVGC-MEEIGGRLEQAAGCGGFGKGNFSELFKSIEDYERTL  418

Query  305  E  303
            +
Sbjct  419  D  419



>ref|XP_005650422.1| p-hydroxyphenylpyruvate dioxigenase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE25878.1| p-hydroxyphenylpyruvate dioxigenase [Coccomyxa subellipsoidea 
C-169]
Length=426

 Score =   234 bits (598),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 152/187 (81%), Gaps = 6/187 (3%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT +SGLNS+VLA+N+E V LP+NEP  GT+RKSQIQT+LE NEGPGLQHLAL ++DIF 
Sbjct  238  GTVDSGLNSMVLASNNERVLLPVNEPTFGTRRKSQIQTFLEQNEGPGLQHLALKTDDIFS  297

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            T+RE+R RS  GGF+FMP     YYKNL ++ GDVL+ EQ K+ +ELG+LVD+DDQG LL
Sbjct  298  TMRELRKRSSQGGFDFMPRASDAYYKNLPAKIGDVLTPEQYKQVQELGLLVDKDDQGVLL  357

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGE------VYQkggcggfgkGNFSELFKSIE  324
            QIFT+P+ DRPT+F+EIIQR+GCM ++ +        + Q GGCGGFGKGNFSELFKSIE
Sbjct  358  QIFTQPLSDRPTVFLEIIQRIGCMHERAEPASAVPPVMEQAGGCGGFGKGNFSELFKSIE  417

Query  323  EYEKMLE  303
            +YE++L+
Sbjct  418  DYERLLD  424



>ref|XP_002952694.1| 4-hydroxyphenylpyruvate dioxygenase [Volvox carteri f. nagariensis]
 gb|EFJ46247.1| 4-hydroxyphenylpyruvate dioxygenase [Volvox carteri f. nagariensis]
Length=433

 Score =   234 bits (598),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 145/186 (78%), Gaps = 6/186 (3%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT +SGLNS+VLA+N+E V LP+NEP  GT RKSQIQTYLE NEGPGLQHLAL + DIF 
Sbjct  246  GTVDSGLNSMVLASNNEAVLLPINEPTFGTPRKSQIQTYLEQNEGPGLQHLALLTNDIFA  305

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RS +GGFEFMP P   YY+ L  + GD L+  Q KE EELGILVDRDDQG LL
Sbjct  306  TLREMRARSDMGGFEFMPRPSDKYYRELPKKIGDTLTPMQYKEVEELGILVDRDDQGVLL  365

Query  485  QIFTKPVGDRPTLFIEIIQRVGC---MMKKEDGEVY---QkggcggfgkGNFSELFKSIE  324
            QIFTKP+GDRPT+FIE+IQRVGC   + +   G V    Q  GCGGFGKGNFSELFKSIE
Sbjct  366  QIFTKPLGDRPTVFIEVIQRVGCEREVKEPTTGAVVGTEQAAGCGGFGKGNFSELFKSIE  425

Query  323  EYEKML  306
            +YE+ L
Sbjct  426  DYERTL  431



>ref|XP_001416712.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95005.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=427

 Score =   234 bits (597),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 124/183 (68%), Positives = 145/183 (79%), Gaps = 2/183 (1%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT +SGLNS+VLANN+E V LP+NEP  GTKRKSQIQTYLE N GPGLQHLAL ++DIF 
Sbjct  244  GTIDSGLNSMVLANNNEYVLLPVNEPTFGTKRKSQIQTYLEQNNGPGLQHLALKTDDIFA  303

Query  665  TLREMRNRSGI-GGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTL  489
            T+REMR  S + GGF+F       YYK LK++ GD L+DEQ    EELG+LVD+DDQG L
Sbjct  304  TVREMRKYSHLRGGFDFQAPASDDYYKQLKAKIGDALNDEQYALVEELGLLVDKDDQGVL  363

Query  488  LQIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVY-QkggcggfgkGNFSELFKSIEEYEK  312
            +Q+FTKPVGDRPTLF+EIIQR+GCM +K D E + Q  GCGGFGKGNFSELFKSIE YE 
Sbjct  364  IQVFTKPVGDRPTLFLEIIQRIGCMRRKADSESFEQAAGCGGFGKGNFSELFKSIEAYEA  423

Query  311  MLE  303
             L+
Sbjct  424  TLQ  426



>ref|XP_001694723.1| 4-hydroxyphenylpyruvate dioxygenase [Chlamydomonas reinhardtii]
 emb|CAD24031.1| p-hydroxyphenylpyruvate dioxigenase [Chlamydomonas reinhardtii]
 gb|EDP02307.1| 4-hydroxyphenylpyruvate dioxygenase [Chlamydomonas reinhardtii]
Length=432

 Score =   234 bits (597),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 147/186 (79%), Gaps = 6/186 (3%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT +SGLNS+VLA+N+E V LP+NEP  GT RKSQIQTYLE NEGPGLQHLAL S DIF 
Sbjct  245  GTVDSGLNSMVLASNNEAVLLPVNEPTFGTPRKSQIQTYLEQNEGPGLQHLALLSNDIFT  304

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RS +GGFEFMP     YYK++ +R GD L+ +Q +E EELGILVD+DDQG LL
Sbjct  305  TLREMRARSELGGFEFMPRANAKYYKDMYARIGDSLTPQQYREVEELGILVDKDDQGVLL  364

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKED---GEVY---QkggcggfgkGNFSELFKSIE  324
            QIFTKP+GDRPT+FIEIIQRVGCM + ++   G V    Q  GCGGFGKGNF  LFKSIE
Sbjct  365  QIFTKPLGDRPTVFIEIIQRVGCMREVKEPATGAVVGTEQAAGCGGFGKGNFGALFKSIE  424

Query  323  EYEKML  306
            +YE+ L
Sbjct  425  DYERTL  430



>ref|XP_003078281.1| p-hydroxyphenylpyruvate dioxigenase (ISS) [Ostreococcus tauri]
 emb|CAL53021.1| Glyoxalase/fosfomycin resistance/dioxygenase domain [Ostreococcus 
tauri]
Length=432

 Score =   233 bits (595),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 127/182 (70%), Positives = 145/182 (80%), Gaps = 2/182 (1%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT +SGLNS+VLANN+E V LP+NEP  GTKRKSQIQTYLE N GPGLQHLAL ++DIF 
Sbjct  249  GTIDSGLNSMVLANNNEYVLLPVNEPTFGTKRKSQIQTYLEQNNGPGLQHLALKTDDIFT  308

Query  665  TLREMRNRSGI-GGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTL  489
            T+REMR  S + GGF+F       YYK+LK + GD L+DEQ    EELG+LVD+DDQG L
Sbjct  309  TVREMRKYSHMHGGFDFQAPASDDYYKHLKEKIGDALTDEQYALVEELGLLVDKDDQGVL  368

Query  488  LQIFTKPVGDRPTLFIEIIQRVGCMMKKED-GEVYQkggcggfgkGNFSELFKSIEEYEK  312
            +Q+FTKPVGDRPTLF+EIIQRVGCM KK D  E+ Q  GCGGFGKGNFSELFKSIE YEK
Sbjct  369  IQVFTKPVGDRPTLFLEIIQRVGCMRKKADTDELEQVAGCGGFGKGNFSELFKSIEAYEK  428

Query  311  ML  306
             L
Sbjct  429  TL  430



>ref|XP_008620054.1| 4-hydroxyphenylpyruvate dioxygenase [Saprolegnia diclina VS20]
 gb|EQC26475.1| 4-hydroxyphenylpyruvate dioxygenase [Saprolegnia diclina VS20]
Length=444

 Score =   233 bits (593),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 119/181 (66%), Positives = 146/181 (81%), Gaps = 1/181 (1%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT +SGLNS+VLANN E + LP+NEP  GTKRKSQIQT+LE NEG GLQH+AL + DIF 
Sbjct  264  GTVDSGLNSMVLANNSEMILLPMNEPTFGTKRKSQIQTFLEQNEGAGLQHMALKTNDIFH  323

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TL EMR R+ +GGF+FMP P   YYKNL ++ GD  + +Q K+ E+LG+LVD+DDQG LL
Sbjct  324  TLAEMRKRTHLGGFDFMPKPSDAYYKNLPTKIGDTFTADQYKKIEQLGLLVDKDDQGILL  383

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKP+GDRPT F EII+RVGC M++ +G + Q  GCGGFGKGNFSELFKSIE+YE+ L
Sbjct  384  QIFTKPLGDRPTCFFEIIERVGC-MEELNGRLEQAAGCGGFGKGNFSELFKSIEDYERTL  442

Query  305  E  303
            +
Sbjct  443  D  443



>gb|ETM00254.1| 4-hydroxyphenylpyruvate dioxygenase, partial [Phytophthora parasitica]
Length=226

 Score =   225 bits (573),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 142/180 (79%), Gaps = 1/180 (1%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT +SGLNS+VLA+N+E V LP+NEP  GTKRKSQIQTYLE N G GLQH+AL ++DIF 
Sbjct  46   GTLDSGLNSMVLASNNEMVLLPVNEPTFGTKRKSQIQTYLEQNVGAGLQHMALKTDDIFH  105

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TL EM+ RS +GGFEFMP P   YY+ +  R GD L+ EQ K+ E+LG+LVD+DDQG LL
Sbjct  106  TLAEMQKRSHVGGFEFMPRPNKVYYEQMPERIGDALTKEQYKQIEQLGLLVDKDDQGILL  165

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKP+GDR T+F EII+RVGC MK   G + Q  GCGGFGKGNFS LFKSIE+YEK L
Sbjct  166  QIFTKPLGDRATVFFEIIERVGC-MKDIAGRLEQAAGCGGFGKGNFSALFKSIEDYEKSL  224



>ref|XP_009825872.1| 4-hydroxyphenylpyruvate dioxygenase [Aphanomyces astaci]
 gb|ETV84180.1| 4-hydroxyphenylpyruvate dioxygenase [Aphanomyces astaci]
Length=475

 Score =   232 bits (591),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 119/181 (66%), Positives = 146/181 (81%), Gaps = 1/181 (1%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT +SGLNS+VLANN+E + LP+NEP  GTKRKSQIQT+LE NEG GLQH+AL + DIF 
Sbjct  295  GTVDSGLNSMVLANNNEMILLPMNEPTFGTKRKSQIQTFLEQNEGAGLQHMALKTNDIFH  354

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TL EMR R+ +GGF+FMP P   YYKNL ++ GDV +  Q ++ E+LG+LVD+DDQG LL
Sbjct  355  TLAEMRKRTHLGGFDFMPKPSAAYYKNLPAKIGDVFTAAQYEKIEQLGLLVDKDDQGILL  414

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKP+GDRPT F EII+RVGC M++  G + Q  GCGGFGKGNFSELFKSIE+YE+ L
Sbjct  415  QIFTKPLGDRPTCFFEIIERVGC-MEEIGGRLEQAAGCGGFGKGNFSELFKSIEDYERSL  473

Query  305  E  303
            +
Sbjct  474  D  474



>ref|XP_007511204.1| 4-hydroxyphenylpyruvate dioxygenase [Bathycoccus prasinos]
 emb|CCO66764.1| 4-hydroxyphenylpyruvate dioxygenase [Bathycoccus prasinos]
Length=466

 Score =   229 bits (584),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 121/182 (66%), Positives = 145/182 (80%), Gaps = 2/182 (1%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT +SGLNS+VLANNDE V LP+NEP  GT+RKSQIQTYLE N G G+QHLAL ++DI  
Sbjct  274  GTVDSGLNSMVLANNDEFVLLPVNEPTFGTRRKSQIQTYLEANNGAGVQHLALKTDDIIH  333

Query  665  TLREMRNRSGI-GGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTL  489
            T+ EM+  SG+ GGF+F P     YY+NLK++ GD LSDE +KECE LG+LVD+DDQG L
Sbjct  334  TVTEMKKYSGMFGGFDFQPPASEKYYQNLKAKVGDALSDETLKECERLGLLVDKDDQGVL  393

Query  488  LQIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKM  309
            +QIFTKP+ DRPT+FIEIIQR+GC   KE+ +  Q  GCGGFGKGNF+ELFKSIE YEK 
Sbjct  394  IQIFTKPLTDRPTIFIEIIQRIGCEYPKEEKK-EQAAGCGGFGKGNFAELFKSIENYEKS  452

Query  308  LE  303
            LE
Sbjct  453  LE  454



>ref|XP_009520219.1| hypothetical protein PHYSODRAFT_539872 [Phytophthora sojae]
 gb|EGZ24931.1| hypothetical protein PHYSODRAFT_539872 [Phytophthora sojae]
Length=420

 Score =   226 bits (575),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 142/180 (79%), Gaps = 1/180 (1%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT ESGLNS+VLA+N+E V LP+NEP  GTKRKSQIQTYLE N G GLQH+AL + DIF 
Sbjct  240  GTLESGLNSMVLASNNEMVLLPVNEPTFGTKRKSQIQTYLEQNVGAGLQHVALKTNDIFH  299

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TL EMR RS +GGFEFMPSP   YY+ +  R GD L+ EQ ++ E+LG+LVD+DDQG LL
Sbjct  300  TLAEMRKRSLVGGFEFMPSPNKRYYEQMPERIGDSLTKEQYEQIEKLGLLVDKDDQGILL  359

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKP+GDR T+F EII+RVGC MK   G + Q  GCGGFGKGNFS LFKSIE+YEK L
Sbjct  360  QIFTKPLGDRATVFFEIIERVGC-MKDIAGRLEQAAGCGGFGKGNFSALFKSIEDYEKSL  418



>ref|XP_008900424.1| 4-hydroxyphenylpyruvate dioxygenase [Phytophthora parasitica 
INRA-310]
 gb|ETN14155.1| 4-hydroxyphenylpyruvate dioxygenase [Phytophthora parasitica 
INRA-310]
 gb|ETP23699.1| 4-hydroxyphenylpyruvate dioxygenase [Phytophthora parasitica 
CJ01A1]
Length=420

 Score =   226 bits (575),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 142/180 (79%), Gaps = 1/180 (1%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT +SGLNS+VLA+N+E V LP+NEP  GTKRKSQIQTYLE N G GLQH+AL ++DIF 
Sbjct  240  GTLDSGLNSMVLASNNEMVLLPVNEPTFGTKRKSQIQTYLEQNVGAGLQHMALKTDDIFH  299

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TL EM+ RS +GGFEFMP P   YY+ +  R GD L+ EQ K+ E+LG+LVD+DDQG LL
Sbjct  300  TLAEMQKRSHVGGFEFMPRPNKVYYEQMPERIGDALTKEQYKQIEQLGLLVDKDDQGILL  359

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKP+GDR T+F EII+RVGC MK   G + Q  GCGGFGKGNFS LFKSIE+YEK L
Sbjct  360  QIFTKPLGDRATVFFEIIERVGC-MKDIAGRLEQAAGCGGFGKGNFSALFKSIEDYEKSL  418



>gb|ETI53876.1| 4-hydroxyphenylpyruvate dioxygenase [Phytophthora parasitica 
P1569]
Length=420

 Score =   225 bits (574),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 142/180 (79%), Gaps = 1/180 (1%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT +SGLNS+VLA+N+E V LP+NEP  GTKRKSQIQTYLE N G GLQH+AL ++DIF 
Sbjct  240  GTLDSGLNSMVLASNNEMVLLPVNEPTFGTKRKSQIQTYLEQNVGAGLQHMALKTDDIFH  299

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TL EM+ RS +GGFEFMP P   YY+ +  R GD L+ EQ K+ E+LG+LVD+DDQG LL
Sbjct  300  TLAEMQKRSHVGGFEFMPRPNKVYYEQMPERIGDALTKEQYKQIEQLGLLVDKDDQGILL  359

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKP+GDR T+F EII+RVGC MK   G + Q  GCGGFGKGNFS LFKSIE+YEK L
Sbjct  360  QIFTKPLGDRATVFFEIIERVGC-MKDIAGRLEQAAGCGGFGKGNFSALFKSIEDYEKSL  418



>gb|EWM23898.1| 4-hydroxyphenylpyruvate dioxygenase [Nannochloropsis gaditana]
Length=525

 Score =   227 bits (579),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 121/183 (66%), Positives = 142/183 (78%), Gaps = 2/183 (1%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT +SGLNSVVLANN E V +PLNEP +GTKRKSQIQTYLE N GPGLQHLAL + DIF 
Sbjct  342  GTVDSGLNSVVLANNAEDVLIPLNEPTYGTKRKSQIQTYLECNNGPGLQHLALATRDIFT  401

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            T+R+MR  S +GGF FM  PPP+YY+ L  R G  L+  Q+ + EELG+L D+DDQG LL
Sbjct  402  TMRKMRAVSEMGGFTFMAPPPPSYYRALPERLGGSLTASQLAQIEELGLLADKDDQGVLL  461

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDG--EVYQkggcggfgkGNFSELFKSIEEYEK  312
            QIFT PVGDRPTLF+EIIQR+GC     +   +  Q+GGCGGFGKGNF+ LFKSIEEYEK
Sbjct  462  QIFTVPVGDRPTLFLEIIQRIGCESPDPNHSEQTKQRGGCGGFGKGNFAALFKSIEEYEK  521

Query  311  MLE  303
             L+
Sbjct  522  TLD  524



>ref|XP_002901240.1| 4-hydroxyphenylpyruvate dioxygenase [Phytophthora infestans T30-4]
 gb|EEY59226.1| 4-hydroxyphenylpyruvate dioxygenase [Phytophthora infestans T30-4]
Length=418

 Score =   224 bits (572),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 142/180 (79%), Gaps = 1/180 (1%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT +SGLNS+VLA+N+E V LP+NEP  GTKRKSQIQTYLE N G GLQH+AL ++DIF 
Sbjct  238  GTLDSGLNSMVLASNNEMVLLPVNEPTFGTKRKSQIQTYLEQNVGAGLQHMALKTDDIFH  297

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TL EM+ RS +GGFEFMP P   YY+ +  R GD L+ EQ K+ E+LG+LVD+D+QG LL
Sbjct  298  TLAEMQKRSHVGGFEFMPRPNKVYYEQMPKRIGDALTQEQYKQIEQLGLLVDKDEQGILL  357

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKP+GDR T+F EII+RVGC MK   G + Q  GCGGFGKGNFS LFKSIE+YEK L
Sbjct  358  QIFTKPLGDRATVFFEIIERVGC-MKDVAGRLEQAAGCGGFGKGNFSALFKSIEDYEKSL  416



