BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig4023

Length=952
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009759025.1|  PREDICTED: L-type lectin-domain containing r...    290   6e-92   Nicotiana sylvestris
ref|XP_004246363.1|  PREDICTED: L-type lectin-domain containing r...    266   1e-82   Solanum lycopersicum
ref|XP_006363087.1|  PREDICTED: L-type lectin-domain containing r...    265   3e-82   Solanum tuberosum [potatoes]
ref|XP_011094954.1|  PREDICTED: L-type lectin-domain containing r...    264   7e-82   Sesamum indicum [beniseed]
ref|XP_009621566.1|  PREDICTED: lectin-like protein At3g16530           263   1e-81   Nicotiana tomentosiformis
gb|EYU41819.1|  hypothetical protein MIMGU_mgv1a009026mg                263   1e-81   Erythranthe guttata [common monkey flower]
ref|XP_007026824.1|  Concanavalin A-like lectin family protein, p...    258   2e-79   
ref|XP_011019177.1|  PREDICTED: lectin-like protein At1g53070           256   5e-79   Populus euphratica
ref|XP_002308200.2|  alpha-amylase inhibitor alpha subunit family...    253   7e-78   Populus trichocarpa [western balsam poplar]
ref|XP_012087950.1|  PREDICTED: L-type lectin-domain containing r...    246   5e-75   Jatropha curcas
gb|KDO58027.1|  hypothetical protein CISIN_1g018168mg                   245   1e-74   Citrus sinensis [apfelsine]
ref|XP_006480935.1|  PREDICTED: L-type lectin-domain containing r...    245   2e-74   Citrus sinensis [apfelsine]
ref|XP_010672608.1|  PREDICTED: probable L-type lectin-domain con...    245   2e-74   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006429260.1|  hypothetical protein CICLE_v10012045mg             244   4e-74   Citrus clementina [clementine]
ref|XP_002527882.1|  Agglutinin-2 precursor, putative                   239   3e-72   Ricinus communis
gb|KJB36868.1|  hypothetical protein B456_006G179800                    234   2e-70   Gossypium raimondii
ref|XP_011009155.1|  PREDICTED: L-type lectin-domain containing r...    233   9e-70   Populus euphratica
ref|XP_002322948.1|  alpha-amylase inhibitor alpha subunit family...    231   4e-69   
ref|XP_010256728.1|  PREDICTED: L-type lectin-domain containing r...    226   2e-67   Nelumbo nucifera [Indian lotus]
emb|CDP06531.1|  unnamed protein product                                224   2e-66   Coffea canephora [robusta coffee]
ref|XP_009358820.1|  PREDICTED: L-type lectin-domain containing r...    223   2e-66   Pyrus x bretschneideri [bai li]
ref|XP_002276782.1|  PREDICTED: L-type lectin-domain containing r...    224   2e-66   Vitis vinifera
gb|KJB76858.1|  hypothetical protein B456_012G110400                    223   3e-66   Gossypium raimondii
emb|CDP14076.1|  unnamed protein product                                223   4e-66   Coffea canephora [robusta coffee]
ref|XP_004302660.1|  PREDICTED: L-type lectin-domain containing r...    218   3e-64   Fragaria vesca subsp. vesca
ref|XP_007009125.1|  Concanavalin A-like lectin family protein, p...    216   2e-63   
gb|EYU19968.1|  hypothetical protein MIMGU_mgv1a007272mg                218   2e-63   Erythranthe guttata [common monkey flower]
ref|XP_010262713.1|  PREDICTED: L-type lectin-domain containing r...    213   2e-62   Nelumbo nucifera [Indian lotus]
ref|XP_008370040.1|  PREDICTED: L-type lectin-domain containing r...    213   4e-62   Malus domestica [apple tree]
ref|XP_009370238.1|  PREDICTED: L-type lectin-domain containing r...    212   8e-62   Pyrus x bretschneideri [bai li]
ref|XP_011076752.1|  PREDICTED: L-type lectin-domain containing r...    210   5e-61   Sesamum indicum [beniseed]
ref|XP_008239852.1|  PREDICTED: L-type lectin-domain containing r...    209   6e-61   Prunus mume [ume]
ref|XP_007218209.1|  hypothetical protein PRUPE_ppa007818mg             209   1e-60   Prunus persica
gb|AFK44294.1|  unknown                                                 209   1e-60   Lotus japonicus
ref|XP_008233697.1|  PREDICTED: lectin-like protein LEC                 208   2e-60   Prunus mume [ume]
ref|XP_010101839.1|  putative inactive L-type lectin-domain conta...    205   3e-59   Morus notabilis
ref|XP_008388104.1|  PREDICTED: L-type lectin-domain containing r...    203   2e-58   
ref|XP_006435567.1|  hypothetical protein CICLE_v10031876mg             203   2e-58   Citrus clementina [clementine]
ref|XP_003552217.1|  PREDICTED: L-type lectin-domain containing r...    202   3e-58   Glycine max [soybeans]
gb|KHN08323.1|  L-type lectin-domain containing receptor kinase V...    202   4e-58   Glycine soja [wild soybean]
ref|XP_007140433.1|  hypothetical protein PHAVU_008G111500g             202   5e-58   Phaseolus vulgaris [French bean]
ref|XP_009344370.1|  PREDICTED: L-type lectin-domain containing r...    201   2e-57   Pyrus x bretschneideri [bai li]
ref|XP_008381923.1|  PREDICTED: L-type lectin-domain containing r...    200   3e-57   
ref|XP_009351458.1|  PREDICTED: galactose-binding lectin-like           199   9e-57   Pyrus x bretschneideri [bai li]
ref|XP_002280264.1|  PREDICTED: L-type lectin-domain containing r...    198   1e-56   Vitis vinifera
gb|KHN28781.1|  L-type lectin-domain containing receptor kinase V...    198   2e-56   Glycine soja [wild soybean]
ref|XP_007133954.1|  hypothetical protein PHAVU_010G006300g             196   7e-56   Phaseolus vulgaris [French bean]
gb|KJB78811.1|  hypothetical protein B456_013G020300                    196   1e-55   Gossypium raimondii
ref|XP_003529134.1|  PREDICTED: L-type lectin-domain containing r...    195   2e-55   Glycine max [soybeans]
gb|KJB74194.1|  hypothetical protein B456_011G278600                    194   4e-55   Gossypium raimondii
ref|XP_008367512.1|  PREDICTED: L-type lectin-domain containing r...    192   4e-54   Malus domestica [apple tree]
gb|KEH23081.1|  legume lectin beta domain protein                       191   7e-54   Medicago truncatula
ref|XP_006576579.1|  PREDICTED: L-type lectin-domain containing r...    190   1e-53   Glycine max [soybeans]
ref|XP_010690349.1|  PREDICTED: probable L-type lectin-domain con...    190   1e-53   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009777186.1|  PREDICTED: L-type lectin-domain containing r...    189   3e-53   Nicotiana sylvestris
ref|XP_004308913.1|  PREDICTED: lectin-like protein LEC                 189   3e-53   Fragaria vesca subsp. vesca
ref|XP_007205667.1|  hypothetical protein PRUPE_ppa009494mg             186   7e-53   
ref|XP_009596223.1|  PREDICTED: L-type lectin-domain containing r...    188   9e-53   Nicotiana tomentosiformis
ref|XP_003516924.1|  PREDICTED: L-type lectin-domain containing r...    187   1e-52   Glycine max [soybeans]
ref|XP_004492393.1|  PREDICTED: L-type lectin-domain containing r...    187   2e-52   Cicer arietinum [garbanzo]
gb|KHN26218.1|  L-type lectin-domain containing receptor kinase I.7     187   2e-52   Glycine soja [wild soybean]
emb|CBI30447.3|  unnamed protein product                                181   2e-51   Vitis vinifera
ref|XP_010037751.1|  PREDICTED: probable L-type lectin-domain con...    184   3e-51   
ref|XP_010067479.1|  PREDICTED: L-type lectin-domain containing r...    180   9e-50   Eucalyptus grandis [rose gum]
ref|XP_012088132.1|  PREDICTED: L-type lectin-domain containing r...    176   2e-48   Jatropha curcas
ref|XP_008448934.1|  PREDICTED: L-type lectin-domain containing r...    175   1e-47   Cucumis melo [Oriental melon]
ref|XP_011036078.1|  PREDICTED: L-type lectin-domain containing r...    174   2e-47   Populus euphratica
ref|XP_004147898.1|  PREDICTED: L-type lectin-domain containing r...    174   3e-47   Cucumis sativus [cucumbers]
ref|XP_006591367.1|  PREDICTED: L-type lectin-domain containing r...    174   3e-47   Glycine max [soybeans]
ref|XP_002316243.2|  hypothetical protein POPTR_0010s20190g             173   4e-47   Populus trichocarpa [western balsam poplar]
ref|XP_006601971.1|  PREDICTED: L-type lectin-domain containing r...    170   5e-46   Glycine max [soybeans]
ref|XP_007163496.1|  hypothetical protein PHAVU_001G239200g             168   3e-45   Phaseolus vulgaris [French bean]
ref|XP_004506648.1|  PREDICTED: L-type lectin-domain containing r...    167   1e-44   Cicer arietinum [garbanzo]
gb|ACJ84633.1|  unknown                                                 162   5e-44   Medicago truncatula
ref|XP_003604815.1|  Lectin                                             163   3e-43   Medicago truncatula
gb|ABK21031.1|  unknown                                                 159   1e-41   Picea sitchensis
ref|XP_010923163.1|  PREDICTED: L-type lectin-domain containing r...    158   2e-41   Elaeis guineensis
gb|KHN17863.1|  L-type lectin-domain containing receptor kinase S.4     153   2e-40   Glycine soja [wild soybean]
ref|XP_004503219.1|  PREDICTED: L-type lectin-domain containing r...    151   9e-39   Cicer arietinum [garbanzo]
ref|XP_003600834.1|  Lectin receptor kinase                             147   2e-37   Medicago truncatula
ref|XP_008785595.1|  PREDICTED: putative L-type lectin-domain con...    149   2e-37   Phoenix dactylifera
ref|NP_195729.1|  concanavalin A-like lectin                            146   5e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002530403.1|  carbohydrate binding protein, putative             145   7e-37   Ricinus communis
ref|XP_010553259.1|  PREDICTED: lectin-like protein At1g53070           144   4e-36   Tarenaya hassleriana [spider flower]
gb|AAM65643.1|  lectin-like protein                                     143   9e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010558351.1|  PREDICTED: L-type lectin-domain containing r...    142   1e-35   Tarenaya hassleriana [spider flower]
emb|CDX80792.1|  BnaC03g00460D                                          140   2e-35   
gb|AFK49110.1|  unknown                                                 140   6e-35   Lotus japonicus
ref|XP_010543888.1|  PREDICTED: L-type lectin-domain containing r...    140   9e-35   Tarenaya hassleriana [spider flower]
ref|XP_010468550.1|  PREDICTED: L-type lectin-domain containing r...    139   1e-34   Camelina sativa [gold-of-pleasure]
ref|XP_006398654.1|  hypothetical protein EUTSA_v10013972mg             138   5e-34   Eutrema salsugineum [saltwater cress]
ref|XP_010093501.1|  Lysine histidine transporter 1                     142   5e-34   
ref|XP_009412582.1|  PREDICTED: L-type lectin-domain containing r...    136   2e-33   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY11212.1|  BnaA03g00480D                                          136   2e-33   Brassica napus [oilseed rape]
ref|XP_009130668.1|  PREDICTED: L-type lectin-domain containing r...    136   2e-33   Brassica rapa
ref|XP_002873031.1|  legume lectin family protein                       135   4e-33   Arabidopsis lyrata subsp. lyrata
ref|XP_010486461.1|  PREDICTED: L-type lectin-domain containing r...    133   2e-32   Camelina sativa [gold-of-pleasure]
ref|XP_010452027.1|  PREDICTED: L-type lectin-domain containing r...    133   3e-32   Camelina sativa [gold-of-pleasure]
ref|XP_010464536.1|  PREDICTED: L-type lectin-domain containing r...    132   4e-32   Camelina sativa [gold-of-pleasure]
ref|XP_006288058.1|  hypothetical protein CARUB_v10001288mg             133   4e-32   Capsella rubella
ref|XP_010423913.1|  PREDICTED: L-type lectin-domain containing r...    132   6e-32   Camelina sativa [gold-of-pleasure]
ref|XP_002882602.1|  legume lectin family protein                       131   1e-31   
ref|XP_009125432.1|  PREDICTED: L-type lectin-domain containing r...    131   2e-31   Brassica rapa
emb|CDY55910.1|  BnaAnng14010D                                          131   2e-31   Brassica napus [oilseed rape]
ref|XP_010490607.1|  PREDICTED: L-type lectin-domain containing r...    130   4e-31   Camelina sativa [gold-of-pleasure]
gb|KFK24622.1|  hypothetical protein AALP_AA8G003000                    129   7e-31   Arabis alpina [alpine rockcress]
ref|XP_010530423.1|  PREDICTED: L-type lectin-domain containing r...    129   1e-30   Tarenaya hassleriana [spider flower]
emb|CDY48111.1|  BnaC02g03680D                                          128   2e-30   Brassica napus [oilseed rape]
gb|EPS72516.1|  hypothetical protein M569_02242                         126   6e-30   Genlisea aurea
ref|XP_009419741.1|  PREDICTED: L-type lectin-domain containing r...    126   1e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006296653.1|  hypothetical protein CARUB_v10015712mg             125   3e-29   Capsella rubella
gb|EPS65420.1|  hypothetical protein M569_09356                         117   2e-27   Genlisea aurea
ref|XP_004138574.1|  PREDICTED: uncharacterized protein LOC101219233    116   2e-26   Cucumis sativus [cucumbers]
gb|KGN45764.1|  hypothetical protein Csa_6G009430                       116   2e-26   Cucumis sativus [cucumbers]
gb|KFK38290.1|  hypothetical protein AALP_AA3G095000                    115   9e-26   Arabis alpina [alpine rockcress]
ref|XP_008441637.1|  PREDICTED: uncharacterized protein LOC103485717    113   3e-25   Cucumis melo [Oriental melon]
ref|XP_002884719.1|  hypothetical protein ARALYDRAFT_317721             112   7e-25   
gb|AAD56334.1|AC009326_21  putative lectin                              110   3e-24   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001154599.1|  putative lectin                                    110   5e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010676673.1|  PREDICTED: L-type lectin-domain containing r...    108   6e-24   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009407575.1|  PREDICTED: L-type lectin-domain containing r...    108   2e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006848043.1|  PREDICTED: L-type lectin-domain containing r...    108   2e-23   Amborella trichopoda
ref|XP_004987284.1|  PREDICTED: uncharacterized protein LOC101762725    107   3e-23   Setaria italica
ref|NP_683540.1|  concanavalin A-like lectin                            104   3e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010326006.1|  PREDICTED: LOW QUALITY PROTEIN: L-type lecti...    106   8e-22   
ref|XP_006361798.1|  PREDICTED: L-type lectin-domain containing r...    106   9e-22   Solanum tuberosum [potatoes]
emb|CDY07898.1|  BnaC03g36250D                                          103   1e-21   Brassica napus [oilseed rape]
ref|XP_010665938.1|  PREDICTED: L-type lectin-domain containing r...    100   2e-21   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009146954.1|  PREDICTED: uncharacterized protein LOC103870564    100   1e-20   Brassica rapa
emb|CDY53094.1|  BnaCnng24240D                                          100   1e-20   Brassica napus [oilseed rape]
ref|XP_009135075.1|  PREDICTED: probable L-type lectin-domain con...  97.4    9e-20   Brassica rapa
emb|CDX73952.1|  BnaA03g30950D                                        96.3    3e-19   
ref|XP_012082318.1|  PREDICTED: L-type lectin-domain containing r...  98.6    3e-19   Jatropha curcas
emb|CDY44678.1|  BnaA05g29280D                                        95.9    3e-19   Brassica napus [oilseed rape]
ref|XP_010486478.1|  PREDICTED: lectin-like                           95.1    5e-19   Camelina sativa [gold-of-pleasure]
ref|XP_008343599.1|  PREDICTED: L-type lectin-domain containing r...  95.1    8e-19   
ref|XP_006664666.1|  PREDICTED: L-type lectin-domain containing r...  96.7    1e-18   
gb|EAZ36652.1|  hypothetical protein OsJ_20996                        96.7    1e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011097757.1|  PREDICTED: probable L-type lectin-domain con...  95.9    2e-18   Sesamum indicum [beniseed]
ref|XP_010253592.1|  PREDICTED: L-type lectin-domain containing r...  95.9    2e-18   Nelumbo nucifera [Indian lotus]
ref|XP_004249497.1|  PREDICTED: L-type lectin-domain containing r...  95.5    3e-18   
ref|XP_003522123.1|  PREDICTED: L-type lectin-domain containing r...  95.1    4e-18   
ref|XP_006339063.1|  PREDICTED: L-type lectin-domain containing r...  94.7    6e-18   Solanum tuberosum [potatoes]
ref|XP_010469992.1|  PREDICTED: uncharacterized protein LOC104749...  91.7    6e-18   Camelina sativa [gold-of-pleasure]
ref|XP_007140498.1|  hypothetical protein PHAVU_008G117700g           94.0    9e-18   Phaseolus vulgaris [French bean]
ref|XP_008352564.1|  PREDICTED: L-type lectin-domain containing r...  94.0    9e-18   Malus domestica [apple tree]
ref|XP_010469926.1|  PREDICTED: truncated lectin 2-like isoform X1    91.7    9e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010464556.1|  PREDICTED: truncated lectin 2-like               91.7    9e-18   Camelina sativa [gold-of-pleasure]
ref|XP_009345528.1|  PREDICTED: L-type lectin-domain containing r...  94.0    1e-17   Pyrus x bretschneideri [bai li]
ref|XP_003561539.1|  PREDICTED: L-type lectin-domain containing r...  91.3    1e-17   Brachypodium distachyon [annual false brome]
ref|XP_011004619.1|  PREDICTED: L-type lectin-domain containing r...  93.6    1e-17   Populus euphratica
ref|XP_011016637.1|  PREDICTED: L-type lectin-domain containing r...  93.6    1e-17   Populus euphratica
ref|XP_009767145.1|  PREDICTED: L-type lectin-domain containing r...  93.2    1e-17   Nicotiana sylvestris
ref|XP_011085039.1|  PREDICTED: L-type lectin-domain containing r...  93.2    2e-17   Sesamum indicum [beniseed]
ref|XP_011004732.1|  PREDICTED: L-type lectin-domain containing r...  93.2    2e-17   Populus euphratica
ref|XP_008370413.1|  PREDICTED: LOW QUALITY PROTEIN: L-type lecti...  92.8    2e-17   
gb|EYU43389.1|  hypothetical protein MIMGU_mgv1a019420mg              92.8    2e-17   Erythranthe guttata [common monkey flower]
ref|XP_006381477.1|  hypothetical protein POPTR_0006s13200g           92.8    2e-17   
gb|ERN08003.1|  hypothetical protein AMTR_s00012p00255610             91.3    2e-17   Amborella trichopoda
gb|KHN46198.1|  Putative L-type lectin-domain containing receptor...  92.4    3e-17   Glycine soja [wild soybean]
ref|XP_003519228.2|  PREDICTED: L-type lectin-domain containing r...  92.4    3e-17   Glycine max [soybeans]
ref|XP_003595897.1|  50S ribosomal protein L5                         85.1    3e-17   
ref|XP_009343780.1|  PREDICTED: L-type lectin-domain containing r...  92.4    3e-17   Pyrus x bretschneideri [bai li]
ref|XP_008239353.1|  PREDICTED: L-type lectin-domain containing r...  92.0    4e-17   Prunus mume [ume]
ref|XP_007204963.1|  hypothetical protein PRUPE_ppa002125mg           92.0    4e-17   Prunus persica
ref|XP_002323460.2|  hypothetical protein POPTR_0016s08920g           92.0    4e-17   
ref|XP_004965240.1|  PREDICTED: probable L-type lectin-domain con...  91.7    5e-17   Setaria italica
ref|XP_008362700.1|  PREDICTED: L-type lectin-domain containing r...  91.7    6e-17   
gb|KHN40023.1|  Putative L-type lectin-domain containing receptor...  90.9    6e-17   Glycine soja [wild soybean]
gb|KHN04724.1|  L-type lectin-domain containing receptor kinase S.4   91.3    8e-17   Glycine soja [wild soybean]
ref|XP_003537433.1|  PREDICTED: L-type lectin-domain containing r...  90.9    8e-17   Glycine max [soybeans]
ref|XP_010264749.1|  PREDICTED: L-type lectin-domain containing r...  90.9    8e-17   Nelumbo nucifera [Indian lotus]
ref|NP_001057404.1|  Os06g0285400                                     90.9    9e-17   
ref|XP_011094691.1|  PREDICTED: L-type lectin-domain containing r...  90.9    9e-17   Sesamum indicum [beniseed]
gb|KFK35122.1|  hypothetical protein AALP_AA5G239200                  91.3    9e-17   Arabis alpina [alpine rockcress]
gb|EAZ00546.1|  hypothetical protein OsI_22565                        90.9    1e-16   Oryza sativa Indica Group [Indian rice]
gb|KDO48105.1|  hypothetical protein CISIN_1g043702mg                 90.9    1e-16   Citrus sinensis [apfelsine]
ref|XP_008233650.1|  PREDICTED: L-type lectin-domain containing r...  90.9    1e-16   Prunus mume [ume]
ref|XP_010262573.1|  PREDICTED: L-type lectin-domain containing r...  90.5    1e-16   Nelumbo nucifera [Indian lotus]
ref|XP_003544276.2|  PREDICTED: L-type lectin-domain containing r...  90.5    1e-16   Glycine max [soybeans]
tpg|DAA52232.1|  TPA: putative lectin-like receptor protein kinas...  90.5    1e-16   
ref|XP_006428827.1|  hypothetical protein CICLE_v10011186mg           90.5    1e-16   Citrus clementina [clementine]
ref|NP_001147835.1|  lectin-like receptor kinase 7 precursor          90.5    1e-16   
ref|XP_002315211.2|  hypothetical protein POPTR_0010s20820g           90.5    1e-16   
ref|XP_003552190.1|  PREDICTED: L-type lectin-domain containing r...  90.5    1e-16   Glycine max [soybeans]
ref|XP_012088795.1|  PREDICTED: L-type lectin-domain containing r...  90.5    1e-16   Jatropha curcas
ref|XP_006480641.1|  PREDICTED: L-type lectin-domain containing r...  90.1    2e-16   Citrus sinensis [apfelsine]
ref|XP_007146994.1|  hypothetical protein PHAVU_006G087700g           90.1    2e-16   Phaseolus vulgaris [French bean]
ref|XP_009598151.1|  PREDICTED: L-type lectin-domain containing r...  90.1    2e-16   Nicotiana tomentosiformis
gb|EMS45030.1|  L-type lectin-domain containing receptor kinase S.4   87.8    2e-16   Triticum urartu
ref|XP_004960359.1|  PREDICTED: L-type lectin-domain containing r...  90.1    2e-16   Setaria italica
ref|XP_009358152.1|  PREDICTED: L-type lectin-domain containing r...  90.1    2e-16   Pyrus x bretschneideri [bai li]
ref|XP_009358154.1|  PREDICTED: L-type lectin-domain containing r...  90.1    2e-16   Pyrus x bretschneideri [bai li]
ref|XP_003615494.1|  Lectin-domain containing receptor kinase A4.2    90.1    2e-16   Medicago truncatula
ref|XP_011624178.1|  PREDICTED: uncharacterized protein LOC18436240   90.1    2e-16   
ref|XP_003563783.1|  PREDICTED: L-type lectin-domain containing r...  89.7    2e-16   Brachypodium distachyon [annual false brome]
ref|XP_010047912.1|  PREDICTED: L-type lectin-domain containing r...  89.7    2e-16   Eucalyptus grandis [rose gum]
ref|XP_007134058.1|  hypothetical protein PHAVU_010G015800g           89.7    2e-16   Phaseolus vulgaris [French bean]
ref|XP_002436886.1|  hypothetical protein SORBIDRAFT_10g010530        89.4    3e-16   Sorghum bicolor [broomcorn]
ref|XP_002441537.1|  hypothetical protein SORBIDRAFT_09g028880        89.4    3e-16   
ref|XP_002461416.1|  hypothetical protein SORBIDRAFT_02g002290        89.7    3e-16   
gb|KJB13892.1|  hypothetical protein B456_002G100600                  89.4    3e-16   Gossypium raimondii
ref|XP_004962683.1|  PREDICTED: L-type lectin-domain containing r...  89.4    3e-16   Setaria italica
ref|XP_004966927.1|  PREDICTED: L-type lectin-domain containing r...  89.0    4e-16   
ref|XP_008363824.1|  PREDICTED: L-type lectin-domain containing r...  89.0    4e-16   
ref|XP_009342662.1|  PREDICTED: L-type lectin-domain containing r...  89.0    4e-16   Pyrus x bretschneideri [bai li]
ref|XP_008345505.1|  PREDICTED: L-type lectin-domain containing r...  86.7    4e-16   
ref|XP_007163432.1|  hypothetical protein PHAVU_001G234200g           88.6    5e-16   Phaseolus vulgaris [French bean]
ref|XP_004296332.2|  PREDICTED: probable L-type lectin-domain con...  88.6    5e-16   Fragaria vesca subsp. vesca
ref|XP_009600218.1|  PREDICTED: probable L-type lectin-domain con...  88.6    5e-16   Nicotiana tomentosiformis
ref|XP_002873076.1|  lectin protein kinase family protein             88.6    5e-16   
ref|XP_008387614.1|  PREDICTED: L-type lectin-domain containing r...  88.6    5e-16   
ref|XP_010107566.1|  L-type lectin-domain containing receptor kin...  88.6    6e-16   Morus notabilis
emb|CDP13714.1|  unnamed protein product                              88.6    6e-16   Coffea canephora [robusta coffee]
ref|XP_010910689.1|  PREDICTED: L-type lectin-domain containing r...  88.6    6e-16   Elaeis guineensis
ref|XP_002532997.1|  kinase, putative                                 88.2    7e-16   
ref|XP_002278015.1|  PREDICTED: L-type lectin-domain containing r...  88.2    7e-16   Vitis vinifera
gb|ACR36638.1|  unknown                                               87.8    8e-16   Zea mays [maize]
ref|XP_011002636.1|  PREDICTED: L-type lectin-domain containing r...  87.8    8e-16   Populus euphratica
ref|XP_007141356.1|  hypothetical protein PHAVU_008G188700g           87.8    9e-16   Phaseolus vulgaris [French bean]
ref|XP_006355698.1|  PREDICTED: L-type lectin-domain containing r...  87.8    9e-16   Solanum tuberosum [potatoes]
gb|AAF21775.1|AF068135_1  receptor-like protein kinase                85.1    9e-16   Glycine max [soybeans]
ref|XP_011002638.1|  PREDICTED: L-type lectin-domain containing r...  87.8    1e-15   Populus euphratica
ref|XP_003530219.1|  PREDICTED: L-type lectin-domain containing r...  87.8    1e-15   Glycine max [soybeans]
gb|KHN40279.1|  L-type lectin-domain containing receptor kinase S.4   87.8    1e-15   Glycine soja [wild soybean]
ref|XP_007208330.1|  hypothetical protein PRUPE_ppa002400mg           87.8    1e-15   Prunus persica
ref|XP_002275244.1|  PREDICTED: L-type lectin-domain containing r...  87.8    1e-15   Vitis vinifera
ref|XP_010678077.1|  PREDICTED: L-type lectin-domain containing r...  87.8    1e-15   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001147947.1|  lectin-like receptor kinase 7 precursor          87.8    1e-15   Zea mays [maize]
ref|XP_007220215.1|  hypothetical protein PRUPE_ppa002277mg           87.4    1e-15   Prunus persica
ref|XP_007020488.1|  Concanavalin A-like lectin protein kinase fa...  87.4    1e-15   
gb|EYU41620.1|  hypothetical protein MIMGU_mgv1a002074mg              87.4    1e-15   Erythranthe guttata [common monkey flower]
ref|XP_004308846.1|  PREDICTED: L-type lectin-domain containing r...  87.4    1e-15   Fragaria vesca subsp. vesca
ref|XP_010068014.1|  PREDICTED: L-type lectin-domain containing r...  87.0    1e-15   Eucalyptus grandis [rose gum]
ref|XP_006435643.1|  hypothetical protein CICLE_v10030854mg           87.4    1e-15   Citrus clementina [clementine]
gb|KDO69144.1|  hypothetical protein CISIN_1g005621mg                 87.0    1e-15   Citrus sinensis [apfelsine]
ref|XP_008368692.1|  PREDICTED: L-type lectin-domain containing r...  87.0    2e-15   
gb|EEE67461.1|  hypothetical protein OsJ_24851                        87.0    2e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006486395.1|  PREDICTED: L-type lectin-domain containing r...  87.0    2e-15   Citrus sinensis [apfelsine]
ref|XP_006289498.1|  hypothetical protein CARUB_v10003045mg           87.0    2e-15   Capsella rubella
dbj|BAC06927.1|  putative receptor-type protein kinase LRK1           87.0    2e-15   Oryza sativa Japonica Group [Japonica rice]
ref|NP_195934.1|  concanavalin A-like lectin kinase-like protein      87.0    2e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004491661.1|  PREDICTED: probable L-type lectin-domain con...  87.0    2e-15   Cicer arietinum [garbanzo]
ref|XP_002463621.1|  hypothetical protein SORBIDRAFT_01g003030        87.0    2e-15   
ref|XP_002443408.1|  hypothetical protein SORBIDRAFT_08g019050        87.0    2e-15   Sorghum bicolor [broomcorn]
ref|XP_010251103.1|  PREDICTED: L-type lectin-domain containing r...  87.0    2e-15   Nelumbo nucifera [Indian lotus]
ref|XP_004490792.1|  PREDICTED: L-type lectin-domain containing r...  87.0    2e-15   
ref|XP_003552886.2|  PREDICTED: L-type lectin-domain containing r...  87.0    2e-15   Glycine max [soybeans]
gb|EMT31278.1|  hypothetical protein F775_03923                       84.7    2e-15   
dbj|BAG68210.1|  lectin receptor kinase-like protein                  86.7    2e-15   Nicotiana benthamiana
ref|XP_006398761.1|  hypothetical protein EUTSA_v10015744mg           86.7    2e-15   
ref|XP_009757287.1|  PREDICTED: L-type lectin-domain containing r...  86.7    2e-15   Nicotiana sylvestris
ref|NP_001141437.1|  uncharacterized LOC100273547 precursor           86.7    2e-15   Zea mays [maize]
gb|EEE62176.1|  hypothetical protein OsJ_16963                        86.7    2e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011077362.1|  PREDICTED: L-type lectin-domain containing r...  86.7    2e-15   Sesamum indicum [beniseed]
ref|XP_003616189.1|  Lectin receptor kinase-like protein              86.7    2e-15   Medicago truncatula
gb|EYU27977.1|  hypothetical protein MIMGU_mgv1a017881mg              86.7    2e-15   Erythranthe guttata [common monkey flower]
emb|CDY53688.1|  BnaA07g37820D                                        85.9    2e-15   Brassica napus [oilseed rape]
ref|XP_009784552.1|  PREDICTED: probable L-type lectin-domain con...  86.7    2e-15   Nicotiana sylvestris
ref|XP_010907811.1|  PREDICTED: L-type lectin-domain containing r...  86.7    2e-15   
ref|XP_009601141.1|  PREDICTED: L-type lectin-domain containing r...  86.7    2e-15   Nicotiana tomentosiformis
ref|XP_010452173.1|  PREDICTED: L-type lectin-domain containing r...  86.7    2e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010423755.1|  PREDICTED: L-type lectin-domain containing r...  86.7    3e-15   Camelina sativa [gold-of-pleasure]
ref|XP_008790453.1|  PREDICTED: L-type lectin-domain containing r...  86.3    3e-15   Phoenix dactylifera
ref|XP_010490781.1|  PREDICTED: L-type lectin-domain containing r...  86.7    3e-15   Camelina sativa [gold-of-pleasure]
ref|XP_004305188.1|  PREDICTED: L-type lectin-domain containing r...  86.3    3e-15   Fragaria vesca subsp. vesca
ref|XP_010696405.1|  PREDICTED: L-type lectin-domain containing r...  86.7    3e-15   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009419708.1|  PREDICTED: L-type lectin-domain containing r...  86.3    3e-15   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFW77019.1|  putative lectin-like receptor protein kinase fami...  86.3    3e-15   
ref|XP_002461845.1|  hypothetical protein SORBIDRAFT_02g009160        86.3    3e-15   
ref|XP_007009266.1|  Concanavalin A-like lectin protein kinase fa...  86.3    3e-15   
ref|XP_010262575.1|  PREDICTED: L-type lectin-domain containing r...  86.3    3e-15   Nelumbo nucifera [Indian lotus]
ref|NP_001168373.1|  uncharacterized protein LOC100382142 precursor   86.3    3e-15   Zea mays [maize]
ref|XP_008789069.1|  PREDICTED: L-type lectin-domain containing r...  86.3    3e-15   Phoenix dactylifera
ref|XP_004235037.1|  PREDICTED: L-type lectin-domain containing r...  86.3    3e-15   Solanum lycopersicum
ref|XP_003537463.2|  PREDICTED: L-type lectin-domain containing r...  86.3    3e-15   Glycine max [soybeans]
gb|EYU38525.1|  hypothetical protein MIMGU_mgv1a002022mg              86.3    3e-15   Erythranthe guttata [common monkey flower]
gb|KJB62490.1|  hypothetical protein B456_009G419200                  85.9    4e-15   Gossypium raimondii
ref|XP_002451987.1|  hypothetical protein SORBIDRAFT_04g012281        85.9    4e-15   
ref|XP_008219839.1|  PREDICTED: probable L-type lectin-domain con...  85.9    4e-15   
gb|EEC82314.1|  hypothetical protein OsI_26590                        85.9    4e-15   
gb|ERN03879.1|  hypothetical protein AMTR_s00078p00169690             85.9    4e-15   
ref|XP_009105530.1|  PREDICTED: L-type lectin-domain containing r...  85.9    4e-15   
ref|XP_011622567.1|  PREDICTED: L-type lectin-domain containing r...  85.9    4e-15   
ref|XP_010061451.1|  PREDICTED: probable L-type lectin-domain con...  85.9    4e-15   
ref|XP_009778121.1|  PREDICTED: L-type lectin-domain containing r...  85.5    5e-15   
ref|XP_003544355.2|  PREDICTED: L-type lectin-domain containing r...  85.5    5e-15   
ref|XP_003571823.1|  PREDICTED: L-type lectin-domain containing r...  85.5    5e-15   
gb|KJB81615.1|  hypothetical protein B456_013G152300                  85.5    5e-15   
ref|XP_008777366.1|  PREDICTED: L-type lectin-domain containing r...  85.5    5e-15   
ref|XP_006656888.1|  PREDICTED: probable L-type lectin-domain con...  85.5    6e-15   
ref|NP_001054518.1|  Os05g0125200                                     85.5    6e-15   
ref|XP_009787790.1|  PREDICTED: L-type lectin-domain containing r...  85.5    6e-15   
ref|XP_002978395.1|  hypothetical protein SELMODRAFT_15694            81.6    7e-15   
ref|XP_002316778.1|  lectin protein kinase                            85.1    7e-15   
ref|XP_002878038.1|  hypothetical protein ARALYDRAFT_906979           85.1    7e-15   
gb|EEC78435.1|  hypothetical protein OsI_18274                        85.1    7e-15   
ref|XP_004306238.1|  PREDICTED: L-type lectin-domain containing r...  85.1    8e-15   
emb|CDP06721.1|  unnamed protein product                              85.1    8e-15   
gb|ERN01302.1|  hypothetical protein AMTR_s00002p00253940             84.0    8e-15   
ref|XP_009350448.1|  PREDICTED: L-type lectin-domain containing r...  85.1    8e-15   
ref|XP_009352912.1|  PREDICTED: L-type lectin-domain containing r...  84.7    8e-15   
ref|XP_007027285.1|  Concanavalin A-like lectin protein kinase fa...  84.7    9e-15   
emb|CDX80852.1|  BnaC03g01060D                                        84.7    1e-14   
ref|XP_010507460.1|  PREDICTED: L-type lectin-domain containing r...  84.7    1e-14   
ref|XP_010558268.1|  PREDICTED: L-type lectin-domain containing r...  84.7    1e-14   
emb|CDM84607.1|  unnamed protein product                              84.3    1e-14   
ref|XP_008449055.1|  PREDICTED: probable L-type lectin-domain con...  84.3    1e-14   
gb|KFK24766.1|  hypothetical protein AALP_AA8G022200                  84.3    1e-14   
ref|XP_010431375.1|  PREDICTED: L-type lectin-domain containing r...  84.3    1e-14   
emb|CDY60320.1|  BnaCnng35990D                                        83.6    1e-14   
ref|XP_010046756.1|  PREDICTED: L-type lectin-domain containing r...  84.3    1e-14   
emb|CDP00126.1|  unnamed protein product                              84.3    1e-14   
ref|XP_007141948.1|  hypothetical protein PHAVU_008G239600g           84.3    1e-14   
gb|EPS66505.1|  lectin receptor kinase-like protein                   84.3    1e-14   
ref|XP_010262582.1|  PREDICTED: L-type lectin-domain containing r...  84.0    1e-14   
gb|EYU41755.1|  hypothetical protein MIMGU_mgv1a026896mg              84.0    1e-14   
ref|XP_010096605.1|  L-type lectin-domain containing receptor kin...  84.0    1e-14   
emb|CDY11240.1|  BnaA03g00760D                                        84.0    1e-14   
ref|XP_010065281.1|  PREDICTED: L-type lectin-domain containing r...  84.0    1e-14   
gb|KCW62715.1|  hypothetical protein EUGRSUZ_G00291                   84.0    1e-14   
ref|XP_004148283.1|  PREDICTED: probable L-type lectin-domain con...  84.0    1e-14   
ref|XP_006403447.1|  hypothetical protein EUTSA_v10011011mg           84.0    2e-14   
ref|XP_010033699.1|  PREDICTED: L-type lectin-domain containing r...  84.0    2e-14   
ref|XP_009596657.1|  PREDICTED: L-type lectin-domain containing r...  84.0    2e-14   
ref|XP_009780725.1|  PREDICTED: L-type lectin-domain containing r...  84.0    2e-14   
ref|XP_002534540.1|  carbohydrate binding protein, putative           84.0    2e-14   
ref|XP_003552868.2|  PREDICTED: L-type lectin-domain containing r...  84.0    2e-14   
gb|ABK24581.1|  unknown                                               84.0    2e-14   
ref|XP_006654946.1|  PREDICTED: uncharacterized protein LOC102699590  84.3    2e-14   
gb|KCW53420.1|  hypothetical protein EUGRSUZ_J02660                   84.0    2e-14   
gb|EAY83613.1|  hypothetical protein OsI_38835                        84.0    2e-14   
gb|ABA98991.1|  Protein kinase domain containing protein, expressed   84.0    2e-14   
ref|XP_008240558.1|  PREDICTED: L-type lectin-domain containing r...  84.0    2e-14   
ref|XP_002970236.1|  hypothetical protein SELMODRAFT_15696            80.1    2e-14   
ref|XP_002312109.2|  hypothetical protein POPTR_0008s05860g           83.6    2e-14   
ref|XP_009130728.1|  PREDICTED: L-type lectin-domain containing r...  84.0    2e-14   
gb|KCW62702.1|  hypothetical protein EUGRSUZ_G00265                   83.6    2e-14   
ref|XP_009347937.1|  PREDICTED: L-type lectin-domain containing r...  83.6    2e-14   
ref|XP_010412787.1|  PREDICTED: L-type lectin-domain containing r...  83.6    2e-14   
ref|XP_006347533.1|  PREDICTED: L-type lectin-domain containing r...  83.6    2e-14   
ref|XP_009785450.1|  PREDICTED: L-type lectin-domain containing r...  83.6    2e-14   
ref|XP_010028188.1|  PREDICTED: L-type lectin-domain containing r...  83.6    2e-14   
ref|XP_002461414.1|  hypothetical protein SORBIDRAFT_02g002250        83.6    2e-14   
ref|XP_010033698.1|  PREDICTED: L-type lectin-domain containing r...  83.6    2e-14   
ref|XP_010227759.1|  PREDICTED: probable L-type lectin-domain con...  83.6    2e-14   
ref|XP_009623953.1|  PREDICTED: L-type lectin-domain containing r...  83.6    2e-14   
gb|EMT31034.1|  Lectin-domain containing receptor kinase A4.3         83.2    3e-14   
ref|XP_002524205.1|  kinase, putative                                 83.6    3e-14   
ref|XP_008649309.1|  PREDICTED: probable L-type lectin-domain con...  83.2    3e-14   
gb|KCW53417.1|  hypothetical protein EUGRSUZ_J02657                   83.2    3e-14   
ref|XP_011094895.1|  PREDICTED: L-type lectin-domain containing r...  83.2    3e-14   
ref|XP_010088604.1|  L-type lectin-domain containing receptor kin...  83.2    3e-14   
ref|XP_010918284.1|  PREDICTED: L-type lectin-domain containing r...  83.2    3e-14   
ref|XP_004981233.1|  PREDICTED: L-type lectin-domain containing r...  83.2    3e-14   
gb|ERN08000.1|  hypothetical protein AMTR_s00012p00255460             83.2    3e-14   
ref|XP_007206547.1|  hypothetical protein PRUPE_ppa018868mg           83.2    3e-14   
ref|XP_003571821.1|  PREDICTED: L-type lectin-domain containing r...  83.2    3e-14   
ref|XP_010671293.1|  PREDICTED: probable L-type lectin-domain con...  83.2    3e-14   
ref|XP_006290450.1|  hypothetical protein CARUB_v10019451mg           83.2    3e-14   
ref|XP_002520526.1|  kinase, putative                                 82.8    3e-14   
ref|XP_010937820.1|  PREDICTED: L-type lectin-domain containing r...  83.2    3e-14   
ref|XP_010088439.1|  putative L-type lectin-domain containing rec...  82.8    3e-14   
ref|XP_008349397.1|  PREDICTED: LOW QUALITY PROTEIN: probable L-t...  82.4    4e-14   
emb|CDY44740.1|  BnaC09g22400D                                        82.8    4e-14   
ref|XP_008384223.1|  PREDICTED: probable L-type lectin-domain con...  82.8    4e-14   
ref|XP_004239908.1|  PREDICTED: L-type lectin-domain containing r...  82.8    4e-14   
ref|XP_010066063.1|  PREDICTED: L-type lectin-domain containing r...  82.4    4e-14   
gb|EMS50918.1|  L-type lectin-domain containing receptor kinase IV.2  82.4    5e-14   
ref|XP_004955417.1|  PREDICTED: L-type lectin-domain containing r...  82.8    5e-14   
ref|XP_010999803.1|  PREDICTED: L-type lectin-domain containing r...  82.4    5e-14   
ref|XP_012074984.1|  PREDICTED: L-type lectin-domain containing r...  82.4    5e-14   
ref|NP_001058830.1|  Os07g0131100                                     82.4    5e-14   
ref|XP_008370432.1|  PREDICTED: L-type lectin-domain containing r...  82.4    5e-14   
ref|XP_008785542.1|  PREDICTED: L-type lectin-domain containing r...  82.4    5e-14   
gb|KJB16820.1|  hypothetical protein B456_002G249200                  82.4    5e-14   
ref|NP_191114.1|  concanavalin A-like lectin protein kinase famil...  82.4    5e-14   
ref|XP_006836473.1|  PREDICTED: L-type lectin-domain containing r...  82.4    5e-14   
ref|XP_008442670.1|  PREDICTED: L-type lectin-domain containing r...  82.4    5e-14   
ref|XP_010923241.1|  PREDICTED: L-type lectin-domain containing r...  82.4    5e-14   
ref|XP_002519607.1|  serine-threonine protein kinase, plant-type,...  82.4    6e-14   
ref|XP_003545982.1|  PREDICTED: L-type lectin-domain containing r...  82.4    6e-14   
ref|XP_002463620.1|  hypothetical protein SORBIDRAFT_01g003020        82.0    6e-14   
gb|EMT18019.1|  Lectin-domain containing receptor kinase A4.3         82.0    6e-14   
ref|XP_006363072.1|  PREDICTED: L-type lectin-domain containing r...  82.0    6e-14   
ref|XP_009412973.1|  PREDICTED: L-type lectin-domain containing r...  82.0    7e-14   
gb|KEH22963.1|  L-type lectin-domain receptor kinase S.4              82.0    7e-14   
ref|NP_172226.1|  Concanavalin A-like lectin family protein           79.3    7e-14   
ref|XP_010037806.1|  PREDICTED: L-type lectin-domain containing r...  82.0    7e-14   
ref|XP_010936301.1|  PREDICTED: L-type lectin-domain containing r...  82.0    7e-14   
ref|XP_006432462.1|  hypothetical protein CICLE_v10003932mg           81.6    8e-14   
ref|XP_007210090.1|  hypothetical protein PRUPE_ppa020779mg           81.6    8e-14   
ref|XP_010262572.1|  PREDICTED: L-type lectin-domain containing r...  81.6    8e-14   
gb|KCW49547.1|  hypothetical protein EUGRSUZ_K03066                   82.0    8e-14   
ref|XP_010691022.1|  PREDICTED: L-type lectin-domain containing r...  81.6    8e-14   
gb|KEH22964.1|  L-type lectin-domain receptor kinase S.4              81.6    8e-14   
gb|KDP35670.1|  hypothetical protein JCGZ_09108                       81.6    8e-14   
ref|XP_006407707.1|  hypothetical protein EUTSA_v10022097mg           79.0    9e-14   
emb|CDX76086.1|  BnaA04g03500D                                        81.6    9e-14   
ref|XP_006396450.1|  hypothetical protein EUTSA_v10028492mg           81.6    9e-14   
ref|XP_009139350.1|  PREDICTED: L-type lectin-domain containing r...  81.6    9e-14   
ref|XP_004490524.1|  PREDICTED: L-type lectin-domain containing r...  81.6    9e-14   
ref|XP_012075029.1|  PREDICTED: L-type lectin-domain containing r...  81.6    9e-14   
gb|KDO56520.1|  hypothetical protein CISIN_1g048419mg                 81.6    9e-14   
ref|XP_004137813.1|  PREDICTED: L-type lectin-domain containing r...  81.6    9e-14   
ref|XP_010262576.1|  PREDICTED: L-type lectin-domain containing r...  81.6    1e-13   
gb|KCW74968.1|  hypothetical protein EUGRSUZ_E03712                   81.6    1e-13   
ref|XP_002517905.1|  kinase, putative                                 81.6    1e-13   
gb|KCW62712.1|  hypothetical protein EUGRSUZ_G00286                   81.3    1e-13   
ref|XP_008238770.1|  PREDICTED: L-type lectin-domain containing r...  81.3    1e-13   
gb|KHN35248.1|  Putative L-type lectin-domain containing receptor...  81.3    1e-13   
ref|XP_002872841.1|  lectin protein kinase family protein             81.3    1e-13   
gb|ABU75307.2|  lectin kinase                                         81.3    1e-13   
ref|XP_010230082.1|  PREDICTED: L-type lectin-domain containing r...  81.3    1e-13   
ref|XP_003526280.1|  PREDICTED: probable L-type lectin-domain con...  81.3    1e-13   
ref|XP_003543044.1|  PREDICTED: L-type lectin-domain containing r...  81.3    1e-13   
ref|XP_006363073.1|  PREDICTED: L-type lectin-domain containing r...  81.3    1e-13   
ref|XP_010262574.1|  PREDICTED: L-type lectin-domain containing r...  81.3    1e-13   
ref|XP_004952520.1|  PREDICTED: L-type lectin-domain containing r...  81.6    1e-13   
ref|XP_011075871.1|  PREDICTED: L-type lectin-domain containing r...  81.3    1e-13   
ref|XP_010045325.1|  PREDICTED: probable L-type lectin-domain con...  81.3    1e-13   
ref|XP_011044913.1|  PREDICTED: probable L-type lectin-domain con...  81.3    1e-13   
gb|KCW88596.1|  hypothetical protein EUGRSUZ_A00972                   81.3    1e-13   
ref|XP_004246354.1|  PREDICTED: L-type lectin-domain containing r...  81.3    1e-13   
ref|XP_010262895.1|  PREDICTED: L-type lectin-domain containing r...  81.3    1e-13   
ref|XP_006664061.1|  PREDICTED: L-type lectin-domain containing r...  81.3    1e-13   
ref|XP_003562843.2|  PREDICTED: uncharacterized protein LOC100846686  81.3    1e-13   
ref|XP_004959787.1|  PREDICTED: uncharacterized protein LOC101759149  81.3    1e-13   
ref|XP_006493279.1|  PREDICTED: L-type lectin-domain containing r...  80.9    1e-13   
emb|CDY02947.1|  BnaC04g25390D                                        80.9    2e-13   
dbj|BAJ99781.1|  predicted protein                                    80.9    2e-13   
ref|XP_003581453.1|  PREDICTED: L-type lectin-domain containing r...  80.9    2e-13   
ref|XP_009599176.1|  PREDICTED: L-type lectin-domain containing r...  80.9    2e-13   
ref|XP_006403697.1|  hypothetical protein EUTSA_v10010158mg           80.9    2e-13   
ref|XP_008383731.1|  PREDICTED: L-type lectin-domain containing r...  80.9    2e-13   
emb|CDP17277.1|  unnamed protein product                              80.9    2e-13   
emb|CDP21076.1|  unnamed protein product                              80.9    2e-13   
emb|CDP14355.1|  unnamed protein product                              80.5    2e-13   
ref|XP_009354482.1|  PREDICTED: L-type lectin-domain containing r...  77.4    2e-13   
ref|XP_009348050.1|  PREDICTED: probable L-type lectin-domain con...  80.5    2e-13   
ref|XP_002877915.1|  lectin protein kinase family protein             80.5    2e-13   
gb|KHN39200.1|  L-type lectin-domain containing receptor kinase S.4   80.5    2e-13   
ref|XP_003592149.1|  Cysteine-rich receptor-like protein kinase       80.5    2e-13   
ref|XP_002467568.1|  hypothetical protein SORBIDRAFT_01g030300        80.5    2e-13   
ref|XP_010515827.1|  PREDICTED: L-type lectin-domain containing r...  80.5    2e-13   
gb|ACL36482.1|  lectin receptor-type kinase                           80.5    2e-13   
ref|XP_007148157.1|  hypothetical protein PHAVU_006G185000g           80.5    2e-13   
ref|XP_010426979.1|  PREDICTED: L-type lectin-domain containing r...  80.5    2e-13   
ref|XP_010231799.1|  PREDICTED: LOW QUALITY PROTEIN: L-type lecti...  80.5    2e-13   
ref|XP_006341007.1|  PREDICTED: L-type lectin-domain containing r...  80.5    2e-13   
gb|AAF79572.1|AC022464_30  F22G5.19                                   79.0    2e-13   
ref|NP_190906.1|  concanavalin A-like lectin protein kinase famil...  80.5    2e-13   
dbj|BAD93993.1|  receptor lectin kinase -like protein                 80.5    2e-13   
gb|ACL36476.1|  lectin receptor kinase 2                              80.5    3e-13   
ref|XP_002298872.2|  hypothetical protein POPTR_0001s37700g           80.1    3e-13   
gb|KFK41426.1|  hypothetical protein AALP_AA2G129400                  80.1    3e-13   
ref|XP_004976331.1|  PREDICTED: L-type lectin-domain containing r...  80.1    3e-13   
ref|XP_009594255.1|  PREDICTED: L-type lectin-domain containing r...  80.1    3e-13   
ref|XP_010028192.1|  PREDICTED: L-type lectin-domain containing r...  80.1    3e-13   
ref|XP_002967904.1|  hypothetical protein SELMODRAFT_88859            77.0    3e-13   
gb|ABR16526.1|  unknown                                               80.1    3e-13   
ref|XP_002446862.1|  hypothetical protein SORBIDRAFT_06g023885        77.0    3e-13   
ref|XP_002436918.1|  hypothetical protein SORBIDRAFT_10g011000        80.1    3e-13   
emb|CDX76218.1|  BnaA04g04820D                                        80.1    3e-13   
emb|CDP17268.1|  unnamed protein product                              80.1    3e-13   
ref|XP_008653697.1|  PREDICTED: L-type lectin-domain containing r...  80.1    3e-13   
ref|XP_008240486.1|  PREDICTED: L-type lectin-domain containing r...  80.1    3e-13   
ref|XP_002872840.1|  hypothetical protein ARALYDRAFT_490325           80.1    3e-13   
gb|EMT24756.1|  Lectin-domain containing receptor kinase A4.3         80.1    3e-13   
ref|XP_004246414.1|  PREDICTED: L-type lectin-domain containing r...  80.1    3e-13   
ref|XP_010942610.1|  PREDICTED: probable L-type lectin-domain con...  80.1    3e-13   
ref|XP_010247279.1|  PREDICTED: L-type lectin-domain containing r...  80.1    3e-13   
gb|EAZ02659.1|  hypothetical protein OsI_24770                        80.1    3e-13   
gb|KJB47153.1|  hypothetical protein B456_008G012800                  80.1    3e-13   
gb|EAY85473.1|  hypothetical protein OsI_06848                        80.1    3e-13   
dbj|BAD23356.1|  putative lectin-like receptor kinase 7;2             80.1    3e-13   
ref|NP_567233.1|  L-type lectin-domain containing receptor kinase...  80.1    3e-13   
dbj|BAC57691.1|  putative receptor-like protein kinase                80.1    3e-13   
gb|KCW74966.1|  hypothetical protein EUGRSUZ_E03710                   79.7    3e-13   
ref|XP_011038801.1|  PREDICTED: probable L-type lectin-domain con...  79.7    4e-13   
ref|XP_009416157.1|  PREDICTED: L-type lectin-domain containing r...  79.7    4e-13   
ref|XP_008225104.1|  PREDICTED: L-type lectin-domain containing r...  79.7    4e-13   
ref|XP_009419258.1|  PREDICTED: L-type lectin-domain containing r...  79.7    4e-13   
ref|XP_010057734.1|  PREDICTED: L-type lectin-domain containing r...  79.7    4e-13   
ref|XP_011038799.1|  PREDICTED: probable L-type lectin-domain con...  79.7    4e-13   
ref|XP_003562841.2|  PREDICTED: uncharacterized protein LOC100846075  80.1    4e-13   
ref|XP_006417802.1|  hypothetical protein EUTSA_v10009305mg           77.4    4e-13   
ref|XP_010918306.1|  PREDICTED: L-type lectin-domain containing r...  79.7    4e-13   
ref|XP_002307486.1|  serine/threonine kinase-like family protein      79.7    4e-13   
gb|EMT31035.1|  Lectin-domain containing receptor kinase A4.3         80.1    4e-13   
ref|XP_002303928.1|  lectin protein kinase                            79.7    4e-13   
ref|XP_010262581.1|  PREDICTED: L-type lectin-domain containing r...  79.7    4e-13   
ref|XP_009110945.1|  PREDICTED: putative inactive L-type lectin-d...  77.0    4e-13   
ref|XP_002299853.2|  hypothetical protein POPTR_0001s25090g           79.7    4e-13   
ref|XP_006346248.1|  PREDICTED: probable L-type lectin-domain con...  79.7    4e-13   
ref|XP_010429638.1|  PREDICTED: L-type lectin-domain containing r...  79.7    5e-13   
ref|XP_008345463.1|  PREDICTED: L-type lectin-domain containing r...  79.3    5e-13   
gb|AAO18448.1|  putative receptor-like protein kinase                 79.3    5e-13   
ref|XP_007132721.1|  hypothetical protein PHAVU_011G119200g           79.3    5e-13   
gb|EAY92387.1|  hypothetical protein OsI_14117                        79.3    5e-13   



