BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig3961

Length=1239
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009789452.1|  PREDICTED: beta-galactosidase 3                    375   7e-118   Nicotiana sylvestris
ref|XP_009628690.1|  PREDICTED: beta-galactosidase 3                    369   1e-115   Nicotiana tomentosiformis
gb|EYU24087.1|  hypothetical protein MIMGU_mgv1a001258mg                366   2e-114   Erythranthe guttata [common monkey flower]
ref|XP_011100972.1|  PREDICTED: beta-galactosidase 3-like               365   3e-114   Sesamum indicum [beniseed]
ref|XP_010029731.1|  PREDICTED: beta-galactosidase 3                    362   7e-113   Eucalyptus grandis [rose gum]
emb|CDP01954.1|  unnamed protein product                                362   1e-112   Coffea canephora [robusta coffee]
gb|KJB43419.1|  hypothetical protein B456_007G198900                    360   3e-112   Gossypium raimondii
gb|KJB43424.1|  hypothetical protein B456_007G198900                    360   3e-112   Gossypium raimondii
gb|KJB43422.1|  hypothetical protein B456_007G198900                    360   4e-112   Gossypium raimondii
ref|XP_010275526.1|  PREDICTED: beta-galactosidase 3-like               360   5e-112   Nelumbo nucifera [Indian lotus]
gb|KJB17716.1|  hypothetical protein B456_003G011900                    357   1e-110   Gossypium raimondii
gb|KDP32675.1|  hypothetical protein JCGZ_13673                         355   1e-110   Jatropha curcas
ref|XP_010649088.1|  PREDICTED: beta-galactosidase 3                    356   1e-110   Vitis vinifera
ref|XP_002310279.2|  beta-galactosidase family protein                  356   1e-110   
ref|XP_011025878.1|  PREDICTED: beta-galactosidase 3                    356   2e-110   Populus euphratica
ref|XP_007046794.1|  Beta-galactosidase 3 isoform 1                     355   3e-110   
ref|XP_012078404.1|  PREDICTED: beta-galactosidase 3                    355   3e-110   Jatropha curcas
ref|XP_011083163.1|  PREDICTED: beta-galactosidase 3                    354   9e-110   Sesamum indicum [beniseed]
ref|XP_006340680.1|  PREDICTED: beta-galactosidase 3-like               352   3e-109   Solanum tuberosum [potatoes]
gb|ADO34791.1|  beta-galactosidase STBG6                                352   5e-109   Solanum lycopersicum
ref|NP_001234317.1|  TBG6 protein precursor                             352   6e-109   Solanum lycopersicum
ref|XP_007158611.1|  hypothetical protein PHAVU_002G1672001g            341   9e-109   Phaseolus vulgaris [French bean]
ref|XP_010437357.1|  PREDICTED: beta-galactosidase 3-like               330   9e-108   Camelina sativa [gold-of-pleasure]
dbj|BAD95183.1|  beta-galactosidase like protein                        331   1e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007156097.1|  hypothetical protein PHAVU_003G258300g             348   1e-107   Phaseolus vulgaris [French bean]
ref|XP_010254673.1|  PREDICTED: beta-galactosidase 3-like               348   2e-107   Nelumbo nucifera [Indian lotus]
ref|XP_004287850.1|  PREDICTED: beta-galactosidase 3                    347   4e-107   Fragaria vesca subsp. vesca
ref|XP_008241765.1|  PREDICTED: beta-galactosidase 3                    345   2e-106   Prunus mume [ume]
ref|XP_008337843.1|  PREDICTED: beta-galactosidase 3                    344   5e-106   
ref|XP_004512085.1|  PREDICTED: beta-galactosidase 3-like               343   6e-106   Cicer arietinum [garbanzo]
gb|AAW47739.1|  beta-galactosidase                                      343   1e-105   Prunus persica
ref|XP_003548865.1|  PREDICTED: beta-galactosidase 3-like               343   2e-105   Glycine max [soybeans]
ref|XP_010113483.1|  Beta-galactosidase 3                               343   2e-105   Morus notabilis
gb|KHN27041.1|  Beta-galactosidase 3                                    343   2e-105   Glycine soja [wild soybean]
ref|XP_003612093.1|  Beta-galactosidase                                 333   2e-105   
ref|XP_003517202.1|  PREDICTED: beta-galactosidase 3-like               343   2e-105   
ref|XP_006425593.1|  hypothetical protein CICLE_v10024881mg             342   2e-105   Citrus clementina [clementine]
gb|KDO71052.1|  hypothetical protein CISIN_1g003044mg                   342   3e-105   Citrus sinensis [apfelsine]
gb|AGR44464.1|  beta-D-galactosidase 5                                  338   3e-105   Pyrus x bretschneideri [bai li]
dbj|BAF01862.1|  beta-galactosidase like protein                        334   4e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003520277.1|  PREDICTED: beta-galactosidase 3-like               341   5e-105   Glycine max [soybeans]
ref|XP_008338023.1|  PREDICTED: beta-galactosidase 3-like               341   6e-105   
gb|KHN00504.1|  Beta-galactosidase 3                                    341   7e-105   Glycine soja [wild soybean]
ref|XP_004509327.1|  PREDICTED: beta-galactosidase 3-like               340   2e-104   
gb|KHN36067.1|  Beta-galactosidase 3                                    340   2e-104   Glycine soja [wild soybean]
dbj|BAD91082.1|  beta-D-galactosidase                                   338   1e-103   Pyrus pyrifolia [sha li]
ref|XP_008440778.1|  PREDICTED: beta-galactosidase 3                    337   2e-103   Cucumis melo [Oriental melon]
ref|XP_004149980.1|  PREDICTED: beta-galactosidase 3                    337   3e-103   Cucumis sativus [cucumbers]
ref|XP_010531064.1|  PREDICTED: beta-galactosidase 3                    337   4e-103   Tarenaya hassleriana [spider flower]
ref|XP_003538867.1|  PREDICTED: beta-galactosidase 3-like               336   5e-103   Glycine max [soybeans]
gb|KHN41933.1|  Beta-galactosidase 3                                    336   6e-103   Glycine soja [wild soybean]
gb|KFK30264.1|  hypothetical protein AALP_AA7G238600                    335   8e-103   Arabis alpina [alpine rockcress]
ref|XP_002263382.2|  PREDICTED: beta-galactosidase 3                    335   2e-102   Vitis vinifera
ref|XP_010437358.1|  PREDICTED: beta-galactosidase 3-like               333   6e-102   Camelina sativa [gold-of-pleasure]
ref|XP_010446807.1|  PREDICTED: beta-galactosidase 3                    333   7e-102   Camelina sativa [gold-of-pleasure]
ref|XP_003612092.1|  Beta-galactosidase                                 333   9e-102   Medicago truncatula
ref|NP_568001.1|  beta-galactosidase 3                                  333   1e-101   Arabidopsis thaliana [mouse-ear cress]
emb|CAB16852.1|  beta-galactosidase like protein                        332   1e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002867020.1|  hypothetical protein ARALYDRAFT_491000             332   2e-101   
dbj|BAF31234.1|  beta-D-galactosidase                                   332   2e-101   Persea americana
ref|XP_006283101.1|  hypothetical protein CARUB_v10004117mg             332   2e-101   Capsella rubella
dbj|BAJ34544.1|  unnamed protein product                                329   2e-100   Eutrema halophilum
ref|XP_006412011.1|  hypothetical protein EUTSA_v10024387mg             329   2e-100   Eutrema salsugineum [saltwater cress]
ref|XP_009145073.1|  PREDICTED: beta-galactosidase 3                    328   1e-99    Brassica rapa
emb|CAA18137.1|  beta-galactosidase like protein                        327   1e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010432182.1|  PREDICTED: beta-galactosidase 3-like               327   1e-99    Camelina sativa [gold-of-pleasure]
ref|NP_849506.1|  beta-galactosidase 3                                  327   3e-99    Arabidopsis thaliana [mouse-ear cress]
gb|EPS60900.1|  beta-galactosidase                                      306   3e-99    Genlisea aurea
ref|XP_004985589.1|  PREDICTED: beta-galactosidase 5-like isoform X2    322   2e-98    
emb|CDY59693.1|  BnaC07g51120D                                          322   1e-97    Brassica napus [oilseed rape]
gb|AAG12249.1|AF184080_1  beta-galactosidase                            308   2e-97    Prunus armeniaca
ref|XP_004985588.1|  PREDICTED: beta-galactosidase 5-like isoform X1    321   2e-97    Setaria italica
ref|XP_009396354.1|  PREDICTED: beta-galactosidase 5-like               317   5e-96    Musa acuminata subsp. malaccensis [pisang utan]
gb|AAM22973.1|AF499737_1  beta-galactosidase                            317   7e-96    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001049068.1|  Os03g0165400                                       317   7e-96    
ref|XP_008809207.1|  PREDICTED: beta-galactosidase 5-like               317   1e-95    Phoenix dactylifera
gb|EEE58382.1|  hypothetical protein OsJ_09539                          317   1e-95    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010917686.1|  PREDICTED: beta-galactosidase 5-like               317   1e-95    Elaeis guineensis
ref|XP_002465807.1|  hypothetical protein SORBIDRAFT_01g046160          316   1e-95    Sorghum bicolor [broomcorn]
ref|XP_008452119.1|  PREDICTED: beta-galactosidase 3-like               316   2e-95    Cucumis melo [Oriental melon]
ref|XP_009418405.1|  PREDICTED: beta-galactosidase 5-like isoform X2    316   3e-95    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006649450.1|  PREDICTED: beta-galactosidase 5-like               315   3e-95    Oryza brachyantha
ref|XP_009418404.1|  PREDICTED: beta-galactosidase 5-like isoform X1    316   3e-95    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004146490.1|  PREDICTED: beta-galactosidase 3-like               315   7e-95    Cucumis sativus [cucumbers]
gb|EEC74580.1|  hypothetical protein OsI_10152                          315   7e-95    Oryza sativa Indica Group [Indian rice]
ref|XP_006838689.1|  PREDICTED: beta-galactosidase 5                    314   1e-94    Amborella trichopoda
ref|XP_008799994.1|  PREDICTED: beta-galactosidase 5-like               310   4e-93    Phoenix dactylifera
gb|ADD62393.1|  beta-galactosidase 3                                    304   2e-92    Prunus persica
ref|XP_008388000.1|  PREDICTED: beta-galactosidase 5                    308   3e-92    
ref|XP_008221339.1|  PREDICTED: beta-galactosidase 5                    307   4e-92    Prunus mume [ume]
ref|NP_001268162.1|  beta-galactosidase BG1-like precursor              307   4e-92    Vitis vinifera
ref|XP_010679814.1|  PREDICTED: beta-galactosidase 3                    307   4e-92    Beta vulgaris subsp. vulgaris [field beet]
emb|CAN78072.1|  hypothetical protein VITISV_013292                     307   4e-92    Vitis vinifera
emb|CBI19767.3|  unnamed protein product                                307   4e-92    Vitis vinifera
ref|XP_008660537.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    306   6e-92    Zea mays [maize]
ref|XP_007225291.1|  hypothetical protein PRUPE_ppa001334mg             306   1e-91    Prunus persica
gb|AGR44466.1|  beta-D-galactosidase 7                                  305   3e-91    Pyrus x bretschneideri [bai li]
dbj|BAD91084.1|  beta-D-galactosidase                                   305   3e-91    Pyrus pyrifolia [sha li]
ref|XP_009335672.1|  PREDICTED: beta-galactosidase 5                    305   3e-91    Pyrus x bretschneideri [bai li]
ref|NP_001168664.1|  uncharacterized protein LOC100382452               303   5e-91    Zea mays [maize]
ref|XP_008377189.1|  PREDICTED: beta-galactosidase 5-like               304   9e-91    
ref|XP_008643999.1|  PREDICTED: uncharacterized protein LOC100382...    303   1e-90    Zea mays [maize]
gb|KJB43423.1|  hypothetical protein B456_007G198900                    302   1e-90    Gossypium raimondii
ref|XP_007199661.1|  hypothetical protein PRUPE_ppa001363mg             303   2e-90    Prunus persica
tpg|DAA43551.1|  TPA: beta-galactosidase                                303   3e-90    
ref|XP_008236954.1|  PREDICTED: beta-galactosidase 3-like               301   5e-90    Prunus mume [ume]
ref|XP_010932916.1|  PREDICTED: beta-galactosidase 5-like               301   7e-90    Elaeis guineensis
ref|XP_003558743.1|  PREDICTED: beta-galactosidase 5                    300   1e-89    Brachypodium distachyon [annual false brome]
ref|XP_002306893.1|  beta-galactosidase family protein                  300   3e-89    Populus trichocarpa [western balsam poplar]
ref|XP_009395554.1|  PREDICTED: beta-galactosidase 5                    299   5e-89    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY59691.1|  BnaC07g51100D                                          285   1e-88    Brassica napus [oilseed rape]
gb|AHL69742.1|  beta-galactosidase                                      298   1e-88    Hylocereus undatus [dragon fruit]
ref|XP_011048837.1|  PREDICTED: beta-galactosidase 5                    297   3e-88    Populus euphratica
dbj|BAJ96054.1|  predicted protein                                      296   4e-88    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009372992.1|  PREDICTED: beta-galactosidase 3-like               294   1e-87    
gb|EMT10014.1|  Beta-galactosidase 5                                    295   2e-87    
dbj|BAK07157.1|  predicted protein                                      294   3e-87    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002510455.1|  beta-galactosidase, putative                       293   6e-87    Ricinus communis
dbj|BAD91085.1|  beta-D-galactosidase                                   293   1e-86    Pyrus pyrifolia [sha li]
ref|XP_008382310.1|  PREDICTED: beta-galactosidase 5-like               293   1e-86    
ref|XP_012071945.1|  PREDICTED: beta-galactosidase 5                    293   1e-86    Jatropha curcas
emb|CDX69219.1|  BnaC01g02340D                                          288   5e-85    
gb|EMS60063.1|  Beta-galactosidase 5                                    288   1e-84    Triticum urartu
ref|XP_010672619.1|  PREDICTED: beta-galactosidase 5                    286   2e-84    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011083609.1|  PREDICTED: beta-galactosidase 3-like               286   3e-84    Sesamum indicum [beniseed]
emb|CDX75569.1|  BnaA01g01330D                                          285   5e-84    
ref|XP_011457728.1|  PREDICTED: beta-galactosidase 3-like               284   2e-83    Fragaria vesca subsp. vesca
gb|KDO71053.1|  hypothetical protein CISIN_1g003044mg                   283   4e-83    Citrus sinensis [apfelsine]
gb|KDO84694.1|  hypothetical protein CISIN_1g003076mg                   278   6e-83    Citrus sinensis [apfelsine]
gb|EYU32887.1|  hypothetical protein MIMGU_mgv1a001295mg                283   6e-83    Erythranthe guttata [common monkey flower]
ref|XP_006435077.1|  hypothetical protein CICLE_v10000260mg             277   1e-82    
gb|KDO84693.1|  hypothetical protein CISIN_1g003076mg                   278   2e-82    Citrus sinensis [apfelsine]
ref|XP_006473573.1|  PREDICTED: beta-galactosidase 3-like               280   5e-82    Citrus sinensis [apfelsine]
gb|KDO84688.1|  hypothetical protein CISIN_1g003076mg                   278   4e-81    Citrus sinensis [apfelsine]
ref|XP_006435076.1|  hypothetical protein CICLE_v10000260mg             277   7e-81    Citrus clementina [clementine]
gb|KCW69754.1|  hypothetical protein EUGRSUZ_F031301                    258   3e-79    Eucalyptus grandis [rose gum]
ref|XP_006283100.1|  hypothetical protein CARUB_v10004117mg             272   3e-79    
gb|ERM94020.1|  hypothetical protein AMTR_s00136p00108810               270   9e-79    Amborella trichopoda
ref|XP_006826783.2|  PREDICTED: beta-galactosidase                      270   2e-78    
ref|XP_010107841.1|  Beta-galactosidase 3                               270   3e-78    Morus notabilis
emb|CDY59722.1|  BnaA03g59210D                                          250   2e-77    Brassica napus [oilseed rape]
gb|ABF94150.1|  Beta-galactosidase precursor, putative, expressed       266   8e-77    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004147848.1|  PREDICTED: beta-galactosidase 5-like               265   2e-76    Cucumis sativus [cucumbers]
emb|CDP07463.1|  unnamed protein product                                265   3e-76    Coffea canephora [robusta coffee]
ref|XP_010262132.1|  PREDICTED: beta-galactosidase isoform X2           264   3e-76    Nelumbo nucifera [Indian lotus]
gb|EYU21377.1|  hypothetical protein MIMGU_mgv1a001631mg                263   6e-76    Erythranthe guttata [common monkey flower]
dbj|BAF31233.1|  beta-D-galactosidase                                   262   2e-75    Persea americana
gb|ACC60981.1|  beta-galactosidase 1 precursor                          262   3e-75    Petunia x hybrida [garden petunia]
ref|XP_009789773.1|  PREDICTED: beta-galactosidase-like                 261   4e-75    Nicotiana sylvestris
ref|XP_003597608.1|  Beta-galactosidase                                 261   7e-75    Medicago truncatula
ref|XP_009783993.1|  PREDICTED: beta-galactosidase                      260   1e-74    Nicotiana sylvestris
ref|XP_009606115.1|  PREDICTED: beta-galactosidase-like                 260   1e-74    
dbj|BAD95407.1|  galactosidase                                          245   1e-74    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010062625.1|  PREDICTED: beta-galactosidase 1                    259   2e-74    
ref|XP_009407297.1|  PREDICTED: beta-galactosidase 2                    259   2e-74    Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC70956.1|  hypothetical protein OsI_02569                          252   2e-74    Oryza sativa Indica Group [Indian rice]
ref|XP_008466519.1|  PREDICTED: beta-galactosidase 5-like               259   2e-74    Cucumis melo [Oriental melon]
ref|XP_010915229.1|  PREDICTED: beta-galactosidase isoform X2           259   3e-74    Elaeis guineensis
ref|XP_007217146.1|  hypothetical protein PRUPE_ppa001382mg             259   3e-74    Prunus persica
gb|ABV32545.1|  beta-galactosidase protein 2                            259   3e-74    Prunus persica
ref|XP_008228300.1|  PREDICTED: beta-galactosidase 1                    259   3e-74    Prunus mume [ume]
emb|CDO97918.1|  unnamed protein product                                259   3e-74    Coffea canephora [robusta coffee]
ref|XP_009627536.1|  PREDICTED: beta-galactosidase                      259   4e-74    Nicotiana tomentosiformis
gb|KHN30042.1|  Beta-galactosidase 1                                    258   4e-74    Glycine soja [wild soybean]
gb|AHG94611.1|  beta-galactosidase                                      258   5e-74    Camellia sinensis [black tea]
ref|XP_003543598.1|  PREDICTED: beta-galactosidase 1-like               258   5e-74    Glycine max [soybeans]
ref|XP_010262131.1|  PREDICTED: beta-galactosidase isoform X1           258   5e-74    Nelumbo nucifera [Indian lotus]
ref|XP_008391326.1|  PREDICTED: beta-galactosidase 1                    258   5e-74    Malus domestica [apple tree]
ref|XP_009768469.1|  PREDICTED: beta-galactosidase-like                 258   6e-74    Nicotiana sylvestris
emb|CAC44500.1|  beta-galactosidase                                     258   6e-74    Fragaria x ananassa
ref|XP_011463326.1|  PREDICTED: beta-galactosidase 1                    258   7e-74    Fragaria vesca subsp. vesca
ref|XP_004486826.1|  PREDICTED: beta-galactosidase 1-like               258   7e-74    Cicer arietinum [garbanzo]
ref|XP_010242207.1|  PREDICTED: beta-galactosidase                      258   9e-74    Nelumbo nucifera [Indian lotus]
ref|XP_012076927.1|  PREDICTED: beta-galactosidase-like                 258   1e-73    Jatropha curcas
ref|XP_011080179.1|  PREDICTED: beta-galactosidase-like                 257   2e-73    Sesamum indicum [beniseed]
ref|XP_009367552.1|  PREDICTED: beta-galactosidase 1                    257   2e-73    Pyrus x bretschneideri [bai li]
gb|EYU45851.1|  hypothetical protein MIMGU_mgv1a002308mg                254   2e-73    Erythranthe guttata [common monkey flower]
ref|XP_002514108.1|  beta-galactosidase, putative                       257   2e-73    
ref|NP_001234465.1|  beta-galactosidase precursor                       256   2e-73    Solanum lycopersicum
ref|XP_006366152.1|  PREDICTED: beta-galactosidase-like                 256   2e-73    Solanum tuberosum [potatoes]
ref|XP_010910613.1|  PREDICTED: beta-galactosidase-like                 246   2e-73    
gb|ADO34788.1|  beta-galactosidase STBG3                                256   3e-73    Solanum lycopersicum
ref|NP_001266102.1|  beta-galactosidase 1-like precursor                255   6e-73    Cicer arietinum [garbanzo]
ref|XP_007135555.1|  hypothetical protein PHAVU_010G139300g             255   6e-73    Phaseolus vulgaris [French bean]
gb|KHN32687.1|  Beta-galactosidase 1                                    255   7e-73    Glycine soja [wild soybean]
ref|XP_003546676.1|  PREDICTED: beta-galactosidase 1-like               255   8e-73    Glycine max [soybeans]
ref|XP_010033786.1|  PREDICTED: beta-galactosidase 1-like               255   1e-72    Eucalyptus grandis [rose gum]
ref|XP_010106660.1|  Beta-galactosidase 1                               255   1e-72    Morus notabilis
emb|CBI27912.3|  unnamed protein product                                254   1e-72    Vitis vinifera
ref|XP_002282132.1|  PREDICTED: beta-galactosidase                      254   1e-72    Vitis vinifera
ref|XP_009769408.1|  PREDICTED: beta-galactosidase-like                 254   1e-72    Nicotiana sylvestris
ref|XP_011072510.1|  PREDICTED: beta-galactosidase-like                 254   2e-72    Sesamum indicum [beniseed]
gb|KHN39301.1|  Beta-galactosidase 1                                    254   2e-72    Glycine soja [wild soybean]
ref|XP_003529875.1|  PREDICTED: beta-galactosidase 1-like               254   2e-72    Glycine max [soybeans]
gb|AGW47883.1|  beta-galactosidase precursor                            254   2e-72    Nicotiana tabacum [American tobacco]
ref|XP_010915228.1|  PREDICTED: beta-galactosidase isoform X1           253   3e-72    Elaeis guineensis
ref|XP_011045966.1|  PREDICTED: beta-galactosidase-like isoform X2      253   3e-72    Populus euphratica
ref|NP_001234303.1|  beta-galactosidase precursor                       253   3e-72    Solanum lycopersicum
ref|XP_009622143.1|  PREDICTED: beta-galactosidase-like                 253   3e-72    Nicotiana tomentosiformis
ref|XP_008447606.1|  PREDICTED: beta-galactosidase 1                    253   4e-72    Cucumis melo [Oriental melon]
ref|XP_007150529.1|  hypothetical protein PHAVU_005G160000g             253   4e-72    Phaseolus vulgaris [French bean]
ref|XP_010686091.1|  PREDICTED: beta-galactosidase 1                    253   5e-72    Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001043405.1|  Os01g0580200                                       253   5e-72    
gb|EEE54862.1|  hypothetical protein OsJ_02342                          253   5e-72    Oryza sativa Japonica Group [Japonica rice]
gb|EEC70952.1|  hypothetical protein OsI_02561                          253   5e-72    Oryza sativa Indica Group [Indian rice]
ref|XP_011045964.1|  PREDICTED: beta-galactosidase-like isoform X1      253   6e-72    Populus euphratica
ref|XP_004150073.1|  PREDICTED: beta-galactosidase 5                    253   6e-72    Cucumis sativus [cucumbers]
gb|AEC33272.1|  beta-galactosidase                                      251   6e-72    Ziziphus jujuba [Chinese jujube]
ref|XP_006646030.1|  PREDICTED: beta-galactosidase 2-like               252   7e-72    Oryza brachyantha
ref|XP_003531618.1|  PREDICTED: beta-galactosidase 1-like               252   8e-72    Glycine max [soybeans]
ref|XP_010654522.1|  PREDICTED: beta-galactosidase 1                    252   1e-71    Vitis vinifera
ref|XP_004241849.1|  PREDICTED: beta-galactosidase-like                 252   1e-71    Solanum lycopersicum
ref|XP_006357461.1|  PREDICTED: beta-galactosidase-like                 252   1e-71    
emb|CBI35944.3|  unnamed protein product                                252   1e-71    Vitis vinifera
ref|XP_002308268.2|  hypothetical protein POPTR_0006s14680g             251   2e-71    Populus trichocarpa [western balsam poplar]
ref|XP_004146823.1|  PREDICTED: beta-galactosidase 1                    251   2e-71    Cucumis sativus [cucumbers]
gb|KEH18344.1|  beta-galactosidase                                      251   2e-71    Medicago truncatula
ref|XP_008460995.1|  PREDICTED: beta-galactosidase 5-like               251   2e-71    Cucumis melo [Oriental melon]
gb|KJB70255.1|  hypothetical protein B456_011G065300                    248   3e-71    Gossypium raimondii
dbj|BAF02242.1|  putative galactosidase                                 246   3e-71    Arabidopsis thaliana [mouse-ear cress]
tpg|DAA58691.1|  TPA: hypothetical protein ZEAMMB73_223728              247   4e-71    
ref|XP_008242341.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    250   4e-71    
ref|XP_002455836.1|  hypothetical protein SORBIDRAFT_03g025990          249   4e-71    
gb|AAQ21370.1|  beta-galactosidase                                      245   5e-71    Sandersonia aurantiaca [Chinese-lantern lily]
ref|XP_007012844.1|  Beta-galactosidase                                 250   7e-71    
dbj|BAH20412.1|  AT3G13750                                              246   9e-71    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007204656.1|  hypothetical protein PRUPE_ppa001412mg             249   9e-71    Prunus persica
ref|XP_006300095.1|  hypothetical protein CARUB_v10016323mg             249   1e-70    Capsella rubella
gb|ABV32546.1|  beta-galactosidase protein 1                            249   1e-70    Prunus persica
gb|KJB70254.1|  hypothetical protein B456_011G065300                    248   2e-70    Gossypium raimondii
gb|KJB56893.1|  hypothetical protein B456_009G140800                    248   2e-70    Gossypium raimondii
ref|XP_006342989.1|  PREDICTED: beta-galactosidase-like                 249   2e-70    Solanum tuberosum [potatoes]
ref|XP_004969419.1|  PREDICTED: beta-galactosidase 2-like               248   2e-70    Setaria italica
gb|KJB56892.1|  hypothetical protein B456_009G140800                    248   2e-70    Gossypium raimondii
ref|XP_002527409.1|  beta-galactosidase, putative                       248   3e-70    
gb|KJB70251.1|  hypothetical protein B456_011G065300                    248   3e-70    Gossypium raimondii
ref|XP_008805774.1|  PREDICTED: beta-galactosidase-like isoform X2      248   3e-70    Phoenix dactylifera
gb|KHF99404.1|  Beta-galactosidase 1 -like protein                      247   5e-70    Gossypium arboreum [tree cotton]
ref|XP_008775429.1|  PREDICTED: beta-galactosidase 2-like               247   5e-70    Phoenix dactylifera
ref|XP_010939579.1|  PREDICTED: beta-galactosidase 2-like               247   6e-70    Elaeis guineensis
ref|XP_008672351.1|  PREDICTED: hypothetical protein isoform X1         247   6e-70    
ref|XP_010542431.1|  PREDICTED: beta-galactosidase 1-like               247   9e-70    Tarenaya hassleriana [spider flower]
ref|NP_187988.1|  beta galactosidase 1                                  246   1e-69    Arabidopsis thaliana [mouse-ear cress]
gb|AAM13196.1|  galactosidase, putative                                 246   1e-69    Arabidopsis thaliana [mouse-ear cress]
emb|CDY37486.1|  BnaC01g37460D                                          246   2e-69    Brassica napus [oilseed rape]
gb|KHG25378.1|  Beta-galactosidase 1 -like protein                      246   2e-69    Gossypium arboreum [tree cotton]
ref|XP_009117469.1|  PREDICTED: beta-galactosidase 1-like               246   2e-69    Brassica rapa
ref|XP_010047575.1|  PREDICTED: beta-galactosidase-like                 246   3e-69    Eucalyptus grandis [rose gum]
emb|CDY51738.1|  BnaA01g37210D                                          245   3e-69    Brassica napus [oilseed rape]
ref|XP_006407174.1|  hypothetical protein EUTSA_v10020056mg             245   3e-69    Eutrema salsugineum [saltwater cress]
gb|KHF98342.1|  Beta-galactosidase 1 -like protein                      245   3e-69    Gossypium arboreum [tree cotton]
ref|XP_008793242.1|  PREDICTED: beta-galactosidase                      245   4e-69    Phoenix dactylifera
ref|XP_002882842.1|  hypothetical protein ARALYDRAFT_897617             245   4e-69    Arabidopsis lyrata subsp. lyrata
ref|XP_010487145.1|  PREDICTED: beta-galactosidase 1-like               244   6e-69    Camelina sativa [gold-of-pleasure]
gb|ABR16628.1|  unknown                                                 244   6e-69    Picea sitchensis
ref|XP_007024475.1|  Beta galactosidase 1                               244   6e-69    
ref|XP_009146456.1|  PREDICTED: beta-galactosidase 1                    244   7e-69    
gb|KJB17255.1|  hypothetical protein B456_003G0595002                   242   7e-69    Gossypium raimondii
gb|KGN48881.1|  hypothetical protein Csa_6G504610                       243   7e-69    Cucumis sativus [cucumbers]
emb|CDY23637.1|  BnaC05g39570D                                          244   8e-69    Brassica napus [oilseed rape]
gb|KJB17254.1|  hypothetical protein B456_003G0595002                   242   8e-69    Gossypium raimondii
emb|CDX97513.1|  BnaA05g25660D                                          244   9e-69    
ref|XP_010465236.1|  PREDICTED: beta-galactosidase 1                    244   9e-69    Camelina sativa [gold-of-pleasure]
ref|XP_010501131.1|  PREDICTED: beta-galactosidase 1-like               244   1e-68    Camelina sativa [gold-of-pleasure]
ref|XP_003566806.1|  PREDICTED: beta-galactosidase 2                    244   1e-68    Brachypodium distachyon [annual false brome]
ref|XP_009611028.1|  PREDICTED: beta-galactosidase-like isoform X2      244   1e-68    Nicotiana tomentosiformis
ref|XP_009611026.1|  PREDICTED: beta-galactosidase-like isoform X1      244   1e-68    Nicotiana tomentosiformis
ref|XP_012068994.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    244   1e-68    Jatropha curcas
ref|XP_009757670.1|  PREDICTED: beta-galactosidase-like isoform X1      243   1e-68    Nicotiana sylvestris
ref|XP_009757671.1|  PREDICTED: beta-galactosidase-like isoform X2      243   2e-68    Nicotiana sylvestris
sp|P45582.1|BGAL_ASPOF  RecName: Full=Beta-galactosidase; Short=L...    243   2e-68    Asparagus officinalis
ref|XP_009760187.1|  PREDICTED: beta-galactosidase-like isoform X4      242   3e-68    Nicotiana sylvestris
ref|XP_009760184.1|  PREDICTED: beta-galactosidase-like isoform X1      242   4e-68    Nicotiana sylvestris
ref|XP_009760186.1|  PREDICTED: beta-galactosidase-like isoform X3      242   4e-68    Nicotiana sylvestris
ref|XP_009760185.1|  PREDICTED: beta-galactosidase-like isoform X2      242   4e-68    Nicotiana sylvestris
ref|XP_010534899.1|  PREDICTED: beta-galactosidase 1                    242   5e-68    Tarenaya hassleriana [spider flower]
gb|ABY71826.1|  beta-galactosidase                                      242   6e-68    Prunus salicina [Japanese plum]
ref|XP_008805772.1|  PREDICTED: beta-galactosidase-like isoform X1      242   6e-68    Phoenix dactylifera
gb|KDO65276.1|  hypothetical protein CISIN_1g002867mg                   238   7e-68    Citrus sinensis [apfelsine]
ref|XP_011000791.1|  PREDICTED: beta-galactosidase 1-like               241   8e-68    
ref|XP_010110010.1|  Beta-galactosidase 3                               241   9e-68    
gb|EMS53990.1|  Beta-galactosidase 2                                    241   9e-68    
ref|XP_006385360.1|  beta-galactosidase 1 family protein                241   1e-67    
gb|ABK96254.1|  unknown                                                 241   1e-67    
ref|XP_006369293.1|  beta-galactosidase 1 family protein                239   3e-67    
gb|EMT02336.1|  Beta-galactosidase 2                                    239   4e-67    
ref|XP_006466038.1|  PREDICTED: beta-galactosidase 1-like               238   1e-66    
ref|XP_011010891.1|  PREDICTED: beta-galactosidase 1-like               238   1e-66    
gb|KDO65274.1|  hypothetical protein CISIN_1g002867mg                   238   1e-66    
gb|KDO65275.1|  hypothetical protein CISIN_1g002867mg                   238   1e-66    
gb|KJB70252.1|  hypothetical protein B456_011G065300                    238   1e-66    
ref|XP_006426535.1|  hypothetical protein CICLE_v10024886mg             238   1e-66    
ref|XP_006426534.1|  hypothetical protein CICLE_v10024886mg             238   1e-66    
ref|XP_010090040.1|  hypothetical protein L484_027271                   236   4e-66    
gb|ACP18875.1|  beta-galactosidase pBG(a)                               236   5e-66    
gb|KHG01120.1|  Beta-galactosidase                                      236   9e-66    
gb|KJB65170.1|  hypothetical protein B456_010G082900                    234   4e-65    
gb|KJB65167.1|  hypothetical protein B456_010G082900                    234   5e-65    
gb|KDO84690.1|  hypothetical protein CISIN_1g003076mg                   232   1e-64    
gb|KHN06610.1|  Beta-galactosidase                                      232   1e-64    
gb|EPS65481.1|  beta-galactosidase                                      224   3e-64    
gb|KHN17668.1|  Beta-galactosidase                                      231   3e-64    
ref|XP_003550633.1|  PREDICTED: beta-galactosidase-like                 231   5e-64    
ref|XP_007217046.1|  hypothetical protein PRUPE_ppa001415mg             230   9e-64    
gb|KDO84689.1|  hypothetical protein CISIN_1g003076mg                   226   1e-62    
ref|XP_008230925.1|  PREDICTED: beta-galactosidase-like                 226   2e-62    
ref|XP_007154660.1|  hypothetical protein PHAVU_003G137000g             224   8e-62    
gb|AAQ21369.1|  beta-galactosidase                                      224   8e-62    
ref|XP_012076925.1|  PREDICTED: beta-galactosidase-like                 222   8e-61    
gb|ABK22678.1|  unknown                                                 210   2e-60    
ref|XP_002514109.1|  beta-galactosidase, putative                       219   6e-60    
ref|XP_006854486.1|  PREDICTED: beta-galactosidase 8                    219   7e-60    
gb|KJB55481.1|  hypothetical protein B456_009G078400                    217   4e-59    
gb|EAY82933.1|  hypothetical protein OsI_38150                          206   4e-59    
gb|ABA97653.1|  Galactose binding lectin domain containing protei...    206   5e-59    
gb|EEE53128.1|  hypothetical protein OsJ_35926                          206   5e-59    
ref|XP_010929758.1|  PREDICTED: beta-galactosidase 15 isoform X3        214   6e-59    
gb|KHG08626.1|  Beta-galactosidase 8 -like protein                      215   1e-58    
ref|XP_010032010.1|  PREDICTED: beta-galactosidase 8                    216   1e-58    
ref|XP_007015424.1|  Beta-galactosidase 8 isoform 4                     215   2e-58    
ref|XP_007015421.1|  Beta-galactosidase 8 isoform 1                     215   2e-58    
ref|XP_008794977.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    214   3e-58    
ref|XP_010929757.1|  PREDICTED: beta-galactosidase 15 isoform X2        214   4e-58    
ref|XP_010929755.1|  PREDICTED: beta-galactosidase 15 isoform X1        213   8e-58    
gb|ERM97946.1|  hypothetical protein AMTR_s00117p00061070               201   8e-58    
gb|AEE01408.1|  beta-galactosidase STBG2                                213   9e-58    
ref|XP_006360940.1|  PREDICTED: beta-galactosidase 9-like               213   1e-57    
ref|XP_011089891.1|  PREDICTED: beta-galactosidase 8-like isoform X1    213   2e-57    
ref|NP_001234298.2|  beta-galactosidase                                 212   2e-57    
ref|XP_006420948.1|  hypothetical protein CICLE_v10004268mg             211   4e-57    
ref|XP_009617413.1|  PREDICTED: beta-galactosidase 9-like               211   4e-57    
gb|AAF70821.1|AF154420_1  beta-galactosidase                            211   4e-57    
ref|XP_006296364.1|  hypothetical protein CARUB_v10025536mg             211   4e-57    
ref|XP_008363504.1|  PREDICTED: beta-galactosidase 8-like               206   5e-57    
gb|ERN18154.1|  hypothetical protein AMTR_s00054p00133410               211   5e-57    
ref|XP_011627921.1|  PREDICTED: beta-galactosidase 10                   211   5e-57    
ref|XP_006493072.1|  PREDICTED: beta-galactosidase 9-like isoform X2    210   5e-57    
gb|EAY89299.1|  hypothetical protein OsI_10800                          211   6e-57    
gb|EMT18371.1|  Beta-galactosidase 6                                    209   7e-57    
ref|XP_006649762.1|  PREDICTED: beta-galactosidase 6-like               210   8e-57    
ref|XP_006420947.1|  hypothetical protein CICLE_v10004268mg             211   8e-57    
gb|ABK24373.1|  unknown                                                 210   8e-57    
ref|XP_009335064.1|  PREDICTED: beta-galactosidase 8-like isoform X2    209   9e-57    
ref|XP_009398591.1|  PREDICTED: beta-galactosidase 6-like               210   9e-57    
ref|XP_010650317.1|  PREDICTED: beta-galactosidase 9 isoform X2         209   1e-56    
ref|XP_006493071.1|  PREDICTED: beta-galactosidase 9-like isoform X1    210   1e-56    
gb|ABF95029.1|  Beta-galactosidase precursor, putative, expressed       208   2e-56    
ref|NP_001289207.1|  beta-galactosidase 8-like precursor                209   2e-56    
ref|XP_006663996.1|  PREDICTED: beta-galactosidase 15-like              209   2e-56    
ref|XP_007207302.1|  hypothetical protein PRUPE_ppa001480mg             209   2e-56    
ref|XP_008778218.1|  PREDICTED: beta-galactosidase 6-like               199   2e-56    
ref|XP_002285084.2|  PREDICTED: beta-galactosidase 8                    209   2e-56    
ref|XP_012091518.1|  PREDICTED: beta-galactosidase 8-like               209   3e-56    
ref|XP_008359158.1|  PREDICTED: putative pentatricopeptide repeat...    204   3e-56    
ref|XP_009338266.1|  PREDICTED: beta-galactosidase 8-like isoform X2    207   3e-56    
dbj|BAD91083.1|  beta-D-galactosidase                                   209   3e-56    
ref|XP_002263385.1|  PREDICTED: beta-galactosidase 9 isoform X1         209   3e-56    
gb|KDO73224.1|  hypothetical protein CISIN_1g003095mg                   207   4e-56    
ref|XP_006373075.1|  beta-galactosidase family protein                  208   4e-56    
ref|XP_008463829.1|  PREDICTED: beta-galactosidase 8                    208   4e-56    
gb|AAQ21371.2|  beta-galactosidase                                      208   4e-56    
ref|XP_007034276.1|  Beta galactosidase 9 isoform 3                     207   5e-56    
ref|XP_008799173.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    208   5e-56    
gb|EAZ24672.1|  hypothetical protein OsJ_08441                          208   5e-56    
dbj|BAK02766.1|  predicted protein                                      208   6e-56    
sp|Q10NX8.2|BGAL6_ORYSJ  RecName: Full=Beta-galactosidase 6; Shor...    208   6e-56    
gb|ABF95028.1|  Beta-galactosidase precursor, putative, expressed       207   6e-56    
gb|KDO73221.1|  hypothetical protein CISIN_1g003095mg                   207   6e-56    
ref|XP_011650872.1|  PREDICTED: beta-galactosidase 9 isoform X2         207   6e-56    
ref|XP_008438342.1|  PREDICTED: beta-galactosidase 9 isoform X2         207   7e-56    
gb|KDO73220.1|  hypothetical protein CISIN_1g003095mg                   207   7e-56    
ref|XP_008225494.1|  PREDICTED: beta-galactosidase 8                    207   8e-56    
ref|XP_003597215.1|  Beta-galactosidase                                 207   8e-56    
gb|AES67466.2|  beta-galactosidase-like protein                         207   8e-56    
ref|XP_012064843.1|  PREDICTED: beta-galactosidase 8                    207   8e-56    
ref|XP_010313192.1|  PREDICTED: TBG5 protein isoform X1                 207   1e-55    
ref|XP_011012769.1|  PREDICTED: beta-galactosidase 9                    207   1e-55    
emb|CBI17270.3|  unnamed protein product                                209   1e-55    
ref|NP_001049591.1|  Os03g0255100                                       207   1e-55    
ref|XP_009338265.1|  PREDICTED: beta-galactosidase 8-like isoform X1    207   1e-55    
ref|XP_004134374.1|  PREDICTED: beta-galactosidase 9 isoform X1         207   1e-55    
ref|XP_010413942.1|  PREDICTED: beta-galactosidase 9-like               207   2e-55    
ref|XP_007034274.1|  Beta galactosidase 9 isoform 1                     206   2e-55    
gb|KJB17252.1|  hypothetical protein B456_003G0595002                   205   2e-55    
ref|XP_003597217.1|  Beta-galactosidase                                 206   2e-55    
dbj|BAF31232.1|  beta-D-galactosidase                                   206   2e-55    
ref|XP_008438341.1|  PREDICTED: beta-galactosidase 9 isoform X1         206   2e-55    
ref|NP_001234312.1|  TBG5 protein precursor                             206   3e-55    
gb|KDP40783.1|  hypothetical protein JCGZ_24782                         194   3e-55    
ref|XP_010232635.1|  PREDICTED: beta-galactosidase 3                    206   3e-55    
gb|KDO65277.1|  hypothetical protein CISIN_1g002867mg                   206   3e-55    
gb|EYU31481.1|  hypothetical protein MIMGU_mgv1a001399mg                206   3e-55    
ref|XP_006424599.1|  hypothetical protein CICLE_v10027805mg             206   3e-55    
ref|XP_010253630.1|  PREDICTED: beta-galactosidase 8                    206   4e-55    
ref|XP_008385297.1|  PREDICTED: beta-galactosidase 8-like               205   5e-55    
ref|XP_010030277.1|  PREDICTED: beta-galactosidase 3-like               195   5e-55    
ref|XP_008366360.1|  PREDICTED: beta-galactosidase 8-like               205   6e-55    
ref|XP_011089316.1|  PREDICTED: beta-galactosidase 8-like               205   6e-55    
ref|XP_008791517.1|  PREDICTED: beta-galactosidase 6 isoform X1         205   6e-55    
ref|XP_009141278.1|  PREDICTED: beta-galactosidase 9                    205   6e-55    
ref|XP_008358406.1|  PREDICTED: beta-galactosidase 8-like               205   6e-55    
ref|XP_006340153.1|  PREDICTED: beta-galactosidase 8-like               205   6e-55    
ref|NP_001066673.1|  Os12g0429200                                       205   6e-55    
gb|EMT06783.1|  Beta-galactosidase 15                                   201   7e-55    
ref|XP_010689565.1|  PREDICTED: beta-galactosidase 8                    205   7e-55    
gb|KFK31109.1|  hypothetical protein AALP_AA6G069300                    205   7e-55    
ref|XP_010228859.1|  PREDICTED: beta-galactosidase 6                    204   7e-55    
ref|XP_008791518.1|  PREDICTED: beta-galactosidase 6 isoform X2         204   7e-55    
gb|EEC71891.1|  hypothetical protein OsI_04635                          204   8e-55    
ref|XP_009611323.1|  PREDICTED: beta-galactosidase 9                    204   1e-54    
ref|NP_001044964.1|  Os01g0875500                                       204   1e-54    
ref|XP_004962561.1|  PREDICTED: beta-galactosidase 15-like              204   1e-54    
dbj|BAJ95568.1|  predicted protein                                      204   1e-54    
emb|CAC44501.1|  beta-galactosidase                                     204   1e-54    
ref|XP_011461703.1|  PREDICTED: beta-galactosidase 8                    204   1e-54    
ref|XP_011462809.1|  PREDICTED: beta-galactosidase 9                    202   1e-54    
ref|XP_004505982.1|  PREDICTED: beta-galactosidase 8-like               204   1e-54    
ref|XP_010522389.1|  PREDICTED: beta-galactosidase 9                    204   1e-54    
ref|XP_010509962.1|  PREDICTED: beta-galactosidase 9-like isoform X2    203   2e-54    
ref|XP_003597218.1|  Beta-galactosidase                                 207   2e-54    
ref|XP_003632537.1|  PREDICTED: beta-galactosidase 10                   203   2e-54    
ref|XP_006645099.1|  PREDICTED: beta-galactosidase 3-like               203   2e-54    
ref|XP_010907798.1|  PREDICTED: beta-galactosidase 3 isoform X2         203   2e-54    
dbj|BAG95687.1|  unnamed protein product                                204   2e-54    
ref|XP_004148770.1|  PREDICTED: beta-galactosidase 8                    203   2e-54    
ref|XP_010907797.1|  PREDICTED: beta-galactosidase 3 isoform X1         203   2e-54    
ref|XP_010910537.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    203   3e-54    
ref|XP_011101986.1|  PREDICTED: beta-galactosidase 9-like               203   3e-54    
ref|XP_010469543.1|  PREDICTED: beta-galactosidase 9 isoform X2         203   3e-54    
ref|XP_010469542.1|  PREDICTED: beta-galactosidase 9 isoform X1         203   3e-54    
ref|XP_009390388.1|  PREDICTED: beta-galactosidase 15 isoform X4        202   4e-54    
ref|XP_002518051.1|  beta-galactosidase, putative                       203   4e-54    
gb|KDP33830.1|  hypothetical protein JCGZ_07401                         200   4e-54    
emb|CDP07127.1|  unnamed protein product                                202   4e-54    
ref|XP_010921989.1|  PREDICTED: beta-galactosidase 8-like isoform X2    202   4e-54    
tpg|DAA56579.1|  TPA: beta-galactosidase isoform 1                      202   4e-54    
ref|XP_010509960.1|  PREDICTED: beta-galactosidase 9-like isoform X1    202   5e-54    
ref|XP_010921988.1|  PREDICTED: beta-galactosidase 8-like isoform X1    202   5e-54    
ref|XP_002456725.1|  hypothetical protein SORBIDRAFT_03g041450          202   6e-54    
ref|XP_009390387.1|  PREDICTED: beta-galactosidase 15 isoform X3        202   6e-54    
ref|XP_009390386.1|  PREDICTED: beta-galactosidase 15 isoform X2        202   6e-54    
emb|CDY23785.1|  BnaC04g43370D                                          202   7e-54    
ref|NP_001235722.1|  lectin                                             196   7e-54    
emb|CDY19166.1|  BnaA04g19060D                                          202   8e-54    
dbj|BAJ89450.1|  predicted protein                                      201   8e-54    
ref|XP_009390385.1|  PREDICTED: beta-galactosidase 15 isoform X1        202   8e-54    
gb|EMS56907.1|  Beta-galactosidase 15                                   200   9e-54    
ref|XP_007207303.1|  hypothetical protein PRUPE_ppa001480mg             201   9e-54    
ref|XP_009595284.1|  PREDICTED: beta-galactosidase 8                    201   9e-54    
gb|EYU18852.1|  hypothetical protein MIMGU_mgv1a001263mg                201   1e-53    
ref|XP_009766589.1|  PREDICTED: beta-galactosidase 8                    201   1e-53    
gb|AAK62590.1|  At2g32810/F24L7.5                                       199   1e-53    
ref|XP_002314274.2|  beta-galactosidase family protein                  201   1e-53    
gb|KJB72044.1|  hypothetical protein B456_011G155500                    201   1e-53    
ref|XP_011620343.1|  PREDICTED: beta-galactosidase 9                    201   1e-53    
ref|XP_006351534.1|  PREDICTED: beta-galactosidase 3-like               201   1e-53    
gb|KJB72045.1|  hypothetical protein B456_011G155500                    200   1e-53    
ref|XP_002963161.1|  hypothetical protein SELMODRAFT_404798             201   2e-53    
gb|AHC32021.1|  beta-galactosidase 3                                    201   2e-53    
ref|XP_006645100.1|  PREDICTED: beta-galactosidase 3-like               201   2e-53    
gb|KJB72043.1|  hypothetical protein B456_011G155500                    201   2e-53    
ref|XP_011022866.1|  PREDICTED: beta-galactosidase 10                   200   3e-53    
ref|XP_002310540.2|  beta-galactosidase family protein                  200   3e-53    
gb|ACJ83814.1|  unknown                                                 187   3e-53    
ref|XP_012076926.1|  PREDICTED: beta-galactosidase-like                 200   4e-53    
gb|KJB65169.1|  hypothetical protein B456_010G082900                    199   4e-53    
gb|ADO34792.1|  beta-galactosidase STBG7                                199   5e-53    
emb|CDM85192.1|  unnamed protein product                                199   6e-53    
ref|XP_008460809.1|  PREDICTED: beta-galactosidase 10                   199   6e-53    
ref|XP_002442888.1|  hypothetical protein SORBIDRAFT_08g004410          200   6e-53    
ref|XP_002317239.1|  beta-galactosidase family protein                  199   6e-53    
emb|CDP11164.1|  unnamed protein product                                199   6e-53    
ref|XP_008674433.1|  PREDICTED: beta-galactosidase 15 isoform X1        199   7e-53    
ref|XP_002862517.1|  hypothetical protein ARALYDRAFT_333310             196   7e-53    
ref|XP_004970751.1|  PREDICTED: beta-galactosidase 3-like               199   7e-53    
gb|ERN14823.1|  hypothetical protein AMTR_s00032p00109160               199   8e-53    
ref|XP_010069008.1|  PREDICTED: beta-galactosidase 9 isoform X2         198   8e-53    
ref|XP_002981627.1|  hypothetical protein SELMODRAFT_421090             199   8e-53    
ref|XP_010052369.1|  PREDICTED: beta-galactosidase 6-like isoform X3    198   9e-53    
ref|NP_001234307.1|  beta-galactosidase, chloroplastic precursor        199   9e-53    
ref|XP_011044378.1|  PREDICTED: beta-galactosidase 8                    198   1e-52    
ref|XP_002521428.1|  beta-galactosidase, putative                       198   1e-52    
ref|XP_007025758.1|  Beta-galactosidase 8                               198   1e-52    
ref|XP_010052368.1|  PREDICTED: beta-galactosidase 6-like isoform X2    198   1e-52    
ref|XP_007048525.1|  Beta-galactosidase 3                               198   1e-52    
ref|XP_010510620.1|  PREDICTED: beta-galactosidase 8-like               198   1e-52    
ref|XP_006410414.1|  hypothetical protein EUTSA_v10016215mg             198   1e-52    
ref|XP_009789911.1|  PREDICTED: beta-galactosidase 6-like isoform X1    198   2e-52    
ref|XP_009789912.1|  PREDICTED: beta-galactosidase 6-like isoform X2    198   2e-52    
ref|XP_011043264.1|  PREDICTED: beta-galactosidase 6-like isoform X1    198   2e-52    
ref|XP_010052367.1|  PREDICTED: beta-galactosidase 8-like isoform X1    198   2e-52    
gb|KJB69393.1|  hypothetical protein B456_011G021800                    197   2e-52    
ref|XP_008674434.1|  PREDICTED: beta-galactosidase 15 isoform X2        198   2e-52    
ref|XP_003576603.1|  PREDICTED: beta-galactosidase 15                   198   2e-52    
ref|XP_010243525.1|  PREDICTED: beta-galactosidase 3 isoform X2         197   2e-52    
ref|NP_850121.1|  beta-galactosidase 8                                  197   2e-52    
ref|XP_002530296.1|  beta-galactosidase, putative                       197   2e-52    
emb|CAB64744.1|  putative beta-galactosidase                            197   2e-52    
ref|XP_002881245.1|  hypothetical protein ARALYDRAFT_902346             198   2e-52    
gb|AAD21482.1|  putative beta-galactosidase                             197   2e-52    