>gb|EWM22209.1| 4-hydroxyphenylpyruvate dioxygenase [Nannochloropsis gaditana]
Length=458

 Score =   224 bits (572),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 149/182 (82%), Gaps = 2/182 (1%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT +SGLNS+VLA+N+E V LP+NEP  GTKRKSQIQTYLE N+G G+QH+AL +++IF 
Sbjct  275  GTVDSGLNSLVLASNNERVLLPVNEPTFGTKRKSQIQTYLEQNQGAGVQHIALKTDNIFA  334

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAG-DVLSDEQIKECEELGILVDRDDQGTL  489
            T+RE++ R+ +GGF+FMP   P YY++L ++ G  VL+DE++   EELG+LVD+DDQG L
Sbjct  335  TMRELKKRTHLGGFDFMPKASPEYYQSLPAKIGPGVLTDEELACVEELGLLVDKDDQGVL  394

Query  488  LQIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEV-YQkggcggfgkGNFSELFKSIEEYEK  312
            LQ+FT+PVGDRPTLF+EIIQRVGC + KE   +  Q  GCGGFGKGNFSELFKSIEEYEK
Sbjct  395  LQVFTRPVGDRPTLFLEIIQRVGCTVDKEGKRLPEQAPGCGGFGKGNFSELFKSIEEYEK  454

Query  311  ML  306
             L
Sbjct  455  TL  456



>ref|XP_008900422.1| 4-hydroxyphenylpyruvate dioxygenase [Phytophthora parasitica 
INRA-310]
 gb|ETI53874.1| 4-hydroxyphenylpyruvate dioxygenase [Phytophthora parasitica 
P1569]
 gb|ETN14153.1| 4-hydroxyphenylpyruvate dioxygenase [Phytophthora parasitica 
INRA-310]
 gb|ETP23697.1| 4-hydroxyphenylpyruvate dioxygenase [Phytophthora parasitica 
CJ01A1]
 gb|ETP51702.1| 4-hydroxyphenylpyruvate dioxygenase [Phytophthora parasitica 
P10297]
Length=471

 Score =   224 bits (572),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 142/180 (79%), Gaps = 1/180 (1%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT +SGLNS+VLA+N+E V LP+NEP  GTKRKSQIQTYLE N G GLQH+AL ++DIF 
Sbjct  291  GTLDSGLNSMVLASNNEMVLLPVNEPTFGTKRKSQIQTYLEQNVGAGLQHMALKTDDIFH  350

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TL EM+ RS +GGFEFMP P   YY+ +  R GD L+ EQ K+ E+LG+LVD+DDQG LL
Sbjct  351  TLAEMQKRSHVGGFEFMPRPNKVYYEQMPERIGDALTKEQYKQIEQLGLLVDKDDQGILL  410

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKP+GDR T+F EII+RVGC MK   G + Q  GCGGFGKGNFS LFKSIE+YEK L
Sbjct  411  QIFTKPLGDRATVFFEIIERVGC-MKDIAGRLEQAAGCGGFGKGNFSALFKSIEDYEKSL  469



>ref|XP_005850767.1| hypothetical protein CHLNCDRAFT_20078 [Chlorella variabilis]
 gb|EFN58665.1| hypothetical protein CHLNCDRAFT_20078 [Chlorella variabilis]
Length=446

 Score =   224 bits (570),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 147/186 (79%), Gaps = 7/186 (4%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT +SGLNS+V+ANN+E + LP+NEP HGTKRKSQIQT+LE NEGPGLQH+AL ++DI  
Sbjct  259  GTVDSGLNSMVMANNNEMILLPVNEPTHGTKRKSQIQTFLEQNEGPGLQHMALKTDDIVA  318

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            T+R++R RS  GGF+FMP P P YY+ L +R G +L+ +Q K+ EELG+LVD+DDQG LL
Sbjct  319  TMRQLRARSAFGGFDFMPRPSPDYYRKLPARIGSLLTAQQYKDVEELGLLVDKDDQGVLL  378

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMM-----KKEDGEV-YQkggcggfgkGNFSELFKSIE  324
            QIFTKP+GDRPT+F EIIQR+ C +     K + G V  + GGCGGFGKGNFSELFKSIE
Sbjct  379  QIFTKPLGDRPTVFFEIIQRL-CALEPQAPKSQRGAVPSEVGGCGGFGKGNFSELFKSIE  437

Query  323  EYEKML  306
             YE  L
Sbjct  438  VYETDL  443



>ref|XP_003055822.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH61074.1| predicted protein [Micromonas pusilla CCMP1545]
Length=447

 Score =   223 bits (568),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 145/189 (77%), Gaps = 8/189 (4%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT +SGLNS+VLAN+DE + LP+NEP  GTKRKSQIQTYLE N G GLQHLAL S+D+F 
Sbjct  258  GTVDSGLNSMVLANDDEMILLPVNEPTFGTKRKSQIQTYLECNNGAGLQHLALKSDDVFA  317

Query  665  TLREMRNR-SGIGGFEFMPSPPPTYYKNLKSRAG-DVLSDEQIKECEELGILVDRDDQGT  492
            T+REMR    G GGFEF       YY NLK+R G D L++ Q KE EELG+LVDRDDQG 
Sbjct  318  TVREMRKHGGGRGGFEFQKPASADYYANLKARVGEDALTERQFKEVEELGLLVDRDDQGV  377

Query  491  LLQIFTKPVGDRPTLFIEIIQRVGCM--MKKEDG----EVYQkggcggfgkGNFSELFKS  330
            L+QIFTKP+GDRPT+FIEIIQR+GC+  +K  D      + Q GGCGGFGKGNFSELFKS
Sbjct  378  LVQIFTKPLGDRPTVFIEIIQRIGCLREVKSADANAPPRIEQAGGCGGFGKGNFSELFKS  437

Query  329  IEEYEKMLE  303
            IE YE+ L+
Sbjct  438  IENYERTLK  446



>gb|ETM00251.1| 4-hydroxyphenylpyruvate dioxygenase [Phytophthora parasitica]
 gb|ETM53441.1| 4-hydroxyphenylpyruvate dioxygenase [Phytophthora parasitica]
 gb|ETM53444.1| 4-hydroxyphenylpyruvate dioxygenase [Phytophthora parasitica]
Length=172

 Score =   212 bits (540),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 113/171 (66%), Positives = 134/171 (78%), Gaps = 1/171 (1%)
 Frame = -2

Query  818  VVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRTLREMRNRS  639
            +VLA+N+E V LP+NEP  GTKRKSQIQTYLE N G GLQH+AL ++DIF TL EM+ RS
Sbjct  1    MVLASNNEMVLLPVNEPTFGTKRKSQIQTYLEQNVGAGLQHMALKTDDIFHTLAEMQKRS  60

Query  638  GIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLLQIFTKPVGD  459
             +GGFEFMP P   YY+ +  R GD L+ EQ K+ E+LG+LVD+DDQG LLQIFTKP+GD
Sbjct  61   HVGGFEFMPRPNKVYYEQMPERIGDALTKEQYKQIEQLGLLVDKDDQGILLQIFTKPLGD  120

Query  458  RPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            R T+F EII+RVGC MK   G + Q  GCGGFGKGNFS LFKSIE+YEK L
Sbjct  121  RATVFFEIIERVGC-MKDIAGRLEQAAGCGGFGKGNFSALFKSIEDYEKSL  170



>ref|XP_003575746.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Brachypodium 
distachyon]
Length=493

 Score =   221 bits (564),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 147/184 (80%), Gaps = 4/184 (2%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT ESGLN VVL+   +TV L + EP HGTKR+SQ+QTYL+H+ GPG+QHLA+ S+D+  
Sbjct  305  GTEESGLNGVVLSEGFDTVLLTVIEPAHGTKRRSQVQTYLDHHGGPGVQHLAMASDDLLA  364

Query  665  TLREMRNR-SGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDR-DDQGT  492
            TLR++R R + +GGFEF+P+PPP+YY  ++ R GDVLS+ QIKECEELG++VDR DD G 
Sbjct  365  TLRKIRARPASMGGFEFLPTPPPSYYDGVRRRIGDVLSEAQIKECEELGVMVDRGDDDGV  424

Query  491  LLQIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEK  312
            +LQIFTKPVGDRPTL +E IQR+GCM K E+G+  Q+G CGGF +GN ++  K+ E+Y+K
Sbjct  425  VLQIFTKPVGDRPTLLLEFIQRIGCMGKDENGK--QRGACGGFARGNTTDFIKAYEDYDK  482

Query  311  MLEA  300
             L+A
Sbjct  483  TLDA  486



>emb|CAJ29893.1| 4-hydroxyphenylpyruvate dioxygenase [Triticum aestivum]
Length=381

 Score =   215 bits (547),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GTAESGLNS+VLANN E V LPLNEPVHGTKR+SQIQT+LEH+ GPG+QH+A+ S D+ R
Sbjct  246  GTAESGLNSMVLANNSEGVLLPLNEPVHGTKRRSQIQTFLEHHGGPGVQHIAVASSDVLR  305

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLREMR RS +GGF+F+P P P YY+ ++  AGDVLS+ QIKEC+ELG+LVDRDDQG LL
Sbjct  306  TLREMRARSAMGGFDFLPPPLPKYYEGVRRIAGDVLSEAQIKECQELGVLVDRDDQGVLL  365

Query  485  QIFTKPVGDRPT  450
            QIFTKPVGDRPT
Sbjct  366  QIFTKPVGDRPT  377



>ref|XP_002499380.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO60639.1| predicted protein [Micromonas sp. RCC299]
Length=441

 Score =   215 bits (547),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 144/188 (77%), Gaps = 7/188 (4%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT +SGLNS+VLANN E V LP+NEP  GTKRKSQIQTYLE N+GPGLQHLAL +++IF 
Sbjct  252  GTVDSGLNSMVLANNSEYVLLPVNEPTFGTKRKSQIQTYLEQNKGPGLQHLALKTDNIFD  311

Query  665  TLREMRNRSGI-GGFEFMPSPPPTYYKNLKSRAG-DVLSDEQIKECEELGILVDRDDQGT  492
            T+R+MR   G  GGFEF       YY+ L  R G + LS EQ KE EELG+LVD+DDQG 
Sbjct  312  TVRKMRAHGGFRGGFEFQKPASEGYYRELPKRVGANALSPEQFKEVEELGLLVDKDDQGV  371

Query  491  LLQIFTKPVGDRPTLFIEIIQRVGCMM-----KKEDGEVYQkggcggfgkGNFSELFKSI  327
            L+Q+FTKPVGDRPT+FIEIIQR+GCM      + ++ ++ Q  GCGGFGKGNFSELFKSI
Sbjct  372  LIQVFTKPVGDRPTVFIEIIQRIGCMREVGGEEAKEKKMEQAAGCGGFGKGNFSELFKSI  431

Query  326  EEYEKMLE  303
            E +E+ L+
Sbjct  432  ENFERTLK  439



>ref|XP_002990594.1| hypothetical protein SELMODRAFT_161008 [Selaginella moellendorffii]
 gb|EFJ08226.1| hypothetical protein SELMODRAFT_161008 [Selaginella moellendorffii]
Length=399

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 137/184 (74%), Gaps = 4/184 (2%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT +SGLN++ LA+N+ETV   L+EP +GTKRKS IQTYLE NEG G+Q LAL  +DIF 
Sbjct  218  GTKDSGLNTMALASNNETVVFSLSEPTYGTKRKSPIQTYLEQNEGSGIQRLALQCDDIFG  277

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            T+ ++R+R   GGFEF+P+P P YY +++ + G VL++EQI +C+ELGI +D+D+ G LL
Sbjct  278  TVNDIRDRIDAGGFEFLPAPGPEYYDSMRGKVGSVLTEEQILKCQELGIWIDKDEHGILL  337

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPTLF+EIIQR+  +    + + +Q       GK NFS L++ +EEYEK L
Sbjct  338  QIFTKPVGDRPTLFLEIIQRLTSI----ESQSFQADKFDVVGKDNFSALYRCLEEYEKTL  393

Query  305  EAKQ  294
            +A +
Sbjct  394  DATR  397



>ref|XP_008360256.1| PREDICTED: LOW QUALITY PROTEIN: 4-hydroxyphenylpyruvate dioxygenase-like 
[Malus domestica]
Length=347

 Score =   205 bits (522),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T+ESGL SVVL NN+E V  P+NE V+GTKRKSQIQTYL+HNEG  +QHLAL S+DIFR 
Sbjct  213  TSESGLXSVVLVNNEEMVLFPMNEHVYGTKRKSQIQTYLKHNEGAEVQHLALVSDDIFRM  272

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLLQ  483
            LREMR+RS +G F+FMP+PP TYY+NLK R GDVL++EQIKECE+LGILVDRDDQ TLLQ
Sbjct  273  LREMRSRSDVGRFQFMPAPPSTYYRNLKKRVGDVLTNEQIKECEKLGILVDRDDQETLLQ  332

Query  482  IFTKPVGDR  456
            IFTK V DR
Sbjct  333  IFTKRVEDR  341



>ref|XP_002968708.1| hypothetical protein SELMODRAFT_91092 [Selaginella moellendorffii]
 gb|EFJ29824.1| hypothetical protein SELMODRAFT_91092 [Selaginella moellendorffii]
Length=475

 Score =   209 bits (531),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 137/186 (74%), Gaps = 4/186 (2%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT +SGLN++ LA+N+ETV   L+EP +GTKR+S IQTYLE NEG G+Q LAL  +DIF 
Sbjct  294  GTKDSGLNTMALASNNETVVFSLSEPTYGTKRQSPIQTYLEQNEGSGIQRLALQCDDIFG  353

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            T+ ++R+R   GGFEF+P+P P YY +++ + G VL++EQI +C+ELGI +D+D+ G LL
Sbjct  354  TVNDIRDRIDAGGFEFLPAPGPEYYDSMRGKVGSVLTEEQILKCQELGIWIDKDEHGILL  413

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKPVGDRPTLF+EIIQR   +    + + +Q       GK NFS L++ +EEYEK L
Sbjct  414  QIFTKPVGDRPTLFLEIIQRFTSI----ESQSFQADKFDVVGKDNFSALYRCLEEYEKTL  469

Query  305  EAKQAI  288
            +A + I
Sbjct  470  DATRQI  475



>ref|XP_011402112.1| 4-hydroxyphenylpyruvate dioxygenase [Auxenochlorella protothecoides]
 gb|KFM29063.1| 4-hydroxyphenylpyruvate dioxygenase [Auxenochlorella protothecoides]
Length=973

 Score =   214 bits (546),  Expect = 9e-60, Method: Composition-based stats.
 Identities = 114/198 (58%), Positives = 135/198 (68%), Gaps = 21/198 (11%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT +SGLNS+VLA+N+E V LP+NEP  GT+RKSQIQT+LE N GPGLQHLAL ++D+F 
Sbjct  776  GTIDSGLNSMVLASNNEMVLLPVNEPTRGTRRKSQIQTFLEQNGGPGLQHLALKTDDVFA  835

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TLR MR     GGFEFMP P   YY++L S+ GD L+ EQ+ E EELG+LVDRDDQG LL
Sbjct  836  TLRAMRAVGDAGGFEFMPRPSDAYYRDLPSKVGDALTPEQLSEAEELGLLVDRDDQGVLL  895

Query  485  QIFTKPVGDRPTLFIEIIQRV------------------GCMMKKEDGEVYQkggcggfg  360
            QIFTKP+GDRPT+F+EIIQR+                   C +     EV   GG G   
Sbjct  896  QIFTKPLGDRPTVFVEIIQRLCHIQPSEETLRAARATAQACPLAANPDEVGGCGGFGKG-  954

Query  359  kGNFSELFKSIEEYEKML  306
              NFSELFKSIE YE  L
Sbjct  955  --NFSELFKSIEVYETDL  970



>ref|XP_002287272.1| 4-hydroxyphenylpyruvate dioxygenase [Thalassiosira pseudonana 
CCMP1335]
 gb|EED94715.1| 4-hydroxyphenylpyruvate dioxygenase, partial [Thalassiosira pseudonana 
CCMP1335]
Length=418

 Score =   206 bits (523),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 119/195 (61%), Positives = 144/195 (74%), Gaps = 15/195 (8%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT +SGLNSVVLA+++E V LPLNEP  G KRKSQIQTYLE NEGPGLQH+A+ + DIF 
Sbjct  224  GTVDSGLNSVVLASDNENVLLPLNEPTEG-KRKSQIQTYLEQNEGPGLQHIAIKTNDIFD  282

Query  665  TLREMRN-RSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTL  489
            T+ +MR+     GGFE M  P   YYK L SR GD L+ EQ K+ EELGIL D DD+G L
Sbjct  283  TIAKMRHAEENFGGFELMKRPSDEYYKELPSRLGDKLTVEQYKQLEELGILADADDEGIL  342

Query  488  LQIFTKPVGDRPTLFIEIIQRVGCMMKKED-----GE--------VYQkggcggfgkGNF  348
            LQIFTKP+GDRPTLF+EIIQR+GC++  +D     GE        V ++ GCGGFG+GNF
Sbjct  343  LQIFTKPLGDRPTLFLEIIQRIGCVLPDDDEATDEGEAKNAHNRIVRERPGCGGFGQGNF  402

Query  347  SELFKSIEEYEKMLE  303
             ELFK+IEE+EK L+
Sbjct  403  RELFKAIEEHEKTLK  417



>ref|XP_008390582.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Malus domestica]
Length=361

 Score =   203 bits (516),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT+++GLNSVVL NN+E +  P+NE V+ TKRKSQIQTYL+HN+G  + HLAL S+DIFR
Sbjct  229  GTSKTGLNSVVLVNNEEIMLFPMNEHVYETKRKSQIQTYLKHNKGAEVHHLALVSDDIFR  288

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
             LREMR+RSG+GGF+FMP+PP  YY+NLK   GDVL+DEQIKECEELGILVD+DDQ TLL
Sbjct  289  MLREMRSRSGVGGFQFMPAPPLMYYRNLKKIVGDVLTDEQIKECEELGILVDKDDQETLL  348

Query  485  QIFTKPVGDR  456
            QIFTK VGDR
Sbjct  349  QIFTKRVGDR  358



>gb|EWM22210.1| 4-hydroxyphenylpyruvate dioxygenase [Nannochloropsis gaditana]
Length=439