>ref|XP_009759025.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.2-like 
[Nicotiana sylvestris]
Length=361

 Score =   290 bits (741),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 149/225 (66%), Positives = 180/225 (80%), Gaps = 8/225 (4%)
 Frame = -3

Query  932  KFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEAS  753
            KFL VEFD   D KY DVNGNHVGVDLSS VSVKV N+SS+ L LNSGEKLQSWIDYEAS
Sbjct  136  KFLAVEFDTFLDKKYDDVNGNHVGVDLSSFVSVKVSNLSSVKLRLNSGEKLQSWIDYEAS  195

Query  752  SKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWSFK  573
            SKRLEVRLSK G+IRP  PL+SC +DLS+MWKE+E++VGLS+S   N + KCN+YS  FK
Sbjct  196  SKRLEVRLSKLGDIRPLNPLVSCPIDLSRMWKEEELYVGLSSST-GNSTQKCNIYSLGFK  254

Query  572  LRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTLMVLFV  393
            +R AP+WMHS+PLDP+AF  G+ +QL V  +SD C L+ILGAL+FGTGCGALG  +V+ V
Sbjct  255  IRTAPNWMHSEPLDPQAFE-GEKKQLKVHSKSD-CALRILGALLFGTGCGALGAFIVVIV  312

Query  392  WSVLRNRRPIVPEELTPE---PKEY-EYKKFQVVVDDKAIKDGKN  270
            W++L +RRP+ PE+   E    KE+ EYKKF VVV DKAI+DGK+
Sbjct  313  WTILGSRRPVAPEDPAVENNNSKEFDEYKKFNVVV-DKAIEDGKS  356



>ref|XP_004246363.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.2 
[Solanum lycopersicum]
Length=359

 Score =   266 bits (679),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 149/226 (66%), Positives = 178/226 (79%), Gaps = 10/226 (4%)
 Frame = -3

Query  932  KFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLEL-NSGEKLQSWIDYEA  756
            KFL VEFD   D+KYGDVN NHVGVDLSS +SVKV NVSS+ L L NSGEK+QSWIDYEA
Sbjct  135  KFLAVEFDTFMDEKYGDVNDNHVGVDLSSFISVKVSNVSSVKLGLMNSGEKMQSWIDYEA  194

Query  755  SSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWSF  576
            SSKRLE+RLSK G+I+P   LLSC +D+SQMWKEDE+FVGLS+S   N + KCN+YS SF
Sbjct  195  SSKRLEIRLSKLGDIKPVDTLLSCPIDMSQMWKEDELFVGLSSSS-GNSTQKCNIYSLSF  253

Query  575  KLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTLMVLF  396
              R AP WMHS+PLDP+AF V K E++ V  RSD C L+ILGAL+FGTGCGALG L+V+ 
Sbjct  254  NTRTAPHWMHSEPLDPQAF-VEKKEEMKVHSRSD-CALRILGALLFGTGCGALGALVVVI  311

Query  395  VWSVLRNRRPIVPEE----LTPEPKEY-EYKKFQVVVDDKAIKDGK  273
            VW+VL +RRP+ PE+    +    KE+ EYKKF VVV DKA++DGK
Sbjct  312  VWTVLGSRRPVAPEDHPAVMELHKKEFDEYKKFIVVV-DKAMEDGK  356



>ref|XP_006363087.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.2-like 
[Solanum tuberosum]
Length=359

 Score =   265 bits (677),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 148/226 (65%), Positives = 178/226 (79%), Gaps = 10/226 (4%)
 Frame = -3

Query  932  KFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLEL-NSGEKLQSWIDYEA  756
            KFL VEFD   D+KYGDVN NHVGVDLSS +SVKV NVSS+ L L NSGEK+QSWIDYEA
Sbjct  135  KFLAVEFDTFMDEKYGDVNENHVGVDLSSFISVKVSNVSSVKLGLMNSGEKMQSWIDYEA  194

Query  755  SSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWSF  576
            SSKRLE+RLSK G+++P   LLSC +D+SQMWKEDE+FVGLS+S   N + KCN+YS SF
Sbjct  195  SSKRLEIRLSKLGDLKPVDTLLSCPIDMSQMWKEDELFVGLSSSS-GNSTQKCNIYSLSF  253

Query  575  KLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTLMVLF  396
              R AP WMHS+PLDP+AF V K E++ V  RSD C L+ILGAL+FGTGCGALG L+V+ 
Sbjct  254  NTRTAPHWMHSEPLDPQAF-VKKKEEMKVHSRSD-CALRILGALLFGTGCGALGALLVVI  311

Query  395  VWSVLRNRRPIVPEE----LTPEPKEY-EYKKFQVVVDDKAIKDGK  273
            VW+VL +RRP+ PE+    +    KE+ EYKKF VVV DKA++DGK
Sbjct  312  VWTVLGSRRPVAPEDHPAVMELHKKEFDEYKKFIVVV-DKAMEDGK  356



>ref|XP_011094954.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.2-like 
[Sesamum indicum]
Length=353

 Score =   264 bits (674),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 146/221 (66%), Positives = 173/221 (78%), Gaps = 4/221 (2%)
 Frame = -3

Query  932  KFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEAS  753
            KFL VEFD  KDDKYGDVNGNH+G+D+ S VSVKV NVSS+NL LNSGEKLQ+WIDYEAS
Sbjct  137  KFLAVEFDTFKDDKYGDVNGNHIGLDVESPVSVKVSNVSSVNLALNSGEKLQAWIDYEAS  196

Query  752  SKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWSFK  573
            SKR EVRLSK+G+ RP  PLLS  +DLS+MWKE++V VGLS+S   N S KCN+Y WSFK
Sbjct  197  SKRFEVRLSKFGDNRPVDPLLSYPIDLSEMWKEEDVIVGLSSSSG-NSSQKCNIYFWSFK  255

Query  572  LRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTLMVLFV  393
             R  P WMHS+P+DP+   V   E+L VPK+ D C L+IL ALIFGT CGALG   VLF+
Sbjct  256  SRTVPQWMHSEPMDPEDV-VENAEELKVPKKGD-CALRILAALIFGTVCGALGAFFVLFL  313

Query  392  WSVLRNRRPIVPEELTPEPKEYEYKKFQVVVDDKAIKDGKN  270
            W++  NRRP+VPEE T + KE++YKKF V V DK I+DGKN
Sbjct  314  WTIFGNRRPVVPEEFTVQSKEFDYKKFNVSV-DKTIEDGKN  353



>ref|XP_009621566.1| PREDICTED: lectin-like protein At3g16530 [Nicotiana tomentosiformis]
Length=363

 Score =   263 bits (673),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 148/226 (65%), Positives = 179/226 (79%), Gaps = 9/226 (4%)
 Frame = -3

Query  932  KFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEAS  753
            KFL VEFD   D KYGD+NGNHVGVDL S VSVKV NVSS+ LELNSGEKLQSWIDYEAS
Sbjct  137  KFLAVEFDTFLDKKYGDLNGNHVGVDLRSFVSVKVSNVSSVKLELNSGEKLQSWIDYEAS  196

Query  752  SKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWSFK  573
            SKRLEVRL+K G+IRP  PL+SC +DLS++WKE+E+FVGLS+S   N + KCN+YS  FK
Sbjct  197  SKRLEVRLNKVGDIRPLNPLVSCPIDLSRIWKEEELFVGLSSSS-GNSTQKCNIYSLGFK  255

Query  572  LRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTLMVLFV  393
               AP WMHS+PLDP+AF  G+ ++L V  +SD C L+ILGAL+FGTGCGALG  +V+ V
Sbjct  256  TMTAPKWMHSEPLDPQAFE-GEKKELKVHSKSD-CALRILGALLFGTGCGALGAFIVVIV  313

Query  392  WSVLRNRRPIVPEELTPE----PKEY-EYKKFQVVVDDKAIKDGKN  270
            W++L +RRP+ PE+   E     KE+ EYKKF+VVV DKAIKDGK+
Sbjct  314  WTILGSRRPVAPEDPAVEQHNDSKEFDEYKKFKVVV-DKAIKDGKS  358



>gb|EYU41819.1| hypothetical protein MIMGU_mgv1a009026mg [Erythranthe guttata]
Length=355

 Score =   263 bits (672),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 135/226 (60%), Positives = 164/226 (73%), Gaps = 3/226 (1%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSW  771
            GE++  KFL VEFD  KD+KYGDVN NHVG+D+ SLVSVKV N SS+ L LNSGEKLQ+W
Sbjct  132  GERKT-KFLAVEFDTFKDEKYGDVNSNHVGLDVESLVSVKVSNASSVRLLLNSGEKLQAW  190

Query  770  IDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNV  591
            IDYEAS KR EVRLS+ G+ RP  PLLS  +DLS+MW+ +E      +S   N S K N+
Sbjct  191  IDYEASGKRFEVRLSELGQNRPVDPLLSYPIDLSRMWR-NENVSVGLSSSSGNSSQKINI  249

Query  590  YSWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGT  411
            YSWSFK R  P WMHS+P+DP+     K +++ VPKRSD C L+I  ALIFGTGCGALG 
Sbjct  250  YSWSFKSRTMPHWMHSEPMDPEGLSE-KGDEIKVPKRSDSCALRIFAALIFGTGCGALGA  308

Query  410  LMVLFVWSVLRNRRPIVPEELTPEPKEYEYKKFQVVVDDKAIKDGK  273
             +VLFVW+V  NRRP+VPEE   E  E+E KK  V +D K ++DGK
Sbjct  309  FLVLFVWTVFGNRRPVVPEEFAVEKDEFEGKKSGVSLDKKTVEDGK  354



>ref|XP_007026824.1| Concanavalin A-like lectin family protein, putative [Theobroma 
cacao]
 gb|EOY07326.1| Concanavalin A-like lectin family protein, putative [Theobroma 
cacao]
Length=358

 Score =   258 bits (658),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 124/225 (55%), Positives = 161/225 (72%), Gaps = 2/225 (1%)
 Frame = -3

Query  947  EKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWI  768
            EK N   + VEFD  KD +YGD+NGNHVGVD+ SLVSVK  N+SS NL LN+GEKL SWI
Sbjct  135  EKRNRGAVAVEFDTFKDARYGDLNGNHVGVDVGSLVSVKARNLSSANLVLNNGEKLHSWI  194

Query  767  DYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVY  588
            DYEASSKRLE+RL++ G  RP  PLLS  +DLS++W ++++FVGLS S   N S  C +Y
Sbjct  195  DYEASSKRLEIRLNQSGSTRPEDPLLSYSIDLSKLWNDEDLFVGLSASNR-NSSQTCFIY  253

Query  587  SWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTL  408
            SWSFKLR  P+WMHSQPL+P+A     P+ L+   +S  C  ++L   IFG  CGAL   
Sbjct  254  SWSFKLRQVPNWMHSQPLNPEAI-AKNPKPLTTAHKSSNCFWRVLAVFIFGGACGALTAS  312

Query  407  MVLFVWSVLRNRRPIVPEELTPEPKEYEYKKFQVVVDDKAIKDGK  273
             VL++W++L +RRP+ PEE    P ++EYKKF+V  D++A+K GK
Sbjct  313  CVLYLWTILGDRRPVAPEECGVHPVDFEYKKFKVAEDEEAVKVGK  357



>ref|XP_011019177.1| PREDICTED: lectin-like protein At1g53070 [Populus euphratica]
Length=356

 Score =   256 bits (654),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 126/226 (56%), Positives = 168/226 (74%), Gaps = 4/226 (2%)
 Frame = -3

Query  947  EKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWI  768
            EK + KF+ VEFD ++D K+GD+N NHVG+D+   VSVKV NVSS N+ LNSG++L SWI
Sbjct  135  EKSSPKFVAVEFDTMRDAKFGDLNDNHVGIDVGGFVSVKVRNVSSNNMVLNSGKRLHSWI  194

Query  767  DYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVY  588
            DYEA SKRLEVRLS  G+I+P  PLLS  +DLS+MW  ++V +GL++S   N S  C ++
Sbjct  195  DYEAGSKRLEVRLSHSGDIKPIDPLLSHPIDLSKMWNGEKVLIGLTSSN-GNSSQTCFLH  253

Query  587  SWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTL  408
            SW+F LR  P WMHSQPLDP+ F   K E+  V ++   C LK+L A+IFGT CGALG  
Sbjct  254  SWNFTLRRVPLWMHSQPLDPQDF--AKHEKPVVVQKKSNCILKMLTAMIFGTACGALGAF  311

Query  407  MVLFVWSVLRNRRPIVPEELTPEPKEYEYKKFQVVVDDKAIKDGKN  270
            MVL++W++  NRRP++PEE +  P ++EYKK +V+V DKAI+DGK+
Sbjct  312  MVLYLWTIFGNRRPVMPEECSVPPVDFEYKKVKVIV-DKAIEDGKH  356



>ref|XP_002308200.2| alpha-amylase inhibitor alpha subunit family protein [Populus 
trichocarpa]
 gb|EEE91723.2| alpha-amylase inhibitor alpha subunit family protein [Populus 
trichocarpa]
Length=356

 Score =   253 bits (647),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 124/226 (55%), Positives = 168/226 (74%), Gaps = 4/226 (2%)
 Frame = -3

Query  947  EKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWI  768
            EK + KF+ VEFD ++D K+GD+N NHVG+D+   VSVKV NVSS N+ LNSG++L SWI
Sbjct  135  EKSSPKFVAVEFDTMRDAKFGDLNDNHVGIDVGGFVSVKVRNVSSNNMVLNSGKRLHSWI  194

Query  767  DYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVY  588
            DYEA SK LEVRLS  G+I+P  PLLS  +DLS+ W +++V +GL++S   N S  C ++
Sbjct  195  DYEAGSKTLEVRLSHSGDIKPIDPLLSHPIDLSKTWNDEKVLIGLTSSN-GNSSQTCFLH  253

Query  587  SWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTL  408
            SW+FKLR  P WMHSQPLDP+ F   K E+  V ++   C LK+L A+IFGT CGA+G  
Sbjct  254  SWNFKLRRVPLWMHSQPLDPQDF--AKHEKPMVVQKKSGCILKMLTAMIFGTACGAMGAF  311

Query  407  MVLFVWSVLRNRRPIVPEELTPEPKEYEYKKFQVVVDDKAIKDGKN  270
            MVL++W++  NRRP++PEE +  P ++EYKK +V+V DKAI+DGK+
Sbjct  312  MVLYLWTIFGNRRPVMPEECSVPPVDFEYKKVKVIV-DKAIEDGKH  356



>ref|XP_012087950.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.2 
[Jatropha curcas]
 gb|KDP24510.1| hypothetical protein JCGZ_25074 [Jatropha curcas]
Length=359

 Score =   246 bits (628),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 126/227 (56%), Positives = 168/227 (74%), Gaps = 6/227 (3%)
 Frame = -3

Query  947  EKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWI  768
            EK N + + VEFD  +DD YGDVNGNHVG+D+   VSVKV N SS NL LN+G++L SWI
Sbjct  136  EKSNSEIVAVEFDTRRDDNYGDVNGNHVGIDVGGFVSVKVKNASSANLVLNNGKRLNSWI  195

Query  767  DYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVY  588
            DYEA SKRLEVRLS++G  +P  PLLS  +DLSQ+W  ++VF+GLS+S   N S +C +Y
Sbjct  196  DYEAGSKRLEVRLSQYGYTKPIDPLLSHPIDLSQLWNNEKVFIGLSSSNG-NSSQECFIY  254

Query  587  SWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTL  408
            SWSF+LR  P WMHS+PLDP+AF   K  +  V  + + C L++L A+IFGT CGALG  
Sbjct  255  SWSFELRHVPQWMHSEPLDPQAF--AKKVKPVVIHKRNACVLRVLAAMIFGTACGALGAF  312

Query  407  MVLFVWSVLRNRR--PIVPEELTPEPKEYEYKKFQVVVDDKAIKDGK  273
            +VL++W++  NRR  P+VPEE + +P +++YKKF V + DKA++DGK
Sbjct  313  IVLYLWTIFGNRRPVPVVPEECSMQPVDFQYKKFNVGL-DKAVEDGK  358



>gb|KDO58027.1| hypothetical protein CISIN_1g018168mg [Citrus sinensis]
Length=360

 Score =   245 bits (626),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 139/229 (61%), Positives = 172/229 (75%), Gaps = 8/229 (3%)
 Frame = -3

Query  947  EKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWI  768
            +K  ++ + VEFD L+D KYGDVNGNHVG+D+ SLVSVKV NVSS N+ LNS +KL SWI
Sbjct  135  DKSKFRVVAVEFDTLRDVKYGDVNGNHVGIDVGSLVSVKVSNVSSHNIVLNSDKKLNSWI  194

Query  767  DYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVY  588
            DYEASSKRLEVRLS     +P  PLLS  +DLS++W ++EVFVGLS+S   N S  CN+Y
Sbjct  195  DYEASSKRLEVRLSYLDSAKPVDPLLSYPIDLSKLWNDEEVFVGLSSSN-RNSSQICNLY  253

Query  587  SWSFKLRAAPDWMHSQPLDPKAF--RVGKPEQLSVPKRSDECGLKILGALIFGTGCGALG  414
            SWSFKLR  P WMHSQPLDPK F   +  P Q   PKRSD C LK+LGALIFGT CGALG
Sbjct  254  SWSFKLRHVPHWMHSQPLDPKTFVKNLKTPPQ-PPPKRSD-CLLKVLGALIFGTACGALG  311

Query  413  TLMVLFVWSVLRNRRPIVP--EELTPEPKEYEYKKFQVVVDDKAIKDGK  273
              +VL++W++  N+RP+VP  EE      ++EY+KF+V+V DKA++DGK
Sbjct  312  ASIVLYLWTIFANKRPVVPVTEECAVHLADFEYEKFKVLV-DKAVEDGK  359



>ref|XP_006480935.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.2-like 
[Citrus sinensis]
Length=360

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 139/229 (61%), Positives = 171/229 (75%), Gaps = 8/229 (3%)
 Frame = -3

Query  947  EKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWI  768
            +K  ++ + VEFD L+D KYGDVNGNHVG+D+ SLVSVKV NVSS N+ LNS +KL SWI
Sbjct  135  DKSKFRVVAVEFDTLRDVKYGDVNGNHVGIDVGSLVSVKVSNVSSHNIVLNSDKKLNSWI  194

Query  767  DYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVY  588
            DYEASSKRLEVRLS     +P  PLLS  +DLS++W  +EVFVGLS+S   N S  CN+Y
Sbjct  195  DYEASSKRLEVRLSYLDSAKPVDPLLSYPIDLSKLWNNEEVFVGLSSSN-RNSSQICNLY  253

Query  587  SWSFKLRAAPDWMHSQPLDPKAF--RVGKPEQLSVPKRSDECGLKILGALIFGTGCGALG  414
            SWSFKLR  P WMHSQPLDPK F   +  P Q   PKRSD C LK+LGALIFGT CGALG
Sbjct  254  SWSFKLRHVPHWMHSQPLDPKTFVKNLKTPPQ-PPPKRSD-CLLKVLGALIFGTACGALG  311

Query  413  TLMVLFVWSVLRNRRPIVP--EELTPEPKEYEYKKFQVVVDDKAIKDGK  273
              +VL++W++  N+RP+VP  EE      ++EY+KF+V+V DKA++DGK
Sbjct  312  ASIVLYLWTIFANKRPVVPVTEECAVHLADFEYEKFKVLV-DKAVEDGK  359



>ref|XP_010672608.1| PREDICTED: probable L-type lectin-domain containing receptor 
kinase S.7 [Beta vulgaris subsp. vulgaris]
Length=364

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 119/220 (54%), Positives = 152/220 (69%), Gaps = 3/220 (1%)
 Frame = -3

Query  947  EKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWI  768
            EK+N  F  VE D   D + GD+N NH+G+++ SLVSVKV N S + L L+SG+KLQ WI
Sbjct  140  EKKNRAFFAVEIDTKFDAELGDLNNNHIGINVGSLVSVKVSNASDVKLSLSSGKKLQCWI  199

Query  767  DYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVY  588
            DYEASSKR+EVR+SK GE RP YPLLSC +DLS M+K +EVF+GLS+S   N +  C +Y
Sbjct  200  DYEASSKRIEVRISKAGEKRPVYPLLSCPIDLSGMFKNEEVFIGLSSSNA-NSNQICKLY  258

Query  587  SWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTL  408
            SWSFKLR  P WMHS PLDP+         +  PKR  +C LK+L ALI GT CGALG  
Sbjct  259  SWSFKLRQVPYWMHSHPLDPETVSKDAQPVMIQPKR--DCALKVLTALILGTACGALGAY  316

Query  407  MVLFVWSVLRNRRPIVPEELTPEPKEYEYKKFQVVVDDKA  288
            MV+FVWS+   ++P+ PEE   +P  Y+Y K + +  DK+
Sbjct  317  MVMFVWSIFFTKKPVAPEEYMVKPVMYDYNKVKALAVDKS  356



>ref|XP_006429260.1| hypothetical protein CICLE_v10012045mg [Citrus clementina]
 gb|ESR42500.1| hypothetical protein CICLE_v10012045mg [Citrus clementina]
Length=360

 Score =   244 bits (622),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 138/229 (60%), Positives = 172/229 (75%), Gaps = 8/229 (3%)
 Frame = -3

Query  947  EKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWI  768
            +K  ++ + VEFD L+D KYGDVNGNHVG+D+ SLVSVKV NVSS N+ LNS +KL SWI
Sbjct  135  DKSKFRVVAVEFDTLRDVKYGDVNGNHVGIDVGSLVSVKVSNVSSHNIVLNSDKKLNSWI  194

Query  767  DYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVY  588
            DYEASSKRLEVRLS     +P  PLLS  +DLS++W ++EVFVGLS+S   N S  CN+Y
Sbjct  195  DYEASSKRLEVRLSYLDSAKPVDPLLSYPIDLSKLWNDEEVFVGLSSSN-RNSSQICNLY  253

Query  587  SWSFKLRAAPDWMHSQPLDPKAF--RVGKPEQLSVPKRSDECGLKILGALIFGTGCGALG  414
            SWSFKLR  P WMHS+PLDPK F   +  P Q   PKRSD C LK+LGALIFGT CGALG
Sbjct  254  SWSFKLRHVPHWMHSKPLDPKTFVKNLKTPPQ-PPPKRSD-CLLKVLGALIFGTACGALG  311

Query  413  TLMVLFVWSVLRNRRPIVP--EELTPEPKEYEYKKFQVVVDDKAIKDGK  273
              +VL++W++  N+RP+VP  EE      ++EY+KF+V+V DKA++DGK
Sbjct  312  ASIVLYLWTIFANKRPVVPVTEECAVHLADFEYEKFKVLV-DKAVEDGK  359



>ref|XP_002527882.1| Agglutinin-2 precursor, putative [Ricinus communis]
 gb|EEF34513.1| Agglutinin-2 precursor, putative [Ricinus communis]
Length=357

 Score =   239 bits (609),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/209 (53%), Positives = 151/209 (72%), Gaps = 3/209 (1%)
 Frame = -3

Query  947  EKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWI  768
            ++ N +F+ VEFD  KD +YGD+N NHVGV++   VS KV N SS+N+ LN+G++L SWI
Sbjct  136  KRNNSEFIAVEFDTRKDAEYGDLNDNHVGVNVGGFVSAKVKNASSVNIVLNNGKRLSSWI  195

Query  767  DYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVY  588
            DYEA S+RLEVRLSK+G I+P  PLLS  +DLS++WK+++ ++GLS+S   N S  C +Y
Sbjct  196  DYEAGSRRLEVRLSKFGNIKPMDPLLSYPIDLSKLWKDEKFYIGLSSSNR-NSSQACLIY  254

Query  587  SWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTL  408
            SWSF+ R  P WMHSQPLDP+AF   K  +  V  +   C L++L  +IFGT CGALG  
Sbjct  255  SWSFEQRHVPQWMHSQPLDPQAF--AKDVKPGVITKQGNCFLRVLATMIFGTACGALGAF  312

Query  407  MVLFVWSVLRNRRPIVPEELTPEPKEYEY  321
             VL++W++  NRRP+VPEE +  P E+EY
Sbjct  313  SVLYLWTIFGNRRPVVPEECSVHPVEFEY  341



>gb|KJB36868.1| hypothetical protein B456_006G179800 [Gossypium raimondii]
Length=357

 Score =   234 bits (597),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 120/225 (53%), Positives = 155/225 (69%), Gaps = 3/225 (1%)
 Frame = -3

Query  947  EKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWI  768
            EK       VEFD  KD KYGD+N NHVG+D+ SLVSVKV N+SS+NL LN+GEKL SWI
Sbjct  135  EKSKKGIFDVEFDTSKDGKYGDLNENHVGIDVGSLVSVKVRNLSSVNLVLNNGEKLHSWI  194

Query  767  DYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVY  588
            DYEA+SKR+E+RLS+    RP  PLLS  +DL+ +WK++EVFVGLS+S   N S  C ++
Sbjct  195  DYEATSKRVEIRLSESSSTRPNEPLLSHSIDLATLWKDEEVFVGLSSSSG-NSSQTCFIH  253

Query  587  SWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTL  408
             WSFKLR  P+WMHSQPLDP+A     P+  +   +S  C  K+L   IFG  CG L   
Sbjct  254  LWSFKLRQVPNWMHSQPLDPEAIS-KNPKPSTTAHKSSNCLWKVLAVFIFGCACGVLTAS  312

Query  407  MVLFVWSVLRNRRPIVPEELTPEPKEYEYKKFQVVVDDKAIKDGK  273
             +L++W+ L  RRP+ PEE +  P E+EYKK ++VVD+  +KD K
Sbjct  313  CLLYLWTTLGARRPVAPEECSVHPVEFEYKKVKIVVDE-VVKDDK  356



>ref|XP_011009155.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.1 
[Populus euphratica]
Length=355

 Score =   233 bits (593),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 118/209 (56%), Positives = 151/209 (72%), Gaps = 3/209 (1%)
 Frame = -3

Query  947  EKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWI  768
            EK + KF+ VEFD  +D K+GD+N NHVG+D+   VSVKV NVSS N+ LNSG+KL SWI
Sbjct  134  EKSSPKFVAVEFDTTRDAKFGDLNDNHVGIDVGGFVSVKVRNVSSNNMVLNSGKKLHSWI  193

Query  767  DYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVY  588
            DYEA SKRLEVRLS+ G I+P  PLLS  +DLS+M  ++ V +   +S   N S  C +Y
Sbjct  194  DYEAGSKRLEVRLSQSGNIKPIDPLLSYPIDLSKMLNDERVLI-GLSSSNGNSSQTCFLY  252

Query  587  SWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTL  408
            SWS KLR  P WMHS+PLDP+AF   + + + V K+SD C LKIL A+IFGT CGALG  
Sbjct  253  SWSLKLRHVPHWMHSEPLDPRAF-AKRAKPVVVQKKSD-CILKILAAMIFGTACGALGAF  310

Query  407  MVLFVWSVLRNRRPIVPEELTPEPKEYEY  321
            MVL++W++  NRRP+VPEE +  P ++EY
Sbjct  311  MVLYLWTIFGNRRPVVPEECSAHPGDFEY  339



>ref|XP_002322948.1| alpha-amylase inhibitor alpha subunit family protein [Populus 
trichocarpa]
 gb|EEF04709.1| alpha-amylase inhibitor alpha subunit family protein [Populus 
trichocarpa]
Length=355

 Score =   231 bits (588),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 117/209 (56%), Positives = 152/209 (73%), Gaps = 3/209 (1%)
 Frame = -3

Query  947  EKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWI  768
            EK + KF+ VEFD  +D K+GD+N NHVG+D+   VSVKV NVSS N+ LNSG++L SWI
Sbjct  134  EKSSPKFVAVEFDTSRDAKFGDLNDNHVGIDVGGFVSVKVRNVSSNNMVLNSGKRLHSWI  193

Query  767  DYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVY  588
            DYEA SKRLEVRLS+ G+I+P  PLLS  +DLS+M  ++ V +   +S   N S  C +Y
Sbjct  194  DYEAGSKRLEVRLSQSGDIKPIDPLLSYPIDLSKMLNDERVLI-GLSSSNGNSSQTCFLY  252

Query  587  SWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTL  408
            SWS KLR  P WMHS+PLDP+AF   + + + V K+SD C LKIL A+IFGT CGALG  
Sbjct  253  SWSLKLRHVPHWMHSEPLDPRAF-AKRVKPVVVQKKSD-CILKILAAMIFGTACGALGAF  310

Query  407  MVLFVWSVLRNRRPIVPEELTPEPKEYEY  321
            MVL++W++  NRRP+VPEE +  P ++EY
Sbjct  311  MVLYLWTIFGNRRPVVPEECSAHPGDFEY  339



>ref|XP_010256728.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.2 
[Nelumbo nucifera]
Length=359

 Score =   226 bits (576),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 112/221 (51%), Positives = 150/221 (68%), Gaps = 3/221 (1%)
 Frame = -3

Query  932  KFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEAS  753
            + L VEFD   D K+ D NGNHVG+D+ +LVSV V NV+S+ L LN G+KL +WIDY+AS
Sbjct  140  RVLAVEFDTSMDAKFADPNGNHVGIDIDTLVSVAVSNVTSLGLVLNGGDKLHTWIDYDAS  199

Query  752  SKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWSFK  573
            SK L+VRL K G +RP  PL+S  +DLS+MWKE+EVFVGLS+S   N S    V+SWSF 
Sbjct  200  SKYLQVRLGKLGNVRPSDPLISYPIDLSEMWKEEEVFVGLSSST-GNSSQTTTVHSWSFT  258

Query  572  LRAAPDWMHSQPLDPKAF-RVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTLMVLF  396
            LR  P+WMHSQPLDP+A     KP  ++V  +  +C ++ L  +IFGT CGAL TL+V+ 
Sbjct  259  LRRIPNWMHSQPLDPRAHSEPSKPLTVTVVHKKKDCVIRTLTGVIFGTACGALVTLIVMA  318

Query  395  VWSVLRNRRPIVPEELTPEPKEYEYKKFQVVVDDKAIKDGK  273
            +W+   +R P+ P E    P E  Y+K + ++ +KA  D K
Sbjct  319  LWNFFTSRPPVAPVEYPEHPVELGYEKIR-IIREKATTDDK  358



>emb|CDP06531.1| unnamed protein product [Coffea canephora]
Length=352

 Score =   224 bits (571),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 165/221 (75%), Gaps = 11/221 (5%)
 Frame = -3

Query  932  KFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEAS  753
            KFL VEF+  ++++YGDVNGN+VGV L+SL+SVK+ N SS+N  L+SGEKLQSWIDYEA+
Sbjct  139  KFLAVEFEPSRNNRYGDVNGNNVGVGLASLISVKISNFSSVNSSLSSGEKLQSWIDYEAN  198

Query  752  SKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWSFK  573
            SKRLEVRL+K GE +P  P+L   VDLS+MW + EV   LS++   N SHKCN+YSWS  
Sbjct  199  SKRLEVRLAKLGEKKPLNPILFYPVDLSRMWDKAEVLFSLSSASG-NSSHKCNLYSWSLT  257

Query  572  LRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTLMVLFV  393
            LR+ P+WMHS+PLDP AF V + ++  V ++SD C L+IL AL+FGTGCGALG L+VLF+
Sbjct  258  LRSIPNWMHSEPLDPAAF-VERRKEPKVHEKSD-CALRILAALMFGTGCGALGALLVLFI  315

Query  392  WSVLRNRRPIVPEELTPEPKEYEYKKFQVVVDDKAIKDGKN  270
            W++L  +RP+VPE+    P  +EY         K I+DGKN
Sbjct  316  WTLLGYKRPVVPEDYVVRPVGFEYA--------KPIRDGKN  348



>ref|XP_009358820.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.2-like 
[Pyrus x bretschneideri]
Length=351

 Score =   223 bits (569),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 116/222 (52%), Positives = 148/222 (67%), Gaps = 11/222 (5%)
 Frame = -3

Query  935  YKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEA  756
            +K + V+FD L D K       HVG+D+ S VS KV NVS+ NL  +SG K Q WIDYEA
Sbjct  139  FKVVAVKFDALSDGKV------HVGIDVGSSVSAKVSNVSAKNLGPSSGNKTQGWIDYEA  192

Query  755  SSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLST-SRLWNQSHKCNVYSWS  579
             S RLEVRLSK+G  +P  PLL   +DLS+MW + EVFV LS  SR  N S  C+VYSWS
Sbjct  193  GSNRLEVRLSKFGGSKPVDPLLWYPIDLSKMWGDKEVFVALSAMSR--NSSQTCSVYSWS  250

Query  578  FKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTLMVL  399
            F+ R  P WMHSQPLDPKA  V K  +    ++   C  +  GA++FG  CGAL + + L
Sbjct  251  FEQRHVPHWMHSQPLDPKA--VAKNSKAEALEKKKNCTERAFGAMVFGVACGALASFVGL  308

Query  398  FVWSVLRNRRPIVPEELTPEPKEYEYKKFQVVVDDKAIKDGK  273
            ++W+VL NRRP+VPEE   + KE+EY+K +VV D+K I+DGK
Sbjct  309  YLWTVLGNRRPVVPEEYAEKSKEFEYEKMKVVADNKTIEDGK  350



>ref|XP_002276782.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.2 
[Vitis vinifera]
Length=358

 Score =   224 bits (570),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 157/221 (71%), Gaps = 6/221 (3%)
 Frame = -3

Query  932  KFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEAS  753
            +   VEFD  +D ++G  NGNHVGVD+++LVSV V NVSSI+L LN+GE+L  WIDYEA 
Sbjct  140  RVFAVEFDTPRDAQHGYSNGNHVGVDVANLVSVTVSNVSSIDLVLNNGERLNCWIDYEAG  199

Query  752  SKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWSFK  573
            SKRLEVRLSK+G+IRP  P +S  +DLS+MW EDEV+VG S+S   N S  C VYSWSF 
Sbjct  200  SKRLEVRLSKFGDIRPVSPFISHPIDLSEMWNEDEVYVGFSSSSG-NSSQTCVVYSWSFN  258

Query  572  LRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTLMVLFV  393
             R  P WMHSQPLDPK  +     Q    KR+  C L++L ALIFGTGCGALG  + LF+
Sbjct  259  TRPVPHWMHSQPLDPKTLKEDMRPQTVHEKRA--CLLRVLAALIFGTGCGALGAFIALFL  316

Query  392  WSVLRNRRPI--VPEELTPEPKEYEYKKFQVVVDDKAIKDG  276
             ++  NRRP+  VPEE    P E+EYKK  V+V DK+I++G
Sbjct  317  CTIFGNRRPVVPVPEEFVMRPVEFEYKKVNVIV-DKSIQNG  356



>gb|KJB76858.1| hypothetical protein B456_012G110400 [Gossypium raimondii]
Length=359

 Score =   223 bits (569),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 122/226 (54%), Positives = 161/226 (71%), Gaps = 3/226 (1%)
 Frame = -3

Query  947  EKENYK-FLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSW  771
            EK N    + VEFD  +D K+GD+N NHVG+D+ SL SVK  N+SS+NL L++GEKL SW
Sbjct  135  EKNNKSGIVAVEFDTFRDAKHGDLNENHVGIDVGSLASVKARNLSSLNLVLSNGEKLHSW  194

Query  770  IDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNV  591
            IDYEASSKRLE+RLS+    RP  PLLS  +DLS++W +++VFVGLS+S   N S  C +
Sbjct  195  IDYEASSKRLEIRLSQSSSTRPDDPLLSYSIDLSKLWNDEQVFVGLSSSNG-NSSQTCFI  253

Query  590  YSWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGT  411
            + WSFKLR  P+WMHSQPLDP+A     P+ L+ P +S +C  K+L   +FG  CGAL  
Sbjct  254  HLWSFKLRQVPNWMHSQPLDPEAI-TKNPKPLTTPHKSSKCFWKVLVVFVFGGACGALTA  312

Query  410  LMVLFVWSVLRNRRPIVPEELTPEPKEYEYKKFQVVVDDKAIKDGK  273
              VL++W++  +RRP+VPEE   E  ++EYKK +VVV D A+KDGK
Sbjct  313  SCVLYLWNMFGDRRPVVPEECGAEGVDFEYKKVKVVVVDNAVKDGK  358



>emb|CDP14076.1| unnamed protein product [Coffea canephora]
Length=348

 Score =   223 bits (568),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 108/223 (48%), Positives = 151/223 (68%), Gaps = 4/223 (2%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSW  771
            G     +F  VEFD  +++  GD N NHVG+D++SL SV+V NVSSI L LNSG KL SW
Sbjct  123  GLSRQSRFFAVEFDTFRNENVGDENANHVGIDVASLHSVQVSNVSSIGLVLNSGIKLHSW  182

Query  770  IDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNV  591
            +DY++SSKRLEVRLS +G  RP  PLL+  +DL +MWK +EV VGL++SR  N   K  +
Sbjct  183  VDYDSSSKRLEVRLSGFGSPRPYAPLLAYQIDLGEMWKGEEVLVGLTSSR-GNSVQKTCI  241

Query  590  YSWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGT  411
            YSW F +R AP+W+HSQP++P+AF   + E     K+S  C L++L  LIF TGCG L  
Sbjct  242  YSWKFTVRIAPNWLHSQPVNPQAFTSKRSEDKVADKKS-LCALRLLSGLIFATGCGLLAA  300

Query  410  LMVLFVWSVLRN--RRPIVPEELTPEPKEYEYKKFQVVVDDKA  288
             +VLF+W+V  N  +  ++P + +  P ++ Y+K QVV++D +
Sbjct  301  FVVLFLWAVFANNDQVAVIPVKCSANPGDFRYEKIQVVLEDSS  343



>ref|XP_004302660.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.2-like 
[Fragaria vesca subsp. vesca]
Length=349

 Score =   218 bits (554),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 107/201 (53%), Positives = 144/201 (72%), Gaps = 6/201 (3%)
 Frame = -3

Query  869  HVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEASSKRLEVRLSKWGEIRPGYPLL  690
            HVG+D+ S VS +V N S+I L L SG++  +WIDYEA SKR+EVRLS+ G  RP  PLL
Sbjct  154  HVGIDVGSSVSARVNNASAIKLNLTSGDRANAWIDYEAGSKRIEVRLSQLGGSRPADPLL  213

Query  689  SCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWSFKLRAAPDWMHSQPLDPKAF-RV  513
               +DLS++W +++VFVGLS     N S  C++YSWSF+ R  PDWMHSQPLDPK + + 
Sbjct  214  WYPIDLSKLWGDEKVFVGLSAQNR-NSSQTCSIYSWSFEQRHVPDWMHSQPLDPKTYSKS  272

Query  512  GKPEQLSVPKRSDECGLKILGALIFGTGCGALGTLMVLFVWSVLRNRRPIVPEELTPEPK  333
             KP  ++V KR D C L+ + A++ G  CGAL + +VL++W +  NRRP+VPEE   +PK
Sbjct  273  SKP--VTVEKRKD-CVLRAVAAMVLGVACGALASYIVLYLWRIFGNRRPVVPEEYAMQPK  329

Query  332  EYEYKKFQVVVDDKAIKDGKN  270
            E+EYKK +VVV DK+I+DGK 
Sbjct  330  EFEYKKMKVVV-DKSIEDGKQ  349



>ref|XP_007009125.1| Concanavalin A-like lectin family protein, putative [Theobroma 
cacao]
 gb|EOY17935.1| Concanavalin A-like lectin family protein, putative [Theobroma 
cacao]
Length=355

 Score =   216 bits (550),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/221 (49%), Positives = 149/221 (67%), Gaps = 4/221 (2%)
 Frame = -3

Query  932  KFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEAS  753
            +FLG+EFD  KDDK GD+N NHVG+D+ SL SVKV N+SS+NL LN+GE L+SW+DY++S
Sbjct  136  RFLGIEFDTKKDDKVGDLNANHVGIDVGSLESVKVSNLSSLNLVLNNGEILKSWVDYDSS  195

Query  752  SKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVG-LSTSRLWNQSHKCNVYSWSF  576
            SK L+VRLSK  + RP  P+L+  +DL +MW  ++VFVG +ST+   +     NVYSW F
Sbjct  196  SKLLQVRLSKLNDKRPFTPILAYRIDLFEMWGNEDVFVGIISTTNEESSQSSSNVYSWRF  255

Query  575  KLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTLMVLF  396
            ++R    WMHS P DP+ + V K  Q    +RS  C L IL  LIF TGCGAL   ++LF
Sbjct  256  RVRDVSSWMHSLPADPRGY-VDKDSQEFRAERSKFCALTILAGLIFATGCGALLAFVMLF  314

Query  395  VWSVLRNRRPIVPEELTPEPKEYEYKKFQVVV--DDKAIKD  279
            +W+++ NR  + P E    P ++ Y+K  V+V  DD+  KD
Sbjct  315  MWAIMVNRHTVFPVECQAGPDDFRYEKVNVIVEKDDQGDKD  355



>gb|EYU19968.1| hypothetical protein MIMGU_mgv1a007272mg [Erythranthe guttata]
Length=413

 Score =   218 bits (554),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 113/224 (50%), Positives = 145/224 (65%), Gaps = 6/224 (3%)
 Frame = -3

Query  932  KFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEAS  753
            +F GVEFD   DD  GDVNGNHVGVD+ SLVSVK  NVSSINL LNSG KL SW+DY++S
Sbjct  193  RFFGVEFDTSADDNVGDVNGNHVGVDVGSLVSVKTSNVSSINLVLNSGVKLHSWVDYDSS  252

Query  752  SKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWSFK  573
            SK++EVRLSK+G  RP  PLL   +DL  +WK +EV VGLS+S   N     NVYSW+FK
Sbjct  253  SKKIEVRLSKFGSSRPYNPLLVYKIDLGDIWKNEEVLVGLSSSS-GNSMQTSNVYSWNFK  311

Query  572  LRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTLMVLFV  393
             R  P W+HSQP+DP+A      E+  + ++   C   +L  L+F TGCGAL  L+VLF+
Sbjct  312  TRNIPKWLHSQPMDPRAVSNDHSEE-KLAQKKKICAFGVLSGLVFMTGCGALLALIVLFL  370

Query  392  WSVLRNRRPIV---PEELTPEPKEYEYKKFQVVVDDKAIKDGKN  270
            W++  N    V   P +      ++ Y+K  VVV D  + + KN
Sbjct  371  WAMFENSSEAVLTFPAKCGVHSGDFRYEKINVVVKDN-MANAKN  413



>ref|XP_010262713.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.2-like 
[Nelumbo nucifera]
Length=357

 Score =   213 bits (543),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 114/222 (51%), Positives = 154/222 (69%), Gaps = 6/222 (3%)
 Frame = -3

Query  932  KFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEAS  753
            + L VEFD   D K+ D +GNHVG+D+  L+S  V N+SS+ L LN GEKL +WIDY+AS
Sbjct  140  RLLAVEFDTSMDAKFADPDGNHVGIDIDGLISAAVTNLSSLGLVLNGGEKLHTWIDYDAS  199

Query  752  SKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWSFK  573
            SK LEVRLSK G+IRP   L+S  +DL++MWK++EV VG+S+S   N S   +VYSW+F+
Sbjct  200  SKYLEVRLSKLGDIRPSNALISYPIDLAEMWKDEEVLVGISSSSG-NSSQTTSVYSWNFR  258

Query  572  LRAAPDWMHSQPLDPKAF-RVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTLMVL-  399
            LR  P WMHSQPLDP+A+    KP  L+V K+ +EC ++IL  +IFGT CGAL TL+V+ 
Sbjct  259  LRRVPSWMHSQPLDPRAYSEHSKP--LTVRKK-NECLVRILTGVIFGTACGALTTLIVMI  315

Query  398  FVWSVLRNRRPIVPEELTPEPKEYEYKKFQVVVDDKAIKDGK  273
             +W+V  NRRP+ P E    P E  Y+K +V+ +  +  D K
Sbjct  316  LLWAVFANRRPVAPVEYPVHPVELGYEKIKVIREKASTDDKK  357



>ref|XP_008370040.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.2-like 
[Malus domestica]
Length=349

 Score =   213 bits (541),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 113/225 (50%), Positives = 148/225 (66%), Gaps = 13/225 (6%)
 Frame = -3

Query  944  KENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWID  765
            K  +K   V+FD L D   G+V   HVG+D+ S VS KV NVS+ NL+ +SG K Q+WID
Sbjct  136  KSKFKVAAVKFDALSD---GNV---HVGIDVGSSVSAKVSNVSAKNLDPSSGNKTQAWID  189

Query  764  YEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLST-SRLWNQSHKCNVY  588
            YEA S RLEVRLSK+G  +P  PLL   +DLS+MW + EV VGLS  SR  N S  C+VY
Sbjct  190  YEAGSNRLEVRLSKFGGSKPVDPLLWYPIDLSEMWGDKEVLVGLSAMSR--NSSQTCSVY  247

Query  587  SWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTL  408
            SWSF  R  P W HSQP+DPKA  + K  +    KR  +C  K  GA++FG  CGAL + 
Sbjct  248  SWSFVQRHVPHWTHSQPVDPKA--IAKNSKAEEKKR--DCTKKAFGAMVFGVACGALASF  303

Query  407  MVLFVWSVLRNRRPIVPEELTPEPKEYEYKKFQVVVDDKAIKDGK  273
            + L++W+V  NRRP+VP E   + KE+EY+K + V D+K ++DG+
Sbjct  304  VGLYLWTVFGNRRPVVPAEYAEKQKEFEYEKMRAVADNKTMEDGQ  348