>ref|XP_009789452.1| PREDICTED: beta-galactosidase 3 [Nicotiana sylvestris]
Length=844

 Score =   375 bits (963),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 177/218 (81%), Positives = 205/218 (94%), Gaps = 0/218 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A FN+PDGDEPLALDMSSMGKGQVWING+S+GRYWTAYATG+CNGCHY+G F+PPKCQLG
Sbjct  626   AYFNSPDGDEPLALDMSSMGKGQVWINGQSIGRYWTAYATGDCNGCHYSGNFRPPKCQLG  685

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQ+WYHVPRS LKPT+NLLVLFEELGGDPTRISLV+R+VSS+C DV E HPNI+NW
Sbjct  686   CGQPTQKWYHVPRSWLKPTQNLLVLFEELGGDPTRISLVKRTVSSICADVAEYHPNIKNW  745

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
             +IE+YGRT+E   PK+ +HC+PGQSISSIKFASFGTPLGTCGSFQQGPCHA TSY+V+EK
Sbjct  746   QIENYGRTEEFHLPKVRIHCAPGQSISSIKFASFGTPLGTCGSFQQGPCHAPTSYAVVEK  805

Query  577   KCIGRQRCSVAISNTNFGDPCPNVVKRLTVEAVCTPSQ  464
             KC+GRQ+C+V I+N+NFGDPCPNV+KRL+VEA CTP+Q
Sbjct  806   KCLGRQKCAVTIANSNFGDPCPNVLKRLSVEAHCTPTQ  843



>ref|XP_009628690.1| PREDICTED: beta-galactosidase 3 [Nicotiana tomentosiformis]
Length=844

 Score =   369 bits (947),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 175/218 (80%), Positives = 202/218 (93%), Gaps = 0/218 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A FN P+GDEPLALDMSSMGKGQVWING+S+GRYWTAYATG+CNGCHY+G F+PPKCQ G
Sbjct  626   AYFNTPNGDEPLALDMSSMGKGQVWINGQSIGRYWTAYATGDCNGCHYSGNFRPPKCQFG  685

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQ+WYHVPRS LKPT+NLLVLFEELGGDP+RISLV+R+VSSVC DV E HPNI+NW
Sbjct  686   CGQPTQKWYHVPRSWLKPTQNLLVLFEELGGDPSRISLVKRTVSSVCADVAEYHPNIKNW  745

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
             +IE+YGRT+E   PK+ +HC+PGQSISSIKFASFGTPLGTCGSFQQG CHA TSY+V+EK
Sbjct  746   QIENYGRTEEFHLPKVRIHCAPGQSISSIKFASFGTPLGTCGSFQQGTCHAPTSYAVVEK  805

Query  577   KCIGRQRCSVAISNTNFGDPCPNVVKRLTVEAVCTPSQ  464
             KC+GRQRC+V I+N+NFGDPCPNV+KRL+VEA CTP+Q
Sbjct  806   KCLGRQRCAVTIANSNFGDPCPNVLKRLSVEAHCTPTQ  843



>gb|EYU24087.1| hypothetical protein MIMGU_mgv1a001258mg [Erythranthe guttata]
Length=851

 Score =   366 bits (940),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 173/217 (80%), Positives = 199/217 (92%), Gaps = 1/217 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A FNAPDGDEPLALDMSSMGKGQ+W+NG+SLGRYWTAYATG+CNGC Y G F+PPKCQLG
Sbjct  633   AYFNAPDGDEPLALDMSSMGKGQLWVNGQSLGRYWTAYATGDCNGCSYVGSFRPPKCQLG  692

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQ+WYH+PRS LKPTENLLVLFEELGGDPTRI +V+RS++SVC D+ E HPN +NW
Sbjct  693   CGQPTQKWYHLPRSWLKPTENLLVLFEELGGDPTRIGVVKRSMTSVCADMAEYHPNFKNW  752

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
             +IESYG+ +E  KPK+HLHC PGQSISSIKFASFGTPLGTCGSFQ+G CHA TSY++LEK
Sbjct  753   QIESYGKPEEFRKPKVHLHCGPGQSISSIKFASFGTPLGTCGSFQKGTCHAPTSYAILEK  812

Query  577   KCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTP  470
             KCIG++RCSVAISN+NFG DPCPNV+KRL+VEA+C P
Sbjct  813   KCIGKERCSVAISNSNFGHDPCPNVLKRLSVEAICAP  849



>ref|XP_011100972.1| PREDICTED: beta-galactosidase 3-like [Sesamum indicum]
Length=848

 Score =   365 bits (938),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 176/217 (81%), Positives = 198/217 (91%), Gaps = 1/217 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A FNAPDGDEPLALDMSSMGKGQVW+NG+SLGRYWTAYATG+CNGC Y G ++PPKCQLG
Sbjct  630   AYFNAPDGDEPLALDMSSMGKGQVWVNGQSLGRYWTAYATGHCNGCSYTGSYRPPKCQLG  689

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQRWYH+PRS LKPT+NLLVLFEELGGDPTRI+LV+RS++SVC DV E HPNIRNW
Sbjct  690   CGQPTQRWYHLPRSWLKPTQNLLVLFEELGGDPTRITLVKRSMTSVCADVAEYHPNIRNW  749

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
             +IESYGR +E  KPK+HL C PGQSISSIKFASFGTPLGTCGSFQQG CHA TSY++LEK
Sbjct  750   QIESYGRPEEFHKPKVHLRCGPGQSISSIKFASFGTPLGTCGSFQQGTCHAPTSYAILEK  809

Query  577   KCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTP  470
             KCIG+Q+CSV ISN+NFG DPCP V+KRL+VEA+C P
Sbjct  810   KCIGQQKCSVTISNSNFGQDPCPKVLKRLSVEAICAP  846



>ref|XP_010029731.1| PREDICTED: beta-galactosidase 3 [Eucalyptus grandis]
 gb|KCW56689.1| hypothetical protein EUGRSUZ_I02384 [Eucalyptus grandis]
Length=849

 Score =   362 bits (929),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 170/220 (77%), Positives = 201/220 (91%), Gaps = 1/220 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A FNAP GDEPLA+DMS MGKGQ+WING+S+GRYWTAYATG+CNGC+YAG F+PPKCQLG
Sbjct  628   AYFNAPKGDEPLAIDMSGMGKGQIWINGQSIGRYWTAYATGDCNGCNYAGTFRPPKCQLG  687

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQRWYHVPRS LKPT+NLLV+FEELGG+P++ISLV+RS++SVC DV E HP ++NW
Sbjct  688   CGQPTQRWYHVPRSWLKPTQNLLVIFEELGGNPSKISLVKRSMTSVCADVTEFHPTLKNW  747

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
              IESYG+++E   PK+HL CSPGQSISSIKFASFGTPLGTCGS+QQG CHA +SY +LEK
Sbjct  748   HIESYGKSEEFHNPKVHLRCSPGQSISSIKFASFGTPLGTCGSYQQGACHAQSSYDILEK  807

Query  577   KCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTPSQW  461
             KCIG++RCSV ISN+NFG DPCPNV+KRL+VEAVCTP++W
Sbjct  808   KCIGKERCSVTISNSNFGRDPCPNVLKRLSVEAVCTPTEW  847



>emb|CDP01954.1| unnamed protein product [Coffea canephora]
Length=851

 Score =   362 bits (928),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 174/217 (80%), Positives = 197/217 (91%), Gaps = 1/217 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A FNAPDGDEPLALDMSSMGKGQVWING+SLGRYWTAYATGNCN C Y G F+PPKCQLG
Sbjct  626   AYFNAPDGDEPLALDMSSMGKGQVWINGQSLGRYWTAYATGNCNECSYTGTFRPPKCQLG  685

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQRWYHVPRS LKPT+NL+VLFEELGGDPTRISLV+R+VSSVC D+ E HP I+NW
Sbjct  686   CGQPTQRWYHVPRSWLKPTQNLVVLFEELGGDPTRISLVKRTVSSVCADITEYHPTIKNW  745

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
              IESYGR++E  KPK+HLHC+PGQSISSIKFASFGT +GTCGSFQQG CHA TSY+ +E+
Sbjct  746   HIESYGRSEEFHKPKVHLHCAPGQSISSIKFASFGTAMGTCGSFQQGTCHAPTSYTTMER  805

Query  577   KCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTP  470
             +C+GRQRCSV ISN+NFG DPCP V+KRL+VEA+C+P
Sbjct  806   RCLGRQRCSVTISNSNFGQDPCPKVLKRLSVEAICSP  842



>gb|KJB43419.1| hypothetical protein B456_007G198900 [Gossypium raimondii]
Length=859

 Score =   360 bits (925),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 174/217 (80%), Positives = 199/217 (92%), Gaps = 1/217 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A FNAP+GDEPLALDM SMGKGQ+WING+S+GRYWTAYA G+CNGC+YAG F+PPKCQLG
Sbjct  631   AYFNAPEGDEPLALDMESMGKGQIWINGQSIGRYWTAYAHGDCNGCNYAGTFRPPKCQLG  690

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQRWYHVPRS LKPT+NLLVLFEELGGDPTRISLV+RSVSSVC DV E HPNI+NW
Sbjct  691   CGQPTQRWYHVPRSWLKPTQNLLVLFEELGGDPTRISLVKRSVSSVCADVTEYHPNIKNW  750

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
             +IESYG+ Q+L +PK+HL CSPGQSIS IKFASFGTPLGTCGS+QQGPCHA  SY+++EK
Sbjct  751   QIESYGKAQQLRRPKVHLRCSPGQSISFIKFASFGTPLGTCGSYQQGPCHAPASYAIVEK  810

Query  577   KCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTP  470
             KC+G+QRC V I+N+NFG DPCPNV+KRL+VEAVC P
Sbjct  811   KCVGKQRCVVTIANSNFGQDPCPNVLKRLSVEAVCAP  847



>gb|KJB43424.1| hypothetical protein B456_007G198900 [Gossypium raimondii]
Length=854

 Score =   360 bits (925),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 174/217 (80%), Positives = 199/217 (92%), Gaps = 1/217 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A FNAP+GDEPLALDM SMGKGQ+WING+S+GRYWTAYA G+CNGC+YAG F+PPKCQLG
Sbjct  626   AYFNAPEGDEPLALDMESMGKGQIWINGQSIGRYWTAYAHGDCNGCNYAGTFRPPKCQLG  685

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQRWYHVPRS LKPT+NLLVLFEELGGDPTRISLV+RSVSSVC DV E HPNI+NW
Sbjct  686   CGQPTQRWYHVPRSWLKPTQNLLVLFEELGGDPTRISLVKRSVSSVCADVTEYHPNIKNW  745

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
             +IESYG+ Q+L +PK+HL CSPGQSIS IKFASFGTPLGTCGS+QQGPCHA  SY+++EK
Sbjct  746   QIESYGKAQQLRRPKVHLRCSPGQSISFIKFASFGTPLGTCGSYQQGPCHAPASYAIVEK  805