 Score =   205 bits (521),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 124/149 (83%), Gaps = 1/149 (1%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT +SGLNS+VLA+N+E V LP+NEP  GTKRKSQIQTYLE N+G G+QH+AL +++IF 
Sbjct  275  GTVDSGLNSLVLASNNERVLLPVNEPTFGTKRKSQIQTYLEQNQGAGVQHIALKTDNIFA  334

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAG-DVLSDEQIKECEELGILVDRDDQGTL  489
            T+RE++ R+ +GGF+FMP   P YY++L ++ G  VL+DE++   EELG+LVD+DDQG L
Sbjct  335  TMRELKKRTHLGGFDFMPKASPEYYQSLPAKIGPGVLTDEELACVEELGLLVDKDDQGVL  394

Query  488  LQIFTKPVGDRPTLFIEIIQRVGCMMKKE  402
            LQ+FT+PVGDRPTLF+EIIQRVGC + KE
Sbjct  395  LQVFTRPVGDRPTLFLEIIQRVGCTVDKE  423



>ref|XP_008653702.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Zea mays]
 tpg|DAA60243.1| TPA: hypothetical protein ZEAMMB73_261174 [Zea mays]
Length=445

 Score =   203 bits (517),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 113/183 (62%), Positives = 141/183 (77%), Gaps = 1/183 (1%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GTAES LN +VLAN+ E V L L EPV GTKR+SQIQT+L+H+ GPG+QHLA+ S+D+  
Sbjct  257  GTAESSLNGLVLANSSEHVLLTLLEPVQGTKRRSQIQTFLDHHGGPGVQHLAMASDDLIG  316

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDR-DDQGTL  489
            TLRE+R RS +GGFE +P PPP+YY  ++  AGDVLS+ QIKEC+ELG+ VD+ D+ G +
Sbjct  317  TLREIRARSSMGGFELLPPPPPSYYDGVRRLAGDVLSEAQIKECQELGVRVDKGDNGGVV  376

Query  488  LQIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKM  309
            LQIFTK  GDRPTL +E IQR+GC+   E G  YQKGGCGGF K N   L KSIE+Y+K 
Sbjct  377  LQIFTKAAGDRPTLLLEFIQRIGCVEIDESGRQYQKGGCGGFAKDNVIHLVKSIEDYDKT  436

Query  308  LEA  300
            L+A
Sbjct  437  LDA  439



>emb|CDP16382.1| unnamed protein product [Coffea canephora]
Length=115

 Score =   192 bits (488),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = -2

Query  617  MPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLLQIFTKPVGDRPTLFIE  438
            MPSPPPTYY+NLKSRAGDVLSDEQIKECEELGILVDRDDQGTLLQIFTKPVGDRPT+FIE
Sbjct  1    MPSPPPTYYRNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLLQIFTKPVGDRPTIFIE  60

Query  437  IIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKMLEAKQAIHAA  279
            IIQR+GCM+K ++G++YQKGGCGGFGKGNFSELFKSIEEYEKMLEAKQ +  A
Sbjct  61   IIQRIGCMIKDDEGKIYQKGGCGGFGKGNFSELFKSIEEYEKMLEAKQIVQTA  113



>emb|CBJ28697.1| 4-hydroxyphenylpyruvate dioxygenase, plastid precursor [Ectocarpus 
siliculosus]
Length=516

 Score =   203 bits (516),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 113/209 (54%), Positives = 144/209 (69%), Gaps = 30/209 (14%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT +SGLNS+VLA+N+E V LPLNEP  GT +KSQIQT+LE N+GPGLQH+AL + DIFR
Sbjct  303  GTVDSGLNSIVLASNNEMVLLPLNEPTFGTAKKSQIQTFLEQNDGPGLQHIALKTNDIFR  362

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRD-DQGTL  489
            T+R MR  SG+GGFEFM  P  +YY+++  R    L+++Q+++ EELG+L D+D D G L
Sbjct  363  TMRLMRANSGLGGFEFMEPPGASYYRDVPRRI-PSLTEDQLRQLEELGLLADKDEDDGVL  421

Query  488  LQIFTKPVGDRPTLFIEIIQRVGCMMKK----------------------------EDGE  393
            LQ+FTKPVGDRPTLF EIIQR+GC  +                             E+GE
Sbjct  422  LQVFTKPVGDRPTLFFEIIQRIGCAFEATDGDNEGDRGVFGPADEDERGVRVSSRVEEGE  481

Query  392  VYQkggcggfgkGNFSELFKSIEEYEKML  306
            + Q+GGCGGFG GNF  LF+SIE+YE  L
Sbjct  482  LLQRGGCGGFGLGNFKALFESIEKYESTL  510



>ref|XP_002461829.1| hypothetical protein SORBIDRAFT_02g008850 [Sorghum bicolor]
 gb|EER98350.1| hypothetical protein SORBIDRAFT_02g008850 [Sorghum bicolor]
Length=496

 Score =   202 bits (514),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 143/187 (76%), Gaps = 1/187 (1%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GTAES LN +VLA++ E V L L EPV GTKR+SQIQT+L+H+ GPG+QHLA+TS+D+  
Sbjct  308  GTAESSLNGLVLADSSEKVLLTLLEPVQGTKRRSQIQTFLDHHGGPGVQHLAMTSDDLLG  367

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDR-DDQGTL  489
            TLRE+R RS +GGFE +P PPP+YY  +K  AGDVLS+ QI EC+ELG+ VDR D+ G +
Sbjct  368  TLREIRARSSMGGFELLPPPPPSYYDGVKRLAGDVLSEAQINECQELGVRVDRADNGGVV  427

Query  488  LQIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKM  309
            LQ FTK  GDRPTL +E IQR+GC+   E+G+ YQ+GGCGGF K N   L KSIE+Y+K 
Sbjct  428  LQTFTKAAGDRPTLLLEFIQRIGCVEIDENGKEYQRGGCGGFAKDNVIHLVKSIEDYDKT  487

Query  308  LEAKQAI  288
            L+A   +
Sbjct  488  LDAPAHV  494



>gb|AET00342.2| 4-hydroxyphenylpyruvate dioxygenase [Medicago truncatula]
Length=314

 Score =   195 bits (496),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 120/148 (81%), Gaps = 14/148 (9%)
 Frame = -2

Query  737  QTYLEHNEGPGLQHLALTSEDIFRTLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVL  558
            +TYLEH+EG GLQH+AL SEDIF+TLREMR +SG+GGFEFMPSPP TYY+NL +R+    
Sbjct  179  KTYLEHSEGAGLQHVALMSEDIFKTLREMRKKSGVGGFEFMPSPPVTYYRNLINRS----  234

Query  557  SDEQIKECEELGILVDRDDQGTLLQIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkg  378
                       GILVDRDDQGTLLQIFTKP+GDRPT+F+EIIQRVGCM+K E+G+ YQKG
Sbjct  235  ----------FGILVDRDDQGTLLQIFTKPIGDRPTIFLEIIQRVGCMLKDEEGKEYQKG  284

Query  377  gcggfgkGNFSELFKSIEEYEKMLEAKQ  294
            G G FGKGN SELFKSI EYEK LE ++
Sbjct  285  GWGEFGKGNVSELFKSILEYEKTLETRR  312



>gb|KHN11980.1| 4-hydroxyphenylpyruvate dioxygenase [Glycine soja]
Length=122

 Score =   188 bits (478),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 99/121 (82%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = -2

Query  653  MRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLLQIFT  474
            MR RS +GGFEFMPSPPPTYY NL +RA DVL+ +QIK+CEELGILVDRDDQGTLLQIFT
Sbjct  1    MRKRSFLGGFEFMPSPPPTYYANLHNRAADVLTVDQIKQCEELGILVDRDDQGTLLQIFT  60

Query  473  KPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKMLEAKQ  294
            KPVGDRPT+FIEIIQR+GCM++ E+G+VYQKG CGGFGKGNFSELFKSIEEYEK LEAK+
Sbjct  61   KPVGDRPTIFIEIIQRIGCMVEDEEGKVYQKGACGGFGKGNFSELFKSIEEYEKTLEAKR  120

Query  293  A  291
             
Sbjct  121  T  121



>gb|KDO32258.1| hypothetical protein SPRG_02737 [Saprolegnia parasitica CBS 223.65]
Length=432

 Score =   197 bits (500),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 108/134 (81%), Gaps = 0/134 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT +SGLNS+VLANN E + LP+NEP  GTKRKSQIQT+LE NEG GLQH+AL + DIF 
Sbjct  230  GTVDSGLNSMVLANNSELILLPMNEPTFGTKRKSQIQTFLEQNEGAGLQHMALKTNDIFH  289

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            TL EMR R+ +GGF+FMP P   YYKNL ++ GD+ + +Q K+ EELG+LVD+DDQG LL
Sbjct  290  TLAEMRKRTHLGGFDFMPKPSDAYYKNLPAKIGDIFTADQYKKIEELGLLVDKDDQGILL  349

Query  485  QIFTKPVGDRPTLF  444
            QIFTKP+GDRPT F
Sbjct  350  QIFTKPLGDRPTCF  363



>ref|XP_003617383.1| 4-hydroxyphenylpyruvate dioxygenase [Medicago truncatula]
Length=410

 Score =   196 bits (497),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 120/148 (81%), Gaps = 14/148 (9%)
 Frame = -2

Query  737  QTYLEHNEGPGLQHLALTSEDIFRTLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVL  558
            +TYLEH+EG GLQH+AL SEDIF+TLREMR +SG+GGFEFMPSPP TYY+NL +R+    
Sbjct  275  KTYLEHSEGAGLQHVALMSEDIFKTLREMRKKSGVGGFEFMPSPPVTYYRNLINRS----  330

Query  557  SDEQIKECEELGILVDRDDQGTLLQIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkg  378
                       GILVDRDDQGTLLQIFTKP+GDRPT+F+EIIQRVGCM+K E+G+ YQKG
Sbjct  331  ----------FGILVDRDDQGTLLQIFTKPIGDRPTIFLEIIQRVGCMLKDEEGKEYQKG  380

Query  377  gcggfgkGNFSELFKSIEEYEKMLEAKQ  294
            G G FGKGN SELFKSI EYEK LE ++
Sbjct  381  GWGEFGKGNVSELFKSILEYEKTLETRR  408



>ref|XP_007048965.1| Phytoene desaturation 1 [Theobroma cacao]
 gb|EOX93122.1| Phytoene desaturation 1 [Theobroma cacao]
Length=408

 Score =   193 bits (490),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 115/184 (63%), Positives = 129/184 (70%), Gaps = 34/184 (18%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT+ESGLNSVVLANNDE V L ++EP      +                         +R
Sbjct  252  GTSESGLNSVVLANNDEMVLLAMSEPNPERNEEENGN---------------------WR  290

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
                         F  +PSPPPTYYKNLK RAGDVLSDEQIKECEELGILVDRDDQGTLL
Sbjct  291  -------------FRVIPSPPPTYYKNLKKRAGDVLSDEQIKECEELGILVDRDDQGTLL  337

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIF+KPVGDRPT F+EIIQRVGCM+K E G++YQK GCGGFGKGNFSELFKS+EEYEK L
Sbjct  338  QIFSKPVGDRPTFFLEIIQRVGCMLKDEQGKLYQKVGCGGFGKGNFSELFKSVEEYEKTL  397

Query  305  EAKQ  294
            E+K+
Sbjct  398  ESKR  401



>gb|KIZ01637.1| 4-hydroxyphenylpyruvate dioxygenase [Monoraphidium neglectum]
Length=325

 Score =   189 bits (480),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 103/130 (79%), Gaps = 0/130 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT  SGLNS+VLA+N+E V LP+NEPV GTKRKSQIQTYLE NEGPGLQHLAL + DI  
Sbjct  187  GTENSGLNSMVLASNNEMVLLPINEPVFGTKRKSQIQTYLEQNEGPGLQHLALKTNDIIA  246

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            T+REMR RS  GGFEFMP    TYY+ L  R GDVL+ EQ    EELGILVD+DDQG L+
Sbjct  247  TMREMRARSDAGGFEFMPRLHDTYYRTLPDRIGDVLTAEQYAAVEELGILVDKDDQGVLM  306

Query  485  QIFTKPVGDR  456
            QIFTKP+GDR
Sbjct  307  QIFTKPLGDR  316



>gb|EJK75816.1| hypothetical protein THAOC_02448 [Thalassiosira oceanica]
Length=508

 Score =   186 bits (473),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 116/149 (78%), Gaps = 2/149 (1%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT +SGLNSVVLA++ E V LPLNEP  G KRKSQIQTYLE NEGPGLQH+A+ ++DIF 
Sbjct  331  GTVDSGLNSVVLASDSEAVLLPLNEPTEG-KRKSQIQTYLEQNEGPGLQHIAIKTDDIFE  389

Query  665  TLREMRN-RSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTL  489
            T+ +MR+     GGFE M  P   YY++L SR G+ LS  Q +  EELGIL D D++G L
Sbjct  390  TITKMRHAEENFGGFELMVRPSDEYYRDLPSRLGNKLSVNQYERLEELGILADADEEGVL  449

Query  488  LQIFTKPVGDRPTLFIEIIQRVGCMMKKE  402
            LQIFTKP+GDRPTLF+EIIQR+GC+++++
Sbjct  450  LQIFTKPLGDRPTLFLEIIQRIGCVIEQD  478



>ref|XP_007048969.1| Phytoene desaturation 1, putative [Theobroma cacao]
 gb|EOX93126.1| Phytoene desaturation 1, putative [Theobroma cacao]
Length=422

 Score =   183 bits (465),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 109/189 (58%), Positives = 125/189 (66%), Gaps = 47/189 (25%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT ESGLNS+VLA+N+E V L + EPV GTKR+SQIQT+LEHN+G G+QHLAL       
Sbjct  279  GTLESGLNSLVLASNNEMVLLVICEPVFGTKRRSQIQTFLEHNDGEGVQHLAL-------  331

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
                                                    IKECEELG+LVDRDDQGTLL
Sbjct  332  ----------------------------------------IKECEELGVLVDRDDQGTLL  351

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKML  306
            QIFTKP GDRPT FIEIIQR+GCM+K + G++YQKGGCGGFGKGNFSELFKS+EEYEK L
Sbjct  352  QIFTKPFGDRPTTFIEIIQRIGCMLKDDKGKMYQKGGCGGFGKGNFSELFKSVEEYEKSL  411

Query  305  EAKQAIHAA  279
            E K+    A
Sbjct  412  ERKKTTERA  420



>emb|CBI22086.3| unnamed protein product [Vitis vinifera]
Length=115

 Score =   172 bits (436),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 91/113 (81%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = -2

Query  617  MPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLLQIFTKPVGDRPTLFIE  438
            MPSPPPTYY+N+K RAGDVL+D+QIKECEELGILVD+DDQGTLLQIFTKP+GDRPT+FIE
Sbjct  1    MPSPPPTYYRNVKKRAGDVLTDDQIKECEELGILVDKDDQGTLLQIFTKPLGDRPTIFIE  60

Query  437  IIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKMLEAKQAIHAA  279
            IIQR+GCM+K ++G+V QKGGCGGFGKGNFSELFKSIEEYEK L AK+ +  A
Sbjct  61   IIQRLGCMVKDDEGKVSQKGGCGGFGKGNFSELFKSIEEYEKTLGAKRIVDPA  113



>ref|XP_005854172.1| 4-hydroxyphenylpyruvate dioxygenase [Nannochloropsis gaditana 
CCMP526]
 gb|EKU22183.1| 4-hydroxyphenylpyruvate dioxygenase [Nannochloropsis gaditana 
CCMP526]
Length=464

 Score =   169 bits (427),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 94/122 (77%), Gaps = 0/122 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT +SGLNSVVLANN E V +PLNEP +GTKRKSQIQTYLE N GPGLQHLAL + DIF 
Sbjct  342  GTVDSGLNSVVLANNAEDVLIPLNEPTYGTKRKSQIQTYLECNNGPGLQHLALATRDIFT  401

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            T+R+MR  S +GGF FM  PPP+YY+ L  R G  L+  Q+ + EELG+L D+DDQG LL
Sbjct  402  TMRKMRAVSEMGGFTFMAPPPPSYYRALPERLGGSLTASQLAQIEELGLLADKDDQGVLL  461

Query  485  QI  480
            Q+
Sbjct  462  QV  463



>gb|KDD74142.1| hypothetical protein H632_c1538p1, partial [Helicosporidium sp. 
ATCC 50920]
Length=362

 Score =   164 bits (414),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 93/119 (78%), Gaps = 0/119 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT +SGLNS+VLA+N+E V LP+NEP  GTKRKSQIQTYLE N G GLQHLAL ++DIF 
Sbjct  244  GTVDSGLNSMVLASNNEMVLLPINEPTFGTKRKSQIQTYLEQNAGAGLQHLALKTDDIFA  303

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTL  489
            T++ M+ RS +GGFEFMP P   YY+ L S+ G+VL+  Q  ECE +G+LVDRDDQG L
Sbjct  304  TMKLMQERSPMGGFEFMPRPSDAYYRELPSKIGEVLTPAQYAECERMGLLVDRDDQGVL  362



>ref|XP_002461838.1| hypothetical protein SORBIDRAFT_02g008990 [Sorghum bicolor]
 gb|EER98359.1| hypothetical protein SORBIDRAFT_02g008990 [Sorghum bicolor]
Length=480

 Score =   160 bits (405),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 93/179 (52%), Positives = 125/179 (70%), Gaps = 9/179 (5%)
 Frame = -2

Query  827  LNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRTLREMR  648
            LN +VLAN+ E V L L EPVHGT R +    Y        +QHLA+ S+D+  TLRE+R
Sbjct  302  LNGLVLANSSEKVLLTLLEPVHGTARSAAGARYRR------VQHLAMISDDLIGTLREIR  355

Query  647  NRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDR---DDQGTLLQIF  477
             RS +GGFE +P PPP+YY  ++  AGDVLS+ QI+EC+ELG+ VDR   ++ G +LQ F
Sbjct  356  ARSSMGGFELLPPPPPSYYDGVRRLAGDVLSEAQIRECQELGVRVDRAADNNGGVVLQTF  415

Query  476  TKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKMLEA  300
            TK  GDRPTL +E++QR+GC+   ++G+ YQ+ GCGGF K N   L KSIE+Y+K L+A
Sbjct  416  TKAAGDRPTLLLELMQRIGCVEIDDNGKEYQRRGCGGFAKDNVIHLVKSIEDYDKTLDA  474