>ref|XP_009370238.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.2-like 
[Pyrus x bretschneideri]
 ref|XP_009370254.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.2-like 
[Pyrus x bretschneideri]
Length=349

 Score =   212 bits (539),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 112/225 (50%), Positives = 148/225 (66%), Gaps = 13/225 (6%)
 Frame = -3

Query  944  KENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWID  765
            K  +K   V+FD L D   G+V   HVG+D+ S VSVKV NVS+ NL+ ++G K Q+WID
Sbjct  136  KSKFKIAAVKFDALSD---GNV---HVGIDVGSTVSVKVSNVSAKNLDPSNGNKTQAWID  189

Query  764  YEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLST-SRLWNQSHKCNVY  588
            YE  S + EVRLSK+G  +P  PLL   +DLS+MW + EV VGLS  SR  N S  C+VY
Sbjct  190  YEVGSNQFEVRLSKFGGSKPVDPLLWYPIDLSKMWGDKEVLVGLSAMSR--NSSQTCSVY  247

Query  587  SWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTL  408
            SWSF+ R  P W HSQP+DPKA    K  +    KR  +C  K  GA++FG  CGAL + 
Sbjct  248  SWSFEQRHVPHWTHSQPVDPKA--AAKNSKAEEKKR--DCTKKAFGAMVFGVACGALASF  303

Query  407  MVLFVWSVLRNRRPIVPEELTPEPKEYEYKKFQVVVDDKAIKDGK  273
            + L++W+V  NRRP+VPEE   + KE+EY+K + V D+K ++DGK
Sbjct  304  VGLYLWTVFGNRRPVVPEEYAEKQKEFEYEKMRAVADNKTMEDGK  348



>ref|XP_011076752.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.1-like 
[Sesamum indicum]
Length=358

 Score =   210 bits (534),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 111/230 (48%), Positives = 147/230 (64%), Gaps = 6/230 (3%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSW  771
            G  +  ++L VEFD   D+  GD+N NHVGVD+ +LVSVK  ++SSINL LNSG KL SW
Sbjct  132  GVSKESRYLAVEFDTSLDENVGDLNANHVGVDVGTLVSVKTSDISSINLVLNSGVKLHSW  191

Query  770  IDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNV  591
            IDY++SSKR+EVRLSK+G  RP  PLL   VDL +MW+++EV VGLS+S         +V
Sbjct  192  IDYDSSSKRIEVRLSKFGSSRPYDPLLVYQVDLGEMWRDEEVLVGLSSSS-GKSMQTTSV  250

Query  590  YSWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGT  411
            YSW F+ R+ P W+HSQPLDP+AF   K  +  + ++   C L  L  L+F  GCGAL  
Sbjct  251  YSWKFRTRSIPKWLHSQPLDPRAFS-SKHSKEKLAQKRKICALGFLSGLVFMIGCGALLA  309

Query  410  LMVLFVWSVLRNRRPIV---PEELTPEPKEYEYKKFQVVVDDKAIKDGKN  270
            L+VLF+W++  N    V   P + T     + Y+K  VVV D +  D KN
Sbjct  310  LIVLFLWALFDNGSETVLTIPTKCTAPSGGFRYEKINVVVGDNS-TDAKN  358



>ref|XP_008239852.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.2-like 
[Prunus mume]
Length=351

 Score =   209 bits (533),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 114/225 (51%), Positives = 149/225 (66%), Gaps = 11/225 (5%)
 Frame = -3

Query  944  KENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWID  765
            K  +K + V+F+ L+DDK       HVG+D+ S VS KV   SS NL L SG K  +WID
Sbjct  136  KGKFKVVAVKFNALRDDKV------HVGIDVGSSVSAKVSTSSSKNLNLTSGNKTHAWID  189

Query  764  YEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYS  585
            YEA S RLEVRLS++G  RP  PLL   +DLS++W+ ++VFVGLS     N S  C + S
Sbjct  190  YEAGSNRLEVRLSQFGHPRPADPLLWYPIDLSKLWEHEKVFVGLSAMNR-NSSQTCLITS  248

Query  584  WSFKLRAAPDWMHSQPLDPKAF-RVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTL  408
            WSF+ R  P WMHSQPLDPK F +  KP +    K   +C  ++ GA++FG  CGAL +L
Sbjct  249  WSFEQRHVPHWMHSQPLDPKVFAKNSKPVRGETKK---DCVKRVFGAMVFGVACGALASL  305

Query  407  MVLFVWSVLRNRRPIVPEELTPEPKEYEYKKFQVVVDDKAIKDGK  273
            + L++W+V  NRRP+VPE    +PKE+EY K +V VDDKAI+DGK
Sbjct  306  LALYLWTVFGNRRPVVPEGYAEQPKEFEYDKVKVGVDDKAIEDGK  350



>ref|XP_007218209.1| hypothetical protein PRUPE_ppa007818mg [Prunus persica]
 gb|EMJ19408.1| hypothetical protein PRUPE_ppa007818mg [Prunus persica]
Length=354

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 109/216 (50%), Positives = 147/216 (68%), Gaps = 2/216 (1%)
 Frame = -3

Query  932  KFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEAS  753
            +FLG+EFD   +    D+N NH+GVD+ S VS+ VGNVSS+NLELNSGEKL+SWIDY AS
Sbjct  135  RFLGIEFDTEMNGNVNDLNANHIGVDVGSFVSLTVGNVSSLNLELNSGEKLKSWIDYVAS  194

Query  752  SKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFV-GLSTSRLWNQSHKCNVYSWSF  576
            SKRLE+RLSK GE RP  P+ +  +DL  MWK ++V+V   S++   N S   +VYSWSF
Sbjct  195  SKRLEIRLSKLGEPRPYNPITAYGIDLLGMWKNEDVYVGISSSNSNGNSSQISSVYSWSF  254

Query  575  KLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTLMVLF  396
            +LR  P+ MHS P++P+ +     E LSV KR   C L +L  +IF TGCGAL   MVLF
Sbjct  255  RLRNIPNSMHSLPVNPRGYLDEHGEHLSVHKRR-VCPLTVLAGMIFVTGCGALVAFMVLF  313

Query  395  VWSVLRNRRPIVPEELTPEPKEYEYKKFQVVVDDKA  288
            +W+++ +R  + P E   +P ++ Y+K  VVV+  A
Sbjct  314  LWAIIISRHTVFPAEFPVKPVDFRYEKINVVVEKDA  349



>gb|AFK44294.1| unknown [Lotus japonicus]
Length=359

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 105/223 (47%), Positives = 142/223 (64%), Gaps = 5/223 (2%)
 Frame = -3

Query  935  YKFLGVEFDILKD-DKYGDVNGN-HVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDY  762
            +K +GV+F   KD    G  + N  V ++  S V  K+ N SS+N+ L SG KL +WIDY
Sbjct  139  FKAIGVQFSASKDGSNEGSASFNVAVAINFGSSVPAKIINTSSVNMSLRSGGKLHAWIDY  198

Query  761  EASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSW  582
            EASS+R+EVRLS++G+ RP  PLL   +D S + ++ E+F G S+ +  N S  C +YSW
Sbjct  199  EASSRRIEVRLSQYGQSRPADPLLWHSIDFSNVQEDKEMFAGFSSVKGNNTSQACFLYSW  258

Query  581  SFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTLMV  402
            SF+ R  P WMHS+PLDPK   V K  +    K   +C  K+L A+IFG GCGAL   MV
Sbjct  259  SFRARHFPHWMHSEPLDPKI--VAKNAETPAVKSRSDCLSKVLAAMIFGAGCGALTAFMV  316

Query  401  LFVWSVLRNRRPIVPEELTPEPKEYEYKKFQVVVDDKAIKDGK  273
            L+ W++  NRRP+VPEE   +P ++EYKK  +VV DK I D K
Sbjct  317  LYFWTIFGNRRPVVPEEYVVQPVDFEYKKVNIVV-DKTINDAK  358



>ref|XP_008233697.1| PREDICTED: lectin-like protein LEC [Prunus mume]
Length=354

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 109/216 (50%), Positives = 147/216 (68%), Gaps = 2/216 (1%)
 Frame = -3

Query  932  KFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEAS  753
            +FLG+EFD   +    D+N NH+GVD+ S VS+ VGNVSS+NLELNSGEKL+SWIDY AS
Sbjct  135  RFLGIEFDTEMNGNVNDLNANHIGVDVGSFVSLTVGNVSSLNLELNSGEKLKSWIDYVAS  194

Query  752  SKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFV-GLSTSRLWNQSHKCNVYSWSF  576
            SKRLE+RLSK GE RP  P+ +  +DL  MWK ++V+V   S++   N S   +VYSWSF
Sbjct  195  SKRLEIRLSKLGEPRPYNPITAYGIDLLGMWKNEDVYVGISSSNSNGNSSQISSVYSWSF  254

Query  575  KLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTLMVLF  396
            +LR  P+ MHS P++P+ +     E LSV KR   C L +L  +IF TGCGAL   MVLF
Sbjct  255  RLRNIPNSMHSLPVNPRGYLDEHGEHLSVHKRR-VCPLTVLAGMIFVTGCGALVAFMVLF  313

Query  395  VWSVLRNRRPIVPEELTPEPKEYEYKKFQVVVDDKA  288
            +W+++ +R  + P E   +P ++ Y+K  VVV+  A
Sbjct  314  LWAIIISRHTVFPAEFPVKPVDFRYEKINVVVEKDA  349



>ref|XP_010101839.1| putative inactive L-type lectin-domain containing receptor kinase 
III.1 [Morus notabilis]
 gb|EXB89976.1| putative inactive L-type lectin-domain containing receptor kinase 
III.1 [Morus notabilis]
Length=355

 Score =   205 bits (521),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 102/225 (45%), Positives = 145/225 (64%), Gaps = 2/225 (1%)
 Frame = -3

Query  947  EKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWI  768
            EK  +K + V+F  + D K   +   H G+D+  LV  KV N S+I+L LN+G+K  +W+
Sbjct  132  EKGKFKIVKVKFSTVNDVKNNGLVKIHAGIDVDGLVPTKVRNASTIDLALNNGKKSYAWV  191

Query  767  DYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVY  588
            DYEA SKRLEVRLS+ G ++P  PL    +DLS+MW  +E  VG  +    + S  C +Y
Sbjct  192  DYEAGSKRLEVRLSQSGYVKPSDPLFWYPIDLSRMWGNEEALVGFFSFSNSSSSQSCLIY  251

Query  587  SWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTL  408
            SWSF  R  P WMHS+PLDPKAF  G+  +    ++  +C  K+L +LIFG  CGAL   
Sbjct  252  SWSFLQRHVPQWMHSEPLDPKAF--GENSKPVKGEKRKDCFTKVLASLIFGVACGALMAF  309

Query  407  MVLFVWSVLRNRRPIVPEELTPEPKEYEYKKFQVVVDDKAIKDGK  273
             VL++W++   +RP+VPEE   +P ++EY+K +VVVD+K I+DGK
Sbjct  310  TVLYLWTIFGTKRPVVPEEYVGKPVDFEYEKVKVVVDNKTIEDGK  354



>ref|XP_008388104.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.2-like 
[Malus domestica]
 ref|XP_008359775.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.2-like 
[Malus domestica]
Length=351

 Score =   203 bits (516),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 114/222 (51%), Positives = 147/222 (66%), Gaps = 11/222 (5%)
 Frame = -3

Query  935  YKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEA  756
            +K + V+FD L D K       HVG+D+ S VS  V NVS+ NL  +SG K Q WIDYEA
Sbjct  139  FKVVAVKFDALSDGKV------HVGIDVGSSVSAXVSNVSAKNLGPSSGNKTQGWIDYEA  192

Query  755  SSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLST-SRLWNQSHKCNVYSWS  579
             S RLEVRLSK+G  +P  PLL   +DLS+MW + EVFVGLS  SR  N S  C+VYSWS
Sbjct  193  GSNRLEVRLSKFGGPKPVDPLLWYPIDLSKMWGDKEVFVGLSAMSR--NSSQTCSVYSWS  250

Query  578  FKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTLMVL  399
            F+ R  P WMHSQPLDPKA  V K  +    ++  +C  +  GA++FG  CGAL + + L
Sbjct  251  FEQRHVPHWMHSQPLDPKA--VAKNSKAEALEKKKDCTKRAFGAMVFGVACGALASFVGL  308

Query  398  FVWSVLRNRRPIVPEELTPEPKEYEYKKFQVVVDDKAIKDGK  273
            ++W+V  NRRP+VPE    + KE+EY+K +VV D+K I+DGK
Sbjct  309  YLWTVXGNRRPVVPEGYAEKSKEFEYEKMKVVADNKTIEDGK  350



>ref|XP_006435567.1| hypothetical protein CICLE_v10031876mg [Citrus clementina]
 gb|ESR48807.1| hypothetical protein CICLE_v10031876mg [Citrus clementina]
Length=369

 Score =   203 bits (517),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 113/227 (50%), Positives = 155/227 (68%), Gaps = 3/227 (1%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSW  771
            G     K+LG+EFD   DD  GDVN NHVGVD++SLVSV VGNVSS+NL LN+GEKL++W
Sbjct  143  GVSSEKKYLGIEFDTKMDDNVGDVNANHVGVDVNSLVSVSVGNVSSLNLVLNNGEKLKAW  202

Query  770  IDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNV  591
            IDY+ SSKR+EVRLSK+G+ RP  P+L+  +DL +MW  ++V+VG+ +S   ++    +V
Sbjct  203  IDYDLSSKRIEVRLSKFGDSRPYSPVLAYHIDLLKMWGNEDVYVGIFSSNGLSE-QTSSV  261

Query  590  YSWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGT  411
            +SW+F+LR+AP WMHS P DP+ +     E+L   KRS  C LK+   +IFGTGC AL  
Sbjct  262  FSWNFRLRSAPYWMHSLPADPRGYVDEHAERLREHKRS-ICPLKVFAGVIFGTGCAALMA  320

Query  410  LMVLFVWSVLRNRRPIVPEELTPEPKEYEYKKFQVVVDDKAIKDGKN  270
             ++L VWS+  NR  + P E    P ++ YKK  V+V++   K G N
Sbjct  321  FLILSVWSIFVNRDTVFPAEYQIRPADFRYKKINVIVEEDG-KRGNN  366



>ref|XP_003552217.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.2-like 
[Glycine max]
Length=358

 Score =   202 bits (515),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 106/228 (46%), Positives = 146/228 (64%), Gaps = 10/228 (4%)
 Frame = -3

Query  947  EKENYKFLGVEFDILKDDKYGDVNGNH---VGVDLSSLVSVKVGNVSSINLELNSGEKLQ  777
            ++  +K +GV+F       YG   G+    V +++ S V VK  N SS+ + L S  KL 
Sbjct  137  KEREFKVVGVQFS-----AYGRNGGSGSCIVSINVGSSVPVKTINASSVIMGLKSEGKLH  191

Query  776  SWIDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKC  597
            +WIDYEASSKRLEVRL+++G+ RP  PLL   +DLS +W  +E+F G ST +  N S  C
Sbjct  192  AWIDYEASSKRLEVRLNQYGQSRPVDPLLWHSMDLSNVWGTEEMFAGFSTVKENNTSQTC  251

Query  596  NVYSWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGAL  417
             +YSWSF +R  P WMHS+PL+PK     K E  +V  RSD C L++L A+IFG GCGAL
Sbjct  252  FLYSWSFIVRHFPHWMHSEPLNPKVL-AKKTETPAVKSRSD-CLLRVLAAMIFGAGCGAL  309

Query  416  GTLMVLFVWSVLRNRRPIVPEELTPEPKEYEYKKFQVVVDDKAIKDGK  273
               +VL++W++  N+RP+VPEE   +P ++EYKK  +VVD   I D K
Sbjct  310  TAFIVLYLWTIFGNKRPVVPEEYAMQPVDFEYKKVSIVVDKTTIIDAK  357



>gb|KHN08323.1| L-type lectin-domain containing receptor kinase VIII.2 [Glycine 
soja]
Length=358

 Score =   202 bits (514),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 106/228 (46%), Positives = 146/228 (64%), Gaps = 10/228 (4%)
 Frame = -3

Query  947  EKENYKFLGVEFDILKDDKYGDVNGNH---VGVDLSSLVSVKVGNVSSINLELNSGEKLQ  777
            ++  +K +GV+F       YG   G+    V +++ S V VK  N SS+ + L S  KL 
Sbjct  137  KEREFKVVGVQFS-----AYGRNGGSGSCIVSINVGSSVPVKTINASSVIMGLKSEGKLH  191

Query  776  SWIDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKC  597
            +WIDYEASSKRLEVRL+++G+ RP  PLL   +DLS +W  +E+F G ST +  N S  C
Sbjct  192  AWIDYEASSKRLEVRLNQFGQSRPVDPLLWHSMDLSNVWGTEEMFAGFSTVKENNTSQTC  251

Query  596  NVYSWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGAL  417
             +YSWSF +R  P WMHS+PL+PK     K E  +V  RSD C L++L A+IFG GCGAL
Sbjct  252  FLYSWSFIVRHFPHWMHSEPLNPKVL-AKKTETPAVKSRSD-CLLRVLAAMIFGAGCGAL  309

Query  416  GTLMVLFVWSVLRNRRPIVPEELTPEPKEYEYKKFQVVVDDKAIKDGK  273
               +VL++W++  N+RP+VPEE   +P ++EYKK  +VVD   I D K
Sbjct  310  TAFIVLYLWTIFGNKRPVVPEEYAMQPVDFEYKKVSIVVDKTTIIDAK  357



>ref|XP_007140433.1| hypothetical protein PHAVU_008G111500g [Phaseolus vulgaris]
 gb|ESW12427.1| hypothetical protein PHAVU_008G111500g [Phaseolus vulgaris]
Length=356

 Score =   202 bits (513),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 107/225 (48%), Positives = 146/225 (65%), Gaps = 6/225 (3%)
 Frame = -3

Query  947  EKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWI  768
            +K+ +K +GV+F +  D K G      V +++ S V VK  NVSS+ + L    KL +WI
Sbjct  137  KKKEFKVVGVQFSV--DGKNGSSGSCVVSINVGSSVPVKTINVSSVIMGLKREGKLHAWI  194

Query  767  DYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVY  588
            DY+ASSKRLEVRL+ +G+ RP  PLL   +DLS +W  +E+F G ST +  N S    +Y
Sbjct  195  DYQASSKRLEVRLNHYGQSRPSDPLLWHSIDLSNVWGTEEMFAGFSTLK-QNTSQASFLY  253

Query  587  SWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTL  408
            SWSF +R  P WMHS+PLDPK       E  +V  RSD C L++L A+IFG GCGAL   
Sbjct  254  SWSFIVRHFPHWMHSEPLDPKVLS-KNTETPAVKSRSD-CLLRVLAAMIFGAGCGALTAF  311

Query  407  MVLFVWSVLRNRRPIVPEELTPEPKEYEYKKFQVVVDDKAIKDGK  273
            +VL++W++  N+RP+VPEE   +P ++EYKK  +VV DK IKD K
Sbjct  312  IVLYLWTIFGNKRPVVPEEYAMQPVDFEYKKVNIVV-DKTIKDAK  355



>ref|XP_009344370.1| PREDICTED: L-type lectin-domain containing receptor kinase S.4-like 
[Pyrus x bretschneideri]
Length=361

 Score =   201 bits (510),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 104/219 (47%), Positives = 147/219 (67%), Gaps = 2/219 (1%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSW  771
            G K + +FLG+EFD   +    D+N NH+GVD+ S VS+ VGNVS +NL LNSGEKL+ W
Sbjct  136  GIKGDDRFLGIEFDTDMNGDMNDLNANHIGVDVGSFVSLAVGNVSKLNLVLNSGEKLKCW  195

Query  770  IDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFV-GLSTSRLWNQSHKCN  594
            IDY+ASSKRLE+RL K  E RP  P+ +  +D+S MW+ ++V+V   S++   N S   +
Sbjct  196  IDYDASSKRLEIRLGKMDESRPYAPISAYGIDMSGMWRGEDVYVGISSSNSNGNSSQISS  255

Query  593  VYSWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALG  414
            VYSW+F+LR  P  MHS P++P+ +  G  E LSV KR   C L +L  +IF TGCGAL 
Sbjct  256  VYSWNFRLRNVPKSMHSLPVNPRGYLDGHGESLSVQKRG-VCPLTVLAGMIFVTGCGALV  314

Query  413  TLMVLFVWSVLRNRRPIVPEELTPEPKEYEYKKFQVVVD  297
              ++LF+W+++ +R    P E +P+P E+ Y+K  VVV+
Sbjct  315  AFVMLFLWAIIISRHTEFPAEFSPKPAEFRYEKIDVVVE  353



>ref|XP_008381923.1| PREDICTED: L-type lectin-domain containing receptor kinase S.4-like 
[Malus domestica]
Length=359

 Score =   200 bits (509),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 104/222 (47%), Positives = 148/222 (67%), Gaps = 2/222 (1%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSW  771
            G K + +FLG+EFD   +    D+N NH+GVD+ S VS+ VGNVS +NL LNSGEKL+ W
Sbjct  135  GIKGDDRFLGIEFDTEMNGDMNDLNANHIGVDVGSFVSLAVGNVSELNLVLNSGEKLKCW  194

Query  770  IDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFV-GLSTSRLWNQSHKCN  594
            IDY+ASSKRLE+RL K  + RP  P+ +  +D+S MW+ ++V+V   S++   N S   +
Sbjct  195  IDYDASSKRLEIRLGKMDDSRPYTPITAYGIDMSGMWRGEDVYVGISSSNSNGNSSQISS  254

Query  593  VYSWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALG  414
            VYSW+F+LR  P  MHS P++P+ +  G  E LSV KR   C L +L  +IF TGCGAL 
Sbjct  255  VYSWNFRLRNVPKSMHSLPVNPRGYVDGHGESLSVQKRG-ICPLTVLARMIFVTGCGALV  313

Query  413  TLMVLFVWSVLRNRRPIVPEELTPEPKEYEYKKFQVVVDDKA  288
              ++LF+W+++ +R    P E +P+P E+ Y+K  VVV+  A
Sbjct  314  AFVMLFLWAIIISRHTEFPAEFSPKPVEFRYEKIDVVVEKDA  355



>ref|XP_009351458.1| PREDICTED: galactose-binding lectin-like [Pyrus x bretschneideri]
Length=363

 Score =   199 bits (505),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 100/213 (47%), Positives = 146/213 (69%), Gaps = 2/213 (1%)
 Frame = -3

Query  932  KFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEAS  753
            +FLG+EFD   +    D+N NH+GVD+ S VS+ VGNVS +NL LNSGEKL+ WIDY+AS
Sbjct  144  RFLGIEFDTEMNGDMNDLNANHIGVDVGSFVSLAVGNVSELNLVLNSGEKLKCWIDYDAS  203

Query  752  SKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKC-NVYSWSF  576
            SKRLE+RL K  E RP  P+ +  +DLS MW++++V+VG+S+S    +S +  +VYSW+F
Sbjct  204  SKRLEIRLGKVDESRPDNPITAYGIDLSGMWRDEDVYVGISSSNSNGKSSQISSVYSWNF  263

Query  575  KLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTLMVLF  396
            +LR  P  MHS P++P+ +  G  + LS+ K+   C L +L  +IF TGCGAL   +VLF
Sbjct  264  RLRNVPKSMHSLPVNPRGYLDGHGKNLSMDKQG-VCPLTVLAGMIFVTGCGALVAFVVLF  322

Query  395  VWSVLRNRRPIVPEELTPEPKEYEYKKFQVVVD  297
            +W+++ +R    P E   +P ++ Y+K  VVV+
Sbjct  323  LWAIIISRHTEFPAEFPAKPVDFRYEKIDVVVE  355



>ref|XP_002280264.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.2-like 
[Vitis vinifera]
Length=343

 Score =   198 bits (503),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 113/228 (50%), Positives = 146/228 (64%), Gaps = 11/228 (5%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSW  771
            G      FLGVEFD   D+  GD NGNHVG+D+ SLVS  V N+SS NL LNSG KL+SW
Sbjct  122  GLSRKILFLGVEFDTSMDENVGDPNGNHVGIDVGSLVSASVRNLSSANLLLNSGVKLRSW  181

Query  770  IDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNV  591
            IDY A+SKRL+V L K    RP  P+LS  +DLS+MWK +EVFVG+S S   N S   +V
Sbjct  182  IDYNANSKRLKVWLGKLESSRPNDPILSYPIDLSKMWKGEEVFVGISASSG-NSSQTSSV  240

Query  590  YSWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGT  411
            YSWSF+LR+ P+W+HSQP+DP+  R G+P ++   ++S  C L +L  +IF TGC AL  
Sbjct  241  YSWSFRLRSVPNWLHSQPVDPRRER-GEPLRM---QKSSVCPLTVLAGVIFSTGCLALMA  296

Query  410  LMVLFVWSVLRNRRPIVPEELTPE-----PKEYEYKKFQVVVDDKAIK  282
             + LFVW++   R   V    T E     P ++ Y+K   VVD K +K
Sbjct  297  FVFLFVWAIFVARHTTVAAAATEEEYPKFPVDFRYQKID-VVDTKDVK  343



>gb|KHN28781.1| L-type lectin-domain containing receptor kinase VIII.2 [Glycine 
soja]
Length=359

 Score =   198 bits (503),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 105/228 (46%), Positives = 145/228 (64%), Gaps = 10/228 (4%)
 Frame = -3

Query  947  EKENYKFLGVEFDILKDDKYGDVNGNH---VGVDLSSLVSVKVGNVSSINLELNSGEKLQ  777
            ++  +K +GV+F       YG   G+    V +++ S V VK  N SS+ + L S  KL 
Sbjct  138  KEREFKVIGVQFS-----AYGRNGGSGSCIVSINVGSSVPVKTINASSVIMGLKSEGKLH  192

Query  776  SWIDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKC  597
            +WIDYEASSKRLEVRL+++G+ RP  PLL   +DLS +W  +E+F G ST +  N S  C
Sbjct  193  AWIDYEASSKRLEVRLNQFGQSRPVDPLLWHSMDLSNVWGTEEMFAGFSTVKGNNTSQSC  252

Query  596  NVYSWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGAL  417
             +YSWSF +R  P WMHS+PLDPK F   K E  +V      C L++L A+IFG GCGAL
Sbjct  253  FLYSWSFIVRHFPHWMHSEPLDPK-FLAKKTETPTVKYYRSFCLLRVLAAMIFGAGCGAL  311

Query  416  GTLMVLFVWSVLRNRRPIVPEELTPEPKEYEYKKFQVVVDDKAIKDGK  273
               +VL++W++  N+RP+VPEE   +P +++YKK  +VV DK I D K
Sbjct  312  TAFIVLYLWTIFGNKRPVVPEEYAMQPVDFDYKKVNIVV-DKTIIDAK  358



>ref|XP_007133954.1| hypothetical protein PHAVU_010G006300g [Phaseolus vulgaris]
 gb|ESW05948.1| hypothetical protein PHAVU_010G006300g [Phaseolus vulgaris]
Length=348

 Score =   196 bits (498),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 104/224 (46%), Positives = 142/224 (63%), Gaps = 8/224 (4%)
 Frame = -3

Query  941  ENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDY  762
             N+  + VEF   +    G     +V + +   V  K+ N    +L L SGEKL +WIDY
Sbjct  133  RNFDVVSVEFSASEGGGNGVSASCNVTISVGGSVVAKISN----HLALTSGEKLHAWIDY  188

Query  761  EASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSW  582
            EASS+RLEVRLS  G+ RP  PLL   +DLS   KE+E+F G S+ +  N S  C +YSW
Sbjct  189  EASSRRLEVRLSHHGKSRPSVPLLWHSIDLSDALKENEMFAGFSSVK-GNDSQACFLYSW  247

Query  581  SFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTLMV  402
            SF LR+ P  MHS+PLDPK F   K  + SV K+  +C L++L A+IFGTGCGAL   +V
Sbjct  248  SFVLRSFPHSMHSEPLDPKVFV--KSTESSVVKQRSDCFLRVLAAMIFGTGCGALTAFIV  305

Query  401  LFVWSVLRNRRPIVPEELTPEPKEYEYKKFQVVVDDKAIKDGKN  270
            L++W++  N+R +VPEE   +P + EY+K ++VV DK I+D KN
Sbjct  306  LYLWTIFGNKRAVVPEETVMQPVDVEYRKVKIVV-DKTIQDRKN  348



>gb|KJB78811.1| hypothetical protein B456_013G020300 [Gossypium raimondii]
Length=359

 Score =   196 bits (498),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 98/215 (46%), Positives = 141/215 (66%), Gaps = 4/215 (2%)
 Frame = -3

Query  929  FLGVEFDILKDD-KYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEAS  753
            FLG+EFD  KDD K G+ N NHV +D+  + SVK+ N+SS+NL LNSG  L+SW+DY++S
Sbjct  137  FLGIEFDTKKDDDKAGNFNANHVSIDIHGVESVKLSNLSSLNLVLNSGNVLKSWVDYDSS  196

Query  752  SKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGL--STSRLWNQ-SHKCNVYSW  582
            SK L+VRLSK  E RP  P+L+  +DL +MW   +VFVG+  +TS   +Q S   NV+SW
Sbjct  197  SKLLQVRLSKLDENRPLNPILAYHIDLVEMWGNHDVFVGIISTTSDESSQISSNVNVHSW  256

Query  581  SFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTLMV  402
             F++   P WMHS P DP+++   K  + +  ++   C L IL  LIF TGCGAL   M+
Sbjct  257  RFRVNVVPSWMHSLPADPRSYMDKKDSEETREEKGKFCALPILARLIFATGCGALFAFMM  316

Query  401  LFVWSVLRNRRPIVPEELTPEPKEYEYKKFQVVVD  297
            LF+W++  +R  + P +  P  +++ Y+K  VVV+
Sbjct  317  LFMWAIFVSRHTVFPVKYQPSHEDFRYEKVNVVVE  351



>ref|XP_003529134.1| PREDICTED: L-type lectin-domain containing receptor kinase S.4-like 
[Glycine max]
Length=354

 Score =   195 bits (496),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 101/220 (46%), Positives = 141/220 (64%), Gaps = 9/220 (4%)
 Frame = -3

Query  947  EKENYKFLGVEFDILKDDKYGDVNGNH---VGVDLSSLVSVKVGNVSSINLELNSGEKLQ  777
            ++  +K +GV+F       YG   G+    V +++ S V VK  N SS+ + L S  KL 
Sbjct  138  KEREFKVIGVQFS-----AYGRNGGSGSCIVSINVGSSVPVKTINASSVIMGLKSEGKLH  192

Query  776  SWIDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKC  597
            +WIDYEASSKRLEVRL+++G+ RP  PLL   +DLS +W  +E+F G ST +  N S  C
Sbjct  193  AWIDYEASSKRLEVRLNQFGQSRPVDPLLWHSMDLSNVWGTEEMFAGFSTVKGNNTSQSC  252

Query  596  NVYSWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGAL  417
             +YSWSF +R  P WMHS+PLDPK F   K E  +V      C L++L A+IFG GCGAL
Sbjct  253  FLYSWSFIVRHFPHWMHSEPLDPK-FLAKKTETPTVKYYRSFCLLRVLAAMIFGAGCGAL  311

Query  416  GTLMVLFVWSVLRNRRPIVPEELTPEPKEYEYKKFQVVVD  297
               +VL++W++  N+RP+VPEE   +P +++YKK  +VVD
Sbjct  312  TAFIVLYLWTIFGNKRPVVPEEYAMQPVDFDYKKVNIVVD  351



>gb|KJB74194.1| hypothetical protein B456_011G278600 [Gossypium raimondii]
Length=341

 Score =   194 bits (492),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 97/215 (45%), Positives = 139/215 (65%), Gaps = 14/215 (7%)
 Frame = -3

Query  929  FLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEASS  750
            +LG+EFD  KDDK GD N NH+G+D++SL S+KV N+SS ++ LN+GE L+SW+DY++SS
Sbjct  129  YLGIEFDTQKDDKVGDFNANHIGIDINSLESIKVSNLSSSSMVLNNGEPLKSWVDYDSSS  188

Query  749  KRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWSFKL  570
            K L+VRLS +   RP  P+L+  +DL +MW   +VFVG+ ++ + N S   NVYSW F++
Sbjct  189  KLLQVRLSTFDSKRPFSPILTYSIDLLEMWGTKDVFVGIISTSI-NGSSFSNVYSWRFRV  247

Query  569  RAAPDWMHSQPLDPK----AFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTLMV  402
            R   + MHS P +P      FR GK         +  C L  L  LIFGTGCGAL   +V
Sbjct  248  RHVLNSMHSLPANPHKDSDGFRTGK---------NKFCALTFLAGLIFGTGCGALFAFVV  298

Query  401  LFVWSVLRNRRPIVPEELTPEPKEYEYKKFQVVVD  297
            LF+W++L +R  + P E    P+++ Y+   VVV+
Sbjct  299  LFMWAILVSRHSVFPVECQVSPEDFRYEMVDVVVE  333



>ref|XP_008367512.1| PREDICTED: L-type lectin-domain containing receptor kinase S.4-like 
[Malus domestica]
Length=363

 Score =   192 bits (487),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 101/216 (47%), Positives = 144/216 (67%), Gaps = 2/216 (1%)
 Frame = -3

Query  932  KFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEAS  753
            +FLG+EFD   +    D+N NH+GVD+ S VS+ VGNVS +NL LNSGEKL+ WIDY+AS
Sbjct  144  RFLGIEFDTEMNGDMNDLNANHIGVDVGSFVSLAVGNVSELNLVLNSGEKLKCWIDYDAS  203

Query  752  SKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFV-GLSTSRLWNQSHKCNVYSWSF  576
            SKRLE+RL K  E RP  P+ +  +DLS MW++++V+V   S++   N S   +VYSW+F
Sbjct  204  SKRLEIRLGKVDESRPYNPITAYGIDLSGMWRDEDVYVGISSSNSNGNSSQISSVYSWNF  263

Query  575  KLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTLMVLF  396
            +LR  P  MHS P++P+ +  G  + LS+ KR   C L +L  +IF TGCGAL   +VLF
Sbjct  264  RLRNVPKSMHSLPVNPRVYLDGHGKSLSMDKRG-VCPLTVLAGMIFVTGCGALVAFVVLF  322

Query  395  VWSVLRNRRPIVPEELTPEPKEYEYKKFQVVVDDKA  288
            + +++ +R    P EL  +P ++ Y+K  VVV+  A
Sbjct  323  LSAIIISRHTEFPAELPAKPVDFRYEKIDVVVEKDA  358



>gb|KEH23081.1| legume lectin beta domain protein [Medicago truncatula]
Length=352

 Score =   191 bits (485),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 98/225 (44%), Positives = 141/225 (63%), Gaps = 2/225 (1%)
 Frame = -3

Query  947  EKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWI  768
            +K++ K + VEF   +D +    +   + +D+   V VK  NVSS+N+ + +G KL  WI
Sbjct  129  KKKDSKVVAVEFLASRDVRNKSSDSFGMAIDVGDSVPVKRINVSSVNMVIRNGGKLHGWI  188

Query  767  DYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVY  588
            DY+++S+RLEVRLS++G  +P  PLL   VDLS  W  +E+F G S+ +    S  C +Y
Sbjct  189  DYDSNSRRLEVRLSRYGHSKPVNPLLWQSVDLSYNWTTEEIFAGFSSMK-GKTSQACFLY  247

Query  587  SWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTL  408
            SWSF +R    WMHS+P+D KA+           K   +C L+IL A+IFG+GCGAL   
Sbjct  248  SWSFDVRHFRHWMHSEPMDTKAYYAKNTYSPPADKPRSDCVLRILAAMIFGSGCGALAAF  307

Query  407  MVLFVWSVLRNRRPIVPEELTPEPKEYEYKKFQVVVDDKAIKDGK  273
             VL++W++  NRRP+VPEE   +P + EYKK  +VV DK +KDGK
Sbjct  308  TVLYLWTMFGNRRPVVPEECVMQPVDCEYKKVNIVV-DKPLKDGK  351



>ref|XP_006576579.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.2-like 
[Glycine max]
 gb|KHN27007.1| L-type lectin-domain containing receptor kinase VIII.2 [Glycine 
soja]
Length=350

 Score =   190 bits (483),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 102/222 (46%), Positives = 140/222 (63%), Gaps = 10/222 (5%)
 Frame = -3

Query  935  YKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEA  756
            ++ +GVEF   K  + G  +   V +++   V  K  N S        GEKL  WIDYEA
Sbjct  137  FEVVGVEFSASKSGRKGVSSSCDVNMNIGGSVVAKKSNTSI-------GEKLHVWIDYEA  189

Query  755  SSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWSF  576
            SS+RLEVRLS+ G+ RP YPL+   +DLS + KE+E+FVG S+ +  N S  C++YSWSF
Sbjct  190  SSRRLEVRLSQHGKARPSYPLMWHSIDLSNVLKENEMFVGFSSVKGNNDSQACDLYSWSF  249

Query  575  KLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTLMVLF  396
             LR  P  MHS+PLDPK F   K  +  V K+  +C L +L A+IFGTGCGAL   +VL+
Sbjct  250  VLRNFPHSMHSEPLDPKVFV--KNTESPVAKQRSDCFLSVLAAMIFGTGCGALTAFIVLY  307

Query  395  VWSVL-RNRRPIVPEELTPEPKEYEYKKFQVVVDDKAIKDGK  273
            +W++   N+R +VPEE   EP + +Y+K   +V DK I+DGK
Sbjct  308  LWTIFGNNKRAVVPEESLVEPVDVDYRKKVKIVVDKTIEDGK  349



>ref|XP_010690349.1| PREDICTED: probable L-type lectin-domain containing receptor 
kinase S.7 [Beta vulgaris subsp. vulgaris]
Length=357

 Score =   190 bits (483),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 105/215 (49%), Positives = 138/215 (64%), Gaps = 5/215 (2%)
 Frame = -3

Query  932  KFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEAS  753
            +F+ VE+D  KDD  GD+NGNHVGVD+ S VS    +VSSI L LN G  L+SWIDYEAS
Sbjct  143  QFVAVEYDTRKDDNVGDLNGNHVGVDVGSFVSSDTSDVSSIGLLLNGGVPLKSWIDYEAS  202

Query  752  SKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWSFK  573
            SKRLE+RL + G  +P  PL+S F+DLS+MW + EV VG+S+S   N     ++ SW FK
Sbjct  203  SKRLEIRLGESGSEKPSQPLISYFIDLSKMWGDKEVLVGISSSN-GNSMQVSSLSSWRFK  261

Query  572  LRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTLMVLFV  393
            +R+ P  +HS+PLDP+  R    EQ+ V +R     L ILG LIF TGCG L   + LFV
Sbjct  262  VRSVPGSLHSKPLDPEGQR---DEQVPV-RREKSSFLSILGGLIFATGCGTLVAFVALFV  317

Query  392  WSVLRNRRPIVPEELTPEPKEYEYKKFQVVVDDKA  288
            W V   R  +V  E+   P E +Y+K  V +D+ +
Sbjct  318  WVVFYGRHSVVAPEVPMNPVECKYEKVNVTIDNAS  352



>ref|XP_009777186.1| PREDICTED: L-type lectin-domain containing receptor kinase S.4-like 
[Nicotiana sylvestris]
Length=351

 Score =   189 bits (480),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 103/223 (46%), Positives = 138/223 (62%), Gaps = 5/223 (2%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSW  771
            G     +F GVEFD L +   GD + NHVGV++ SLVS K  NVS INL LNSG+KL SW
Sbjct  125  GLSNERRFFGVEFDTLLNKNVGDKSANHVGVNVGSLVSAKSTNVSFINLVLNSGKKLHSW  184

Query  770  IDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNV  591
            +DYE +SKRLEVRLS++G  RP  PLL   VDL+ MWK +EV VGLS+S   +     +V
Sbjct  185  VDYECTSKRLEVRLSEFGSPRPYDPLLVYQVDLASMWKGEEVLVGLSSST-GSSFQVTSV  243

Query  590  YSWSFKLRAAPDWMHSQPLDPKAFRVGKPEQL-SVPKRSDECGLKILGALIFGTGCGALG  414
            YSW F++R+ P W+HSQP DP   ++G    L  +  +     L  L   IF TGC AL 
Sbjct  244  YSWKFRVRSVPKWLHSQPADPH--KIGNEHSLEKMANKKRFHLLAFLSGFIFVTGCIALA  301

Query  413  TLMVLFVWSVL-RNRRPIVPEELTPEPKEYEYKKFQVVVDDKA  288
              + LF+W +L  N   ++P + +  P ++ Y+K  VVV+D +
Sbjct  302  AFIGLFLWVILGNNSEVVIPVKSSVHPGDFRYEKVNVVVEDDS  344



>ref|XP_004308913.1| PREDICTED: lectin-like protein LEC [Fragaria vesca subsp. vesca]
Length=369

 Score =   189 bits (481),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 105/222 (47%), Positives = 143/222 (64%), Gaps = 12/222 (5%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSW  771
            GEK   +FLG+EFD   +    DVN NHVGV++ S VSV VGNVS + L LNSGEK++SW
Sbjct  134  GEK---RFLGIEFDTEMNHNVNDVNANHVGVNVGSFVSVTVGNVSDLGLVLNSGEKMKSW  190

Query  770  IDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKC-N  594
            IDY+ASSKRLE+RLSK GE RP  P+++  VDL  MWK+ +V VG+S+S     S +  +
Sbjct  191  IDYDASSKRLEIRLSKMGEPRPYNPIVAYGVDLMAMWKDKDVNVGISSSNGNGSSSQISS  250

Query  593  VYSWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALG  414
            VY WSF+LR  P  MHS P++P+ +   K  + S   +   C L IL  +IF TGCGAL 
Sbjct  251  VYFWSFRLRNVPR-MHSLPVNPRDYLDDKHGEGSRLHKRMACPLSILAGIIFMTGCGALV  309

Query  413  TLMVLFVWSVLRNRRPIVPEE-------LTPEPKEYEYKKFQ  309
            + +VLF+W+++ NR  + P E       + P P ++ Y+K  
Sbjct  310  SFVVLFLWAIVANRHTVFPPEVLPAEFPVKPSPTDFRYEKIS  351



>ref|XP_007205667.1| hypothetical protein PRUPE_ppa009494mg [Prunus persica]
 gb|EMJ06866.1| hypothetical protein PRUPE_ppa009494mg [Prunus persica]
Length=290

 Score =   186 bits (473),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 101/213 (47%), Positives = 137/213 (64%), Gaps = 11/213 (5%)
 Frame = -3

Query  944  KENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWID  765
            K  +K + V+F+ L+D K       HVG+D+ S VS KV   SS NL L SG K  +WID
Sbjct  88   KGKFKVVAVKFNALRDAKV------HVGIDVGSSVSAKVSTSSSKNLNLTSGNKTHAWID  141

Query  764  YEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYS  585
            YEA S RLEVRLS++   RP  PLL   +DLS++W+ ++VFVGLS     N S  C + S
Sbjct  142  YEAGSNRLEVRLSQFAHPRPADPLLWYPIDLSELWEHEKVFVGLSAMNR-NSSQTCLITS  200

Query  584  WSFKLRAAPDWMHSQPLDPKAF-RVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTL  408
            WSF+ R  P WMHSQPLDP+ F +  KP ++   K   +C  ++ GA++FG  CGAL +L
Sbjct  201  WSFEQRHVPHWMHSQPLDPEVFAKNSKPVRVETKK---DCVKRVFGAMVFGVACGALASL  257

Query  407  MVLFVWSVLRNRRPIVPEELTPEPKEYEYKKFQ  309
            + L++W+V  NRRP+VPE    +PKE+EY K +
Sbjct  258  LALYLWTVFGNRRPVVPEGYAEQPKEFEYDKVK  290



>ref|XP_009596223.1| PREDICTED: L-type lectin-domain containing receptor kinase S.4-like 
[Nicotiana tomentosiformis]
Length=344

 Score =   188 bits (477),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 101/221 (46%), Positives = 136/221 (62%), Gaps = 5/221 (2%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSW  771
            G     ++ G+EFD L ++  GD N NHVGV++ S+VS K  NVS INL LNSG+KL SW
Sbjct  120  GLSNERRYFGIEFDTLLNENVGDKNANHVGVNVGSIVSAKSTNVSFINLVLNSGKKLHSW  179

Query  770  IDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNV  591
            +DYE +SKRLEVRLS++G  +P  PLL   VDL  MWK +EV  GLS+S   +     +V
Sbjct  180  VDYECTSKRLEVRLSEFGSPKPYDPLLVYQVDLGNMWKGEEVLAGLSSST-GSSFQVTSV  238

Query  590  YSWSFKLRAAPDWMHSQPLDPKAFRVGKPEQL-SVPKRSDECGLKILGALIFGTGCGALG  414
            YSW F++R+ P W+HSQP DP   ++G    L  +  +     L  L   IF TGC AL 
Sbjct  239  YSWKFRVRSVPKWLHSQPADPH--KIGNEHSLEKMANKRRFHLLAFLSGFIFATGCIALA  296

Query  413  TLMVLFVWSVLRNRRPIV-PEELTPEPKEYEYKKFQVVVDD  294
              + LF+W +L N   +V P + +  P ++ Y+K  VVVDD
Sbjct  297  AFVGLFLWVLLGNNSEVVIPAKSSVHPGDFRYEKVNVVVDD  337



>ref|XP_003516924.1| PREDICTED: L-type lectin-domain containing receptor kinase I.7-like 
[Glycine max]
Length=348

 Score =   187 bits (476),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 107/222 (48%), Positives = 142/222 (64%), Gaps = 12/222 (5%)
 Frame = -3

Query  935  YKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEA  756
            ++ +GVEF   K  + G  +  HV +++   V+ K    +SI      GEKL  WIDYEA
Sbjct  137  FEVVGVEFSASKGGRKGVSSSCHVNMNIGGFVAKKSN--TSI------GEKLHVWIDYEA  188

Query  755  SSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWSF  576
            SSKRLEVRLS+ G+ RP YPLL   +DLS + KE E+ VG S+ +  N S  C +YSWSF
Sbjct  189  SSKRLEVRLSQHGKSRPSYPLLWQSIDLSNVLKEKEMLVGFSSVK-GNDSQACFLYSWSF  247

Query  575  KLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTLMVLF  396
             LR  P  MHS+PLDPK F V   E   V +RSD C L++L A+IFGTGCGAL   +VL+
Sbjct  248  VLRNFPHSMHSEPLDPKVF-VKNTESPVVKQRSD-CFLRVLAAMIFGTGCGALTAFIVLY  305

Query  395  VWSVL-RNRRPIVPEELTPEPKEYEYKKFQVVVDDKAIKDGK  273
            +W++   N+R +VPEE   +P + EY+K   +V DK I+DGK
Sbjct  306  LWTIFGNNKRAVVPEESVVQPVDVEYRKNVRIVVDKTIEDGK  347



>ref|XP_004492393.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.2-like 
[Cicer arietinum]
Length=362

 Score =   187 bits (475),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 99/228 (43%), Positives = 141/228 (62%), Gaps = 6/228 (3%)
 Frame = -3

Query  947  EKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWI  768
            EKE+ K +GV+F   +DD         V +++ S + VK  N+SS+N  + +G KL +WI
Sbjct  137  EKES-KVIGVKFIASRDDGNESSASFSVAINVGSSIHVKTINISSVNTVIRNGGKLHAWI  195

Query  767  DYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVY  588
            DY+++S+RLEVRLS++G  +P  PLL   ++   +WK +E+F G  TS     S  C +Y
Sbjct  196  DYDSNSRRLEVRLSRYGHSKPVDPLLWQTINFFNLWKPEEMFAGF-TSMKGKTSQACFLY  254

Query  587  SWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVP---KRSDECGLKILGALIFGTGCGAL  417
            SWSF +R  P  +HS+P DP  F     E  S P   K   +C L+IL A+IFGT CGAL
Sbjct  255  SWSFIVRHFPHSVHSEPQDPNVFVAKNTESYSPPVTVKPRSDCLLRILAAMIFGTVCGAL  314

Query  416  GTLMVLFVWSVLRNRRPIVPEELTPEPKEYEYKKFQVVVDDKAIKDGK  273
                VL++W++  NRRP+VPEE   +P ++EYKK  +VV DK +KD K
Sbjct  315  SAFTVLYLWTMFGNRRPVVPEECVMQPVDFEYKKVNIVV-DKPLKDAK  361



>gb|KHN26218.1| L-type lectin-domain containing receptor kinase I.7 [Glycine 
soja]
Length=348

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 106/222 (48%), Positives = 142/222 (64%), Gaps = 12/222 (5%)
 Frame = -3

Query  935  YKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEA  756
            ++ +GVEF   K  + G  +  HV +++   V+ K    +SI      GEKL  WIDYEA
Sbjct  137  FEVVGVEFSASKGGRKGVSSSCHVNMNIGGFVAKKSN--TSI------GEKLHVWIDYEA  188

Query  755  SSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWSF  576
            SS+RLEVRLS+ G+ RP YPLL   +DLS + KE E+ VG S+ +  N S  C +YSWSF
Sbjct  189  SSRRLEVRLSQHGKSRPSYPLLWQSIDLSNVLKEKEMLVGFSSVK-GNDSQACFLYSWSF  247

Query  575  KLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTLMVLF  396
             LR  P  MHS+PLDPK F V   E   V +RSD C L++L A+IFGTGCGAL   +VL+
Sbjct  248  VLRNFPHSMHSEPLDPKVF-VKNTESPVVKQRSD-CFLRVLAAMIFGTGCGALTAFIVLY  305

Query  395  VWSVL-RNRRPIVPEELTPEPKEYEYKKFQVVVDDKAIKDGK  273
            +W++   N+R +VPEE   +P + EY+K   +V DK I+DGK
Sbjct  306  LWTIFGNNKRAVVPEESVVQPVDVEYRKNVRIVVDKTIEDGK  347



>emb|CBI30447.3| unnamed protein product [Vitis vinifera]
Length=235

 Score =   181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 117/165 (71%), Gaps = 5/165 (3%)
 Frame = -3

Query  836  VKVGNVSSINLELNSGEKLQSWIDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWK  657
            + V NVSSI+L LN+GE+L  WIDYEA SKRLEVRLSK+G+IRP  P +S  +DLS+MW 
Sbjct  8    ITVSNVSSIDLVLNNGERLNCWIDYEAGSKRLEVRLSKFGDIRPVSPFISHPIDLSEMWN  67