Query  577   KCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTP  470
             KC+G+QRC V I+N+NFG DPCPNV+KRL+VEAVC P
Sbjct  806   KCVGKQRCVVTIANSNFGQDPCPNVLKRLSVEAVCAP  842



>gb|KJB43422.1| hypothetical protein B456_007G198900 [Gossypium raimondii]
Length=850

 Score =   360 bits (924),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 174/217 (80%), Positives = 199/217 (92%), Gaps = 1/217 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A FNAP+GDEPLALDM SMGKGQ+WING+S+GRYWTAYA G+CNGC+YAG F+PPKCQLG
Sbjct  622   AYFNAPEGDEPLALDMESMGKGQIWINGQSIGRYWTAYAHGDCNGCNYAGTFRPPKCQLG  681

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQRWYHVPRS LKPT+NLLVLFEELGGDPTRISLV+RSVSSVC DV E HPNI+NW
Sbjct  682   CGQPTQRWYHVPRSWLKPTQNLLVLFEELGGDPTRISLVKRSVSSVCADVTEYHPNIKNW  741

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
             +IESYG+ Q+L +PK+HL CSPGQSIS IKFASFGTPLGTCGS+QQGPCHA  SY+++EK
Sbjct  742   QIESYGKAQQLRRPKVHLRCSPGQSISFIKFASFGTPLGTCGSYQQGPCHAPASYAIVEK  801

Query  577   KCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTP  470
             KC+G+QRC V I+N+NFG DPCPNV+KRL+VEAVC P
Sbjct  802   KCVGKQRCVVTIANSNFGQDPCPNVLKRLSVEAVCAP  838



>ref|XP_010275526.1| PREDICTED: beta-galactosidase 3-like [Nelumbo nucifera]
Length=853

 Score =   360 bits (923),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 173/218 (79%), Positives = 198/218 (91%), Gaps = 1/218 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A FNAP+GDEPLALDMSSMGKGQVWING+S+GRYWT YA GNCNGC Y+G F+PPKCQ+G
Sbjct  625   AYFNAPEGDEPLALDMSSMGKGQVWINGQSIGRYWTIYANGNCNGCSYSGTFRPPKCQIG  684

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQRWYHVPRS LKPT+NLLV+FEE+GGD + ISLV+RSVSSVC DV E HPNI+NW
Sbjct  685   CGQPTQRWYHVPRSWLKPTQNLLVVFEEIGGDASGISLVKRSVSSVCADVSEWHPNIKNW  744

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
             +IESYGRTQE  +PK+HL C+PGQSIS+IKFASFGTPLGTCGSFQQG CHA TSYSVLE+
Sbjct  745   QIESYGRTQEFHRPKVHLRCAPGQSISAIKFASFGTPLGTCGSFQQGICHAPTSYSVLEE  804

Query  577   KCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTPS  467
             +C+G++RCSV ISN NFG DPCPNV+KRLTVEA+C P+
Sbjct  805   RCVGQERCSVTISNRNFGADPCPNVLKRLTVEAICAPA  842



>gb|KJB17716.1| hypothetical protein B456_003G011900 [Gossypium raimondii]
Length=854

 Score =   357 bits (915),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 167/217 (77%), Positives = 200/217 (92%), Gaps = 1/217 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A F+AP+GDEPLALDM SMGKGQ+WING+S+GRYWTAYA G+C+GC Y+G F+P KCQLG
Sbjct  627   AYFDAPEGDEPLALDMESMGKGQIWINGQSIGRYWTAYAHGDCSGCSYSGTFRPTKCQLG  686

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQ+WYHVPRS LKPT+NLLVLFEELGGDP++ISLV+RSVS+VC ++ E HPNI+NW
Sbjct  687   CGQPTQKWYHVPRSWLKPTQNLLVLFEELGGDPSKISLVKRSVSTVCAEISEYHPNIKNW  746

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
             +IESYG+T+E  +PK+HLHCSPGQ+ISSIKFASFGTPLGTCGS+QQGPCHA TSY +LEK
Sbjct  747   QIESYGKTEEFHRPKVHLHCSPGQAISSIKFASFGTPLGTCGSYQQGPCHAPTSYDILEK  806

Query  577   KCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTP  470
             +C+G+QRC+V ISN+NFG DPCPNV+KRL+VEAVC P
Sbjct  807   RCVGKQRCAVTISNSNFGHDPCPNVLKRLSVEAVCAP  843



>gb|KDP32675.1| hypothetical protein JCGZ_13673 [Jatropha curcas]
Length=790

 Score =   355 bits (910),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 165/220 (75%), Positives = 197/220 (90%), Gaps = 1/220 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A FNAPDGDEPLALDM  MGKGQ+W+NG+S+GRYWTAYATGNCNGC YAG F+PPKCQ+G
Sbjct  569   AYFNAPDGDEPLALDMEGMGKGQIWVNGQSIGRYWTAYATGNCNGCSYAGSFRPPKCQVG  628

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQRWYHVPRS LKPT+NLLV+FEELGG+P+RISLV+R+++SVC +V E HP I+NW
Sbjct  629   CGQPTQRWYHVPRSWLKPTQNLLVVFEELGGNPSRISLVKRAMTSVCAEVAEFHPTIKNW  688

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
              IESYGR +E   PK+H+ CS GQSIS+IKFASFGTPLGTCGS+QQGPCH+  SY+++EK
Sbjct  689   HIESYGRAEEFHSPKVHIRCSLGQSISAIKFASFGTPLGTCGSYQQGPCHSPASYAIVEK  748

Query  577   KCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTPSQW  461
             KC+G+QRC+V ISN+NFG DPCPNV+KRL+VEAVC P+ W
Sbjct  749   KCVGKQRCTVTISNSNFGQDPCPNVLKRLSVEAVCAPTNW  788



>ref|XP_010649088.1| PREDICTED: beta-galactosidase 3 [Vitis vinifera]
 emb|CBI17431.3| unnamed protein product [Vitis vinifera]
Length=845

 Score =   356 bits (913),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 172/217 (79%), Positives = 196/217 (90%), Gaps = 1/217 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A FNAP+GDEPLALDM  MGKGQVWING+S+GRYWTAYA GNC GC Y+G ++PPKCQLG
Sbjct  626   AFFNAPEGDEPLALDMEGMGKGQVWINGQSIGRYWTAYANGNCQGCSYSGTYRPPKCQLG  685

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQRWYHVPRS LKPT+NLLV+FEELGGDP+RISLVRRS++SVC DV E HPNI+NW
Sbjct  686   CGQPTQRWYHVPRSWLKPTQNLLVVFEELGGDPSRISLVRRSMTSVCADVFEYHPNIKNW  745

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
              IESYG+T+EL KPK+HL C PGQSISSIKFAS+GTPLGTCGSF+QGPCHA  SY+++EK
Sbjct  746   HIESYGKTEELHKPKVHLRCGPGQSISSIKFASYGTPLGTCGSFEQGPCHAPDSYAIVEK  805

Query  577   KCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTP  470
             +CIGRQRC+V ISNTNF  DPCPNV+KRL+VEAVC P
Sbjct  806   RCIGRQRCAVTISNTNFAQDPCPNVLKRLSVEAVCAP  842



>ref|XP_002310279.2| beta-galactosidase family protein [Populus trichocarpa]
 gb|EEE90729.2| beta-galactosidase family protein [Populus trichocarpa]
Length=847

 Score =   356 bits (913),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 170/220 (77%), Positives = 197/220 (90%), Gaps = 1/220 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A FNAP+GDEPLALDM  MGKGQ+WING+S+GRYWTAYA+GNCNGC YAG F+P KCQLG
Sbjct  626   AYFNAPEGDEPLALDMEGMGKGQIWINGQSIGRYWTAYASGNCNGCSYAGTFRPTKCQLG  685

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQRWYHVPRS LKPT NLLV+FEELGGDP+RISLV+RS++SVC +V E HP I+NW
Sbjct  686   CGQPTQRWYHVPRSWLKPTNNLLVVFEELGGDPSRISLVKRSLASVCAEVSEFHPTIKNW  745

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
             +IESYGR +E   PK+HL CS GQSI+SIKFASFGTPLGTCGS+QQG CHASTSY++LEK
Sbjct  746   QIESYGRAEEFHSPKVHLRCSGGQSITSIKFASFGTPLGTCGSYQQGACHASTSYAILEK  805

Query  577   KCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTPSQW  461
             KCIG+QRC+V ISN+NFG DPCPNV+K+L+VEAVC P+ W
Sbjct  806   KCIGKQRCAVTISNSNFGQDPCPNVMKKLSVEAVCAPTNW  845



>ref|XP_011025878.1| PREDICTED: beta-galactosidase 3 [Populus euphratica]
Length=847

 Score =   356 bits (913),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 170/220 (77%), Positives = 197/220 (90%), Gaps = 1/220 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A FNAP+GDEPLALDM  MGKGQ+WING+S+GRYWTAYA+GNCNGC YAG F+P KCQLG
Sbjct  626   AYFNAPEGDEPLALDMEGMGKGQIWINGQSIGRYWTAYASGNCNGCSYAGTFRPTKCQLG  685

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQRWYHVPRS LKPT NLLV+FEELGGDP+RISLV+RS++SVC +V E HP I+NW
Sbjct  686   CGQPTQRWYHVPRSWLKPTNNLLVVFEELGGDPSRISLVKRSLASVCAEVSEFHPTIKNW  745

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
             +IESYGR +E   PK+HL CS GQSI+SIKFASFGTPLGTCGS+QQG CHASTSY++LEK
Sbjct  746   QIESYGRAEEFHNPKVHLRCSVGQSITSIKFASFGTPLGTCGSYQQGACHASTSYAILEK  805

Query  577   KCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTPSQW  461
             KCIG+QRC+V ISN+NFG DPCPNV+K+L+VEAVC P+ W
Sbjct  806   KCIGKQRCAVTISNSNFGQDPCPNVMKKLSVEAVCAPTNW  845



>ref|XP_007046794.1| Beta-galactosidase 3 isoform 1 [Theobroma cacao]
 gb|EOX90951.1| Beta-galactosidase 3 isoform 1 [Theobroma cacao]
Length=854

 Score =   355 bits (912),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 167/217 (77%), Positives = 197/217 (91%), Gaps = 1/217 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A FNAP+GDEPLALDM SMGKGQ+WING+S+GRYWTAYA G+CNGC YAG F+PPKCQLG
Sbjct  626   AYFNAPEGDEPLALDMESMGKGQIWINGQSIGRYWTAYAHGDCNGCSYAGTFRPPKCQLG  685

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQRWYHVPRS LKPT+NLLV+FEELG DP+RIS+++RSVSSVC +V E HPNI+NW
Sbjct  686   CGQPTQRWYHVPRSWLKPTQNLLVIFEELGADPSRISVMKRSVSSVCAEVSEYHPNIKNW  745

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
             +IESYG+ +E  +PK+HLHC+PGQ+IS IKFASFGTPLGTCGS+QQGPCHA  SY++LEK
Sbjct  746   QIESYGKAEEFHRPKVHLHCNPGQAISFIKFASFGTPLGTCGSYQQGPCHAPASYAILEK  805

Query  577   KCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTP  470
             KCIG+QRC+V I+N+NFG DPCPNV+KRL+VEA C P
Sbjct  806   KCIGKQRCAVTIANSNFGQDPCPNVLKRLSVEAACAP  842



>ref|XP_012078404.1| PREDICTED: beta-galactosidase 3 [Jatropha curcas]
Length=848

 Score =   355 bits (911),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 165/220 (75%), Positives = 197/220 (90%), Gaps = 1/220 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A FNAPDGDEPLALDM  MGKGQ+W+NG+S+GRYWTAYATGNCNGC YAG F+PPKCQ+G
Sbjct  627   AYFNAPDGDEPLALDMEGMGKGQIWVNGQSIGRYWTAYATGNCNGCSYAGSFRPPKCQVG  686

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQRWYHVPRS LKPT+NLLV+FEELGG+P+RISLV+R+++SVC +V E HP I+NW
Sbjct  687   CGQPTQRWYHVPRSWLKPTQNLLVVFEELGGNPSRISLVKRAMTSVCAEVAEFHPTIKNW  746

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
              IESYGR +E   PK+H+ CS GQSIS+IKFASFGTPLGTCGS+QQGPCH+  SY+++EK
Sbjct  747   HIESYGRAEEFHSPKVHIRCSLGQSISAIKFASFGTPLGTCGSYQQGPCHSPASYAIVEK  806

Query  577   KCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTPSQW  461
             KC+G+QRC+V ISN+NFG DPCPNV+KRL+VEAVC P+ W
Sbjct  807   KCVGKQRCTVTISNSNFGQDPCPNVLKRLSVEAVCAPTNW  846



>ref|XP_011083163.1| PREDICTED: beta-galactosidase 3 [Sesamum indicum]
Length=845

 Score =   354 bits (908),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 170/217 (78%), Positives = 194/217 (89%), Gaps = 1/217 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A F+APDGDEPLALDMSSMGKGQ+W+NG+SLGRYWTAYA G+C+GC Y G FKP KCQ+G
Sbjct  627   AYFSAPDGDEPLALDMSSMGKGQLWVNGQSLGRYWTAYAAGDCSGCSYTGIFKPQKCQVG  686

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQRWYH+PRS LKPT+NLLVLFEE+GGDPTRI LV+RSV+SVC DV E HPNI+NW
Sbjct  687   CGQPTQRWYHLPRSWLKPTQNLLVLFEEIGGDPTRIILVKRSVTSVCADVAEYHPNIKNW  746

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
             ++ESYG+ +E  KP++HLHC PGQSISSIKFASFGTPLGTCGSFQQG CHA TSY+VL K
Sbjct  747   QVESYGKMEEFRKPRVHLHCGPGQSISSIKFASFGTPLGTCGSFQQGTCHAPTSYTVLAK  806

Query  577   KCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTP  470
             KCIG+QRCSV ISN NFG DPCPN+ KRL+VEA+C P
Sbjct  807   KCIGQQRCSVTISNRNFGRDPCPNISKRLSVEAICAP  843



>ref|XP_006340680.1| PREDICTED: beta-galactosidase 3-like [Solanum tuberosum]
Length=845

 Score =   352 bits (904),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 169/219 (77%), Positives = 200/219 (91%), Gaps = 1/219 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A FN P+GDEPLALDMSSMGKGQVWING+S+GRYWTAYATG+CNGC Y+G F+PPKCQLG
Sbjct  626   AYFNTPEGDEPLALDMSSMGKGQVWINGQSIGRYWTAYATGDCNGCQYSGTFRPPKCQLG  685

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CG+PTQ+WYHVPRS LKPT+NLLVLFEELGGDPTRISLV+RSV++VC +V E HPNI+NW
Sbjct  686   CGEPTQKWYHVPRSWLKPTQNLLVLFEELGGDPTRISLVKRSVTNVCSNVAEYHPNIKNW  745

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
             +IE+YG+T+E   PK+ +HC+PGQSISSIKFASFGTPLGTCGSF+QG CHA  S++V+EK
Sbjct  746   QIENYGKTEEFHLPKVRIHCAPGQSISSIKFASFGTPLGTCGSFKQGTCHAPDSHAVVEK  805

Query  577   KCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTPSQ  464
             KC+GRQ C+V ISN+NFG DPCPNV+KRL+VEA CTP+Q
Sbjct  806   KCLGRQSCAVTISNSNFGEDPCPNVLKRLSVEAHCTPTQ  844



>gb|ADO34791.1| beta-galactosidase STBG6 [Solanum lycopersicum]
Length=845

 Score =   352 bits (903),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 169/219 (77%), Positives = 200/219 (91%), Gaps = 1/219 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A FN P+GDEPLALDMSSMGKGQVWING+S+GRYWTAYATG+CNGC Y+G F+PPKCQLG
Sbjct  626   AYFNTPEGDEPLALDMSSMGKGQVWINGQSIGRYWTAYATGDCNGCQYSGVFRPPKCQLG  685

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CG+PTQ+WYHVPRS LKPT+NLLVLFEELGGDPTRISLV+RSV++VC +V E HPNI+NW
Sbjct  686   CGEPTQKWYHVPRSWLKPTQNLLVLFEELGGDPTRISLVKRSVTNVCSNVAEYHPNIKNW  745

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
             +IE+YG+T+E   PK+ +HC+PGQSISSIKFASFGTPLGTCGSF+QG CHA  S++V+EK
Sbjct  746   QIENYGKTEEFHLPKVRIHCAPGQSISSIKFASFGTPLGTCGSFKQGTCHAPDSHAVVEK  805

Query  577   KCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTPSQ  464
             KC+GRQ C+V ISN+NFG DPCPNV+KRL+VEA CTP+Q
Sbjct  806   KCLGRQTCAVTISNSNFGEDPCPNVLKRLSVEAHCTPTQ  844



>ref|NP_001234317.1| TBG6 protein precursor [Solanum lycopersicum]
 gb|AAF70825.1|AF154424_1 putative beta-galactosidase [Solanum lycopersicum]
Length=845

 Score =   352 bits (902),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 169/219 (77%), Positives = 200/219 (91%), Gaps = 1/219 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A FN P+GDEPLALDMSSMGKGQVWING+S+GRYWTAYATG+CNGC Y+G F+PPKCQLG
Sbjct  626   AYFNTPEGDEPLALDMSSMGKGQVWINGQSIGRYWTAYATGDCNGCQYSGVFRPPKCQLG  685

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CG+PTQ+WYHVPRS LKPT+NLLVLFEELGGDPTRISLV+RSV++VC +V E HPNI+NW
Sbjct  686   CGEPTQKWYHVPRSWLKPTQNLLVLFEELGGDPTRISLVKRSVTNVCSNVAEYHPNIKNW  745

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
             +IE+YG+T+E   PK+ +HC+PGQSISSIKFASFGTPLGTCGSF+QG CHA  S++V+EK
Sbjct  746   QIENYGKTEEFHLPKVRIHCAPGQSISSIKFASFGTPLGTCGSFKQGTCHAPDSHAVVEK  805

Query  577   KCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTPSQ  464
             KC+GRQ C+V ISN+NFG DPCPNV+KRL+VEA CTP+Q
Sbjct  806   KCLGRQTCAVTISNSNFGEDPCPNVLKRLSVEAHCTPTQ  844



>ref|XP_007158611.1| hypothetical protein PHAVU_002G1672001g, partial [Phaseolus vulgaris]
 gb|ESW30605.1| hypothetical protein PHAVU_002G1672001g, partial [Phaseolus vulgaris]
Length=487

 Score =   341 bits (874),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 162/218 (74%), Positives = 190/218 (87%), Gaps = 1/218 (0%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLGCG  932
             F+APDGDEPLALDM  MGKGQ+WING S+GRYWTA A G+C GC YAG F+PPKCQ+GCG
Sbjct  268   FDAPDGDEPLALDMEGMGKGQIWINGLSIGRYWTALAAGDCKGCSYAGTFRPPKCQVGCG  327

Query  931   QPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWEI  752
             QPTQRWYHVPRS LKP  NLLV+FEELGGDP++ISL +RSVSSVC DV E   N+RNW I
Sbjct  328   QPTQRWYHVPRSWLKPNHNLLVVFEELGGDPSKISLAKRSVSSVCADVSEFQSNVRNWHI  387

Query  751   ESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKKC  572
             ESYG+++E   PK+HLHCS GQ+ISSIKFASFGTPLGTCGS++QG CH+ +SYS+LEKKC
Sbjct  388   ESYGKSEEFHPPKVHLHCSSGQTISSIKFASFGTPLGTCGSYEQGVCHSPSSYSILEKKC  447

Query  571   IGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTPSQW  461
             IG+ RC+V +SN+NFG DPCPNV+KRLTVEAVC P++W
Sbjct  448   IGKPRCTVTVSNSNFGHDPCPNVLKRLTVEAVCAPTKW  485



>ref|XP_010437357.1| PREDICTED: beta-galactosidase 3-like [Camelina sativa]
Length=257

 Score =   330 bits (846),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 157/215 (73%), Positives = 190/215 (88%), Gaps = 1/215 (0%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLGCG  932
             F+AP+G+EPLALDM  MGKGQ+W+NGES+GRYWTA+ATG+C  C Y G +KP KCQ GCG
Sbjct  34    FDAPEGNEPLALDMEGMGKGQIWVNGESIGRYWTAFATGDCGHCSYTGTYKPNKCQTGCG  93

Query  931   QPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWEI  752
             QPTQRWYHVPRS LKP++NLLV+FEELGG+P+ ISLV+RSVS VC +V E HPNI+NW+I
Sbjct  94    QPTQRWYHVPRSWLKPSQNLLVIFEELGGNPSTISLVKRSVSGVCAEVSEYHPNIKNWQI  153

Query  751   ESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKKC  572
             ESYG+ Q   +PK+HL CSPGQ+I+SIKFASFGTPLGTCGS+QQG CHA+TSY++LE+KC
Sbjct  154   ESYGKGQTFHRPKVHLKCSPGQAIASIKFASFGTPLGTCGSYQQGECHATTSYAILERKC  213

Query  571   IGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTP  470
             +G+ RC+V ISN+NFG DPCPNV+KRLTVEAVC P
Sbjct  214   VGKARCAVTISNSNFGKDPCPNVLKRLTVEAVCAP  248



>dbj|BAD95183.1| beta-galactosidase like protein [Arabidopsis thaliana]
Length=275

 Score =   331 bits (848),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 155/215 (72%), Positives = 191/215 (89%), Gaps = 1/215 (0%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLGCG  932
             F+AP+G+EPLALDM  MGKGQ+W+NGES+GRYWTA+ATG+C+ C Y G +KP KCQ GCG
Sbjct  52    FDAPEGNEPLALDMEGMGKGQIWVNGESIGRYWTAFATGDCSHCSYTGTYKPNKCQTGCG  111

Query  931   QPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWEI  752
             QPTQRWYHVPR+ LKP++NLLV+FEELGG+P+ +SLV+RSVS VC +V E HPNI+NW+I
Sbjct  112   QPTQRWYHVPRAWLKPSQNLLVIFEELGGNPSTVSLVKRSVSGVCAEVSEYHPNIKNWQI  171

Query  751   ESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKKC  572
             ESYG+ Q   +PK+HL CSPGQ+I+SIKFASFGTPLGTCGS+QQG CHA+TSY++LE+KC
Sbjct  172   ESYGKGQTFHRPKVHLKCSPGQAIASIKFASFGTPLGTCGSYQQGECHAATSYAILERKC  231

Query  571   IGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTP  470
             +G+ RC+V ISN+NFG DPCPNV+KRLTVEAVC P
Sbjct  232   VGKARCAVTISNSNFGKDPCPNVLKRLTVEAVCAP  266



>ref|XP_007156097.1| hypothetical protein PHAVU_003G258300g [Phaseolus vulgaris]
 gb|ESW28091.1| hypothetical protein PHAVU_003G258300g [Phaseolus vulgaris]
Length=847

 Score =   348 bits (893),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 163/216 (75%), Positives = 195/216 (90%), Gaps = 1/216 (0%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLGCG  932
             F+AP+GDEPLALDM  MGKGQ+WING+S+GRYWTA+ATGNCN C+YAG F+PPKCQLGCG
Sbjct  626   FDAPEGDEPLALDMEGMGKGQIWINGQSIGRYWTAFATGNCNDCNYAGSFRPPKCQLGCG  685

Query  931   QPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWEI  752
             QPTQRWYHVPRS LKPT+NLLV+FEELGGDP++ISLV+RSVSSVC DV E HPNI+NW I
Sbjct  686   QPTQRWYHVPRSWLKPTQNLLVIFEELGGDPSKISLVKRSVSSVCADVSEFHPNIKNWHI  745

Query  751   ESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKKC  572
             ESYG+++E   PK+HLHCSPGQ+ISSIKFASFGTPLGTCG++ QG CH+  SY+ LEK+C
Sbjct  746   ESYGKSEEFRPPKVHLHCSPGQTISSIKFASFGTPLGTCGNYVQGACHSPASYATLEKRC  805

Query  571   IGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTPS  467
             +G+ RC++ +SN+NFG DPCPNV+KRL+VEAVC PS
Sbjct  806   VGKSRCTITVSNSNFGQDPCPNVLKRLSVEAVCAPS  841



>ref|XP_010254673.1| PREDICTED: beta-galactosidase 3-like [Nelumbo nucifera]
Length=853

 Score =   348 bits (892),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 164/218 (75%), Positives = 198/218 (91%), Gaps = 1/218 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A FNAP+GDEPLALDM SMGKGQVWING+S+GRYWT +A+G+CNGC Y G F+PPKCQ G
Sbjct  625   AYFNAPEGDEPLALDMGSMGKGQVWINGQSIGRYWTIHASGDCNGCSYTGTFRPPKCQTG  684

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQRWYHVPRS LKPT+NLLV+FEE+GGD +RISLV+RSV+++C DV E HPNI++W
Sbjct  685   CGQPTQRWYHVPRSWLKPTQNLLVVFEEIGGDASRISLVKRSVTTICADVSEWHPNIKSW  744

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
             +IESY RT+E  +PK+HLHC+PGQSIS+IKFASFGTPLGTCGSFQ+G CHA TSYS+L+K
Sbjct  745   QIESYDRTEEFHRPKVHLHCAPGQSISAIKFASFGTPLGTCGSFQRGTCHAPTSYSILDK  804

Query  577   KCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTPS  467
              CIG++RC+V ISN+NFG DPCPNV+KRL+VEAVC+P+
Sbjct  805   MCIGQERCAVTISNSNFGADPCPNVLKRLSVEAVCSPT  842



>ref|XP_004287850.1| PREDICTED: beta-galactosidase 3 [Fragaria vesca subsp. vesca]
Length=853

 Score =   347 bits (890),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 163/215 (76%), Positives = 192/215 (89%), Gaps = 0/215 (0%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLGCG  932
             F+AP+GDEPLALDM  MGKGQ+WING+S+GRYWTA+A G+CNGC YAG FKP KCQ GCG
Sbjct  628   FDAPEGDEPLALDMEGMGKGQIWINGQSVGRYWTAFANGDCNGCSYAGGFKPTKCQTGCG  687

Query  931   QPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWEI  752
             QPTQR+YHVPRS LKPT+NLLV+FEELGGDP+R+S+V+RSVS+VC +V E HP I+NW I
Sbjct  688   QPTQRYYHVPRSWLKPTQNLLVIFEELGGDPSRVSIVKRSVSTVCAEVAEYHPTIKNWHI  747

Query  751   ESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKKC  572
             ESYG+ Q+   PK+HL C+PGQSISSIKFASFGTP GTCG++QQG CHASTSYSV+EKKC
Sbjct  748   ESYGKVQDFHSPKVHLRCNPGQSISSIKFASFGTPFGTCGTYQQGSCHASTSYSVIEKKC  807

Query  571   IGRQRCSVAISNTNFGDPCPNVVKRLTVEAVCTPS  467
             IG+QRC+V ISNTNFGDPCP V+KRL+VEAVC P+
Sbjct  808   IGKQRCAVTISNTNFGDPCPKVLKRLSVEAVCAPT  842



>ref|XP_008241765.1| PREDICTED: beta-galactosidase 3 [Prunus mume]
Length=853

 Score =   345 bits (885),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 164/214 (77%), Positives = 192/214 (90%), Gaps = 0/214 (0%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLGCG  932
             FNAP+GDEPLALDM  MGKGQ+WING+S+GRYWTA+A GNCNGC YAG F+PPKCQ+GCG
Sbjct  628   FNAPEGDEPLALDMEGMGKGQIWINGQSIGRYWTAFANGNCNGCSYAGGFRPPKCQVGCG  687

Query  931   QPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWEI  752
             QPTQR YHVPRS LKP +NLLV+FEELGGDP+RISLV+RSVSSVC +V E HP I+NW I
Sbjct  688   QPTQRVYHVPRSWLKPMQNLLVIFEELGGDPSRISLVKRSVSSVCAEVAEYHPTIKNWHI  747

Query  751   ESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKKC  572
             ESYG+ ++   PK+HL C+PGQ+ISSIKFASFGTPLGTCGS+Q+G CHA+TSYSVL+KKC
Sbjct  748   ESYGKAEDFQSPKVHLRCNPGQAISSIKFASFGTPLGTCGSYQEGTCHATTSYSVLQKKC  807

Query  571   IGRQRCSVAISNTNFGDPCPNVVKRLTVEAVCTP  470
             IG+QRC+V ISN+NFGDPCP V+KRL+VEAVC P
Sbjct  808   IGKQRCAVTISNSNFGDPCPKVLKRLSVEAVCAP  841



>ref|XP_008337843.1| PREDICTED: beta-galactosidase 3 [Malus domestica]
 ref|XP_008363095.1| PREDICTED: beta-galactosidase 3-like [Malus domestica]
Length=853

 Score =   344 bits (883),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 163/215 (76%), Positives = 193/215 (90%), Gaps = 0/215 (0%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLGCG  932
             FN P+G+EPLALD+  MGKGQ+WING+S+GRYWTA+A GNCNGC YAG F+P KCQ GCG
Sbjct  628   FNEPEGNEPLALDLEGMGKGQIWINGQSIGRYWTAFANGNCNGCSYAGGFRPTKCQSGCG  687

Query  931   QPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWEI  752
             QPTQR+YHVPRS LKPT+NLLVLFEELGGDP+RISLV+R+VSSVC +V E HP I+NW I
Sbjct  688   QPTQRYYHVPRSWLKPTQNLLVLFEELGGDPSRISLVKRAVSSVCSEVAEYHPTIKNWHI  747

Query  751   ESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKKC  572
             ESYG+ ++   PK+HL C+PGQ+ISSIKFASFGTPLGTCGS+QQG CHA+TSYSVL+KKC
Sbjct  748   ESYGKVEDFXSPKVHLRCNPGQAISSIKFASFGTPLGTCGSYQQGTCHATTSYSVLQKKC  807

Query  571   IGRQRCSVAISNTNFGDPCPNVVKRLTVEAVCTPS  467
             IG+QRC+V ISN+NFGDPCPNV+KRL+VEAVC P+
Sbjct  808   IGKQRCAVTISNSNFGDPCPNVLKRLSVEAVCAPT  842



>ref|XP_004512085.1| PREDICTED: beta-galactosidase 3-like [Cicer arietinum]
Length=847

 Score =   343 bits (881),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 163/216 (75%), Positives = 194/216 (90%), Gaps = 1/216 (0%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLGCG  932
             F+AP+G+EPLALDM  MGKGQ+WING S+GRYWTA ATG+CNGC YAG F+PPKCQLGCG
Sbjct  628   FDAPEGEEPLALDMDGMGKGQIWINGVSIGRYWTASATGSCNGCSYAGSFRPPKCQLGCG  687

Query  931   QPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWEI  752
             +PTQRWYHVPRS LKP  NLLV+FEELGGDP++ISLV+RSVSSVC DV E HPNI+NW I
Sbjct  688   EPTQRWYHVPRSWLKPNHNLLVVFEELGGDPSKISLVKRSVSSVCADVSEYHPNIKNWHI  747

Query  751   ESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKKC  572
             +SYG+++E   PK+HLHC+PGQ+ISSIKFASFGTPLGTCG+++QG CH+S SY++LEKKC
Sbjct  748   DSYGKSEEFHPPKVHLHCNPGQAISSIKFASFGTPLGTCGNYEQGACHSSASYAILEKKC  807

Query  571   IGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTPS  467
             IG+QRC V +SN+NFG DPCPNV+KRL+VEAVC PS
Sbjct  808   IGKQRCIVTVSNSNFGQDPCPNVLKRLSVEAVCAPS  843



>gb|AAW47739.1| beta-galactosidase [Prunus persica]
Length=853

 Score =   343 bits (880),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 163/214 (76%), Positives = 191/214 (89%), Gaps = 0/214 (0%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLGCG  932
             FNAP+GDEPLALDM  MGKGQ+WING+S+GRYWTA+A GNCNGC YAG F+PPKCQ+GCG
Sbjct  628   FNAPEGDEPLALDMEGMGKGQIWINGQSIGRYWTAFANGNCNGCSYAGGFRPPKCQVGCG  687