>ref|XP_002902379.1| 4-hydroxyphenylpyruvate dioxygenase [Phytophthora infestans T30-4]
 gb|EEY56305.1| 4-hydroxyphenylpyruvate dioxygenase [Phytophthora infestans T30-4]
Length=335

 Score =   150 bits (379),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 88/116 (76%), Gaps = 0/116 (0%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT +SGLNS+VLA+N+E V LP+NEP  GTKRKSQIQTYLE N G GLQH+AL ++DIF 
Sbjct  217  GTLDSGLNSMVLASNNEMVLLPVNEPTFGTKRKSQIQTYLEQNVGAGLQHMALKTDDIFH  276

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQ  498
            TL EM+ RS +GGFEFMP P   YY+ +  R GD L+ EQ K+ E+LG+L+ R  +
Sbjct  277  TLAEMQKRSHVGGFEFMPRPNKVYYEQMPKRIGDALTQEQYKQIEQLGLLLTRTSK  332



>ref|WP_028069109.1| 4-hydroxyphenylpyruvate dioxygenase [Sphingobacterium thalpophilum]
Length=375

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 110/173 (64%), Gaps = 22/173 (13%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V++N +  V  P+NEP  G K+KSQI+ YLE  EG G+QH AL ++DI RT
Sbjct  216  TEYSALMSKVMSNGNGYVKFPINEPAEG-KKKSQIEEYLEFYEGEGVQHAALATKDIVRT  274

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLLQ  483
            ++E++ R    G EF+ +PP  YY  L  R GD+  DE+I+  +ELGILVDRD++G LLQ
Sbjct  275  VKELKAR----GVEFLAAPPEAYYDMLPDRVGDI--DEEIRVIQELGILVDRDEEGYLLQ  328

Query  482  IFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIE  324
            IFTKPV DRPTLF EIIQR G                  FG GNF  LF++IE
Sbjct  329  IFTKPVEDRPTLFYEIIQRKGAQ---------------SFGAGNFKALFEAIE  366



>ref|WP_021188075.1| 4-hydroxyphenylpyruvate dioxygenase [Sphingobacterium sp. IITKGP-BTPF85]
 gb|EQB83665.1| 4-hydroxyphenylpyruvate dioxygenase [Sphingobacterium sp. IITKGP-BTPF85]
Length=375

 Score =   145 bits (367),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 108/173 (62%), Gaps = 22/173 (13%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V++N +  V  P+NEP  G K KSQI+ YLE  EG G+QH AL ++DI +T
Sbjct  216  TEYSALMSKVMSNGNGYVKFPINEPAEGQK-KSQIEEYLEFYEGEGVQHAALATKDIVKT  274

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLLQ  483
            ++E++ R    G EF+ +PP  YY  L  R G +  DE+IK  ++LGILVDRDD+G LLQ
Sbjct  275  VKELKAR----GVEFLGAPPEAYYDMLPDRVGQI--DEEIKIIQDLGILVDRDDEGYLLQ  328

Query  482  IFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIE  324
            IFTKPV DRPTLF EIIQR G                  FG GNF  LF++IE
Sbjct  329  IFTKPVEDRPTLFFEIIQRKGAQ---------------SFGAGNFKALFEAIE  366



>ref|WP_037440536.1| 4-hydroxyphenylpyruvate dioxygenase [Sphingobacterium antarcticum]
 gb|KEQ30054.1| 4-hydroxyphenylpyruvate dioxygenase [Sphingobacterium antarcticus 
4BY]
Length=375

 Score =   145 bits (366),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 106/173 (61%), Gaps = 22/173 (13%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V++N +  V  P+NEP  G K+KSQI+ YLE  EG G+QH+A+ + DI +T
Sbjct  216  TEYSALMSKVMSNQNGYVKFPINEPAEG-KKKSQIEEYLEFYEGEGVQHIAVATHDIIKT  274

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLLQ  483
            +R M+ R    G EF+ +PP  YY NL  R G +  DE I   +ELGILVD D++G LLQ
Sbjct  275  VRAMKAR----GVEFLSAPPAAYYDNLLERVGKI--DEDIAPLQELGILVDYDEEGYLLQ  328

Query  482  IFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIE  324
            IFTKPV DRPTLF EIIQR G                  FG GNF  LF+S+E
Sbjct  329  IFTKPVQDRPTLFFEIIQRKGAQ---------------SFGAGNFKALFESLE  366



>ref|WP_041885392.1| 4-hydroxyphenylpyruvate dioxygenase [Pedobacter sp. NL19]
 gb|KIO75311.1| 4-hydroxyphenylpyruvate dioxygenase [Pedobacter sp. NL19]
Length=375

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 106/173 (61%), Gaps = 22/173 (13%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V++N +  V  P+NEP  G K+KSQI+ YLE  EG G+QH+A+ + DI +T
Sbjct  216  TEYSALMSKVMSNKNGYVKFPINEPAEG-KKKSQIEEYLEFYEGEGVQHIAVATHDIIKT  274

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLLQ  483
            +REM+ R    G EF+ +PP  YY  L  R G +  DE I   +ELGILVD D++G LLQ
Sbjct  275  VREMKLR----GVEFLSAPPKAYYDTLLERVGKI--DEDIAPLQELGILVDYDEEGYLLQ  328

Query  482  IFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIE  324
            IFTKPV DRPTLF EIIQR G                  FG GNF  LF+S+E
Sbjct  329  IFTKPVQDRPTLFFEIIQRKGAQ---------------SFGAGNFKALFESLE  366



>ref|WP_045851174.1| 4-hydroxyphenylpyruvate dioxygenase [Domibacillus enclensis]
Length=373

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 105/173 (61%), Gaps = 23/173 (13%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V+ N    +  P+NEP  G KRKSQIQ YL+  +GPG+QHLAL + DI  T
Sbjct  215  TEYSALMSKVMMNGTGRIKFPINEPAEG-KRKSQIQEYLDFYKGPGVQHLALLTNDIIAT  273

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLLQ  483
            +  ++      G EF+ +P  TYY+ L  R GD+  DE +K  +EL ILVDRDD+G LLQ
Sbjct  274  IAALKEN----GVEFLQTPD-TYYEELADRVGDI--DEDVKRLQELNILVDRDDEGYLLQ  326

Query  482  IFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIE  324
            IFTKP+ DRPTLFIEIIQR G +   E               GNF  LF+SIE
Sbjct  327  IFTKPIVDRPTLFIEIIQRKGALGFGE---------------GNFKALFQSIE  364



>ref|WP_031266144.1| 4-hydroxyphenylpyruvate dioxygenase, partial [Cytophagales bacterium 
B6]
Length=161

 Score =   138 bits (348),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 107/173 (62%), Gaps = 23/173 (13%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V++N +  V  P+NEP  G K+KSQI+ YLE  EG G+QHLAL + DI  T
Sbjct  3    TEYSALMSKVMSNGNGYVKFPINEPAEG-KKKSQIEEYLEFYEGEGVQHLALATNDIVTT  61

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLLQ  483
            + E++NR    G EF+ + P TYY +L  R G +  DE ++  + LGILVDRDD+G LLQ
Sbjct  62   VTELQNR----GVEFL-TVPTTYYDDLTDRVGHI--DEDLEPLKRLGILVDRDDEGYLLQ  114

Query  482  IFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIE  324
            IFTKPV DRPTLF EIIQR G                  FG GNF  LF++IE
Sbjct  115  IFTKPVEDRPTLFFEIIQRKGA---------------KSFGAGNFKALFEAIE  152



>ref|WP_045752705.1| 4-hydroxyphenylpyruvate dioxygenase [Sphingobacterium sp. PM2-P1-29]
 emb|CDS92026.1| 4-hydroxyphenylpyruvate dioxygenase [Sphingobacterium sp. PM2-P1-29]
Length=375

 Score =   143 bits (360),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 106/173 (61%), Gaps = 22/173 (13%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V++N +  V  P+NEP  G K KSQI+ YLE  EG G+QH AL + DI +T
Sbjct  216  TEYSALMSKVMSNGNGYVKFPINEPAEGQK-KSQIEEYLEFYEGEGVQHAALATHDIVKT  274

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLLQ  483
            ++ ++ R    G EF+ +PP  YY  L  R G +  DE+IK  ++LGILVDRDD+G LLQ
Sbjct  275  VKALKAR----GVEFLGAPPEAYYDMLPERVGQI--DEEIKIIQDLGILVDRDDEGYLLQ  328

Query  482  IFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIE  324
            IFTKPV DRPTLF EIIQR G                  FG GNF  LF++IE
Sbjct  329  IFTKPVEDRPTLFFEIIQRKGAQ---------------SFGAGNFKALFEAIE  366



>gb|EMT08063.1| 4-hydroxyphenylpyruvate dioxygenase [Aegilops tauschii]
Length=343

 Score =   142 bits (357),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 111/171 (65%), Gaps = 18/171 (11%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            G  ES LN +VLANN +TV L L E VHGTK  ++                   S+D+  
Sbjct  189  GMKESALNGLVLANNKDTVLLTLLETVHGTKHGTKRPA----------------SDDLLC  232

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQ-GTL  489
            TLR +R RS +GGFE +P+PPP+YY +++  A DVLS+EQIKEC+E+G+LVDRDD  G +
Sbjct  233  TLRGIRARSSMGGFELLPAPPPSYYDDVRQIASDVLSEEQIKECQEMGVLVDRDDHGGVV  292

Query  488  LQIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELF  336
            LQ+FTK   DRPTL +E IQR+   M+ +  +VY KGG GGF K N + +F
Sbjct  293  LQVFTKAAVDRPTLLLEFIQRIE-GMENQHQQVYPKGGYGGFAKDNVNHIF  342



>ref|WP_026710094.1| 4-hydroxyphenylpyruvate dioxygenase [Flavobacterium filum]
Length=386

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 83/175 (47%), Positives = 109/175 (62%), Gaps = 22/175 (13%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V++N +  +  P+NEP  G K+KSQI+ YL+  EGPG+QH+A+ ++DI  T
Sbjct  223  TEYSALMSKVMSNGNGRIKFPINEPAEG-KKKSQIEEYLDFYEGPGVQHIAVATDDIIST  281

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSD--EQIKECEELGILVDRDDQGTL  489
            + EMR R    G EF+ +PP  YY  +  R  D +S   E I E ++LGI++D D++G L
Sbjct  282  VAEMRKR----GVEFLSTPPQAYYDAIPERLKDHMSKFKEDINELQKLGIMIDADEEGYL  337

Query  488  LQIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIE  324
            LQIFTKPV DRPTLF EIIQR+G                 GFG GNF  LF+SIE
Sbjct  338  LQIFTKPVEDRPTLFFEIIQRMGA---------------RGFGAGNFKALFESIE  377



>ref|WP_038030064.1| 4-hydroxyphenylpyruvate dioxygenase [Thermonema rossianum]
Length=365

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 110/173 (64%), Gaps = 23/173 (13%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V++N    +  P+NEP  G KRKSQI+ YLE   GPG+QH+A+ ++DI  T
Sbjct  207  TEYSALMSKVVSNGTGYIKFPINEPAEG-KRKSQIEEYLEFYHGPGVQHIAVATDDIVHT  265

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLLQ  483
            + E+R R    G EF+   P TYY++LK R G++  DE +++ +EL ILVDRDD+G LLQ
Sbjct  266  VSELRRR----GVEFL-YVPETYYEDLKERVGNI--DEDVEKLKELNILVDRDDEGYLLQ  318

Query  482  IFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIE  324
            IFTKPV DRPTLF EIIQR G                  FGKGNF  LF++IE
Sbjct  319  IFTKPVEDRPTLFYEIIQRKGA---------------TSFGKGNFKALFEAIE  356



>gb|EPB65553.1| 4-hydroxyphenylpyruvate dioxygenase, partial [Ancylostoma ceylanicum]
Length=328

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 82/175 (47%), Positives = 110/175 (63%), Gaps = 22/175 (13%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V++N +  +  P+NEP  G KR SQI+ YL+  EG G+QH+A+ ++DI +T
Sbjct  165  TEYSALMSKVMSNGNGRIKFPINEPAEGKKR-SQIEEYLDFYEGAGVQHIAVATDDIIQT  223

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSD--EQIKECEELGILVDRDDQGTL  489
            + +MR+R    G EF+ +PP  YY  + +R  D +S   E I E ++LGI++D DD+G L
Sbjct  224  VADMRSR----GVEFLSTPPQAYYDAIPARLKDHMSKFKEDINELQKLGIMIDADDEGYL  279

Query  488  LQIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIE  324
            LQIFTKPV DRPTLF EIIQR+G                 GFG GNF  LF+SIE
Sbjct  280  LQIFTKPVEDRPTLFFEIIQRMGA---------------RGFGAGNFKALFESIE  319



>ref|WP_015195378.1| 4-hydroxyphenylpyruvate dioxygenase [Stanieria cyanosphaera]
 gb|AFZ37724.1| 4-hydroxyphenylpyruvate dioxygenase [Stanieria cyanosphaera PCC 
7437]
Length=362

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 107/174 (61%), Gaps = 23/174 (13%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
             T  S L S V+ +   ++ LP+NEP  G K KSQIQ YL++N G G+QH+A  + DI +
Sbjct  203  ATEYSALMSKVMQDGKGSIKLPINEPAQG-KGKSQIQEYLDYNGGAGIQHVAFATNDIIQ  261

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLL  486
            T+ ++RN     G EF+ + PPTYY+N+  R G +  DE+I++  ELGILVDRD +G LL
Sbjct  262  TVSQLRN----SGVEFL-AVPPTYYENIDKRVGKI--DERIEKLAELGILVDRDSEGYLL  314

Query  485  QIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIE  324
            QIFT+PV DRPTLF E+IQR G     E                NF  LF++IE
Sbjct  315  QIFTQPVEDRPTLFFEVIQRCGSQGFGEG---------------NFKALFEAIE  353



>ref|WP_043066209.1| 4-hydroxyphenylpyruvate dioxygenase [Aneurinibacillus migulanus]
 gb|KIV53029.1| 4-hydroxyphenylpyruvate dioxygenase [Aneurinibacillus migulanus]
 gb|KIV55437.1| 4-hydroxyphenylpyruvate dioxygenase [Aneurinibacillus migulanus]
Length=373

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 107/173 (62%), Gaps = 23/173 (13%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V+ N    +  P+NEP  G KRKSQIQ YL+  +GPG+QHLAL + DI  T
Sbjct  215  TEYSALMSKVMTNGTGRIKFPINEPAEG-KRKSQIQEYLDFYKGPGVQHLALLTNDIIST  273

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLLQ  483
            ++ ++      G EF+ +P  TYY+ L +R G++  DE IK  +EL ILVDRDD+G LLQ
Sbjct  274  VKALKEN----GVEFLYTPD-TYYEELSNRVGEI--DEDIKRLQELNILVDRDDEGYLLQ  326

Query  482  IFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIE  324
            IFTKP+ DRPTLFIEIIQR G +    DG              NF  LF+SIE
Sbjct  327  IFTKPIVDRPTLFIEIIQRKGALGFG-DG--------------NFKALFESIE  364



>gb|KIE12076.1| 4-hydroxyphenylpyruvate dioxygenase [Tolypothrix bouteillei VB521301]
Length=363

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 107/178 (60%), Gaps = 23/178 (13%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V+ N    + LP+NEP  G KRKSQI+ YLE+N GPG+QH+A  + +I  T
Sbjct  205  TEYSALMSKVMQNGTGKIKLPINEPAKG-KRKSQIEEYLEYNNGPGVQHIACATNNIIET  263

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLLQ  483
            + +++      G EF+   P TYY+NLK R GD+  DE I++  +LGILVDRD+ G LLQ
Sbjct  264  VSQLKK----AGLEFL-HVPKTYYENLKERVGDI--DEPIEQLADLGILVDRDEDGYLLQ  316

Query  482  IFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKM  309
            IFT+PV DRPTLF E+IQR G     E                NF  LF++IE  + M
Sbjct  317  IFTQPVQDRPTLFFEVIQRHGAQGFGEG---------------NFKALFEAIEREQAM  359



>ref|WP_039814073.1| 4-hydroxyphenylpyruvate dioxygenase [Jeotgalibacillus sp. D5]
Length=362

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 84/173 (49%), Positives = 105/173 (61%), Gaps = 23/173 (13%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V+ N    +  P+NEP  G KRKSQIQ YL+ + GPG+QHLA+ + DI  T
Sbjct  204  TDYSALMSKVMTNGSGRIKFPINEPAEG-KRKSQIQEYLDFHNGPGVQHLAVLTNDIIST  262

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLLQ  483
            +  +       G EF+ +P  TYY++L +R GD+  DE ++  +EL ILVDRDD+G LLQ
Sbjct  263  VHALHEN----GVEFLQTPA-TYYEDLAARVGDI--DEDVQRLQELNILVDRDDEGYLLQ  315

Query  482  IFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIE  324
            IFTKPV DRPTLFIEIIQR G     E               GNF  LF+SIE
Sbjct  316  IFTKPVVDRPTLFIEIIQRKGARGFGE---------------GNFKALFESIE  353



>gb|AJD92913.1| 4-hydroxyphenylpyruvate dioxygenase [Jeotgalibacillus sp. D5]
Length=373

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 84/173 (49%), Positives = 105/173 (61%), Gaps = 23/173 (13%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V+ N    +  P+NEP  G KRKSQIQ YL+ + GPG+QHLA+ + DI  T
Sbjct  215  TDYSALMSKVMTNGSGRIKFPINEPAEG-KRKSQIQEYLDFHNGPGVQHLAVLTNDIIST  273

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLLQ  483
            +  +       G EF+ +P  TYY++L +R GD+  DE ++  +EL ILVDRDD+G LLQ
Sbjct  274  VHALHEN----GVEFLQTPA-TYYEDLAARVGDI--DEDVQRLQELNILVDRDDEGYLLQ  326

Query  482  IFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIE  324
            IFTKPV DRPTLFIEIIQR G     E               GNF  LF+SIE
Sbjct  327  IFTKPVVDRPTLFIEIIQRKGARGFGE---------------GNFKALFESIE  364



>ref|WP_021624803.1| 4-hydroxyphenylpyruvate dioxygenase [Aneurinibacillus aneurinilyticus]
 gb|ERI06740.1| 4-hydroxyphenylpyruvate dioxygenase [Aneurinibacillus aneurinilyticus 
ATCC 12856]
Length=373