Query  656  EDEVFVGLSTSRLWNQSHKCNVYSWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRS  477
            EDEV+VG S+S   N S  C VYSWSF  R  P WMHSQPLDPK  +     Q    KR+
Sbjct  68   EDEVYVGFSSSSG-NSSQTCVVYSWSFNTRPVPHWMHSQPLDPKTLKEDMRPQTVHEKRA  126

Query  476  DECGLKILGALIFGTGCGALGTLMVLFVWSVLRNRRPI--VPEEL  348
              C L++L ALIFGTGCGALG  + LF+ ++  NRRP+  VPEEL
Sbjct  127  --CLLRVLAALIFGTGCGALGAFIALFLCTIFGNRRPVVPVPEEL  169



>ref|XP_010037751.1| PREDICTED: probable L-type lectin-domain containing receptor 
kinase S.7 [Eucalyptus grandis]
 gb|KCW49484.1| hypothetical protein EUGRSUZ_K03005 [Eucalyptus grandis]
Length=365

 Score =   184 bits (468),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 105/218 (48%), Positives = 141/218 (65%), Gaps = 14/218 (6%)
 Frame = -3

Query  926  LGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEASSK  747
            + VEFD +K         N V +D   L  VK  N+SS++L LNSG KL SWIDYEA S+
Sbjct  155  VAVEFDSVK---------NAVAIDAGGLGPVKAKNLSSLDLVLNSGSKLHSWIDYEAGSR  205

Query  746  RLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWSFKLR  567
            RLEVR+S+  E RP  P L+ FVDL  MWKE +VF+   +S   N S  C ++SWSFKLR
Sbjct  206  RLEVRVSRSSESRPSDPTLARFVDLWTMWKEGDVFL-GLSSSNGNSSQACFIHSWSFKLR  264

Query  566  AAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTLMVLFVWS  387
              P  MHS+P+DP+A R    + L   +++D C LK+L A++FGTG GALG  +VL++W+
Sbjct  265  HVPRSMHSEPVDPQAIRQ-NAKNLGAHEKND-CFLKVLAAMVFGTGSGALGAFVVLYLWT  322

Query  386  VLRNRRPIVPEELTPEPKEYEY-KKFQVVVDDK-AIKD  279
            +  NRRP+ PEE   EP + +   K +V+V DK A+KD
Sbjct  323  IFGNRRPVAPEEFVVEPVDLKKCNKLEVIVVDKEAVKD  360



>ref|XP_010067479.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.2-like 
[Eucalyptus grandis]
 gb|KCW65623.1| hypothetical protein EUGRSUZ_G03015 [Eucalyptus grandis]
Length=354

 Score =   180 bits (457),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 102/227 (45%), Positives = 146/227 (64%), Gaps = 6/227 (3%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSW  771
            G   + +F+ VE+D   +++ GDVN NHVGVDL +  SV V N SS+ L L+SGEKL+SW
Sbjct  134  GLSGDRRFVAVEYDAWMNEEVGDVNANHVGVDLGNFRSVSVCNASSVGLALSSGEKLKSW  193

Query  770  IDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNV  591
            +DY+ SSKRLEVRLSK+ + RP  P+++  +DL +MWK ++V+VG+S++   N S   +V
Sbjct  194  VDYDGSSKRLEVRLSKFRDPRPYDPIIAYSIDLLRMWKGEDVYVGISSAN-GNSSQTISV  252

Query  590  YSWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGT  411
            YSW FK R  P  MHS P  P  +     E   + KR + C L ILG +IF TGCGAL  
Sbjct  253  YSWRFKPRKIPMSMHSLPARPHGY---SSEHGKLRKRGN-CPLAILGRVIFATGCGALLA  308

Query  410  LMVLFVWSVLRNRRPIVPEELTPEPKEYEYKKFQVVVDDKAIKDGKN  270
             + LF+W+++ NR  + P E    P +++Y+K  VV   K ++ GK+
Sbjct  309  FLGLFLWAIVANRHTVFPAECPVHPADFKYEKINVVA-GKDVEGGKH  354



>ref|XP_012088132.1| PREDICTED: L-type lectin-domain containing receptor kinase S.4-like 
[Jatropha curcas]
 gb|KDP44843.1| hypothetical protein JCGZ_01343 [Jatropha curcas]
Length=343

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/219 (43%), Positives = 134/219 (61%), Gaps = 11/219 (5%)
 Frame = -3

Query  929  FLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEASS  750
            +L ++F +  D   GD N        + +VSV V N  S +    SGEKL+SWIDY+ASS
Sbjct  134  YLCIKFGVSTDSNVGDSN--------TIIVSVTVDNEPSTHFTTKSGEKLRSWIDYDASS  185

Query  749  KRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWSFKL  570
            +RLEVRLSK  + RP  P+++  +DL +MW+++EV+VGL +    N S K  VYSW F+L
Sbjct  186  RRLEVRLSKLSDKRPYNPIMAYSIDLYKMWEDNEVYVGLGSKHNGNLSDKSYVYSWRFRL  245

Query  569  RAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTLMVLFVW  390
            R  P WMHS P++P A +    E + V +R   C L IL  +IF TGCGAL    VLF W
Sbjct  246  RKIPYWMHSLPVNPNASKDNSNEIVKVQRR-KFCPLTILAGMIFATGCGALLAFAVLFAW  304

Query  389  SVLRNRRPIVPEELTPEPKEYEYKKFQVVV--DDKAIKD  279
            ++  +RR + P +   +P ++ Y+K  VVV  D+K +K+
Sbjct  305  AIFVSRRTVFPIDGDVQPVDFRYQKVCVVVEKDEKVLKN  343



>ref|XP_008448934.1| PREDICTED: L-type lectin-domain containing receptor kinase S.4 
[Cucumis melo]
Length=372

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 102/230 (44%), Positives = 144/230 (63%), Gaps = 12/230 (5%)
 Frame = -3

Query  944  KENYKFLGVEFDILKDDKYGDVNGNHVGVDL---SSLVSVKVGNVSSINLELNSGEKLQS  774
            K+    + V+F    D + GD+    VG+D+   S+      GN S+ +     G+ L +
Sbjct  139  KQKLNMILVKFTTSSDAENGDLIKTLVGIDVGYKSNKSLADSGNFSNSSWASIRGKNLHA  198

Query  773  WIDYEASSKRLEVRLSK-WGEIRPGYPLLSCFVDLSQMWKEDE-VFVGLSTSRLWNQSHK  600
            WIDYE  S++LEVRL++     RP  PLLS  +DLSQ+W E+E V VGLS+S+  N S  
Sbjct  199  WIDYEVGSRQLEVRLAENSNNKRPFAPLLSYPIDLSQIWGENEEVLVGLSSSK-GNPSQP  257

Query  599  CNVYSWSFKLRAAPDWMHSQPLDPKAFRVGK---PEQLSVPKRSDECGLKILGALIFGTG  429
            C VYSWSFK+++ P+WMHS+PLDPK   V +   PE + V +    C +K++ A IFGTG
Sbjct  258  CLVYSWSFKVKSIPNWMHSEPLDPKTIAVARESDPESV-VKEEGKNCLMKVVAATIFGTG  316

Query  428  CGALGTLMVLFVWSVLRNRRPIVPEELTPEPKEYEYKKFQVVVDDKAIKD  279
            CGAL   + L++W++  NRRP+VPEE   +  + +YKK  VVV DKAI+D
Sbjct  317  CGALTAFVGLYLWTIFGNRRPVVPEEFAVQQMDVKYKK--VVVLDKAIED  364



>ref|XP_011036078.1| PREDICTED: L-type lectin-domain containing receptor kinase S.4-like 
[Populus euphratica]
Length=343

 Score =   174 bits (440),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 97/220 (44%), Positives = 132/220 (60%), Gaps = 15/220 (7%)
 Frame = -3

Query  929  FLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSS-INLELNSGEKLQSWIDYEAS  753
            +LGVE   L D   GD N        +SL++V + N SS + LE N+GEKL+SW+DY+ S
Sbjct  134  YLGVEIGSLSDSNVGDFN--------ASLLAVGISNASSSVRLETNTGEKLKSWVDYKVS  185

Query  752  SKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWSFK  573
             KRLEVRLSK G+ RP  P ++  +DLS+ W ++EV+V L +         C VYSW F+
Sbjct  186  LKRLEVRLSKVGDERPHSPTIAYSIDLSKTWGDNEVYVALQSFN-GKSLETCTVYSWRFR  244

Query  572  LRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTLMVLFV  393
            LR  P+ MHS P DP  +     E+L V KR   C L +L  +IF TGCGA+    VLFV
Sbjct  245  LRKVPNRMHSLPADPHGYVDEPNEELRVHKR-RFCPLSVLAGIIFVTGCGAMLAFAVLFV  303

Query  392  WSVLRNRRPIVPEELTPEPKEYEYKKFQVVVDDKAIKDGK  273
            W+V  NR  + P E   +P +++Y+K  VVV+    KDG+
Sbjct  304  WAVFVNRHTVFPREGNVKPVDFKYEKISVVVE----KDGE  339



>ref|XP_004147898.1| PREDICTED: L-type lectin-domain containing receptor kinase S.4 
[Cucumis sativus]
 gb|KGN54345.1| hypothetical protein Csa_4G307380 [Cucumis sativus]
Length=373

 Score =   174 bits (441),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 101/230 (44%), Positives = 143/230 (62%), Gaps = 12/230 (5%)
 Frame = -3

Query  944  KENYKFLGVEFDILKDDKYGDVNGNHVGVDL---SSLVSVKVGNVSSINLELNSGEKLQS  774
            K+    + V+F    D + GD+    VG+D+   S+      GN S+ +     G+ L +
Sbjct  139  KQKLNMILVKFTTSSDAENGDLIKTFVGIDVGYKSNKSLADSGNFSNSSWASIRGKNLHA  198

Query  773  WIDYEASSKRLEVRLS-KWGEIRPGYPLLSCFVDLSQMWKEDE-VFVGLSTSRLWNQSHK  600
            WIDY+  S++LEVRL+      RP  PLLS  VDLSQ+W E+E V VGLS+S+  N S  
Sbjct  199  WIDYQVGSRQLEVRLAGNSNNKRPFAPLLSYPVDLSQIWGENEEVLVGLSSSK-GNSSQP  257

Query  599  CNVYSWSFKLRAAPDWMHSQPLDPKAFRVGK---PEQLSVPKRSDECGLKILGALIFGTG  429
            C VYSW+FK+++ P+WMHS+PLDPK   V +   PE + V +    C +K++ A IFGTG
Sbjct  258  CLVYSWNFKVKSIPNWMHSEPLDPKTIAVARESEPESV-VKEEGRNCLMKVVAATIFGTG  316

Query  428  CGALGTLMVLFVWSVLRNRRPIVPEELTPEPKEYEYKKFQVVVDDKAIKD  279
            CGAL   + L++W++  NRRP+VPEE   +  + +YKK  VVV DKAI+D
Sbjct  317  CGALTAFVGLYLWTIFGNRRPVVPEEFAVQQMDVKYKK--VVVLDKAIED  364



>ref|XP_006591367.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.2-like 
[Glycine max]
Length=358

 Score =   174 bits (440),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 97/228 (43%), Positives = 131/228 (57%), Gaps = 10/228 (4%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSW  771
            G   NY  +GVEFD  KDD  GD N NHV +D+ S VSV + NVS +NL LN+GEKLQ+W
Sbjct  135  GNVSNY--VGVEFDTSKDDNAGDPNANHVSIDVGSHVSVAIANVSDLNLVLNNGEKLQAW  192

Query  770  IDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNV  591
            +DYEASSK LEVRLSKWGE +P  P++S  +D S++W ++ V   LS+S   +     +V
Sbjct  193  VDYEASSKVLEVRLSKWGEQKPSDPIVSHDIDFSKIWGKNPVIAALSSSNGAHSVQVVSV  252

Query  590  YSWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGT  411
            YSW   L+   + +HS P DP +       +     +   C L +L  +IFGTGC AL T
Sbjct  253  YSWRVSLKKVSNGLHSLPADPHSN--NNNNKFEDEHKKSVCPLTVLAWVIFGTGCVALVT  310

Query  410  LMVLFVWSVLRNRRPIVPEELTPEP----KEYEYKKFQVVVDDKAIKD  279
             +VLF+W +   +     E L   P     +  Y++  V VD  A  D
Sbjct  311  FVVLFMWVIFFQKGE--EESLVKIPDHPSSDVRYERIDVAVDKNAHDD  356



>ref|XP_002316243.2| hypothetical protein POPTR_0010s20190g [Populus trichocarpa]
 gb|EEF02414.2| hypothetical protein POPTR_0010s20190g [Populus trichocarpa]
Length=343

 Score =   173 bits (438),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 98/220 (45%), Positives = 133/220 (60%), Gaps = 15/220 (7%)
 Frame = -3

Query  929  FLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSS-INLELNSGEKLQSWIDYEAS  753
            +LGVE   L D   GD N        +SLV+V V N SS ++LE N+GEKL+SW+DY+ S
Sbjct  134  YLGVEIGSLSDSNVGDFN--------ASLVAVGVSNASSSVHLETNTGEKLKSWVDYKVS  185

Query  752  SKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWSFK  573
             KRLEVRLSK G+ RP  P ++  +DLS+ W ++EV+V L +         C VYSW F+
Sbjct  186  LKRLEVRLSKVGDERPHNPTIAYSIDLSKTWGDNEVYVALQSFN-GKSLETCIVYSWRFR  244

Query  572  LRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTLMVLFV  393
            LR  P+ MHS P DP  +     E+L V KR   C L +L  +IF TGCGA+    VLFV
Sbjct  245  LRKVPNRMHSLPADPHGYVDEPNEELRVHKR-RFCPLSVLAGIIFVTGCGAMLAFAVLFV  303

Query  392  WSVLRNRRPIVPEELTPEPKEYEYKKFQVVVDDKAIKDGK  273
            W+V  NR  + P +   +P +++Y+K  VVV+    KDG+
Sbjct  304  WAVFVNRHTVFPTKGNVKPVDFKYEKISVVVE----KDGE  339



>ref|XP_006601971.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.2-like 
[Glycine max]
Length=352

 Score =   170 bits (431),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 97/230 (42%), Positives = 131/230 (57%), Gaps = 14/230 (6%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSW  771
            G   NY  +GVEFD  KDD  GD N NHVG+D+ S VSV V NVS ++L LN+GEKL +W
Sbjct  129  GNLSNY--VGVEFDTSKDDNVGDPNANHVGIDVGSHVSVAVANVSDVHLVLNNGEKLNAW  186

Query  770  IDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNV  591
            +DYEASSK LEVRLSKWG  +P  P++S  +D S++W  + V  G+S+S   +     +V
Sbjct  187  VDYEASSKVLEVRLSKWGAQKPSDPIVSHDIDFSKIWGANPVIAGISSSNGAHSVQVVSV  246

Query  590  YSWSFKLR--AAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGAL  417
            YSW   L+  +  + +HS P DP      K E     +    C L +L  +IFGTGC A+
Sbjct  247  YSWKLSLKKVSVSNGLHSLPADPHGNNNNKFED----EHKKLCPLTVLAGVIFGTGCVAM  302

Query  416  GTLMVLFVWSVLRNRRPIVPEELTPEPK----EYEYKKFQVVVDDKAIKD  279
             T +VLF+W +   +     E L   P     +  Y++  V VD  A  D
Sbjct  303  VTFVVLFMWVIFFQKGE--EESLVKIPNHPSSDVRYERIDVAVDKNAHGD  350



>ref|XP_007163496.1| hypothetical protein PHAVU_001G239200g [Phaseolus vulgaris]
 gb|ESW35490.1| hypothetical protein PHAVU_001G239200g [Phaseolus vulgaris]
Length=345

 Score =   168 bits (425),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 87/217 (40%), Positives = 126/217 (58%), Gaps = 9/217 (4%)
 Frame = -3

Query  926  LGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEASSK  747
            + VEFD  KD+  GD N NHVG+D+ S VS+ V NVS +NL LN+GEKL +W+DYEA SK
Sbjct  135  VAVEFDTSKDENVGDPNSNHVGIDVGSHVSLAVANVSDVNLVLNNGEKLNAWVDYEAGSK  194

Query  746  RLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWSFKLR  567
             +EVRLSKWGE +P  P++S  +D  ++W  + VF G+++S   +     ++YSW  ++ 
Sbjct  195  GMEVRLSKWGEKKPSDPIVSLKIDFYKIWHGNPVFAGITSSNGGHWMQVVSIYSWRLRMN  254

Query  566  AAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTLMVLFVWS  387
                 +HS P+DP          LS  +    C L +L  +IFGTGC AL T +VLF+W 
Sbjct  255  KVSTGLHSLPVDPHG--------LSEDEHRRACPLTVLAGVIFGTGCVALVTFVVLFMWV  306

Query  386  VLRNRRPIVPEELTPE-PKEYEYKKFQVVVDDKAIKD  279
            +   +         P+ P +  Y++  V V+  A  D
Sbjct  307  IFFQKGSEESLAKIPDHPSDVRYERIDVAVERNAQDD  343



>ref|XP_004506648.1| PREDICTED: L-type lectin-domain containing receptor kinase I.7-like 
[Cicer arietinum]
Length=367

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 95/232 (41%), Positives = 138/232 (59%), Gaps = 12/232 (5%)
 Frame = -3

Query  947  EKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWI  768
            + E++  + VEFD  +D    ++    +   + S V  K  +    NL L S EKL +WI
Sbjct  138  KNEDFDVINVEFDASRDSNKNEI---LISSKVGSSVFAKRSSTYFTNLGLKSDEKLHAWI  194

Query  767  DYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVY  588
            DYEASS+RLEVRLSK G  +P  PLL   +D++ + K  E+F+G S S +  +S+   +Y
Sbjct  195  DYEASSRRLEVRLSKHGNSKPSDPLLWHKIDITNVLKAKEMFIGFSPSNVKGKSN-VFLY  253

Query  587  SWSFKLRAAPDW-MHSQPLDPKAFRVGKPEQLSVPK----RSDECGLKILGALIFGTGCG  423
            SWSF +R  P   MHS PLDPK F        ++ +    + ++C L+IL A+IFGTGCG
Sbjct  254  SWSFVMRRFPTHSMHSDPLDPKVFVKNSETATTIEQKEKAKKNDCVLRILAAMIFGTGCG  313

Query  422  ALGTLMVLFVWSVLRNRRP--IVPEELTPEPKEYEYKKFQVVVD-DKAIKDG  276
            AL    VL++W++  N+R   +VPE    +P + EYKK ++VVD +K I DG
Sbjct  314  ALTAFTVLYLWTIFGNKRAVVVVPEGCVMQPLDVEYKKVKIVVDNNKTIGDG  365



>gb|ACJ84633.1| unknown [Medicago truncatula]
Length=252

 Score =   162 bits (410),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 89/185 (48%), Positives = 120/185 (65%), Gaps = 12/185 (6%)
 Frame = -3

Query  809  NLELNSGEKLQSWIDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLS  630
            NL L SGEKL +WIDYEASS+RLEVRLSK G  +P  PLL   +D+S + KE+E+FVG S
Sbjct  71   NLALKSGEKLHTWIDYEASSRRLEVRLSKHGNSKPLDPLLWHKIDISNVLKEEEMFVGFS  130

Query  629  TSRLWNQSHKCNVYSWSFKLRA-APDWMHSQPLDPKAFRVGKPEQLSVPK-----RSDEC  468
              +     +   +YSWSF +R   P  MHS+PLDP    V K E   V K     + ++C
Sbjct  131  HVK----GNNAFLYSWSFVMRNFPPHSMHSEPLDPNV-SVKKSETSMVVKPKEKAKKNDC  185

Query  467  GLKILGALIFGTGCGALGTLMVLFVWSVLRNRR-PIVPEELTPEPKEYEYKKFQVVVDDK  291
             L++L A+IFGTGCGAL    VL++W++  N+R  +VPE  + +P + EY+K ++VVD K
Sbjct  186  VLRVLAAMIFGTGCGALTAFTVLYLWTIFGNKRGAVVPEGCSMQPLDVEYRKVKIVVDSK  245

Query  290  AIKDG  276
             I DG
Sbjct  246  TIGDG  250



>ref|XP_003604815.1| Lectin [Medicago truncatula]
 gb|AES87012.1| legume lectin beta domain protein [Medicago truncatula]
Length=350

 Score =   163 bits (412),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 89/185 (48%), Positives = 120/185 (65%), Gaps = 12/185 (6%)
 Frame = -3

Query  809  NLELNSGEKLQSWIDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLS  630
            NL L SGEKL +WIDYEASS+RLEVRLSK G  +P  PLL   +D+S + KE+E+FVG S
Sbjct  169  NLALKSGEKLHTWIDYEASSRRLEVRLSKHGNSKPLDPLLWHKIDISNVLKEEEMFVGFS  228

Query  629  TSRLWNQSHKCNVYSWSFKLRA-APDWMHSQPLDPKAFRVGKPEQLSVPK-----RSDEC  468
              +     +   +YSWSF +R   P  MHS+PLDP    V K E   V K     + ++C
Sbjct  229  HVK----GNNAFLYSWSFVMRNFPPHSMHSEPLDPNV-SVKKSETSMVVKPKEKAKKNDC  283

Query  467  GLKILGALIFGTGCGALGTLMVLFVWSVLRNRR-PIVPEELTPEPKEYEYKKFQVVVDDK  291
             L++L A+IFGTGCGAL    VL++W++  N+R  +VPE  + +P + EY+K ++VVD K
Sbjct  284  VLRVLAAMIFGTGCGALTAFTVLYLWTIFGNKRGAVVPEGCSMQPLDVEYRKVKIVVDSK  343

Query  290  AIKDG  276
             I DG
Sbjct  344  TIGDG  348



>gb|ABK21031.1| unknown [Picea sitchensis]
Length=366

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 91/211 (43%), Positives = 128/211 (61%), Gaps = 6/211 (3%)
 Frame = -3

Query  932  KFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEAS  753
                VEFD  ++ +  D+N NHVG+D+ SL+S K  +VS I L LN G +L +WIDY+A 
Sbjct  150  NLFAVEFDSAQNKEVMDINANHVGIDIESLISSKTADVSEIKLILNDGTQLHAWIDYDAR  209

Query  752  SKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWSFK  573
            SK LEVRLSK G I+P  PL+S  VDLS +WK DE++VG+S+S   +  +   VYSWSF 
Sbjct  210  SKVLEVRLSKSGLIKPSAPLISHSVDLSGLWK-DEMYVGISSSSGDSSQNNV-VYSWSFT  267

Query  572  LRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTLMVLF-  396
                    HS P++P+AF   +  + S  +R+++  L I  AL+FGTGCGA+   + +F 
Sbjct  268  SSPFHRPQHSHPVNPQAF--SQNGRSSFHRRANDI-LDIFVALLFGTGCGAMAAALTMFL  324

Query  395  VWSVLRNRRPIVPEELTPEPKEYEYKKFQVV  303
            VWS+   R      E T  P ++ Y+K  V 
Sbjct  325  VWSLFTRRFGSTSTEFTAHPVDFGYEKISVT  355



>ref|XP_010923163.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.1-like 
[Elaeis guineensis]
Length=350

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 86/207 (42%), Positives = 127/207 (61%), Gaps = 5/207 (2%)
 Frame = -3

Query  887  GDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEASSKRLEVRLSKWGEIR  708
            G   G+H+G+++S  +S +  N+S+++L LN GEK+ SWIDY+  SKRLEVRLSK   +R
Sbjct  146  GPETGSHIGIEVSGKISKQSSNLSNVSLVLNGGEKVHSWIDYDGDSKRLEVRLSKSRVLR  205

Query  707  PGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWSFKLR-AAPDWMHSQPLD  531
            P  PL+S  +DLS++ + +E  VG+S+S   N +   +VYSWSF ++  AP  MHS+PLD
Sbjct  206  PPSPLVSYPIDLSRVLQREEKLVGISSSS-GNSTQTSSVYSWSFSVKQGAPYLMHSEPLD  264

Query  530  PKAFRVGKPEQLSVP-KRSDECGLKILGALIFGTGCGALGTLMVLFVWSVLRNRRPIVPE  354
            P +  V   E   +  +R+   G+ I  A+ F   CG L T   +FVW  L  RRP+ P 
Sbjct  265  PGSVTVQARESPPIHLRRTYPWGVFI--AMAFAAVCGGLVTFFAMFVWFALIARRPVAPV  322

Query  353  ELTPEPKEYEYKKFQVVVDDKAIKDGK  273
            E    P E  Y++ ++VV +K + D K
Sbjct  323  EYPVHPVEVAYQQIELVVGEKGVDDAK  349



>gb|KHN17863.1| L-type lectin-domain containing receptor kinase S.4 [Glycine 
soja]
Length=272

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/206 (41%), Positives = 118/206 (57%), Gaps = 8/206 (4%)
 Frame = -3

Query  884  DVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEASSKRLEVRLSKWGEIRP  705
            D N NHV +D+ S VSV + NVS +NL LN+GEKLQ+W+DYEASSK LEVRLSKWGE +P
Sbjct  69   DPNANHVSIDVGSHVSVAIANVSDLNLVLNNGEKLQAWVDYEASSKVLEVRLSKWGEQKP  128

Query  704  GYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWSFKLRAAPDWMHSQPLDPK  525
              P++S  +D S++W ++ V   LS+S   +     +VYSW   L+   + +HS P DP 
Sbjct  129  SDPIVSHDIDFSKIWGKNPVIAALSSSNGAHSVQVVSVYSWRVSLKKVSNGLHSLPADPH  188

Query  524  AFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTLMVLFVWSVLRNRRPIVPEELT  345
            +       +     +   C L +L  +IFGTGC AL T +VLF+W +   +     E L 
Sbjct  189  SN--NNNNKFEDEHKKSVCPLTVLAWVIFGTGCVALVTFVVLFMWVIFFQKGE--EESLV  244

Query  344  PEP----KEYEYKKFQVVVDDKAIKD  279
              P     +  Y++  V VD  A  D
Sbjct  245  KIPDHPSSDVRYERIDVAVDKNAHDD  270



>ref|XP_004503219.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.2-like 
[Cicer arietinum]
Length=351

 Score =   151 bits (381),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 92/216 (43%), Positives = 126/216 (58%), Gaps = 5/216 (2%)
 Frame = -3

Query  929  FLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEASS  750
            FLGVEFD  KDD  GD+N NHVG+D  SLVSV V NVS  N+ LNSG+KL++W+DYEA S
Sbjct  133  FLGVEFDTSKDDNVGDLNANHVGIDFGSLVSVAVANVSDSNMVLNSGKKLKAWVDYEAGS  192

Query  749  KRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWSFKL  570
              LEVRL+KW E +   P++S  +DL ++W    V++GLS+S   +      VYSW   L
Sbjct  193  HILEVRLNKWNEDKSLNPIVSHNIDLFKIWGSQPVYIGLSSSNDADSVQVVRVYSWKLNL  252

Query  569  R-AAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTLMVLFV  393
            R  + + +HSQP+DP        E+  +        L +L  +IFGT C  L T +VLF+
Sbjct  253  RNVSTNSLHSQPVDPNGL---SDEEAKLDANRKFRPLTLLAGVIFGTVCVVLVTFVVLFM  309

Query  392  WSVLRNRRPIVPEELTPE-PKEYEYKKFQVVVDDKA  288
            W +  ++         PE P +  Y++  V VD  A
Sbjct  310  WVIFFHKYEEESLAKLPEHPSDVRYERIDVAVDKNA  345



>ref|XP_003600834.1| Lectin receptor kinase [Medicago truncatula]
 gb|AES71085.1| legume lectin beta domain protein [Medicago truncatula]
Length=346

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 90/215 (42%), Positives = 125/215 (58%), Gaps = 3/215 (1%)
 Frame = -3

Query  929  FLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEASS  750
            +LGVEFD  KDD  GD+N NHVG++L SLVSV V NVS  NL LNSGEKL+SW+DY+   
Sbjct  127  YLGVEFDTSKDDNVGDLNANHVGINLGSLVSVAVANVSKSNLVLNSGEKLKSWVDYDNGL  186

Query  749  KRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWSFKL  570
             RLEVRLSK  E +   P++S  +DL ++W    +F+GLS+S   +      VYSW   L
Sbjct  187  HRLEVRLSKLNEAKSEKPIVSHNIDLFKIWGNQPIFLGLSSSNDAHSIQVVRVYSWKVNL  246

Query  569  RAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTLMVLFVW  390
            +   + +HSQP++P   +  +  +L    R     L  L  +IFGT C  L T +VLF+W
Sbjct  247  KNGTNSLHSQPVNPNDEQ--EQSKLDAANRRKYRPLTFLAGVIFGTVCVVLVTFVVLFMW  304

Query  389  SVLRNRRPIVPEELTPE-PKEYEYKKFQVVVDDKA  288
             +  ++         PE P +  Y++  V V+  A
Sbjct  305  VIFFHKHEEESLAKLPEHPSDVRYERIDVAVEKNA  339



>ref|XP_008785595.1| PREDICTED: putative L-type lectin-domain containing receptor 
kinase I.1 [Phoenix dactylifera]
Length=445

 Score =   149 bits (376),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/204 (40%), Positives = 124/204 (61%), Gaps = 5/204 (2%)
 Frame = -3

Query  878  NGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEASSKRLEVRLSKWGEIRPGY  699
             G+H+ V++   +S +  N+S+++L L+ GEK+ SW+DY+  SKR EVRLSK  + RP  
Sbjct  244  TGSHIRVEVGGEISKQSSNLSNVSLVLHGGEKVHSWVDYDGDSKRFEVRLSKSSDSRPLS  303

Query  698  PLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWSFKL-RAAPDWMHSQPLDPKA  522
            PL+S  +DLS++ + +E  VG+S+S   N +   +VYSWSF + R AP  MHS+PLDP+ 
Sbjct  304  PLVSYPIDLSRVLQREEKLVGISSSS-GNSTQTSSVYSWSFAVKRGAPYSMHSEPLDPRP  362

Query  521  FRVGKPEQLSVP-KRSDECGLKILGALIFGTGCGALGTLMVLFVWSVLRNRRPIVPEELT  345
            F V   E   +  +R+   G+ +  A++F   CG L T  V+FVW  L  RRP+ P E  
Sbjct  363  FVVRARESPPIHLRRTYPWGVFV--AMVFAAACGGLLTFFVMFVWFALIARRPVAPVEYP  420

Query  344  PEPKEYEYKKFQVVVDDKAIKDGK  273
              P E  Y++ ++V  +K +   K
Sbjct  421  VHPVEVGYQQIELVAGEKGVDSTK  444



>ref|NP_195729.1| concanavalin A-like lectin [Arabidopsis thaliana]
 emb|CAB69837.1| lectin-like protein [Arabidopsis thaliana]
 dbj|BAF00398.1| lectin - like protein [Arabidopsis thaliana]
 gb|AED90298.1| concanavalin A-like lectin [Arabidopsis thaliana]
Length=353

 Score =   146 bits (369),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 91/222 (41%), Positives = 126/222 (57%), Gaps = 12/222 (5%)
 Frame = -3

Query  935  YKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEA  756
            +K + VEF I K        GNHVG+ +    S KV  +SS     N  ++L  WIDYEA
Sbjct  140  HKVVAVEFGISK-------RGNHVGILVGRPESGKVRKLSSFGHHFNEEKRLNCWIDYEA  192

Query  755  SSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWSF  576
            SSKR+EVRLS    ++P  P +S  VDL+++WK+ +  VGL TS   N S    ++SWSF
Sbjct  193  SSKRIEVRLSLSAALKPVDPFVSYSVDLAKLWKDGKFMVGL-TSANGNTSKPVYLHSWSF  251

Query  575  KLRAAPDWMHSQPLDPK--AFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTLMV  402
            KLR     +HSQPLDP   +  V + E+    K   +C  +ILGAL+ G  CG LG +  
Sbjct  252  KLRHPSMRIHSQPLDPNDVSKTVKEGEKTVEVKGKGKCIWRILGALVLGAVCGTLGAMFA  311

Query  401  LFVWSVLRNRR--PIVPEELTPEPKEYEYKKFQVVVDDKAIK  282
            L++W++  NR+   IVPEE   E  +    K  VVV+++  K
Sbjct  312  LYLWTICGNRQSMAIVPEECADEKADILVTKADVVVEEEVKK  353



>ref|XP_002530403.1| carbohydrate binding protein, putative [Ricinus communis]
 gb|EEF31973.1| carbohydrate binding protein, putative [Ricinus communis]
Length=346

 Score =   145 bits (367),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 84/222 (38%), Positives = 126/222 (57%), Gaps = 16/222 (7%)
 Frame = -3

Query  929  FLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEASS  750
            +LG+EF   +D      +GN   +    LV ++V N    ++    G+++++WIDY+ASS
Sbjct  134  YLGIEFGYSRDGN----DGNSTKI----LVLIRVNNEPLGHVWTERGQRMKAWIDYDASS  185

Query  749  KRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWSFKL  570
            KR+E+R+++    RP  P  +  +DLS+MW ++E FV L ++   N S  CNVYSW F+L
Sbjct  186  KRIEIRINELNGKRPYDPFAAYALDLSKMWSDNEAFVVLGSNDGGNPSGTCNVYSWRFRL  245

Query  569  RAAPDWMHSQPLDPKAFRVG---KPEQLSVPKRSDECGLKILGALIFGTGCGALGTLMVL  399
            R  P+WMHS P++P           E+L V KR   C L IL  LIF +GC AL   + L
Sbjct  246  RKVPNWMHSLPVNPHGSMHNDNSDNERLRVHKR-KFCPLTILAGLIFASGCVALLAFVGL  304

Query  398  FVWSVLRNRRPIVPEELTPEPKEYEYKKFQVVVDDKAIKDGK  273
            ++W +  NRR   P E   +  ++ Y+K  VVV+    KDG 
Sbjct  305  YMWPIFVNRRSAFPLEGKMQRMDFRYEKISVVVE----KDGN  342



>ref|XP_010553259.1| PREDICTED: lectin-like protein At1g53070 [Tarenaya hassleriana]
Length=351

 Score =   144 bits (362),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 89/209 (43%), Positives = 122/209 (58%), Gaps = 13/209 (6%)
 Frame = -3

Query  920  VEFDILKD-DKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEASSKR  744
            VEFD   +  KYGD N NHV V +   V  K+ N +S NL +N  EKL +WIDY+A SKR
Sbjct  136  VEFDTSANVSKYGDSNENHVAVVVDGSVLEKISNFTSENLVMNEEEKLYTWIDYQAGSKR  195

Query  743  LEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGL-STSRLWNQSHKCNVYSWSFKLR  567
            LEVR S  G+ +P   L+SC++DLS+M K++E  VG+ S +R  N +   N++SWS ++R
Sbjct  196  LEVRFSNSGDAKPSEILMSCWIDLSEMLKDNEFMVGVYSYNR--NSTQTYNLHSWSLEVR  253

Query  566  AAPDWMHSQPL-DPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTLMVLFVW  390
              P WMHS  L DP        E  S  KR D    +IL   +   G  A+    V+++W
Sbjct  254  RIPRWMHSYALADPD-----HDESASDKKRKD-TARQILACFLTTFGSTAVLFFAVIYLW  307

Query  389  SVLR--NRRPIVPEELTPEPKEYEYKKFQ  309
            + LR  N   +VPEE   + KE+EYKK +
Sbjct  308  TFLRRNNLVMVVPEECGLKGKEFEYKKME  336



>gb|AAM65643.1| lectin-like protein [Arabidopsis thaliana]
Length=353

 Score =   143 bits (360),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 90/222 (41%), Positives = 125/222 (56%), Gaps = 12/222 (5%)
 Frame = -3

Query  935  YKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEA  756
            +K + VEF I K        GNHVG+ +    S KV  +SS     N  ++L  WIDYEA
Sbjct  140  HKVVAVEFGISK-------RGNHVGILVGRPESGKVRKLSSFGHHFNEEKRLNCWIDYEA  192

Query  755  SSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWSF  576
            SSKR+EVRLS    ++P  P +S  VDL+++WK+ +  VGL TS   N S    ++SWSF
Sbjct  193  SSKRIEVRLSLSAALKPVDPFVSYSVDLAKLWKDGKFMVGL-TSANGNTSKPVYLHSWSF  251

Query  575  KLRAAPDWMHSQPLDPK--AFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTLMV  402
            KL      +HSQPLDP   +  V + E+    K   +C  +ILGAL+ G  CG LG +  
Sbjct  252  KLIHPSMRIHSQPLDPNDVSKTVKEGEKTVEVKGKGKCIWRILGALVLGAVCGTLGAMFA  311

Query  401  LFVWSVLRNRR--PIVPEELTPEPKEYEYKKFQVVVDDKAIK  282
            L++W++  NR+   IVPEE   E  +    K  VVV+++  K
Sbjct  312  LYLWTICGNRQSMAIVPEECADEKADILVTKADVVVEEEVKK  353



>ref|XP_010558351.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.2-like 
[Tarenaya hassleriana]
Length=359

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 91/235 (39%), Positives = 134/235 (57%), Gaps = 24/235 (10%)
 Frame = -3

Query  947  EKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSIN--LELNSGEKLQS  774
            E+   + + VEF   K        G+ VG+ + S  S K+GN+SS +     N+GEKL  
Sbjct  138  ERAETEAVAVEFSTSK-------KGSRVGIVVGSPKSAKIGNLSSFHSFFPWNNGEKLSC  190

Query  773  WIDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCN  594
            WIDY ASSKR+EVRLSK G  +P  P +S  +DL ++WK+ +  VGLS+    N S    
Sbjct  191  WIDYGASSKRIEVRLSKLGATKPVDPTISYSIDLVKLWKDGKFMVGLSSIN-GNSSQPYF  249

Query  593  VYSWSFKLRAAPDWMHSQPLDP-KAFRVGKPEQLSVP----KRSDECGLKILGALIFGTG  429
            ++SWSF L+  P WMHSQPLDP +  +  K + +  P    K+SD C  +++ ALI G  
Sbjct  250  LHSWSFNLKNPPVWMHSQPLDPNEVLKTEKEDLVEKPVGNAKKSD-CVWRMVSALILGAL  308

Query  428  CGALGTLMVLFVWSVLRNRRPIVPEELTPEPKEYEYKKFQVVVDDKA---IKDGK  273
            CG LG ++ L++W +   RRP     +   P+E   K  + VV +K+   +++GK
Sbjct  309  CGTLGAMLGLYLWRICSGRRP-----MAVAPEECAGKSVEAVVVEKSATEVEEGK  358



>emb|CDX80792.1| BnaC03g00460D [Brassica napus]
Length=300

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 84/222 (38%), Positives = 124/222 (56%), Gaps = 13/222 (6%)
 Frame = -3

Query  932  KFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEAS  753
            + + VEF I K        GN VG+ +    S K+ N+SS +   N  ++L  WIDYEAS
Sbjct  87   EIVAVEFGISK-------RGNRVGILVGRPESAKIRNLSSFDGHFNGEKRLNCWIDYEAS  139

Query  752  SKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWSFK  573
            SKR+EVRLS    ++P  P +S  VDL+++WK     VGL++S   N S    ++SWSF 
Sbjct  140  SKRVEVRLSVSTALKPVDPFVSYSVDLAKLWKGKNFMVGLTSSN-GNSSKPHYLHSWSFG  198

Query  572  LRAAPDWMHSQPLDPKAFRVGKPEQ---LSVPKRSDECGLKILGALIFGTGCGALGTLMV  402
            +R     +HSQPLDP A      E+   + V  +  +C  ++LGAL+ G  CG+LG ++ 
Sbjct  199  MRHPSMRIHSQPLDPNAVSKTVKEEVKTVEVKGKKSKCVWRMLGALVLGAVCGSLGAMLA  258

Query  401  LFVWSVLRNRR--PIVPEELTPEPKEYEYKKFQVVVDDKAIK  282
            L++W++  NRR   +VPEE      +    K   VVD++  K
Sbjct  259  LYLWTICGNRRSMAVVPEECANGKSDIVVIKAAAVVDEQGKK  300



>gb|AFK49110.1| unknown [Lotus japonicus]
Length=332

 Score =   140 bits (353),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 86/225 (38%), Positives = 121/225 (54%), Gaps = 30/225 (13%)
 Frame = -3

Query  932  KFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEAS  753
             +LGVEFD              VG+D+ S  SV V N S++NL +N+GEK+ +W+DY+A 
Sbjct  134  SYLGVEFD------------TTVGIDVGSRASVAVANGSALNLVVNNGEKVNAWVDYKAG  181

Query  752  SKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWSFK  573
            S+ LEVRLSKWGE R   P++S  +DL   W    VFVGLS+S   N     +VYSW   
Sbjct  182  SRTLEVRLSKWGEPRSEDPIVSHRIDLFNFWNRKPVFVGLSSSNDANSVQVVSVYSWKVS  241

Query  572  LRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTLMVLFV  393
            +R     +HSQP DP+ F   +  +           L +L  +IFG+ C AL T +VLF+
Sbjct  242  VREVSKSLHSQPADPRRFSEERKFRT----------LTVLAGVIFGSVCVALVTFVVLFM  291

Query  392  WSVLRNRRPIVPEE----LTPEPKEYEYKKFQVVVDDKAIKDGKN  270
            W +  ++     EE    L   P +  Y++  V V +K  KD +N
Sbjct  292  WVIFFHKH---EEESLAKLPNHPADVRYERIDVSV-EKHTKDDEN  332



>ref|XP_010543888.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.2-like, 
partial [Tarenaya hassleriana]
Length=332

 Score =   140 bits (352),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 86/230 (37%), Positives = 125/230 (54%), Gaps = 20/230 (9%)
 Frame = -3

Query  947  EKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSI-NLELNSGEKLQSW  771
            E+   + + VEF          + G   G+ +    S KVGN+SS  N   N+GEKL  W
Sbjct  115  EQAETRVVAVEFST-------SMKGRRAGIVVGGPKSAKVGNLSSFRNFLWNNGEKLHCW  167

Query  770  IDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNV  591
            IDYEAS KR+EV + K  + +P  PL+S  ++L+++WK+ +  VGL ++   N S    +
Sbjct  168  IDYEASLKRIEVSMMK-SDTKPADPLISYSIELAKLWKDGKFMVGLGSTN-GNSSQPHFL  225

Query  590  YSWSFKLR-AAPDWMHSQPLDP----KAFRVGKPEQLSVPKRSDECGLKILGALIFGTGC  426
            YSW F +R  AP WMHSQPLDP    K  R G  E+ +   R   C  K+L ALI G+ C
Sbjct  226  YSWIFNIRHPAPAWMHSQPLDPNEVSKTEREGVVEKPTHVHRKGSCVWKMLTALILGSVC  285

Query  425  GALGTLMVLFVWSVLRNRRPIVPEELTPEPKEYEYKKFQVVVDDKAIKDG  276
            G  G ++ L++W++   RRP     +   P E   K  + +V DK  ++G
Sbjct  286  GTFGAMLALYLWTICGGRRP-----MAVAPVECTAKSVEAMVADKEEEEG  330



>ref|XP_010468550.1| PREDICTED: L-type lectin-domain containing receptor kinase V.9-like 
[Camelina sativa]
Length=339

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 84/205 (41%), Positives = 122/205 (60%), Gaps = 16/205 (8%)
 Frame = -3

Query  941  ENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSI-NLELNSGEKLQSWID  765
            +N   + VEFDI K       +GN+  V + S  SV++ N+S I +L +N+GE L   ID
Sbjct  143  KNETVVAVEFDISK-------SGNYARVLIGSPESVQIINLSFIGDLMMNNGEALSCMID  195

Query  764  YEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYS  585
            YEASSKR+ VR  K G I+   P  S  VDL+++W++ +V VGLS++   N S    ++S
Sbjct  196  YEASSKRMMVRFRKSGSIKLFDPFFSFSVDLAELWEDSQVTVGLSSAN-GNSSKSHFLHS  254

Query  584  WSFKLRAAPD-WMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTL  408
            WSF++R  P  WMHS+PL+P      + E     +   EC  K+LGAL+ G  CG+LG +
Sbjct  255  WSFEIRRPPPMWMHSEPLEPNKVSTEEKEG----REGSECIWKMLGALVMGAACGSLGAM  310

Query  407  MVLFVWSVLRNRR--PIVPEELTPE  339
            + L++W + R RR   +VPEE   E
Sbjct  311  LALYLWKICRVRRSMAVVPEECAIE  335



>ref|XP_006398654.1| hypothetical protein EUTSA_v10013972mg [Eutrema salsugineum]
 gb|ESQ40107.1| hypothetical protein EUTSA_v10013972mg [Eutrema salsugineum]
Length=352

 Score =   138 bits (348),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 85/218 (39%), Positives = 120/218 (55%), Gaps = 12/218 (6%)
 Frame = -3

Query  935  YKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEA  756
            ++ + VEF I K        G  VG+ +    S K+ N+SS     N   K   WIDYEA
Sbjct  140  HEIVAVEFGISK-------RGKRVGILVGRPESAKIRNLSSFGGHFNGETKWNCWIDYEA  192

Query  755  SSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWSF  576
            SSKR+EVRL+     +P  P +S  VDL+++WK+ +  VGL ++   N S    ++SWSF
Sbjct  193  SSKRIEVRLTPSAASKPTDPFVSYAVDLAKLWKDGKFMVGLISAN-GNSSKPHYLHSWSF  251

Query  575  KLRAAPDWMHSQPLDPKAF--RVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTLMV  402
            KLR     +HSQPLDP A    V + E+    K   +C  ++LGAL+ G  CG LG ++ 
Sbjct  252  KLRHPSMRIHSQPLDPNAVSETVKEEEKTVEVKGKSKCIWRMLGALVLGAVCGTLGAMLA  311

Query  401  LFVWSVLRNRR--PIVPEELTPEPKEYEYKKFQVVVDD  294
            L++W+V  NRR   +VPEE   E  +    K  VV D+
Sbjct  312  LYLWTVCGNRRSMAVVPEECANEKSDMVVIKADVVDDE  349



>ref|XP_010093501.1| Lysine histidine transporter 1 [Morus notabilis]
 gb|EXB54154.1| Lysine histidine transporter 1 [Morus notabilis]
Length=867

 Score =   142 bits (359),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 81/184 (44%), Positives = 115/184 (63%), Gaps = 7/184 (4%)
 Frame = -3

Query  839  SVKVGNVSSINLELNSGEKLQSWIDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMW  660
            +V V NVSS +L   +GEKL+SWIDY+ASS+RLEVRL+K+G  RP  P ++   DLS MW
Sbjct  144  AVAVINVSSTDLGRRNGEKLKSWIDYDASSERLEVRLAKFGASRPYDPTIAYARDLSSMW  203

Query  659  KEDEVFVGLSTSRLWNQSHK-CNVYSWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPK  483
             ++EV VG+S+      S +   VYSW+F+ R  P+ MHS P DP+  R    +     +
Sbjct  204  GDEEVLVGISSPSSTENSSRIITVYSWNFRFRNFPNSMHSLPADPRVSRQHPTDH----Q  259

Query  482  RSDECGLKILGALIFGTGCGALGTLMVLFVWSVL-RNRRPIVPEELTP-EPKEYEYKKFQ  309
            +   C L +LG LIF T CGAL    VLF+W+V+  N+  + P +L+  +   + Y+KF 
Sbjct  260  KRRVCPLAVLGGLIFATVCGALMAFAVLFLWAVVAANKHTVFPVDLSHVKSMGFRYEKFG  319

Query  308  VVVD  297
            VVV+
Sbjct  320  VVVE  323



>ref|XP_009412582.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.1-like 
[Musa acuminata subsp. malaccensis]
Length=346

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/193 (39%), Positives = 114/193 (59%), Gaps = 3/193 (2%)
 Frame = -3

Query  926  LGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEASSK  747
            + V F     +K G++ G+ + +D+      +  +++ + L LNSGEKL+SWIDY+  SK
Sbjct  134  VAVRFGRFNVEKLGELGGSFIEIDVEGETLTRSIDLTEVGLILNSGEKLRSWIDYDGESK  193

Query  746  RLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWSFKLR  567
            R+EVRLS+  + RP    +S  +DLS +   + VFVG+S S   N +H  ++YSW+F ++
Sbjct  194  RIEVRLSQARDPRPRNSSISYSIDLSNVLWREAVFVGISFSS-GNSTHTSSIYSWNFAVK  252

Query  566  -AAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTLMVLFVW  390
              AP  MHS+PL+P +F V   E  SV  R       +  A++F   CGA+  L V+ VW
Sbjct  253  HGAPYLMHSEPLNPDSFLVRSTESPSVHLRK-ASPWGVFMAMVFAAACGAMLALFVMLVW  311

Query  389  SVLRNRRPIVPEE  351
            +VL  RRP+ P E
Sbjct  312  AVLAARRPVAPVE  324



>emb|CDY11212.1| BnaA03g00480D [Brassica napus]
Length=354

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 84/224 (38%), Positives = 128/224 (57%), Gaps = 15/224 (7%)
 Frame = -3

Query  932  KFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEAS  753
            + + VEF I K        GN VGV +    + K+ N+SS +   N  ++L  WIDYEAS
Sbjct  139  EIVAVEFGISK-------RGNRVGVLVGRPEAAKIRNLSSFDGHFNGEKRLNCWIDYEAS  191

Query  752  SKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWSFK  573
            SKR+EVRLS    ++P  P +S  VDL+++W++ +  VGL++S   N S    ++SWSFK
Sbjct  192  SKRVEVRLSGSTALKPVDPFVSYSVDLAKIWEDKKFMVGLTSSN-GNSSKPHYLHSWSFK  250

Query  572  LRAAPDWMHSQPLDPKAFRVGKPEQLSVPK-----RSDECGLKILGALIFGTGCGALGTL  408
            LR     +HSQPLDP A      E++ V       +  +C  ++LGAL+ G  CG+LG +
Sbjct  251  LRHPSVRIHSQPLDPNAVSKTVKEEVEVKTVEVKGKKSKCIWRMLGALVLGAVCGSLGAM  310

Query  407  MVLFVWSVLRNRR--PIVPEELTPEPKEYEYKKFQVVVDDKAIK  282
            + L++W++  NR+   +VPEE   +  +    K   VVD++  K
Sbjct  311  LALYLWTICGNRQSMAVVPEERADDKSDIVVIKAAAVVDEQGKK  354



>ref|XP_009130668.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.2-like 
[Brassica rapa]
Length=356

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 84/222 (38%), Positives = 127/222 (57%), Gaps = 15/222 (7%)
 Frame = -3

Query  926  LGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEASSK  747
            + VEF I K        GN VGV +    + K+ N+SS +   N  ++L  WIDYEASSK
Sbjct  143  VAVEFGISK-------RGNRVGVLVGRPEAAKIRNLSSFDGHFNGEKRLNCWIDYEASSK  195