Query  931   QPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWEI  752
             QPTQR YHVPRS LKP +NLLV+FEE GGDP+RISLV+RSVSSVC +V E HP I+NW I
Sbjct  688   QPTQRVYHVPRSWLKPMQNLLVIFEEFGGDPSRISLVKRSVSSVCAEVAEYHPTIKNWHI  747

Query  751   ESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKKC  572
             ESYG+ ++   PK+HL C+PGQ+ISSIKFASFGTPLGTCGS+Q+G CHA+TSYSVL+KKC
Sbjct  748   ESYGKAEDFHSPKVHLRCNPGQAISSIKFASFGTPLGTCGSYQEGTCHAATSYSVLQKKC  807

Query  571   IGRQRCSVAISNTNFGDPCPNVVKRLTVEAVCTP  470
             IG+QRC+V ISN+NFGDPCP V+KRL+VEAVC P
Sbjct  808   IGKQRCAVTISNSNFGDPCPKVLKRLSVEAVCAP  841



>ref|XP_003548865.1| PREDICTED: beta-galactosidase 3-like [Glycine max]
Length=848

 Score =   343 bits (879),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 161/216 (75%), Positives = 195/216 (90%), Gaps = 1/216 (0%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLGCG  932
             F+AP+GDEPLALDM  MGKGQ+WING+S+GRYWT +ATGNCN C+YAG F+PPKCQLGCG
Sbjct  627   FDAPEGDEPLALDMEGMGKGQIWINGQSIGRYWTTFATGNCNDCNYAGSFRPPKCQLGCG  686

Query  931   QPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWEI  752
             QPTQRWYHVPRS LKPT+NLLV+FEELGG+P++ISLV+RSVSSVC DV E HPNI+NW I
Sbjct  687   QPTQRWYHVPRSWLKPTQNLLVIFEELGGNPSKISLVKRSVSSVCADVSEYHPNIKNWHI  746

Query  751   ESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKKC  572
             ESYG+++E   PK+HLHCSPGQ+ISSIKFASFGTPLGTCG+++QG CH+  SY++LEK+C
Sbjct  747   ESYGKSEEFHPPKVHLHCSPGQTISSIKFASFGTPLGTCGNYEQGACHSPASYAILEKRC  806

Query  571   IGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTPS  467
             IG+ RC+V +SN+NFG DPCP V+KRL+VEAVC P+
Sbjct  807   IGKPRCTVTVSNSNFGQDPCPKVLKRLSVEAVCAPT  842



>ref|XP_010113483.1| Beta-galactosidase 3 [Morus notabilis]
 gb|EXC35510.1| Beta-galactosidase 3 [Morus notabilis]
Length=847

 Score =   343 bits (879),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 163/215 (76%), Positives = 193/215 (90%), Gaps = 0/215 (0%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLGCG  932
             F+AP+GDEPLALDM  MGKGQ+WING+S+GRYWTA+A GNCN C+YAG FKP KCQ GCG
Sbjct  627   FDAPEGDEPLALDMEGMGKGQIWINGQSIGRYWTAFANGNCNECNYAGGFKPTKCQFGCG  686

Query  931   QPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWEI  752
             QPTQRWYHVPRS L+PT+NLLVLFEELGGDP+RISLVRRSVS+VC +V E HP ++NW I
Sbjct  687   QPTQRWYHVPRSWLRPTQNLLVLFEELGGDPSRISLVRRSVSTVCAEVTEYHPTLKNWHI  746

Query  751   ESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKKC  572
             ESYG+++E   PK+HL CS GQ+ISSIKFASFGTPLGTCGS+QQG CH++ SYSV+EKKC
Sbjct  747   ESYGKSEEFHSPKVHLRCSNGQAISSIKFASFGTPLGTCGSYQQGTCHSAASYSVIEKKC  806

Query  571   IGRQRCSVAISNTNFGDPCPNVVKRLTVEAVCTPS  467
             IG+QRC+V I+N+NFGDPCPNV+KRL+VEAVC P+
Sbjct  807   IGKQRCAVTIANSNFGDPCPNVLKRLSVEAVCGPT  841



>gb|KHN27041.1| Beta-galactosidase 3 [Glycine soja]
Length=848

 Score =   343 bits (879),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 161/216 (75%), Positives = 195/216 (90%), Gaps = 1/216 (0%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLGCG  932
             F+AP+GDEPLALDM  MGKGQ+WING+S+GRYWT +ATGNCN C+YAG F+PPKCQLGCG
Sbjct  627   FDAPEGDEPLALDMEGMGKGQIWINGQSIGRYWTTFATGNCNDCNYAGSFRPPKCQLGCG  686

Query  931   QPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWEI  752
             QPTQRWYHVPRS LKPT+NLLV+FEELGG+P++ISLV+RSVSSVC DV E HPNI+NW I
Sbjct  687   QPTQRWYHVPRSWLKPTQNLLVIFEELGGNPSKISLVKRSVSSVCADVSEYHPNIKNWHI  746

Query  751   ESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKKC  572
             ESYG+++E   PK+HLHCSPGQ+ISSIKFASFGTPLGTCG+++QG CH+  SY++LEK+C
Sbjct  747   ESYGKSEEFHPPKVHLHCSPGQTISSIKFASFGTPLGTCGNYEQGACHSPASYAILEKRC  806

Query  571   IGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTPS  467
             IG+ RC+V +SN+NFG DPCP V+KRL+VEAVC P+
Sbjct  807   IGKPRCTVTVSNSNFGQDPCPKVLKRLSVEAVCAPT  842



>ref|XP_003612093.1| Beta-galactosidase [Medicago truncatula]
Length=504

 Score =   333 bits (854),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 157/216 (73%), Positives = 190/216 (88%), Gaps = 1/216 (0%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLGCG  932
             F+AP+G+EPLALDM  MGKGQ+WING S+GRYWTA ATG+CN C+YAG F+PPKCQLGCG
Sbjct  286   FDAPEGEEPLALDMDGMGKGQIWINGISIGRYWTAIATGSCNDCNYAGSFRPPKCQLGCG  345

Query  931   QPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWEI  752
             QPTQRWYHVPRS LK   NLLV+FEELGGDP++ISL +RSVSSVC DV E HPN++NW I
Sbjct  346   QPTQRWYHVPRSWLKQNHNLLVVFEELGGDPSKISLAKRSVSSVCADVSEYHPNLKNWHI  405

Query  751   ESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKKC  572
             +SYG+++    PK+HLHC+PGQ+ISSIKFASFGTPLGTCGS++QG CH+S+SY +LE+KC
Sbjct  406   DSYGKSENFRPPKVHLHCNPGQAISSIKFASFGTPLGTCGSYEQGACHSSSSYDILEQKC  465

Query  571   IGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTPS  467
             IG+ RC V +SN+NFG DPCPNV+KRL+VEAVC P+
Sbjct  466   IGKPRCIVTVSNSNFGRDPCPNVLKRLSVEAVCAPT  501



>ref|XP_003517202.1| PREDICTED: beta-galactosidase 3-like [Glycine max]
Length=849

 Score =   343 bits (879),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 164/216 (76%), Positives = 193/216 (89%), Gaps = 1/216 (0%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLGCG  932
             F+APDGDEPLALDM  MGKGQ+WING S+GRYWTA A GNCNGC YAG F+PPKCQ+GCG
Sbjct  634   FDAPDGDEPLALDMEGMGKGQIWINGLSIGRYWTALAAGNCNGCSYAGTFRPPKCQVGCG  693

Query  931   QPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWEI  752
             QPTQRWYHVPRS LKP  NLLV+FEELGGDP++ISLV+RSVSSVC DV E HPNIRNW I
Sbjct  694   QPTQRWYHVPRSWLKPDHNLLVVFEELGGDPSKISLVKRSVSSVCADVSEYHPNIRNWHI  753

Query  751   ESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKKC  572
             +SYG+++E   PK+HLHCSPGQ+ISSIKFASFGTPLGTCG++++G CH+STS++ LEKKC
Sbjct  754   DSYGKSEEFHPPKVHLHCSPGQTISSIKFASFGTPLGTCGNYEKGVCHSSTSHATLEKKC  813

Query  571   IGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTPS  467
             IG+ RC+V +SN+NFG DPCPNV+KRL+VEAVC P+
Sbjct  814   IGKPRCTVTVSNSNFGQDPCPNVLKRLSVEAVCAPN  849



>ref|XP_006425593.1| hypothetical protein CICLE_v10024881mg [Citrus clementina]
 ref|XP_006466876.1| PREDICTED: beta-galactosidase 3-like [Citrus sinensis]
 gb|ESR38833.1| hypothetical protein CICLE_v10024881mg [Citrus clementina]
Length=854

 Score =   342 bits (878),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 162/218 (74%), Positives = 194/218 (89%), Gaps = 1/218 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A FNAP+GDEPLALDM  MGKGQ+WING+S+GRYWTAYA G+CNGC+Y G ++P KCQLG
Sbjct  626   AYFNAPEGDEPLALDMEGMGKGQIWINGQSVGRYWTAYAKGDCNGCNYVGGYRPTKCQLG  685

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQRWYHVPRS LKPT+N LV+FEELGG+P+RISLV+RSV+SVC +V E HP I+NW
Sbjct  686   CGQPTQRWYHVPRSWLKPTQNFLVVFEELGGNPSRISLVKRSVTSVCAEVAEYHPTIKNW  745

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
              IESYG+ +E   PK+HL CSPG +ISSIKFASFGTPLGTCGS+QQGPCH+ TSY +LEK
Sbjct  746   HIESYGKPEEFHSPKVHLRCSPGHTISSIKFASFGTPLGTCGSYQQGPCHSPTSYDILEK  805

Query  577   KCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTPS  467
             KC+G+QRC+V ISN+NFG DPCPNV+KRL+VEA+C+P+
Sbjct  806   KCVGKQRCAVTISNSNFGVDPCPNVLKRLSVEAICSPT  843



>gb|KDO71052.1| hypothetical protein CISIN_1g003044mg [Citrus sinensis]
Length=854

 Score =   342 bits (878),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 162/218 (74%), Positives = 194/218 (89%), Gaps = 1/218 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A FNAP+GDEPLALDM  MGKGQ+WING+S+GRYWTAYA G+CNGC+Y G ++P KCQLG
Sbjct  626   AYFNAPEGDEPLALDMEGMGKGQIWINGQSVGRYWTAYAKGDCNGCNYVGGYRPTKCQLG  685

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQRWYHVPRS LKPT+N LV+FEELGG+P+RISLV+RSV+SVC +V E HP I+NW
Sbjct  686   CGQPTQRWYHVPRSWLKPTQNFLVVFEELGGNPSRISLVKRSVTSVCAEVAEYHPTIKNW  745

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
              IESYG+ +E   PK+HL CSPG +ISSIKFASFGTPLGTCGS+QQGPCH+ TSY +LEK
Sbjct  746   HIESYGKPEEFHSPKVHLRCSPGHTISSIKFASFGTPLGTCGSYQQGPCHSPTSYDILEK  805

Query  577   KCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTPS  467
             KC+G+QRC+V ISN+NFG DPCPNV+KRL+VEA+C+P+
Sbjct  806   KCVGKQRCAVTISNSNFGVDPCPNVLKRLSVEAICSPT  843



>gb|AGR44464.1| beta-D-galactosidase 5, partial [Pyrus x bretschneideri]
Length=697

 Score =   338 bits (867),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 160/214 (75%), Positives = 190/214 (89%), Gaps = 0/214 (0%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLGCG  932
             FN P+G EPLALDM  MGKGQ+WING+S+GRYWTA+A GNCNGC YAG F+P KCQ GCG
Sbjct  472   FNEPEGSEPLALDMEGMGKGQIWINGQSIGRYWTAFANGNCNGCSYAGGFRPTKCQSGCG  531

Query  931   QPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWEI  752
             +PTQR+YHVPRS LKPT+NLLVLFEELGGDP+RISLV+R+VSSVC +V E HP I+NW I
Sbjct  532   KPTQRYYHVPRSWLKPTQNLLVLFEELGGDPSRISLVKRAVSSVCSEVAEYHPTIKNWHI  591

Query  751   ESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKKC  572
             ESYG+ ++   PK+HL C+PGQ+ISSIKFASFGTPLGTCGS+Q+G CHA+TSYSV++KKC
Sbjct  592   ESYGKVEDFHSPKVHLRCNPGQAISSIKFASFGTPLGTCGSYQEGTCHATTSYSVVQKKC  651

Query  571   IGRQRCSVAISNTNFGDPCPNVVKRLTVEAVCTP  470
             IG+QRC+V ISN+NFGDPCP V+KRL+VEAVC P
Sbjct  652   IGKQRCAVTISNSNFGDPCPKVLKRLSVEAVCAP  685



>dbj|BAF01862.1| beta-galactosidase like protein [Arabidopsis thaliana]
Length=578

 Score =   334 bits (857),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 155/215 (72%), Positives = 191/215 (89%), Gaps = 1/215 (0%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLGCG  932
             F+AP+G+EPLALDM  MGKGQ+W+NGES+GRYWTA+ATG+C+ C Y G +KP KCQ GCG
Sbjct  355   FDAPEGNEPLALDMEGMGKGQIWVNGESIGRYWTAFATGDCSHCSYTGTYKPNKCQTGCG  414

Query  931   QPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWEI  752
             QPTQRWYHVPR+ LKP++NLLV+FEELGG+P+ +SLV+RSVS VC +V E HPNI+NW+I
Sbjct  415   QPTQRWYHVPRAWLKPSQNLLVIFEELGGNPSTVSLVKRSVSGVCAEVSEYHPNIKNWQI  474

Query  751   ESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKKC  572
             ESYG+ Q   +PK+HL CSPGQ+I+SIKFASFGTPLGTCGS+QQG CHA+TSY++LE+KC
Sbjct  475   ESYGKGQTFHRPKVHLKCSPGQAIASIKFASFGTPLGTCGSYQQGECHAATSYAILERKC  534

Query  571   IGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTP  470
             +G+ RC+V ISN+NFG DPCPNV+KRLTVEAVC P
Sbjct  535   VGKARCAVTISNSNFGKDPCPNVLKRLTVEAVCAP  569



>ref|XP_003520277.1| PREDICTED: beta-galactosidase 3-like [Glycine max]
Length=848

 Score =   341 bits (875),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 161/216 (75%), Positives = 194/216 (90%), Gaps = 1/216 (0%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLGCG  932
             F+AP+GDEPLALDM  MGKGQ+WING+S+GRYWTA+ATGNCN C+YAG F+PPKCQLGCG
Sbjct  627   FDAPEGDEPLALDMEGMGKGQIWINGQSIGRYWTAFATGNCNDCNYAGSFRPPKCQLGCG  686

Query  931   QPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWEI  752
             QPTQRWYHVPRS LK T+NLLV+FEELGG+P++ISLV+RSVSSVC DV E HPNI+NW I
Sbjct  687   QPTQRWYHVPRSWLKTTQNLLVIFEELGGNPSKISLVKRSVSSVCADVSEYHPNIKNWHI  746

Query  751   ESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKKC  572
             ESYG+++E   PK+HLHCSPGQ+ISSIKFASFGTPLGTCG+++QG CH+  SY +LEK+C
Sbjct  747   ESYGKSEEFRPPKVHLHCSPGQTISSIKFASFGTPLGTCGNYEQGACHSPASYVILEKRC  806

Query  571   IGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTPS  467
             IG+ RC+V +SN+NFG DPCP V+KRL+VEAVC P+
Sbjct  807   IGKPRCTVTVSNSNFGQDPCPKVLKRLSVEAVCAPT  842



>ref|XP_008338023.1| PREDICTED: beta-galactosidase 3-like [Malus domestica]
 ref|XP_008367947.1| PREDICTED: beta-galactosidase 3-like [Malus domestica]
Length=853

 Score =   341 bits (875),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 162/214 (76%), Positives = 191/214 (89%), Gaps = 0/214 (0%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLGCG  932
             FN P+G EPLALDM  MGKGQ+WING+S+GRYWTA+A GNCNGC YAG F+P KCQLGCG
Sbjct  628   FNEPEGSEPLALDMEGMGKGQIWINGQSIGRYWTAFANGNCNGCSYAGGFRPTKCQLGCG  687

Query  931   QPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWEI  752
             +PTQR+YHVPRS LKPT+NLLVLFEELGGDP+RISLV+R+VSSVC +V E HP I+NW I
Sbjct  688   KPTQRYYHVPRSWLKPTQNLLVLFEELGGDPSRISLVKRAVSSVCSEVAEYHPTIKNWHI  747

Query  751   ESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKKC  572
             ESYG+ ++   PK+HL C+PGQ+ISSIKFASFGTPLGTCGS+Q+G CHA+TSYSVL+KKC
Sbjct  748   ESYGKVEDFHSPKVHLRCNPGQAISSIKFASFGTPLGTCGSYQEGTCHATTSYSVLQKKC  807

Query  571   IGRQRCSVAISNTNFGDPCPNVVKRLTVEAVCTP  470
             IG+QRC+V ISN+NFGDPCP V+KRL+VEAVC P
Sbjct  808   IGKQRCAVTISNSNFGDPCPKVLKRLSVEAVCAP  841



>gb|KHN00504.1| Beta-galactosidase 3 [Glycine soja]
Length=848

 Score =   341 bits (875),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 161/216 (75%), Positives = 194/216 (90%), Gaps = 1/216 (0%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLGCG  932
             F+AP+GDEPLALDM  MGKGQ+WING+S+GRYWTA+ATGNCN C+YAG F+PPKCQLGCG
Sbjct  627   FDAPEGDEPLALDMEGMGKGQIWINGQSIGRYWTAFATGNCNDCNYAGSFRPPKCQLGCG  686

Query  931   QPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWEI  752
             QPTQRWYHVPRS LK T+NLLV+FEELGG+P++ISLV+RSVSSVC DV E HPNI+NW I
Sbjct  687   QPTQRWYHVPRSWLKTTQNLLVIFEELGGNPSKISLVKRSVSSVCADVSEYHPNIKNWHI  746

Query  751   ESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKKC  572
             ESYG+++E   PK+HLHCSPGQ+ISSIKFASFGTPLGTCG+++QG CH+  SY +LEK+C
Sbjct  747   ESYGKSEEFRPPKVHLHCSPGQTISSIKFASFGTPLGTCGNYEQGACHSPASYVILEKRC  806

Query  571   IGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTPS  467
             IG+ RC+V +SN+NFG DPCP V+KRL+VEAVC P+
Sbjct  807   IGKPRCTVTVSNSNFGQDPCPKVLKRLSVEAVCAPT  842



>ref|XP_004509327.1| PREDICTED: beta-galactosidase 3-like [Cicer arietinum]
Length=851

 Score =   340 bits (872),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 160/215 (74%), Positives = 193/215 (90%), Gaps = 1/215 (0%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLGCG  932
             F+AP+GDEPLALDM  MGKGQ+WING+S+GRYWTA+A GNCN C+YAG F+P KCQLGCG
Sbjct  630   FDAPEGDEPLALDMEGMGKGQIWINGQSIGRYWTAFANGNCNDCNYAGSFRPQKCQLGCG  689

Query  931   QPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWEI  752
             QPTQRWYHVPRS LKPT+NLLV+FEELGG+P++ISLV+RSVSSVC DV E HPNI+NW I
Sbjct  690   QPTQRWYHVPRSWLKPTQNLLVIFEELGGNPSKISLVKRSVSSVCADVSEYHPNIKNWHI  749

Query  751   ESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKKC  572
             +SYG+++E   PK+HLHCSPGQ+ISSIKFASFGTPLGTCG+++QG CH+ TSY++LEKKC
Sbjct  750   DSYGKSEEFHAPKVHLHCSPGQTISSIKFASFGTPLGTCGNYEQGACHSPTSYAILEKKC  809

Query  571   IGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTP  470
             +G+ RC V +SN+NFG DPCP V+KRL+VEAVC P
Sbjct  810   LGKPRCVVTVSNSNFGQDPCPRVMKRLSVEAVCAP  844



>gb|KHN36067.1| Beta-galactosidase 3 [Glycine soja]
Length=849

 Score =   340 bits (871),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 163/216 (75%), Positives = 192/216 (89%), Gaps = 1/216 (0%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLGCG  932
             F+APDGDE LALDM  MGKGQ+WING S+GRYWTA A GNCNGC YAG F+PPKCQ+GCG
Sbjct  634   FDAPDGDERLALDMEGMGKGQIWINGLSIGRYWTALAAGNCNGCSYAGTFRPPKCQVGCG  693

Query  931   QPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWEI  752
             QPTQRWYHVPRS LKP  NLLV+FEELGGDP++ISLV+RSVSSVC DV E HPNIRNW I
Sbjct  694   QPTQRWYHVPRSWLKPDHNLLVVFEELGGDPSKISLVKRSVSSVCADVSEYHPNIRNWHI  753

Query  751   ESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKKC  572
             +SYG+++E   PK+HLHCSPGQ+ISSIKFASFGTPLGTCG++++G CH+STS++ LEKKC
Sbjct  754   DSYGKSEEFHPPKVHLHCSPGQTISSIKFASFGTPLGTCGNYEKGVCHSSTSHATLEKKC  813

Query  571   IGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTPS  467
             IG+ RC+V +SN+NFG DPCPNV+KRL+VEAVC P+
Sbjct  814   IGKPRCTVTVSNSNFGQDPCPNVLKRLSVEAVCAPN  849



>dbj|BAD91082.1| beta-D-galactosidase [Pyrus pyrifolia]
Length=854

 Score =   338 bits (867),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 160/214 (75%), Positives = 190/214 (89%), Gaps = 0/214 (0%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLGCG  932
             FN P+G EPLALDM  MGKGQ+WING+S+GRYWTA+A GNCNGC YAG F+P KCQ GCG
Sbjct  629   FNEPEGSEPLALDMEGMGKGQIWINGQSIGRYWTAFANGNCNGCSYAGGFRPTKCQSGCG  688

Query  931   QPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWEI  752
             +PTQR+YHVPRS LKPT+NLLVLFEELGGDP+RISLV+R+VSSVC +V E HP I+NW I
Sbjct  689   KPTQRYYHVPRSWLKPTQNLLVLFEELGGDPSRISLVKRAVSSVCSEVAEYHPTIKNWHI  748

Query  751   ESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKKC  572
             ESYG+ ++   PK+HL C+PGQ+ISSIKFASFGTPLGTCGS+Q+G CHA+TSYSV++KKC
Sbjct  749   ESYGKVEDFHSPKVHLRCNPGQAISSIKFASFGTPLGTCGSYQEGTCHATTSYSVVQKKC  808

Query  571   IGRQRCSVAISNTNFGDPCPNVVKRLTVEAVCTP  470
             IG+QRC+V ISN+NFGDPCP V+KRL+VEAVC P
Sbjct  809   IGKQRCAVTISNSNFGDPCPKVLKRLSVEAVCAP  842



>ref|XP_008440778.1| PREDICTED: beta-galactosidase 3 [Cucumis melo]
Length=854

 Score =   337 bits (864),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 159/218 (73%), Positives = 191/218 (88%), Gaps = 1/218 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             + F+AP+GDEPLA+DM  MGKGQ+WING S+GRYWTAYATGNC+ C+YAG F+PPKCQ G
Sbjct  627   SNFDAPEGDEPLAIDMRGMGKGQIWINGVSIGRYWTAYATGNCDKCNYAGTFRPPKCQQG  686

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQRWYHVPR+ LKP +NLLV+FEELGG+PT ISLV+RSV+SVC DV E HP ++NW
Sbjct  687   CGQPTQRWYHVPRAWLKPKDNLLVVFEELGGNPTSISLVKRSVTSVCADVSEYHPTLKNW  746

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
              IESYG++++L +PK+HL CS G SI+SIKFASFGTPLGTCGS+QQG CHA  SY +LEK
Sbjct  747   HIESYGKSEDLHRPKVHLKCSAGYSITSIKFASFGTPLGTCGSYQQGTCHAPMSYDILEK  806

Query  577   KCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTPS  467
             +CIG+QRC+V ISNTNFG DPCPNV+KRL+VE VC P+
Sbjct  807   RCIGKQRCAVTISNTNFGQDPCPNVLKRLSVEVVCAPA  844



>ref|XP_004149980.1| PREDICTED: beta-galactosidase 3 [Cucumis sativus]
Length=854

 Score =   337 bits (864),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 158/218 (72%), Positives = 190/218 (87%), Gaps = 1/218 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             + F+AP+GDEPLA+DM  MGKGQ+WING S+GRYWTAYATGNC+ C+YAG F+PPKCQ G
Sbjct  627   SNFDAPEGDEPLAIDMRGMGKGQIWINGVSIGRYWTAYATGNCDKCNYAGTFRPPKCQQG  686

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQRWYHVPR+ LKP +NLLV+FEELGG+PT ISLV+RSV+ VC DV E HP ++NW
Sbjct  687   CGQPTQRWYHVPRAWLKPKDNLLVVFEELGGNPTSISLVKRSVTGVCADVSEYHPTLKNW  746

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
              IESYG++++L +PK+HL CS G SI+SIKFASFGTPLGTCGS+QQG CHA  SY +LEK
Sbjct  747   HIESYGKSEDLHRPKVHLKCSAGYSITSIKFASFGTPLGTCGSYQQGTCHAPMSYDILEK  806

Query  577   KCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTPS  467
             +CIG+QRC+V ISNTNFG DPCPNV+KRL+VE VC P+
Sbjct  807   RCIGKQRCAVTISNTNFGQDPCPNVLKRLSVEVVCAPA  844



>ref|XP_010531064.1| PREDICTED: beta-galactosidase 3 [Tarenaya hassleriana]
Length=855

 Score =   337 bits (863),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 158/217 (73%), Positives = 191/217 (88%), Gaps = 1/217 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A F+AP+GDEPLALDM  MGKGQ+W+NGES+GRYWTA+ATGNCN C YAG +KP KCQ G
Sbjct  630   AFFDAPEGDEPLALDMQGMGKGQIWVNGESIGRYWTAFATGNCNHCSYAGTYKPTKCQTG  689

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQRWYHVPRS LKP +NLLV+FEELGG+P+ ISLV+RSVSSVC ++ E HPNI+NW
Sbjct  690   CGQPTQRWYHVPRSWLKPGQNLLVIFEELGGNPSTISLVKRSVSSVCAEISEYHPNIKNW  749

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
             +IE+YG+ ++   PK+HL C PGQ+ISSIKFASFGTPLGTCGS+QQG CHA  SY++LE+
Sbjct  750   QIENYGKAEDFRTPKVHLRCRPGQTISSIKFASFGTPLGTCGSYQQGQCHAPASYAILER  809

Query  577   KCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTP  470
             KC+G+QRC+V +SN+NFG DPCPNV+KRL+VEAVC P
Sbjct  810   KCVGKQRCAVTVSNSNFGQDPCPNVLKRLSVEAVCDP  846



>ref|XP_003538867.1| PREDICTED: beta-galactosidase 3-like [Glycine max]
Length=853

 Score =   336 bits (862),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 161/216 (75%), Positives = 191/216 (88%), Gaps = 1/216 (0%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLGCG  932
             F+APDGDEPLALDM  MGKGQ+WING S+GRYWTA A G CNGC YAG F+PPKCQ+GCG
Sbjct  634   FDAPDGDEPLALDMEGMGKGQIWINGLSIGRYWTAPAAGICNGCSYAGTFRPPKCQVGCG  693

Query  931   QPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWEI  752
             QPTQRWYHVPRS LKP  NLLV+FEELGGDP++ISLV+RSVSS+C DV E HPNIRNW I
Sbjct  694   QPTQRWYHVPRSWLKPNHNLLVVFEELGGDPSKISLVKRSVSSICADVSEYHPNIRNWHI  753

Query  751   ESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKKC  572
             +SYG+++E   PK+HLHCSP Q+ISSIKFASFGTPLGTCG++++G CH+ TSY+ LEKKC
Sbjct  754   DSYGKSEEFHPPKVHLHCSPSQAISSIKFASFGTPLGTCGNYEKGVCHSPTSYATLEKKC  813

Query  571   IGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTPS  467
             IG+ RC+V +SN+NFG DPCPNV+KRL+VEAVC+P+
Sbjct  814   IGKPRCTVTVSNSNFGQDPCPNVLKRLSVEAVCSPT  849



>gb|KHN41933.1| Beta-galactosidase 3 [Glycine soja]
Length=862

 Score =   336 bits (862),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 161/216 (75%), Positives = 191/216 (88%), Gaps = 1/216 (0%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLGCG  932
             F+APDGDEPLALDM  MGKGQ+WING S+GRYWTA A G CNGC YAG F+PPKCQ+GCG
Sbjct  643   FDAPDGDEPLALDMEGMGKGQIWINGLSIGRYWTAPAAGICNGCSYAGTFRPPKCQVGCG  702

Query  931   QPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWEI  752
             QPTQRWYHVPRS LKP  NLLV+FEELGGDP++ISLV+RSVSS+C DV E HPNIRNW I
Sbjct  703   QPTQRWYHVPRSWLKPNHNLLVVFEELGGDPSKISLVKRSVSSICADVSEYHPNIRNWHI  762

Query  751   ESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKKC  572
             +SYG+++E   PK+HLHCSP Q+ISSIKFASFGTPLGTCG++++G CH+ TSY+ LEKKC
Sbjct  763   DSYGKSEEFHPPKVHLHCSPSQAISSIKFASFGTPLGTCGNYEKGVCHSPTSYATLEKKC  822

Query  571   IGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTPS  467
             IG+ RC+V +SN+NFG DPCPNV+KRL+VEAVC+P+
Sbjct  823   IGKPRCTVTVSNSNFGQDPCPNVLKRLSVEAVCSPT  858



>gb|KFK30264.1| hypothetical protein AALP_AA7G238600 [Arabis alpina]
Length=849

 Score =   335 bits (860),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 157/215 (73%), Positives = 191/215 (89%), Gaps = 1/215 (0%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLGCG  932
             F+AP+GDEPLALDM  MGKGQ+W+NGES+GRYWTA+ATG+C+ C Y G +KP KCQ GCG
Sbjct  626   FDAPEGDEPLALDMEGMGKGQIWVNGESIGRYWTAFATGDCSHCSYTGTYKPNKCQSGCG  685

Query  931   QPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWEI  752
             QPTQRWYHVPRS LKP++NLLV+FEELGG+P+ +SLV+RSVS VC +V E HPNI+NW+I
Sbjct  686   QPTQRWYHVPRSWLKPSQNLLVIFEELGGNPSTVSLVKRSVSGVCAEVSEYHPNIKNWQI  745

Query  751   ESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKKC  572
             ESYG+ Q   +PK+HL CSPGQ+IS+IKFASFGTPLGTCGS+QQG CHA+TSY++LE+KC
Sbjct  746   ESYGKGQTFHRPKVHLKCSPGQAISAIKFASFGTPLGTCGSYQQGECHAATSYAILERKC  805

Query  571   IGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTP  470
             +G+ RC+V ISN+NFG DPCPNV+KRLTVEAVC P
Sbjct  806   VGKARCAVTISNSNFGKDPCPNVLKRLTVEAVCAP  840



>ref|XP_002263382.2| PREDICTED: beta-galactosidase 3 [Vitis vinifera]
 emb|CBI38026.3| unnamed protein product [Vitis vinifera]
Length=846

 Score =   335 bits (858),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 158/217 (73%), Positives = 190/217 (88%), Gaps = 0/217 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A F+APDGDEPLALDM SMGKGQVWING+S+GRYWTAYA GNC+GC Y+G F+  KCQ G
Sbjct  625   AYFDAPDGDEPLALDMGSMGKGQVWINGQSIGRYWTAYAKGNCSGCSYSGTFRTTKCQFG  684