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 107/173 (62%), Gaps = 23/173 (13%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V+ N    +  P+NEP  G KRKSQIQ YL+  +GPG+QHLAL + DI  T
Sbjct  215  TEYSALMSKVMTNGTGRIKFPINEPAEG-KRKSQIQEYLDFYKGPGVQHLALLTNDIIST  273

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLLQ  483
            ++ ++      G EF+ +P  TYY+ L SR G++  DE IK+ + L ILVDRDD+G LLQ
Sbjct  274  VKALKEN----GVEFLYTPD-TYYEELTSRVGEI--DEDIKKLQALNILVDRDDEGYLLQ  326

Query  482  IFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIE  324
            IFTKP+ DRPTLFIEIIQR G +    DG              NF  LF+SIE
Sbjct  327  IFTKPIVDRPTLFIEIIQRKGALGFG-DG--------------NFKALFESIE  364



>ref|WP_015142185.1| 4-hydroxyphenylpyruvate dioxygenase [Pleurocapsa minor]
 gb|AFY75877.1| 4-hydroxyphenylpyruvate dioxygenase [Pleurocapsa sp. PCC 7327]
Length=364

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 83/178 (47%), Positives = 110/178 (62%), Gaps = 23/178 (13%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V+ +N   + LP+NEP  G KRKSQIQ YLE++ GPG+QH+AL ++DI  T
Sbjct  206  TEYSALMSKVMQDNTGKIKLPINEPA-GGKRKSQIQEYLEYHCGPGIQHVALATDDIIAT  264

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLLQ  483
            + +++      G EF+ +P  TYY+NL+ R G +  DE I +  ELGILVDRD++G LLQ
Sbjct  265  VAQLKA----AGVEFLDTPK-TYYENLEKRVGKI--DEPIDKLAELGILVDRDEEGYLLQ  317

Query  482  IFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKM  309
            IFT+PV DRPTLF EII+R G     E                NF  LF++IE  + M
Sbjct  318  IFTQPVQDRPTLFFEIIERHGAQGFGEG---------------NFKALFEAIEREQAM  360



>ref|WP_023577663.1| hppD protein [Flavobacterium saliperosum]
 gb|ESU21534.1| hppD protein [Flavobacterium saliperosum S13]
Length=386

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 83/180 (46%), Positives = 111/180 (62%), Gaps = 22/180 (12%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V++N +  +  P+NEP  G KR SQI+ YL+  EGPG+QH+A+ ++DI  T
Sbjct  223  TEYSALMSKVMSNGNGRIKFPINEPAEGKKR-SQIEEYLDFYEGPGVQHIAVATDDILTT  281

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSD--EQIKECEELGILVDRDDQGTL  489
            + EMR R    G EF+ +PP  YY  +  R  D +S   E I E ++LGI++D D++G L
Sbjct  282  VAEMRAR----GIEFLSTPPQAYYDAIPERLKDHMSKFKEDINELQKLGIMIDADEEGYL  337

Query  488  LQIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKM  309
            LQIFTKPV DRPTLF EIIQR+G                 GFG GNF  LF+SIE  +++
Sbjct  338  LQIFTKPVEDRPTLFFEIIQRMGA---------------RGFGAGNFKALFESIEREQQL  382



>ref|WP_038699940.1| 4-hydroxyphenylpyruvate dioxygenase [Sphingobacterium sp. ML3W]
 gb|AIM38160.1| 4-hydroxyphenylpyruvate dioxygenase [Sphingobacterium sp. ML3W]
Length=375

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 83/173 (48%), Positives = 107/173 (62%), Gaps = 22/173 (13%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V++N +  V  P+NEP  G K KSQI+ YL+  EG G+QH AL ++DI +T
Sbjct  216  TEYSALMSKVMSNGNGYVKFPINEPAEGQK-KSQIEEYLDFYEGEGVQHAALATQDIVQT  274

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLLQ  483
            ++ ++ R    G EF+ +PP  YY  L  R G +  DE+I+  ++LGILVDRDD+G LLQ
Sbjct  275  VKALKAR----GVEFLGAPPEAYYDMLPERVGQI--DEEIQIIQDLGILVDRDDEGYLLQ  328

Query  482  IFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIE  324
            IFTKPV DRPTLF EIIQR G                  FG GNF  LF++IE
Sbjct  329  IFTKPVEDRPTLFFEIIQRKGAQ---------------SFGAGNFKALFEAIE  366



>ref|XP_004709651.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase [Echinops telfairi]
Length=354

 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 116/180 (64%), Gaps = 23/180 (13%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S+V+AN +E++ +P+NEP  G K+KSQIQ Y+++N G G+QH+AL ++DI  T
Sbjct  180  TEYSSLRSIVVANYEESIKMPINEPAPG-KKKSQIQEYVDYNGGAGVQHIALKTQDIITT  238

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKS--RAGDVLSDEQIKECEELGILVDRDDQGTL  489
            +R ++ R    G EF+ + PPTYYK L+   ++  +   E I   EEL ILVD D++G L
Sbjct  239  IRHLKER----GMEFL-AVPPTYYKQLRENLKSAKIRVKESIDVLEELRILVDYDEKGYL  293

Query  488  LQIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKM  309
            LQIFTKPV DRPTLF+E+IQR                   GFG GNF+ LFK+ EE +K+
Sbjct  294  LQIFTKPVQDRPTLFLEVIQR---------------HNHQGFGAGNFNALFKAFEEEQKL  338



>ref|WP_021072238.1| 4-hydroxyphenylpyruvate dioxygenase [Sphingobacterium paucimobilis]
 gb|ERJ57504.1| 4-hydroxyphenylpyruvate dioxygenase [Sphingobacterium paucimobilis 
HER1398]
Length=375

 Score =   140 bits (354),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 84/173 (49%), Positives = 106/173 (61%), Gaps = 22/173 (13%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V++N +  V  P+NEP  G K+KSQI+ YLE  EG G+QH AL + DI  T
Sbjct  216  TEYSALMSKVMSNGNGYVKFPINEPAEG-KKKSQIEEYLEFYEGEGVQHAALATNDIVST  274

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLLQ  483
            ++ ++ R    G EF+ +PP  YY  L  R G +  DE+IK  ++LGILVDRD++G LLQ
Sbjct  275  VKALKAR----GVEFLGAPPEAYYDMLPDRVGVI--DEEIKIIQDLGILVDRDEEGYLLQ  328

Query  482  IFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIE  324
            IFTKPV DRPTLF EIIQR G                  FG GNF  LF++IE
Sbjct  329  IFTKPVQDRPTLFFEIIQRKGAQ---------------SFGAGNFKALFEAIE  366



>ref|WP_004428063.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus alcalophilus]
 gb|KGA98918.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus alcalophilus ATCC 
27647]
Length=373

 Score =   140 bits (354),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 83/173 (48%), Positives = 107/173 (62%), Gaps = 23/173 (13%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V+ N    +  P+NEP  G KRKSQI+ YL+   GPG+QHLA+ + D+  T
Sbjct  215  TEYSALMSKVMMNGTGRIKFPINEPAEG-KRKSQIEEYLDFYNGPGVQHLAVLTNDVIST  273

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLLQ  483
            ++ +R      G EF+ +P  TYY++L +R GD+  DE +K+ +EL ILVDRDD+G LLQ
Sbjct  274  VKTLREN----GVEFLQTPD-TYYEDLIARVGDI--DEDVKKLQELNILVDRDDEGYLLQ  326

Query  482  IFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIE  324
            IFTKP+ DRPTLFIEIIQR G     E               GNF  LF+SIE
Sbjct  327  IFTKPIVDRPTLFIEIIQRKGARGFGE---------------GNFKALFESIE  364



>ref|WP_038267139.1| 4-hydroxyphenylpyruvate dioxygenase [Zhouia amylolytica]
 gb|ETN94534.1| 4-hydroxyphenylpyruvate dioxygenase [Zhouia amylolytica AD3]
Length=387

 Score =   140 bits (354),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 83/175 (47%), Positives = 108/175 (62%), Gaps = 22/175 (13%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V++N +  +  P+NEP  G K+KSQI+ YL+  EG G+QH+A+ ++DI  T
Sbjct  223  TEYSALMSKVMSNGNGRIKFPINEPAEG-KKKSQIEEYLDFYEGSGVQHIAVATDDIIST  281

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLS--DEQIKECEELGILVDRDDQGTL  489
            +R ++ R    G EF+P PP +YY  +  R G  +    E IKE +EL ILVD D++G L
Sbjct  282  VRALKAR----GIEFLPPPPQSYYDAIPERMGTHMKIMKEDIKELQELSILVDADEEGYL  337

Query  488  LQIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIE  324
            LQIFTKPV DRPTLF EIIQR+G                 GFG GNF  LF+SIE
Sbjct  338  LQIFTKPVEDRPTLFFEIIQRMGAQ---------------GFGAGNFKALFESIE  377



>ref|WP_026980463.1| 4-hydroxyphenylpyruvate dioxygenase [Flavobacterium suncheonense]
 gb|KGO89200.1| 4-hydroxyphenylpyruvate dioxygenase [Flavobacterium suncheonense 
GH29-5 = DSM 17707]
Length=387

 Score =   140 bits (354),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 82/175 (47%), Positives = 109/175 (62%), Gaps = 22/175 (13%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V++N +  +  P+NEP HG KR SQI+ YL+  E  G+QH+A+ ++DI +T
Sbjct  224  TEYSALMSKVMSNGNGRIKFPINEPAHGKKR-SQIEEYLDFYEDEGVQHIAVATDDIIKT  282

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSD--EQIKECEELGILVDRDDQGTL  489
            + +MR+R    G EF+ +PP  YY  +  R  D +S   E I E ++LGI++D DD+G L
Sbjct  283  VTDMRSR----GVEFLSTPPQAYYDAIPDRLKDHMSKFKEDINELQKLGIMIDADDEGYL  338

Query  488  LQIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIE  324
            LQIFTKPV DRPTLF EIIQR+G                 GFG GNF  LF+SIE
Sbjct  339  LQIFTKPVEDRPTLFFEIIQRMGA---------------RGFGAGNFKALFESIE  378



>ref|WP_039865967.1| 4-hydroxyphenylpyruvate dioxygenase [Pedobacter sp. BAL39]
Length=376

 Score =   140 bits (352),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 81/173 (47%), Positives = 110/173 (64%), Gaps = 22/173 (13%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V++N +     P+NEP  G K+KSQI+ YLE  EG G+QH+A+ ++DI  T
Sbjct  217  TEYSALMSKVMSNGNGFSKFPINEPAEG-KKKSQIEEYLEFYEGEGVQHIAVATKDILST  275

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLLQ  483
            +R++++R    G EF+ +PP  YY  + +R G++  DE+I + +ELGILVD D++G LLQ
Sbjct  276  VRQLKSR----GVEFLSAPPEAYYNMMPNRVGEI--DEEIAQLKELGILVDCDEEGYLLQ  329

Query  482  IFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIE  324
            IFTKPV DRPTLF EIIQR G                  FG GNF  LF+S+E
Sbjct  330  IFTKPVEDRPTLFFEIIQRKGAQ---------------SFGAGNFKALFESLE  367



>gb|EDM38745.1| 4-hydroxyphenylpyruvate dioxygenase [Pedobacter sp. BAL39]
Length=403

 Score =   140 bits (353),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 81/173 (47%), Positives = 110/173 (64%), Gaps = 22/173 (13%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V++N +     P+NEP  G K+KSQI+ YLE  EG G+QH+A+ ++DI  T
Sbjct  244  TEYSALMSKVMSNGNGFSKFPINEPAEG-KKKSQIEEYLEFYEGEGVQHIAVATKDILST  302

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLLQ  483
            +R++++R    G EF+ +PP  YY  + +R G++  DE+I + +ELGILVD D++G LLQ
Sbjct  303  VRQLKSR----GVEFLSAPPEAYYNMMPNRVGEI--DEEIAQLKELGILVDCDEEGYLLQ  356

Query  482  IFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIE  324
            IFTKPV DRPTLF EIIQR G                  FG GNF  LF+S+E
Sbjct  357  IFTKPVEDRPTLFFEIIQRKGAQ---------------SFGAGNFKALFESLE  394



>ref|WP_041966606.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus selenatarsenatis]
 dbj|GAM14906.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus selenatarsenatis 
SF-1]
Length=371

 Score =   139 bits (351),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 105/173 (61%), Gaps = 24/173 (14%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V+ N     F P+NEP  G KRKSQIQ YLE   GPG+QHLA+ +EDI  T
Sbjct  214  TEYSALMSKVMHNGGRIKF-PINEPAEG-KRKSQIQEYLEFYNGPGVQHLAILTEDIVST  271

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLLQ  483
            + ++R      G EF+ S P +YY+ L  R G++  DE+I + +EL ILVDRDD+G LLQ
Sbjct  272  VAQLREN----GVEFL-STPDSYYEMLSKRVGEI--DEEIDKLKELSILVDRDDEGYLLQ  324

Query  482  IFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIE  324
            IFTKP+ DRPTLFIEIIQR G     E                NF  LF+SIE
Sbjct  325  IFTKPIVDRPTLFIEIIQRKGARGFGEG---------------NFKALFESIE  362



>ref|WP_023614753.1| MULTISPECIES: 4-hydroxyphenylpyruvate dioxygenase [Bacillus]
 gb|ESU33144.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus sp. 17376]
 dbj|GAE44495.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus boroniphilus JCM 
21738]
Length=371

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 105/173 (61%), Gaps = 24/173 (14%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V+ N     F P+NEP  G KRKSQIQ YLE   GPG+QHLA+ +EDI  T
Sbjct  214  TEYSALMSKVMHNGGRIKF-PINEPAEG-KRKSQIQEYLEFYNGPGVQHLAILTEDIVST  271

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLLQ  483
            + ++R      G EF+ S P +YY+ L  R G++  DE+I + +EL ILVDRDD+G LLQ
Sbjct  272  VAQLREN----GVEFL-STPDSYYEMLSERVGEI--DEEIDKLKELSILVDRDDEGYLLQ  324

Query  482  IFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIE  324
            IFTKP+ DRPTLFIEIIQR G     E                NF  LF+SIE
Sbjct  325  IFTKPIVDRPTLFIEIIQRKGARGFGEG---------------NFKALFESIE  362



>ref|WP_026849707.1| 4-hydroxyphenylpyruvate dioxygenase [Gemmatimonas sp. AP64]
Length=357

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 86/178 (48%), Positives = 111/178 (62%), Gaps = 23/178 (13%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V+AN ++ +  P+NEP  G K+KSQI+ YL+   GPG QHLAL ++DI  T
Sbjct  199  TEYSSLMSKVMANGNDKIKFPINEPASG-KKKSQIEEYLDFYGGPGAQHLALATDDILTT  257

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLLQ  483
            +  ++NR    G EF+ S P +YY  L++R G +  DE ++E  +LGILVDRD  G LLQ
Sbjct  258  VTALKNR----GVEFL-SVPTSYYDELQARVGQI--DEPVEELAKLGILVDRDPDGYLLQ  310

Query  482  IFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKM  309
            IFTKPV DRPTLF EIIQR G                  FGKGNF  LF+SIE  +++
Sbjct  311  IFTKPVEDRPTLFYEIIQRKGAT---------------SFGKGNFKALFESIEREQEL  353



>ref|WP_034260207.1| 4-hydroxyphenylpyruvate dioxygenase [Altibacter lentus]
Length=386

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 111/176 (63%), Gaps = 24/176 (14%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V++N +  +  P+NEP  G KR SQI+ YL+  EG G+QHLA+ ++DI +T
Sbjct  223  TEYSALMSKVMSNGNGRIKFPINEPAKGAKR-SQIEEYLDFYEGAGVQHLAVATDDIIKT  281

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAG---DVLSDEQIKECEELGILVDRDDQGT  492
            + ++++R    G EF+P PP  YY ++  R G   DV+  E +KE ++L ILVD D++G 
Sbjct  282  VAQLKDR----GVEFLPPPPQAYYDDIPRRLGAHMDVMK-EDLKELQKLSILVDADEEGY  336

Query  491  LLQIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIE  324
            LLQIFTKPV DRPTLF EIIQR+G                 GFG GNF  LF+SIE
Sbjct  337  LLQIFTKPVEDRPTLFFEIIQRMGA---------------KGFGAGNFKALFESIE  377



>ref|WP_028567254.1| 4-hydroxyphenylpyruvate dioxygenase [Salisaeta longa]
Length=362

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 85/175 (49%), Positives = 107/175 (61%), Gaps = 25/175 (14%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V+AN +E +  P+NEP  G KRKSQI+ YLE   G G+QH+A+ ++DI  T
Sbjct  202  TEYSALMSKVMANGNERIKFPINEPAEG-KRKSQIEEYLEFYNGAGVQHVAIATDDIIAT  260

Query  662  LREMRNRSGIGGFEFMPSPPPTYY--KNLKSRAGDVLSDEQIKECEELGILVDRDDQGTL  489
            +R++R+R    G EF+   P TYY  + LK R GD+  DEQI    EL ILVDRD +G L
Sbjct  261  VRDLRSR----GVEFL-EVPDTYYNPETLKKRVGDI--DEQIDALHELSILVDRDPEGYL  313

Query  488  LQIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIE  324
            LQIFTKP+ DRPT+F EIIQR G     E               GNF  LF++IE
Sbjct  314  LQIFTKPLQDRPTVFFEIIQRKGARTFGE---------------GNFKALFEAIE  353



>ref|XP_002307562.2| hypothetical protein POPTR_0005s22680g [Populus trichocarpa]
 gb|EEE94558.2| hypothetical protein POPTR_0005s22680g [Populus trichocarpa]
Length=254

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 77/102 (75%), Gaps = 16/102 (16%)
 Frame = -2

Query  845  GTAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFR  666
            GT+ESGLN+VVLANN+ETV LP+NEPV GTKRKSQIQTYLEHNEG G+QHL L SEDIFR
Sbjct  169  GTSESGLNAVVLANNEETVLLPMNEPVFGTKRKSQIQTYLEHNEGAGVQHLPLVSEDIFR  228

Query  665  TLREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIK  540
            TLREMR  S + GFE                AGDVLSDEQIK
Sbjct  229  TLREMRKCSAVEGFE----------------AGDVLSDEQIK  254



>emb|CEG27351.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus sp. B-jedd]
Length=371