Query  746  RLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWSFKLR  567
            R+EVRLS    ++P  P +S  VDL+++W++ +  VGL++S   N S    ++SWSFKLR
Sbjct  196  RVEVRLSGSTALKPVDPFVSYSVDLAKIWEDKKFMVGLTSSN-GNSSKPHYLHSWSFKLR  254

Query  566  AAPDWMHSQPLDPKAFRVGKPEQLSVPK-----RSDECGLKILGALIFGTGCGALGTLMV  402
                 +HSQPLDP A      E++ V       +  +C  ++LGAL+ G  CG+LG ++ 
Sbjct  255  HPSVRIHSQPLDPNAVSKTVKEEVEVKTVEVKGKKSKCIWRMLGALVLGAVCGSLGAMLA  314

Query  401  LFVWSVLRNRR--PIVPEELTPEPKEYEYKKFQVVVDDKAIK  282
            L++W++  NR+   +VPEE   +  +    K   VVD++  K
Sbjct  315  LYLWTICGNRQSMAVVPEERADDKSDIVVIKAAAVVDEQGKK  356



>ref|XP_002873031.1| legume lectin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49290.1| legume lectin family protein [Arabidopsis lyrata subsp. lyrata]
Length=351

 Score =   135 bits (341),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 87/215 (40%), Positives = 119/215 (55%), Gaps = 12/215 (6%)
 Frame = -3

Query  935  YKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEA  756
            +K + VEF I K        GN VG+ +    S KV  +SS     N  +KL  WIDYEA
Sbjct  139  HKVVAVEFGISK-------RGNRVGILVGRPESGKVRKLSSFGDHFNGEKKLNCWIDYEA  191

Query  755  SSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWSF  576
            SSKR+EVRLS    ++P  P +S  VDL+++WK+ +  VGL TS     S    ++SW+F
Sbjct  192  SSKRIEVRLSLSTALKPVDPFVSYLVDLAKLWKDGKFMVGL-TSANGKSSKPVYLHSWNF  250

Query  575  KLRAAPDWMHSQPLDPK--AFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTLMV  402
            KLR     +HSQPLDP   +  V + E+    K   +C  +ILGAL+ G  CG LG +  
Sbjct  251  KLRHPSMRIHSQPLDPNDVSKTVKEGEKTVEVKGKGKCIWRILGALVLGAVCGTLGAMSA  310

Query  401  LFVWSVLRNRR--PIVPEELTPEPKEYEYKKFQVV  303
            L++W++  NR+   IVPEE   E  +    K  VV
Sbjct  311  LYLWTICGNRQSMAIVPEECANEKADIVVMKSDVV  345



>ref|XP_010486461.1| PREDICTED: L-type lectin-domain containing receptor kinase S.4-like 
[Camelina sativa]
Length=338

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 79/205 (39%), Positives = 120/205 (59%), Gaps = 16/205 (8%)
 Frame = -3

Query  941  ENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSI-NLELNSGEKLQSWID  765
            +N   + VEFDI +       +GN+  + +    S ++ N+S + +L +N+GE L   ID
Sbjct  142  KNETVVAVEFDISE-------SGNYARILIGRPESAQIRNLSFVGDLMMNNGEALSCMID  194

Query  764  YEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYS  585
            YEASSKR+ VR  K G I+   P  S  VDL+++W++ +V VGLS++   N S    ++S
Sbjct  195  YEASSKRMMVRFRKSGSIKLFDPFFSFSVDLAKLWEDGQVTVGLSSAN-GNSSKAHFLHS  253

Query  584  WSFKLRAAPD-WMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTL  408
            WSF++R  P  WMHS+PL+P      + E     +   EC  K+LGAL+ G  CG+LG +
Sbjct  254  WSFEIRHPPPMWMHSEPLEPNEVSTEEKEG----REGSECIWKMLGALVLGAACGSLGAI  309

Query  407  MVLFVWSVLRNRR--PIVPEELTPE  339
            + L++W + R RR   +VPEE   E
Sbjct  310  LALYLWKICRVRRSMAVVPEECAIE  334



>ref|XP_010452027.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.2-like 
[Camelina sativa]
Length=354

 Score =   133 bits (335),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 86/226 (38%), Positives = 125/226 (55%), Gaps = 17/226 (8%)
 Frame = -3

Query  938  NYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYE  759
             +K + V F I K        GN VG+ +    S K+  +SS+  + N  +KL  WIDYE
Sbjct  141  QHKVVAVAFGISK-------KGNRVGILVGKPESGKIRKLSSLGDQFNGEKKLNCWIDYE  193

Query  758  ASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWS  579
            ASSKR+EVR+S    ++P  P +S  VDL+++W++ +  VGL TS   N S    ++SWS
Sbjct  194  ASSKRIEVRVSLSTALKPIDPFVSYSVDLAKIWRDGKFVVGL-TSANGNSSRPHYLHSWS  252

Query  578  FKLRAAPDWMHSQPLDPKAF--RVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTLM  405
            FKLR     +HSQPLDP      V + E+    K    C  ++LGAL+ G  CG LG ++
Sbjct  253  FKLRHPSMRIHSQPLDPDEVSKTVKEGEKTVEVKGKSRCIWRMLGALVLGAVCGTLGAML  312

Query  404  VLFVWSVLRNRR--PIVPEELTPEPKEYEYKKFQVVVDDKAIKDGK  273
             L++W++  NR+   IVPEE   E  +       V+  D A ++GK
Sbjct  313  ALYLWTICGNRQSMAIVPEECANEKSD-----IVVMKTDAAEEEGK  353



>ref|XP_010464536.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.2-like 
[Camelina sativa]
Length=338

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 79/205 (39%), Positives = 121/205 (59%), Gaps = 16/205 (8%)
 Frame = -3

Query  941  ENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSI-NLELNSGEKLQSWID  765
            +N   + VEFDI K       +GN+  + + S  S ++ N+S + +L +++GE L   ID
Sbjct  142  KNETVVAVEFDISK-------SGNYARILIGSPESSQIRNLSFVGDLMMSNGEALSCMID  194

Query  764  YEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYS  585
            YEASSKR+ VR  K G I+   P  S  +DL+++W++ +V VGLS++   N S    ++S
Sbjct  195  YEASSKRMMVRFRKAGSIKLFDPFFSFSLDLAKLWEDGQVTVGLSSAN-GNSSKAQFLHS  253

Query  584  WSFKLRAAPD-WMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTL  408
            WSF++R  P  WMHS+PL+P      + E     +   EC  K+LGAL+ G  CG+LG +
Sbjct  254  WSFEIRNPPPMWMHSEPLEPNEVSTEEKEG----REGSECIWKMLGALVLGAACGSLGAM  309

Query  407  MVLFVWSVLRNRR--PIVPEELTPE  339
            + L++W + R RR   +VPEE   E
Sbjct  310  LALYLWKICRVRRSMAVVPEECAIE  334



>ref|XP_006288058.1| hypothetical protein CARUB_v10001288mg [Capsella rubella]
 gb|EOA20956.1| hypothetical protein CARUB_v10001288mg [Capsella rubella]
Length=353

 Score =   133 bits (334),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 84/220 (38%), Positives = 120/220 (55%), Gaps = 15/220 (7%)
 Frame = -3

Query  935  YKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEA  756
            +K + V F I +        GN VG+ +    S K+  +SS     N  +K   WIDYEA
Sbjct  140  HKVVAVAFGISR-------KGNRVGILVGKPESGKIRKLSSFGDHFNGEKKFNCWIDYEA  192

Query  755  SSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWSF  576
            SSKR+EVRLS    ++P  P +S  VDL+++WK+ +  VGL TS   N S    ++SW+F
Sbjct  193  SSKRIEVRLSLSTALKPVDPFVSYLVDLAKLWKDGKFMVGL-TSANGNSSKPLYLHSWTF  251

Query  575  KLRAAPDWMHSQPLDP----KAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTL  408
            KLR     +HSQPLDP    K  + G+     V K    C  ++LGAL+ G  CG LG +
Sbjct  252  KLRHPSMRIHSQPLDPNEVSKTVKEGETTVEEV-KGKRRCIWRMLGALVLGAVCGTLGAM  310

Query  407  MVLFVWSVLRNRR--PIVPEELTPEPKEYEYKKFQVVVDD  294
            + L++W++  NR+   IVPEE   E  +    K  VV ++
Sbjct  311  LALYLWTICGNRQSMAIVPEECANEKSDNSVIKTDVVQEE  350



>ref|XP_010423913.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.2-like 
[Camelina sativa]
Length=354

 Score =   132 bits (333),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 85/225 (38%), Positives = 126/225 (56%), Gaps = 17/225 (8%)
 Frame = -3

Query  935  YKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEA  756
            +K + V F I K        GN VG+ +    S K+  +SS+  + N  +KL  WIDYEA
Sbjct  142  HKVVAVAFGISK-------KGNRVGILVGRPESGKIRKLSSLGDQFNGEKKLNCWIDYEA  194

Query  755  SSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWSF  576
            SSKR+EVR+S    ++P  P +S  VDL+++W++ +  VGL TS   N S    ++SWSF
Sbjct  195  SSKRIEVRVSLSTALKPIDPFVSYSVDLAKIWRDGKFVVGL-TSANGNCSRSHYLHSWSF  253

Query  575  KLRAAPDWMHSQPLDPK--AFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTLMV  402
            KLR     +HSQPLDP   +  V + ++    K    C  ++LGAL+ G  CG LG ++ 
Sbjct  254  KLRHPSMRIHSQPLDPNEVSMTVKEGKKTVEVKGKSRCIWRMLGALVLGAVCGTLGAMLA  313

Query  401  LFVWSVLRNRR--PIVPEELTPEPKEYEYKKFQVVVDDKAIKDGK  273
            L++W++  NR+   IVPEE   E  +       V+  D A ++GK
Sbjct  314  LYLWTICGNRQSMAIVPEECANEKSD-----IVVMKTDAAEEEGK  353



>ref|XP_002882602.1| legume lectin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58861.1| legume lectin family protein [Arabidopsis lyrata subsp. lyrata]
Length=337

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 83/205 (40%), Positives = 117/205 (57%), Gaps = 16/205 (8%)
 Frame = -3

Query  941  ENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSI-NLELNSGEKLQSWID  765
            +N     VEFDI K        GN   + +    S ++ N+S + +L +++G  L   I+
Sbjct  141  KNETVFAVEFDISK-------RGNCARILIGRPESAQIRNLSFVGDLMMDNGGTLNCMIE  193

Query  764  YEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYS  585
            YEASSKR+ VR  K G I+   P  S  VDL+++WK  EV VGLS++   + S    ++S
Sbjct  194  YEASSKRMMVRFRKPGSIKLLDPFFSFSVDLAKLWKGGEVTVGLSSANGNSSSKAHFLHS  253

Query  584  WSFKLRAAPD-WMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTL  408
            WSF++R  P  WMHS PL+P    V K E     +   EC  K+LGAL FG  CGALGT+
Sbjct  254  WSFEIRHPPPMWMHSVPLEPN--EVSKEED---GRGRSECIWKMLGALFFGAACGALGTM  308

Query  407  MVLFVWSVLRNRR--PIVPEELTPE  339
            + L++W++ R RR   +VPEE   E
Sbjct  309  LALYIWTICRVRRSMAVVPEECAIE  333



>ref|XP_009125432.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.2-like 
[Brassica rapa]
Length=360

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 87/223 (39%), Positives = 121/223 (54%), Gaps = 27/223 (12%)
 Frame = -3

Query  926  LGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEASSK  747
            + VEF + K        GN VGV +    S ++ N+SS     + G+KL  WIDYEASSK
Sbjct  153  VAVEFGVSK-------RGNRVGVLVGRPGSARIRNLSSFGGHFDGGKKLSCWIDYEASSK  205

Query  746  RLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWSFKLR  567
            R+EVRLS    ++P  PL+S  VDL+++WK  +  VGL TS   N S    ++SWSFKLR
Sbjct  206  RIEVRLSVSNALKPVDPLVSYSVDLAKIWKGKKFMVGL-TSANGNSSKPHYLHSWSFKLR  264

Query  566  AAPDWMHSQPLDPKAFRVGKPEQLSVPKRSD--------ECGLKILGALIFGTGCGALGT  411
                 +HSQPLDP A      E     K+          +C  ++L AL+ G  CG LG 
Sbjct  265  HPSMRIHSQPLDPNAVSKTVKEVEVKKKKKTVEVKGKKRKCVWRMLSALVLGAVCGTLGA  324

Query  410  LMVLFVWSVLRNRR--PIVPEELTPEPKEYEYKKFQVVVDDKA  288
            ++ L++W++  NRR   +VPEE   E         + VVD++A
Sbjct  325  MLALYLWTMCGNRRSMAVVPEECATE---------KSVVDEEA  358



>emb|CDY55910.1| BnaAnng14010D [Brassica napus]
Length=360

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 87/223 (39%), Positives = 121/223 (54%), Gaps = 27/223 (12%)
 Frame = -3

Query  926  LGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEASSK  747
            + VEF + K        GN VGV +    S ++ N+SS     + G+KL  WIDYEASSK
Sbjct  153  VAVEFGVSK-------RGNRVGVLVGRPGSARIRNLSSFGGHFDGGKKLSCWIDYEASSK  205

Query  746  RLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWSFKLR  567
            R+EVRLS    ++P  PL+S  VDL+++WK  +  VGL TS   N S    ++SWSFKLR
Sbjct  206  RIEVRLSVSNALKPVDPLVSYSVDLAKIWKGKKFMVGL-TSANGNSSKPHYLHSWSFKLR  264

Query  566  AAPDWMHSQPLDPKAFRVGKPEQLSVPKRSD--------ECGLKILGALIFGTGCGALGT  411
                 +HSQPLDP A      E     K+          +C  ++L AL+ G  CG LG 
Sbjct  265  HPSMRIHSQPLDPNAVSKTVKEVEVKKKKKTVEVKGKKRKCVWRMLSALVLGAVCGTLGA  324

Query  410  LMVLFVWSVLRNRR--PIVPEELTPEPKEYEYKKFQVVVDDKA  288
            ++ L++W++  NRR   +VPEE   E         + VVD++A
Sbjct  325  MLALYLWTMCGNRRSMAVVPEECATE---------KSVVDEEA  358



>ref|XP_010490607.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.2-like 
[Camelina sativa]
Length=357

 Score =   130 bits (327),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 83/223 (37%), Positives = 122/223 (55%), Gaps = 12/223 (5%)
 Frame = -3

Query  938  NYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYE  759
             +K + V F I K        GN VG+ +    S K+  +SS+  + +  ++L  WIDYE
Sbjct  143  QHKVVAVPFGISK-------KGNRVGILVGRPESGKIRKLSSLGDQFSGEKRLNCWIDYE  195

Query  758  ASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWS  579
            ASSKR+EVR+S    ++P  P +S  VDL+++WK+ +  VGL TS   N S    +YSWS
Sbjct  196  ASSKRIEVRVSLSNALKPIDPFVSYSVDLAKIWKDGKFMVGL-TSANGNSSRPHYLYSWS  254

Query  578  FKLRAAPDWMHSQPLDPKAF--RVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTLM  405
            FKLR     +HSQPLDP      V + E+    K    C  ++L AL+ G  CG LG ++
Sbjct  255  FKLRHPSMRIHSQPLDPDEVVKTVKEGEKTLEVKGKGRCIWRMLSALVLGAVCGTLGAML  314

Query  404  VLFVWSVLRNRR--PIVPEELTPEPKEYEYKKFQVVVDDKAIK  282
             L++W++  NR+   IVPEE   E  +    K   V +++  K
Sbjct  315  ALYLWTICGNRQSMAIVPEECANEKSDMVVMKTDAVEEEEGKK  357



>gb|KFK24622.1| hypothetical protein AALP_AA8G003000 [Arabis alpina]
Length=341

 Score =   129 bits (324),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 81/208 (39%), Positives = 116/208 (56%), Gaps = 16/208 (8%)
 Frame = -3

Query  938  NYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEK-LQSWIDY  762
             YK + VEF + K        GN VG+ +     VK+  +SS +     GEK L  WIDY
Sbjct  129  QYKIVAVEFGVSK-------RGNRVGILVGRPRDVKIRKLSSFS---EYGEKRLNCWIDY  178

Query  761  EASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSW  582
            EASSKR+EVRLS +  ++P  P +S  VDL+++WK+    VGL++S   N S    ++SW
Sbjct  179  EASSKRIEVRLSVYNALKPVDPFVSYSVDLAKLWKDGGFMVGLTSSN-GNSSKPHYLHSW  237

Query  581  SFKLRAAPDWMHSQPLDPKAF--RVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTL  408
             F++R      HSQPLDP      V + E+    K   +C  ++LGAL+ G  CG LG +
Sbjct  238  RFEMRRLSMRTHSQPLDPNEVSKTVKEQEKTVEVKGKRKCIWRMLGALVLGAVCGTLGAM  297

Query  407  MVLFVWSVLRNRR--PIVPEELTPEPKE  330
            + L++W++   RR   IVPEE   E  +
Sbjct  298  LALYLWTICGTRRSMAIVPEECANEKSD  325



>ref|XP_010530423.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.1-like 
[Tarenaya hassleriana]
Length=354

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 80/208 (38%), Positives = 117/208 (56%), Gaps = 11/208 (5%)
 Frame = -3

Query  920  VEFDILKD-DKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEASSKR  744
            VEFD   +  KYGD N NHV V +   V  K+ N +S +L +NS EKL +WIDY++ SKR
Sbjct  135  VEFDTSANVSKYGDSNENHVAVLVDGSVMEKISNFTSADLVMNSEEKLYAWIDYQSDSKR  194

Query  743  LEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWSFKLRA  564
            LEVR    G+ +P   L+S ++D S M K++E  VG+  S   N +   N++SWS ++R 
Sbjct  195  LEVRFRNSGDAKPIETLISYWIDFSAMVKDNEFMVGV-YSYNQNSTQTYNLHSWSLEVRR  253

Query  563  APDWMHSQPL-DPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTLMVLFVWS  387
             P W+HS  L DPK+    KP      K+  +  L+IL   I   G  A  +  ++++  
Sbjct  254  FPRWVHSYALVDPKS---NKPTS---DKKRKDMALQILTCFITTFGSMAFLSFALVYLCR  307

Query  386  VLR--NRRPIVPEELTPEPKEYEYKKFQ  309
              R  N   +VPEE   + K++EYKK +
Sbjct  308  FFRRDNLAMVVPEECGLKAKDFEYKKME  335



>emb|CDY48111.1| BnaC02g03680D [Brassica napus]
Length=352

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 83/205 (40%), Positives = 117/205 (57%), Gaps = 22/205 (11%)
 Frame = -3

Query  926  LGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEASSK  747
            + VEF + K        GN VGV +    S ++ N+SS     + G+KL  WIDYEASSK
Sbjct  151  VAVEFGVSK-------RGNRVGVLVGRPESARIRNLSS----FDGGKKLSCWIDYEASSK  199

Query  746  RLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWSFKLR  567
            R++VRLS    ++P  PL+S  VDL+++WK  +  VGL TS   N S    ++SWSFKLR
Sbjct  200  RIKVRLSVSNALKPVDPLVSYSVDLAKIWKGKKFMVGL-TSANGNSSKPHYLHSWSFKLR  258

Query  566  AAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLK-------ILGALIFGTGCGALGTL  408
                 +HSQPLDP A      +++ V K++ E   K       +L AL+ G  CG LG +
Sbjct  259  HPSMRIHSQPLDPNAVS-NTVKEVEVKKKTVEVKGKKSKSVWRMLSALVLGAVCGTLGAM  317

Query  407  MVLFVWSVLRNRR--PIVPEELTPE  339
            + L++W++  NRR   +VPEE   E
Sbjct  318  LALYLWTMCGNRRSMAVVPEECANE  342



>gb|EPS72516.1| hypothetical protein M569_02242 [Genlisea aurea]
Length=327

 Score =   126 bits (317),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 76/203 (37%), Positives = 118/203 (58%), Gaps = 18/203 (9%)
 Frame = -3

Query  902  KDDKYG-DVNGNHVGVDLSSLVSV-----KVGNVS--SINLELNSGEKLQSWIDYEASSK  747
            K+D +  + +GN  G D+ S  S        GNVS  S+ L L SGEKL +WI+YEA+ K
Sbjct  113  KNDSFAVEFDGNRGGADVESRASFFRRKPAAGNVSVTSVKLRLRSGEKLSAWINYEATGK  172

Query  746  RLEVRLSKWG------EIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYS  585
            RLE+ LSK G      +     PL+S  +D S +WK+ ++ VG+ +S   + +    +YS
Sbjct  173  RLEISLSKNGGGGRNADKDLYIPLVSYPIDFSSIWKQQQILVGIISSSSTSATE---IYS  229

Query  584  WSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRS-DECGLKILGALIFGTGCGALGTL  408
            WSF+ R   +  HS+P++ ++F+    E  +  K S D CG +I+ AL FG GCGA+G L
Sbjct  230  WSFESRNLENTSHSEPMNTESFKATSKEVGNENKDSEDGCGSRIVAALAFGIGCGAMGGL  289

Query  407  MVLFVWSVLRNRRPIVPEELTPE  339
             ++F+W +   +R +VPE +  +
Sbjct  290  FLVFLWRLFGGKRLVVPEVIVDD  312



>ref|XP_009419741.1| PREDICTED: L-type lectin-domain containing receptor kinase S.4-like 
[Musa acuminata subsp. malaccensis]
Length=350

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 75/192 (39%), Positives = 110/192 (57%), Gaps = 9/192 (5%)
 Frame = -3

Query  887  GDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEASSKRLEVRLSKWGEIR  708
            G+ +G+ + +D+     +   N+S + L LNSGEKL+SWIDY+  SKR+EVRLS+ G+ R
Sbjct  147  GNRSGSLIEIDVGGEALMTSSNLSDVGLLLNSGEKLRSWIDYDGESKRMEVRLSQAGDPR  206

Query  707  PGYPL-LSCFVDLSQM-WKEDEVFVGLSTSRLW--NQSHKCNVYSWSFKL-RAAPDWMHS  543
            P     + C ++LS + WKE  VFVG+S+   W  N +   ++YSW+F + R AP  MHS
Sbjct  207  PTANCSIYCSINLSSLVWKE-AVFVGISS---WSGNSTETSSLYSWNFTVKRGAPYLMHS  262

Query  542  QPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTLMVLFVWSVLRNRRPI  363
            +PL+P +F V   E      R       +L A++    CGA      +FVW+ L  RRP+
Sbjct  263  EPLNPNSFLVRPTESPPSVHRRKAYAWGVLMAMVSAAACGATLAFSAMFVWAALVARRPV  322

Query  362  VPEELTPEPKEY  327
             P E   E  E+
Sbjct  323  SPVECPVEEDEH  334



>ref|XP_006296653.1| hypothetical protein CARUB_v10015712mg [Capsella rubella]
 gb|EOA29551.1| hypothetical protein CARUB_v10015712mg [Capsella rubella]
Length=338

 Score =   125 bits (313),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 76/201 (38%), Positives = 116/201 (58%), Gaps = 16/201 (8%)
 Frame = -3

Query  941  ENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSI-NLELNSGEKLQSWID  765
            +N   + VEFDI K        GN   + +    S ++ N+S + +L +N+G  L   ID
Sbjct  142  KNETVVAVEFDISKI-------GNCARILIGGPESAEIRNLSFVGDLMMNNGGTLSCMID  194

Query  764  YEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYS  585
            YEA+SKR+ VR  K G I+   P  S  +DL+++W++ +V VGLS++   N S    ++S
Sbjct  195  YEANSKRMMVRFRKSGSIKLFDPFFSFSLDLAKLWEDGQVTVGLSSAN-GNSSKAHFLHS  253

Query  584  WSFKLRAAPD-WMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTL  408
            WSF+ R  P  WMHS+PL+P      + E     +   EC  K+LGAL+ G  CG+LG +
Sbjct  254  WSFETRHPPPMWMHSEPLEPNEVSTEEKEG----RGRSECIWKVLGALVLGAACGSLGVM  309

Query  407  MVLFVWSVLRNRR--PIVPEE  351
            + L++W++ R RR   +VPEE
Sbjct  310  LALYLWTICRVRRSMAVVPEE  330



>gb|EPS65420.1| hypothetical protein M569_09356, partial [Genlisea aurea]
Length=244

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/143 (47%), Positives = 86/143 (60%), Gaps = 4/143 (3%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDK-YGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQS  774
            G     +F  VEF    D +  GD+NGNHV + + S V+V+  NVSSI L LNSG KL S
Sbjct  102  GIPRGARFFEVEFGTSVDGRNLGDLNGNHVSIHVGSPVAVETSNVSSIGLVLNSGLKLHS  161

Query  773  WIDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMW-KEDEVFVGLSTSRLWNQS--H  603
             IDY+A+SKR E+RLS + + RP  PLL   +DL + W  ED V+ GL +S         
Sbjct  162  RIDYDATSKRFEIRLSSFSDRRPYDPLLVYRIDLLRTWGDEDPVYAGLRSSSNGGGDSWQ  221

Query  602  KCNVYSWSFKLRAAPDWMHSQPL  534
              +VYSWSF  R  P W+HSQP+
Sbjct  222  FSSVYSWSFTTRTVPRWLHSQPV  244



>ref|XP_004138574.1| PREDICTED: uncharacterized protein LOC101219233 [Cucumis sativus]
Length=308

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 75/175 (43%), Positives = 100/175 (57%), Gaps = 19/175 (11%)
 Frame = -3

Query  797  NSGEKLQSWIDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRL  618
            N+G K  SW+DY+  SK +E+RLSK+GE RP   LL   +DL       EVFVGLS+   
Sbjct  146  NNGGKFTSWVDYD--SKMVEIRLSKYGESRPYDSLLEYPIDLGIKCGGREVFVGLSS---  200

Query  617  WNQ--SHKCNVYSWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGAL  444
            WN   S    V+SW F +R    WMHS P+DP   R G  EQ      +    L I   +
Sbjct  201  WNSKSSEWSRVFSWRFGVRNVHKWMHSLPVDP---RRGSDEQ------NHSYPLTIFAWV  251

Query  443  IFGTGCGALGTLMVLFVWSVLRNRRPIVPEELTPEPKEYEYKKFQVVVDDKAIKD  279
            IFGTGCGAL   +VLF+W++  NR  I   E  P+  +++Y+K  VVV++  +KD
Sbjct  252  IFGTGCGALMAFLVLFMWAIAGNRNAIFGGE--PQSVDFQYEKVSVVVEE-GLKD  303



>gb|KGN45764.1| hypothetical protein Csa_6G009430 [Cucumis sativus]
Length=330

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 75/175 (43%), Positives = 100/175 (57%), Gaps = 19/175 (11%)
 Frame = -3

Query  797  NSGEKLQSWIDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRL  618
            N+G K  SW+DY+  SK +E+RLSK+GE RP   LL   +DL       EVFVGLS+   
Sbjct  168  NNGGKFTSWVDYD--SKMVEIRLSKYGESRPYDSLLEYPIDLGIKCGGREVFVGLSS---  222

Query  617  WNQ--SHKCNVYSWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGAL  444
            WN   S    V+SW F +R    WMHS P+DP   R G  EQ      +    L I   +
Sbjct  223  WNSKSSEWSRVFSWRFGVRNVHKWMHSLPVDP---RRGSDEQ------NHSYPLTIFAWV  273

Query  443  IFGTGCGALGTLMVLFVWSVLRNRRPIVPEELTPEPKEYEYKKFQVVVDDKAIKD  279
            IFGTGCGAL   +VLF+W++  NR  I   E  P+  +++Y+K  VVV++  +KD
Sbjct  274  IFGTGCGALMAFLVLFMWAIAGNRNAIFGGE--PQSVDFQYEKVSVVVEE-GLKD  325



>gb|KFK38290.1| hypothetical protein AALP_AA3G095000 [Arabis alpina]
Length=347

 Score =   115 bits (287),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 68/179 (38%), Positives = 105/179 (59%), Gaps = 9/179 (5%)
 Frame = -3

Query  875  GNHVGVDLSSLVSVKVGNVSSI-NLELNSGEKLQSWIDYEASSKRLEVRLSKWGEIRPGY  699
            GN+  + +    S K+ N+S + +L + SG +L   I+YEASSKR+ VR  K G ++   
Sbjct  154  GNNARILVGRPESAKIRNLSFVGDLMMRSGGRLNCMIEYEASSKRMMVRFRKSGSVKLFD  213

Query  698  PLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWSFKLRAAPD-WMHSQPLDPKA  522
            P  +  VDL ++WK  EV VGLS++   N S+   ++SW F++R  P  WMHS+PL+P  
Sbjct  214  PFFAFSVDLGKLWKGGEVMVGLSSAN-GNSSNAHFLHSWRFEIRHPPPVWMHSEPLEPTE  272

Query  521  FRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTLMVLFVWSVLRNRR--PIVPEE  351
              V + E     +   E   +++GAL+ G  CG LGT+  L++W++   RR   +VPEE
Sbjct  273  VSVEEKES----RGGSEYKWRMVGALLLGVVCGTLGTMFALYLWTICSVRRSVAVVPEE  327



>ref|XP_008441637.1| PREDICTED: uncharacterized protein LOC103485717 [Cucumis melo]
Length=308

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 72/170 (42%), Positives = 95/170 (56%), Gaps = 18/170 (11%)
 Frame = -3

Query  797  NSGEKLQSWIDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRL  618
            N+G K  SW+DY+  SK +E+RL K+GE RP  PLL   +DL+      EVFVGLS+   
Sbjct  146  NNGGKFTSWVDYD--SKMVEIRLGKYGESRPYDPLLEYPIDLAIKSGGREVFVGLSS---  200

Query  617  WNQ--SHKCNVYSWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGAL  444
            WN   S    V+SW F +R     MHS P+DP   R G  EQ           L I   +
Sbjct  201  WNSKSSEWSRVFSWRFGVRNVHKLMHSLPVDP---RRGSDEQ------DHSYPLTIFAWV  251

Query  443  IFGTGCGALGTLMVLFVWSVLRNRRPIVPEELTPEPKEYEYKKFQVVVDD  294
            IFGTGCGAL   +VLF+W++  NR  I   E  P+   ++Y+K  VVV++
Sbjct  252  IFGTGCGALMAFLVLFMWAIAGNRNAIFGGE--PQSVNFQYEKVNVVVEE  299



>ref|XP_002884719.1| hypothetical protein ARALYDRAFT_317721 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60978.1| hypothetical protein ARALYDRAFT_317721 [Arabidopsis lyrata subsp. 
lyrata]
Length=313

 Score =   112 bits (279),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 78/228 (34%), Positives = 115/228 (50%), Gaps = 25/228 (11%)
 Frame = -3

Query  941  ENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSI-NLELNSGEKLQSWID  765
            +N   +  EFDI K        GN   + +    S K+ N+S + +L +N+G  L   I+
Sbjct  105  KNETVVAFEFDISK-------RGNRARILIGRPESAKIRNLSFVGDLMMNNGGTLNCMIE  157

Query  764  YEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYS  585
            YEASSKR+ VR  K G I+   P  S  VDL + WK  EV VGLS++   N S    +YS
Sbjct  158  YEASSKRMMVRFRKPGSIKLLDPFFSFSVDLEKTWKGGEVMVGLSSAN-GNSSKPHFLYS  216

Query  584  WSFKLRAA-PDWMHSQPLDP-KAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGT  411
            WSF++R   P W+   P  P +  +     ++   +   EC  ++LG L+ G  CGALG 
Sbjct  217  WSFEIRHLDPIWVQPTPFGPNEGLKPDVSTEVEEGRERSECIWRMLGTLVLGAVCGALGA  276

Query  410  LMVLFVWSVLRNRR--PIVPEELTPEPKEYEYKKFQVVVDDKAIKDGK  273
            +  +++W++   RR   +VPEE              V +   A+KDGK
Sbjct  277  MSAMYLWTICGVRRSMAVVPEECA------------VSIVVVAVKDGK  312



>gb|AAD56334.1|AC009326_21 putative lectin [Arabidopsis thaliana]
Length=313

 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 77/228 (34%), Positives = 116/228 (51%), Gaps = 25/228 (11%)
 Frame = -3

Query  941  ENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSI-NLELNSGEKLQSWID  765
            +N   +  EFDI K        GN   V +    S K+ N+S + +L ++ G  L   ID
Sbjct  105  KNETVVAFEFDISK-------RGNRARVLIGRPESAKIRNLSFVGDLMMDDGGILSCMID  157

Query  764  YEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYS  585
            YEASSKR+ VR  K G I+   P  S  VDL ++WK  EV VGLS++   N S    ++S
Sbjct  158  YEASSKRMRVRFRKRGSIKMFDPFFSFSVDLEKLWKGGEVMVGLSSAN-GNSSKPHFLHS  216

Query  584  WSFKL-RAAPDWMHSQPLDP-KAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGT  411
            WSF++    P W+   PL P +  +     ++   + + EC  ++LGAL+    CGA+G 
Sbjct  217  WSFEIWHLDPIWVQPAPLGPNEGLKPDVSTEMEEGRENSECIWRMLGALVLAAVCGAVGA  276

Query  410  LMVLFVWSVLRNRR--PIVPEELTPEPKEYEYKKFQVVVDDKAIKDGK  273
            +  +++W++   RR   +VPEE              V +   A+KDGK
Sbjct  277  MSAMYLWTICSVRRSMAVVPEECA------------VSIVVVAVKDGK  312



>ref|NP_001154599.1| putative lectin [Arabidopsis thaliana]
 gb|AEE74735.1| putative lectin [Arabidopsis thaliana]
Length=345

 Score =   110 bits (274),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 79/228 (35%), Positives = 117/228 (51%), Gaps = 25/228 (11%)
 Frame = -3

Query  941  ENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSI-NLELNSGEKLQSWID  765
            +N   +  EFDI K        GN   V +    S K+ N+S + +L ++ G  L   ID
Sbjct  137  KNETVVAFEFDISK-------RGNRARVLIGRPESAKIRNLSFVGDLMMDDGGILSCMID  189

Query  764  YEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYS  585
            YEASSKR+ VR  K G I+   P  S  VDL ++WK  EV VGLS++   N S    ++S
Sbjct  190  YEASSKRMRVRFRKRGSIKMFDPFFSFSVDLEKLWKGGEVMVGLSSAN-GNSSKPHFLHS  248

Query  584  WSFKL-RAAPDWMHSQPLDP-KAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGT  411
            WSF++    P W+   PL P +  +     ++   + + EC  ++LGAL+    CGA+G 
Sbjct  249  WSFEIWHLDPIWVQPAPLGPNEGLKPDVSTEMEEGRENSECIWRMLGALVLAAVCGAVGA  308

Query  410  LMVLFVWSVLRNRR--PIVPEELTPEPKEYEYKKFQVVVDDKAIKDGK  273
            +  +++W++   RR   +VPEE              VVV   A+KDGK
Sbjct  309  MSAMYLWTICSVRRSMAVVPEECAVS---------IVVV---AVKDGK  344



>ref|XP_010676673.1| PREDICTED: L-type lectin-domain containing receptor kinase I.3-like 
[Beta vulgaris subsp. vulgaris]
Length=256

 Score =   108 bits (270),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 85/125 (68%), Gaps = 4/125 (3%)
 Frame = -3

Query  929  FLGVEFDILKDDK--YGDVNG-NHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYE  759
            F+GV+ +I  DD   +G+ +  NHVG+  S+  S K  N +  NL L+SGE+LQ W+DYE
Sbjct  133  FIGVKINIRHDDTQLFGNSDAANHVGLYASTPPSAKFANAADANLVLDSGERLQLWLDYE  192

Query  758  ASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWS  579
            A+SKR+EVR+++WG+ RP  PLL   V+LS+M+   +VF+ L+ S   N +  C +YSWS
Sbjct  193  ATSKRVEVRVAQWGKKRPVDPLLWLSVNLSKMFNTQDVFLTLA-SITGNSTQVCKLYSWS  251

Query  578  FKLRA  564
            F+LR 
Sbjct  252  FELRT  256



>ref|XP_009407575.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.4-like 
[Musa acuminata subsp. malaccensis]
Length=345

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 69/199 (35%), Positives = 103/199 (52%), Gaps = 16/199 (8%)
 Frame = -3

Query  926  LGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEASSK  747
            + V+F     +KY + +G  + +D+      K  N+S +       +KLQSWIDY+  SK
Sbjct  129  VAVKFGRSNREKYSNGSGTLIEIDVGGQALKKSSNLSGVE------DKLQSWIDYDGKSK  182

Query  746  RLEVRLSKWGEI-RPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWN--QSHKCNVYSWSF  576
            R+EVRLS   +  RP    +SC VDLS     + V VG+S    WN   +    +Y W+F
Sbjct  183  RIEVRLSHSRDSSRPMNSSISCSVDLSNALWREAVTVGMSC---WNANSTKTSTLYRWNF  239

Query  575  KLR-AAPDWMHSQPLDPKAFRVG---KPEQLSVPKRSDECGLKILGALIFGTGCGALGTL  408
              +  +P  MHS+PL+P +F V     P  L  P+R       +  A++F   CGA+   
Sbjct  240  TSKHGSPYLMHSEPLNPNSFLVRPTESPPPLLHPRRGGAYPWGVFMAMLFAAACGAMVAF  299

Query  407  MVLFVWSVLRNRRPIVPEE  351
             V+F+W  L +RRP+ P E
Sbjct  300  FVVFMWLALVSRRPVAPVE  318



>ref|XP_006848043.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.2 
[Amborella trichopoda]
 gb|ERN09624.1| hypothetical protein AMTR_s00029p00189980 [Amborella trichopoda]
Length=447

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 73/211 (35%), Positives = 111/211 (53%), Gaps = 11/211 (5%)
 Frame = -3

Query  932  KFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEAS  753
                +EFD   +      +GN VG D ++LVS+K  + SSI L LN+   L SWI Y + 
Sbjct  232  NMFAIEFDTSMNSNSTSFDGNQVGFDPNTLVSIKAADTSSIGLVLNNDTTLHSWIHYHSI  291

Query  752  SKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWSFK  573
            S+ +EVR+S      P  PL+S   DLS++W + E+FVG++ S   N +    +YSWSF 
Sbjct  292  SQTVEVRISNSIASWPLKPLISIHKDLSRIWGK-ELFVGITGSN-GNSTQTSVIYSWSFD  349

Query  572  LRAAPDW--MHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTLMVL  399
                 +W   HS P+DP+   V   +  S   R +    + + ALI+G G GA+  L V 
Sbjct  350  --GGYNWKNQHSMPVDPRTLEV---KNGSFGGRINVI-CRTMVALIWGIGIGAIAALSVF  403

Query  398  FVWSVLRNR-RPIVPEELTPEPKEYEYKKFQ  309
             VW++  +R +  V +    +P +  Y+K Q
Sbjct  404  VVWNLFMSRYKSSVADYGGKKPVDLGYEKIQ  434



>ref|XP_004987284.1| PREDICTED: uncharacterized protein LOC101762725 [Setaria italica]
Length=338

 Score =   107 bits (268),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 66/175 (38%), Positives = 87/175 (50%), Gaps = 22/175 (13%)
 Frame = -3

Query  779  QSWIDYEASSKRLEVRLSKWGEIR--PGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQS  606
             +WIDY A+S  L VRLS    I   P  PLLSC +DLS +     V  G  T      S
Sbjct  166  HAWIDYNATSATLHVRLSAATTIHNHPTPPLLSCPLDLSPVLLRGPVLAGFRT-----PS  220

Query  605  HKCNVYSWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDEC----GLKILGALIF  438
              C ++SW+F   AAP  MHSQPL+P +     P     P R+D      G  +  +L+F
Sbjct  221  GNCTLFSWAF--HAAPYRMHSQPLNPASLLATPP-----PDRADRHYSPWGAAV--SLLF  271

Query  437  GTGCGALGTLMVLFVWSVLRNRRPIVPEELTPEPKEYEYKKFQV--VVDDKAIKD  279
               CGA+ T  VL++W  +  RRP+ P E    P +  Y+K  +  V DD A  D
Sbjct  272  AAACGAMVTFFVLYLWYAVTARRPVAPVEYPMHPSDVAYQKIVLVGVKDDSATTD  326



>ref|NP_683540.1| concanavalin A-like lectin [Arabidopsis thaliana]
 gb|AEE74712.1| concanavalin A-like lectin [Arabidopsis thaliana]
Length=338

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 80/205 (39%), Positives = 117/205 (57%), Gaps = 15/205 (7%)
 Frame = -3

Query  941  ENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSI-NLELNSGEKLQSWID  765
            +N   + VEF I +        GN   + +    S ++ N+S + +L +++G  L   I+
Sbjct  141  KNETVVAVEFGISR-------TGNSARILVGRPESAEIRNLSFVGDLMMDNGRTLSCMIE  193

Query  764  YEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYS  585
            YEASSKR+ VR  K G ++   P  S  VDL+++WK  EV VGLS++   + S    ++S
Sbjct  194  YEASSKRMMVRFRKSGSVKLFDPFFSFSVDLAKLWKGGEVTVGLSSANGNSSSKAHFLHS  253

Query  584  WSFKLRAAPD-WMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTL  408
            W F++R  P  WMHS PL+P    V K E+    +   EC  K+LGALIFG  CGALG L
Sbjct  254  WRFEIRHPPPMWMHSVPLEPN--EVSKEEENG--RGRSECTRKMLGALIFGAACGALGAL  309

Query  407  MVLFVWSVLRNRR--PIVPEELTPE  339
            + L++W++ R RR   +VPEE   E
Sbjct  310  LGLYLWTICRVRRSMAVVPEECAIE  334



>ref|XP_010326006.1| PREDICTED: LOW QUALITY PROTEIN: L-type lectin-domain containing 
receptor kinase VIII.1 [Solanum lycopersicum]
Length=719

 Score =   106 bits (265),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 74/260 (28%), Positives = 132/260 (51%), Gaps = 49/260 (19%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSW  771
            G+  N+   GVEFD L D ++ D+NGNHVG+DL+S++S +VG++ SI ++L SG+ + SW
Sbjct  127  GQNGNF---GVEFDTLMDVEFKDINGNHVGLDLNSMISTQVGDLDSIGVDLKSGDLVNSW  183

Query  770  IDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNV  591
            IDY  S+K+L + +S +  ++P  P LS  +D+S+ +  D +FVG S S     +   ++
Sbjct  184  IDYFGSTKKLNLYVS-YSNLKPKEPFLSVTIDISE-YVNDFMFVGFSGST-QGSTEIHSI  240

Query  590  YSWSFKL------RAAPDWMHSQPLDPKAFRVGKP---------------EQL-------  495
              WSF        ++ P  +  QP  P    +  P               +Q+       
Sbjct  241  EYWSFTSSFDTNPKSPPAAVAEQPPPPPTASLMNPTADVTTSVTSPPPEQQQIAPAEANG  300

Query  494  ---SVPKRSDEC--------GLKILGALIFGTGCGALGTLMVLFVWSV----LRNRRPIV  360
               +V K S +C           ++G +  G    AL TL++++++S     ++    ++
Sbjct  301  TANAVQKNSSKCHSSFCKQGAGAVVGVVTAGAFFLALATLVLIWLYSKKFKHVKASETML  360

Query  359  PEELTPEPKEYEYKKFQVVV  300
            P ++   PKE+ YK+ ++  
Sbjct  361  PSDIIKMPKEFSYKELKIAT  380



>ref|XP_006361798.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.1-like 
[Solanum tuberosum]
Length=712

 Score =   106 bits (264),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 73/257 (28%), Positives = 133/257 (52%), Gaps = 46/257 (18%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSW  771
            G+  N+   GVEFD L D ++ D+NGNHVG+DL+S++S +VG++ SI ++L SG+ + SW
Sbjct  127  GQNGNF---GVEFDTLMDVEFKDINGNHVGLDLNSMISTQVGDLDSIGVDLKSGDLVNSW  183

Query  770  IDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNV  591
            IDY  S+K+L + +S +  ++P  P LS  +D+S+ +  D +FVG S S     +   ++
Sbjct  184  IDYFGSTKKLNLYVS-YSNLKPKEPFLSVTIDISE-YVNDFMFVGFSGST-QGSTEIHSI  240

Query  590  YSWSFKL------RAAPDWMHSQP--------LDPKAFRVGKP----EQL----------  495
              WSF        ++ P+ +  QP        ++P A     P    +Q+          
Sbjct  241  EYWSFTSSFDTNPKSPPEAVAEQPPPPPTASLMNPTADVTTSPPPEQQQIAPADANGTAN  300

Query  494  SVPKRSDEC--------GLKILGALIFGTGCGALGTLMVLFVWSV----LRNRRPIVPEE  351
            +V + S +C           ++G +  G    A  TL++++++S     ++    ++P  
Sbjct  301  AVQRNSSKCHNSFCKQGAGAVVGVVTAGAFFLAFATLVLIWLYSKKFKNVKTSETMLPSN  360

Query  350  LTPEPKEYEYKKFQVVV  300
            +   PKE+ YK+ ++  
Sbjct  361  IIKMPKEFSYKELKIAT  377



>emb|CDY07898.1| BnaC03g36250D [Brassica napus]
Length=346

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 69/202 (34%), Positives = 105/202 (52%), Gaps = 17/202 (8%)
 Frame = -3

Query  941  ENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVS-SINLELNSGEKLQSWID  765
            +N   +G EFD+          GN   +    L+  ++ N+S   +L +  G +L   ++
Sbjct  142  KNETVVGFEFDV-------SSGGNRARI----LIGSQIRNLSFRGDLMMEKGGRLSCMVE  190

Query  764  YEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYS  585
            YEASSKR+ VR  K G ++   P  S  VDL ++W   E  VGLS++   N S+   +YS
Sbjct  191  YEASSKRMMVRFRKAGSVKMYDPFFSFSVDLEELWSGGEFMVGLSSAN-GNSSNAHFLYS  249

Query  584  WSFKL-RAAPDWMHSQPLDP-KAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGT  411
            W  ++    P WMHS+PL P +A    K  +  V    + C   +LG L+ G  CGALG 
Sbjct  250  WGVEIWHPPPVWMHSEPLQPYEALEAEKSTEEEVGVERNGCLWGMLGVLVLGAVCGALGA  309

Query  410  LMVLFVWSVLRNRRP--IVPEE  351
            ++ L +W++   RR   +VPEE
Sbjct  310  VLALCLWTLCGVRRSMVVVPEE  331



>ref|XP_010665938.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.3-like 
[Beta vulgaris subsp. vulgaris]
Length=237

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 79/120 (66%), Gaps = 5/120 (4%)
 Frame = -3

Query  929  FLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEASS  750
            F+ V+ D   D ++G+VN  HVG+ ++   SV     S + LELNSG++L  W+DYEAS 
Sbjct  122  FVAVQLDTNYDQEFGNVN--HVGIYVNRPASVNRVAHSVVKLELNSGKRLHCWVDYEASL  179

Query  749  KRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGL-STSRLWNQSHKCNVYSWSFK  573
            K++EVR+++WGE RP +P L C +DLS+M+    V++   STS   NQ   C +YSWSF+
Sbjct  180  KQVEVRVARWGEKRPVHPSLYCPIDLSEMFNTKNVYLAFTSTSGYSNQ--ICMLYSWSFE  237



>ref|XP_009146954.1| PREDICTED: uncharacterized protein LOC103870564 [Brassica rapa]
Length=354

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 69/203 (34%), Positives = 106/203 (52%), Gaps = 14/203 (7%)
 Frame = -3

Query  941  ENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVS-SINLELNSGEKLQSWID  765
            +N      EFDI K        GN   V +    S ++ N+S   +L + SG +L   ++
Sbjct  141  KNETVAAFEFDISK-------RGNRARVLVGKPESSEIRNLSFEGDLLMESGGRLNCMVE  193

Query  764  YEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYS  585
            YEASSKR+ VR  K G ++   P  S  VDL ++W + E  V LS++   N S+   ++S
Sbjct  194  YEASSKRVMVRFRKPGSVKLLDPFFSFSVDLGELWSDGEFVVCLSSAN-GNSSNAHLLHS  252

Query  584  WSFKLRA-APDWMHSQPLDP-KAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGT  411
            W F++R   P WMHS P++P +A       +       +EC  ++LG  + G  CGALG 
Sbjct  253  WRFEIRQPTPVWMHSLPVEPNQAIEADVSTEGEEGVERNECIWRMLGVWVLGAVCGALGV  312

Query  410  LMVLFVWSVLRNRRP---IVPEE  351
             + L++W++   RR    +VPEE
Sbjct  313  TLALYLWTICGLRRSMAVVVPEE  335



>emb|CDY53094.1| BnaCnng24240D [Brassica napus]
Length=352

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/158 (37%), Positives = 88/158 (56%), Gaps = 6/158 (4%)
 Frame = -3

Query  809  NLELNSGEKLQSWIDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLS  630
            +L ++ G +L   I+YEA  KR+ VR  K G ++   P  S  VDL ++W   E  VGLS
Sbjct  178  DLLMDDGGRLNCMIEYEALIKRMMVRFRKPGSVKLLDPFFSFSVDLGELWNGGEFVVGLS  237

Query  629  TSRLWNQSHKCNVYSWSFKLRA-APDWMHSQPLDP-KAFRVGKPEQLSVPKRSDECGLKI  456
            +    N S+   ++SW F++R   P W HS PL+P +A       +       +EC  ++
Sbjct  238  SVN-GNSSNAHFLHSWRFEIRQPTPVWTHSLPLEPNQAIEADDSTEGGKGVERNECIWRM  296

Query  455  LGALIFGTGCGALGTLMVLFVWSVLRNRRP---IVPEE  351
            LG L+FG  CGALG ++ L++W++   RR    +VPEE
Sbjct  297  LGVLVFGAVCGALGVMLALYLWTICGLRRSMAVVVPEE  334



>ref|XP_009135075.1| PREDICTED: probable L-type lectin-domain containing receptor 
kinase VI.1 [Brassica rapa]
Length=346

 Score = 97.4 bits (241),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 67/204 (33%), Positives = 105/204 (51%), Gaps = 21/204 (10%)
 Frame = -3

Query  941  ENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVS-SINLELNSGEKLQSWID  765
            +N   +G EFD+          GN   +    L+  ++ N+S   +L +  G +L   ++
Sbjct  143  KNETVVGFEFDV-------SSGGNRARI----LIGSQIRNLSFRGDLMMEKGGRLNCMVE  191