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQRWYHVPRS LKPT+NLLVLFEELGGD ++IS ++RSV++VC +V E HPNI+NW
Sbjct  685   CGQPTQRWYHVPRSWLKPTQNLLVLFEELGGDASKISFMKRSVTTVCAEVSEHHPNIKNW  744

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
              IES  R +E+ KPK+HLHC+ GQSIS+IKFASFGTP GTCG+FQ+G CHA TS +VLEK
Sbjct  745   HIESQERPEEMSKPKVHLHCASGQSISAIKFASFGTPSGTCGNFQKGTCHAPTSQAVLEK  804

Query  577   KCIGRQRCSVAISNTNFGDPCPNVVKRLTVEAVCTPS  467
             KCIG+Q+CSVA+S++NF +PCPN+ K+L+VEAVC PS
Sbjct  805   KCIGQQKCSVAVSSSNFANPCPNMFKKLSVEAVCAPS  841



>ref|XP_010437358.1| PREDICTED: beta-galactosidase 3-like [Camelina sativa]
Length=856

 Score =   333 bits (855),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 157/215 (73%), Positives = 190/215 (88%), Gaps = 1/215 (0%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLGCG  932
             F+AP+G+EPLALDM  MGKGQ+W+NGES+GRYWTA+ATG+C  C Y G +KP KCQ GCG
Sbjct  633   FDAPEGNEPLALDMEGMGKGQIWVNGESIGRYWTAFATGDCGHCSYTGTYKPNKCQTGCG  692

Query  931   QPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWEI  752
             QPTQRWYHVPRS LKP++NLLV+FEELGG+P+ ISLV+RSVS VC +V E HPNI+NW+I
Sbjct  693   QPTQRWYHVPRSWLKPSQNLLVIFEELGGNPSTISLVKRSVSGVCAEVSEYHPNIKNWQI  752

Query  751   ESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKKC  572
             ESYG+ Q   +PK+HL CSPGQ+I+SIKFASFGTPLGTCGS+QQG CHA+TSY++LE+KC
Sbjct  753   ESYGKGQTFHRPKVHLKCSPGQAIASIKFASFGTPLGTCGSYQQGECHATTSYAILERKC  812

Query  571   IGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTP  470
             +G+ RC+V ISN+NFG DPCPNV+KRLTVEAVC P
Sbjct  813   VGKARCAVTISNSNFGKDPCPNVLKRLTVEAVCAP  847



>ref|XP_010446807.1| PREDICTED: beta-galactosidase 3 [Camelina sativa]
Length=856

 Score =   333 bits (854),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 157/215 (73%), Positives = 190/215 (88%), Gaps = 1/215 (0%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLGCG  932
             F+AP+G+EPLALDM  MGKGQ+W+NGES+GRYWTA+ATG+C  C Y G +KP KCQ GCG
Sbjct  633   FDAPEGNEPLALDMEGMGKGQIWVNGESIGRYWTAFATGDCGHCSYTGTYKPNKCQTGCG  692

Query  931   QPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWEI  752
             QPTQRWYHVPRS LKP++NLLV+FEELGG+P+ ISLV+RSVS VC +V E HPNI+NW+I
Sbjct  693   QPTQRWYHVPRSWLKPSQNLLVIFEELGGNPSTISLVKRSVSGVCAEVSEYHPNIKNWQI  752

Query  751   ESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKKC  572
             ESYG+ Q   +PK+HL CSPGQ+I+SIKFASFGTPLGTCGS+QQG CHA+TSY++LE+KC
Sbjct  753   ESYGKGQTFHRPKVHLKCSPGQAIASIKFASFGTPLGTCGSYQQGECHATTSYAILERKC  812

Query  571   IGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTP  470
             +G+ RC+V ISN+NFG DPCPNV+KRLTVEAVC P
Sbjct  813   VGKARCAVTISNSNFGKDPCPNVLKRLTVEAVCAP  847



>ref|XP_003612092.1| Beta-galactosidase [Medicago truncatula]
 gb|AES95050.1| beta-galactosidase [Medicago truncatula]
Length=843

 Score =   333 bits (853),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 157/216 (73%), Positives = 190/216 (88%), Gaps = 1/216 (0%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLGCG  932
             F+AP+G+EPLALDM  MGKGQ+WING S+GRYWTA ATG+CN C+YAG F+PPKCQLGCG
Sbjct  625   FDAPEGEEPLALDMDGMGKGQIWINGISIGRYWTAIATGSCNDCNYAGSFRPPKCQLGCG  684

Query  931   QPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWEI  752
             QPTQRWYHVPRS LK   NLLV+FEELGGDP++ISL +RSVSSVC DV E HPN++NW I
Sbjct  685   QPTQRWYHVPRSWLKQNHNLLVVFEELGGDPSKISLAKRSVSSVCADVSEYHPNLKNWHI  744

Query  751   ESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKKC  572
             +SYG+++    PK+HLHC+PGQ+ISSIKFASFGTPLGTCGS++QG CH+S+SY +LE+KC
Sbjct  745   DSYGKSENFRPPKVHLHCNPGQAISSIKFASFGTPLGTCGSYEQGACHSSSSYDILEQKC  804

Query  571   IGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTPS  467
             IG+ RC V +SN+NFG DPCPNV+KRL+VEAVC P+
Sbjct  805   IGKPRCIVTVSNSNFGRDPCPNVLKRLSVEAVCAPT  840



>ref|NP_568001.1| beta-galactosidase 3 [Arabidopsis thaliana]
 sp|Q9SCV9.1|BGAL3_ARATH RecName: Full=Beta-galactosidase 3; Short=Lactase 3; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAB64739.1| putative beta-galactosidase [Arabidopsis thaliana]
 gb|AAL07134.1| putative beta-galactosidase [Arabidopsis thaliana]
 gb|AAM14371.1| putative beta-galactosidase [Arabidopsis thaliana]
 gb|AEE86646.1| beta-galactosidase 3 [Arabidopsis thaliana]
Length=856

 Score =   333 bits (853),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 155/215 (72%), Positives = 191/215 (89%), Gaps = 1/215 (0%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLGCG  932
             F+AP+G+EPLALDM  MGKGQ+W+NGES+GRYWTA+ATG+C+ C Y G +KP KCQ GCG
Sbjct  633   FDAPEGNEPLALDMEGMGKGQIWVNGESIGRYWTAFATGDCSHCSYTGTYKPNKCQTGCG  692

Query  931   QPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWEI  752
             QPTQRWYHVPR+ LKP++NLLV+FEELGG+P+ +SLV+RSVS VC +V E HPNI+NW+I
Sbjct  693   QPTQRWYHVPRAWLKPSQNLLVIFEELGGNPSTVSLVKRSVSGVCAEVSEYHPNIKNWQI  752

Query  751   ESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKKC  572
             ESYG+ Q   +PK+HL CSPGQ+I+SIKFASFGTPLGTCGS+QQG CHA+TSY++LE+KC
Sbjct  753   ESYGKGQTFHRPKVHLKCSPGQAIASIKFASFGTPLGTCGSYQQGECHAATSYAILERKC  812

Query  571   IGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTP  470
             +G+ RC+V ISN+NFG DPCPNV+KRLTVEAVC P
Sbjct  813   VGKARCAVTISNSNFGKDPCPNVLKRLTVEAVCAP  847



>emb|CAB16852.1| beta-galactosidase like protein [Arabidopsis thaliana]
 emb|CAB80302.1| beta-galactosidase like protein [Arabidopsis thaliana]
Length=853

 Score =   332 bits (852),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 155/215 (72%), Positives = 191/215 (89%), Gaps = 1/215 (0%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLGCG  932
             F+AP+G+EPLALDM  MGKGQ+W+NGES+GRYWTA+ATG+C+ C Y G +KP KCQ GCG
Sbjct  630   FDAPEGNEPLALDMEGMGKGQIWVNGESIGRYWTAFATGDCSHCSYTGTYKPNKCQTGCG  689

Query  931   QPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWEI  752
             QPTQRWYHVPR+ LKP++NLLV+FEELGG+P+ +SLV+RSVS VC +V E HPNI+NW+I
Sbjct  690   QPTQRWYHVPRAWLKPSQNLLVIFEELGGNPSTVSLVKRSVSGVCAEVSEYHPNIKNWQI  749

Query  751   ESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKKC  572
             ESYG+ Q   +PK+HL CSPGQ+I+SIKFASFGTPLGTCGS+QQG CHA+TSY++LE+KC
Sbjct  750   ESYGKGQTFHRPKVHLKCSPGQAIASIKFASFGTPLGTCGSYQQGECHAATSYAILERKC  809

Query  571   IGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTP  470
             +G+ RC+V ISN+NFG DPCPNV+KRLTVEAVC P
Sbjct  810   VGKARCAVTISNSNFGKDPCPNVLKRLTVEAVCAP  844



>ref|XP_002867020.1| hypothetical protein ARALYDRAFT_491000 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43279.1| hypothetical protein ARALYDRAFT_491000 [Arabidopsis lyrata subsp. 
lyrata]
Length=853

 Score =   332 bits (852),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 156/215 (73%), Positives = 191/215 (89%), Gaps = 1/215 (0%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLGCG  932
             F+AP+G+EPLALDM  MGKGQ+W+NGES+GRYWTA+ATG+C+ C Y G +KP KCQ GCG
Sbjct  630   FDAPEGNEPLALDMEGMGKGQIWVNGESIGRYWTAFATGDCSQCSYTGTYKPNKCQTGCG  689

Query  931   QPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWEI  752
             QPTQR+YHVPRS LKP++NLLV+FEELGG+P+ +SLV+RSVS VC +V E HPNI+NW+I
Sbjct  690   QPTQRYYHVPRSWLKPSQNLLVIFEELGGNPSSVSLVKRSVSGVCAEVSEYHPNIKNWQI  749

Query  751   ESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKKC  572
             ESYG+ Q   +PK+HL CSPGQ+I+SIKFASFGTPLGTCGS+QQG CHA+TSY++LE+KC
Sbjct  750   ESYGKGQTFHRPKVHLKCSPGQAIASIKFASFGTPLGTCGSYQQGECHAATSYAILERKC  809

Query  571   IGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTP  470
             +G+ RC+V ISNTNFG DPCPNV+KRLTVEAVC P
Sbjct  810   VGKARCAVTISNTNFGKDPCPNVLKRLTVEAVCAP  844



>dbj|BAF31234.1| beta-D-galactosidase [Persea americana]
Length=849

 Score =   332 bits (851),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 161/219 (74%), Positives = 190/219 (87%), Gaps = 1/219 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A FNAP GDEPLALD+ SMGKGQVWINGES+GRYWTA A G+CN C YAG ++ PKCQ G
Sbjct  628   AYFNAPGGDEPLALDLGSMGKGQVWINGESIGRYWTAAANGDCNHCSYAGTYRAPKCQTG  687

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQRWYHVPRS L+PT+NLLV+FEE+GGD + ISLV+RSVSSVC DV E HP I+NW
Sbjct  688   CGQPTQRWYHVPRSWLQPTKNLLVIFEEIGGDASGISLVKRSVSSVCADVSEWHPTIKNW  747

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
              IESYGR++EL +PK+HL C+ GQSIS+IKFASFGTPLGTCGSFQQGPCH+  S+++LEK
Sbjct  748   HIESYGRSEELHRPKVHLRCAMGQSISAIKFASFGTPLGTCGSFQQGPCHSPNSHAILEK  807

Query  577   KCIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCTPSQ  464
             KCIG+QRC+V IS  NF GDPCPNV+KR+ VEA+CT ++
Sbjct  808   KCIGQQRCAVTISMNNFGGDPCPNVMKRVAVEAICTSTE  846



>ref|XP_006283101.1| hypothetical protein CARUB_v10004117mg [Capsella rubella]
 gb|EOA15999.1| hypothetical protein CARUB_v10004117mg [Capsella rubella]
Length=856

 Score =   332 bits (851),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 155/215 (72%), Positives = 190/215 (88%), Gaps = 1/215 (0%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLGCG  932
             F+AP+G+EPLALDM  MGKGQ+W+NGES+GRYWTA+ATG+C+ C Y G +KP KCQ GCG
Sbjct  633   FDAPEGNEPLALDMEGMGKGQIWVNGESIGRYWTAFATGDCSHCSYTGTYKPNKCQTGCG  692

Query  931   QPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWEI  752
             QPTQRWYHVPRS LKP++NLLV+FEELGG+P+ +SLV+RSVS VC +V E HPNI+NW+I
Sbjct  693   QPTQRWYHVPRSWLKPSQNLLVIFEELGGNPSSVSLVKRSVSGVCAEVSEYHPNIKNWQI  752

Query  751   ESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKKC  572
             ESYG+ Q   +PK+HL CSPGQ+I+SIKFASFGTPLGTCGS+QQG CHA+TSY++L +KC
Sbjct  753   ESYGKGQTFHRPKVHLKCSPGQAIASIKFASFGTPLGTCGSYQQGECHATTSYAILARKC  812

Query  571   IGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTP  470
             +G+ RC+V ISN+NFG DPCPNV+KRLTVEAVC P
Sbjct  813   VGKARCAVTISNSNFGKDPCPNVLKRLTVEAVCAP  847



>dbj|BAJ34544.1| unnamed protein product [Thellungiella halophila]
Length=856

 Score =   329 bits (844),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 154/215 (72%), Positives = 189/215 (88%), Gaps = 1/215 (0%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLGCG  932
             F+AP+G+EPLALDM  MGKGQ+W+NGES+GRYWTA+ATG+C  C Y G +KP KC  GCG
Sbjct  633   FDAPEGNEPLALDMEGMGKGQIWVNGESIGRYWTAFATGDCGHCSYTGTYKPNKCNSGCG  692

Query  931   QPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWEI  752
             QPTQ+WYHVPRS LKP++NLLV+FEELGG+P+ +SLV+RSVS VC +V E HPNI+NW+I
Sbjct  693   QPTQKWYHVPRSWLKPSQNLLVIFEELGGNPSTVSLVKRSVSGVCAEVSEYHPNIKNWQI  752

Query  751   ESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKKC  572
             ESYG+ Q   +PK+HL CSPGQ+IS+IKFASFGTPLGTCGS+QQG CHA+TSY++LE+KC
Sbjct  753   ESYGKGQTFRRPKVHLKCSPGQAISAIKFASFGTPLGTCGSYQQGDCHAATSYAILERKC  812

Query  571   IGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTP  470
             +G+ RC+V ISN+NFG DPCPNV+KRLTVEAVC P
Sbjct  813   VGKARCAVTISNSNFGKDPCPNVLKRLTVEAVCAP  847



>ref|XP_006412011.1| hypothetical protein EUTSA_v10024387mg [Eutrema salsugineum]
 gb|ESQ53464.1| hypothetical protein EUTSA_v10024387mg [Eutrema salsugineum]
Length=856

 Score =   329 bits (844),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 154/215 (72%), Positives = 189/215 (88%), Gaps = 1/215 (0%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLGCG  932
             F+AP+G+EPLALDM  MGKGQ+W+NGES+GRYWTA+ATG+C  C Y G +KP KC  GCG
Sbjct  633   FDAPEGNEPLALDMEGMGKGQIWVNGESIGRYWTAFATGDCGHCSYTGTYKPNKCNSGCG  692

Query  931   QPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWEI  752
             QPTQ+WYHVPRS LKP++NLLV+FEELGG+P+ +SLV+RSVS VC +V E HPNI+NW+I
Sbjct  693   QPTQKWYHVPRSWLKPSQNLLVIFEELGGNPSTVSLVKRSVSGVCAEVSEYHPNIKNWQI  752

Query  751   ESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKKC  572
             ESYG+ Q   +PK+HL CSPGQ+IS+IKFASFGTPLGTCGS+QQG CHA+TSY++LE+KC
Sbjct  753   ESYGKGQTFRRPKVHLKCSPGQAISAIKFASFGTPLGTCGSYQQGDCHAATSYAILERKC  812

Query  571   IGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTP  470
             +G+ RC+V ISN+NFG DPCPNV+KRLTVEAVC P
Sbjct  813   VGKARCAVTISNSNFGKDPCPNVLKRLTVEAVCAP  847



>ref|XP_009145073.1| PREDICTED: beta-galactosidase 3 [Brassica rapa]
Length=856

 Score =   328 bits (840),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 155/217 (71%), Positives = 190/217 (88%), Gaps = 1/217 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A F+AP+G+EPLALDM  MGKGQVW+NGES+GRYWTA+ATG+C  C Y G +KP KC  G
Sbjct  631   AYFDAPEGNEPLALDMEGMGKGQVWVNGESIGRYWTAFATGDCGHCSYTGTYKPNKCLSG  690

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQR+YHVPRS LKP++NLLV+FEELGG+P+ +SLV+RSVS VC +V E HPNI+NW
Sbjct  691   CGQPTQRYYHVPRSWLKPSQNLLVIFEELGGNPSAVSLVKRSVSGVCAEVSEYHPNIKNW  750

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
             +IESYG+ Q   +PK+HL CSPGQ+IS+IKFASFGTPLG CGS+QQG CHA+TSY++LE+
Sbjct  751   QIESYGKGQTFRRPKVHLKCSPGQAISAIKFASFGTPLGKCGSYQQGECHATTSYAILER  810

Query  577   KCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTP  470
             KC+G+ RC+V ISN+NFG DPCPNV+KRLTVEAVC+P
Sbjct  811   KCVGKARCAVTISNSNFGKDPCPNVLKRLTVEAVCSP  847



>emb|CAA18137.1| beta-galactosidase like protein [Arabidopsis thaliana]
Length=853

 Score =   327 bits (839),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 155/218 (71%), Positives = 191/218 (88%), Gaps = 4/218 (2%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLGCG  932
             F+AP+G+EPLALDM  MGKGQ+W+NGES+GRYWTA+ATG+C+ C Y G +KP KCQ GCG
Sbjct  627   FDAPEGNEPLALDMEGMGKGQIWVNGESIGRYWTAFATGDCSHCSYTGTYKPNKCQTGCG  686

Query  931   QPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWEI  752
             QPTQRWYHVPR+ LKP++NLLV+FEELGG+P+ +SLV+RSVS VC +V E HPNI+NW+I
Sbjct  687   QPTQRWYHVPRAWLKPSQNLLVIFEELGGNPSTVSLVKRSVSGVCAEVSEYHPNIKNWQI  746

Query  751   ESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK--  578
             ESYG+ Q   +PK+HL CSPGQ+I+SIKFASFGTPLGTCGS+QQG CHA+TSY++LE+  
Sbjct  747   ESYGKGQTFHRPKVHLKCSPGQAIASIKFASFGTPLGTCGSYQQGECHAATSYAILERYM  806

Query  577   -KCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTP  470
              KC+G+ RC+V ISN+NFG DPCPNV+KRLTVEAVC P
Sbjct  807   QKCVGKARCAVTISNSNFGKDPCPNVLKRLTVEAVCAP  844



>ref|XP_010432182.1| PREDICTED: beta-galactosidase 3-like [Camelina sativa]
Length=856

 Score =   327 bits (839),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 155/215 (72%), Positives = 189/215 (88%), Gaps = 1/215 (0%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLGCG  932
             F+AP+G+EPLALDM  MGKGQ+W+NGES+GRYWTA+ATG+C  C Y G +KP KCQ GCG
Sbjct  633   FDAPEGNEPLALDMEGMGKGQIWVNGESIGRYWTAFATGDCGHCSYTGTYKPNKCQTGCG  692

Query  931   QPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWEI  752
             QPTQRWYHVPRS LKP++NLLV+FEELGG+P+ ISLV+RSVS VC +V E HPNI+NW+I
Sbjct  693   QPTQRWYHVPRSWLKPSQNLLVIFEELGGNPSTISLVKRSVSGVCAEVSEYHPNIKNWQI  752

Query  751   ESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKKC  572
             ESYG+ Q   +PK+HL CSPGQ+I+SIKFASFGTPLGTCG++QQG CHA+TS ++LE+KC
Sbjct  753   ESYGKGQTFHRPKVHLKCSPGQAIASIKFASFGTPLGTCGNYQQGECHATTSCAILERKC  812

Query  571   IGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTP  470
             +G+ RC+V ISN+NFG DPCPNV+KRLTVEAVC P
Sbjct  813   VGKARCAVTISNSNFGKDPCPNVLKRLTVEAVCAP  847



>ref|NP_849506.1| beta-galactosidase 3 [Arabidopsis thaliana]
 gb|AEE86647.1| beta-galactosidase 3 [Arabidopsis thaliana]
Length=855

 Score =   327 bits (837),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 154/215 (72%), Positives = 190/215 (88%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLGCG  932
             F+AP+G+EPLALDM  MGKGQ+W+NGES+GRYWTA+ATG+C+ C Y G +KP KCQ GCG
Sbjct  633   FDAPEGNEPLALDMEGMGKGQIWVNGESIGRYWTAFATGDCSHCSYTGTYKPNKCQTGCG  692

Query  931   QPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWEI  752
             QPTQRWYHVPR+ LKP++NLLV+FEELGG+P+ +SLV+RSVS VC +V E HPNI+NW+I
Sbjct  693   QPTQRWYHVPRAWLKPSQNLLVIFEELGGNPSTVSLVKRSVSGVCAEVSEYHPNIKNWQI  752

Query  751   ESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKKC  572
             ESYG+ Q   +PK+HL CSPGQ+I+SIKFASFGTPLGTCGS+QQG CHA+TSY++LE +C
Sbjct  753   ESYGKGQTFHRPKVHLKCSPGQAIASIKFASFGTPLGTCGSYQQGECHAATSYAILE-RC  811

Query  571   IGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTP  470
             +G+ RC+V ISN+NFG DPCPNV+KRLTVEAVC P
Sbjct  812   VGKARCAVTISNSNFGKDPCPNVLKRLTVEAVCAP  846



>gb|EPS60900.1| beta-galactosidase, partial [Genlisea aurea]
Length=205

 Score =   306 bits (785),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 148/205 (72%), Positives = 172/205 (84%), Gaps = 1/205 (0%)
 Frame = -3

Query  1087  PLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLGCGQPTQRWYH  908
             PLA DM+ MGKGQ+W+NG+SLGRYWTAYA GNC  C Y G F+PPKCQ GCGQPTQRWYH
Sbjct  1     PLAFDMAGMGKGQLWVNGQSLGRYWTAYAAGNCGQCGYEGTFRPPKCQQGCGQPTQRWYH  60

Query  907   VPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWEIESYGRTQE  728
             +PRS +KPT+NL+VL EELGGDP  I LV+RSV SVC DV E HPNIRNW++E+YG+ + 
Sbjct  61    LPRSWIKPTQNLVVLLEELGGDPASIKLVKRSVRSVCADVTEFHPNIRNWQLENYGQPEA  120

Query  727   LPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKKCIGRQRCSV  548
               KPK+HL C  GQ+ISSIKFASFGTP+GTCG F QGPCHA +SYS LEKKC+G++RCSV
Sbjct  121   FHKPKIHLKCGSGQTISSIKFASFGTPMGTCGKFSQGPCHAPSSYSTLEKKCVGKERCSV  180

Query  547   AISNTNFG-DPCPNVVKRLTVEAVC  476
              IS TNFG DPCPNV+KRL+VEA C
Sbjct  181   TISTTNFGQDPCPNVLKRLSVEAAC  205



>ref|XP_004985589.1| PREDICTED: beta-galactosidase 5-like isoform X2 [Setaria italica]
Length=743

 Score =   322 bits (824),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 158/218 (72%), Positives = 184/218 (84%), Gaps = 2/218 (1%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A F  P GDEPLALDM SMGKGQ+WING+S+GRYWTAYA G+C GC Y G F+ PKCQ G
Sbjct  526   AYFETPSGDEPLALDMGSMGKGQIWINGQSIGRYWTAYANGDCKGCSYTGTFRAPKCQAG  585

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQRWYHVPRS L+PT NLLV+FEELGGD ++I+LV+RSVSSVC DV E HPNI+ W
Sbjct  586   CGQPTQRWYHVPRSWLQPTRNLLVVFEELGGDSSKIALVKRSVSSVCADVSEDHPNIKKW  645

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
             +IESYG  +E  + K+HL C+PGQSIS+IKFASFGTP+GTCGSFQQG CH++ S++VLEK
Sbjct  646   QIESYGE-REYHRAKVHLKCAPGQSISAIKFASFGTPMGTCGSFQQGDCHSANSHTVLEK  704

Query  577   KCIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCTPS  467
             KCIG QRC VAIS  NF GDPCPNV KR+ VEAVC+P+
Sbjct  705   KCIGLQRCVVAISPENFGGDPCPNVTKRVAVEAVCSPT  742



>emb|CDY59693.1| BnaC07g51120D [Brassica napus]
Length=856

 Score =   322 bits (826),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 151/215 (70%), Positives = 188/215 (87%), Gaps = 1/215 (0%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLGCG  932
             F+A +GDEPLALDM  MGKGQ+W+NGES+GRYWTA+ATG+C+ C Y G +KP KC  GCG
Sbjct  633   FDASEGDEPLALDMEGMGKGQIWVNGESIGRYWTAFATGDCDHCSYTGTYKPNKCLSGCG  692

Query  931   QPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWEI  752
             QPTQR+YHVPRS LKP++NLLV+FEE+ G+P+ +SLV+RSVS VC +V E HPNI+NW++
Sbjct  693   QPTQRYYHVPRSWLKPSQNLLVIFEEIEGNPSAVSLVKRSVSGVCAEVSEYHPNIKNWQL  752

Query  751   ESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKKC  572
             ESYG+ Q   +PK+HL CSPGQ+IS+IKFASFGTPLG CGS+Q+G CHA+TSY++LEKKC
Sbjct  753   ESYGKGQTFHRPKVHLKCSPGQAISAIKFASFGTPLGKCGSYQEGECHAATSYAILEKKC  812

Query  571   IGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTP  470
             +G+ RC+V ISNTNFG DPCPNV+KRLTVEAVC+P
Sbjct  813   VGKARCAVTISNTNFGKDPCPNVLKRLTVEAVCSP  847



>gb|AAG12249.1|AF184080_1 beta-galactosidase [Prunus armeniaca]
Length=376

 Score =   308 bits (788),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 148/216 (69%), Positives = 182/216 (84%), Gaps = 1/216 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A FNAP GDEPLALDM SMGKGQVWING+S+GRYW AYA G+C+ C Y G F+P KCQLG
Sbjct  149   AYFNAPGGDEPLALDMRSMGKGQVWINGQSIGRYWMAYANGDCSLCSYIGTFRPTKCQLG  208

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQRWYHVPRS LKPT+NL+V+FEELGGDP++I+LV+RSV+ VC D+ E HPN   +
Sbjct  209   CGQPTQRWYHVPRSWLKPTKNLMVMFEELGGDPSKITLVKRSVAGVCADLQEHHPNAEKF  268

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
             +I+S+  ++ L + ++HL C PGQSISSIKFASFGTP GTCGSFQQG CHA+ S++++EK
Sbjct  269   DIDSHEESKTLHQAQVHLQCVPGQSISSIKFASFGTPTGTCGSFQQGTCHATNSHAIVEK  328

Query  577   KCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCT  473
              CIGR+ C V +SN+ FG DPCPNV+KRL+VEAVC+
Sbjct  329   NCIGRESCLVTVSNSIFGTDPCPNVLKRLSVEAVCS  364



>ref|XP_004985588.1| PREDICTED: beta-galactosidase 5-like isoform X1 [Setaria italica]
Length=841

 Score =   321 bits (822),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 158/218 (72%), Positives = 184/218 (84%), Gaps = 2/218 (1%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A F  P GDEPLALDM SMGKGQ+WING+S+GRYWTAYA G+C GC Y G F+ PKCQ G
Sbjct  624   AYFETPSGDEPLALDMGSMGKGQIWINGQSIGRYWTAYANGDCKGCSYTGTFRAPKCQAG  683

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQRWYHVPRS L+PT NLLV+FEELGGD ++I+LV+RSVSSVC DV E HPNI+ W
Sbjct  684   CGQPTQRWYHVPRSWLQPTRNLLVVFEELGGDSSKIALVKRSVSSVCADVSEDHPNIKKW  743

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
             +IESYG  +E  + K+HL C+PGQSIS+IKFASFGTP+GTCGSFQQG CH++ S++VLEK
Sbjct  744   QIESYGE-REYHRAKVHLKCAPGQSISAIKFASFGTPMGTCGSFQQGDCHSANSHTVLEK  802

Query  577   KCIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCTPS  467
             KCIG QRC VAIS  NF GDPCPNV KR+ VEAVC+P+
Sbjct  803   KCIGLQRCVVAISPENFGGDPCPNVTKRVAVEAVCSPT  840



>ref|XP_009396354.1| PREDICTED: beta-galactosidase 5-like [Musa acuminata subsp. malaccensis]
Length=848

 Score =   317 bits (813),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 154/219 (70%), Positives = 184/219 (84%), Gaps = 2/219 (1%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYA-TGNCNGCHYAGPFKPPKCQL  941
             A F+APDGDEPLALDM+SMGKG VWING+S+GRYWTAYA   NC  C Y G ++ PKCQ 
Sbjct  625   AYFDAPDGDEPLALDMASMGKGHVWINGQSIGRYWTAYAPKENCKSCSYTGTYRSPKCQS  684

Query  940   GCGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRN  761
             GCGQPTQRWYHVPRS L+PT NLLV+FEELGGD T+I+L+ RSVSSVC DV E HP I+N
Sbjct  685   GCGQPTQRWYHVPRSWLQPTRNLLVVFEELGGDATKIALMMRSVSSVCADVSEWHPTIKN  744

Query  760   WEIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLE  581
             W IESYG  +E  KPK+HL C+PGQSIS+IKFAS+GTPLGTCG+FQQG CH+  S+++LE
Sbjct  745   WHIESYGEPEEYRKPKVHLRCAPGQSISAIKFASYGTPLGTCGNFQQGACHSPNSHTILE  804

Query  580   KKCIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCTPS  467
             KKCIG+++C VAIS  NF GDPCPNV+K++ VEAVC+ +
Sbjct  805   KKCIGKEKCVVAISQANFGGDPCPNVMKKVAVEAVCSSA  843



>gb|AAM22973.1|AF499737_1 beta-galactosidase [Oryza sativa Japonica Group]
 gb|AAM34271.1|AF508799_1 beta-galactosidase [Oryza sativa Japonica Group]
Length=843

 Score =   317 bits (812),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 154/218 (71%), Positives = 181/218 (83%), Gaps = 2/218 (1%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A F+ P GDEPLALDM SMGKGQ+WING+S+GRYWTAYA G+C GCHY G ++ PKCQ G
Sbjct  626   AYFDTPSGDEPLALDMGSMGKGQIWINGQSIGRYWTAYAEGDCKGCHYTGSYRAPKCQAG  685

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQRWYHVPRS L+PT NLLV+FEELGGD ++I+L +R+VS VC DV E HPNI+NW
Sbjct  686   CGQPTQRWYHVPRSWLQPTRNLLVVFEELGGDSSKIALAKRTVSGVCADVSEYHPNIKNW  745

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
             +IESYG   E    K+HL C+PGQ+IS+IKFASFGTPLGTCG+FQQG CH+  S SVLEK
Sbjct  746   QIESYGEP-EFHTAKVHLKCAPGQTISAIKFASFGTPLGTCGTFQQGECHSINSNSVLEK  804

Query  577   KCIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCTPS  467
             KCIG QRC VAIS +NF GDPCP V+KR+ VEAVC+ +
Sbjct  805   KCIGLQRCVVAISPSNFGGDPCPEVMKRVAVEAVCSTA  842