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 105/173 (61%), Gaps = 24/173 (14%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V+ N     F P+NEP  G KRKSQIQ YLE   GPG+QHLA+ +EDI  T
Sbjct  214  TEYSALMSKVMHNGGRIKF-PINEPAEG-KRKSQIQEYLEFYNGPGVQHLAILTEDIIST  271

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLLQ  483
            +  +++     G EF+ S P TYY+ L  R G++  DE+I +  EL ILVDRDD+G LLQ
Sbjct  272  VSALKDN----GVEFL-STPDTYYEELAERVGEI--DEEISKLRELSILVDRDDEGYLLQ  324

Query  482  IFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIE  324
            IFTKP+ DRPTLFIE+IQR G     E               GNF  LF+SIE
Sbjct  325  IFTKPIVDRPTLFIEVIQRKGARGFGE---------------GNFKALFESIE  362



>ref|WP_035127658.1| 4-hydroxyphenylpyruvate dioxygenase [Flavobacterium aquatile]
 gb|KGD67112.1| 4-hydroxyphenylpyruvate dioxygenase [Flavobacterium aquatile 
LMG 4008]
Length=386

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 82/175 (47%), Positives = 108/175 (62%), Gaps = 22/175 (13%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V++N +  +  P+NEP  G K+KSQI+ YL+   GPG+QH+A+ ++DI +T
Sbjct  223  TEYSALMSKVMSNGNGRIKFPINEPAEG-KKKSQIEEYLDFYGGPGIQHIAIATDDIIKT  281

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLS--DEQIKECEELGILVDRDDQGTL  489
            + E+R R    G EF+ +PP TYY+ +  R G  +    E I E E+L I+VD D+ G L
Sbjct  282  VSELRAR----GVEFLSAPPSTYYQAIPERLGVHMEMMKEDINEIEKLAIMVDADEDGYL  337

Query  488  LQIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIE  324
            LQIFTKPV DRPTLF EIIQR+G                 GFG GNF  LF+SIE
Sbjct  338  LQIFTKPVQDRPTLFFEIIQRMGA---------------KGFGAGNFKALFESIE  377



>ref|XP_008588978.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase [Galeopterus variegatus]
Length=393

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 111/176 (63%), Gaps = 23/176 (13%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S+V+AN +ET+ +P+NEP  G K+KSQIQ Y+++N GPG+QH+AL ++DI   
Sbjct  219  TEYSSLRSIVVANYEETIKMPINEPAQG-KKKSQIQEYVDYNGGPGVQHIALKTQDIITA  277

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNL--KSRAGDVLSDEQIKECEELGILVDRDDQGTL  489
            +R +R R    G EF+   P TYYK L  K ++  +   E I   EEL ILVD D++G L
Sbjct  278  IRHLRER----GLEFL-GVPSTYYKQLREKLKSAKIRVKESIDVLEELKILVDYDEKGYL  332

Query  488  LQIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEE  321
            LQIFTKP+ DRPTLF+E+IQR                   GFG GNF+ LFK+ EE
Sbjct  333  LQIFTKPMQDRPTLFLEVIQR---------------HNHQGFGAGNFNSLFKAFEE  373



>gb|AHG91240.1| 4-hydroxyphenylpyruvate dioxygenase [Gemmatimonadetes bacterium 
KBS708]
Length=378

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 85/178 (48%), Positives = 110/178 (62%), Gaps = 23/178 (13%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V+AN ++ +  P+NEP  G K+KSQI+ YL+   GPG QHLAL ++DI  T
Sbjct  220  TEYSSLMSKVMANGNDRIKFPINEPASG-KKKSQIEEYLDFYHGPGAQHLALATDDIIAT  278

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLLQ  483
            +  +R+R    G EF+ +P  TYY+ L+ R G +  DE +   EELGILVDRD  G LLQ
Sbjct  279  VAALRDR----GVEFLAAPT-TYYRELQERVGRI--DEPLDVLEELGILVDRDPDGYLLQ  331

Query  482  IFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKM  309
            IFTKPV DRPTLF EIIQR G    K  G+            GNF  LF++IE  +++
Sbjct  332  IFTKPVEDRPTLFYEIIQRKGA---KSFGK------------GNFKALFEAIEREQEL  374



>ref|WP_002988933.1| MULTISPECIES: 4-hydroxyphenylpyruvate dioxygenase [Myroides]
 gb|EHQ42696.1| 4-hydroxyphenylpyruvate dioxygenase [Myroides odoratus DSM 2801]
 gb|EKB07682.1| 4-hydroxyphenylpyruvate dioxygenase [Myroides [odoratimimus] 
CIP 103059]
Length=386

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 109/176 (62%), Gaps = 24/176 (14%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V++N +  +  P+NEP  G KR SQ++ YL+   GPG+QH+A+ ++DI +T
Sbjct  223  TEYSALMSKVMSNGNGRIKFPINEPAEGAKR-SQVEEYLDFYNGPGVQHIAVATDDIIKT  281

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAG---DVLSDEQIKECEELGILVDRDDQGT  492
            + EMR R    G EF+ +PP  YY  +  R G   D++  E IKE ++L ILVD D++G 
Sbjct  282  VGEMRAR----GVEFLSAPPQAYYDAIPGRLGVHMDMMK-EDIKELQKLSILVDADEEGY  336

Query  491  LLQIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIE  324
            LLQIFTKPV DRPTLF EIIQR+G                 GFG GNF  LF+SIE
Sbjct  337  LLQIFTKPVEDRPTLFFEIIQRMGA---------------RGFGAGNFKALFESIE  377



>ref|NP_001165464.1| 4-hydroxyphenylpyruvate dioxygenase isoform 2 [Homo sapiens]
 dbj|BAG51925.1| unnamed protein product [Homo sapiens]
Length=354

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 110/176 (63%), Gaps = 23/176 (13%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S+V+AN +E++ +P+NEP  G K+KSQIQ Y+++N G G+QH+AL +EDI   
Sbjct  180  TEYSSLRSIVVANYEESIKMPINEPAPG-KKKSQIQEYVDYNGGAGVQHIALKTEDIITA  238

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNL--KSRAGDVLSDEQIKECEELGILVDRDDQGTL  489
            +R +R R    G EF+ S P TYYK L  K +   +   E I   EEL ILVD D++G L
Sbjct  239  IRHLRER----GLEFL-SVPSTYYKQLREKLKTAKIKVKENIDALEELKILVDYDEKGYL  293

Query  488  LQIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEE  321
            LQIFTKPV DRPTLF+E+IQR                   GFG GNF+ LFK+ EE
Sbjct  294  LQIFTKPVQDRPTLFLEVIQR---------------HNHQGFGAGNFNSLFKAFEE  334



>gb|ETZ23271.1| 4-hydroxyphenylpyruvate dioxygenase [Pedobacter sp. V48]
Length=376

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 81/173 (47%), Positives = 108/173 (62%), Gaps = 22/173 (13%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V++N +     P+NEP  G K+KSQI+ YLE  EG G+QH+A+ ++DI  T
Sbjct  217  TEYSALMSKVMSNGNGYSKFPINEPAEG-KKKSQIEEYLEFYEGEGVQHIAVATKDILAT  275

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLLQ  483
            ++E++ R    G EF+ +PP  YY  +  R G++  DE+I + +ELGILVD D++G LLQ
Sbjct  276  VKELKAR----GVEFLSAPPEAYYSMMPDRVGEI--DEEIVQLKELGILVDCDEEGYLLQ  329

Query  482  IFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIE  324
            IFTKPV DRPTLF EIIQR G                  FG GNF  LF+S+E
Sbjct  330  IFTKPVEDRPTLFFEIIQRKGAQ---------------SFGAGNFKALFESLE  367



>ref|WP_034641974.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus manliponensis]
 gb|KEK18059.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus manliponensis]
Length=372

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 107/173 (62%), Gaps = 24/173 (14%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V+ N     F P+NEP  G KRKSQIQ YLE   G G+QHLAL + DI +T
Sbjct  215  TEYSALMSKVMTNGSRIKF-PINEPAEG-KRKSQIQEYLEFYNGAGVQHLALLTNDIVKT  272

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLLQ  483
            +  +R      G EF+ +P  TYY+ L +R G +  DE++++ +EL ILVDRDD+G LLQ
Sbjct  273  ITALRAN----GVEFLDTPD-TYYEELTARVGKI--DEEVEKLKELKILVDRDDEGYLLQ  325

Query  482  IFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIE  324
            IFTKP+ DRPTLFIEIIQR G    K  GE            GNF  LF+SIE
Sbjct  326  IFTKPIVDRPTLFIEIIQRKGS---KGFGE------------GNFKALFESIE  363



>ref|XP_003832400.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase isoform X2 [Pan 
paniscus]
Length=354

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 110/176 (63%), Gaps = 23/176 (13%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S+V+AN +E++ +P+NEP  G K+KSQIQ Y+++N G G+QH+AL +EDI   
Sbjct  180  TEYSSLRSIVVANYEESIKMPINEPAPG-KKKSQIQEYVDYNGGAGVQHIALKTEDIITA  238

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNL--KSRAGDVLSDEQIKECEELGILVDRDDQGTL  489
            +R +R R    G EF+ S P TYYK L  K +   +   E I   EEL ILVD D++G L
Sbjct  239  IRHLRER----GLEFL-SVPSTYYKQLREKLKTAKIKVKENIDALEELKILVDYDEKGYL  293

Query  488  LQIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEE  321
            LQIFTKPV DRPTLF+E+IQR                   GFG GNF+ LFK+ EE
Sbjct  294  LQIFTKPVQDRPTLFLEVIQR---------------HNHQGFGAGNFNSLFKAFEE  334



>ref|XP_004054097.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase isoform 2 [Gorilla 
gorilla gorilla]
Length=354

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 110/176 (63%), Gaps = 23/176 (13%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S+V+AN +E++ +P+NEP  G K+KSQIQ Y+++N G G+QH+AL +EDI   
Sbjct  180  TEYSSLRSIVVANYEESIKMPINEPAPG-KKKSQIQEYVDYNGGAGVQHIALKTEDIITA  238

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNL--KSRAGDVLSDEQIKECEELGILVDRDDQGTL  489
            +R +R R    G EF+ S P TYYK L  K +   +   E I   EEL ILVD D++G L
Sbjct  239  IRHLRER----GLEFL-SVPSTYYKQLREKLKTAKIKVKENIDALEELKILVDYDEKGYL  293

Query  488  LQIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEE  321
            LQIFTKPV DRPTLF+E+IQR                   GFG GNF+ LFK+ EE
Sbjct  294  LQIFTKPVQDRPTLFLEVIQR---------------HNHQGFGAGNFNSLFKAFEE  334



>gb|AIM09595.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
Length=221

 Score =   134 bits (338),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 93/142 (65%), Gaps = 9/142 (6%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V+ N     F P+NEP  G KRKSQIQ YLE   G G+QHLAL + DI +T
Sbjct  57   TEYSALMSKVMTNGSRIKF-PINEPADG-KRKSQIQEYLEFYNGAGVQHLALLTNDIVKT  114

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLLQ  483
            +  +R      G EF+ +P  TYY  L +R G +  DE+I + +EL ILVDRDD+G LLQ
Sbjct  115  VEALRA----NGVEFLDTPD-TYYDELTARVGKI--DEEIDKLKELKILVDRDDEGYLLQ  167

Query  482  IFTKPVGDRPTLFIEIIQRVGC  417
            IFTKP+ DRPTLFIEIIQR G 
Sbjct  168  IFTKPIVDRPTLFIEIIQRKGS  189



>ref|WP_041266432.1| 4-hydroxyphenylpyruvate dioxygenase [Gemmatimonas aurantiaca]
Length=366

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 85/178 (48%), Positives = 112/178 (63%), Gaps = 23/178 (13%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V+AN ++ +  P+NEP  G K+KSQI+ YL+   GPG QHLAL ++DI  T
Sbjct  208  TEYSSLMSKVMANGNDRIKFPINEPASG-KKKSQIEEYLDFYGGPGAQHLALATDDILAT  266

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLLQ  483
            +  +R+R    G EF+ S P +YY++L+ R G +  DE+++E   LGILVDRD  G LLQ
Sbjct  267  VTALRDR----GVEFL-SVPTSYYEDLQERVGKI--DEKLEELAALGILVDRDPDGYLLQ  319

Query  482  IFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKM  309
            IFTKPV DRPTLF EIIQR G                  FGKGNF  LF++IE  +++
Sbjct  320  IFTKPVEDRPTLFFEIIQRKGAT---------------SFGKGNFRALFEAIEREQEL  362



>ref|WP_006257753.1| MULTISPECIES: 4-hydroxyphenylpyruvate dioxygenase [Myroides]
 gb|EHO11345.1| 4-hydroxyphenylpyruvate dioxygenase [Myroides odoratimimus CCUG 
10230]
 gb|EHO14446.1| 4-hydroxyphenylpyruvate dioxygenase [Myroides odoratimimus CCUG 
12901]
 gb|AJA68495.1| 4-hydroxyphenylpyruvate dioxygenase [Myroides sp. A21]
Length=386

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 111/176 (63%), Gaps = 24/176 (14%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V++N +  +  P+NEP  G KR SQ++ YL+   GPG+QH+A+ ++DI +T
Sbjct  223  TEYSALMSKVMSNGNGRIKFPINEPAEGAKR-SQVEEYLDFYNGPGVQHIAVATDDIIKT  281

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAG---DVLSDEQIKECEELGILVDRDDQGT  492
            +  M++R    G EF+ +PP  YY  + +R G   D++  E IKE ++LGI++D D++G 
Sbjct  282  VAAMKDR----GVEFLSAPPQAYYDMIPARLGVHMDMMK-EDIKELQKLGIMIDADEEGY  336

Query  491  LLQIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIE  324
            LLQIFTKPV DRPTLF EIIQR+G                 GFG GNF  LF+SIE
Sbjct  337  LLQIFTKPVEDRPTLFFEIIQRMGA---------------RGFGAGNFKALFESIE  377



>ref|WP_006266112.1| 4-hydroxyphenylpyruvate dioxygenase [Myroides odoratimimus]
 gb|EKB04525.1| 4-hydroxyphenylpyruvate dioxygenase [Myroides odoratimimus CCUG 
3837]
Length=386

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 111/176 (63%), Gaps = 24/176 (14%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V++N +  +  P+NEP  G KR SQ++ YL+   GPG+QH+A+ ++DI +T
Sbjct  223  TEYSALMSKVMSNGNGRIKFPINEPAEGAKR-SQVEEYLDFYNGPGVQHIAVATDDIIKT  281

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAG---DVLSDEQIKECEELGILVDRDDQGT  492
            +  M++R    G EF+ +PP  YY  + +R G   D++  E IKE ++LGI++D D++G 
Sbjct  282  VAAMKDR----GVEFLSAPPQAYYDMIPARLGVHMDMMK-EDIKELQKLGIMIDADEEGY  336

Query  491  LLQIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIE  324
            LLQIFTKPV DRPTLF EIIQR+G                 GFG GNF  LF+SIE
Sbjct  337  LLQIFTKPVEDRPTLFFEIIQRMGA---------------RGFGAGNFKALFESIE  377



>ref|WP_026728258.1| 4-hydroxyphenylpyruvate dioxygenase [Flavobacterium denitrificans]
Length=386

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 82/175 (47%), Positives = 108/175 (62%), Gaps = 22/175 (13%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V++N +  +  P+NEP  G K+KSQI+ YL+   GPG+QH+A+ ++DI +T
Sbjct  223  TEYSALMSKVMSNGNGRIKFPINEPAEG-KKKSQIEEYLDFYGGPGIQHIAIATDDIIKT  281

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLS--DEQIKECEELGILVDRDDQGTL  489
            + ++R R    G EF+ SPP TYY+ +  R G  +    E I E E+L I+VD D+ G L
Sbjct  282  VSQLRAR----GVEFLSSPPHTYYEAIPERLGVHMEMMKEDINEIEKLAIMVDADEDGYL  337

Query  488  LQIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIE  324
            LQIFTKPV DRPTLF EIIQR+G                 GFG GNF  LF+SIE
Sbjct  338  LQIFTKPVQDRPTLFFEIIQRMGA---------------KGFGAGNFKALFESIE  377



>ref|WP_011685885.1| 4-hydroxyphenylpyruvate dioxygenase [Candidatus Solibacter usitatus]
 gb|ABJ85131.1| 4-hydroxyphenylpyruvate dioxygenase [Candidatus Solibacter usitatus 
Ellin6076]
Length=375

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 81/173 (47%), Positives = 111/173 (64%), Gaps = 23/173 (13%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V++N +E V  P+NEP H  KRKSQI+ YLE+  GPG+QH+A+ +++I  T
Sbjct  217  TEYSALMSKVMSNGNERVKFPINEPAH-AKRKSQIEEYLEYYHGPGVQHIAMATDNIIET  275

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLLQ  483
            +  +R +    G +F+   P TYY +L+SR G +  DE + + ++LGILVDRDD+G +LQ
Sbjct  276  VGTLRRQ----GVDFL-RVPSTYYDDLQSRVGKI--DEPVADLKDLGILVDRDDEGYMLQ  328

Query  482  IFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIE  324
            IFT+PV DRPTLF E+IQR G                  FGKGNF  LF++IE
Sbjct  329  IFTRPVEDRPTLFYEVIQRKGS---------------RSFGKGNFKALFEAIE  366



>ref|WP_041518598.1| 4-hydroxyphenylpyruvate dioxygenase [Flavobacterium hibernum]
 gb|KIO52331.1| 4-hydroxyphenylpyruvate dioxygenase [Flavobacterium hibernum]
Length=386

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 82/176 (47%), Positives = 110/176 (63%), Gaps = 24/176 (14%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V++N +  +  P+NEP  G K+KSQI+ YL+   GPG+QH+A+ ++DI +T
Sbjct  223  TEYSALMSKVMSNGNGRIKFPINEPAEG-KKKSQIEEYLDFYGGPGIQHIAIATDDIIKT  281

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAG---DVLSDEQIKECEELGILVDRDDQGT  492
            + ++R R    G EF+ +PP TYY+ +  R G   D++  E I E E+L I+VD D+ G 
Sbjct  282  VSQLRAR----GVEFLSAPPHTYYQAIPERLGVHMDMMK-EDINEIEKLAIMVDADEDGY  336

Query  491  LLQIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIE  324
            LLQIFTKPV DRPTLF EIIQR+G                 GFG GNF  LF+SIE
Sbjct  337  LLQIFTKPVQDRPTLFFEIIQRMGA---------------KGFGAGNFKALFESIE  377