Query  764  YEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYS  585
            YE SSKR+ +R  K G ++   P  S  VDL ++W   E  VGLS++   N S+   +YS
Sbjct  192  YEGSSKRMMIRFRKAGSVKMYDPFFSFSVDLEELWNGGEFMVGLSSAN-GNSSNAHFLYS  250

Query  584  WSFKL-RAAPDWMHSQPLDPKAFRVG---KPEQLSVPKRSDECGLKILGALIFGTGCGAL  417
            W  ++    P WMHS+PL P     G     E+  V +  +EC   ++G L+ G  CGAL
Sbjct  251  WGVEVWHPPPVWMHSEPLQPYEALEGDSSTEEEEGVGR--NECVWGMIGVLVLGAVCGAL  308

Query  416  GTLMVLFVWSVLRNRRP--IVPEE  351
            G ++ L +W++   RR   +VPEE
Sbjct  309  GAVLALCIWTLCGVRRSMVVVPEE  332



>emb|CDX73952.1| BnaA03g30950D [Brassica napus]
Length=346

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 67/203 (33%), Positives = 104/203 (51%), Gaps = 21/203 (10%)
 Frame = -3

Query  941  ENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVS-SINLELNSGEKLQSWID  765
            +N   +G EFD+          GN   +    L+  ++ N+S   +L +  G +L   ++
Sbjct  143  KNETVVGFEFDV-------SSGGNRARI----LIGSQIRNLSFRGDLMMEKGGRLNCMVE  191

Query  764  YEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYS  585
            YE SSKR+ VR  K G ++   P  S  VDL ++W   E  VGLS++   N S+   +YS
Sbjct  192  YEGSSKRMMVRFRKAGSVKMYDPFFSFSVDLEELWNGGEFMVGLSSAN-GNSSNAHFLYS  250

Query  584  WSFKL-RAAPDWMHSQPLDPKAFRVG---KPEQLSVPKRSDECGLKILGALIFGTGCGAL  417
            W  ++    P WMHS+PL P     G     E+  V +  +EC   ++G L+ G  CGAL
Sbjct  251  WGVEVWHPPPVWMHSEPLQPYEALEGDSSTEEEEGVGR--NECVWGMIGVLVLGAVCGAL  308

Query  416  GTLMVLFVWSVLRNRRP--IVPE  354
            G ++ L +W++   RR   +VPE
Sbjct  309  GAVLALCIWTLCGVRRSMVVVPE  331



>ref|XP_012082318.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.1 
[Jatropha curcas]
 gb|KDP29095.1| hypothetical protein JCGZ_16484 [Jatropha curcas]
Length=705

 Score = 98.6 bits (244),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 57/158 (36%), Positives = 93/158 (59%), Gaps = 8/158 (5%)
 Frame = -3

Query  929  FLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEASS  750
            F+ VEFD L D +Y D+NGNHVG+DL+S+VS +VG++ +IN++L SG+ + +WIDY  S+
Sbjct  139  FVAVEFDTLMDVEYKDINGNHVGLDLNSMVSTQVGDLGAINIDLKSGDLVNAWIDYNGSN  198

Query  749  KRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLS-TSRLWNQSHKCNVYSWSFK  573
              L V +S +  ++P  P+LS  +DL Q +  D ++VG S +++   ++H    +S+S  
Sbjct  199  HGLNVFVS-YSNLKPKEPILSLILDLDQ-YVSDFMYVGFSGSTQGSTETHSIEWWSFSSL  256

Query  572  LRAAPDWMHSQP-----LDPKAFRVGKPEQLSVPKRSD  474
              +     +  P     ++P A  V  P     P  SD
Sbjct  257  FDSTGSSSYPPPPTTSLMNPTANSVKSPPPTLAPTGSD  294



>emb|CDY44678.1| BnaA05g29280D [Brassica napus]
Length=353

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 68/203 (33%), Positives = 104/203 (51%), Gaps = 14/203 (7%)
 Frame = -3

Query  941  ENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVS-SINLELNSGEKLQSWID  765
            +N      EFDI K        GN   V +    S ++ N+S   +L + SG +L   ++
Sbjct  141  KNETVAAFEFDISK-------RGNRARVLVGKPESSEIRNLSFEGDLLMESGGRLNCMVE  193

Query  764  YEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYS  585
            YEASSKR+ VR  K G ++   P  S  VDL ++W + E  V LS++   N S+   ++S
Sbjct  194  YEASSKRVMVRFRKPGSVKLLDPFFSFSVDLGELWSDGEFVVCLSSAN-GNSSNAHLLHS  252

Query  584  WSFKLRA-APDWMHSQPLDP-KAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGT  411
            W F++R   P WMHS PL+P +A       +       +EC  ++ G  + G   GALG 
Sbjct  253  WRFEIRQPTPVWMHSLPLEPNQAIEADVSTEGEEDVERNECIWRMFGVWVLGAVFGALGV  312

Query  410  LMVLFVWSVLRNRRP---IVPEE  351
             + L++W++   RR    +VPEE
Sbjct  313  TLALYLWTICGLRRSMAVVVPEE  335



>ref|XP_010486478.1| PREDICTED: lectin-like [Camelina sativa]
Length=336

 Score = 95.1 bits (235),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 67/207 (32%), Positives = 107/207 (52%), Gaps = 15/207 (7%)
 Frame = -3

Query  941  ENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVS-SINLELNSGEKLQSWID  765
            +N   +  EFDI K        GN   + +    S  + N+S   +L +N+G  L   ID
Sbjct  135  KNETVVAFEFDISK-------RGNRARILIGRPESSNIRNLSFDGDLMMNNGGTLSCMID  187

Query  764  YEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCN-VY  588
            Y A SK + V   + G I+   P  S  VDL+++WK  EV VGLS++    +S K + ++
Sbjct  188  YAARSKSMMVNFRRSGSIKEFDPFFSFSVDLAKLWKGGEVMVGLSSAN--GKSSKAHFLH  245

Query  587  SWSFKL-RAAPDWMHSQPLDP-KAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALG  414
            SWSF+  +  P W+H  PL+  +  +     +    +   EC  ++LG L+ G  CGALG
Sbjct  246  SWSFETWQRHPMWLHPVPLEQNEGLKADVSTEEEEGRERSECTWRMLGGLVLGVVCGALG  305

Query  413  TLMVLFVWSVLRNRR--PIVPEELTPE  339
             ++ L++W++   +R   +VPEE   E
Sbjct  306  AMLALYLWTICGVKRSMAVVPEECAIE  332



>ref|XP_008343599.1| PREDICTED: L-type lectin-domain containing receptor kinase S.4-like, 
partial [Malus domestica]
Length=396

 Score = 95.1 bits (235),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 75/226 (33%), Positives = 114/226 (50%), Gaps = 31/226 (14%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKV--------GNVSSINLELN  795
            G   N+ F  VEFD ++D ++GD+N NHVG+D++SL S K         GN +  NL+L 
Sbjct  136  GNFSNHIF-AVEFDTVQDFEFGDINDNHVGIDINSLASNKSTPAGFFTGGNSTKENLKLK  194

Query  794  SGEKLQSWIDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSR-L  618
            SG  +Q+W+DY++   ++ V LS    I+P  P+L+  VDLS +  ED ++VG S S  L
Sbjct  195  SGLPIQAWVDYDSVKNQVTVMLSP-DSIKPRSPILTFDVDLSPIL-EDFMYVGFSASTGL  252

Query  617  WNQSHKCNVYSWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKI---LGA  447
               SH   V  WSFK+        ++ LD +A       +L  PK+     L +   L  
Sbjct  253  LASSHY--VSGWSFKMNG-----EAKSLDLEAL-----PKLPGPKKKHSSALIVGVSLSV  300

Query  446  LIFGTGCGALGTLMVLFVWSVLRNRRPIVPEELTPEPKEYEYKKFQ  309
            L+F      LG     ++   ++N   I P EL   P  + Y + +
Sbjct  301  LVFFILAAGLG----FYIVHRIKNAEVIEPWELDIGPHRFRYNELK  342



>ref|XP_006664666.1| PREDICTED: L-type lectin-domain containing receptor kinase S.4-like 
[Oryza brachyantha]
Length=576

 Score = 96.7 bits (239),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 75/225 (33%), Positives = 114/225 (51%), Gaps = 33/225 (15%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSW  771
            G   N+  L VEFD ++D ++GD+N NHVGVDL+SLVS    + + +N++  SG+ + +W
Sbjct  138  GNATNH-VLAVEFDTVQDFEFGDINDNHVGVDLNSLVSNASASAAPVNIK--SGDTILAW  194

Query  770  IDYEASSKRLEVRLSKWGE---IRPGYPLLSCFVDLSQMWKEDEVFVGLSTSR-LWNQSH  603
            +DY+A ++ L V ++        +P  PL+S  VDLS ++  D+++VG S S  L   SH
Sbjct  195  VDYDAGARLLNVSIAAAASSKGSKPAAPLISFHVDLSPIFL-DQMYVGFSASTGLLASSH  253

Query  602  KCNVYSWSFKL--RAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTG  429
               +  WSFKL   AAP      PLD            S+P        K   +LI  + 
Sbjct  254  Y--LMGWSFKLGGGAAP------PLDVS----------SLPSLPRPAASKNRTSLILASA  295

Query  428  CGALGTLMVL-----FVWSVLRNRRPIVPEELTPEPKEYEYKKFQ  309
              A   L+VL     +     +NR  + P EL   P  Y+Y + +
Sbjct  296  FSAFVALVVLAGAATYAAYRYKNRDVVEPWELDYGPHRYKYSELK  340



>gb|EAZ36652.1| hypothetical protein OsJ_20996 [Oryza sativa Japonica Group]
Length=698

 Score = 96.7 bits (239),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 66/226 (29%), Positives = 103/226 (46%), Gaps = 17/226 (8%)
 Frame = -3

Query  944  KENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWID  765
            K N   + VEFD + +D++GD + NHVG+DL S VSV   ++++  + LNSG    +WID
Sbjct  146  KTNASIVAVEFDTMLNDEFGDPSDNHVGLDLGSPVSVNAVDLAAFGVVLNSGNLTTAWID  205

Query  764  YEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYS  585
            Y  +   L+V LS +   +P  P+LS  VDLS  +  D ++VG S S     + +  +  
Sbjct  206  YHGADHLLQVSLS-YSAAKPAKPVLSVAVDLSP-YLRDAMYVGFSAST-EGSTQQHTIKE  262

Query  584  WSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGL----KILGALIFGTGCGAL  417
            W+F+    P   +S          G     +VP  +   G+    K  G  +   G  AL
Sbjct  263  WTFQTFGFPSATNSSSFSNT---TGNASAQTVPGEAAAGGVASRKKRFGLALGILGPVAL  319

Query  416  GTLMVLFVWSVLRNRRPIVPE-------ELTPEPKEYEYKKFQVVV  300
                V F W  +R    +          EL   P+++ YK+     
Sbjct  320  AVSFVFFAWVSIRKLIELTSRKNAGFLPELVKGPRKFSYKELSAAT  365



>ref|XP_011097757.1| PREDICTED: probable L-type lectin-domain containing receptor 
kinase S.7 [Sesamum indicum]
Length=673

 Score = 95.9 bits (237),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 69/217 (32%), Positives = 109/217 (50%), Gaps = 15/217 (7%)
 Frame = -3

Query  932  KFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEAS  753
            +F+ VEFD   D  + D +GNHVG+D+ SL+SVK  N     + L SG  + +WIDY   
Sbjct  137  RFIAVEFDTKLDLDFNDPDGNHVGLDIDSLISVKTANPMLRAINLKSGNLITAWIDYSNE  196

Query  752  SKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWSFK  573
             K++EV LS +   +P  PLL+  +DLS   KE  +F G S S     +   ++ +WSF+
Sbjct  197  RKKVEVFLS-YSSFKPDEPLLTVDIDLSDYLKE-FMFAGFSAST-EGSTELHHIQNWSFQ  253

Query  572  ---LRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGA-LGTLM  405
                R     +HS  +   +  + +P  + V    +    +I   L  G GC A    ++
Sbjct  254  TTGFRPVRPRIHSHNVSDSSVPL-RPPPIPVSDSGNRHHKRI--GLALGIGCPAFFCAVL  310

Query  404  VLFVWSVLRNRRPI-----VPEELTPEPKEYEYKKFQ  309
            V+F W  ++  R I     +  EL   P+E+ YK+ +
Sbjct  311  VVFGWVSVKKWRGIRTDKSLKAELVTGPREFNYKELK  347



>ref|XP_010253592.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.1 
[Nelumbo nucifera]
Length=719

 Score = 95.9 bits (237),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 72/102 (71%), Gaps = 2/102 (2%)
 Frame = -3

Query  929  FLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEASS  750
            F+ VEFD L D ++ D+NGNHVGVDL+SLVS +VG++ ++N+EL SG+ + +WIDY+ S+
Sbjct  140  FVAVEFDTLMDVEFKDINGNHVGVDLNSLVSFQVGDLGAVNVELKSGDLVNAWIDYDGST  199

Query  749  KRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTS  624
                V +S +  +RP  PLLS  +DL + +  D +FVG S S
Sbjct  200  HLFNVSVS-YSNLRPTDPLLSFTLDLYR-FVNDFMFVGFSGS  239



>ref|XP_004249497.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.1-like 
[Solanum lycopersicum]
Length=721

 Score = 95.5 bits (236),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 71/244 (29%), Positives = 123/244 (50%), Gaps = 39/244 (16%)
 Frame = -3

Query  926  LGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEASSK  747
            + VEFD L D ++ D+NGNHVG+DL+S++S +VGN+ SI+++L SG+ +  WIDY  S+ 
Sbjct  143  IAVEFDTLMDVEFKDINGNHVGLDLNSMISTEVGNLDSIDIDLKSGDLVNCWIDYSGSNG  202

Query  746  RLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWSF--K  573
             +++ +S +  ++P    LS  ++L++ +  D +FVG S S     +   N+  WSF   
Sbjct  203  EMDIFVS-YTNLKPKESFLSVNINLAE-YVNDFMFVGFSAST-QGSTEIHNIVWWSFSSS  259

Query  572  LRAAPD--WMHSQPLDPKAFRVGKPEQLSVP--------------------KRSDECGLK  459
              A P+   + ++P  P A  +  P   SVP                    K S +C   
Sbjct  260  FDATPNSGAVVAEP-PPPANSLMNPTADSVPLPPPSMAPSESNSSKGVLQEKSSRKCHSN  318

Query  458  --------ILGALIFGTGCGALGTLMVLFVWSVLRNR---RPIVPEELTPEPKEYEYKKF  312
                    ++G +  G    A  TL++++++S    R     IV  ++   PKE+ YK+ 
Sbjct  319  FCRQGPGAVVGVVTAGAFFLAFATLVLIWLYSKRFKRVKNSEIVASDIIKMPKEFSYKEL  378

Query  311  QVVV  300
            ++  
Sbjct  379  KLAT  382



>ref|XP_003522123.1| PREDICTED: L-type lectin-domain containing receptor kinase S.4-like 
[Glycine max]
Length=684

 Score = 95.1 bits (235),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 83/240 (35%), Positives = 118/240 (49%), Gaps = 41/240 (17%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVK---VG-------NVSSINLE  801
            G   N+ F  VEFD  +D ++GD++ NHVG+D++SLVS+    VG       N +  NL 
Sbjct  133  GNSSNHLF-AVEFDTAQDFEFGDIDDNHVGIDINSLVSIASAPVGYYTGGDDNSTKQNLT  191

Query  800  LNSGEKLQSWIDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSR  621
            L SGE + +W+DY+AS   + V +S+    +P  PLLS  VDLS ++ ED +FVG S S 
Sbjct  192  LTSGEPIIAWVDYDASQSIVNVTISE-SSTKPKRPLLSHHVDLSPIF-EDLMFVGFSAST  249

Query  620  -LWNQSHKCNVYSWSFKLR--AAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDE---CGLK  459
             L   SH   +  WSFK+   A P  + S P            QL  PK+       G+ 
Sbjct  250  GLLASSHY--ILGWSFKINGPAPPLELSSLP------------QLPGPKKKHTSLITGVS  295

Query  458  ILGALIFGTGCGALGTLMVLFVWSVLRNRRPIVPEELTPEPKEYEYKKFQVVVDDKAIKD  279
            I G L     C   G L  ++++   +N   I   EL   P  Y Y++ +     K  KD
Sbjct  296  ISGFLAL---C---GFLFGIYMYRRYKNADVIEAWELEIGPHRYSYQELKKAT--KGFKD  347



>ref|XP_006339063.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.1-like 
[Solanum tuberosum]
Length=720

 Score = 94.7 bits (234),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 68/244 (28%), Positives = 121/244 (50%), Gaps = 38/244 (16%)
 Frame = -3

Query  926  LGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEASSK  747
            + VEFD L D ++ D+NGNHVG+DL+S++S ++GN+ SI+++L SG+ +  WI+Y  S+ 
Sbjct  143  IAVEFDTLMDVEFKDINGNHVGLDLNSMISTEIGNLDSIDIDLKSGDLINCWIEYSGSNG  202

Query  746  RLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWSF--K  573
             +++ +S +  ++P    LS  ++L++ +  D +FVG S S     +   N+  WSF   
Sbjct  203  EMDIFVS-YTNLKPKESFLSVNINLAE-YVNDFMFVGFSGST-QGSTEIHNIVWWSFSSS  259

Query  572  LRAAPD---------WMHSQPLDPKAFRVGKPEQLSVP-------------KRSDECGLK  459
              A P+            +  ++P A  V  P     P             KRS +C   
Sbjct  260  FDATPNSGEVVAPPPPPTTSLMNPTADSVALPPPSMAPSESNSSTPGVLQEKRSRKCHSN  319

Query  458  --------ILGALIFGTGCGALGTLMVLFVWSVLRNR---RPIVPEELTPEPKEYEYKKF  312
                    ++G +  G    A  TL++++++S    R     IV  ++   PKE+ YK+ 
Sbjct  320  FCKQGPGAVVGVVTAGAFFLAFATLVLIWLYSKRFKRVKNSEIVASDIIKMPKEFSYKEL  379

Query  311  QVVV  300
            ++  
Sbjct  380  KLAT  383



>ref|XP_010469992.1| PREDICTED: uncharacterized protein LOC104749882 isoform X2 [Camelina 
sativa]
Length=287

 Score = 91.7 bits (226),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 65/207 (31%), Positives = 107/207 (52%), Gaps = 15/207 (7%)
 Frame = -3

Query  941  ENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVS-SINLELNSGEKLQSWID  765
            +N   +  EFDI K        GN   + +    S  + N+S   +L +N+G  L   ID
Sbjct  86   KNETVVAFEFDISK-------RGNRARILIGRPESSNIRNLSFDGDLMMNNGGTLSCMID  138

Query  764  YEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCN-VY  588
            Y AS K++ V   + G I+   P  S  VDL+++W+  EV VGLS++    +S K + ++
Sbjct  139  YVASYKKMMVNFRRSGSIKEYDPFFSFSVDLAKLWEGGEVMVGLSSAN--GKSSKAHFLH  196

Query  587  SWSFKL-RAAPDWMHSQPLDP-KAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALG  414
            SW  +  +  P W+H  PL+  +  +     +    +   EC  +++GAL+ G  CGALG
Sbjct  197  SWRIETWQRQPMWLHPVPLEQNEGLKADVSTEEEEGRERSECTWRMVGALVLGVVCGALG  256

Query  413  TLMVLFVWSVLRNRR--PIVPEELTPE  339
             ++ L++W++   RR   +VPEE   E
Sbjct  257  AMLALYLWTICGVRRSMAVVPEECAIE  283



>ref|XP_007140498.1| hypothetical protein PHAVU_008G117700g [Phaseolus vulgaris]
 gb|ESW12492.1| hypothetical protein PHAVU_008G117700g [Phaseolus vulgaris]
Length=672

 Score = 94.0 bits (232),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 69/215 (32%), Positives = 108/215 (50%), Gaps = 18/215 (8%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSW  771
            G   N+ F  VEFD ++D ++GD+N NHVG+D++S+ S K  NVS + L L  G+ + +W
Sbjct  131  GNFSNHIF-AVEFDTVQDFEFGDINDNHVGIDINSMQSNKSANVSVVGLNLKGGKPVLAW  189

Query  770  IDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSR-LWNQSHKCN  594
            +DY++    + V LS     +P  P+LS  VDLS ++  D ++VG S S  L   SH   
Sbjct  190  VDYDSELNVISVALSP-NSSKPKTPILSFNVDLSPVF-HDTMYVGFSASTGLLASSHY--  245

Query  593  VYSWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALG  414
            +  WSFK+        + PLD  +       QL  PK+       I+G  +       L 
Sbjct  246  ILGWSFKING-----QAPPLDLSSL-----PQLPQPKKKQTA--LIIGVSVSVAVIVLLA  293

Query  413  TLMVLFVWSVLRNRRPIVPEELTPEPKEYEYKKFQ  309
              + ++ +  +RN   I   EL   P  Y Y++ +
Sbjct  294  IAIGIYFYRKIRNADVIEAWELEIGPHRYSYQELK  328



>ref|XP_008352564.1| PREDICTED: L-type lectin-domain containing receptor kinase S.4-like 
[Malus domestica]
Length=693

 Score = 94.0 bits (232),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 74/226 (33%), Positives = 113/226 (50%), Gaps = 31/226 (14%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKV--------GNVSSINLELN  795
            G   N+ F  VEFD ++D ++GD+N NHVG+D++SL S K         GN +  NL L 
Sbjct  136  GNFSNHIF-AVEFDTVQDFEFGDINDNHVGIDINSLASNKSTPAGFFSNGNSTKENLNLT  194

Query  794  SGEKLQSWIDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSR-L  618
            SG  +Q+W+DY++   ++ V LS    I+P  P+L+  VDLS +  ED ++VG S S  +
Sbjct  195  SGLPIQAWVDYDSVKNQVTVMLSP-DSIKPRSPILTFDVDLSPIL-EDFMYVGFSASTGM  252

Query  617  WNQSHKCNVYSWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKI---LGA  447
               SH   V  WSFK+        ++ LD +A       +L  PK+     L +   L  
Sbjct  253  LASSHY--VSGWSFKMNG-----EAKSLDLEAL-----PKLPSPKKKHSSALIVGISLSV  300

Query  446  LIFGTGCGALGTLMVLFVWSVLRNRRPIVPEELTPEPKEYEYKKFQ  309
            L+F      LG     ++   ++N   I P EL   P  + Y + +
Sbjct  301  LVFFILAAGLG----FYIVHRIKNAEVIEPWELDIGPHRFRYNELK  342



>ref|XP_010469926.1| PREDICTED: truncated lectin 2-like isoform X1 [Camelina sativa]
Length=336

 Score = 91.7 bits (226),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 65/207 (31%), Positives = 107/207 (52%), Gaps = 15/207 (7%)
 Frame = -3

Query  941  ENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVS-SINLELNSGEKLQSWID  765
            +N   +  EFDI K        GN   + +    S  + N+S   +L +N+G  L   ID
Sbjct  135  KNETVVAFEFDISK-------RGNRARILIGRPESSNIRNLSFDGDLMMNNGGTLSCMID  187

Query  764  YEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCN-VY  588
            Y AS K++ V   + G I+   P  S  VDL+++W+  EV VGLS++    +S K + ++
Sbjct  188  YVASYKKMMVNFRRSGSIKEYDPFFSFSVDLAKLWEGGEVMVGLSSAN--GKSSKAHFLH  245

Query  587  SWSFKL-RAAPDWMHSQPLDP-KAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALG  414
            SW  +  +  P W+H  PL+  +  +     +    +   EC  +++GAL+ G  CGALG
Sbjct  246  SWRIETWQRQPMWLHPVPLEQNEGLKADVSTEEEEGRERSECTWRMVGALVLGVVCGALG  305

Query  413  TLMVLFVWSVLRNRR--PIVPEELTPE  339
             ++ L++W++   RR   +VPEE   E
Sbjct  306  AMLALYLWTICGVRRSMAVVPEECAIE  332



>ref|XP_010464556.1| PREDICTED: truncated lectin 2-like [Camelina sativa]
Length=337

 Score = 91.7 bits (226),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 66/207 (32%), Positives = 106/207 (51%), Gaps = 15/207 (7%)
 Frame = -3

Query  941  ENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVS-SINLELNSGEKLQSWID  765
            +N   +  EFDI +        GN   + +    S  + N+S   +L +N+G  +   ID
Sbjct  135  KNETVVAFEFDISE-------RGNRARILIGRPESSNIRNLSFDGDLMMNNGGFVSCMID  187

Query  764  YEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCN-VY  588
            Y ASSK + V   + G I+   P  S  VDL+++WK  EV VGLS++    +S K + ++
Sbjct  188  YMASSKSMMVNFRRSGSIKEYDPFFSFSVDLAKLWKGGEVMVGLSSAN--GKSSKAHFLH  245

Query  587  SWSFKL-RAAPDWMHSQPL-DPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALG  414
             W F+  +  P W+H  PL   +  +     +    +   EC  ++LG+L+FG  CGALG
Sbjct  246  KWRFETWQRHPMWLHPSPLAQNEGLKADVSTEEEEGRERSECTWRMLGSLVFGVVCGALG  305

Query  413  TLMVLFVWSVLRNRR--PIVPEELTPE  339
             +  L++W++   RR   +VPEE   E
Sbjct  306  AMSALYLWTICCVRRSMAVVPEECAIE  332



>ref|XP_009345528.1| PREDICTED: L-type lectin-domain containing receptor kinase S.4-like 
[Pyrus x bretschneideri]
Length=711

 Score = 94.0 bits (232),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 75/226 (33%), Positives = 115/226 (51%), Gaps = 31/226 (14%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKV--------GNVSSINLELN  795
            G   N+ F  VEFD ++D ++GD+N NHVG+D++SLVS K         GN +  +L+L 
Sbjct  154  GNFSNHIF-AVEFDTVQDFEFGDINDNHVGIDINSLVSNKSTPAGFFSGGNSTKEDLKLK  212

Query  794  SGEKLQSWIDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSR-L  618
            SG  +Q+W+DY++   ++ V LS    I+P  P+L+  VDLS + K D ++VG S S  L
Sbjct  213  SGLPIQAWVDYDSVKNQVTVMLSP-DSIKPKSPILTFDVDLSPILK-DFMYVGFSASTGL  270

Query  617  WNQSHKCNVYSWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKI---LGA  447
               SH   V  WSFK+        ++ LD +A       +L  PK+     L +   L  
Sbjct  271  LASSHY--VSGWSFKMNG-----EAKSLDLEAL-----PKLPGPKKKHSSALIVGVSLSV  318

Query  446  LIFGTGCGALGTLMVLFVWSVLRNRRPIVPEELTPEPKEYEYKKFQ  309
            L+F      LG     ++   ++N   I P EL   P  + Y + +
Sbjct  319  LVFFILAAGLG----FYIVHRIKNAEVIEPWELDIGPHRFRYNELK  360



>ref|XP_003561539.1| PREDICTED: L-type lectin-domain containing receptor kinase I.9 
[Brachypodium distachyon]
Length=335

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 71/220 (32%), Positives = 106/220 (48%), Gaps = 31/220 (14%)
 Frame = -3

Query  926  LGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSS-INLELNSGEKLQSWIDYEASS  750
            L V F +       DV+ +HV V +  L  V    V +  +L ++  +KL SWIDY A+S
Sbjct  120  LAVVFSV------ADVDPSHVRVQID-LPGVNTAVVQARFSLPVSRAQKLHSWIDYNATS  172

Query  749  KRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWSFKL  570
              L+VRLS     +P +PLLS  + L +      +  G ++S        C+++SW+FK 
Sbjct  173  AALQVRLSSSRVPKPPHPLLSHPLHL-RPQSSTRMLAGFASSHA-----NCSLFSWAFKA  226

Query  569  RAAPDW-MHSQPLDPK--AFRVGKPE----QLSVPKRSDECGLKILGALIFGTGCGALGT  411
             + P + MHS PLDP   +  +  P     Q  +P R          +L+    CGA+ T
Sbjct  227  SSGPPYLMHSLPLDPTGGSILLTTPPLPHYQPPLPYRYH------WPSLLLAAACGAMLT  280

Query  410  LMVLFVWSVLRNRRPI--VPEE--LTPEPKEYEYKKFQVV  303
              VLFVW  +  RRPI   P E  + P   +  Y+K  +V
Sbjct  281  FFVLFVWYSVATRRPIGVTPVEYPMHPSSSDIVYEKIVLV  320



>ref|XP_011004619.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.1-like 
[Populus euphratica]
Length=716

 Score = 93.6 bits (231),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 69/242 (29%), Positives = 120/242 (50%), Gaps = 32/242 (13%)
 Frame = -3

Query  944  KENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWID  765
            K    F+ VEFD L D ++ D+NGNHVG+DLSS+VS ++G++ +IN++L SG+ + +WID
Sbjct  141  KAASSFVAVEFDTLMDVEFKDINGNHVGLDLSSMVSTQIGDLGAINIDLKSGDLVNAWID  200

Query  764  YEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLS-TSRLWNQSHKCN--  594
            Y+ ++    + +S +  ++P  P+LS  +DL Q +  D ++VG S +++   + H     
Sbjct  201  YDGTNLSFNISVS-YSNLKPKEPILSFNLDLDQ-YVNDFMYVGFSGSTQGSTEVHSIEWW  258

Query  593  VYSWSFKLRAAPDWMHSQP-------LDPKAFRVGKPEQLSVPK----------RSDECG  465
             +S SF+L    +     P       ++P A  V  P     P           +SD C 
Sbjct  259  SFSSSFQLSPGSESSSPVPPPPTASLMNPTANSVKSPPPTLAPSGLESVGGKSAKSDSCH  318

Query  464  LKIL----GALIFGTGCGALGTLMVLFVWSVLRNRRPIVPE------ELTPEPKEYEYKK  315
             ++     GA+       A   ++   +  V   R  +V E      E+   PKE+ Y++
Sbjct  319  NQLCKQGAGAVAGVVTASAFFVIVASVLIWVFSKRSKLVKESESFASEVIKMPKEFSYRE  378

Query  314  FQ  309
             +
Sbjct  379  LK  380



>ref|XP_011016637.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.1-like 
[Populus euphratica]
Length=715

 Score = 93.6 bits (231),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 75/109 (69%), Gaps = 2/109 (2%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSW  771
            G +    F+ VEFD L D ++ D+NGNHVG+DL+S+VS ++G++ +IN++L SG+ + +W
Sbjct  139  GPEAASSFVAVEFDTLMDVEFKDINGNHVGLDLNSMVSTQIGDLGAINIDLKSGDLVNAW  198

Query  770  IDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTS  624
            IDY+ +++   + +S +  ++P  PLLS  +DL Q +  D ++VG S S
Sbjct  199  IDYDGTNQSFNISVS-YSNLKPKEPLLSFGLDLDQ-YVSDFMYVGFSGS  245



>ref|XP_009767145.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.1-like 
[Nicotiana sylvestris]
Length=710

 Score = 93.2 bits (230),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 67/243 (28%), Positives = 120/243 (49%), Gaps = 37/243 (15%)
 Frame = -3

Query  926  LGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEASSK  747
              +EFD L D ++ D+NGNHVG+DL+S+VS +VG++ S++++L SG+ + SWI+Y  S+K
Sbjct  136  FAIEFDTLMDVEFKDINGNHVGLDLNSMVSTQVGDLDSVDVDLKSGDLVNSWIEYSGSTK  195

Query  746  RLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRL----------WNQSHKC  597
            +L + +S +  ++P  P LS  +DLS+ +  D +FVG   S            W+ S   
Sbjct  196  KLNIFVS-YSNLKPKEPFLSVTIDLSE-YVNDFMFVGFCGSTQGSTEIHSIEWWSFSSSF  253

Query  596  NVYSWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSD-------------------  474
            +V   S      P    +  ++P A  V  P     P +S+                   
Sbjct  254  DVNPKSPAAALPPPPPTASLMNPTADSVTSPPPSMAPLQSNGTVNSEQKSSSSKCHNSFC  313

Query  473  -ECGLKILGALIFGTGCGALGTLMVLFVWSV----LRNRRPIVPEELTPEPKEYEYKKFQ  309
             +    ++G +  G    A  TL++++++S     ++N   +   E+   PKE+ YK+ +
Sbjct  314  KQGAGAVVGVVTAGAFFLAFATLVLVWLYSKKFKNVKNSENL-GSEIIKMPKEFSYKELK  372

Query  308  VVV  300
            +  
Sbjct  373  IAT  375



>ref|XP_011085039.1| PREDICTED: L-type lectin-domain containing receptor kinase S.4 
[Sesamum indicum]
Length=675

 Score = 93.2 bits (230),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 67/215 (31%), Positives = 109/215 (51%), Gaps = 18/215 (8%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSW  771
            G   N+ F  VEFD +KD ++GD+N NH+G+D++SLVS    + S   + L SG ++Q+W
Sbjct  132  GNISNHVF-AVEFDTVKDFEFGDINDNHIGIDINSLVSNASVSASKEGINLKSGMRIQAW  190

Query  770  IDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSR-LWNQSHKCN  594
            IDY+++ + L V LS     +P  P+LS  +DL+ ++ E  ++VG S S  L   SH   
Sbjct  191  IDYDSTRQELNVTLS-LSSSKPSVPILSYPLDLTPIFME-YMYVGFSASTGLLASSH--F  246

Query  593  VYSWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALG  414
            +  WSF +     +  ++ LD            S+P   +     ILG  +       L 
Sbjct  247  ISGWSFTM-----YGQAKSLDLSLLP-------SIPGAKNNQVALILGTSLSAAAFMVLA  294

Query  413  TLMVLFVWSVLRNRRPIVPEELTPEPKEYEYKKFQ  309
              + L++   ++NR  I   EL   P  + YK+ +
Sbjct  295  IGLSLYILKKIKNRDVIESWELDIGPHRFSYKELK  329



>ref|XP_011004732.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.1-like 
[Populus euphratica]
Length=715

 Score = 93.2 bits (230),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 75/109 (69%), Gaps = 2/109 (2%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSW  771
            G +    F+ VEFD L D ++ D+NGNHVG+DL+S+VS ++G++ +IN++L SG+ + +W
Sbjct  139  GPEAASSFVAVEFDTLMDVEFKDINGNHVGLDLNSMVSTQIGDLGAINIDLKSGDLVNAW  198

Query  770  IDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTS  624
            IDY+ +++   + +S +  ++P  PLLS  +DL Q +  D ++VG S S
Sbjct  199  IDYDGTNQSFNISVS-YSNLKPKEPLLSFGLDLDQ-YVSDFMYVGFSGS  245



>ref|XP_008370413.1| PREDICTED: LOW QUALITY PROTEIN: L-type lectin-domain containing 
receptor kinase S.4-like [Malus domestica]
Length=664

 Score = 92.8 bits (229),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 74/226 (33%), Positives = 112/226 (50%), Gaps = 31/226 (14%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKV--------GNVSSINLELN  795
            G   N+ F  VEFD +KD ++GD+N NHVG+D+++L S K         GN +  NL L 
Sbjct  136  GNFSNHIF-AVEFDTVKDFEFGDINDNHVGIDINTLASNKSTPAGFFSGGNSTKENLNLK  194

Query  794  SGEKLQSWIDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSR-L  618
            SG  +Q+W+DY++   ++ V LS +  I+P  P+L+  VDLS + K D ++VG S S  L
Sbjct  195  SGLPIQAWVDYDSVKNQVTVMLSPY-SIKPRSPILTFDVDLSPILK-DFMYVGFSASTGL  252

Query  617  WNQSHKCNVYSWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKI---LGA  447
               SH   V  WSFK+        ++ LD +A       +L   K+     L +   L  
Sbjct  253  LASSHY--VSGWSFKMNG-----EAKSLDLEAL-----PKLPXRKKKHSSALIVGVSLSV  300

Query  446  LIFGTGCGALGTLMVLFVWSVLRNRRPIVPEELTPEPKEYEYKKFQ  309
            L+F      LG     ++   ++N   I P EL   P  + Y   +
Sbjct  301  LVFFILAAGLG----FYIVHRIKNAEVIEPWELDIGPHRFRYNDLK  342



>gb|EYU43389.1| hypothetical protein MIMGU_mgv1a019420mg [Erythranthe guttata]
Length=673

 Score = 92.8 bits (229),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 77/201 (38%), Positives = 105/201 (52%), Gaps = 25/201 (12%)
 Frame = -3

Query  938  NYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKV---------GNVSSI-NLELNSG  789
            N   LGVEFD  ++ ++ D++ NHVG+D++SL SV           G  SS   LELN+G
Sbjct  129  NNHVLGVEFDCFRNQEFNDIDDNHVGIDVNSLTSVAAHEAGYWPDDGGASSFEKLELNNG  188

Query  788  EKLQSWIDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRL-WN  612
               Q WIDY  S   L V +S  G  RP  PLL+  ++LS ++ EDE+FVG + S     
Sbjct  189  RIYQVWIDYADSI--LNVTMSPVGMKRPKQPLLNVPLNLSDVF-EDEMFVGFTASTGDMI  245

Query  611  QSHKCNVYSWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGT  432
            QSHK  + SWSF   +  ++  S+ L       G P    +PK         + ALI G 
Sbjct  246  QSHK--ILSWSF---SNTNFSLSEGLITD----GLP-SFELPKTPIHRTKGFITALIVGI  295

Query  431  GCGALGTLMVLFVWSVLRNRR  369
               AL   +V F +SV+RNRR
Sbjct  296  SVFALACSVVAF-FSVVRNRR  315



>ref|XP_006381477.1| hypothetical protein POPTR_0006s13200g, partial [Populus trichocarpa]
 gb|ERP59274.1| hypothetical protein POPTR_0006s13200g, partial [Populus trichocarpa]
Length=700

 Score = 92.8 bits (229),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 75/109 (69%), Gaps = 2/109 (2%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSW  771
            G +    F+ VEFD L D ++ D+NGNHVG+DL+S+VS ++G++ +IN++L SG+ + +W
Sbjct  139  GPEAASSFVAVEFDTLMDVEFKDINGNHVGLDLNSMVSTQIGDLGAINIDLKSGDLVNAW  198

Query  770  IDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTS  624
            IDY+ +++   + +S +  ++P  P+LS  +DL Q +  D ++VG S S
Sbjct  199  IDYDGTNQSFNISVS-YSNLKPKEPILSFSLDLDQ-YVNDFMYVGFSGS  245



>gb|ERN08003.1| hypothetical protein AMTR_s00012p00255610 [Amborella trichopoda]
Length=413

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 72/235 (31%), Positives = 117/235 (50%), Gaps = 26/235 (11%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSV----------KVGNVSSINLE  801
            G   N+ F  VEFD ++D ++GD+N NHVGVD+ +L S           K G +++ N+ 
Sbjct  131  GNLSNHIF-AVEFDTVQDYEFGDINDNHVGVDIDNLNSTVAAPAFIKLAKNGIITTTNVT  189

Query  800  LNSGEKLQSWIDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSR  621
            L  G  +Q+WI+Y++ SK L + LS   + +P  PL+S  +DLS +  ED ++VG STS 
Sbjct  190  LQGGNPIQAWIEYDSPSKVLNITLSLSSD-KPQIPLISTEIDLSPVL-EDYMYVGFSTST  247

Query  620  -LWNQSHKCNVYSWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGAL  444
             +   SH   V  W+F++   P     QPL      + +  +     +    G+ I   L
Sbjct  248  GVLASSHY--VSGWTFRMNGEP-----QPLFLSRLPLLRNTKNITQSKGFISGVSISVTL  300

Query  443  IFGTGCGALGTLMVLFVWSVLRNRRPIVPEELTPEPKEYEYKKFQVVVDDKAIKD  279
            +    C A+   + + VW  L+    I   ELT  P  + YK+ ++     + K+
Sbjct  301  LV---CAAIAASLYI-VWK-LKTADIIEEWELTSGPHRFSYKQLRMATRSFSSKE  350



>gb|KHN46198.1| Putative L-type lectin-domain containing receptor kinase S.7 
[Glycine soja]
Length=674

 Score = 92.4 bits (228),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/126 (40%), Positives = 76/126 (60%), Gaps = 5/126 (4%)
 Frame = -3

Query  944  KENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWID  765
            + +YK + VEFD  K+ ++GD+N NHVG++L ++VS KV NVS + L LN G   ++WI 
Sbjct  155  ENDYKAVAVEFDTRKNPEFGDLNDNHVGINLGTIVSTKVINVSDVGLSLNDGSVHRAWIT  214

Query  764  YEASSKRLEVRLSKWGE---IRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCN  594
            Y+   +R+++RL +  +     P  PL S  +DLS    E  +FVG S S   N +   N
Sbjct  215  YDGPQRRMDIRLGRANQEDYDYPPKPLFSESMDLSPFLNE-YMFVGFSAS-TGNHTQIHN  272

Query  593  VYSWSF  576
            + SW+F
Sbjct  273  ILSWNF  278



>ref|XP_003519228.2| PREDICTED: L-type lectin-domain containing receptor kinase VIII.1-like 
[Glycine max]
Length=686

 Score = 92.4 bits (228),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/126 (40%), Positives = 76/126 (60%), Gaps = 5/126 (4%)
 Frame = -3

Query  944  KENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWID  765
            + +YK + VEFD  K+ ++GD+N NHVG++L ++VS KV NVS + L LN G   ++WI 
Sbjct  167  ENDYKAVAVEFDTRKNPEFGDLNDNHVGINLGTIVSTKVINVSDVGLSLNDGSVHRAWIT  226

Query  764  YEASSKRLEVRLSKWGE---IRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCN  594
            Y+   +R+++RL +  +     P  PL S  +DLS    E  +FVG S S   N +   N
Sbjct  227  YDGPQRRMDIRLGRANQEDYDYPPKPLFSESMDLSPFLNE-YMFVGFSAS-TGNHTQIHN  284

Query  593  VYSWSF  576
            + SW+F
Sbjct  285  ILSWNF  290



>ref|XP_003595897.1| 50S ribosomal protein L5, partial [Medicago truncatula]
Length=82

 Score = 85.1 bits (209),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 40/70 (57%), Positives = 52/70 (74%), Gaps = 2/70 (3%)
 Frame = -3

Query  482  RSDECGLKILGALIFGTGCGALGTLMVLFVWSVLRNRRPIVPEELTPEPKEYEYKKFQVV  303
            RSD C L+IL A+IFG+GCGAL    VL++W++  NRRP+VPEE   +P + EYKK  +V
Sbjct  14   RSD-CVLRILAAMIFGSGCGALAAFTVLYLWTMFGNRRPVVPEECVMQPVDCEYKKVNIV  72

Query  302  VDDKAIKDGK  273
            V DK +KDGK
Sbjct  73   V-DKPLKDGK  81



>ref|XP_009343780.1| PREDICTED: L-type lectin-domain containing receptor kinase S.4-like 
[Pyrus x bretschneideri]
Length=693

 Score = 92.4 bits (228),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 74/226 (33%), Positives = 111/226 (49%), Gaps = 31/226 (14%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVK--------VGNVSSINLELN  795
            G   N+ F  VEFD ++D ++GD+N NHVG+D++SL S K         GN +  NL L 
Sbjct  136  GNFSNHIF-AVEFDTVQDFEFGDINDNHVGIDINSLASNKSTPAGFFSSGNSTKENLNLK  194

Query  794  SGEKLQSWIDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSR-L  618
            SG  +Q+W+DY++   ++ V LS    I+P  P+L+  VDLS +  ED ++VG S S  +
Sbjct  195  SGLPIQAWVDYDSVKNKVTVMLSP-DSIKPRSPILTFDVDLSPIL-EDFMYVGFSASTGM  252

Query  617  WNQSHKCNVYSWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKI---LGA  447
               SH   V  WSFK+        ++ LD  A       +L  PK+     L +   L  
Sbjct  253  LASSHY--VCGWSFKMNG-----EAKSLDLDAL-----PKLPGPKKKHSLALIVGVSLSV  300

Query  446  LIFGTGCGALGTLMVLFVWSVLRNRRPIVPEELTPEPKEYEYKKFQ  309
            L+F      LG     ++   ++N   I P EL   P  + Y   +
Sbjct  301  LVFFILAAGLG----FYIVHRIKNAEVIEPWELDIGPHRFRYNDLK  342



>ref|XP_008239353.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.1-like 
[Prunus mume]
Length=716

 Score = 92.0 bits (227),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 75/109 (69%), Gaps = 2/109 (2%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSW  771
            G      F+ VEFD L D ++ D+N NHVG+DL+S+VS +VG++SSI+++L SG+ + SW
Sbjct  130  GSAPGSGFVAVEFDTLMDVEFKDINSNHVGLDLNSMVSTRVGDLSSIDVDLKSGDLVNSW  189

Query  770  IDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTS  624
            I+Y+ SS+ + V +S +  ++P  P+LS  +DL Q +  D ++VG S S
Sbjct  190  IEYDGSSRVINVSVS-YSNLKPRDPVLSYSLDLGQ-YVSDFMYVGFSGS  236



>ref|XP_007204963.1| hypothetical protein PRUPE_ppa002125mg [Prunus persica]
 gb|EMJ06162.1| hypothetical protein PRUPE_ppa002125mg [Prunus persica]
Length=713

 Score = 92.0 bits (227),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 75/109 (69%), Gaps = 2/109 (2%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSW  771
            G      F+ VEFD L D ++ D+N NHVG+DL+S+VS +VG++SSI+++L SG+ + SW
Sbjct  130  GSDPGSGFVAVEFDTLMDVEFKDINSNHVGLDLNSMVSTRVGDLSSIDVDLKSGDLVNSW  189

Query  770  IDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTS  624
            I+Y+ SS+ + V +S +  ++P  P+LS  +DL Q +  D ++VG S S
Sbjct  190  IEYDGSSRVINVSVS-YSNLKPRDPVLSYSLDLGQ-YVSDFMYVGFSGS  236



>ref|XP_002323460.2| hypothetical protein POPTR_0016s08920g [Populus trichocarpa]
 gb|EEF05221.2| hypothetical protein POPTR_0016s08920g [Populus trichocarpa]
Length=666

 Score = 92.0 bits (227),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 73/107 (68%), Gaps = 2/107 (2%)
 Frame = -3

Query  944  KENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWID  765
            K    F+ VEFD L D ++ D+NGNHVG+DLSS+VS ++G++ +IN++L SG+ + +WID
Sbjct  141  KAASSFVAVEFDTLMDVEFKDINGNHVGLDLSSMVSTQIGDLGAINIDLKSGDLVNAWID  200

Query  764  YEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTS  624
            Y+ ++    + +S +  ++P  P+LS  +DL Q +  D ++VG S S
Sbjct  201  YDGTNLSFNISVS-YSNLKPKEPILSFNLDLDQ-YVNDFMYVGFSGS  245



>ref|XP_004965240.1| PREDICTED: probable L-type lectin-domain containing receptor 
kinase S.7-like [Setaria italica]
Length=699

 Score = 91.7 bits (226),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 64/218 (29%), Positives = 102/218 (47%), Gaps = 15/218 (7%)
 Frame = -3

Query  929  FLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEASS  750
             + VEFD + + ++ D + NHVG+DL S VSV V ++++  ++L SG    +WIDY ++ 
Sbjct  156  IVAVEFDTMANPEFADTSDNHVGLDLGSPVSVAVADLAASGIDLRSGNLTTAWIDYRSAD  215

Query  749  KRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWSFKL  570
            +RLEV LS     +P  P+LS  VDLS  +    ++VG S S     + +  +  W+F+ 
Sbjct  216  RRLEVFLSYAPAPKPKRPVLSVAVDLSP-YLNGAMYVGFSAS-TEGSTQQHTIKEWTFQT  273

Query  569  RAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTLMVLFVW  390
               P   +S   +  A         +VP  +     K +G  +   G  AL    V F W
Sbjct  274  FDLPSTANSSSFESNA--TSNSSDQAVPTSTAH--HKRVGLALGILGPVALAVAFVFFAW  329

Query  389  SVL--------RNRRPIVPEELTPEPKEYEYKKFQVVV  300
              +        RN     P EL   P+++ YK+     
Sbjct  330  VSIRKLIQLTARNDGAFSP-ELLKGPRKFSYKELSAAT  366



>ref|XP_008362700.1| PREDICTED: L-type lectin-domain containing receptor kinase S.4-like 
[Malus domestica]
Length=693

 Score = 91.7 bits (226),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 74/226 (33%), Positives = 112/226 (50%), Gaps = 31/226 (14%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKV--------GNVSSINLELN  795
            G   N+ F  VEFD +KD ++GD+N NHVG+D+++L S K         GN +  NL L 
Sbjct  136  GNFSNHIF-AVEFDTVKDFEFGDINDNHVGIDINTLASNKSTPAGFFSGGNSTKENLNLK  194

Query  794  SGEKLQSWIDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSR-L  618
            SG  +Q+W+DY++   ++ V LS +  I+P  P+L+  VDLS + K D ++VG S S  L
Sbjct  195  SGLPIQAWVDYDSVKNQVTVMLSPY-SIKPRSPILTFDVDLSPILK-DFMYVGFSASTGL  252

Query  617  WNQSHKCNVYSWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKI---LGA  447
               SH   V  WSFK+        ++ LD +A       +L   K+     L +   L  
Sbjct  253  LASSHY--VSGWSFKMNG-----EAKSLDLEAL-----PKLPGRKKKHSSALIVGVSLSV  300

Query  446  LIFGTGCGALGTLMVLFVWSVLRNRRPIVPEELTPEPKEYEYKKFQ  309
            L+F      LG     ++   ++N   I P EL   P  + Y   +
Sbjct  301  LVFFILAAGLG----FYIVHRIKNAEVIEPWELDIGPHRFRYNDLK  342



>gb|KHN40023.1| Putative L-type lectin-domain containing receptor kinase S.7 
[Glycine soja]
Length=499

 Score = 90.9 bits (224),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 74/124 (60%), Gaps = 3/124 (2%)
 Frame = -3

Query  944  KENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWID  765
            + +YK + VEFD  K+ ++GD N NHVG++L ++VS KV NVS + L L  G   ++WI 
Sbjct  166  ENDYKAVAVEFDTRKNPEFGDPNDNHVGINLGTIVSTKVINVSDVGLSLKDGSVYRAWIT  225

Query  764  YEASSKRLEVRLSKWG-EIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVY  588
            Y+   +R+++RL K   E  P  P+ S  +DLS    E  +FVG S S   N +   N+ 
Sbjct  226  YDGPQRRMDIRLGKANQEDYPSKPMFSESMDLSPYLNE-YMFVGFSAS-TGNHTQIHNLL  283

Query  587  SWSF  576
            SW+F
Sbjct  284  SWNF  287



>gb|KHN04724.1| L-type lectin-domain containing receptor kinase S.4 [Glycine 
soja]
Length=674