>ref|NP_001049068.1| Os03g0165400 [Oryza sativa Japonica Group]
 sp|Q10RB4.1|BGAL5_ORYSJ RecName: Full=Beta-galactosidase 5; Short=Lactase 5; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|ABF94149.1| Beta-galactosidase precursor, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF10982.1| Os03g0165400 [Oryza sativa Japonica Group]
 dbj|BAG95436.1| unnamed protein product [Oryza sativa Japonica Group]
Length=841

 Score =   317 bits (812),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 154/218 (71%), Positives = 181/218 (83%), Gaps = 2/218 (1%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A F+ P GDEPLALDM SMGKGQ+WING+S+GRYWTAYA G+C GCHY G ++ PKCQ G
Sbjct  624   AYFDTPSGDEPLALDMGSMGKGQIWINGQSIGRYWTAYAEGDCKGCHYTGSYRAPKCQAG  683

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQRWYHVPRS L+PT NLLV+FEELGGD ++I+L +R+VS VC DV E HPNI+NW
Sbjct  684   CGQPTQRWYHVPRSWLQPTRNLLVVFEELGGDSSKIALAKRTVSGVCADVSEYHPNIKNW  743

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
             +IESYG   E    K+HL C+PGQ+IS+IKFASFGTPLGTCG+FQQG CH+  S SVLEK
Sbjct  744   QIESYGEP-EFHTAKVHLKCAPGQTISAIKFASFGTPLGTCGTFQQGECHSINSNSVLEK  802

Query  577   KCIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCTPS  467
             KCIG QRC VAIS +NF GDPCP V+KR+ VEAVC+ +
Sbjct  803   KCIGLQRCVVAISPSNFGGDPCPEVMKRVAVEAVCSTA  840



>ref|XP_008809207.1| PREDICTED: beta-galactosidase 5-like [Phoenix dactylifera]
Length=852

 Score =   317 bits (811),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 155/219 (71%), Positives = 187/219 (85%), Gaps = 2/219 (1%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYA-TGNCNGCHYAGPFKPPKCQL  941
             A F+AP GD+PLALDM SMGKGQVWING+S+GRYW+ +A  G+C GC+YAG ++ P CQ 
Sbjct  629   AYFDAPAGDDPLALDMGSMGKGQVWINGQSVGRYWSLWAPDGDCKGCNYAGTYRSPNCQS  688

Query  940   GCGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRN  761
             GCGQPTQRWYHVPRS L+P +NLLV+FEELGGD T+ISLV++SVSSVC DV E HP I+N
Sbjct  689   GCGQPTQRWYHVPRSWLQPAQNLLVVFEELGGDATKISLVKKSVSSVCADVSEWHPTIKN  748

Query  760   WEIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLE  581
             W IESYG+  E  KPK+HL C+PGQSIS+IKFASFGTPLGTCG+FQQG CH++ S+S LE
Sbjct  749   WHIESYGQPVEHHKPKVHLRCAPGQSISAIKFASFGTPLGTCGNFQQGACHSTNSHSTLE  808

Query  580   KKCIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCTPS  467
             KKCIG+QRC+V IS  NF GDPCPNV+KR+ VEA+C+P+
Sbjct  809   KKCIGQQRCAVTISTDNFGGDPCPNVMKRVAVEAICSPT  847



>gb|EEE58382.1| hypothetical protein OsJ_09539 [Oryza sativa Japonica Group]
Length=851

 Score =   317 bits (811),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 154/218 (71%), Positives = 181/218 (83%), Gaps = 2/218 (1%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A F+ P GDEPLALDM SMGKGQ+WING+S+GRYWTAYA G+C GCHY G ++ PKCQ G
Sbjct  634   AYFDTPSGDEPLALDMGSMGKGQIWINGQSIGRYWTAYAEGDCKGCHYTGSYRAPKCQAG  693

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQRWYHVPRS L+PT NLLV+FEELGGD ++I+L +R+VS VC DV E HPNI+NW
Sbjct  694   CGQPTQRWYHVPRSWLQPTRNLLVVFEELGGDSSKIALAKRTVSGVCADVSEYHPNIKNW  753

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
             +IESYG   E    K+HL C+PGQ+IS+IKFASFGTPLGTCG+FQQG CH+  S SVLEK
Sbjct  754   QIESYGEP-EFHTAKVHLKCAPGQTISAIKFASFGTPLGTCGTFQQGECHSINSNSVLEK  812

Query  577   KCIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCTPS  467
             KCIG QRC VAIS +NF GDPCP V+KR+ VEAVC+ +
Sbjct  813   KCIGLQRCVVAISPSNFGGDPCPEVMKRVAVEAVCSTA  850



>ref|XP_010917686.1| PREDICTED: beta-galactosidase 5-like [Elaeis guineensis]
Length=849

 Score =   317 bits (811),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 153/217 (71%), Positives = 185/217 (85%), Gaps = 2/217 (1%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYA-TGNCNGCHYAGPFKPPKCQL  941
             A F+AP GD+PLALDM SMGKGQ WING+S+GRYW+ +A  G+CNGC+YAG ++ PKCQ 
Sbjct  626   AYFDAPAGDDPLALDMGSMGKGQAWINGQSIGRYWSLWAPNGDCNGCNYAGTYRSPKCQS  685

Query  940   GCGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRN  761
             GCGQPTQRWYHVPRS L+PT+NLLV+FEELGGD T+IS V++SVS VC DV E HP I+N
Sbjct  686   GCGQPTQRWYHVPRSWLQPTQNLLVVFEELGGDATKISFVKKSVSGVCADVSEWHPMIKN  745

Query  760   WEIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLE  581
             W IESYG+ +E  KPK+HL C+PGQSIS+IKFASFGTPLGTCG+F+QG CH+  S+S LE
Sbjct  746   WHIESYGQPEEHHKPKVHLRCAPGQSISAIKFASFGTPLGTCGNFEQGACHSPNSHSTLE  805

Query  580   KKCIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             KKCIG+QRC+V IS  NF GDPCPNV+KR+ VEA+C+
Sbjct  806   KKCIGQQRCAVTISTDNFGGDPCPNVMKRVAVEAICS  842



>ref|XP_002465807.1| hypothetical protein SORBIDRAFT_01g046160 [Sorghum bicolor]
 gb|EER92805.1| hypothetical protein SORBIDRAFT_01g046160 [Sorghum bicolor]
Length=842

 Score =   316 bits (810),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 156/218 (72%), Positives = 184/218 (84%), Gaps = 2/218 (1%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A F  P GDEPLALDM SMGKGQ+WING+S+GRYWTAYA G+C  C Y G F+ PKCQ G
Sbjct  625   AYFETPSGDEPLALDMGSMGKGQIWINGQSIGRYWTAYADGDCKECSYTGTFRAPKCQAG  684

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQRWYHVPRS L+PT NLLV+FEELGGD ++I+LV+RSVSSVC DV E HPNI+NW
Sbjct  685   CGQPTQRWYHVPRSWLQPTRNLLVVFEELGGDSSKIALVKRSVSSVCADVSEDHPNIKNW  744

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
             +IESYG  +E  + K+HL CSPGQSIS+IKFASFGTP+GTCG+FQQG CH++ S++VLEK
Sbjct  745   QIESYGE-REYHRAKVHLRCSPGQSISAIKFASFGTPMGTCGNFQQGDCHSANSHTVLEK  803

Query  577   KCIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCTPS  467
             KCIG QRC+VAIS  +F GDPCP V KR+ VEAVC+P+
Sbjct  804   KCIGLQRCAVAISPESFGGDPCPRVTKRVAVEAVCSPT  841



>ref|XP_008452119.1| PREDICTED: beta-galactosidase 3-like [Cucumis melo]
Length=846

 Score =   316 bits (810),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 149/217 (69%), Positives = 183/217 (84%), Gaps = 5/217 (2%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A F+AP+G+EPLALDM  MGKGQ+WING+S+GRYWTAYA GNC+ C+YA  F+PPKCQLG
Sbjct  625   AYFDAPEGEEPLALDMEGMGKGQIWINGQSIGRYWTAYARGNCSRCNYATAFRPPKCQLG  684

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQRWYHVPRS L+P +NLLV+FEE+GG+P+RIS+V+R V+SVCGDV E HP  +NW
Sbjct  685   CGQPTQRWYHVPRSWLRPEQNLLVVFEEVGGNPSRISIVKRLVTSVCGDVSEFHPTFKNW  744

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
              I     T +   PK+HL C PGQ ISSIKFASFGTPLGTCGS+QQG CHA +S  +LEK
Sbjct  745   HI-----TAKFHAPKVHLSCDPGQYISSIKFASFGTPLGTCGSYQQGTCHAPSSRGILEK  799

Query  577   KCIGRQRCSVAISNTNFGDPCPNVVKRLTVEAVCTPS  467
             KC+G+QRC++ +SN+NF DPCPN++KRL+VEAVC P+
Sbjct  800   KCVGKQRCAITVSNSNFEDPCPNMMKRLSVEAVCNPT  836



>ref|XP_009418405.1| PREDICTED: beta-galactosidase 5-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=847

 Score =   316 bits (809),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 152/219 (69%), Positives = 187/219 (85%), Gaps = 2/219 (1%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYA-TGNCNGCHYAGPFKPPKCQL  941
             A F+APDG++PLALDM SMGKGQVWING+S+GRYWTAYA  G+CN C Y G ++ PKCQ 
Sbjct  624   AYFDAPDGNDPLALDMGSMGKGQVWINGQSIGRYWTAYAPNGDCNSCSYIGTYRSPKCQS  683

Query  940   GCGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRN  761
              CGQPTQRWYHVPRS L+PT NLLV+FEE+GGD T+IS+++RSVSSVC DV E HP I+N
Sbjct  684   NCGQPTQRWYHVPRSWLQPTRNLLVIFEEVGGDATKISMMKRSVSSVCADVSEWHPTIKN  743

Query  760   WEIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLE  581
             W+IES G+ +E  KPK+HL C+PGQSIS+IKFAS+GTPLGTCG+FQQG CH+  SY++LE
Sbjct  744   WDIESDGQPEEYHKPKVHLRCAPGQSISAIKFASYGTPLGTCGNFQQGACHSPNSYTILE  803

Query  580   KKCIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCTPS  467
             K CIG++RC+V IS TNF GDPCPNV+KR+ VEA+C+ +
Sbjct  804   KNCIGQERCAVVISTTNFGGDPCPNVMKRVAVEAICSSA  842



>ref|XP_006649450.1| PREDICTED: beta-galactosidase 5-like [Oryza brachyantha]
Length=841

 Score =   315 bits (808),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 156/218 (72%), Positives = 181/218 (83%), Gaps = 2/218 (1%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A F  P GDEPLALDM SMGKGQ+WING+S+GRYWTAYA G+C  C Y G F+ PKCQ G
Sbjct  624   AYFETPSGDEPLALDMGSMGKGQIWINGQSIGRYWTAYAEGDCKECSYTGTFRAPKCQAG  683

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQRWYHVPRS L+PT NLLV+FEELGGD ++I+LV+RSVS VC DV E HPNI+NW
Sbjct  684   CGQPTQRWYHVPRSWLQPTRNLLVVFEELGGDSSKIALVKRSVSGVCADVSEYHPNIKNW  743

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
             +IESYG   E    K+HL C+PGQ+IS+IKFASFGTPLGTCG+FQQG CH+S S+SVLEK
Sbjct  744   QIESYGEP-EFHTAKVHLKCAPGQTISAIKFASFGTPLGTCGTFQQGECHSSNSHSVLEK  802

Query  577   KCIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCTPS  467
             KCIG QRC VAIS  +F GDPCP V+KR+ VEAVC+P+
Sbjct  803   KCIGLQRCVVAISPNSFGGDPCPEVMKRVAVEAVCSPA  840



>ref|XP_009418404.1| PREDICTED: beta-galactosidase 5-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=860

 Score =   316 bits (809),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 152/219 (69%), Positives = 187/219 (85%), Gaps = 2/219 (1%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYA-TGNCNGCHYAGPFKPPKCQL  941
             A F+APDG++PLALDM SMGKGQVWING+S+GRYWTAYA  G+CN C Y G ++ PKCQ 
Sbjct  637   AYFDAPDGNDPLALDMGSMGKGQVWINGQSIGRYWTAYAPNGDCNSCSYIGTYRSPKCQS  696

Query  940   GCGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRN  761
              CGQPTQRWYHVPRS L+PT NLLV+FEE+GGD T+IS+++RSVSSVC DV E HP I+N
Sbjct  697   NCGQPTQRWYHVPRSWLQPTRNLLVIFEEVGGDATKISMMKRSVSSVCADVSEWHPTIKN  756

Query  760   WEIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLE  581
             W+IES G+ +E  KPK+HL C+PGQSIS+IKFAS+GTPLGTCG+FQQG CH+  SY++LE
Sbjct  757   WDIESDGQPEEYHKPKVHLRCAPGQSISAIKFASYGTPLGTCGNFQQGACHSPNSYTILE  816

Query  580   KKCIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCTPS  467
             K CIG++RC+V IS TNF GDPCPNV+KR+ VEA+C+ +
Sbjct  817   KNCIGQERCAVVISTTNFGGDPCPNVMKRVAVEAICSSA  855



>ref|XP_004146490.1| PREDICTED: beta-galactosidase 3-like [Cucumis sativus]
Length=846

 Score =   315 bits (806),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 149/217 (69%), Positives = 182/217 (84%), Gaps = 5/217 (2%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A F+AP+G+EPLALDM  MGKGQ+WING+S+GRYWTAYA GNC+ C+YA  F+PPKCQLG
Sbjct  625   AYFDAPEGEEPLALDMEGMGKGQIWINGQSIGRYWTAYARGNCSRCNYATAFRPPKCQLG  684

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQRWYHVPRS L+P +NLLV+FEE+GG+P+RIS+V+R V+SVC DV E HP  +NW
Sbjct  685   CGQPTQRWYHVPRSWLRPEQNLLVVFEEVGGNPSRISIVKRLVTSVCADVSEFHPTFKNW  744

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
              I     T +   PK+HL C PGQ ISSIKFASFGTPLGTCGS+QQG CHA +S  +LEK
Sbjct  745   HI-----TAKFITPKVHLSCDPGQYISSIKFASFGTPLGTCGSYQQGTCHAPSSSGILEK  799

Query  577   KCIGRQRCSVAISNTNFGDPCPNVVKRLTVEAVCTPS  467
             KC+G+QRC+V +SN+NF DPCPN++KRL+VEAVC P+
Sbjct  800   KCVGKQRCAVTVSNSNFEDPCPNMMKRLSVEAVCNPT  836



>gb|EEC74580.1| hypothetical protein OsI_10152 [Oryza sativa Indica Group]
Length=851

 Score =   315 bits (806),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 152/218 (70%), Positives = 181/218 (83%), Gaps = 2/218 (1%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A F+ P GDEPLALDM SMGKGQ+WING+S+GRYWTAYA G+C GCHY G ++ PKCQ G
Sbjct  634   AYFDTPSGDEPLALDMGSMGKGQIWINGQSIGRYWTAYAEGDCKGCHYTGSYRAPKCQAG  693

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQRWYHVPRS L+PT NLLV+FEELGGD ++I+L +R+VS VC DV E HPNI+NW
Sbjct  694   CGQPTQRWYHVPRSWLQPTRNLLVVFEELGGDSSKIALAKRTVSGVCADVSEYHPNIKNW  753

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
             +IESYG   E    K+HL C+PGQ+IS+IKFASFGTPLGTCG+FQQG CH+  S SVLE+
Sbjct  754   QIESYGEP-EFHTAKVHLKCAPGQTISAIKFASFGTPLGTCGTFQQGECHSINSNSVLER  812

Query  577   KCIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCTPS  467
             KCIG +RC VAIS +NF GDPCP V+KR+ VEAVC+ +
Sbjct  813   KCIGLERCVVAISPSNFGGDPCPEVMKRVAVEAVCSTA  850



>ref|XP_006838689.1| PREDICTED: beta-galactosidase 5 [Amborella trichopoda]
 gb|ERN01258.1| hypothetical protein AMTR_s00002p00246870 [Amborella trichopoda]
Length=843

 Score =   314 bits (804),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 152/216 (70%), Positives = 177/216 (82%), Gaps = 1/216 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQL  941
             A F+AP GD+PLALDM +M KGQVW+NG+S+GRYW AY A G C  C Y G ++P KCQ 
Sbjct  622   AYFDAPAGDDPLALDMGTMHKGQVWVNGQSIGRYWPAYLAQGQCGACDYTGTYRPNKCQT  681

Query  940   GCGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRN  761
             GCG PTQRWYHVPRS L+PT NLL++FEE+GGD + ISL RRSV SVC DV E HP ++N
Sbjct  682   GCGHPTQRWYHVPRSWLQPTGNLLIVFEEIGGDVSGISLGRRSVESVCADVSEFHPVVKN  741

Query  760   WEIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLE  581
             W IESYGR Q + KPK+HLHCSPGQSIS+IKFASFGTPLGTCGSFQQG CH+  S+ VL+
Sbjct  742   WHIESYGRAQPVIKPKVHLHCSPGQSISAIKFASFGTPLGTCGSFQQGACHSPNSHDVLQ  801

Query  580   KKCIGRQRCSVAISNTNFGDPCPNVVKRLTVEAVCT  473
             KKCIGRQRCSV IS   FGDPCPN++KR+ VEAVC+
Sbjct  802   KKCIGRQRCSVTISTNIFGDPCPNIMKRVAVEAVCS  837



>ref|XP_008799994.1| PREDICTED: beta-galactosidase 5-like [Phoenix dactylifera]
Length=845

 Score =   310 bits (793),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 151/219 (69%), Positives = 183/219 (84%), Gaps = 2/219 (1%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYA-TGNCNGCHYAGPFKPPKCQL  941
             A F+AP GD+PLALDM SMGKGQ W+NG+S+GRYWT +A  G+CNGC+YAG ++ PKCQ 
Sbjct  622   AYFDAPAGDDPLALDMGSMGKGQAWLNGQSIGRYWTLWAPNGDCNGCNYAGTYRTPKCQT  681

Query  940   GCGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRN  761
             GC QPTQRWYHVPRS L+PTENLLV+FEELGGD T+ISL ++S+SSVC DV E HP I+N
Sbjct  682   GCSQPTQRWYHVPRSWLQPTENLLVVFEELGGDATKISLAKKSMSSVCADVSEWHPTIKN  741

Query  760   WEIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLE  581
               I+SYG+ +E  KPK+HL C+PGQSIS+IKFASFGTPLGTCG+FQQG CH+  S+S LE
Sbjct  742   RHIQSYGQPEEYHKPKIHLRCAPGQSISAIKFASFGTPLGTCGNFQQGTCHSPNSHSTLE  801

Query  580   KKCIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCTPS  467
             KKCIG QRC+V IS  NF GDPCP V+K + VEA+C+P+
Sbjct  802   KKCIGLQRCAVTISTNNFGGDPCPEVMKSVAVEAICSPT  840



>gb|ADD62393.1| beta-galactosidase 3 [Prunus persica]
Length=683

 Score =   304 bits (779),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 147/216 (68%), Positives = 181/216 (84%), Gaps = 1/216 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A FNAP GDEPLALDM SMGKGQVWING+S+G+YW AYA G+C+ C Y G F+P KCQLG
Sbjct  456   AYFNAPGGDEPLALDMRSMGKGQVWINGQSIGKYWMAYANGDCSLCSYIGTFRPTKCQLG  515

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQRWYHVPRS LKPT+NL+V+FEELGGDP++I+LV+RSV+ VC D+ E HPN    
Sbjct  516   CGQPTQRWYHVPRSWLKPTQNLVVVFEELGGDPSKITLVKRSVAGVCADLQEHHPNAEKL  575

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
             +I+S+  ++ L + ++HL C PGQSISSIKFASFGTP GTCGSFQQG CHA+ S++++EK
Sbjct  576   DIDSHEESKTLHQAQVHLQCVPGQSISSIKFASFGTPTGTCGSFQQGTCHATNSHAIVEK  635

Query  577   KCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCT  473
              CIGR+ C V +SN+ FG DPCPNV+KRL+VEAVC+
Sbjct  636   NCIGRESCLVTVSNSIFGTDPCPNVLKRLSVEAVCS  671



>ref|XP_008388000.1| PREDICTED: beta-galactosidase 5 [Malus domestica]
Length=852

 Score =   308 bits (788),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 148/216 (69%), Positives = 184/216 (85%), Gaps = 1/216 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A FNAP G+EPLALDMSSMGKGQVWING+S+GRYW AYA G+C+ C Y G F+P +CQLG
Sbjct  625   AYFNAPGGNEPLALDMSSMGKGQVWINGQSIGRYWMAYAKGDCSSCSYIGTFRPTECQLG  684

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQRWYHVPRS LKPT+NL+V+FEELGGDP++I+LV+RSV+ VCGD+ E HPN+ N+
Sbjct  685   CGQPTQRWYHVPRSWLKPTQNLVVVFEELGGDPSKITLVKRSVTGVCGDLHENHPNVENF  744

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
             ++E    ++ L + ++HL C+PG+SISSIKFASFGTP GTCGSFQQG CHA  S+ V+EK
Sbjct  745   DVEGNENSKTLHQAQVHLQCAPGKSISSIKFASFGTPTGTCGSFQQGTCHAKNSHGVVEK  804

Query  577   KCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCT  473
              CIGR+ CSVA++N+ F  DPCPNV+KRL+VEAVC+
Sbjct  805   NCIGRESCSVAVTNSIFKTDPCPNVLKRLSVEAVCS  840



>ref|XP_008221339.1| PREDICTED: beta-galactosidase 5 [Prunus mume]
Length=851

 Score =   307 bits (787),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 148/216 (69%), Positives = 182/216 (84%), Gaps = 1/216 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A FNAP GDEPLALDM SMGKGQVWING+S+GRYW AYA G+C+ C Y G F+P KCQLG
Sbjct  624   AYFNAPGGDEPLALDMRSMGKGQVWINGQSIGRYWMAYANGDCSLCSYIGTFRPTKCQLG  683

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQRWYHVPRS LKPT+NL+V+FEELGGDP++I+LV+RSV+ VC D+ E HPN   +
Sbjct  684   CGQPTQRWYHVPRSWLKPTKNLMVMFEELGGDPSKITLVKRSVAGVCADLQEHHPNAEKF  743

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
             +I+S+  ++ L + ++HL C PGQSISSIKFASFGTP GTCGSFQQG CHA+ S++++EK
Sbjct  744   DIDSHEESKTLHQAQVHLQCVPGQSISSIKFASFGTPTGTCGSFQQGTCHATNSHAIVEK  803

Query  577   KCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCT  473
              CIGR+ C V +SN+ FG DPCPNV+KRL+VEAVC+
Sbjct  804   NCIGRESCLVTVSNSIFGTDPCPNVLKRLSVEAVCS  839



>ref|NP_001268162.1| beta-galactosidase BG1-like precursor [Vitis vinifera]
 gb|AAK81874.1| putative beta-galactosidase BG1 [Vitis vinifera]
Length=854

 Score =   307 bits (787),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 145/218 (67%), Positives = 180/218 (83%), Gaps = 1/218 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A FNAP+GDEPLALDM SMGKGQVWING+S+GRYW AYA G+CN C Y+G ++PPKCQ G
Sbjct  627   AYFNAPEGDEPLALDMRSMGKGQVWINGQSIGRYWMAYAKGDCNVCSYSGTYRPPKCQHG  686

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CG PTQRWYHVPRS LKPT+NLL++FEELGGD ++I+L++R++ SVC D  E HP + NW
Sbjct  687   CGHPTQRWYHVPRSWLKPTQNLLIIFEELGGDASKIALMKRAMKSVCADANEHHPTLENW  746

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
               ES   ++EL +  +HL C+PGQSIS+I FASFGTP GTCGSFQ+G CHA  S ++LEK
Sbjct  747   HTESPSESEELHQASVHLQCAPGQSISTIMFASFGTPSGTCGSFQKGTCHAPNSQAILEK  806

Query  577   KCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTPS  467
              CIG+++CSV ISN+ FG DPCPNV+KRL+VEA C+P+
Sbjct  807   NCIGQEKCSVPISNSYFGADPCPNVLKRLSVEAACSPT  844



>ref|XP_010679814.1| PREDICTED: beta-galactosidase 3 [Beta vulgaris subsp. vulgaris]
Length=853

 Score =   307 bits (787),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 143/219 (65%), Positives = 180/219 (82%), Gaps = 1/219 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A F+AP+G EPLALDM SMGKGQVWINGES+GRYWT YA+G C GC Y G F PPKCQ+G
Sbjct  621   AYFDAPEGKEPLALDMQSMGKGQVWINGESIGRYWTTYASGECKGCGYTGRFAPPKCQVG  680

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CG+P+QRWYHVPRS LKPT NL+VLFEE GG+PT+I+L++R+ +++C  V E H  I+++
Sbjct  681   CGKPSQRWYHVPRSWLKPTRNLIVLFEETGGNPTKIALMKRTTNTICAQVSETHRTIKSF  740

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
             +IESY  TQE   PK+HLHC+  Q ISSI FASFGTP GTCGSF +  CHASTS +VLEK
Sbjct  741   QIESYDSTQEFYIPKIHLHCASNQYISSIAFASFGTPFGTCGSFVKSSCHASTSNAVLEK  800

Query  577   KCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTPSQ  464
             +CIG+Q C+V ++N+NFG DPCPNV+KRL+V+A+C  ++
Sbjct  801   RCIGKQSCAVTVTNSNFGKDPCPNVLKRLSVQAICASTK  839



>emb|CAN78072.1| hypothetical protein VITISV_013292 [Vitis vinifera]
Length=854

 Score =   307 bits (787),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 145/218 (67%), Positives = 180/218 (83%), Gaps = 1/218 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A FNAP+GDEPLALDM SMGKGQVWING+S+GRYW AYA G+CN C Y+G ++PPKCQ G
Sbjct  627   AYFNAPEGDEPLALDMRSMGKGQVWINGQSIGRYWMAYAKGDCNVCSYSGTYRPPKCQHG  686

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CG PTQRWYHVPRS LKPT+NLL++FEELGGD ++I+L++R++ SVC D  E HP + NW
Sbjct  687   CGHPTQRWYHVPRSWLKPTQNLLIIFEELGGDASKIALMKRAMKSVCADANEHHPTLENW  746

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
               ES   ++EL +  +HL C+PGQSIS+I FASFGTP GTCGSFQ+G CHA  S ++LEK
Sbjct  747   HTESPSESEELHZASVHLQCAPGQSISTIMFASFGTPSGTCGSFQKGTCHAPNSQAILEK  806

Query  577   KCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTPS  467
              CIG+++CSV ISN+ FG DPCPNV+KRL+VEA C+P+
Sbjct  807   NCIGQEKCSVPISNSYFGADPCPNVLKRLSVEAACSPT  844



>emb|CBI19767.3| unnamed protein product [Vitis vinifera]
Length=854

 Score =   307 bits (787),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 145/218 (67%), Positives = 180/218 (83%), Gaps = 1/218 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A FNAP+GDEPLALDM SMGKGQVWING+S+GRYW AYA G+CN C Y+G ++PPKCQ G
Sbjct  627   AYFNAPEGDEPLALDMRSMGKGQVWINGQSIGRYWMAYAKGDCNVCSYSGTYRPPKCQHG  686

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CG PTQRWYHVPRS LKPT+NLL++FEELGGD ++I+L++R++ SVC D  E HP + NW
Sbjct  687   CGHPTQRWYHVPRSWLKPTQNLLIIFEELGGDASKIALMKRAMKSVCADANEHHPTLENW  746

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
               ES   ++EL +  +HL C+PGQSIS+I FASFGTP GTCGSFQ+G CHA  S ++LEK
Sbjct  747   HTESPSESEELHEASVHLQCAPGQSISTIMFASFGTPSGTCGSFQKGTCHAPNSQAILEK  806

Query  577   KCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTPS  467
              CIG+++CSV ISN+ FG DPCPNV+KRL+VEA C+P+
Sbjct  807   NCIGQEKCSVPISNSYFGADPCPNVLKRLSVEAACSPT  844



>ref|XP_008660537.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase 5-like [Zea 
mays]
Length=842

 Score =   306 bits (785),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 152/217 (70%), Positives = 180/217 (83%), Gaps = 2/217 (1%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A F  P GDEPLALDM SMGKGQ+WING+S+GRYWTAYA G+C  C Y G F+ PKCQ G
Sbjct  625   AYFETPSGDEPLALDMGSMGKGQIWINGQSIGRYWTAYADGDCKECSYTGTFRAPKCQSG  684

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQRWYHVP+S L+PT NLLV+FEELGGD ++I+LV+RSVSSVC DV E HPNI+NW
Sbjct  685   CGQPTQRWYHVPKSWLQPTRNLLVVFEELGGDSSKIALVKRSVSSVCADVSEDHPNIKNW  744

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
             +IESYG  +E  + K+HL C+ GQSIS+IKFASFGTP GTCG FQQG CH++ S++VLEK
Sbjct  745   QIESYGE-REYHRAKVHLRCARGQSISAIKFASFGTPTGTCGDFQQGDCHSANSHTVLEK  803

Query  577   KCIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCTP  470
             KCIG QRC VAIS  +F GDPCP+V KR+ V+AVC+P
Sbjct  804   KCIGLQRCVVAISPESFGGDPCPSVTKRVAVQAVCSP  840



>ref|XP_007225291.1| hypothetical protein PRUPE_ppa001334mg [Prunus persica]
 gb|EMJ26490.1| hypothetical protein PRUPE_ppa001334mg [Prunus persica]
Length=851

 Score =   306 bits (784),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 148/216 (69%), Positives = 181/216 (84%), Gaps = 1/216 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A FNAP GDEPLALDM SMGKGQVWING+S+GRYW AYA G+C+ C Y G F+P KCQLG
Sbjct  624   AYFNAPGGDEPLALDMRSMGKGQVWINGQSIGRYWMAYANGDCSLCSYIGTFRPTKCQLG  683

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQRWYHVPRS LKPT+NL+V+FEELGGDP++I+LV+RSV+ VC D+ E HPN    
Sbjct  684   CGQPTQRWYHVPRSWLKPTQNLVVVFEELGGDPSKITLVKRSVAGVCADLQEHHPNAEKL  743

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
             +I+S+  ++ L + ++HL C PGQSISSIKFASFGTP GTCGSFQQG CHA+ S++++EK
Sbjct  744   DIDSHEESKTLHQAQVHLQCVPGQSISSIKFASFGTPTGTCGSFQQGTCHATNSHAIVEK  803

Query  577   KCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCT  473
              CIGR+ C V +SN+ FG DPCPNV+KRL+VEAVC+
Sbjct  804   NCIGRESCLVTVSNSIFGTDPCPNVLKRLSVEAVCS  839



>gb|AGR44466.1| beta-D-galactosidase 7 [Pyrus x bretschneideri]
Length=852

 Score =   305 bits (781),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 148/216 (69%), Positives = 183/216 (85%), Gaps = 1/216 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A FNAP G+EPLALDM  MGKGQVWING+S+GRYW AYA G+C+ C Y G F+P KCQL 
Sbjct  625   AYFNAPGGNEPLALDMRMMGKGQVWINGQSIGRYWMAYAKGDCSSCSYIGTFRPTKCQLH  684

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CG+PTQRWYHVPRS LKPT+NL+V+FEELGGDP++I+LVRRSV+ VCGD+ E HPN  N+
Sbjct  685   CGRPTQRWYHVPRSWLKPTQNLVVVFEELGGDPSKITLVRRSVAGVCGDLHENHPNAENF  744

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
             +++    ++ L + ++HLHC+PGQSISSIKFASFGTP GTCGSFQQG CHA+ S++V+EK
Sbjct  745   DVDGNEDSKTLHQAQVHLHCAPGQSISSIKFASFGTPSGTCGSFQQGTCHATNSHAVVEK  804

Query  577   KCIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
              CIGR+ CSVA+SN+ F  DPCPNV+KRL+VEAVC+
Sbjct  805   NCIGRESCSVAVSNSTFETDPCPNVLKRLSVEAVCS  840