>ref|WP_016873294.1| 4-hydroxyphenylpyruvate dioxygenase [Chlorogloeopsis fritschii]
Length=367

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 82/173 (47%), Positives = 103/173 (60%), Gaps = 23/173 (13%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V+ +    + LP+NEP  G K KSQI+ YLEHN GPG+QH+AL SE+I  T
Sbjct  206  TEYSALMSKVMQDGTGKIKLPINEPAQG-KHKSQIEEYLEHNYGPGVQHVALASENIIET  264

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLLQ  483
            +  M+      G EF+ S P TYY++L+ R G +  DE I +  ELGILVDRD  G LLQ
Sbjct  265  VTRMKA----AGVEFL-SAPQTYYEDLEERVGKI--DEPIDKLAELGILVDRDQDGYLLQ  317

Query  482  IFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIE  324
            IFT+PV DRPTLF E+I+R G     E                NF  LF++IE
Sbjct  318  IFTQPVQDRPTLFFEVIERHGARGFGEG---------------NFKALFEAIE  355



>ref|WP_026575026.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus sp. UNC438CL73TsuS30]
Length=369

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 83/173 (48%), Positives = 106/173 (61%), Gaps = 23/173 (13%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V+ N    +  P+NEP  G KRKSQIQ YL++  GPG+QHLAL + DI  T
Sbjct  211  TEYSALMSKVMMNGTGRIKFPINEPAEG-KRKSQIQEYLDYYNGPGVQHLALLTNDIIGT  269

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLLQ  483
            +  +R      G E + +P  TYY++L +R G++  DE +K  +EL ILVDRDD+G LLQ
Sbjct  270  VAALRAN----GVELLFTPD-TYYQDLANRVGEI--DEDVKRLQELNILVDRDDEGYLLQ  322

Query  482  IFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIE  324
            IFTKP+ DRPT+FIEIIQR G  +   DG              NF  LF+SIE
Sbjct  323  IFTKPLVDRPTMFIEIIQRKGA-LGFGDG--------------NFKALFESIE  360



>ref|WP_029270890.1| 4-hydroxyphenylpyruvate dioxygenase [Flavobacterium sp. KJJ]
Length=386

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 82/176 (47%), Positives = 110/176 (63%), Gaps = 24/176 (14%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V++N +  +  P+NEP  G K+KSQI+ YL+   GPG+QH+A+ ++DI +T
Sbjct  223  TEYSALMSKVMSNGNGRIKFPINEPAEG-KKKSQIEEYLDFYGGPGIQHIAIATDDIIKT  281

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAG---DVLSDEQIKECEELGILVDRDDQGT  492
            + ++R R    G EF+ +PP TYY+ +  R G   D++  E I E E+L I+VD D+ G 
Sbjct  282  VSQLRAR----GVEFLSAPPHTYYQAIPERLGVHMDMMK-EDINEIEKLAIMVDADEDGY  336

Query  491  LLQIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIE  324
            LLQIFTKPV DRPTLF EIIQR+G                 GFG GNF  LF+SIE
Sbjct  337  LLQIFTKPVQDRPTLFFEIIQRMGA---------------KGFGAGNFKALFESIE  377



>ref|WP_017497444.1| 4-hydroxyphenylpyruvate dioxygenase [Flavobacterium sp. WG21]
Length=386

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 82/176 (47%), Positives = 110/176 (63%), Gaps = 24/176 (14%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V++N +  +  P+NEP  G K+KSQI+ YL+   GPG+QH+A+ ++DI +T
Sbjct  223  TEYSALMSKVMSNGNGRIKFPINEPAEG-KKKSQIEEYLDFYGGPGIQHIAIATDDIIKT  281

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAG---DVLSDEQIKECEELGILVDRDDQGT  492
            + ++R R    G EF+ +PP TYY+ +  R G   D++  E I E E+L I+VD D+ G 
Sbjct  282  VSQLRAR----GVEFLSAPPHTYYQAIPERLGVHMDMMK-EDINEIEKLAIMVDADEDGY  336

Query  491  LLQIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIE  324
            LLQIFTKPV DRPTLF EIIQR+G                 GFG GNF  LF+SIE
Sbjct  337  LLQIFTKPVQDRPTLFFEIIQRMGA---------------KGFGAGNFKALFESIE  377



>ref|WP_016649995.1| 4-hydroxyphenylpyruvate dioxygenase [Myroides odoratimimus]
 gb|EPH10533.1| 4-hydroxyphenylpyruvate dioxygenase [Myroides odoratimimus CCUG 
12700]
Length=386

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 111/176 (63%), Gaps = 24/176 (14%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V++N +  +  P+NEP  G KR SQ++ YL+   GPG+QH+A+ ++DI +T
Sbjct  223  TEYSALMSKVMSNGNGRIKFPINEPAEGAKR-SQVEEYLDFYNGPGVQHIAVATDDIIKT  281

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAG---DVLSDEQIKECEELGILVDRDDQGT  492
            +  M++R    G EF+ +PP  YY  + +R G   D++  E IKE ++LGI++D D++G 
Sbjct  282  VAAMKDR----GVEFLSAPPQAYYDMIPTRLGVHMDMMK-EDIKELQKLGIMIDADEEGY  336

Query  491  LLQIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIE  324
            LLQIFTKPV DRPTLF EIIQR+G                 GFG GNF  LF+SIE
Sbjct  337  LLQIFTKPVEDRPTLFFEIIQRMGA---------------RGFGAGNFKALFESIE  377



>ref|WP_035681519.1| 4-hydroxyphenylpyruvate dioxygenase [Flavobacterium reichenbachii]
 gb|KFF04791.1| 4-hydroxyphenylpyruvate dioxygenase [Flavobacterium reichenbachii]
Length=386

 Score =   138 bits (348),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 82/176 (47%), Positives = 110/176 (63%), Gaps = 24/176 (14%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V++N +  +  P+NEP  G K+KSQI+ YL+   GPG+QH+A+ ++DI +T
Sbjct  223  TEYSALMSKVMSNGNGRIKFPINEPAEG-KKKSQIEEYLDFYGGPGIQHIAIATDDIIKT  281

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAG---DVLSDEQIKECEELGILVDRDDQGT  492
            + ++R R    G EF+ +PP TYY+ +  R G   D++  E I E E+L I+VD D+ G 
Sbjct  282  VSQLRAR----GVEFLSAPPHTYYQAIPERLGVHMDMMK-EDINEIEKLAIMVDADEDGY  336

Query  491  LLQIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIE  324
            LLQIFTKPV DRPTLF EIIQR+G                 GFG GNF  LF+SIE
Sbjct  337  LLQIFTKPVQDRPTLFFEIIQRMGA---------------KGFGAGNFKALFESIE  377



>ref|WP_026134698.1| 4-hydroxyphenylpyruvate dioxygenase [Scytonema hofmanni]
Length=363

 Score =   137 bits (346),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 106/173 (61%), Gaps = 23/173 (13%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V+ N    + LP+NEP  G KRKSQI+ YLE+N+GPG+QH+A  + +I  T
Sbjct  205  TEYSALMSKVMQNGTGKIKLPINEPAKG-KRKSQIEEYLEYNKGPGVQHIACATNNIIET  263

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLLQ  483
            + +++      G EF+   P TYY+NLK R G++  DE I++  +LGILVDRD+ G LLQ
Sbjct  264  VTQLKK----AGLEFL-DVPRTYYENLKERVGEI--DEPIEQLADLGILVDRDEDGYLLQ  316

Query  482  IFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIE  324
            IFT+PV DRPTLF E+IQR G     E                NF  LF++IE
Sbjct  317  IFTQPVQDRPTLFFEVIQRHGAQGFGEG---------------NFKALFEAIE  354



>ref|WP_035653039.1| 4-hydroxyphenylpyruvate dioxygenase [Flavobacterium sp. Fl]
Length=386

 Score =   138 bits (347),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 82/176 (47%), Positives = 110/176 (63%), Gaps = 24/176 (14%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V++N +  +  P+NEP  G K+KSQI+ YL+   GPG+QH+A+ ++DI +T
Sbjct  223  TEYSALMSKVMSNGNGRIKFPINEPAEG-KKKSQIEEYLDFYGGPGIQHIAIATDDIIKT  281

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAG---DVLSDEQIKECEELGILVDRDDQGT  492
            + ++R R    G EF+ +PP TYY+ +  R G   D++  E I E E+L I+VD D+ G 
Sbjct  282  VSQLRAR----GVEFLSAPPHTYYQAIPERLGVHMDMMK-EDINEIEKLAIMVDADEDGY  336

Query  491  LLQIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIE  324
            LLQIFTKPV DRPTLF EIIQR+G                 GFG GNF  LF+SIE
Sbjct  337  LLQIFTKPVQDRPTLFFEIIQRMGA---------------KGFGAGNFKALFESIE  377



>gb|EEM07226.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus mycoides Rock1-4]
Length=303

 Score =   136 bits (343),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 105/173 (61%), Gaps = 24/173 (14%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V+ N     F P+NEP  G KRKSQIQ YLE   G G+QHLAL + DI +T
Sbjct  146  TEYSALMSKVMTNGSRIKF-PINEPADG-KRKSQIQEYLEFYNGAGVQHLALLTNDIVKT  203

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLLQ  483
            +  +R+     G EF+ +P  TYY+ L +R G +  DE+I + +EL ILVDRDD+G LLQ
Sbjct  204  VEALRSN----GVEFLDTPD-TYYEELTARVGKI--DEEIDKLKELKILVDRDDEGYLLQ  256

Query  482  IFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIE  324
            IFTKP+ DRPTLFIEIIQR G     E               GNF  LF+SIE
Sbjct  257  IFTKPIVDRPTLFIEIIQRKGSRGFGE---------------GNFKALFESIE  294



>ref|WP_020060738.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus sp. 123MFChir2]
Length=372

 Score =   138 bits (347),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 107/173 (62%), Gaps = 24/173 (14%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V+ N     F P+NEP  G KRKSQIQ YLE   G G+QHLAL + DI +T
Sbjct  215  TEYSALMSKVMTNGSRIKF-PINEPAEG-KRKSQIQEYLEFYNGAGVQHLALLTNDIVKT  272

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLLQ  483
            +  +R      G EF+ +P  TYY+ L +R G +  DE+I++ +EL ILVDRDD+G LLQ
Sbjct  273  VSALRT----NGVEFLDTPD-TYYEELTARVGQI--DEEIEKLKELKILVDRDDEGYLLQ  325

Query  482  IFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIE  324
            IFTKP+ DRPTLFIEIIQR G    +  GE            GNF  LF+SIE
Sbjct  326  IFTKPIVDRPTLFIEIIQRKGS---RGFGE------------GNFKALFESIE  363



>ref|NP_002141.1| 4-hydroxyphenylpyruvate dioxygenase isoform 1 [Homo sapiens]
 sp|P32754.2|HPPD_HUMAN RecName: Full=4-hydroxyphenylpyruvate dioxygenase; AltName: Full=4-hydroxyphenylpyruvic 
acid oxidase; Short=4HPPD; Short=HPD; 
Short=HPPDase [Homo sapiens]
 emb|CAA51082.1| 4-hydroxyphenylpyruvate dioxygenase [Homo sapiens]
 dbj|BAA06498.1| 4-hydroxyphenylpyruvic acid dioxgenase [Homo sapiens]
 gb|AAH24287.1| 4-hydroxyphenylpyruvate dioxygenase [Homo sapiens]
 gb|EAW98292.1| 4-hydroxyphenylpyruvate dioxygenase, isoform CRA_b [Homo sapiens]
 gb|ABM83590.1| 4-hydroxyphenylpyruvate dioxygenase [synthetic construct]
 gb|ABM87048.1| 4-hydroxyphenylpyruvate dioxygenase [synthetic construct]
 dbj|BAF83515.1| unnamed protein product [Homo sapiens]
 gb|AIC48974.1| HPD, partial [synthetic construct]
Length=393

 Score =   138 bits (348),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 110/176 (63%), Gaps = 23/176 (13%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S+V+AN +E++ +P+NEP  G K+KSQIQ Y+++N G G+QH+AL +EDI   
Sbjct  219  TEYSSLRSIVVANYEESIKMPINEPAPG-KKKSQIQEYVDYNGGAGVQHIALKTEDIITA  277

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNL--KSRAGDVLSDEQIKECEELGILVDRDDQGTL  489
            +R +R R    G EF+ S P TYYK L  K +   +   E I   EEL ILVD D++G L
Sbjct  278  IRHLRER----GLEFL-SVPSTYYKQLREKLKTAKIKVKENIDALEELKILVDYDEKGYL  332

Query  488  LQIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEE  321
            LQIFTKPV DRPTLF+E+IQR                   GFG GNF+ LFK+ EE
Sbjct  333  LQIFTKPVQDRPTLFLEVIQR---------------HNHQGFGAGNFNSLFKAFEE  373



>ref|WP_026708430.1| 4-hydroxyphenylpyruvate dioxygenase [Flavobacterium frigidarium]
Length=386

 Score =   138 bits (347),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 80/175 (46%), Positives = 109/175 (62%), Gaps = 22/175 (13%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V++N +  +  P+NEP  G KR SQI+ YL+   GPG+QH+A+ ++DI +T
Sbjct  223  TEYSALMSKVMSNGNGRIKFPINEPAEGKKR-SQIEEYLDFYGGPGIQHIAIATDDIIKT  281

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLS--DEQIKECEELGILVDRDDQGTL  489
            + ++R R    G EF+ +PP  YY+ +  R GD ++   E + E E+L I+VD D++G L
Sbjct  282  VSQLRAR----GVEFLSAPPHAYYEAIPERLGDHMNMMKEDLGEIEKLAIMVDADEEGYL  337

Query  488  LQIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIE  324
            LQIFTKPV DRPTLF EIIQR+G                 GFG GNF  LF+SIE
Sbjct  338  LQIFTKPVQDRPTLFFEIIQRMGA---------------KGFGAGNFKALFESIE  377



>ref|XP_009246611.1| PREDICTED: LOW QUALITY PROTEIN: 4-hydroxyphenylpyruvate dioxygenase 
[Pongo abelii]
Length=393

 Score =   138 bits (348),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 110/176 (63%), Gaps = 23/176 (13%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S+V+AN +E++ +P+NEP  G K+KSQIQ Y+++N G G+QH+AL +EDI   
Sbjct  219  TEYSSLRSIVVANYEESIKMPINEPAPG-KKKSQIQEYVDYNGGAGVQHIALKTEDIITA  277

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNL--KSRAGDVLSDEQIKECEELGILVDRDDQGTL  489
            +R +R R    G EF+ S P TYYK L  K +   +   E I   EEL ILVD D++G L
Sbjct  278  IRHLRER----GLEFL-SVPSTYYKQLREKLKTAKIKVKENIDALEELKILVDYDEKGYL  332

Query  488  LQIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEE  321
            LQIFTKPV DRPTLF+E+IQR                   GFG GNF+ LFK+ EE
Sbjct  333  LQIFTKPVQDRPTLFLEVIQR---------------HNHQGFGAGNFNSLFKAFEE  373



>ref|XP_528667.2| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase [Pan troglodytes]
 ref|XP_003832399.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase isoform X1 [Pan 
paniscus]
Length=393

 Score =   138 bits (348),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 110/176 (63%), Gaps = 23/176 (13%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S+V+AN +E++ +P+NEP  G K+KSQIQ Y+++N G G+QH+AL +EDI   
Sbjct  219  TEYSSLRSIVVANYEESIKMPINEPAPG-KKKSQIQEYVDYNGGAGVQHIALKTEDIITA  277

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNL--KSRAGDVLSDEQIKECEELGILVDRDDQGTL  489
            +R +R R    G EF+ S P TYYK L  K +   +   E I   EEL ILVD D++G L
Sbjct  278  IRHLRER----GLEFL-SVPSTYYKQLREKLKTAKIKVKENIDALEELKILVDYDEKGYL  332

Query  488  LQIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEE  321
            LQIFTKPV DRPTLF+E+IQR                   GFG GNF+ LFK+ EE
Sbjct  333  LQIFTKPVQDRPTLFLEVIQR---------------HNHQGFGAGNFNSLFKAFEE  373



>ref|WP_026725162.1| 4-hydroxyphenylpyruvate dioxygenase [Flavobacterium sasangense]
Length=387

 Score =   138 bits (347),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 82/175 (47%), Positives = 107/175 (61%), Gaps = 22/175 (13%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V++N +  +  P+NEP  G KR SQI+ YL+  EG G+QH+A+ ++DI  T
Sbjct  224  TEYSALMSKVMSNGNGRIKFPINEPAEGKKR-SQIEEYLDFYEGEGVQHIAVATDDIIST  282

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSD--EQIKECEELGILVDRDDQGTL  489
            + EMR R    G EF+ +PP  YY  +  R  D +S   E I E ++LGI++D D++G L
Sbjct  283  VAEMRAR----GIEFLSTPPQAYYDAIPERLKDHMSKFKEDINELQKLGIMIDADEEGYL  338

Query  488  LQIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIE  324
            LQIFTKPV DRPTLF EIIQR+G                 GFG GNF  LF+SIE
Sbjct  339  LQIFTKPVEDRPTLFFEIIQRMGA---------------RGFGAGNFKALFESIE  378



>dbj|BAH39165.1| 4-hydroxyphenylpyruvate dioxygenase [Gemmatimonas aurantiaca 
T-27]
Length=374

 Score =   138 bits (347),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 85/178 (48%), Positives = 112/178 (63%), Gaps = 23/178 (13%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V+AN ++ +  P+NEP  G K+KSQI+ YL+   GPG QHLAL ++DI  T
Sbjct  216  TEYSSLMSKVMANGNDRIKFPINEPASG-KKKSQIEEYLDFYGGPGAQHLALATDDILAT  274

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLLQ  483
            +  +R+R    G EF+ S P +YY++L+ R G +  DE+++E   LGILVDRD  G LLQ
Sbjct  275  VTALRDR----GVEFL-SVPTSYYEDLQERVGKI--DEKLEELAALGILVDRDPDGYLLQ  327

Query  482  IFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKM  309
            IFTKPV DRPTLF EIIQR G                  FGKGNF  LF++IE  +++
Sbjct  328  IFTKPVEDRPTLFFEIIQRKGAT---------------SFGKGNFRALFEAIEREQEL  370