 Score = 91.3 bits (225),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 71/221 (32%), Positives = 110/221 (50%), Gaps = 30/221 (14%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSW  771
            G   N+ F  VEFD ++D ++GD+N NHVG+D++S+ S    NVS + L L SG+ + +W
Sbjct  131  GNISNHIF-AVEFDTVQDFEFGDINDNHVGIDINSMQSNASANVSLVGLTLKSGKPILAW  189

Query  770  IDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSR-LWNQSHKCN  594
            +DY++    + V LS     +P  PLL+  VDLS ++  D ++VG S S  L   SH   
Sbjct  190  VDYDSQLNLISVALSP-NSSKPKTPLLTFNVDLSPVF-HDIMYVGFSASTGLLASSHY--  245

Query  593  VYSWSFKLRA-APDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGAL  417
            +  WSFK+   AP      PLD  +       QL  PK+          +LI G      
Sbjct  246  ILGWSFKINGPAP------PLDLSSL-----PQLPQPKKKQT-------SLIIGVSVSVF  287

Query  416  GTLMV-----LFVWSVLRNRRPIVPEELTPEPKEYEYKKFQ  309
              +++     L+ +  ++N   I   EL   P  Y Y++ +
Sbjct  288  VIVLLAISIGLYFYRKIKNADVIEAWELEIGPHRYSYQELK  328



>ref|XP_003537433.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.1-like 
[Glycine max]
Length=674

 Score = 90.9 bits (224),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 69/213 (32%), Positives = 111/213 (52%), Gaps = 13/213 (6%)
 Frame = -3

Query  929  FLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEASS  750
            FL VEFD L D ++ DVNGNHVG+DL+S+VS +V ++ +I ++L SG+ + +WI+Y+ ++
Sbjct  137  FLAVEFDTLMDVEFSDVNGNHVGLDLNSVVSTQVSDLGTIGVDLKSGDSVNAWIEYDGNA  196

Query  749  KRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWSFKL  570
            K L V +S +  +RP  P+L   +D+  M+ +D ++VG S S     +   +V  WSF  
Sbjct  197  KGLRVWVS-YSNLRPKDPILKVDLDVG-MYVDDFMYVGFSGST-QGSTEVHSVEWWSFN-  252

Query  569  RAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSD---ECGLKILGALIFGTGCGALGTLMVL  399
                    S      A  V K  + S  K+S      G+   GA +     GAL  L   
Sbjct  253  ----SSFDSAAAPAAATSVQKERKSS--KKSTVGAVAGVVTAGAFVLALFAGALIWLYSN  306

Query  398  FVWSVLRNRRPIVPEELTPEPKEYEYKKFQVVV  300
             V   ++     +  E+   PKE+ YK+ ++  
Sbjct  307  KVKYYVKKLDHSIESEIIRMPKEFSYKELKLAT  339



>ref|XP_010264749.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.1-like 
[Nelumbo nucifera]
Length=698

 Score = 90.9 bits (224),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 73/109 (67%), Gaps = 2/109 (2%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSW  771
            G      F+ VEFD L D ++ D+NGNHVG+DL+SL+S +VG++ ++N+EL SG+ + +W
Sbjct  132  GRNAVSGFVAVEFDTLMDVEFRDINGNHVGLDLNSLLSTQVGDLGAVNVELKSGDLVNAW  191

Query  770  IDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTS  624
            IDY+  ++   + +S +  +RP  PLLS  +DL + +  D ++VG S S
Sbjct  192  IDYDGPTRSFNISVS-YSNLRPTDPLLSFNLDLER-FVNDFMYVGFSGS  238



>ref|NP_001057404.1| Os06g0285400 [Oryza sativa Japonica Group]
 dbj|BAD69028.1| putative lectin-like receptor kinase [Oryza sativa Japonica Group]
 dbj|BAF19318.1| Os06g0285400 [Oryza sativa Japonica Group]
Length=698

 Score = 90.9 bits (224),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 66/233 (28%), Positives = 102/233 (44%), Gaps = 31/233 (13%)
 Frame = -3

Query  944  KENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWID  765
            K N   + VEFD + +D++GD + NHVG+DL   VSV   ++++  + LNSG    +WID
Sbjct  146  KTNASIVAVEFDTMLNDEFGDPSDNHVGLDLGLPVSVNAVDLAAFGVVLNSGNLTTAWID  205

Query  764  YEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYS  585
            Y  +   L+V LS +   +P  P+LS  VDLS  +  D ++VG S S     + +  +  
Sbjct  206  YHGADHLLQVSLS-YSAAKPAKPVLSVAVDLSP-YLRDAMYVGFSAST-EGSTQQHTIKE  262

Query  584  WSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVP-----------KRSDECGLKILGALIF  438
            W+F+    P   +S          G     +VP           K+     L ILG +  
Sbjct  263  WTFQTFGFPSATNSSSFSNT---TGNASAQTVPGEAAAGGAASRKKRFGLALGILGPV--  317

Query  437  GTGCGALGTLMVLFVWSVLRNRRPIVPE-------ELTPEPKEYEYKKFQVVV  300
                 AL    V F W  +R    +          EL   P+++ YK+     
Sbjct  318  -----ALAVSFVFFAWVSIRKLIELTSRKNAGFLPELVKGPRKFSYKELSAAT  365



>ref|XP_011094691.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.1-like 
[Sesamum indicum]
Length=723

 Score = 90.9 bits (224),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 81/126 (64%), Gaps = 2/126 (2%)
 Frame = -3

Query  926  LGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEASSK  747
            + VEFD L D ++ D+NGNHVG+DL+S++S +V ++ +I ++L SG+ + SW+DY  S++
Sbjct  144  VAVEFDTLMDVEFKDINGNHVGLDLNSMISTRVSDLDAIGVDLKSGDLVNSWVDYSGSTR  203

Query  746  RLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLS-TSRLWNQSHKCNVYSWSFKL  570
             ++V +S +  ++P  P++S   DL+Q    D +FVG S +++   + H    +S+S   
Sbjct  204  MIKVYVS-YSNLKPKAPVISATFDLNQYIVNDFMFVGFSGSTQGSTEIHSVEWWSFSSSF  262

Query  569  RAAPDW  552
              +P +
Sbjct  263  DESPSY  268



>gb|KFK35122.1| hypothetical protein AALP_AA5G239200 [Arabis alpina]
Length=975

 Score = 91.3 bits (225),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 71/218 (33%), Positives = 112/218 (51%), Gaps = 27/218 (12%)
 Frame = -3

Query  929  FLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVK-------VGNVSSINLELNSGEKLQSW  771
            F  VEFD +KD ++ D+N NHVG+D++SLVS         + N +   L L+ G  +Q+W
Sbjct  45   FFAVEFDTVKDLEFKDINDNHVGIDINSLVSSTSTPAGYFLANSTKKELFLDGGRVIQAW  104

Query  770  IDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSR-LWNQSHKCN  594
            IDY++++KRL+V+LS + E +P   LLS  VDLS +   DE++VG S S  L   SH   
Sbjct  105  IDYDSNNKRLDVKLSPFSE-KPKLSLLSYDVDLSSVLG-DEMYVGFSASTGLLASSHY--  160

Query  593  VYSWSFKL--RAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGA  420
            +  W+F +   A   ++ S P  P++ +  K     +   +  C L  +  L+       
Sbjct  161  ILGWNFNMSGEALSLYLPSLPRIPRSIKKKKKSPGLILGVAISCSLLFIAVLV-------  213

Query  419  LGTLMVLFVWSVLRNRRPIVPE-ELTPEPKEYEYKKFQ  309
               +  +F+  V    R  V E EL   P  + YK+ +
Sbjct  214  ---IAAMFIKRVKDEDR--VEEWELDFGPHRFSYKELK  246



>gb|EAZ00546.1| hypothetical protein OsI_22565 [Oryza sativa Indica Group]
Length=698

 Score = 90.9 bits (224),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 66/233 (28%), Positives = 102/233 (44%), Gaps = 31/233 (13%)
 Frame = -3

Query  944  KENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWID  765
            K N   + VEFD + +D++GD + NHVG+DL   VSV   ++++  + LNSG    +WID
Sbjct  146  KTNASIVAVEFDTMLNDEFGDPSDNHVGLDLGLPVSVNAVDLAAFGVVLNSGNLTTAWID  205

Query  764  YEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYS  585
            Y  +   L+V LS +   +P  P+LS  VDLS  +  D ++VG S S     + +  +  
Sbjct  206  YHGADHLLQVSLS-YSAAKPAKPVLSVAVDLSP-YLRDAMYVGFSAST-EGSTQQHTIKE  262

Query  584  WSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVP-----------KRSDECGLKILGALIF  438
            W+F+    P   +S          G     +VP           K+     L ILG +  
Sbjct  263  WTFQTFGFPSATNSSSFSNT---TGNASAQTVPGEAAAGGAASRKKRFGLALGILGPV--  317

Query  437  GTGCGALGTLMVLFVWSVLRNRRPIVPE-------ELTPEPKEYEYKKFQVVV  300
                 AL    V F W  +R    +          EL   P+++ YK+     
Sbjct  318  -----ALAVSFVFFAWVSIRKLIELTSRKNAGFLPELVKGPRKFSYKELSAAT  365



>gb|KDO48105.1| hypothetical protein CISIN_1g043702mg [Citrus sinensis]
Length=711

 Score = 90.9 bits (224),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 71/102 (70%), Gaps = 2/102 (2%)
 Frame = -3

Query  929  FLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEASS  750
            F+ VEFD L D ++ D+NGNHVG+DL+S+VS +V N+ +IN++L SG+ + SWI+Y+  +
Sbjct  144  FVAVEFDTLMDVEFSDINGNHVGLDLNSMVSTEVDNLDTINVDLKSGDLVNSWIEYDGLT  203

Query  749  KRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTS  624
            +   + +S +  ++P  P+LS  +DL Q +  D ++VG S S
Sbjct  204  RAFNISVS-YSNLKPKVPILSFTLDLDQ-YVNDFMYVGFSGS  243



>ref|XP_008233650.1| PREDICTED: L-type lectin-domain containing receptor kinase S.4 
[Prunus mume]
Length=692

 Score = 90.9 bits (224),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 70/226 (31%), Positives = 114/226 (50%), Gaps = 32/226 (14%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVK---VGNVSSIN-----LELN  795
            G   N+ F  VEFD ++D ++GD+N NHVG+D++SL S K    G  +S N     L L 
Sbjct  134  GNFSNHIF-AVEFDTVQDFEFGDINDNHVGIDINSLASNKSTPAGYFTSQNSTKQSLNLK  192

Query  794  SGEKLQSWIDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSR-L  618
            SG  +Q+W+DY++   ++ V+LS    I+P  P+L+  VDLS ++ +D ++VG S S  L
Sbjct  193  SGHVIQAWVDYDSVKNQVTVKLSP-NSIKPTSPILTFDVDLSPIF-QDFMYVGFSASTGL  250

Query  617  WNQSHKCNVYSWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDE---CGLKILGA  447
               SH   V  WSFK+            D K+  +    +L  PK++      G+ +   
Sbjct  251  LASSHY--VSGWSFKMNG----------DAKSLSLDALPKLPGPKKTHTGVIVGVSVSAF  298

Query  446  LIFGTGCGALGTLMVLFVWSVLRNRRPIVPEELTPEPKEYEYKKFQ  309
            L+   G G     +  ++   ++N   I   EL   P  + Y++ +
Sbjct  299  LVLILGIG-----LAFYIIHRIKNAEVIEAWELDIGPHRFTYQELK  339



>ref|XP_010262573.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.2-like 
[Nelumbo nucifera]
Length=677

 Score = 90.5 bits (223),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 69/232 (30%), Positives = 114/232 (49%), Gaps = 31/232 (13%)
 Frame = -3

Query  950  GEKENYKFLGVEFD-ILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSI--------NLEL  798
            G++ N+ F  VEFD I+    + D+N NHVG+D++ L+S+     S          NL L
Sbjct  136  GKQSNHVF-AVEFDTIMNTGDFSDINNNHVGIDINGLMSIHAAPASYATDHSGGVNNLTL  194

Query  797  NSGEKLQSWIDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSR-  621
             SG+ +Q W++Y   +K+L V L+     +P  PLLS +++LSQ+  ED +++G S+S  
Sbjct  195  MSGKPIQVWVEYSGLNKQLNVTLAPIDVTKPDIPLLSYYLNLSQVV-EDLMYIGFSSSTG  253

Query  620  LWNQSHKCNVYSWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALI  441
             ++ SH   V  WSFK+      +    L PK  R+G  E      +    GL I+G + 
Sbjct  254  AFSASHY--VLGWSFKMNGPAKELSISQL-PKLPRIGPKEH----SKFLTVGLPIIGLV-  305

Query  440  FGTGCGALGTLMVLFVWSVLRNRRPIVPE----ELTPEPKEYEYKKFQVVVD  297
                   L  +++  V  ++R +R         EL   P  ++YK   +  +
Sbjct  306  -------LAFIVISIVLFIVRRKRKFAELLEDWELNYGPHRFKYKDLYIATN  350



>ref|XP_003544276.2| PREDICTED: L-type lectin-domain containing receptor kinase VIII.2-like 
[Glycine max]
Length=682

 Score = 90.5 bits (223),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 74/124 (60%), Gaps = 3/124 (2%)
 Frame = -3

Query  944  KENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWID  765
            + +YK + VEFD  K+ ++GD N NHVG++L ++VS KV NVS + L L  G   ++WI 
Sbjct  166  ENDYKAVAVEFDTRKNPEFGDPNDNHVGINLGTIVSTKVINVSDVGLSLKDGSVYRAWIT  225

Query  764  YEASSKRLEVRLSKWG-EIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVY  588
            Y+   +R+++RL K   E  P  P+ S  +DLS    E  +FVG S S   N +   N+ 
Sbjct  226  YDGPQRRMDIRLGKANQEDYPSKPMFSESMDLSPYLNE-YMFVGFSAS-TGNHTQIHNLL  283

Query  587  SWSF  576
            SW+F
Sbjct  284  SWNF  287



>tpg|DAA52232.1| TPA: putative lectin-like receptor protein kinase family protein 
[Zea mays]
Length=682

 Score = 90.5 bits (223),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 78/132 (59%), Gaps = 10/132 (8%)
 Frame = -3

Query  944  KENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVK------VGNVSSINLELNSGEK  783
            K     + VE D  KD+++ D+N NHVG+D++SLVSV       V   S +N+ L SGE 
Sbjct  134  KARSGVVAVELDTAKDEEFSDINDNHVGIDVNSLVSVSSAPAAYVDAGSLVNISLVSGEP  193

Query  782  LQSWIDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSR-LWNQS  606
            LQ+W++Y+ +S RLEV ++   + RP  PL+S  V+LS     D+ +VG + +    + S
Sbjct  194  LQAWVEYDGASMRLEVTVAPARKPRPAVPLVSSIVNLSSAVA-DDTYVGFTAANGAASTS  252

Query  605  HKCNVYSWSFKL  570
            H   V  WSF+L
Sbjct  253  HY--VLGWSFRL  262



>ref|XP_006428827.1| hypothetical protein CICLE_v10011186mg [Citrus clementina]
 gb|ESR42067.1| hypothetical protein CICLE_v10011186mg [Citrus clementina]
Length=711

 Score = 90.5 bits (223),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 71/102 (70%), Gaps = 2/102 (2%)
 Frame = -3

Query  929  FLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEASS  750
            F+ VEFD L D ++ D+NGNHVG+DL+S+VS +V N+ +IN++L SG+ + SWI+Y+  +
Sbjct  144  FVAVEFDTLMDVEFSDINGNHVGLDLNSMVSTQVVNLDTINVDLKSGDLVNSWIEYDGLT  203

Query  749  KRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTS  624
            +   + +S +  ++P  P+LS  +DL Q +  D ++VG S S
Sbjct  204  RAFNISVS-YSNLKPKVPILSFTLDLDQ-YVNDFMYVGFSGS  243



>ref|NP_001147835.1| lectin-like receptor kinase 7 precursor [Zea mays]
 gb|ACG28845.1| lectin-like receptor kinase 7 [Zea mays]
Length=682

 Score = 90.5 bits (223),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 78/132 (59%), Gaps = 10/132 (8%)
 Frame = -3

Query  944  KENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVK------VGNVSSINLELNSGEK  783
            K     + VE D  KD+++ D+N NHVG+D++SLVSV       V   S +N+ L SGE 
Sbjct  134  KARSGVVAVELDTAKDEEFSDINDNHVGIDVNSLVSVSSAPAAYVDAGSLVNISLVSGEP  193

Query  782  LQSWIDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSR-LWNQS  606
            LQ+W++Y+ +S RLEV ++   + RP  PL+S  V+LS     D+ +VG + +    + S
Sbjct  194  LQAWVEYDGASMRLEVTVAPARKPRPAVPLVSSVVNLSSAVS-DDTYVGFTAANGAASTS  252

Query  605  HKCNVYSWSFKL  570
            H   V  WSF+L
Sbjct  253  HY--VLGWSFRL  262



>ref|XP_002315211.2| hypothetical protein POPTR_0010s20820g [Populus trichocarpa]
 gb|EEF01382.2| hypothetical protein POPTR_0010s20820g [Populus trichocarpa]
Length=674

 Score = 90.5 bits (223),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 84/137 (61%), Gaps = 13/137 (9%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVK-------VGNVSSINLELNS  792
            G   N+ F  VEFD +KD    D+N NHVG+D++S++S K       + N ++ +L L S
Sbjct  131  GNFSNHLF-AVEFDTVKDYDLHDINDNHVGIDINSVISNKSVPAASFLVNSTTKDLNLCS  189

Query  791  GEKLQSWIDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSR-LW  615
            G  +Q+W+DY++    LEVRLS + + RP  P+LSC +DLS ++K D ++VG S+S  L 
Sbjct  190  GRPIQAWVDYDSIKNLLEVRLSSFSK-RPVSPILSCKIDLSPLFK-DYMYVGFSSSTGLL  247

Query  614  NQSHKCNVYSWSFKLRA  564
              +H   +  WSF ++ 
Sbjct  248  TSTHY--ILGWSFSMKG  262



>ref|XP_003552190.1| PREDICTED: L-type lectin-domain containing receptor kinase S.4-like 
[Glycine max]
Length=674

 Score = 90.5 bits (223),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 70/221 (32%), Positives = 110/221 (50%), Gaps = 30/221 (14%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSW  771
            G   N+ F  VEFD ++D ++GD+N NHVG+D++S+ S    NVS + L L SG+ + +W
Sbjct  131  GNISNHIF-AVEFDTVQDFEFGDINDNHVGIDINSMQSNASANVSLVGLTLKSGKPILAW  189

Query  770  IDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSR-LWNQSHKCN  594
            +DY++    + V LS     +P  PLL+  VDLS ++  D ++VG S S  L   SH   
Sbjct  190  VDYDSQLNLISVALSP-NSSKPKTPLLTFNVDLSPVF-HDIMYVGFSASTGLLASSHY--  245

Query  593  VYSWSFKLRA-APDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGAL  417
            +  WSFK+   AP      PLD  +       QL  PK+          +LI G      
Sbjct  246  ILGWSFKINGPAP------PLDLSSL-----PQLPQPKKKQT-------SLIIGVSVSVF  287

Query  416  GTLMV-----LFVWSVLRNRRPIVPEELTPEPKEYEYKKFQ  309
              +++     ++ +  ++N   I   EL   P  Y Y++ +
Sbjct  288  VIVLLAISIGIYFYRKIKNADVIEAWELEIGPHRYSYQELK  328



>ref|XP_012088795.1| PREDICTED: L-type lectin-domain containing receptor kinase S.4 
[Jatropha curcas]
 gb|KDP44923.1| hypothetical protein JCGZ_01423 [Jatropha curcas]
Length=688

 Score = 90.5 bits (223),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 82/137 (60%), Gaps = 13/137 (9%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVK-------VGNVSSINLELNS  792
            G   N+ F  VEFD ++D ++GD+N NHVG+D++SL S K       + N + INL L  
Sbjct  132  GNFSNHIF-AVEFDTVRDFEFGDINDNHVGIDINSLESNKSAPAAYFLDNSTKINLNLQM  190

Query  791  GEKLQSWIDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSR-LW  615
            G  +QSW+DY++S   +EVRLS +  I+P  P+LS  VDLS   KE  +FVG S+S  L 
Sbjct  191  GTVIQSWVDYDSSKNLVEVRLSPF-SIKPRSPILSFEVDLSPYLKE-YMFVGFSSSTGLL  248

Query  614  NQSHKCNVYSWSFKLRA  564
              +H   +  WSF +  
Sbjct  249  ASTHY--ILGWSFTING  263



>ref|XP_006480641.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.1-like 
[Citrus sinensis]
Length=711

 Score = 90.1 bits (222),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 71/102 (70%), Gaps = 2/102 (2%)
 Frame = -3

Query  929  FLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEASS  750
            F+ VEFD L D ++ D+NGNHVG+DL+S+VS +V N+ +IN++L SG+ + SWI+Y+  +
Sbjct  144  FVAVEFDTLMDVEFSDINGNHVGLDLNSMVSTQVVNLDTINVDLKSGDLVNSWIEYDGLT  203

Query  749  KRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTS  624
            +   + +S +  ++P  P+LS  +DL Q +  D ++VG S S
Sbjct  204  QAFNISVS-YSNLKPKVPILSFTLDLDQ-YVNDFMYVGFSGS  243



>ref|XP_007146994.1| hypothetical protein PHAVU_006G087700g [Phaseolus vulgaris]
 gb|ESW18988.1| hypothetical protein PHAVU_006G087700g [Phaseolus vulgaris]
Length=678

 Score = 90.1 bits (222),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 77/119 (65%), Gaps = 3/119 (3%)
 Frame = -3

Query  929  FLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEASS  750
            F+ VEFD L D ++ D+NGNHVG+DL+S+VS +V ++ S+ +EL SG+ + +WI+Y+ SS
Sbjct  138  FVAVEFDTLMDVEFSDINGNHVGLDLNSVVSAQVSDLGSVGVELKSGDSVNAWIEYDGSS  197

Query  749  KRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWSFK  573
            K L V +S +  +RP  P+L   +D+  M+  D ++VG S S     +   +V  WSF 
Sbjct  198  KGLRVWVS-YSTVRPKDPILKVDLDV-DMYVNDFMYVGFSGST-QGSTEVHSVEWWSFN  253



>ref|XP_009598151.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.1-like 
[Nicotiana tomentosiformis]
Length=711

 Score = 90.1 bits (222),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/101 (43%), Positives = 70/101 (69%), Gaps = 2/101 (2%)
 Frame = -3

Query  926  LGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEASSK  747
              +EFD L D ++ D+NGNHVG+DL+S+VS +VG++ S+ ++L SG+ + SWI+Y  S+K
Sbjct  136  FAIEFDTLMDVEFKDINGNHVGLDLNSMVSTQVGDLDSVGVDLKSGDLVNSWIEYSGSTK  195

Query  746  RLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTS  624
            +L + +S +  ++P  P LS  +DLS+ +  D +FVG   S
Sbjct  196  KLNIFVS-YSNLKPKEPFLSVTIDLSE-YVNDFMFVGFCGS  234



>gb|EMS45030.1| L-type lectin-domain containing receptor kinase S.4 [Triticum 
urartu]
Length=322

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 72/217 (33%), Positives = 108/217 (50%), Gaps = 32/217 (15%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSW  771
            G   N+ F  VEFD ++D ++ D+N NHVGVDL+SL S    + + INL+  SG+ + +W
Sbjct  76   GNATNHVF-AVEFDTVQDFEFADINDNHVGVDLNSLTSNASASAAPINLK--SGDTVLAW  132

Query  770  IDYEASSKRLEVRLSKWGEI-RPGYPLLSCFVDLSQMWKEDEVFVGLSTSR-LWNQSHKC  597
            +DY+   + L V ++      +P  PL+S  VDLS +++E +++VG S S  L   SH  
Sbjct  133  VDYDGDRRLLNVSIATLAAPEKPAAPLISFHVDLSIVFRE-QMYVGFSASTGLLASSHY-  190

Query  596  NVYSWSFKL---RAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGC  426
             +  W+FKL    AAP  + S P  P+     KP++            K    LI  +  
Sbjct  191  -LMGWTFKLGGGAAAPLDLSSLPSLPRP----KPDK------------KSRTTLILASVF  233

Query  425  GALGTLMVLFVWSV-----LRNRRPIVPEELTPEPKE  330
             A   L+VL          ++NR  I P EL   P  
Sbjct  234  SAFVALLVLAGAGAYAAYRIKNREVIEPWELDHGPHR  270



>ref|XP_004960359.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.1-like 
[Setaria italica]
Length=753

 Score = 90.1 bits (222),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 71/132 (54%), Gaps = 4/132 (3%)
 Frame = -3

Query  920  VEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEASSKR-  744
            +EFD L D ++GDVNGNHVG+DL S+VS  V ++    +EL SG  + +WIDY       
Sbjct  141  IEFDTLMDVQFGDVNGNHVGLDLGSMVSAAVADLGEAGVELTSGRTVNAWIDYRPDKGGI  200

Query  743  LEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWSFKLRA  564
            LEV +S +   RP  P+LS  +DL +  K D  FVG S S     +    +  WSF   +
Sbjct  201  LEVSVS-YAANRPRVPVLSAPLDLGETVK-DAAFVGFSAS-TQGSTEVHAIEWWSFSTAS  257

Query  563  APDWMHSQPLDP  528
                 HS P  P
Sbjct  258  PAPAPHSAPTPP  269



>ref|XP_009358152.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.1-like 
isoform X1 [Pyrus x bretschneideri]
Length=715

 Score = 90.1 bits (222),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 74/109 (68%), Gaps = 2/109 (2%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSW  771
            G      F+ VEFD L D ++ D+NGNHVG+DL S+VS +V ++ +++++L SG+ + SW
Sbjct  130  GPDTGSGFVAVEFDTLMDVEFKDINGNHVGLDLDSIVSTRVSDLDAVDIDLKSGDLVNSW  189

Query  770  IDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTS  624
            I+Y+ SSK + V +S +  ++P  P+LS  +DL+Q +  D ++VG S S
Sbjct  190  IEYDGSSKVINVSVS-YSNLKPKDPVLSFSLDLAQ-YVSDFMYVGFSGS  236



>ref|XP_009358154.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.1-like 
isoform X2 [Pyrus x bretschneideri]
Length=715

 Score = 90.1 bits (222),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 74/109 (68%), Gaps = 2/109 (2%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSW  771
            G      F+ VEFD L D ++ D+NGNHVG+DL S+VS +V ++ +++++L SG+ + SW
Sbjct  130  GPDTGSGFVAVEFDTLMDVEFKDINGNHVGLDLDSIVSTRVSDLDAVDIDLKSGDLVNSW  189

Query  770  IDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTS  624
            I+Y+ SSK + V +S +  ++P  P+LS  +DL+Q +  D ++VG S S
Sbjct  190  IEYDGSSKVINVSVS-YSNLKPKDPVLSFSLDLAQ-YVSDFMYVGFSGS  236



>ref|XP_003615494.1| Lectin-domain containing receptor kinase A4.2 [Medicago truncatula]
 gb|AES98452.1| lectin-like receptor kinase, putative [Medicago truncatula]
Length=672

 Score = 90.1 bits (222),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 75/124 (60%), Gaps = 3/124 (2%)
 Frame = -3

Query  944  KENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWID  765
            + +YK + +EFD  ++ ++GD N NHVG++L S+VS K+ NVS I + L  G    +WID
Sbjct  154  ESDYKAVAIEFDTRENPEFGDPNDNHVGINLGSIVSTKIINVSDIGVSLKDGFVHHAWID  213

Query  764  YEASSKRLEVRLSKWGE-IRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVY  588
            Y+   +R+++RL    + + P  P+ S F+DLS    E  +FVG S +   N +   N+ 
Sbjct  214  YDGPQRRIDIRLGLANQDVYPTKPIFSEFMDLSPYLNE-YMFVGFSAAT-GNHTQIHNIL  271

Query  587  SWSF  576
            SW+F
Sbjct  272  SWNF  275



>ref|XP_011624178.1| PREDICTED: uncharacterized protein LOC18436240 [Amborella trichopoda]
Length=1367

 Score = 90.1 bits (222),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 72/235 (31%), Positives = 117/235 (50%), Gaps = 26/235 (11%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSV----------KVGNVSSINLE  801
            G   N+ F  VEFD ++D ++GD+N NHVGVD+ +L S           K G +++ N+ 
Sbjct  131  GNLSNHIF-AVEFDTVQDYEFGDINDNHVGVDIDNLNSTVAAPAFIKLAKNGIITTTNVT  189

Query  800  LNSGEKLQSWIDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSR  621
            L  G  +Q+WI+Y++ SK L + LS   + +P  PL+S  +DLS +  ED ++VG STS 
Sbjct  190  LQGGNPIQAWIEYDSPSKVLNITLSLSSD-KPQIPLISTEIDLSPVL-EDYMYVGFSTST  247

Query  620  -LWNQSHKCNVYSWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGAL  444
             +   SH   V  W+F++   P     QPL      + +  +     +    G+ I   L
Sbjct  248  GVLASSHY--VSGWTFRMNGEP-----QPLFLSRLPLLRNTKNITQSKGFISGVSISVTL  300

Query  443  IFGTGCGALGTLMVLFVWSVLRNRRPIVPEELTPEPKEYEYKKFQVVVDDKAIKD  279
            +    C A+   + + VW  L+    I   ELT  P  + YK+ ++     + K+
Sbjct  301  LV---CAAIAASLYI-VWK-LKTADIIEEWELTSGPHRFSYKQLRMATRSFSSKE  350


 Score = 83.6 bits (205),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 69/235 (29%), Positives = 117/235 (50%), Gaps = 26/235 (11%)
 Frame = -3

Query  950   GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSL-------VSVKV---GNVSSINLE  801
             G   N+ F  VEFD ++D ++GD+N NHVGVD+ +L        SVK+   G +++ N+ 
Sbjct  829   GNLSNHVF-AVEFDTVQDYEFGDINDNHVGVDIDNLNSTVAEPASVKLARNGTITATNVS  887

Query  800   LNSGEKLQSWIDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSR  621
             L  G+ +Q+WI+Y + S  L V LS   + +P  PL+S  +DLS  + ED ++VG S+S 
Sbjct  888   LQGGKPIQAWIEYNSPSNLLNVTLSLTSD-KPEIPLISTTIDLSSAF-EDYMYVGFSSST  945

Query  620   LWNQSHKCNVYSWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALI  441
                 S    +  W+F++   P     QPL      + +  +     +    G+ I   L+
Sbjct  946   GLLSSSHY-LSGWAFRMNGQP-----QPLFLSHLPLLRDTKNIARSKGFIIGVSISATLL  999

Query  440   FGTGCGALGTLMVLFVWSVLRNRRPIVPE-ELTPEPKEYEYKKFQVVVDDKAIKD  279
                 C A+   + +  W +   R  ++ E ELT  P  + YK+ ++     + K+
Sbjct  1000  V---CAAIAASLYI-AWKL--KRADVIEEWELTYGPHRFSYKELRMATRSFSSKE  1048



>ref|XP_003563783.1| PREDICTED: L-type lectin-domain containing receptor kinase S.4 
[Brachypodium distachyon]
Length=693

 Score = 89.7 bits (221),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 72/220 (33%), Positives = 112/220 (51%), Gaps = 20/220 (9%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSW  771
            G   N+ F  VEFD +KD ++GD++ NHV VDL+SLVS      + INL+  SG+ + +W
Sbjct  141  GNATNHVF-AVEFDTVKDFEFGDIDDNHVAVDLNSLVSNASAPAAPINLK--SGDTVLAW  197

Query  770  IDYEASSKRLEVRLSKW--GEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSR-LWNQSHK  600
            +DY+  +K L V ++    G  +P  PL+S  VDL+ +++E +++VG S S  L   SH 
Sbjct  198  VDYDGDAKLLNVSIATTSDGGKKPSAPLISFRVDLAGIFRE-QMYVGFSASTGLLASSHY  256

Query  599  CNVYSWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLK---ILGALIFGTG  429
              +  WSFKL AA     + PLD     V    +L  P  +D+   K   +L ++     
Sbjct  257  --LMGWSFKLGAA---GAAPPLD-----VSSLPRLPRPSTADDGRNKTTVVLASVFSAFV  306

Query  428  CGALGTLMVLFVWSVLRNRRPIVPEELTPEPKEYEYKKFQ  309
                      +     +NR  I P EL   P  ++Y + +
Sbjct  307  ALVALAAAGAYAAYRFKNRDVIEPWELDYGPHRFKYPELK  346



>ref|XP_010047912.1| PREDICTED: L-type lectin-domain containing receptor kinase S.4-like 
[Eucalyptus grandis]
 gb|KCW88973.1| hypothetical protein EUGRSUZ_A01292 [Eucalyptus grandis]
Length=693

 Score = 89.7 bits (221),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 66/225 (29%), Positives = 113/225 (50%), Gaps = 26/225 (12%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVG---------NVSSINLEL  798
            G   N+ F  VE D ++D ++GD+N NH+G+D++SLVS             N + ++L L
Sbjct  135  GNFSNHLF-AVELDTVQDFEFGDINDNHIGIDINSLVSNASAAAAYYAAGENSTKLDLNL  193

Query  797  NSGEKLQSWIDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSR-  621
             SG+ LQ+WIDY++  K + V ++    ++P  P+LS  VDLS +++E  ++VG S S  
Sbjct  194  KSGKALQAWIDYDSGEKVISVTIAP-SSVKPTKPILSYKVDLSPIFRE-FMYVGFSASTG  251

Query  620  LWNQSHKCNVYSWSFKLRAAPDWMHSQPLDP-KAFRVGKPEQLSVPKRSDECGLKILGAL  444
            L   SH   V  WSF++  A   +    L P    R   P     P  +   G+ +L  +
Sbjct  252  LLASSHY--VMGWSFRIDGAARALEISSLPPLPGARKKHP-----PSTALAIGISVLCVV  304

Query  443  IFGTGCGALGTLMVLFVWSVLRNRRPIVPEELTPEPKEYEYKKFQ  309
            + G+        +V+ +   ++N   +   EL   P  + Y++ +
Sbjct  305  LAGS-----AVFLVVLIVRRIKNADGVEEWELEIGPHRFSYQELK  344



>ref|XP_007134058.1| hypothetical protein PHAVU_010G015800g [Phaseolus vulgaris]
 gb|ESW06052.1| hypothetical protein PHAVU_010G015800g [Phaseolus vulgaris]
Length=686

 Score = 89.7 bits (221),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 76/234 (32%), Positives = 110/234 (47%), Gaps = 29/234 (12%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVS-------VKVGNVSS--INLEL  798
            G   N+ F  VEFD  +D ++GD+N NHVG+D+ SLVS          G+  S   NL L
Sbjct  134  GNFSNHLF-AVEFDTAQDFEFGDINDNHVGIDIDSLVSNASAPAGYYTGDHDSDKQNLTL  192

Query  797  NSGEKLQSWIDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSR-  621
             SG+ +  W+DY+++   + V +S     +P  PLLS  VDLS +  ED ++VG S S  
Sbjct  193  KSGQPILVWVDYDSAQSVVNVTISA-SSTKPTRPLLSFPVDLSPIL-EDSMYVGFSASTG  250

Query  620  LWNQSHKCNVYSWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALI  441
            L   SH   +  WSFK+        + PLD  +       QL  PKR       I+G  +
Sbjct  251  LLASSHY--ILGWSFKINGP-----APPLDLSSL-----PQLPGPKRKHTS--LIIGVSV  296

Query  440  FGTGCGALGTLMVLFVWSVLRNRRPIVPEELTPEPKEYEYKKFQVVVDDKAIKD  279
             G        L+  +++   +N   I   EL   P  Y Y++ +     K  KD
Sbjct  297  SGVVLALFAVLLGFYMYRRYKNADVIEAWELEIGPHRYSYQELKKAT--KGFKD  348



>ref|XP_002436886.1| hypothetical protein SORBIDRAFT_10g010530 [Sorghum bicolor]
 gb|EER88253.1| hypothetical protein SORBIDRAFT_10g010530 [Sorghum bicolor]
Length=703

 Score = 89.4 bits (220),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 65/218 (30%), Positives = 102/218 (47%), Gaps = 13/218 (6%)
 Frame = -3

Query  929  FLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEASS  750
             + VEFD + + ++ D + NHVG+DL S +SV   ++++  ++L SG    +WIDY +  
Sbjct  160  IVAVEFDTMANPEFADPSDNHVGLDLGSPLSVATVDLAASGVDLKSGNLTTAWIDYRSGD  219

Query  749  KRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWSFKL  570
            +RLEV LS     +P  P+LS  VDLS   KE  ++VG S S     + +  +  W+F+ 
Sbjct  220  RRLEVFLSYAVATKPKRPVLSVAVDLSPYLKE-AMYVGFSAST-EGSTQQHTIKEWTFQT  277

Query  569  RAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGTLMVLFVW  390
               P   +S   +  A      E  +VP  +     K +G  +   G  AL    V F W
Sbjct  278  FGFPPTANSS-FESNA-TSNSSEPATVPVSNAANSHKRVGLALGILGPVALAVAFVFFAW  335

Query  389  SVL--------RNRRPIVPEELTPEPKEYEYKKFQVVV  300
              +        RN     P EL   P+++ YK+     
Sbjct  336  VSIKKLIQLTSRNDAAFSP-ELLKGPRKFSYKELSAAT  372



>ref|XP_002441537.1| hypothetical protein SORBIDRAFT_09g028880 [Sorghum bicolor]
 gb|EES19967.1| hypothetical protein SORBIDRAFT_09g028880 [Sorghum bicolor]
Length=671

 Score = 89.4 bits (220),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 64/219 (29%), Positives = 104/219 (47%), Gaps = 19/219 (9%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVG--------NVSSINLELN  795
            G   N+ F  VE D +++ ++GD++ NHVGVD++SL S+K          N    NL+L 
Sbjct  131  GNSSNHIF-AVELDTVQNTEFGDIDNNHVGVDINSLSSLKSSTAGFHDDSNGRFTNLQLR  189

Query  794  SGEKLQSWIDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLW  615
                +Q+W++Y+ ++ R+ V ++  G  +P  PLLS   +LS +  E E ++G S++   
Sbjct  190  GSGPIQAWVEYDGNTTRIHVTIAPLGMQKPVTPLLSLTYNLSTVVTE-EAYIGFSSATGL  248

Query  614  NQSHKCNVYSWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFG  435
            +  H   V  WSF + +    + S  L    +   +P     P R  E  L I  AL   
Sbjct  249  STGHHHCVLGWSFGMNSPAPSIDSAKLPKLPYLGPRP-----PSRIMEITLPIASALF--  301

Query  434  TGCGALGTLMVLFVWSVLRNRRPIVPEELTPEPKEYEYK  318
                  GT++VL V    R +      E+   P  + YK
Sbjct  302  --VLLTGTIVVLLVRRHFRYKEVHEDWEVEYGPHRFAYK  338



>ref|XP_002461416.1| hypothetical protein SORBIDRAFT_02g002290 [Sorghum bicolor]
 gb|EER97937.1| hypothetical protein SORBIDRAFT_02g002290 [Sorghum bicolor]
Length=1167

 Score = 89.7 bits (221),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 76/132 (58%), Gaps = 12/132 (9%)
 Frame = -3

Query  932  KFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKV-----------GNVSSINLELNSGE  786
             F  VE D +K++++ D++ NHVGVD+++L SV             G +++ +L  + G+
Sbjct  616  HFFAVELDTIKNNEFHDIDANHVGVDINALSSVYSHTAAFHDETDDGALTTFSLISSHGK  675

Query  785  KLQSWIDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQS  606
             +Q+W+DY+  SK+L V L+  G  +P  PLLS   DLS +  +D+ FVG S +     S
Sbjct  676  AMQAWVDYDGQSKQLNVTLAPMGVTKPSKPLLSNTTDLSPVITDDKAFVGFSGATGPGGS  735

Query  605  HKCNVYSWSFKL  570
              C V +WSF +
Sbjct  736  QHC-VLAWSFAV  746



>gb|KJB13892.1| hypothetical protein B456_002G100600 [Gossypium raimondii]
Length=658

 Score = 89.4 bits (220),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 71/214 (33%), Positives = 104/214 (49%), Gaps = 12/214 (6%)
 Frame = -3

Query  932  KFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEAS  753
            +FL VEFD   D ++ D NGNHVG+D++ L S+   +    N++L SG  + +WIDY+  
Sbjct  133  RFLAVEFDSKLDTEFNDPNGNHVGLDINELDSIITADALLQNIDLKSGNLITAWIDYKND  192

Query  752  SKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWSFK  573
             + L V LS +  ++P  PLLS  +DLS   K D++FVG S S     +    +Y+WSF+
Sbjct  193  LRVLNVFLS-YSTVKPPTPLLSLEIDLSHYLK-DDMFVGFSAST-EGSTEVHLIYNWSFR  249

Query  572  LRA-APDWMHSQPLDPKAFRV----GKPEQLSVPKRSDE--CGLKILGALIFGTGCGALG  414
                 P    S P +     V    G P   S  K       GL I G   F       G
Sbjct  250  TFGFLPVRSRSHPHNVSDSSVSAITGIPVSNSTKKHHKRFGLGLGIAGPAFFFVVLAVFG  309

Query  413  TLMVLFVWSVLRNRRPIVPEELTPEPKEYEYKKF  312
             + V   W  ++  + +  E LT  P+E+ YK+ 
Sbjct  310  YVSVK-KWKGMKVEKCLKAEILT-GPREFSYKEL  341



>ref|XP_004962683.1| PREDICTED: L-type lectin-domain containing receptor kinase S.4-like 
[Setaria italica]
Length=693

 Score = 89.4 bits (220),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 76/223 (34%), Positives = 115/223 (52%), Gaps = 27/223 (12%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSW  771
            G   N+ F  VEFD ++D ++ D+NGNHVGVDL+SL+S K  +   +NL+  +G+ + +W
Sbjct  136  GNATNHVF-AVEFDTVQDFEFEDINGNHVGVDLNSLISNKSASAEPVNLK--AGDTV-AW  191

Query  770  IDYEASSKRLEVRL----SKWGEI-RPGYPLLSCFVDLSQMWKEDEVFVGLSTSR-LWNQ  609
            IDY+ +++ L V +    S  G + +P  PL+S  VDLS + + D+++VG S S  +   
Sbjct  192  IDYDGAARLLNVSIANGTSPSGVVNKPAKPLISFPVDLSGVLR-DQMYVGFSASTGVLAS  250

Query  608  SHKCNVYSWSFKL--RAAPDW-MHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIF  438
            SH   V  WSF+L   AAP   + S P  P+A   GK     +             AL+ 
Sbjct  251  SHY--VRGWSFRLGGGAAPRLDVSSLPALPRAKNGGKNRTSLILA----AAFSAFVALVV  304

Query  437  GTGCGALGTLMVLFVWSVLRNRRPIVPEELTPEPKEYEYKKFQ  309
              G GA G           +NR  I P EL   P  ++Y + +
Sbjct  305  LAGAGAYGAYR-------YKNRDIIEPWELDYGPHRFKYAELR  340



>ref|XP_004966927.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Setaria italica]
Length=678

 Score = 89.0 bits (219),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 64/214 (30%), Positives = 107/214 (50%), Gaps = 20/214 (9%)
 Frame = -3

Query  932  KFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKV---------GNVSSINLELNSGEKL  780
            +   VE D +++ ++GD++ NHVG+D++SL S+K           N +  NL L     +
Sbjct  142  QIFAVELDTIQNTEFGDIDNNHVGIDINSLNSLKSRPAGFYNNGKNGTFTNLPLIGSGPI  201

Query  779  QSWIDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHK  600
            Q+W++Y+ ++ ++ V L+  G  +P  PLLS   DLS + KE + ++G S+S   +  H 
Sbjct  202  QTWVEYDGNTTQINVTLAPLGMEKPARPLLSSTYDLSTVLKE-QSYIGFSSSTGLSTGHH  260

Query  599  CNVYSWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGA  420
            C V  WSF + +    + S  L PK   +G       P +  E  L I  A++      A
Sbjct  261  C-VLGWSFGMNSPAPIIDSTKL-PKLPYLGPRS----PSKLLEIILPIASAVL----VLA  310

Query  419  LGTLMVLFVWSVLRNRRPIVPEELTPEPKEYEYK  318
            +GT+ V+ V   LR +      E+   P  + YK
Sbjct  311  IGTITVILVRRHLRYKEVHEDWEVEYGPHRFTYK  344



>ref|XP_008363824.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.1-like 
[Malus domestica]
Length=716

 Score = 89.0 bits (219),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 74/109 (68%), Gaps = 2/109 (2%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSW  771
            G      F+ VEFD L D ++ D+NGNHVG+DL S+VS +V ++ +++++L SG+ + SW
Sbjct  130  GPDTGSGFVAVEFDTLMDVEFKDINGNHVGLDLDSMVSTRVSDLDAVDIDLKSGDLVNSW  189

Query  770  IDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTS  624
            I+Y+ SS+ + V +S +  ++P  P+LS  +DL+Q +  D ++VG S S
Sbjct  190  IEYDGSSQVITVSVS-YSNLKPKDPVLSFSLDLAQ-YVSDFMYVGFSGS  236



>ref|XP_009342662.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.1-like 
[Pyrus x bretschneideri]
Length=710

 Score = 89.0 bits (219),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 73/109 (67%), Gaps = 2/109 (2%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSW  771
            G      F+ VEFD L D ++ D+NGNHVG+DL+S+VS +V ++ S++++L SG+ + SW
Sbjct  130  GPDTGSDFVAVEFDTLMDVEFKDINGNHVGLDLNSMVSTRVSDLGSVDIDLKSGDLVNSW  189

Query  770  IDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTS  624
            I+Y+ SS  + V +S +  ++P  P+LS  +DL Q +  D ++VG S S
Sbjct  190  IEYDGSSGVINVSVS-YSNLKPTDPVLSFSLDLGQ-YVSDFMYVGFSGS  236



>ref|XP_008345505.1| PREDICTED: L-type lectin-domain containing receptor kinase S.4-like 
[Malus domestica]
Length=336

 Score = 86.7 bits (213),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 64/215 (30%), Positives = 107/215 (50%), Gaps = 25/215 (12%)
 Frame = -3

Query  926  LGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKV-------GNVSSINLELNSGEKLQSWI  768
              VEFD ++D ++GD+N NHVG+D++SL S           +VS  +L L SG+ +Q+WI
Sbjct  88   FAVEFDTVQDFEFGDINDNHVGIDINSLKSNASAAAAYYKDSVSKQSLNLKSGKPIQAWI  147

Query  767  DYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSR-LWNQSHKCNV  591
            DY++S   + V +S     +P  PLLS  VDLS + +E  ++VG S S  L   SH  + 
Sbjct  148  DYDSSRNLMNVTISP-SSTKPKIPLLSFQVDLSPILQE-FMYVGFSASTGLLASSHYIS-  204

Query  590  YSWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCGALGT  411
              WSFK+            + +   +G    L  PK++      ++G L+          
Sbjct  205  -GWSFKIDG----------ETRVLNMGSLPSLPKPKKNHTS--LMIGVLVSTIALALSAI  251

Query  410  LMVLFVWS-VLRNRRPIVPEELTPEPKEYEYKKFQ  309
             + +++++   +N  P+   EL   P  Y Y++ +
Sbjct  252  SVSVYIYTKKFKNSDPVESWELQLGPHRYSYQELK  286



>ref|XP_007163432.1| hypothetical protein PHAVU_001G234200g [Phaseolus vulgaris]
 gb|ESW35426.1| hypothetical protein PHAVU_001G234200g [Phaseolus vulgaris]
Length=664

 Score = 88.6 bits (218),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 73/238 (31%), Positives = 116/238 (49%), Gaps = 38/238 (16%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKV--------GNVSSINLELN  795
            G   N+ F  VEFD ++D ++ D+N NHVGV+L+++VS K          + +  NL L 
Sbjct  139  GNFSNHLF-AVEFDTVQDFEFEDINDNHVGVNLNNMVSNKSVEAAFFPEDSANKQNLSLK  197

Query  794  SGEKLQSWIDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSR-L  618
            SG+ +Q+W+DY++S+ +LEVRLS     +P YP+L   VDLS +  +D ++VG S S  L
Sbjct  198  SGKVIQAWVDYDSSNNQLEVRLSPTSS-KPTYPILKYKVDLSPIL-QDSMYVGFSASTGL  255

Query  617  WNQSHKCNVYSWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIF  438
               +H   ++ WSFK+            + K   +     LSVP ++          LI 
Sbjct  256  LASTHY--IFGWSFKING----------EAKTLSLHNLPSLSVPNKTQN-------HLIL  296

Query  437  GTGCGALGTLMVL----FVWSVLRNRRPIVP-EELTPEPKEYEYKKFQVVVDDKAIKD  279
            G     + TL  +    +++  ++N   I   E     P  + YK+       K  KD
Sbjct  297  GLSLSFILTLAAISLACYLFRRMKNTEVIEAWERDVVGPHRFPYKELHKAT--KCFKD  352



>ref|XP_004296332.2| PREDICTED: probable L-type lectin-domain containing receptor 
kinase S.7 [Fragaria vesca subsp. vesca]
Length=654

 Score = 88.6 bits (218),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 66/218 (30%), Positives = 105/218 (48%), Gaps = 14/218 (6%)
 Frame = -3

Query  929  FLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEASS  750
            F+ VEFD  +D ++ D N NHVG+D+SSLVS+K  +    +++L SG  + +W+DY+   
Sbjct  122  FIAVEFDSKRDPRFDDPNDNHVGLDISSLVSLKTADPIDQDVDLKSGAAVTAWVDYKNDQ  181

Query  749  KRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWSFKL  570
            + L+V LS    ++P  P+L   +DLS   +E  ++VG S S     +    + SWSFK 
Sbjct  182  ETLKVYLSYSSAVKPENPILDVGIDLSGYLRE-TMYVGFSAST-EGSTELHQLMSWSFKT  239

Query  569  RA-APDWMHSQPLDPKAFRVGKPEQLSVP-----KRSDECGLKILGALIFGTGCGALGTL  408
                P      P +     V    ++  P     +R    GL I    +F   C AL   
Sbjct  240  SGFVPKRPTLHPHNVSDTYVIVSPRMPAPESGSGRRRMGLGLGIGMPAVF---CVALAVF  296

Query  407  MVLFV--WSVLRNRRPIVPEELTPEPKEYEYKKFQVVV  300
             VL V  W  +R R      E+   P+++ Y++ +   
Sbjct  297  GVLSVRKWREVR-REKSFKAEVVAGPRQFSYRELKAAT  333