>dbj|BAD91084.1| beta-D-galactosidase [Pyrus pyrifolia]
Length=852

 Score =   305 bits (781),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 148/216 (69%), Positives = 183/216 (85%), Gaps = 1/216 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A FNAP G+EPLALDM  MGKGQVWING+S+GRYW AYA G+C+ C Y G F+P KCQL 
Sbjct  625   AYFNAPGGNEPLALDMRRMGKGQVWINGQSIGRYWMAYAKGDCSSCSYIGTFRPTKCQLH  684

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CG+PTQRWYHVPRS LKPT+NL+V+FEELGGDP++I+LVRRSV+ VCGD+ E HPN  N+
Sbjct  685   CGRPTQRWYHVPRSWLKPTQNLVVVFEELGGDPSKITLVRRSVAGVCGDLHENHPNAENF  744

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
             +++    ++ L + ++HLHC+PGQSISSIKFASFGTP GTCGSFQQG CHA+ S++V+EK
Sbjct  745   DVDGNEDSKTLHQAQVHLHCAPGQSISSIKFASFGTPSGTCGSFQQGTCHATNSHAVVEK  804

Query  577   KCIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
              CIGR+ CSVA+SN+ F  DPCPNV+KRL+VEAVC+
Sbjct  805   NCIGRESCSVAVSNSTFETDPCPNVLKRLSVEAVCS  840



>ref|XP_009335672.1| PREDICTED: beta-galactosidase 5 [Pyrus x bretschneideri]
Length=852

 Score =   305 bits (781),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 146/216 (68%), Positives = 185/216 (86%), Gaps = 1/216 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A FNAP G+EPLALDMSSMGKGQVWING+S+GRYW AYA G+C+ C Y G F+P +CQLG
Sbjct  625   AYFNAPGGNEPLALDMSSMGKGQVWINGQSIGRYWMAYAKGDCSSCSYIGTFRPTECQLG  684

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQ+WYHVPRS LKPT+NL+V+FEELGGDP++I+LV+RSV+ VCGD+ E HPN+ N+
Sbjct  685   CGQPTQQWYHVPRSWLKPTQNLVVVFEELGGDPSKITLVKRSVTGVCGDLHENHPNVENF  744

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
             ++E    ++ L + ++HL C+PGQSISSIKFASFGTP GTCGSFQQG CHA+ S++++EK
Sbjct  745   DVEGNENSKTLHQAQVHLQCAPGQSISSIKFASFGTPTGTCGSFQQGTCHATNSHAMVEK  804

Query  577   KCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCT  473
              CI R+ CSVA++N+ F  DPCPNV+KRL+VEAVC+
Sbjct  805   NCISRESCSVAVTNSIFKTDPCPNVLKRLSVEAVCS  840



>ref|NP_001168664.1| uncharacterized protein LOC100382452 [Zea mays]
 gb|ACN29095.1| unknown [Zea mays]
Length=815

 Score =   303 bits (777),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 151/219 (69%), Positives = 182/219 (83%), Gaps = 3/219 (1%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A F  P GDEPLALDM SMGKGQVWING+S+GRYWTAYA G+C GC Y G F+ PKCQ G
Sbjct  597   AYFETPSGDEPLALDMGSMGKGQVWINGQSIGRYWTAYADGDCKGCSYTGTFRAPKCQAG  656

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEEL-GGDPTrislvrrsvssVCGDVGEIHPNIRN  761
             CGQPTQRWYHVPRS L+P+ NLLV+ EEL GGD ++I+L +RSVSSVC DV E HPNI+ 
Sbjct  657   CGQPTQRWYHVPRSWLQPSRNLLVVLEELGGGDSSKIALAKRSVSSVCADVSEDHPNIKK  716

Query  760   WEIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLE  581
             W+IESYG  +E  + K+HL C+ GQSIS+I+FASFGTP+GTCG+FQQG CH+++S++VLE
Sbjct  717   WQIESYGE-REHRRAKVHLRCAHGQSISAIRFASFGTPVGTCGNFQQGGCHSASSHAVLE  775

Query  580   KKCIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCTPS  467
             K+CIG QRC VAIS  NF GDPCP+V KR+ VEAVC+P+
Sbjct  776   KRCIGLQRCVVAISPDNFGGDPCPSVTKRVAVEAVCSPA  814



>ref|XP_008377189.1| PREDICTED: beta-galactosidase 5-like [Malus domestica]
Length=852

 Score =   304 bits (778),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 148/216 (69%), Positives = 181/216 (84%), Gaps = 1/216 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A FNAP G+EPLALDM  MGKGQVWING+S+GRYW AYA G+C+ C Y G F+P KCQL 
Sbjct  625   AYFNAPGGNEPLALDMRRMGKGQVWINGQSIGRYWMAYAKGDCSSCSYIGTFRPTKCQLH  684

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CG+PTQRWYHVPRS LKPT+NL+V+FEELGGDP++I+LVRRSV+ VCGD+ E HPN  N+
Sbjct  685   CGRPTQRWYHVPRSWLKPTQNLVVVFEELGGDPSKITLVRRSVTGVCGDLHENHPNAENF  744

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
             ++E    ++ L + ++HLHC+PGQSISSIKFASFGTP GTCGSFQQG CH   S++V+EK
Sbjct  745   DVEXNEDSKTLHQAQVHLHCAPGQSISSIKFASFGTPSGTCGSFQQGTCHXXNSHAVVEK  804

Query  577   KCIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
              CIGR+ CSVA+SN+ F  DPCPNV+KRL+VEAVC+
Sbjct  805   NCIGRESCSVAVSNSAFETDPCPNVLKRLSVEAVCS  840



>ref|XP_008643999.1| PREDICTED: uncharacterized protein LOC100382452 isoform X1 [Zea 
mays]
 tpg|DAA43552.1| TPA: hypothetical protein ZEAMMB73_935084 [Zea mays]
Length=845

 Score =   303 bits (776),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 151/219 (69%), Positives = 182/219 (83%), Gaps = 3/219 (1%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A F  P GDEPLALDM SMGKGQVWING+S+GRYWTAYA G+C GC Y G F+ PKCQ G
Sbjct  627   AYFETPSGDEPLALDMGSMGKGQVWINGQSIGRYWTAYADGDCKGCSYTGTFRAPKCQAG  686

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEEL-GGDPTrislvrrsvssVCGDVGEIHPNIRN  761
             CGQPTQRWYHVPRS L+P+ NLLV+ EEL GGD ++I+L +RSVSSVC DV E HPNI+ 
Sbjct  687   CGQPTQRWYHVPRSWLQPSRNLLVVLEELGGGDSSKIALAKRSVSSVCADVSEDHPNIKK  746

Query  760   WEIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLE  581
             W+IESYG  +E  + K+HL C+ GQSIS+I+FASFGTP+GTCG+FQQG CH+++S++VLE
Sbjct  747   WQIESYGE-REHRRAKVHLRCAHGQSISAIRFASFGTPVGTCGNFQQGGCHSASSHAVLE  805

Query  580   KKCIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCTPS  467
             K+CIG QRC VAIS  NF GDPCP+V KR+ VEAVC+P+
Sbjct  806   KRCIGLQRCVVAISPDNFGGDPCPSVTKRVAVEAVCSPA  844



>gb|KJB43423.1| hypothetical protein B456_007G198900 [Gossypium raimondii]
Length=807

 Score =   302 bits (774),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 166/180 (92%), Gaps = 0/180 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A FNAP+GDEPLALDM SMGKGQ+WING+S+GRYWTAYA G+CNGC+YAG F+PPKCQLG
Sbjct  626   AYFNAPEGDEPLALDMESMGKGQIWINGQSIGRYWTAYAHGDCNGCNYAGTFRPPKCQLG  685

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQRWYHVPRS LKPT+NLLVLFEELGGDPTRISLV+RSVSSVC DV E HPNI+NW
Sbjct  686   CGQPTQRWYHVPRSWLKPTQNLLVLFEELGGDPTRISLVKRSVSSVCADVTEYHPNIKNW  745

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
             +IESYG+ Q+L +PK+HL CSPGQSIS IKFASFGTPLGTCGS+QQGPCHA  SY+++EK
Sbjct  746   QIESYGKAQQLRRPKVHLRCSPGQSISFIKFASFGTPLGTCGSYQQGPCHAPASYAIVEK  805



>ref|XP_007199661.1| hypothetical protein PRUPE_ppa001363mg [Prunus persica]
 gb|EMJ00860.1| hypothetical protein PRUPE_ppa001363mg [Prunus persica]
Length=844

 Score =   303 bits (775),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 145/217 (67%), Positives = 181/217 (83%), Gaps = 1/217 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A F+AP GD+PLALDM SMGKGQVWING+S+GRYWT YATGNC+ C Y+G F+P KCQ G
Sbjct  627   ASFDAPKGDDPLALDMGSMGKGQVWINGQSIGRYWTTYATGNCSECAYSGTFRPKKCQFG  686

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             C  PTQ+WYHVPRS LKP+ NLLV+FEE+GGD +RI LV++SV+SVC +V E HP+ RNW
Sbjct  687   CQHPTQQWYHVPRSFLKPSNNLLVVFEEIGGDVSRIGLVKKSVTSVCAEVSENHPHFRNW  746

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
             + ES+G+ +E  KP++ LHC+ G SIS+IKF+SFGTP G+CG+FQ G CHA  S +VLEK
Sbjct  747   QTESHGQLEEQNKPEISLHCTEGHSISAIKFSSFGTPSGSCGTFQHGACHAPNSNAVLEK  806

Query  577   KCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTP  470
             +CIG+Q+CSV ISNTNFG DPCP+ +K+L+VEAVC P
Sbjct  807   ECIGKQKCSVTISNTNFGKDPCPSKLKKLSVEAVCAP  843



>tpg|DAA43551.1| TPA: beta-galactosidase [Zea mays]
Length=897

 Score =   303 bits (776),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 151/219 (69%), Positives = 182/219 (83%), Gaps = 3/219 (1%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A F  P GDEPLALDM SMGKGQVWING+S+GRYWTAYA G+C GC Y G F+ PKCQ G
Sbjct  679   AYFETPSGDEPLALDMGSMGKGQVWINGQSIGRYWTAYADGDCKGCSYTGTFRAPKCQAG  738

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEEL-GGDPTrislvrrsvssVCGDVGEIHPNIRN  761
             CGQPTQRWYHVPRS L+P+ NLLV+ EEL GGD ++I+L +RSVSSVC DV E HPNI+ 
Sbjct  739   CGQPTQRWYHVPRSWLQPSRNLLVVLEELGGGDSSKIALAKRSVSSVCADVSEDHPNIKK  798

Query  760   WEIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLE  581
             W+IESYG  +E  + K+HL C+ GQSIS+I+FASFGTP+GTCG+FQQG CH+++S++VLE
Sbjct  799   WQIESYGE-REHRRAKVHLRCAHGQSISAIRFASFGTPVGTCGNFQQGGCHSASSHAVLE  857

Query  580   KKCIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCTPS  467
             K+CIG QRC VAIS  NF GDPCP+V KR+ VEAVC+P+
Sbjct  858   KRCIGLQRCVVAISPDNFGGDPCPSVTKRVAVEAVCSPA  896



>ref|XP_008236954.1| PREDICTED: beta-galactosidase 3-like [Prunus mume]
Length=844

 Score =   301 bits (772),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 145/217 (67%), Positives = 180/217 (83%), Gaps = 1/217 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A F+AP GD+PLALDM SMGKGQVWING+S+GRYWT YATGNC+ C Y+G F+P KCQ G
Sbjct  627   ASFDAPKGDDPLALDMGSMGKGQVWINGQSIGRYWTTYATGNCSECAYSGTFRPKKCQFG  686

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             C  PTQ+WYHVPRS LK + NLLV+FEE+GGD +RI LV++SV+SVC +V E HP+ RNW
Sbjct  687   CQHPTQQWYHVPRSFLKSSNNLLVVFEEIGGDVSRIGLVKKSVTSVCAEVSESHPHFRNW  746

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
             + ES+G+ +E  KPK+ LHC+ G SIS+IKF+SFGTP G+CG+FQ G CHA  S +VLEK
Sbjct  747   QTESHGQLEEQNKPKISLHCTEGHSISAIKFSSFGTPSGSCGTFQHGDCHAPNSNAVLEK  806

Query  577   KCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTP  470
             +CIG+Q+CSV ISNTNFG DPCP+ +K+L+VEAVC P
Sbjct  807   ECIGKQKCSVTISNTNFGKDPCPSKLKKLSVEAVCAP  843



>ref|XP_010932916.1| PREDICTED: beta-galactosidase 5-like [Elaeis guineensis]
Length=845

 Score =   301 bits (771),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 148/219 (68%), Positives = 182/219 (83%), Gaps = 2/219 (1%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYA-TGNCNGCHYAGPFKPPKCQL  941
             A F+AP G +PL LDM SMGKGQ WING+S+GRYWT  A  G+C GC+YAG ++ PKCQ 
Sbjct  622   AYFDAPAGHDPLGLDMGSMGKGQAWINGQSIGRYWTLLAPNGDCKGCNYAGTYRIPKCQT  681

Query  940   GCGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRN  761
             GCGQPTQ WYHVPRS L+PT+NLLV+FEELGGD T+ISLV++SVSSVC DV E HP I++
Sbjct  682   GCGQPTQLWYHVPRSWLQPTKNLLVVFEELGGDATKISLVKKSVSSVCADVSEWHPTIKS  741

Query  760   WEIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLE  581
             W I+SYG+ +E  KPK+HL C+ GQ IS+IKFASFGTPLGTCG+FQQG CH+  S++ LE
Sbjct  742   WHIQSYGQPEEYHKPKVHLRCASGQLISAIKFASFGTPLGTCGNFQQGACHSPNSHTTLE  801

Query  580   KKCIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCTPS  467
             KKC+G+QRC+V IS  NF GDPCP+V+KR+ VEAVC+P+
Sbjct  802   KKCVGQQRCAVTISTNNFGGDPCPDVMKRVAVEAVCSPT  840



>ref|XP_003558743.1| PREDICTED: beta-galactosidase 5 [Brachypodium distachyon]
Length=839

 Score =   300 bits (769),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 147/217 (68%), Positives = 182/217 (84%), Gaps = 2/217 (1%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A F+ P GDEPLALDM SMGKGQ+WING+S+GRY T+YA+G+C  C YAG ++ PKCQ G
Sbjct  622   AYFDTPTGDEPLALDMGSMGKGQIWINGQSIGRYSTSYASGDCKACSYAGSYRAPKCQAG  681

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQRWYHVP+S L+P+ NLLV+FEELGGD ++ISLV+RSVSSVC DV E H NI+NW
Sbjct  682   CGQPTQRWYHVPKSWLQPSRNLLVVFEELGGDSSKISLVKRSVSSVCADVSEYHTNIKNW  741

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
             +IE+ G   E  +PK+HL C+PGQ+IS+IKFASFGTPLGTCG+FQQG CH++ S++VLEK
Sbjct  742   QIENAGEV-EFHRPKVHLRCAPGQTISAIKFASFGTPLGTCGNFQQGDCHSTKSHAVLEK  800

Query  577   KCIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCTP  470
              CIG+QRC+V IS  NF GDPCP  +K++ VEAVC+P
Sbjct  801   NCIGQQRCAVTISPDNFGGDPCPKEMKKVAVEAVCSP  837



>ref|XP_002306893.1| beta-galactosidase family protein [Populus trichocarpa]
 gb|EEE93889.1| beta-galactosidase family protein [Populus trichocarpa]
Length=853

 Score =   300 bits (768),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 149/217 (69%), Positives = 181/217 (83%), Gaps = 2/217 (1%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A F+AP G+EPLALDM SMGKGQVWING+S+GRYW +YA G+C+ C Y+G F+PPKCQLG
Sbjct  625   AYFDAPGGNEPLALDMRSMGKGQVWINGQSIGRYWLSYAKGDCSSCGYSGTFRPPKCQLG  684

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQRWYHVPRS LKP +NLLV+FEELGGD ++ISLV+RS +SVC D  E HP I N+
Sbjct  685   CGQPTQRWYHVPRSWLKPKQNLLVIFEELGGDASKISLVKRSTTSVCADAFEHHPTIENY  744

Query  757   EIESYGRTQE-LPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLE  581
               ES G ++  L + K+HL C+PGQSIS+I FASFGTP GTCGSFQ+G CHA  S+SV+E
Sbjct  745   NTESNGESERNLHQAKVHLRCAPGQSISAINFASFGTPTGTCGSFQEGTCHAPNSHSVVE  804

Query  580   KKCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCT  473
             KKCIGR+ C VAISN+NFG DPCP+ +K+L+VEAVC+
Sbjct  805   KKCIGRESCMVAISNSNFGADPCPSKLKKLSVEAVCS  841



>ref|XP_009395554.1| PREDICTED: beta-galactosidase 5 [Musa acuminata subsp. malaccensis]
Length=842

 Score =   299 bits (765),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 146/219 (67%), Positives = 180/219 (82%), Gaps = 2/219 (1%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYA-TGNCNGCHYAGPFKPPKCQL  941
             A F+APDG++PLALDM SMGKG VWING+S+GRYWTAYA +  CN C Y G ++ PKCQ 
Sbjct  619   AYFDAPDGNDPLALDMGSMGKGHVWINGQSIGRYWTAYAPSEYCNSCSYRGTYRSPKCQS  678

Query  940   GCGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRN  761
             GCGQPTQRWYHVPRS L+PT NLL++FEELGGD T+ISL +RSVSSVC DV E HP I+N
Sbjct  679   GCGQPTQRWYHVPRSWLQPTRNLLIVFEELGGDATKISLAKRSVSSVCADVSEWHPTIKN  738

Query  760   WEIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLE  581
             W IE+YGR +E  KPK+HL C+ GQ IS+IKFAS+GTP+GTCG+FQQG CH+  S+++LE
Sbjct  739   WHIENYGRPEEHHKPKVHLRCAQGQFISAIKFASYGTPIGTCGNFQQGACHSPNSHTILE  798

Query  580   KKCIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCTPS  467
             K CIG+++C VAIS   F GDPC NV+KR+ VEA+C+ +
Sbjct  799   KMCIGKEKCMVAISQNIFGGDPCRNVMKRVAVEAICSSA  837



>emb|CDY59691.1| BnaC07g51100D [Brassica napus]
Length=352

 Score =   285 bits (728),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/215 (62%), Positives = 162/215 (75%), Gaps = 26/215 (12%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLGCG  932
             F+AP+GDEPLALDM  MGKGQ+W+NGES+GRYWTA+ATG+CN C Y G +KP KC  GCG
Sbjct  154   FDAPEGDEPLALDMEGMGKGQIWVNGESIGRYWTAFATGDCNHCSYTGTYKPNKCLSGCG  213

Query  931   QPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWEI  752
             QPTQR+YHVPRS LKP++NLL L                            HPNI+NW +
Sbjct  214   QPTQRYYHVPRSWLKPSQNLLFLNHH-------------------------HPNIKNWHL  248

Query  751   ESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKKC  572
             ESYG+ Q   +PK+HL  SPGQ+ S+IKFASFGTPLG CG +QQG CHA+TSY++LE+KC
Sbjct  249   ESYGKGQTFHRPKVHLKWSPGQANSAIKFASFGTPLGKCGRYQQGECHAATSYAILERKC  308

Query  571   IGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTP  470
             +G+ RC+V ISNTNFG DPCPNV+KRLTVEAVC+P
Sbjct  309   VGKARCAVTISNTNFGKDPCPNVLKRLTVEAVCSP  343



>gb|AHL69742.1| beta-galactosidase [Hylocereus undatus]
Length=835

 Score =   298 bits (762),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 144/216 (67%), Positives = 175/216 (81%), Gaps = 1/216 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A F+AP+G EPLALDM+SMGKGQ+WING+ +GRYWT YA GNCN C+YAG ++P  CQ G
Sbjct  620   AYFDAPEGVEPLALDMNSMGKGQIWINGQIIGRYWTNYAKGNCNSCNYAGTYRPKNCQSG  679

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CG PTQRWYHVPRS LKP +NL+V+FEELGGD ++ISLV+RSVS VC D  E HP   NW
Sbjct  680   CGSPTQRWYHVPRSWLKPRQNLMVVFEELGGDASKISLVKRSVSRVCADAYEHHPMAENW  739

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
              +   G T+ L + K+HL C PGQSIS+I+FASFGTP GTCGSF QG CHA  S++V+EK
Sbjct  740   RVNDAGDTEILHQAKVHLQCGPGQSISNIQFASFGTPSGTCGSFLQGTCHAQESHAVIEK  799

Query  577   KCIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
              C+GR+RCSV I+N NF GDPCPNV+KRL+VEA+C+
Sbjct  800   MCVGRERCSVTIANKNFGGDPCPNVLKRLSVEAICS  835



>ref|XP_011048837.1| PREDICTED: beta-galactosidase 5 [Populus euphratica]
Length=853

 Score =   297 bits (760),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 147/217 (68%), Positives = 181/217 (83%), Gaps = 2/217 (1%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A F+AP G+EPLALDM SMGKGQVWING+S+GRYW +YA G+C+ C Y+G F+PPKCQLG
Sbjct  625   AYFDAPGGNEPLALDMRSMGKGQVWINGQSIGRYWLSYAKGDCSSCSYSGTFRPPKCQLG  684

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CG+PTQRWYHVPRS LKP +NLLV+FEELGGD ++ISLV+RS +SVC D  E HP I N+
Sbjct  685   CGRPTQRWYHVPRSWLKPKQNLLVIFEELGGDASKISLVKRSTTSVCADAFEHHPAIENY  744

Query  757   EIESYGRTQE-LPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLE  581
               ES G ++  L + K+HL C+PGQSIS+IKFASFGTP GTCGSFQ+G CH+  S+SV+E
Sbjct  745   NNESNGESERNLHQAKVHLQCAPGQSISAIKFASFGTPTGTCGSFQEGACHSPNSHSVVE  804

Query  580   KKCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCT  473
             KKCIGR+ C V ISN+NFG DPCP+ +K+L+VEAVC+
Sbjct  805   KKCIGRESCMVTISNSNFGADPCPSKLKKLSVEAVCS  841



>dbj|BAJ96054.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=847

 Score =   296 bits (759),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 149/218 (68%), Positives = 180/218 (83%), Gaps = 3/218 (1%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A F+ P GDEPLALDM SMGKGQ+WING+S+GRY  AYATG+C  C Y G F+  KCQ G
Sbjct  629   AYFDTPSGDEPLALDMGSMGKGQIWINGQSIGRYSLAYATGDCKDCSYTGSFRAIKCQAG  688

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQRWYHVP+S L+PT NLLV+FEELGGD ++ISLV+RSVS+VC DV E HP+I+NW
Sbjct  689   CGQPTQRWYHVPKSWLQPTRNLLVVFEELGGDTSKISLVKRSVSNVCADVSEFHPSIKNW  748

Query  757   EIESYGRTQ-ELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLE  581
             + E+ G  + EL + K+HL C+PGQSIS+IKFASFGTPLGTCGSF+QG CH++ S +VLE
Sbjct  749   QTENSGEAKPELRRSKVHLRCAPGQSISAIKFASFGTPLGTCGSFEQGQCHSTKSQTVLE  808

Query  580   KKCIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCTP  470
               CIG+QRC+V IS  NF GDPCPNV+KR+ VEAVC+P
Sbjct  809   -NCIGKQRCAVTISPDNFGGDPCPNVMKRVAVEAVCSP  845



>ref|XP_009372992.1| PREDICTED: beta-galactosidase 3-like [Pyrus x bretschneideri]
Length=788

 Score =   294 bits (752),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 138/217 (64%), Positives = 180/217 (83%), Gaps = 1/217 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A F+ P+GDEPLALDM SMGKGQVWING+S+GRYWT YA G+C+ C Y+G F+P KCQ G
Sbjct  569   AYFDEPNGDEPLALDMGSMGKGQVWINGQSIGRYWTIYADGDCSACAYSGTFRPKKCQFG  628

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             C  PTQ+WYHVPRS LKP++NLLV+FEE+GGD ++++LV++SV+SVC +V E HP I NW
Sbjct  629   CQHPTQQWYHVPRSWLKPSKNLLVVFEEIGGDVSKVALVKKSVTSVCAEVSENHPRITNW  688

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
               ES+G+T+   KP++ LHC+ G SIS+IKF+SFGTP G+CG FQ G CHA  S +VL+K
Sbjct  689   HTESHGQTEVQQKPEISLHCTDGHSISAIKFSSFGTPSGSCGKFQHGTCHAPNSNAVLQK  748

Query  577   KCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTP  470
             +C+G+Q+CS+ ISNTNFG DPCP+ +K+L+VEAVC+P
Sbjct  749   ECLGKQKCSLTISNTNFGVDPCPSKLKKLSVEAVCSP  785



>gb|EMT10014.1| Beta-galactosidase 5 [Aegilops tauschii]
Length=851

 Score =   295 bits (755),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 150/218 (69%), Positives = 180/218 (83%), Gaps = 3/218 (1%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A F+ P GDEPLALDM SMGKGQ+WING+S+GRY  AYATG+C    Y G F+  KCQ G
Sbjct  633   AYFDTPSGDEPLALDMGSMGKGQIWINGQSIGRYSLAYATGDCKDYSYTGSFRATKCQAG  692

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQRWYHVP+S L+P+ NLLV+FEELGGD ++ISLV+RSVSSVC DV E HP+I+NW
Sbjct  693   CGQPTQRWYHVPKSWLQPSRNLLVVFEELGGDTSKISLVKRSVSSVCADVSEFHPSIKNW  752

Query  757   EIESYGRTQ-ELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLE  581
             + ES G  + EL + K+HL C+PGQSIS+IKFASFGTP GTCGSF+QG CH++ S +VLE
Sbjct  753   QTESSGEAKPELRRSKVHLRCAPGQSISAIKFASFGTPSGTCGSFEQGECHSTKSQTVLE  812

Query  580   KKCIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCTP  470
              KCIG+QRC+VAIS  NF GDPCPNV+KR+ VEAVC+P
Sbjct  813   -KCIGKQRCAVAISPDNFGGDPCPNVMKRVAVEAVCSP  849



>dbj|BAK07157.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=847

 Score =   294 bits (753),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 148/218 (68%), Positives = 179/218 (82%), Gaps = 3/218 (1%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A F+ P GDEPLALDM SMGKGQ+WING+S+GRY  AYATG+C  C Y G F+  KCQ G
Sbjct  629   AYFDTPSGDEPLALDMGSMGKGQIWINGQSIGRYSLAYATGDCKDCSYTGSFRAIKCQAG  688

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQRWYHVP+  L+PT NLLV+FEELGGD ++ISLV+RSVS+VC DV E HP+I+NW
Sbjct  689   CGQPTQRWYHVPKPWLQPTRNLLVVFEELGGDTSKISLVKRSVSNVCADVSEFHPSIKNW  748

Query  757   EIESYGRTQ-ELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLE  581
             + E+ G  + EL + K+HL C+PGQSIS+IKFASFGTPLGTCGSF+QG CH++ S +VLE
Sbjct  749   QTENSGEAKPELRRSKVHLRCAPGQSISAIKFASFGTPLGTCGSFEQGQCHSTKSQTVLE  808

Query  580   KKCIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCTP  470
               CIG+QRC+V IS  NF GDPCPNV+KR+ VEAVC+P
Sbjct  809   -NCIGKQRCAVTISPDNFGGDPCPNVMKRVAVEAVCSP  845



>ref|XP_002510455.1| beta-galactosidase, putative [Ricinus communis]
 gb|EEF52642.1| beta-galactosidase, putative [Ricinus communis]
Length=846

 Score =   293 bits (751),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 175/216 (81%), Gaps = 1/216 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A F+AP G+EPLALDM SMGKGQVWING+S+GRYW AYA G+CN C Y   F+P KCQLG
Sbjct  625   AYFDAPRGNEPLALDMRSMGKGQVWINGQSIGRYWMAYAKGDCNSCSYIWTFRPSKCQLG  684

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CG+PTQRWYHVPRS LKPT+NLLV+FEELGGD ++ISLV+RS+  VC D  E HP  +N+
Sbjct  685   CGEPTQRWYHVPRSWLKPTKNLLVVFEELGGDASKISLVKRSIEGVCADAYEHHPATKNY  744

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
                    + +L + K+HL C+PGQ I++IKFASFGTP GTCGSFQQG CHA  ++SV+EK
Sbjct  745   NTGGNDESSKLHQAKIHLRCAPGQFIAAIKFASFGTPSGTCGSFQQGTCHAPNTHSVIEK  804

Query  577   KCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCT  473
             KCIG++ C V ISN+NFG DPCPNV+K+L+VEAVC+
Sbjct  805   KCIGQESCMVTISNSNFGADPCPNVLKKLSVEAVCS  840



>dbj|BAD91085.1| beta-D-galactosidase [Pyrus pyrifolia]
Length=848

 Score =   293 bits (749),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 138/217 (64%), Positives = 179/217 (82%), Gaps = 1/217 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A F+ P+GDEPLALDM SMGKGQVWING+S+GRYWT YA  +C+ C Y+G F+P KCQ G
Sbjct  629   AYFDEPNGDEPLALDMGSMGKGQVWINGQSIGRYWTIYADSDCSACTYSGTFRPKKCQFG  688

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             C  PTQ+WYHVPRS LKP++NLLV+FEE+GGD ++++LV++SV+SVC +V E HP I NW
Sbjct  689   CQHPTQQWYHVPRSWLKPSKNLLVVFEEIGGDVSKVALVKKSVTSVCAEVSENHPRITNW  748

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
               ES+G+T+   KP++ LHC+ G SIS+IKF+SFGTP G+CG FQ G CHA  S +VL+K
Sbjct  749   HTESHGQTEVQQKPEISLHCTDGHSISAIKFSSFGTPSGSCGKFQHGTCHAPNSNAVLQK  808

Query  577   KCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTP  470
             +C+G+Q+CSV ISNTNFG DPCP+ +K+L+VEAVC+P
Sbjct  809   ECLGKQKCSVTISNTNFGADPCPSKLKKLSVEAVCSP  845



>ref|XP_008382310.1| PREDICTED: beta-galactosidase 5-like [Malus domestica]
Length=848

 Score =   293 bits (749),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 138/217 (64%), Positives = 180/217 (83%), Gaps = 1/217 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A F+ P+GDEPLALDM SMGKGQ WING+S+GRYWT YA G+C+ C Y+G F+P KCQ G
Sbjct  629   AYFDEPNGDEPLALDMGSMGKGQAWINGQSIGRYWTIYADGDCSACTYSGTFRPKKCQFG  688

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             C  PTQ+WYHVPRS LKP++NLLV+FEE+GGD ++++LV++SV+SVC +V E HP+I NW
Sbjct  689   CQHPTQQWYHVPRSWLKPSKNLLVVFEEIGGDVSKVALVKKSVTSVCAEVSENHPHITNW  748

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
               ES+G+T+   KP++ LHC+ G SIS+IKF+SFGTP G+CG FQ G CHA  S +VL+K
Sbjct  749   HTESHGQTEVQQKPEIGLHCTDGHSISAIKFSSFGTPSGSCGKFQHGTCHAPNSNAVLQK  808

Query  577   KCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTP  470
             +C+G+Q+CSV ISNTNFG DPCP+ +K+L+VEAVC+P
Sbjct  809   ECLGKQKCSVTISNTNFGADPCPSKLKKLSVEAVCSP  845



>ref|XP_012071945.1| PREDICTED: beta-galactosidase 5 [Jatropha curcas]
 gb|KDP38567.1| hypothetical protein JCGZ_04492 [Jatropha curcas]
Length=853