>ref|XP_004054096.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase isoform 1 [Gorilla 
gorilla gorilla]
Length=393

 Score =   138 bits (347),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 110/176 (63%), Gaps = 23/176 (13%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S+V+AN +E++ +P+NEP  G K+KSQIQ Y+++N G G+QH+AL +EDI   
Sbjct  219  TEYSSLRSIVVANYEESIKMPINEPAPG-KKKSQIQEYVDYNGGAGVQHIALKTEDIITA  277

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNL--KSRAGDVLSDEQIKECEELGILVDRDDQGTL  489
            +R +R R    G EF+ S P TYYK L  K +   +   E I   EEL ILVD D++G L
Sbjct  278  IRHLRER----GLEFL-SVPSTYYKQLREKLKTAKIKVKENIDALEELKILVDYDEKGYL  332

Query  488  LQIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEE  321
            LQIFTKPV DRPTLF+E+IQR                   GFG GNF+ LFK+ EE
Sbjct  333  LQIFTKPVQDRPTLFLEVIQR---------------HNHQGFGAGNFNSLFKAFEE  373



>gb|AAC73008.1| 4-hydroxyphenylpyruvate-dioxygenase [Homo sapiens]
Length=393

 Score =   138 bits (347),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 110/176 (63%), Gaps = 23/176 (13%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S+V+AN +E++ +P+NEP  G K+KSQIQ Y+++N G G+QH+AL +EDI   
Sbjct  219  TEYSSLRSIVVANYEESIKMPINEPAPG-KKKSQIQEYVDYNGGAGVQHIALKTEDIITA  277

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNL--KSRAGDVLSDEQIKECEELGILVDRDDQGTL  489
            +R +R R    G EF+ S P TYYK L  K +   +   E I   EEL ILVD D++G L
Sbjct  278  IRHLRER----GLEFL-SVPSTYYKQLREKLKTAKIKVKENIDALEELKILVDYDEKGYL  332

Query  488  LQIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEE  321
            LQIFTKPV DRPTLF+E+IQR                   GFG GNF+ LFK+ EE
Sbjct  333  LQIFTKPVQDRPTLFLEVIQR---------------HNHQGFGAGNFNSLFKAFEE  373



>pdb|3ISQ|A Chain A, Crystal Structure Of Human 4-Hydroxyphenylpyruvate Dioxygenase
Length=393

 Score =   138 bits (347),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 110/176 (63%), Gaps = 23/176 (13%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S+V+AN +E++ +P+NEP  G K+KSQIQ Y+++N G G+QH+AL +EDI   
Sbjct  212  TEYSSLRSIVVANYEESIKMPINEPAPG-KKKSQIQEYVDYNGGAGVQHIALKTEDIITA  270

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNL--KSRAGDVLSDEQIKECEELGILVDRDDQGTL  489
            +R +R R    G EF+ S P TYYK L  K +   +   E I   EEL ILVD D++G L
Sbjct  271  IRHLRER----GLEFL-SVPSTYYKQLREKLKTAKIKVKENIDALEELKILVDYDEKGYL  325

Query  488  LQIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEE  321
            LQIFTKPV DRPTLF+E+IQR                   GFG GNF+ LFK+ EE
Sbjct  326  LQIFTKPVQDRPTLFLEVIQR---------------HNHQGFGAGNFNSLFKAFEE  366



>ref|XP_005572523.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase [Macaca fascicularis]
Length=393

 Score =   138 bits (347),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 111/176 (63%), Gaps = 23/176 (13%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S+V+AN +E++ +P+NEP  G K+KSQIQ Y+++N G G+QH+AL ++DI  T
Sbjct  219  TEYSSLRSIVVANYEESIKMPINEPAPG-KKKSQIQEYVDYNGGAGVQHIALNTQDIITT  277

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNL--KSRAGDVLSDEQIKECEELGILVDRDDQGTL  489
            +R +R R    G EF+ S P TYYK L  K +   +   E I   EEL ILVD D++G L
Sbjct  278  IRHLRER----GMEFL-SVPSTYYKQLREKLKTAKIKVKENIDVLEELKILVDYDEKGYL  332

Query  488  LQIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEE  321
            LQIFTKPV DRPTLF+E+IQR                   GFG GNF+ LFK+ EE
Sbjct  333  LQIFTKPVQDRPTLFLEVIQR---------------HNHQGFGAGNFNSLFKAFEE  373



>ref|WP_007807141.1| 4-hydroxyphenylpyruvate dioxygenase [Flavobacterium sp. CF136]
 gb|EJL64286.1| 4-hydroxyphenylpyruvate dioxygenase [Flavobacterium sp. CF136]
Length=386

 Score =   138 bits (347),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 82/176 (47%), Positives = 110/176 (63%), Gaps = 24/176 (14%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V++N +  +  P+NEP  G K+KSQI+ YL+   GPG+QH+A+ ++DI +T
Sbjct  223  TEYSALMSKVMSNGNGRIKFPINEPAEG-KKKSQIEEYLDFYGGPGIQHIAIATDDIIKT  281

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAG---DVLSDEQIKECEELGILVDRDDQGT  492
            + E++ R    G EF+ +PP TYY+ +  R G   DV+  E + E E+L I+VD D+ G 
Sbjct  282  VSELKAR----GVEFLSAPPHTYYQAIPERLGVHMDVMK-EDLNEIEKLAIMVDADEDGY  336

Query  491  LLQIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIE  324
            LLQIFTKPV DRPTLF EIIQR+G                 GFG GNF  LF+SIE
Sbjct  337  LLQIFTKPVQDRPTLFFEIIQRMGA---------------KGFGAGNFKALFESIE  377



>ref|WP_044219112.1| 4-hydroxyphenylpyruvate dioxygenase [Flammeovirga pacifica]
Length=373

 Score =   137 bits (346),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 84/173 (49%), Positives = 109/173 (63%), Gaps = 23/173 (13%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  + L S V++N +  V  P+NEP  G KRKSQI+ YLE   G G+QH+A+ ++DI  T
Sbjct  215  TEYTALMSKVVSNGNGYVKFPINEPADG-KRKSQIEEYLEFYNGSGVQHIAVATDDICYT  273

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLLQ  483
            ++E+R R    G EF+   P TYY +LK R G++  DE+I   +EL ILVDRD++G LLQ
Sbjct  274  VKELRRR----GIEFL-HVPETYYLDLKDRVGEI--DEEINHLKELNILVDRDEEGYLLQ  326

Query  482  IFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIE  324
            IFTKPV DRPTLF EIIQR G    K  G+            GNF  LF++IE
Sbjct  327  IFTKPVEDRPTLFFEIIQRKGA---KSFGK------------GNFKALFEAIE  364



>ref|WP_025124885.1| 4-hydroxyphenylpyruvate dioxygenase [Myroides odoratimimus]
Length=386

 Score =   137 bits (346),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 79/175 (45%), Positives = 109/175 (62%), Gaps = 22/175 (13%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V++N +  +  P+NEP  G KR SQ++ YL+   GPG+QH+A+ ++DI +T
Sbjct  223  TEYSALMSKVMSNGNGRIKFPINEPAEGAKR-SQVEEYLDFYNGPGVQHIAVATDDIIKT  281

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLS--DEQIKECEELGILVDRDDQGTL  489
            +  M+ R    G EF+ +PP  YY  + +R G  ++   E IKE ++LGI++D D++G L
Sbjct  282  VAAMKGR----GVEFLSAPPQAYYDMIPARLGVHMNMMKEDIKELQKLGIMIDADEEGYL  337

Query  488  LQIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIE  324
            LQIFTKPV DRPTLF EIIQR+G                 GFG GNF  LF+SIE
Sbjct  338  LQIFTKPVEDRPTLFFEIIQRMGA---------------RGFGAGNFKALFESIE  377



>ref|WP_010255704.1| 4-hydroxyphenylpyruvate dioxygenase [Myroides injenensis]
Length=386

 Score =   137 bits (346),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 107/175 (61%), Gaps = 22/175 (13%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V++N +  +  P+NEP  G KR SQI+ YL+   G G+QH+A+ ++DI  T
Sbjct  223  TEYSALMSKVMSNGNGRIKFPINEPAEGMKR-SQIEEYLDFYNGAGVQHIAVATDDIIYT  281

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLS--DEQIKECEELGILVDRDDQGTL  489
            + EM+ R    G EF+ +PP  YY  + SR GD +    E I E ++LGI++D D++G L
Sbjct  282  VGEMKKR----GVEFLSAPPTAYYDAIPSRLGDHMEMMKEDISELQKLGIMIDADEEGYL  337

Query  488  LQIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIE  324
            LQIFTKPV DRPTLF EIIQR+G                 GFG GNF  LF+SIE
Sbjct  338  LQIFTKPVEDRPTLFFEIIQRMGA---------------RGFGAGNFKALFESIE  377



>ref|XP_003994683.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase [Felis catus]
Length=393

 Score =   137 bits (346),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 113/180 (63%), Gaps = 23/180 (13%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S+V+AN +E++ +P+NEP  G K+KSQIQ Y+++N GPG+QH+AL ++DI   
Sbjct  219  TEYSSLRSIVVANYEESIKMPINEPAPG-KKKSQIQEYVDYNGGPGVQHIALKTQDIITA  277

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNL--KSRAGDVLSDEQIKECEELGILVDRDDQGTL  489
            +R +R R    G EF+   P TYYK L  K ++  +   E I   EEL ILVD D++G L
Sbjct  278  IRHLRER----GMEFL-GVPSTYYKQLREKLKSAKIRVKENIDVLEELKILVDYDEKGYL  332

Query  488  LQIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKM  309
            LQIFTKPV DRPTLF+E+IQR                   GFG GNF+ LFK+ EE + +
Sbjct  333  LQIFTKPVQDRPTLFLEVIQR---------------HNHQGFGAGNFNSLFKAFEEEQNL  377



>ref|WP_015809084.1| 4-hydroxyphenylpyruvate dioxygenase [Pedobacter heparinus]
 gb|ACU05475.1| 4-hydroxyphenylpyruvate dioxygenase [Pedobacter heparinus DSM 
2366]
Length=376

 Score =   137 bits (346),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 108/173 (62%), Gaps = 22/173 (13%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V++N +     P+NEP  G K+KSQI+ YLE  EG G+QH+A+ ++DI  T
Sbjct  217  TEYSALMSKVMSNGNGYSKFPINEPAEG-KKKSQIEEYLEFYEGEGVQHIAVATKDILTT  275

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLLQ  483
            +R+++ R    G EF+ +PP  YY  +  R G++  DE++ + +ELGILVD D++G LLQ
Sbjct  276  VRDLKAR----GVEFLSAPPEAYYNMMPERVGEI--DEEMAQLKELGILVDCDEEGYLLQ  329

Query  482  IFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIE  324
            IFTKPV DRPTLF EIIQR G                  FG GNF  LF+S+E
Sbjct  330  IFTKPVEDRPTLFFEIIQRKGAQ---------------SFGAGNFKALFESLE  367



>ref|WP_026445133.1| 4-hydroxyphenylpyruvate dioxygenase [Acidobacteriaceae bacterium 
URHE0068]
Length=366

 Score =   137 bits (345),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 85/178 (48%), Positives = 110/178 (62%), Gaps = 23/178 (13%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V+AN +  V  P+NEP  G K+KSQ++ YL+   GPG+QH+AL + DI  T
Sbjct  208  TEYSALMSKVMANGNGYVKFPINEPAQG-KKKSQVEEYLDFYPGPGVQHIALATNDILHT  266

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLLQ  483
            + ++  +    G EF+   P TYY  L+SR G +  DE I+E E LGILVDRDD+G +LQ
Sbjct  267  VTKLTEQ----GVEFL-RVPHTYYTELQSRVGKI--DEPIEELERLGILVDRDDEGYMLQ  319

Query  482  IFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKM  309
            IFTKPV DRPTLF EIIQR G                  FGKGNF  LF++IE  +++
Sbjct  320  IFTKPVEDRPTLFFEIIQRKGS---------------RSFGKGNFKALFEAIEREQQL  362



>ref|WP_006262560.1| MULTISPECIES: 4-hydroxyphenylpyruvate dioxygenase [Myroides]
 gb|EHO15098.1| 4-hydroxyphenylpyruvate dioxygenase [Myroides odoratimimus CIP 
101113]
 gb|AJH13391.1| 4-hydroxyphenylpyruvate dioxygenase [Myroides profundi]
Length=386

 Score =   137 bits (346),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 110/176 (63%), Gaps = 24/176 (14%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V++N +  +  P+NEP  G KR SQ++ YL+   GPG+QH+A+ ++DI +T
Sbjct  223  TEYSALMSKVMSNGNGRIKFPINEPAEGAKR-SQVEEYLDFYNGPGVQHIAVATDDIIKT  281

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAG---DVLSDEQIKECEELGILVDRDDQGT  492
            +  M+ R    G EF+ +PP  YY  + +R G   D++  E IKE ++LGI++D D++G 
Sbjct  282  VAAMKER----GVEFLSAPPQAYYDMIPARLGVHMDMMK-EDIKELQKLGIMIDADEEGY  336

Query  491  LLQIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIE  324
            LLQIFTKPV DRPTLF EIIQR+G                 GFG GNF  LF+SIE
Sbjct  337  LLQIFTKPVEDRPTLFFEIIQRMGA---------------RGFGAGNFKALFESIE  377



>ref|WP_003205593.1| MULTISPECIES: 4-hydroxyphenylpyruvate dioxygenase [Bacillus]
 gb|EEM13055.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus mycoides Rock3-17]
 gb|EEM18929.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus pseudomycoides 
DSM 12442]
 gb|AIK37583.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus mycoides]
 gb|KFN14696.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus mycoides]
 gb|AJI18127.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus]
Length=372

 Score =   137 bits (345),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 107/173 (62%), Gaps = 24/173 (14%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V+ N     F P+NEP  G KRKSQIQ YLE   G G+QHLAL + DI +T
Sbjct  215  TEYSALMSKVMTNGSRIKF-PINEPADG-KRKSQIQEYLEFYNGAGVQHLALLTNDIVKT  272

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLLQ  483
            +  +R+     G EF+ +P  TYY+ L +R G +  DE+I + +EL ILVDRDD+G LLQ
Sbjct  273  VEALRS----NGVEFLDTPD-TYYEELTARVGKI--DEEIDKLKELKILVDRDDEGYLLQ  325

Query  482  IFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIE  324
            IFTKP+ DRPTLFIEIIQR G    +  GE            GNF  LF+SIE
Sbjct  326  IFTKPIVDRPTLFIEIIQRKGS---RGFGE------------GNFKALFESIE  363



>ref|WP_039108515.1| 4-hydroxyphenylpyruvate dioxygenase [Flavobacterium sp. AED]
 gb|KIA87107.1| 4-hydroxyphenylpyruvate dioxygenase [Flavobacterium sp. AED]
Length=386

 Score =   137 bits (346),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 113/180 (63%), Gaps = 22/180 (12%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V++N +  +  P+NEP  G K+KSQI+ YL+   GPG+QH+A+ ++DI +T
Sbjct  223  TEYSALMSKVMSNGNGRIKFPINEPAEG-KKKSQIEEYLDFYGGPGIQHIAIATDDIIKT  281

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLS--DEQIKECEELGILVDRDDQGTL  489
            + +++ R    G EF+ +PP TYY+ +  R G+ +    E + E E+L I+VD D++G L
Sbjct  282  VSQLKAR----GIEFLSAPPHTYYEAIPERLGEHMKMMKEDLNEIEKLAIMVDADEEGYL  337

Query  488  LQIFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEKM  309
            LQIFTKPV DRPTLF EIIQR+G                 GFG GNF  LF+SIE  +++
Sbjct  338  LQIFTKPVQDRPTLFFEIIQRMGA---------------KGFGAGNFKALFESIEREQQL  382



>ref|XP_002775900.1| 4-hydroxyphenylpyruvate dioxygenase, putative [Perkinsus marinus 
ATCC 50983]
 gb|EER07716.1| 4-hydroxyphenylpyruvate dioxygenase, putative [Perkinsus marinus 
ATCC 50983]
Length=441

 Score =   138 bits (348),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 109/177 (62%), Gaps = 23/177 (13%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  + L S V+  +   V  P+NEP  G K+KSQI+ YLE+N GPG+QHLAL +EDI  T
Sbjct  279  TEYTALKSKVMTVDTGLVKYPINEPAKG-KKKSQIEEYLEYNNGPGVQHLALATEDIIHT  337

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLLQ  483
            +  MR R    G  F+   P TYY+NL+ R G +  +E +   ++LGILVDRDD+G LLQ
Sbjct  338  VSAMRAR----GTSFL-RVPDTYYENLEDRVGPI--EEDVAVLKDLGILVDRDDKGYLLQ  390

Query  482  IFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIEEYEK  312
            IFT+P+ DRPT FIEIIQR G                  FGKGNF  LF SIEE ++
Sbjct  391  IFTRPLTDRPTFFIEIIQRRGGF---------------SFGKGNFKALFVSIEEEQR  432



>ref|WP_041488236.1| 4-hydroxyphenylpyruvate dioxygenase, partial [Bacillus mycoides]
Length=359

 Score =   137 bits (345),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 105/173 (61%), Gaps = 24/173 (14%)
 Frame = -2

Query  842  TAESGLNSVVLANNDETVFLPLNEPVHGTKRKSQIQTYLEHNEGPGLQHLALTSEDIFRT  663
            T  S L S V+ N     F P+NEP  G KRKSQIQ YLE   G G+QHLAL + DI +T
Sbjct  202  TEYSALMSKVMTNGSRIKF-PINEPADG-KRKSQIQEYLEFYNGAGVQHLALLTNDIVKT  259

Query  662  LREMRNRSGIGGFEFMPSPPPTYYKNLKSRAGDVLSDEQIKECEELGILVDRDDQGTLLQ  483
            +  +R+     G EF+ +P  TYY+ L +R G +  DE+I + +EL ILVDRDD+G LLQ
Sbjct  260  VEALRS----NGVEFLDTPD-TYYEELTARVGKI--DEEIDKLKELKILVDRDDEGYLLQ  312

Query  482  IFTKPVGDRPTLFIEIIQRVGCMMKKEDGEVYQkggcggfgkGNFSELFKSIE  324
            IFTKP+ DRPTLFIEIIQR G     E               GNF  LF+SIE
Sbjct  313  IFTKPIVDRPTLFIEIIQRKGSRGFGE---------------GNFKALFESIE  350



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1840026230422