>ref|XP_009600218.1| PREDICTED: probable L-type lectin-domain containing receptor 
kinase S.7 [Nicotiana tomentosiformis]
Length=671

 Score = 88.6 bits (218),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 67/223 (30%), Positives = 108/223 (48%), Gaps = 28/223 (13%)
 Frame = -3

Query  932  KFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEAS  753
            KF+ VEFD  +D  + D + NHVG+D+ SL+S+K  NV    ++L S   + SWIDY++ 
Sbjct  135  KFVAVEFDTRQDLHFNDPDDNHVGLDIDSLISIKTANVKLAGVDLKSRNLITSWIDYKSE  194

Query  752  SKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWSFK  573
             K+L V LS +   +P  PLL+  +DLS   KE  ++VG + S   +    C + +WSF+
Sbjct  195  KKQLLVFLS-YSSSKPKKPLLTVDIDLSDYLKE-FMYVGFAASTEGSTELHC-IENWSFQ  251

Query  572  LRAAPDWMHSQPLDPKAFRVGKPEQLS----------VPKRSDECGLKILGALIFGTGCG  423
                       P+ P+ +    P  +S          + + SD    K LG  +   G  
Sbjct  252  TFGF------SPMRPRHY----PHNVSDNSVLVKPPTIQEDSDNKHHKRLGLGLGIAGPA  301

Query  422  ALGTLMVLFVWSVLRNRRPIVPE-----ELTPEPKEYEYKKFQ  309
                ++V F W   +  R +  E     EL   P+++ YK+ +
Sbjct  302  FFCAVLVAFGWISFKKWRGLNTEKNLTAELVTGPRQFSYKELR  344



>ref|XP_002873076.1| lectin protein kinase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49335.1| lectin protein kinase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=710

 Score = 88.6 bits (218),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 69/102 (68%), Gaps = 2/102 (2%)
 Frame = -3

Query  929  FLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEASS  750
            F+ VEFD L D ++ DVNGNHVG+DL+++VS  V ++ +++++L SG  + SWI Y+ S 
Sbjct  145  FVAVEFDTLMDVQFKDVNGNHVGLDLNAVVSAAVADLGNVDIDLKSGNAVNSWITYDGSG  204

Query  749  KRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTS  624
            + L + +S +  +RP  P+LS  +DL + +  D +FVG S S
Sbjct  205  RVLTIYVS-YSNVRPKSPILSVPLDLDR-YVNDSMFVGFSGS  244



>ref|XP_008387614.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.1 
[Malus domestica]
Length=707

 Score = 88.6 bits (218),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 72/102 (71%), Gaps = 2/102 (2%)
 Frame = -3

Query  929  FLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEASS  750
            F+ VEFD L D ++ D+NGNHVG+DL+S+VS +V ++ S++++L SG+ + SWI+Y+ SS
Sbjct  134  FVAVEFDTLMDVEFKDINGNHVGLDLNSMVSTRVSDLGSVDIDLKSGDLVNSWIEYDGSS  193

Query  749  KRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTS  624
              + V +S +  ++P  P+LS  +DL Q +  D ++VG S S
Sbjct  194  GVINVSVS-YSNLKPKDPVLSFSLDLGQ-YVSDFMYVGFSGS  233



>ref|XP_010107566.1| L-type lectin-domain containing receptor kinase VIII.1 [Morus 
notabilis]
 gb|EXC16248.1| L-type lectin-domain containing receptor kinase VIII.1 [Morus 
notabilis]
Length=713

 Score = 88.6 bits (218),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 71/102 (70%), Gaps = 2/102 (2%)
 Frame = -3

Query  929  FLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEASS  750
            F  VEFD L D ++ D+NGNHVG+DL+S+VS +VGN++ + +EL SG+ + +WI+Y+ S+
Sbjct  132  FFAVEFDTLMDVEFSDINGNHVGLDLNSVVSSEVGNLADVGVELKSGDLVNAWIEYDGST  191

Query  749  KRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTS  624
            +   V +S +  ++P  P+LS  +DL + +  D ++VG S S
Sbjct  192  RIFNVSVS-YSNLKPENPILSLPLDLDK-YVNDFMYVGFSGS  231



>emb|CDP13714.1| unnamed protein product [Coffea canephora]
Length=678

 Score = 88.6 bits (218),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 64/220 (29%), Positives = 105/220 (48%), Gaps = 22/220 (10%)
 Frame = -3

Query  932  KFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEAS  753
            +F+ +EFD   D  + D + NHVG+D+ SL+S+K  N +S+ + L SG  + +WIDY+  
Sbjct  143  RFIAIEFDTKLDSHFDDPDDNHVGLDIDSLISIKTANPASLGISLKSGNLIFTWIDYKNE  202

Query  752  SKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWSFK  573
             K+L+V LS +   +PG PLL   +DLS   K D +++G S S     +    + +WSF+
Sbjct  203  EKKLDVFLS-YSSFKPGVPLLKVDIDLSGYLK-DFMYLGFSGST-EGSTELHFIENWSFR  259

Query  572  ---LRAAPDWMHSQPLDPKAFRVGKPEQLSVP----KRSDECGLKILGALIFGTGCGALG  414
                R     +H   +   +  +  P  +S P     R    G  I G   F   C  L 
Sbjct  260  TRGFRPVRPRIHPHNVTENSVPLNPPIPVSDPGNRHHRRLGLGFGIAGPAFF---CAVL-  315

Query  413  TLMVLFVWSVL-----RNRRPIVPEELTPEPKEYEYKKFQ  309
               V+F W  +           +  EL   P+++ Y++ +
Sbjct  316  ---VVFGWISVNKWKENKTEKTLKAELVTGPRQFSYQELK  352



>ref|XP_010910689.1| PREDICTED: L-type lectin-domain containing receptor kinase S.4-like 
[Elaeis guineensis]
Length=720

 Score = 88.6 bits (218),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 68/228 (30%), Positives = 113/228 (50%), Gaps = 37/228 (16%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSI-----------NL  804
            G   N+ F  VEFD ++D ++GD+N NHVG+D+++LVS    N+S+            N+
Sbjct  158  GNFSNHVF-AVEFDTVQDFEFGDINDNHVGIDINNLVS----NISTAVAYYGNDGKKNNI  212

Query  803  ELNSGEKLQSWIDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTS  624
             + +G  LQ+W+DY+   K L V +S +   +P  PLLS  VDLS +   D++FVG S S
Sbjct  213  SIKAGHTLQAWVDYDGVGKVLNVTVSPFSS-KPPRPLLSFPVDLSTIL-HDQMFVGFSAS  270

Query  623  R-LWNQSHKCNVYSWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGA  447
              L + SH   +  W+FK+              ++  +     L  PK+ D   +  + A
Sbjct  271  TGLLSSSHY--LLGWNFKMNGI----------ARSLDLASLPALPQPKKKDPTFVIAISA  318

Query  446  LIFGTGCGALGTLMV--LFVWSVLRNRRPIVPEELTPEPKEYEYKKFQ  309
                T    L  ++V  ++++  ++N   I P EL   P  + Y + +
Sbjct  319  ----TSVAVLIAIIVAAVYLFYKIKNADVIEPWELEMGPHRFSYSELK  362



>ref|XP_002532997.1| kinase, putative [Ricinus communis]
 gb|EEF29389.1| kinase, putative [Ricinus communis]
Length=683

 Score = 88.2 bits (217),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 70/220 (32%), Positives = 109/220 (50%), Gaps = 32/220 (15%)
 Frame = -3

Query  929  FLGVEFDILKDDKYGDVNGNHVGVDLSSLVS-------VKVGNVSSINLELNSGEKLQSW  771
             L VEFD ++D ++GD+N NHVG+D+++L S         + + S  +L L +G+ +Q W
Sbjct  137  LLAVEFDTVQDFEFGDINDNHVGIDINNLKSNASAAAAYYINDTSKQDLNLKTGKPIQVW  196

Query  770  IDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSR-LWNQSHKCN  594
            IDY++    L V +S   E +P  P+LS  +DLSQ++ E+ ++VG S S  L   SH   
Sbjct  197  IDYDSIQNLLNVTISPTSE-KPRLPILSFPIDLSQIF-EEYMYVGFSASTGLLASSHY--  252

Query  593  VYSWSFKLRAAPDWMH-----SQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTG  429
            +  WSFK+      +      S P  PK    G    + VP         +  A+I    
Sbjct  253  ILGWSFKMDGQARALDLSSLPSLPRGPKTKHTGLTIAVIVP--------SVFLAII----  300

Query  428  CGALGTLMVLFVWSVLRNRRPIVPEELTPEPKEYEYKKFQ  309
              AL +L + +V   +RN   I   EL   P  Y Y++ +
Sbjct  301  --AL-SLAIFYVIRKIRNADVIEDWELEIGPHRYSYQELK  337



>ref|XP_002278015.1| PREDICTED: L-type lectin-domain containing receptor kinase S.4 
[Vitis vinifera]
Length=679

 Score = 88.2 bits (217),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 68/222 (31%), Positives = 106/222 (48%), Gaps = 25/222 (11%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSIN-------LELNS  792
            G   N+ F  VEFD ++D ++ D++ NHVG+DL+S+ S    N S  +       L L  
Sbjct  132  GNSTNHVF-AVEFDTVQDFEFNDISDNHVGIDLNSMTSYASANASYFSDNSTKEYLNLKG  190

Query  791  GEKLQSWIDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSR-LW  615
            G+ +Q+WIDY+    +L V LS     +P  P+LSC V+LS + KE  ++VG S S  L 
Sbjct  191  GKTIQAWIDYDGQRDQLNVFLSPH-STKPTSPILSCGVNLSSILKE-FMYVGFSASTGLL  248

Query  614  NQSHKCNVYSWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFG  435
              SH   V  W FK+    + +    L PK         L  PKR++     I+G  +  
Sbjct  249  ASSHY--VLGWRFKMNGVAESLDLSSL-PK---------LPGPKRNNTP--LIIGVSVAA  294

Query  434  TGCGALGTLMVLFVWSVLRNRRPIVPEELTPEPKEYEYKKFQ  309
            T        +  ++   ++N   I   EL   P  + Y++ +
Sbjct  295  TSMIVFAVALAFYLIRKIKNADVIEAWELDIGPHRFSYQELK  336



>gb|ACR36638.1| unknown [Zea mays]
Length=569

 Score = 87.8 bits (216),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 69/218 (32%), Positives = 108/218 (50%), Gaps = 23/218 (11%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSW  771
            G   N+ F  +EFD ++D ++ DVNGNHVGVDL+SL+S        +NL+  SG+   +W
Sbjct  19   GNATNHLF-AIEFDTVQDFEFDDVNGNHVGVDLNSLISNASAKADPLNLK--SGDT-TAW  74

Query  770  IDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSR-LWNQSHKCN  594
            +DY+ +++ L V ++     +P  PL+S  VDLS +++E +++VG S S  +   SH   
Sbjct  75   VDYDGAARLLNVSIANGTLGKPTTPLISFRVDLSGIFRE-QMYVGFSASTGVLASSHYLR  133

Query  593  VYSWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSD---ECGLKILGALIFGTGCG  423
               WSF+L A      +  LD  +     P+  S   R+            AL+   G G
Sbjct  134  --GWSFRLGAGA----APALDLSSL-PSLPQLKSSKNRTSLILAVAFSAFVALVVLAGAG  186

Query  422  ALGTLMVLFVWSVLRNRRPIVPEELTPEPKEYEYKKFQ  309
            A G           +NR  I P EL   P  ++Y + +
Sbjct  187  AYGAYR-------YKNRDIIEPWELDYGPHRFKYAELR  217



>ref|XP_011002636.1| PREDICTED: L-type lectin-domain containing receptor kinase S.4-like 
isoform X1 [Populus euphratica]
Length=688

 Score = 87.8 bits (216),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 84/137 (61%), Gaps = 13/137 (9%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVK-------VGNVSSINLELNS  792
            G   N+ F  VEFD +KD    D+N NHVG+D++S++S K       + N ++ +L L S
Sbjct  131  GNFSNHLF-AVEFDTVKDYDLHDINDNHVGIDINSMISNKSVPAASFLVNSTTKDLNLCS  189

Query  791  GEKLQSWIDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSR-LW  615
            G  +Q+W+DY++    +EVRLS + + RP  P+LSC +DLS ++K D ++VG S+S  L 
Sbjct  190  GRPIQAWVDYDSIKNLVEVRLSSFSK-RPVSPILSCKLDLSPIFK-DYMYVGFSSSTGLL  247

Query  614  NQSHKCNVYSWSFKLRA  564
              +H   +  WSF ++ 
Sbjct  248  TSTHY--ILGWSFSMKG  262



>ref|XP_007141356.1| hypothetical protein PHAVU_008G188700g [Phaseolus vulgaris]
 gb|ESW13350.1| hypothetical protein PHAVU_008G188700g [Phaseolus vulgaris]
Length=677

 Score = 87.8 bits (216),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 74/124 (60%), Gaps = 3/124 (2%)
 Frame = -3

Query  944  KENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWID  765
            + +YK + VEFD  K+ ++GD N NHVG++L ++VS KV NVS + + L  G   ++WI 
Sbjct  164  ENDYKAVAVEFDTRKNPEFGDPNDNHVGINLGTIVSTKVINVSDVGVSLKDGFVHRAWIT  223

Query  764  YEASSKRLEVRLSKWG-EIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVY  588
            Y+   +R+++RL +   E  P  P+ S  +DLS    E  +FVG S S   N +   N+ 
Sbjct  224  YDGPQRRMDIRLGRANEEDYPSIPIFSESMDLSPYLNE-YMFVGFSAS-TGNHTQIHNIL  281

Query  587  SWSF  576
            SW+F
Sbjct  282  SWNF  285



>ref|XP_006355698.1| PREDICTED: L-type lectin-domain containing receptor kinase S.4-like 
[Solanum tuberosum]
Length=690

 Score = 87.8 bits (216),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 69/223 (31%), Positives = 112/223 (50%), Gaps = 26/223 (12%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVS--------VKVGNVSSINLELN  795
            G   N+ F  VEFD ++D ++GD++ NHVG+D++ L S           G+ S   L L 
Sbjct  133  GNFSNHVF-AVEFDTVQDFEFGDISDNHVGIDVNDLKSNASVNASYFSEGSFSKQKLFLQ  191

Query  794  SGEKLQSWIDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSR-L  618
            SG+ +Q+WIDY++S   L V LS     +P + +LS  +DLS ++ E+ ++VG S S  L
Sbjct  192  SGKTIQAWIDYDSSRNVLNVTLS-LSSTKPAFSILSFPLDLSLVF-EEFMYVGFSASTGL  249

Query  617  WNQSHKCNVYSWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIF  438
               SH   ++ WSFK+        +Q LD  +         ++PK   +  + I+   I 
Sbjct  250  LASSHY--IFGWSFKMNG-----KAQSLDLDSLP-------ALPKPKKDQTVLIVATTIS  295

Query  437  GTGCGALGTLMVLFVWSVLRNRRPIVPEELTPEPKEYEYKKFQ  309
                   G ++ L+V   ++N   I P EL   P  + YK+ +
Sbjct  296  AVVFLVFGLVLALYVIWKIKNIDVIEPWELEIGPHRFSYKELK  338



>gb|AAF21775.1|AF068135_1 receptor-like protein kinase [Glycine max]
Length=276

 Score = 85.1 bits (209),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 77/133 (58%), Gaps = 12/133 (9%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSI------NLELNSG  789
            G   N+ F  VEFD ++D ++GD+N NHVG++L+++ S K    +        NL L SG
Sbjct  93   GNFSNHLF-AVEFDTVQDFEFGDINDNHVGINLNNMASNKSVEAAFFSRNNKQNLNLKSG  151

Query  788  EKLQSWIDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSR-LWN  612
            E  Q+W+DY+     LEVRLS     +P  P+LS  VDLS +  +D ++VG S+S  L  
Sbjct  152  EVTQAWVDYDXLKNNLEVRLSTTSS-KPTSPILSYKVDLSPIL-QDSMYVGFSSSTGLLA  209

Query  611  QSHKCNVYSWSFK  573
             SH   +  WSFK
Sbjct  210  SSHY--ILGWSFK  220



>ref|XP_011002638.1| PREDICTED: L-type lectin-domain containing receptor kinase S.4-like 
isoform X2 [Populus euphratica]
Length=652

 Score = 87.8 bits (216),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 84/137 (61%), Gaps = 13/137 (9%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVK-------VGNVSSINLELNS  792
            G   N+ F  VEFD +KD    D+N NHVG+D++S++S K       + N ++ +L L S
Sbjct  95   GNFSNHLF-AVEFDTVKDYDLHDINDNHVGIDINSMISNKSVPAASFLVNSTTKDLNLCS  153

Query  791  GEKLQSWIDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSR-LW  615
            G  +Q+W+DY++    +EVRLS + + RP  P+LSC +DLS ++K D ++VG S+S  L 
Sbjct  154  GRPIQAWVDYDSIKNLVEVRLSSFSK-RPVSPILSCKLDLSPIFK-DYMYVGFSSSTGLL  211

Query  614  NQSHKCNVYSWSFKLRA  564
              +H   +  WSF ++ 
Sbjct  212  TSTHY--ILGWSFSMKG  226



>ref|XP_003530219.1| PREDICTED: L-type lectin-domain containing receptor kinase S.4-like 
[Glycine max]
Length=673

 Score = 87.8 bits (216),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 84/145 (58%), Gaps = 8/145 (6%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSW  771
            G   N+ F  VEFD ++D ++GD+N NHVG+D++S+ S    NVS + L L SG+ + +W
Sbjct  131  GNFSNHIF-AVEFDTVQDFEFGDINDNHVGIDINSMQSNTSANVSLVGLTLKSGKPILAW  189

Query  770  IDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSR-LWNQSHKCN  594
            +DY++    + V LS     +P  PLL+  VDLS ++  D ++VG S S  L   SH   
Sbjct  190  VDYDSRLNLISVALSP-NSSKPKTPLLTFNVDLSPVF-HDTMYVGFSASTGLLASSHY--  245

Query  593  VYSWSFKLR--AAPDWMHSQPLDPK  525
            +  WSFK+   A P  + S P  PK
Sbjct  246  ILGWSFKINGPAPPLDLSSLPQLPK  270



>gb|KHN40279.1| L-type lectin-domain containing receptor kinase S.4 [Glycine 
soja]
Length=674

 Score = 87.8 bits (216),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 84/145 (58%), Gaps = 8/145 (6%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSW  771
            G   N+ F  VEFD ++D ++GD+N NHVG+D++S+ S    NVS + L L SG+ + +W
Sbjct  131  GNFSNHIF-AVEFDTVQDFEFGDINDNHVGIDINSMQSNTSANVSLVGLTLKSGKPILAW  189

Query  770  IDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSR-LWNQSHKCN  594
            +DY++    + V LS     +P  PLL+  VDLS ++  D ++VG S S  L   SH   
Sbjct  190  VDYDSRLNLISVALSP-NSSKPKTPLLTFNVDLSPVF-HDTMYVGFSASTGLLASSHY--  245

Query  593  VYSWSFKLR--AAPDWMHSQPLDPK  525
            +  WSFK+   A P  + S P  PK
Sbjct  246  ILGWSFKINGPAPPLDLSSLPQLPK  270



>ref|XP_007208330.1| hypothetical protein PRUPE_ppa002400mg [Prunus persica]
 gb|EMJ09529.1| hypothetical protein PRUPE_ppa002400mg [Prunus persica]
Length=677

 Score = 87.8 bits (216),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 67/215 (31%), Positives = 103/215 (48%), Gaps = 12/215 (6%)
 Frame = -3

Query  932  KFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEAS  753
            KF+ +EFD   D  + D N NHVG+D+ SL S+K  +    ++E  SG  + +WIDY+  
Sbjct  141  KFVAIEFDTRLDLHFNDPNDNHVGLDIESLTSIKTADPILQDVEFKSGNSITAWIDYKND  200

Query  752  SKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWSFK  573
             +RL+V LS  G  +PG P LS  +DLS+  KE  ++VG S S   +      + +WSF 
Sbjct  201  QERLKVYLSYSG-FKPGKPALSVDIDLSEYLKE-AMYVGFSASTEGSTEVHL-IENWSFH  257

Query  572  LRA-APDWMHSQPLDPKAFRVGKPEQLSVPKRSDE------CGLKILGALIFGTGCGALG  414
                 P     QP +     V    ++ V   +++       GL I G   F       G
Sbjct  258  TFGFVPTRPRLQPHNVSDTYVVVSPRIPVSDSTNKHHKRLGLGLGIAGPAFFCVALAVFG  317

Query  413  TLMVLFVWSVLRNRRPIVPEELTPEPKEYEYKKFQ  309
             + V   W  +R R+     E+   P+E+ YK+ +
Sbjct  318  YVSVS-KWMNMR-RQKSFKAEVIAGPREFGYKELK  350



>ref|XP_002275244.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.1 
[Vitis vinifera]
Length=709

 Score = 87.8 bits (216),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 71/102 (70%), Gaps = 2/102 (2%)
 Frame = -3

Query  929  FLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEASS  750
            F+ VEFD L D ++ D+NGNHVG+DL+S+VS +VG++ +I ++L SG+ +  W++Y+ S+
Sbjct  142  FVAVEFDTLMDVEFKDINGNHVGLDLNSMVSSQVGDLGAIGIDLKSGDLVNVWVEYDGST  201

Query  749  KRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTS  624
            +   + +S +  ++P  PLLS  +DL Q +  D +FVG S S
Sbjct  202  QLFNISVS-YSNLKPKEPLLSFDLDLDQ-YVNDFMFVGFSGS  241



>ref|XP_010678077.1| PREDICTED: L-type lectin-domain containing receptor kinase S.4-like 
[Beta vulgaris subsp. vulgaris]
Length=717

 Score = 87.8 bits (216),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/142 (35%), Positives = 84/142 (59%), Gaps = 12/142 (8%)
 Frame = -3

Query  926  LGVEFDILKDDKYGDVNGNHVGVDLSSLVS-------VKVGNVSSINLELNSGEKLQSWI  768
              VEFD +KD +YGD++ NH+G+DL+SLVS         + N + +N+ + +G  +Q+W+
Sbjct  173  FAVEFDTVKDFEYGDIDDNHIGIDLNSLVSNFSVPATYILENSTKVNVTMKAGYTIQAWV  232

Query  767  DYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSR-LWNQSHKCNV  591
            DY+A +  + V +S +G  +P  PL+S   DLSQ+++E+ ++VG + S  L   SH   V
Sbjct  233  DYDAENHLINVTISPFGT-KPRIPLISYKYDLSQLFEEN-MYVGFAASTGLLASSHY--V  288

Query  590  YSWSFKLRAAPDWMHSQPLDPK  525
              WSF +    + +    L P+
Sbjct  289  LGWSFNMSGPAESLPMLSLPPR  310



>ref|NP_001147947.1| lectin-like receptor kinase 7 precursor [Zea mays]
 gb|ACG29206.1| lectin-like receptor kinase 7 [Zea mays]
 tpg|DAA47151.1| TPA: putative lectin-like receptor protein kinase family protein 
[Zea mays]
Length=690

 Score = 87.8 bits (216),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 73/222 (33%), Positives = 110/222 (50%), Gaps = 31/222 (14%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSW  771
            G   N+ F  +EFD ++D ++ DVNGNHVGVDL+SL+S        +NL+  SG+   +W
Sbjct  140  GNATNHLF-AIEFDTVQDFEFDDVNGNHVGVDLNSLISNASAKADPLNLK--SGDT-TAW  195

Query  770  IDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSR-LWNQSHKCN  594
            +DY+ +++ L V ++     +P  PL+S  VDLS +++E +++VG S S  +   SH   
Sbjct  196  VDYDGAARLLNVSIANGTLGKPTTPLISFRVDLSGIFRE-QMYVGFSASTGVLASSHYLR  254

Query  593  VYSWSFKL--RAAPDW-MHSQPLDPKAFRVGKPEQLSVPKRSDECGLKI----LGALIFG  435
               WSF+L   AAP   + S P  P         QL   K      L +      AL+  
Sbjct  255  --GWSFRLGAGAAPALDLSSLPSLP---------QLKSSKNRTSLILAVAFSAFVALVVL  303

Query  434  TGCGALGTLMVLFVWSVLRNRRPIVPEELTPEPKEYEYKKFQ  309
             G GA G           +NR  I P EL   P  ++Y + +
Sbjct  304  AGAGAYGAYR-------YKNRDIIEPWELDYGPHRFKYAELR  338



>ref|XP_007220215.1| hypothetical protein PRUPE_ppa002277mg [Prunus persica]
 gb|EMJ21414.1| hypothetical protein PRUPE_ppa002277mg [Prunus persica]
Length=692

 Score = 87.4 bits (215),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 71/223 (32%), Positives = 115/223 (52%), Gaps = 26/223 (12%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVK---VGNVSSIN-----LELN  795
            G   N+ F  VEFD ++D ++GD+N NHVG+D++SL S K    G  +S N     L L 
Sbjct  134  GNFSNHIF-AVEFDTVQDFEFGDINDNHVGIDINSLASNKSTPAGYFTSQNSTKQSLNLK  192

Query  794  SGEKLQSWIDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSR-L  618
            SG  +Q+W+DY++   ++ V+LS    I+P  P+L+  VDLS ++ +D ++VG S S  L
Sbjct  193  SGHVIQAWVDYDSVKNQVTVKLSP-NSIKPTSPILTFDVDLSPIF-QDFMYVGFSASTGL  250

Query  617  WNQSHKCNVYSWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIF  438
               SH   V  WSFK+            D K+  +    +L  PK++   G+ I+G  + 
Sbjct  251  LASSHY--VSGWSFKMNG----------DAKSLSLDALPKLPGPKKT-HTGV-IVGVSVS  296

Query  437  GTGCGALGTLMVLFVWSVLRNRRPIVPEELTPEPKEYEYKKFQ  309
                  LG  +  ++   ++N   I   EL   P  + Y++ +
Sbjct  297  ALLVLILGIGLAFYIIHRIKNAEVIEAWELDIGPHRFTYQELK  339



>ref|XP_007020488.1| Concanavalin A-like lectin protein kinase family protein [Theobroma 
cacao]
 gb|EOY12013.1| Concanavalin A-like lectin protein kinase family protein [Theobroma 
cacao]
Length=661

 Score = 87.4 bits (215),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 66/218 (30%), Positives = 103/218 (47%), Gaps = 12/218 (6%)
 Frame = -3

Query  932  KFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEAS  753
            KFL +EFD   D ++ D N NHVG+D++ L S+K  +    +++L SG  + +WIDY+  
Sbjct  136  KFLAIEFDTKLDAQFNDPNQNHVGLDINKLNSIKTADAMLQDIDLKSGNLITAWIDYKND  195

Query  752  SKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWSFK  573
             + L V LS +  ++P  PLLS  +DLS   KED +FVG S S     +   ++ +W FK
Sbjct  196  LRALNVFLS-YSTLKPLTPLLSVDIDLSGYLKED-MFVGFSAST-EGSTEVHSIVNWKFK  252

Query  572  LRA-APDWMHSQPLDPKAFRVGKPEQLSVPKRSDE------CGLKILGALIFGTGCGALG  414
                 P    S P +     V     + V   +++       GL I G   F       G
Sbjct  253  TFGFLPVRPRSHPHNVSDSSVTIISDVPVSNSTNKHHKRLGLGLGIAGPAFFFVVLAVFG  312

Query  413  TLMVLFVWSVLRNRRPIVPEELTPEPKEYEYKKFQVVV  300
             + V   W  +R  +  +  E+   P+E+ YK+     
Sbjct  313  YVSVK-KWKDMRTEK-CLKAEILAGPREFSYKEVHAAT  348



>gb|EYU41620.1| hypothetical protein MIMGU_mgv1a002074mg [Erythranthe guttata]
Length=719

 Score = 87.4 bits (215),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 77/126 (61%), Gaps = 2/126 (2%)
 Frame = -3

Query  926  LGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEASSK  747
            + VEFD L D ++ D+NGNH G+DL S+VS +V ++ ++ ++L SG+ + SWIDY  S++
Sbjct  138  VAVEFDTLMDVEFSDINGNHAGLDLGSMVSTRVCDLDTVGVDLKSGDLVNSWIDYSGSTR  197

Query  746  RLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLS-TSRLWNQSHKCNVYSWSFKL  570
             ++V +S +  ++P  P++S  +DL      D +FVG S +++   + H    +S+S   
Sbjct  198  FIKVYVS-YSNLKPKEPIISAALDLHDYLTNDFMFVGFSGSTQGSTEIHSIEWWSFSSSF  256

Query  569  RAAPDW  552
               P +
Sbjct  257  EEFPSY  262



>ref|XP_004308846.1| PREDICTED: L-type lectin-domain containing receptor kinase S.4 
[Fragaria vesca subsp. vesca]
Length=696

 Score = 87.4 bits (215),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 72/225 (32%), Positives = 114/225 (51%), Gaps = 29/225 (13%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSL---VSVKVG-----NVSSINLELN  795
            G   N+ F  VEFD ++D ++GD+N NHVG+D++SL    S   G     N +   L L 
Sbjct  132  GNFSNHIF-AVEFDTVQDFEFGDINDNHVGIDINSLASNASTAAGYYDGRNTTKKELNLK  190

Query  794  SGEKLQSWIDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSR-L  618
            SG+ +Q+W+ Y+A  K++ V+LS    ++P   +L+  VDLS ++ +D ++VG S+S  L
Sbjct  191  SGDVIQAWVSYDADKKQVTVKLSP-TSVQPSTSILTFDVDLSPIF-QDYMYVGFSSSTGL  248

Query  617  WNQSHKCNVYSWSFKLR--AAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGAL  444
               SH   +  WSFK+   A   ++ + P  PKA +                G+ +  AL
Sbjct  249  LASSHY--ILGWSFKMNGDAKSLYLETLPKFPKAKKT---------HTGVVVGVSVGAAL  297

Query  443  IFGTGCGALGTLMVLFVWSVLRNRRPIVPEELTPEPKEYEYKKFQ  309
            +F   C  LG     +V    +NR  I   EL   P  + YK+ +
Sbjct  298  MFVFICVVLG----FYVVRKYKNREVIEAWELDIGPHRFPYKELK  338



>ref|XP_010068014.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Eucalyptus grandis]
 gb|KCW62694.1| hypothetical protein EUGRSUZ_G00255 [Eucalyptus grandis]
Length=663

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/161 (36%), Positives = 85/161 (53%), Gaps = 11/161 (7%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSI-------NLELNS  792
            G   N+ F GVEFD  +  ++ D+N NHVG+DL+ L S    +           NL L S
Sbjct  127  GNASNHVF-GVEFDTTQSSEFNDINDNHVGIDLNGLTSANSTSAGYYADGGEFKNLTLIS  185

Query  791  GEKLQSWIDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWN  612
            GE++Q W+DY  + KR++V L+     +P  PLLS   DL+ +  E+ ++VG S+S    
Sbjct  186  GEEMQVWVDYNGTEKRIDVTLAPIKVQKPNTPLLSLTWDLASVINEN-MYVGFSSSTGSA  244

Query  611  QSHKCNVYSWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSV  489
            Q+    V  WSF + A P  +    L PK  +VGK +   V
Sbjct  245  QTSNY-VLGWSFGVNAKPQELALSQL-PKLPQVGKKDMSKV  283



>ref|XP_006435643.1| hypothetical protein CICLE_v10030854mg [Citrus clementina]
 gb|ESR48883.1| hypothetical protein CICLE_v10030854mg [Citrus clementina]
Length=698

 Score = 87.4 bits (215),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 81/135 (60%), Gaps = 13/135 (10%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVK-------VGNVSSINLELNS  792
            G   N+ F  VEFD +KD ++GD+N NHVG+D++SL S         + N +   L L S
Sbjct  135  GNLTNHIF-AVEFDTVKDFEFGDINDNHVGIDINSLRSNASEPAAYFLENSTKQVLNLKS  193

Query  791  GEKLQSWIDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSR-LW  615
            GE +Q+WIDY++S   LEVRL+    ++P  P+LS  VDLS + KE  ++VG S+S  L 
Sbjct  194  GEVIQAWIDYDSSKNHLEVRLAP-SSVKPRSPILSFDVDLSPIVKE-TMYVGFSSSTGLL  251

Query  614  NQSHKCNVYSWSFKL  570
              SH   +  WSF +
Sbjct  252  ASSHY--ILGWSFNM  264



>gb|KDO69144.1| hypothetical protein CISIN_1g005621mg [Citrus sinensis]
Length=687

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 81/135 (60%), Gaps = 13/135 (10%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVK-------VGNVSSINLELNS  792
            G   N+ F  VEFD +KD ++GD+N NHVG+D++SL S         + N +   L L S
Sbjct  135  GNLTNHIF-AVEFDTVKDFEFGDINDNHVGIDINSLRSNASEPAAYFLENSTKQVLNLKS  193

Query  791  GEKLQSWIDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSR-LW  615
            GE +Q+WIDY++S   LEVRL+    ++P  P+LS  VDLS + KE  ++VG S+S  L 
Sbjct  194  GEVIQAWIDYDSSKNHLEVRLAP-SSVKPRSPILSFDVDLSPIVKE-TMYVGFSSSTGLL  251

Query  614  NQSHKCNVYSWSFKL  570
              SH   +  WSF +
Sbjct  252  ASSHY--ILGWSFNM  264



>ref|XP_008368692.1| PREDICTED: L-type lectin-domain containing receptor kinase S.4-like 
[Malus domestica]
Length=664

 Score = 87.0 bits (214),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 71/226 (31%), Positives = 110/226 (49%), Gaps = 31/226 (14%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKV--------GNVSSINLELN  795
            G   N+ F  VEFD +++ ++GD+N NHVG+D++SL S K         GN +  +L L 
Sbjct  136  GNFSNHIF-AVEFDTVQNFEFGDINDNHVGIDINSLASNKSTPAGFFTGGNSTKEDLNLK  194

Query  794  SGEKLQSWIDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSR-L  618
            SG  +Q+W+DY++   ++ V LS    I+P  P+L+  VDLS +  ED ++VG S S  L
Sbjct  195  SGLPIQAWVDYDSVKNQVTVMLSP-DSIKPRSPILTFDVDLSPIL-EDFMYVGFSASTGL  252

Query  617  WNQSHKCNVYSWSFKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKI---LGA  447
               SH   V  WSFK+            + K+  +    +L  PK      L I   +  
Sbjct  253  LASSHY--VSGWSFKMNG----------EAKSLNLEASPKLPGPKEKQSSALIIGVSVSV  300

Query  446  LIFGTGCGALGTLMVLFVWSVLRNRRPIVPEELTPEPKEYEYKKFQ  309
            L+F      LG     ++   ++N   I P EL   P  + Y + +
Sbjct  301  LVFFILAVGLG----FYIVHRIKNAEVIEPWELDIGPHIFRYSELK  342



>gb|EEE67461.1| hypothetical protein OsJ_24851 [Oryza sativa Japonica Group]
Length=685

 Score = 87.0 bits (214),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 73/204 (36%), Positives = 107/204 (52%), Gaps = 29/204 (14%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKV--------GNVSSINLELN  795
            G+  N+ F  VE DI+ + ++GD++ NHVGVD++SL S++         G+ +  +L+LN
Sbjct  142  GKPSNHVF-AVELDIITNPEFGDIDSNHVGVDVNSLRSLQAKTAGYYVDGDGAFRSLQLN  200

Query  794  SGEKLQSWIDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLW  615
            S + +Q W+DY+  +K+L V LS     +P  PLLS  +DLS +  E E++VG S++   
Sbjct  201  SQKPMQVWVDYDGQAKQLNVTLSPVQVPKPKKPLLSQAIDLSTVMAE-EMYVGFSSATGV  259

Query  614  NQSHKCNVYSWSFKLR--AAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALI  441
              +H   V  WSF     AAP    S  + PK  RVG P + SV        L I  AL+
Sbjct  260  VFTHHY-VLGWSFSFDGGAAPSLDFS--MLPKVPRVG-PTRRSVMLY---VVLPIASALL  312

Query  440  FGTGCGALGTLMVLFVWSVLRNRR  369
            F          +V FV  V   RR
Sbjct  313  F----------LVAFVLGVFFVRR  326



>ref|XP_006486395.1| PREDICTED: L-type lectin-domain containing receptor kinase S.4-like 
isoform X1 [Citrus sinensis]
Length=698

 Score = 87.0 bits (214),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 81/135 (60%), Gaps = 13/135 (10%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVK-------VGNVSSINLELNS  792
            G   N+ F  VEFD +KD ++GD+N NHVG+D++SL S         + N +   L L S
Sbjct  135  GNLTNHIF-AVEFDTVKDFEFGDINDNHVGIDINSLRSNASEPAAYFLENSTKQVLNLKS  193

Query  791  GEKLQSWIDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSR-LW  615
            GE +Q+WIDY++S   LEVRL+    ++P  P+LS  VDLS + KE  ++VG S+S  L 
Sbjct  194  GEVIQAWIDYDSSKNHLEVRLAP-SSVKPRSPILSFDVDLSPIVKE-TMYVGFSSSTGLL  251

Query  614  NQSHKCNVYSWSFKL  570
              SH   +  WSF +
Sbjct  252  ASSHY--ILGWSFNM  264



>ref|XP_006289498.1| hypothetical protein CARUB_v10003045mg [Capsella rubella]
 gb|EOA22396.1| hypothetical protein CARUB_v10003045mg [Capsella rubella]
Length=710

 Score = 87.0 bits (214),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 68/102 (67%), Gaps = 2/102 (2%)
 Frame = -3

Query  929  FLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEASS  750
            F+ VEFD L D ++ DVNGNHVG+DL+++VS  V ++ + +++L SG  + SWI Y+ S 
Sbjct  145  FVAVEFDTLMDVQFKDVNGNHVGLDLNAVVSAAVADLGNFDIDLKSGNAVNSWITYDGSG  204

Query  749  KRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTS  624
            + L V +S +  ++P  P+LS  +DL  ++  D +FVG S S
Sbjct  205  RVLTVYVS-YSNVKPKSPILSVPLDL-DLYVSDSMFVGFSGS  244



>dbj|BAC06927.1| putative receptor-type protein kinase LRK1 [Oryza sativa Japonica 
Group]
Length=692

 Score = 87.0 bits (214),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 73/204 (36%), Positives = 107/204 (52%), Gaps = 29/204 (14%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKV--------GNVSSINLELN  795
            G+  N+ F  VE DI+ + ++GD++ NHVGVD++SL S++         G+ +  +L+LN
Sbjct  149  GKPSNHVF-AVELDIITNPEFGDIDSNHVGVDVNSLRSLQAKTAGYYVDGDGAFRSLQLN  207

Query  794  SGEKLQSWIDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLW  615
            S + +Q W+DY+  +K+L V LS     +P  PLLS  +DLS +  E E++VG S++   
Sbjct  208  SQKPMQVWVDYDGQAKQLNVTLSPVQVPKPKKPLLSQAIDLSTVMAE-EMYVGFSSATGV  266

Query  614  NQSHKCNVYSWSFKLR--AAPDWMHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALI  441
              +H   V  WSF     AAP    S  + PK  RVG P + SV        L I  AL+
Sbjct  267  VFTHHY-VLGWSFSFDGGAAPSLDFS--MLPKVPRVG-PTRRSVMLY---VVLPIASALL  319

Query  440  FGTGCGALGTLMVLFVWSVLRNRR  369
            F          +V FV  V   RR
Sbjct  320  F----------LVAFVLGVFFVRR  333



>ref|NP_195934.1| concanavalin A-like lectin kinase-like protein [Arabidopsis thaliana]
 sp|Q9LYX1.1|LRK82_ARATH RecName: Full=L-type lectin-domain containing receptor kinase 
VIII.2; Short=LecRK-VIII.2; Flags: Precursor [Arabidopsis thaliana]
 emb|CAB86081.1| receptor like protein kinase [Arabidopsis thaliana]
 dbj|BAB08374.1| receptor lectin kinase-like protein [Arabidopsis thaliana]
 gb|AAM13211.1| receptor like protein kinase [Arabidopsis thaliana]
 gb|AAP68230.1| At5g03140 [Arabidopsis thaliana]
 dbj|BAE99121.1| receptor like protein kinase [Arabidopsis thaliana]
 gb|AED90560.1| concanavalin A-like lectin kinase-like protein [Arabidopsis thaliana]
Length=711

 Score = 87.0 bits (214),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 69/102 (68%), Gaps = 2/102 (2%)
 Frame = -3

Query  929  FLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEASS  750
            F+ VEFD L D ++ DVNGNHVG+DL+++VS  V ++ +++++L SG  + SWI Y+ S 
Sbjct  145  FVAVEFDTLMDVQFKDVNGNHVGLDLNAVVSAAVADLGNVDIDLKSGNAVNSWITYDGSG  204

Query  749  KRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTS  624
            + L V +S +  ++P  P+LS  +DL + +  D +FVG S S
Sbjct  205  RVLTVYVS-YSNLKPKSPILSVPLDLDR-YVSDSMFVGFSGS  244



>ref|XP_004491661.1| PREDICTED: probable L-type lectin-domain containing receptor 
kinase S.7-like [Cicer arietinum]
Length=677

 Score = 87.0 bits (214),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 62/220 (28%), Positives = 106/220 (48%), Gaps = 15/220 (7%)
 Frame = -3

Query  932  KFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEAS  753
             F+ VEFD   D ++ D N NHVG D+ +L S++  +  S  ++L SG  + SWIDY+  
Sbjct  133  NFVAVEFDTRLDPRFNDPNENHVGFDIDTLNSLRTVDPISNGIDLKSGNSITSWIDYKTD  192

Query  752  SKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDE-VFVGLSTSRLWNQSHKCNVYSWS-  579
               L V LS +  I+P  PLLS  VDLS+ ++++E  +VG S S     +   ++ SWS 
Sbjct  193  HNLLSVFLS-YSHIKPIDPLLSVTVDLSEYFRDNEFAYVGFSASA-EKSTELHHIESWSF  250

Query  578  --FKLRAAPDWMHSQPLDPKAFRVGKPEQLSVPK--------RSDECGLKILGALIFGTG  429
              F  + A   +HS  +   +  V    +++V +        +    G  + G + F   
Sbjct  251  YTFGFQPARPRLHSHNVSDNSVSVTTGNEMNVRRPHSFLKKNKRFGVGFAVAGPVFFCVV  310

Query  428  CGALGTLMVLFVWSVLRNRRPIVPEELTPEPKEYEYKKFQ  309
               LG   +L  W  +R  +          P++++Y++ +
Sbjct  311  FSLLGYYSIL-KWKGMRKGQKNFETGFVACPRQFDYRELK  349



>ref|XP_002463621.1| hypothetical protein SORBIDRAFT_01g003030 [Sorghum bicolor]
 gb|EER90619.1| hypothetical protein SORBIDRAFT_01g003030 [Sorghum bicolor]
Length=698

 Score = 87.0 bits (214),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/138 (37%), Positives = 82/138 (59%), Gaps = 17/138 (12%)
 Frame = -3

Query  926  LGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKV-----------GNVSSINLELNSGEKL  780
            + VE D  +D+++ D+N NHVG+D++SLVSV             G++ ++++ L SGE L
Sbjct  151  VAVELDTARDEEFNDINDNHVGIDVNSLVSVGSAPAAYVDVGVGGSLVNVSVNLVSGEPL  210

Query  779  QSWIDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSR-LWNQSH  603
            Q+W++Y+ +S RLEV ++   + RP  PL+S  V+LS     D+ +VG + +    + SH
Sbjct  211  QAWVEYDGASMRLEVTVAPARKPRPSVPLVSSIVNLSSAVA-DDTYVGFTAANGAASSSH  269

Query  602  KCNVYSWSFKLRA--APD  555
               V  WSF+L    APD
Sbjct  270  Y--VLGWSFRLGGGRAPD  285



>ref|XP_002443408.1| hypothetical protein SORBIDRAFT_08g019050 [Sorghum bicolor]
 gb|EES17246.1| hypothetical protein SORBIDRAFT_08g019050 [Sorghum bicolor]
Length=693

 Score = 87.0 bits (214),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 70/218 (32%), Positives = 107/218 (49%), Gaps = 23/218 (11%)
 Frame = -3

Query  950  GEKENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSW  771
            G   N+ F  VEFD ++D ++ DVNGNHVGV+L+SL+S        +NL+        +W
Sbjct  142  GNATNHLF-AVEFDTVQDFEFDDVNGNHVGVNLNSLISNASAKADPLNLKAG---DTTAW  197

Query  770  IDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSR-LWNQSHKCN  594
            IDY+ ++  L V ++     +P  PL+S  VDLS +++E +++VG S S  +   SH   
Sbjct  198  IDYDGAAGLLNVSIANGTAGKPAAPLISFRVDLSGVFRE-QMYVGFSASTGVLASSHY--  254

Query  593  VYSWSFKL--RAAPDW-MHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALIFGTGCG  423
            V  WSF+L   AAP   + S P  P+  + G+     +             AL+   G G
Sbjct  255  VRGWSFRLGGGAAPALDLASLPSLPR-IKSGRNRTSLILA----VAFSAFVALVVLAGAG  309

Query  422  ALGTLMVLFVWSVLRNRRPIVPEELTPEPKEYEYKKFQ  309
            A G           +NR  I P EL   P  ++Y + +
Sbjct  310  AYGAYR-------YKNRDIIEPWELDYGPHRFKYAELR  340



>ref|XP_010251103.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.2-like 
[Nelumbo nucifera]
Length=671

 Score = 87.0 bits (214),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/143 (36%), Positives = 79/143 (55%), Gaps = 4/143 (3%)
 Frame = -3

Query  941  ENYKFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDY  762
            ++YK   VEFD  ++ ++GD N NHVG++L S++S    N S + + L  G   ++WI Y
Sbjct  172  DDYKAFAVEFDTRRNLEFGDPNDNHVGINLGSILSSTTINASDVGIYLRDGSVHRAWITY  231

Query  761  EASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSW  582
            +   K +++RL   G+  P  P+ S  +DLS   KE  +FVG S S   N +   NV SW
Sbjct  232  DGERKWIDIRLGPDGQAYPSTPIFSAPLDLSPFLKE-YMFVGFSAS-TGNLTQIHNVLSW  289

Query  581  SFK--LRAAPDWMHSQPLDPKAF  519
            +F    RAA  +  ++  + K F
Sbjct  290  NFSSTSRAALRFPSTETCETKIF  312



>ref|XP_004490792.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.1-like 
isoform X1 [Cicer arietinum]
 ref|XP_004490793.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.1-like 
isoform X2 [Cicer arietinum]
Length=704

 Score = 87.0 bits (214),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 69/102 (68%), Gaps = 2/102 (2%)
 Frame = -3

Query  929  FLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEASS  750
            F  VEFD L D ++ D+NGNHVGVDL+S+VS KVG++ SI ++L SG+ +  WI+++ SS
Sbjct  134  FFAVEFDTLMDVEFKDINGNHVGVDLNSVVSNKVGDLDSIGIDLKSGDTVNVWIEFDGSS  193

Query  749  KRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTS  624
                V +S +  ++P  P+LS  +D+ Q +  D ++VG S S
Sbjct  194  NGFNVWVS-YSNLKPKDPILSMNLDMGQ-YLNDFMYVGFSGS  233



>ref|XP_003552886.2| PREDICTED: L-type lectin-domain containing receptor kinase VIII.1-like 
[Glycine max]
Length=685

 Score = 87.0 bits (214),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 76/120 (63%), Gaps = 3/120 (3%)
 Frame = -3

Query  932  KFLGVEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEAS  753
             FL VEFD L D ++ D+NGNHVG+DL+S+VS +V ++  I ++L SG+ + +WI+Y+ +
Sbjct  141  NFLAVEFDTLMDVEFSDINGNHVGLDLNSVVSTQVSDLGGIGVDLKSGDSVNAWIEYDGN  200

Query  752  SKRLEVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTSRLWNQSHKCNVYSWSFK  573
            +K L V +S +  +RP  P+L   +D+  M+  D ++VG S S     +   +V  WSF 
Sbjct  201  AKGLRVWVS-YSNVRPKDPILKVDLDVG-MYVNDFMYVGFSGST-QGSTEVHSVEWWSFN  257



>gb|EMT31278.1| hypothetical protein F775_03923 [Aegilops tauschii]
Length=323

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 84/168 (50%), Gaps = 12/168 (7%)
 Frame = -3

Query  788  EKLQSWIDYEASSKRLEVRLSKWGEIRPGYPLLSCFVDLSQMW---KEDEVFVGLSTSRL  618
            +KL SWIDY A+S  L+VRLS     +P   LLS  + L       +   +  G ++S  
Sbjct  147  KKLHSWIDYNATSATLQVRLSASRLPKPPRALLSHPLHLHSALLLLRSKPMLAGFASSHA  206

Query  617  WNQSHKCNVYSWSFKLRAAPDW-MHSQPLDPKAFRVGKPEQLSVPKRSDECGLKILGALI  441
                  C+++SW+F+    P + MHSQPL+P    +  P    +P R+         +L+
Sbjct  207  -----NCSLFSWAFRANHGPPYLMHSQPLNPTGLSLTTPPPDRLP-RAPPGNRHPWVSLL  260

Query  440  FGTGCGALGTLMVLFVWSVLRNRRPIVPEE--LTPEPKEYEYKKFQVV  303
                CGA+ T ++LFVW  +  RRP+ P E  + P   +  Y+K  +V
Sbjct  261  LAAACGAVFTFVLLFVWYSMGKRRPVAPVEYPMHPSSDDIIYEKIVLV  308



>dbj|BAG68210.1| lectin receptor kinase-like protein [Nicotiana benthamiana]
Length=717

 Score = 86.7 bits (213),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 70/99 (71%), Gaps = 2/99 (2%)
 Frame = -3

Query  920  VEFDILKDDKYGDVNGNHVGVDLSSLVSVKVGNVSSINLELNSGEKLQSWIDYEASSKRL  741
            VEFD L D ++ D+NGNHVG+DL+S+VS +VG++ SI ++L SG+ + SWI+Y  S+ +L
Sbjct  145  VEFDTLMDVEFKDINGNHVGLDLNSMVSTQVGDLDSIGVDLKSGDIVNSWIEYSGSTGQL  204

Query  740  EVRLSKWGEIRPGYPLLSCFVDLSQMWKEDEVFVGLSTS  624
             V +S +  ++P  P LS  +++++ +  D +FVG S S
Sbjct  205  NVFVS-YSNLKPKEPFLSVVLNIAE-YVNDFMFVGFSGS  241



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2295928061616