 Score =   293 bits (749),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 144/218 (66%), Positives = 176/218 (81%), Gaps = 1/218 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A F+AP G+EPLALD+ SMGKGQVWING+S+GRYW  YA G+C GC Y+G F+P KCQLG
Sbjct  626   AYFDAPGGNEPLALDLRSMGKGQVWINGQSIGRYWMTYAKGDCIGCSYSGTFRPSKCQLG  685

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQ+WYHVPRS LKPT+NLLV+FEELGGDP++I+LV+RSV+ VC D  E HP    +
Sbjct  686   CGQPTQQWYHVPRSWLKPTKNLLVVFEELGGDPSKIALVKRSVTRVCADAYEHHPAFEYY  745

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
               E +  +  L + K+HL CS GQSIS I FASFGTP GTCGSFQ+G CHAS + SV+EK
Sbjct  746   SREGHNESSMLHQAKIHLQCSLGQSISFINFASFGTPSGTCGSFQKGTCHASDTRSVIEK  805

Query  577   KCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTPS  467
             KCIG++ C V ISN+NFG DPCPNV+K+L++EAVC+ S
Sbjct  806   KCIGQESCMVTISNSNFGADPCPNVLKKLSIEAVCSTS  843



>emb|CDX69219.1| BnaC01g02340D [Brassica napus]
Length=824

 Score =   288 bits (736),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 135/217 (62%), Positives = 165/217 (76%), Gaps = 30/217 (14%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A F+AP+G+EPLALDM  MGKGQ+W+NGES+GRYWTA+ATG+C  C Y G +KP KC  G
Sbjct  628   AYFDAPEGNEPLALDMEGMGKGQIWVNGESIGRYWTAFATGDCGHCSYTGTYKPNKCLSG  687

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQR+YHVPRS LKP++NLL                              HPNI+NW
Sbjct  688   CGQPTQRYYHVPRSWLKPSQNLLY-----------------------------HPNIKNW  718

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
             +IESYG+ Q   +PK+HL CSPGQ+IS+IKFASFGTPLG CGS+QQG CHA+TSY++LE+
Sbjct  719   QIESYGKGQTFRRPKVHLKCSPGQAISAIKFASFGTPLGKCGSYQQGECHAATSYAILER  778

Query  577   KCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTP  470
             KC+G+ RC+V ISN+NFG DPCPNV+KRLTVEAVC+P
Sbjct  779   KCVGKARCAVTISNSNFGKDPCPNVLKRLTVEAVCSP  815



>gb|EMS60063.1| Beta-galactosidase 5 [Triticum urartu]
Length=860

 Score =   288 bits (736),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 147/221 (67%), Positives = 178/221 (81%), Gaps = 3/221 (1%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A F+ P GDEPLALDM SMGKGQ+WING+S+GRY  AYATG+C    Y G F+  KCQ G
Sbjct  593   AYFDTPSGDEPLALDMGSMGKGQIWINGQSIGRYSLAYATGDCKNYSYTGSFRATKCQAG  652

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQRWYHVP+S L+P+ NLLV+FEELGGD ++ISLV+RSVSSVC DV E HP+I+NW
Sbjct  653   CGQPTQRWYHVPKSWLQPSRNLLVVFEELGGDTSKISLVKRSVSSVCADVSEFHPSIKNW  712

Query  757   EIESYGRTQ-ELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLE  581
             + ES G  + EL + K+HL C+PGQSIS+IKFASFGTP GTCGSF+QG CH++ S +VLE
Sbjct  713   QTESSGEAKPELHRSKVHLRCAPGQSISAIKFASFGTPSGTCGSFEQGECHSTKSQTVLE  772

Query  580   KKCIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCTPSQW  461
              KCIG+QRC+VAIS  NF GDPCP+V+KR+ VEA     +W
Sbjct  773   -KCIGKQRCAVAISPDNFGGDPCPDVMKRVAVEAKENKHEW  812



>ref|XP_010672619.1| PREDICTED: beta-galactosidase 5 [Beta vulgaris subsp. vulgaris]
Length=837

 Score =   286 bits (733),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 139/216 (64%), Positives = 172/216 (80%), Gaps = 1/216 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A F+APDG EPLALDM SMGKG++WING S+GRYWT YA GNC  C+Y G ++  KCQ G
Sbjct  622   ANFDAPDGVEPLALDMESMGKGEIWINGLSIGRYWTNYAKGNCQPCNYGGTYRQTKCQSG  681

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CG+PTQRWYHVPR  LKP +N +V+FEELGGD ++ISL++RSVS VC D  E HP + +W
Sbjct  682   CGRPTQRWYHVPRGWLKPRQNQMVIFEELGGDASKISLMKRSVSRVCADAFEHHPMVEHW  741

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
              ++S G  + + +  + LHC PGQSI+SI+FASFGTPLGTCGSF +G CH+  S  VLEK
Sbjct  742   RLDSNGEQELIHQSNIRLHCGPGQSIASIQFASFGTPLGTCGSFVKGSCHSENSQDVLEK  801

Query  577   KCIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
              C+GR+RCSVAISN+NF GDPC NV+KRLTVEA+C+
Sbjct  802   LCVGRERCSVAISNSNFKGDPCRNVLKRLTVEAICS  837



>ref|XP_011083609.1| PREDICTED: beta-galactosidase 3-like [Sesamum indicum]
Length=845

 Score =   286 bits (732),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 136/216 (63%), Positives = 174/216 (81%), Gaps = 1/216 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A F+AP GDEPLALDM SMGKGQVWING+++GRYW AY+ GNC  CHYAG F+  KCQ  
Sbjct  626   AYFDAPSGDEPLALDMRSMGKGQVWINGQNIGRYWMAYSNGNCGVCHYAGTFRATKCQRS  685

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQRWYHVPRS L+PT+NL+VLFEELGGD ++ISLV+R+ + VC +  E  P++ N+
Sbjct  686   CGQPTQRWYHVPRSWLQPTQNLIVLFEELGGDASKISLVKRTTAGVCANAFEHRPSVANY  745

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
             +I+S   ++ L + K+HL CSPGQSIS+I FASFGTP GTCGSF+ G CHA  S+SV+EK
Sbjct  746   QIQSTSASKMLHQAKIHLSCSPGQSISAITFASFGTPTGTCGSFRLGNCHAQNSHSVVEK  805

Query  577   KCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCT  473
              C+G + C +A+SN+ FG DPCP V+K+L+VEA+C+
Sbjct  806   MCVGMESCKLAVSNSYFGADPCPRVLKKLSVEAICS  841



>emb|CDX75569.1| BnaA01g01330D [Brassica napus]
Length=827

 Score =   285 bits (729),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 135/217 (62%), Positives = 164/217 (76%), Gaps = 30/217 (14%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A F+AP+G+EPLALDM  MGKGQVW+NGES+GRYWTA+ATG+C  C Y G +KP KC  G
Sbjct  631   AYFDAPEGNEPLALDMEGMGKGQVWVNGESIGRYWTAFATGDCGHCSYTGTYKPNKCLSG  690

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQR+YHVPRS LKP++NLL                              HPNI+NW
Sbjct  691   CGQPTQRYYHVPRSWLKPSQNLLY-----------------------------HPNIKNW  721

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
             +IESYG+ Q   +PK+HL CS GQ+IS+IKFASFGTPLG CGS+QQG CHA+TSY++LE+
Sbjct  722   QIESYGKGQTFRRPKVHLKCSHGQAISAIKFASFGTPLGKCGSYQQGECHAATSYAILER  781

Query  577   KCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTP  470
             KC+G+ RC+V ISN+NFG DPCPNV+KRLTVEAVC+P
Sbjct  782   KCVGKARCAVTISNSNFGKDPCPNVLKRLTVEAVCSP  818



>ref|XP_011457728.1| PREDICTED: beta-galactosidase 3-like [Fragaria vesca subsp. vesca]
Length=843

 Score =   284 bits (727),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 137/218 (63%), Positives = 177/218 (81%), Gaps = 2/218 (1%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPP-KCQL  941
               F+AP+GDEPLALDM SMGKGQ+WING+S+GRYWT YA G+C+ C YAG F+P  KCQ 
Sbjct  626   VNFDAPEGDEPLALDMGSMGKGQLWINGQSIGRYWTTYANGDCSACSYAGTFRPKNKCQS  685

Query  940   GCGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRN  761
             GC +PTQ+WYHVPRS LK ++NLLV+FEE+ GD ++I+LV+ SVS+VC +V E HP IRN
Sbjct  686   GCNRPTQQWYHVPRSWLKQSKNLLVVFEEISGDVSKIALVKTSVSTVCAEVFENHPYIRN  745

Query  760   WEIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLE  581
             W  +S G+ +E  KP + LHC+ G SIS+IKF+SFGTP G+CG+FQ G CHA  S +V+E
Sbjct  746   WHTDSGGQLEEQKKPIMSLHCTEGYSISAIKFSSFGTPSGSCGNFQHGTCHAPNSKAVIE  805

Query  580   KKCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTP  470
             KKCIG+Q+CS+ IS+ NFG DPCP+++K+L+VEAVC P
Sbjct  806   KKCIGKQKCSLTISDANFGMDPCPSILKKLSVEAVCAP  843



>gb|KDO71053.1| hypothetical protein CISIN_1g003044mg [Citrus sinensis]
Length=816

 Score =   283 bits (723),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 161/190 (85%), Gaps = 0/190 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A FNAP+GDEPLALDM  MGKGQ+WING+S+GRYWTAYA G+CNGC+Y G ++P KCQLG
Sbjct  626   AYFNAPEGDEPLALDMEGMGKGQIWINGQSVGRYWTAYAKGDCNGCNYVGGYRPTKCQLG  685

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQRWYHVPRS LKPT+N LV+FEELGG+P+RISLV+RSV+SVC +V E HP I+NW
Sbjct  686   CGQPTQRWYHVPRSWLKPTQNFLVVFEELGGNPSRISLVKRSVTSVCAEVAEYHPTIKNW  745

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
              IESYG+ +E   PK+HL CSPG +ISSIKFASFGTPLGTCGS+QQGPCH+ TSY +LEK
Sbjct  746   HIESYGKPEEFHSPKVHLRCSPGHTISSIKFASFGTPLGTCGSYQQGPCHSPTSYDILEK  805

Query  577   KCIGRQRCSV  548
               I     SV
Sbjct  806   VFITALISSV  815



>gb|KDO84694.1| hypothetical protein CISIN_1g003076mg [Citrus sinensis]
Length=644

 Score =   278 bits (712),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 140/218 (64%), Positives = 173/218 (79%), Gaps = 1/218 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A F+AP G+EPLALD+ SMGKGQVWING+S+GRYW AYA G+C  C YAG F+P  CQ  
Sbjct  421   AYFDAPTGNEPLALDLRSMGKGQVWINGQSIGRYWMAYAKGDCKTCSYAGTFRPINCQRR  480

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CG PTQRWYHVPRS LKPT+NLLV+FEELGGD +RISLV+RSV+ VC D  E HP   N 
Sbjct  481   CGHPTQRWYHVPRSWLKPTKNLLVVFEELGGDASRISLVKRSVARVCADAHEHHPTTDNN  540

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
             +IE+ G +      K+ L C+PGQSI+SI+FASFGTP GTCGSFQ+G CHA  S+++LEK
Sbjct  541   DIENKGNSNSTGNAKVLLQCAPGQSITSIEFASFGTPSGTCGSFQKGTCHAPNSHAMLEK  600

Query  577   KCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTPS  467
             +CIG++ CS+ IS+  FG DPCPNV+KRL+V+AVC+ +
Sbjct  601   ECIGQESCSIFISSGVFGTDPCPNVLKRLSVQAVCSTA  638



>gb|EYU32887.1| hypothetical protein MIMGU_mgv1a001295mg [Erythranthe guttata]
Length=845

 Score =   283 bits (723),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 131/218 (60%), Positives = 174/218 (80%), Gaps = 1/218 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A F+AP+GDEPLALDM+SMGKGQVW+NG+S+GRYW   A GNC+ CHY G ++ PKCQLG
Sbjct  626   AYFDAPNGDEPLALDMTSMGKGQVWVNGQSIGRYWLTNANGNCDICHYNGTYRAPKCQLG  685

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQRWYHVPRS L+PT+N +VL EE+GGD ++I+LV+R+ S VC +  E HP + N+
Sbjct  686   CGQPTQRWYHVPRSWLRPTQNFIVLLEEIGGDASKIALVKRTTSRVCANAFEHHPTVANY  745

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
             + ES    + L + ++HL C PGQSIS+IKFASFGTP GTCGSFQ G CH+  S +++EK
Sbjct  746   KTESTAPQKMLRQARVHLSCGPGQSISAIKFASFGTPKGTCGSFQLGNCHSQNSNALIEK  805

Query  577   KCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTPS  467
              C+G++ C +A+SN+ FG DPCP V+K+L+VEA+C+ +
Sbjct  806   MCVGKESCKIAVSNSYFGSDPCPRVLKKLSVEAICSTT  843



>ref|XP_006435077.1| hypothetical protein CICLE_v10000260mg [Citrus clementina]
 gb|ESR48317.1| hypothetical protein CICLE_v10000260mg [Citrus clementina]
Length=644

 Score =   277 bits (709),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 140/219 (64%), Positives = 172/219 (79%), Gaps = 1/219 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A F+AP G+EPLALD+ SMGKGQVWING+S+GRYW AYA G+C  C YAG F+P  CQ  
Sbjct  421   AYFDAPAGNEPLALDLRSMGKGQVWINGQSIGRYWMAYAKGDCKTCSYAGTFRPINCQRR  480

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CG PTQRWYHVPRS LKPT+NLLV+FEELGGD +RISLV+RSV+ VC D  E HP   N 
Sbjct  481   CGHPTQRWYHVPRSWLKPTKNLLVVFEELGGDASRISLVKRSVARVCADAHEHHPTTDNN  540

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
             +IE+ G +      K+ L C+PGQSI+SI+FASFGTP GTCGSFQ+G CHA  S+++LEK
Sbjct  541   DIENKGNSNSTGNAKVLLQCAPGQSITSIEFASFGTPSGTCGSFQKGTCHAPNSHAMLEK  600

Query  577   KCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTPSQ  464
             +CIG+  CS+ IS+  FG DPCPNV+KRL+V+AVC+ + 
Sbjct  601   ECIGQDSCSIFISSGVFGTDPCPNVLKRLSVQAVCSTAD  639



>gb|KDO84693.1| hypothetical protein CISIN_1g003076mg [Citrus sinensis]
Length=698

 Score =   278 bits (712),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 140/218 (64%), Positives = 173/218 (79%), Gaps = 1/218 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A F+AP G+EPLALD+ SMGKGQVWING+S+GRYW AYA G+C  C YAG F+P  CQ  
Sbjct  475   AYFDAPTGNEPLALDLRSMGKGQVWINGQSIGRYWMAYAKGDCKTCSYAGTFRPINCQRR  534

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CG PTQRWYHVPRS LKPT+NLLV+FEELGGD +RISLV+RSV+ VC D  E HP   N 
Sbjct  535   CGHPTQRWYHVPRSWLKPTKNLLVVFEELGGDASRISLVKRSVARVCADAHEHHPTTDNN  594

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
             +IE+ G +      K+ L C+PGQSI+SI+FASFGTP GTCGSFQ+G CHA  S+++LEK
Sbjct  595   DIENKGNSNSTGNAKVLLQCAPGQSITSIEFASFGTPSGTCGSFQKGTCHAPNSHAMLEK  654

Query  577   KCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTPS  467
             +CIG++ CS+ IS+  FG DPCPNV+KRL+V+AVC+ +
Sbjct  655   ECIGQESCSIFISSGVFGTDPCPNVLKRLSVQAVCSTA  692



>ref|XP_006473573.1| PREDICTED: beta-galactosidase 3-like [Citrus sinensis]
Length=850

 Score =   280 bits (717),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 140/218 (64%), Positives = 174/218 (80%), Gaps = 1/218 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A F+AP G+EPLALD+ SMGKGQVWING+S+GRYW AYA G+C  C YAG F+P  CQ  
Sbjct  627   AYFDAPTGNEPLALDLRSMGKGQVWINGQSIGRYWMAYAKGDCKTCSYAGTFRPINCQRR  686

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CG PTQRWYHVPRS LKPT+NLLV+FEELGGD +RISLV+RSV+ VC D  E HP   N+
Sbjct  687   CGHPTQRWYHVPRSWLKPTKNLLVVFEELGGDASRISLVKRSVARVCADAHEHHPTTDNY  746

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
             +IE+ G +      K+ L C+PGQSI+SI+FASFGTP GTCGSFQ+G CHA  S+++LEK
Sbjct  747   DIENKGNSNSTGNAKVLLQCAPGQSITSIEFASFGTPSGTCGSFQKGTCHAPNSHAMLEK  806

Query  577   KCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTPS  467
             +CIG++ CS+ IS+  FG DPCPNV+KRL+V+AVC+ +
Sbjct  807   ECIGQESCSIFISSGVFGKDPCPNVLKRLSVQAVCSTA  844



>gb|KDO84688.1| hypothetical protein CISIN_1g003076mg [Citrus sinensis]
Length=850

 Score =   278 bits (711),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 140/218 (64%), Positives = 173/218 (79%), Gaps = 1/218 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A F+AP G+EPLALD+ SMGKGQVWING+S+GRYW AYA G+C  C YAG F+P  CQ  
Sbjct  627   AYFDAPTGNEPLALDLRSMGKGQVWINGQSIGRYWMAYAKGDCKTCSYAGTFRPINCQRR  686

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CG PTQRWYHVPRS LKPT+NLLV+FEELGGD +RISLV+RSV+ VC D  E HP   N 
Sbjct  687   CGHPTQRWYHVPRSWLKPTKNLLVVFEELGGDASRISLVKRSVARVCADAHEHHPTTDNN  746

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
             +IE+ G +      K+ L C+PGQSI+SI+FASFGTP GTCGSFQ+G CHA  S+++LEK
Sbjct  747   DIENKGNSNSTGNAKVLLQCAPGQSITSIEFASFGTPSGTCGSFQKGTCHAPNSHAMLEK  806

Query  577   KCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTPS  467
             +CIG++ CS+ IS+  FG DPCPNV+KRL+V+AVC+ +
Sbjct  807   ECIGQESCSIFISSGVFGTDPCPNVLKRLSVQAVCSTA  844



>ref|XP_006435076.1| hypothetical protein CICLE_v10000260mg [Citrus clementina]
 gb|ESR48316.1| hypothetical protein CICLE_v10000260mg [Citrus clementina]
Length=850

 Score =   277 bits (709),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 140/219 (64%), Positives = 172/219 (79%), Gaps = 1/219 (0%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A F+AP G+EPLALD+ SMGKGQVWING+S+GRYW AYA G+C  C YAG F+P  CQ  
Sbjct  627   AYFDAPAGNEPLALDLRSMGKGQVWINGQSIGRYWMAYAKGDCKTCSYAGTFRPINCQRR  686

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CG PTQRWYHVPRS LKPT+NLLV+FEELGGD +RISLV+RSV+ VC D  E HP   N 
Sbjct  687   CGHPTQRWYHVPRSWLKPTKNLLVVFEELGGDASRISLVKRSVARVCADAHEHHPTTDNN  746

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
             +IE+ G +      K+ L C+PGQSI+SI+FASFGTP GTCGSFQ+G CHA  S+++LEK
Sbjct  747   DIENKGNSNSTGNAKVLLQCAPGQSITSIEFASFGTPSGTCGSFQKGTCHAPNSHAMLEK  806

Query  577   KCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTPSQ  464
             +CIG+  CS+ IS+  FG DPCPNV+KRL+V+AVC+ + 
Sbjct  807   ECIGQDSCSIFISSGVFGTDPCPNVLKRLSVQAVCSTAD  845



>gb|KCW69754.1| hypothetical protein EUGRSUZ_F031301, partial [Eucalyptus grandis]
Length=291

 Score =   258 bits (660),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 130/215 (60%), Positives = 160/215 (74%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             FNAP G  PLALDM SM KGQVWING+SLGRYW AY A+G CN C+Y G F   KC   C
Sbjct  77    FNAPGGSAPLALDMDSMSKGQVWINGQSLGRYWPAYKASGTCNSCNYTGTFNENKCLSNC  136

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +QRWYH+PRS L PT NLLV+ EE GG+P  ISLV+R + SVC D+ E  P + NW+
Sbjct  137   GEASQRWYHIPRSWLYPTGNLLVVLEEWGGEPNGISLVKREIDSVCSDIFEWQPTLMNWQ  196

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             +++ G+  +  +PK+HL CSPGQ ISSI+FASFGTP GTCGSF+QG CHA  SY V E+ 
Sbjct  197   MQASGKVTKPLRPKVHLWCSPGQQISSIRFASFGTPEGTCGSFRQGSCHAFHSYDVFERT  256

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             C+G   CSV ++   F GDPCPNV+K+L+VEAVC+
Sbjct  257   CLGLNSCSVTVAPEIFGGDPCPNVMKKLSVEAVCS  291



>ref|XP_006283100.1| hypothetical protein CARUB_v10004117mg [Capsella rubella]
 gb|EOA15998.1| hypothetical protein CARUB_v10004117mg [Capsella rubella]
Length=813

 Score =   272 bits (696),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 127/178 (71%), Positives = 157/178 (88%), Gaps = 0/178 (0%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLGCG  932
             F+AP+G+EPLALDM  MGKGQ+W+NGES+GRYWTA+ATG+C+ C Y G +KP KCQ GCG
Sbjct  633   FDAPEGNEPLALDMEGMGKGQIWVNGESIGRYWTAFATGDCSHCSYTGTYKPNKCQTGCG  692

Query  931   QPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWEI  752
             QPTQRWYHVPRS LKP++NLLV+FEELGG+P+ +SLV+RSVS VC +V E HPNI+NW+I
Sbjct  693   QPTQRWYHVPRSWLKPSQNLLVIFEELGGNPSSVSLVKRSVSGVCAEVSEYHPNIKNWQI  752

Query  751   ESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
             ESYG+ Q   +PK+HL CSPGQ+I+SIKFASFGTPLGTCGS+QQG CHA+TSY++L +
Sbjct  753   ESYGKGQTFHRPKVHLKCSPGQAIASIKFASFGTPLGTCGSYQQGECHATTSYAILAR  810



>gb|ERM94020.1| hypothetical protein AMTR_s00136p00108810 [Amborella trichopoda]
Length=755

 Score =   270 bits (689),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 136/216 (63%), Positives = 166/216 (77%), Gaps = 2/216 (1%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQL  941
             A FNAP GDEPLALDM SMGKGQVWING+S+GRYW AY A G+C  C Y+G +    CQ 
Sbjct  539   ATFNAPGGDEPLALDMGSMGKGQVWINGQSIGRYWPAYTAKGSCGDCSYSGTYNEKNCQS  598

Query  940   GCGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRN  761
              CG+P+QRWYHVPR  L PT NLLV+FEE GGDP+ ISLV+RSV SVC DV E H  I+N
Sbjct  599   NCGEPSQRWYHVPRPWLNPTGNLLVVFEEWGGDPSGISLVKRSVGSVCADVSEWHLTIKN  658

Query  760   WEIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLE  581
             W I++YG+ + L + K+HL C  GQ+I+SIKFASFGTP G CG+FQQG CH+  SY+V +
Sbjct  659   WHIKTYGKPERLQRAKVHLGCDQGQTITSIKFASFGTPQGACGNFQQGACHSPNSYAVFQ  718

Query  580   KKCIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVC  476
             KKC+G+Q C+V IS   F GDPC +V+KR+ VEA+C
Sbjct  719   KKCVGQQACAVTISPDVFGGDPCFSVMKRVAVEAIC  754



>ref|XP_006826783.2| PREDICTED: beta-galactosidase [Amborella trichopoda]
Length=815

 Score =   270 bits (691),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 136/216 (63%), Positives = 166/216 (77%), Gaps = 2/216 (1%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQL  941
             A FNAP GDEPLALDM SMGKGQVWING+S+GRYW AY A G+C  C Y+G +    CQ 
Sbjct  599   ATFNAPGGDEPLALDMGSMGKGQVWINGQSIGRYWPAYTAKGSCGDCSYSGTYNEKNCQS  658

Query  940   GCGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRN  761
              CG+P+QRWYHVPR  L PT NLLV+FEE GGDP+ ISLV+RSV SVC DV E H  I+N
Sbjct  659   NCGEPSQRWYHVPRPWLNPTGNLLVVFEEWGGDPSGISLVKRSVGSVCADVSEWHLTIKN  718

Query  760   WEIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLE  581
             W I++YG+ + L + K+HL C  GQ+I+SIKFASFGTP G CG+FQQG CH+  SY+V +
Sbjct  719   WHIKTYGKPERLQRAKVHLGCDQGQTITSIKFASFGTPQGACGNFQQGACHSPNSYAVFQ  778

Query  580   KKCIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVC  476
             KKC+G+Q C+V IS   F GDPC +V+KR+ VEA+C
Sbjct  779   KKCVGQQACAVTISPDVFGGDPCFSVMKRVAVEAIC  814



>ref|XP_010107841.1| Beta-galactosidase 3 [Morus notabilis]
 gb|EXC17241.1| Beta-galactosidase 3 [Morus notabilis]
Length=860

 Score =   270 bits (691),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 133/217 (61%), Positives = 168/217 (77%), Gaps = 7/217 (3%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A F+ P GDEPLALDMSSM KGQ+WING+++GRYWT +A GNCN C YA  F+PPKC+ G
Sbjct  627   AYFDEPAGDEPLALDMSSMQKGQIWINGQNIGRYWTIHANGNCNTCSYASTFRPPKCEFG  686

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             C QPTQ+WYHVPRS LKP+ NLLV+F E+GGD ++I+L +RSV++VC  V +      NW
Sbjct  687   CNQPTQKWYHVPRSWLKPSRNLLVVFGEIGGDVSKITLAKRSVTTVCAKVSD------NW  740

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
               ES G  + L  P + LHC+ G SISSIKFASFGTP G+CG+FQ G CHA +S +VLEK
Sbjct  741   HAESIGGQEGLTVPNISLHCTAGYSISSIKFASFGTPSGSCGNFQHGTCHAPSSLAVLEK  800

Query  577   KCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTP  470
             +CIG+Q C V +S++NFG DPCPN  K+L+VEA+C+P
Sbjct  801   ECIGQQTCLVTVSSSNFGADPCPNTPKKLSVEALCSP  837



>emb|CDY59722.1| BnaA03g59210D [Brassica napus]
Length=188

 Score =   250 bits (638),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/202 (59%), Positives = 149/202 (74%), Gaps = 24/202 (12%)
 Frame = -3

Query  1072  MSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLGCGQPTQRWYHVPRSL  893
             M  MGKGQ+W+NGES+G YWTA+ATG+C+ C Y G +KP KC  GCGQPTQR+YHVPRS 
Sbjct  1     MEGMGKGQIWVNGESIGIYWTAFATGDCDHCSYTGTYKPNKCLSGCGQPTQRYYHVPRSW  60

Query  892   LKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWEIESYGRTQELPKPK  713
             LKP++NL+                       C +V E HP I  W++ESYG+ Q   +PK
Sbjct  61    LKPSQNLV-----------------------CAEVSEYHPTINIWQMESYGKGQTFHRPK  97

Query  712   LHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKKCIGRQRCSVAISNT  533
             LHL CSPGQ+IS+IKFASFGTPLG C ++QQG CHA+TSY++LE+KC+G+ R ++ ISNT
Sbjct  98    LHLKCSPGQAISAIKFASFGTPLGKCRTYQQGECHAATSYAILERKCVGKARNAMLISNT  157

Query  532   NFG-DPCPNVVKRLTVEAVCTP  470
             NFG DPC NV+KRLTVEAVC+P
Sbjct  158   NFGKDPCLNVLKRLTVEAVCSP  179



>gb|ABF94150.1| Beta-galactosidase precursor, putative, expressed [Oryza sativa 
Japonica Group]
Length=819

 Score =   266 bits (679),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 150/180 (83%), Gaps = 1/180 (1%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A F+ P GDEPLALDM SMGKGQ+WING+S+GRYWTAYA G+C GCHY G ++ PKCQ G
Sbjct  624   AYFDTPSGDEPLALDMGSMGKGQIWINGQSIGRYWTAYAEGDCKGCHYTGSYRAPKCQAG  683

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQRWYHVPRS L+PT NLLV+FEELGGD ++I+L +R+VS VC DV E HPNI+NW
Sbjct  684   CGQPTQRWYHVPRSWLQPTRNLLVVFEELGGDSSKIALAKRTVSGVCADVSEYHPNIKNW  743

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
             +IESYG   E    K+HL C+PGQ+IS+IKFASFGTPLGTCG+FQQG CH+  S SVLEK
Sbjct  744   QIESYGEP-EFHTAKVHLKCAPGQTISAIKFASFGTPLGTCGTFQQGECHSINSNSVLEK  802



>ref|XP_004147848.1| PREDICTED: beta-galactosidase 5-like [Cucumis sativus]
 ref|XP_011652436.1| PREDICTED: beta-galactosidase 5-like [Cucumis sativus]
 ref|XP_011652437.1| PREDICTED: beta-galactosidase 5-like [Cucumis sativus]
Length=844

 Score =   265 bits (676),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 136/215 (63%), Positives = 167/215 (78%), Gaps = 6/215 (3%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A FNAP G+EPLALD+ SMGKGQ WING+S+GRYW AYA G C+ C YAG ++PP C+ G
Sbjct  625   ASFNAPRGNEPLALDLRSMGKGQAWINGQSIGRYWMAYAKGGCSRCTYAGTYRPPTCENG  684

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQRWYHVPRS LKPT N+LVLFEELGGD ++ISL+RRSV+ +CG+  E H    ++
Sbjct  685   CGQPTQRWYHVPRSWLKPTNNVLVLFEELGGDASKISLMRRSVTGLCGEAVEYHAKNDSY  744

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
              IES    +EL    LHL C+PGQ IS+IKFASFGTP GTCGS+Q+G CHA  S++++EK
Sbjct  745   IIES---NEEL--DSLHLQCNPGQVISAIKFASFGTPSGTCGSYQKGTCHAPDSHAIIEK  799

Query  577   KCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVC  476
             KCIG + CSV+ +  NFG DPCPN +K+L VE  C
Sbjct  800   KCIGLKSCSVSTTRDNFGVDPCPNELKQLLVEVDC  834



>emb|CDP07463.1| unnamed protein product [Coffea canephora]
Length=850

 Score =   265 bits (676),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 129/218 (59%), Positives = 166/218 (76%), Gaps = 5/218 (2%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A F+AP G+EPLALDM SMGKGQVWING+S+GRYW   A GNC  C Y+G F+  KCQLG
Sbjct  627   AYFDAPMGNEPLALDMKSMGKGQVWINGQSIGRYWITNANGNCGTCQYSGTFRVSKCQLG  686

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQ WYHVPRS LKP++NLLV+FEE+GGD ++ISLV+R+ +SVC    E  P I NW
Sbjct  687   CGQPTQHWYHVPRSWLKPSQNLLVVFEEIGGDASKISLVKRATTSVCASAQEHRPTIVNW  746

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
              ++S G ++ L + K+HL C+ GQ+IS IKFASFGTP GTCG++Q G CHA  S+++   
Sbjct  747   HVDSNGESEMLRQAKIHLECAAGQTISGIKFASFGTPSGTCGAYQLGTCHAKNSHAM---  803

Query  577   KCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTPS  467
              C+G++ C   +S+  FG DPCPN +KRL+VEA+C+ S
Sbjct  804   -CLGQENCRATVSDNFFGSDPCPNQLKRLSVEAICSTS  840



>ref|XP_010262132.1| PREDICTED: beta-galactosidase isoform X2 [Nelumbo nucifera]
Length=842

 Score =   264 bits (675),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 131/215 (61%), Positives = 162/215 (75%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             FNAP G+EPLALDM SMGKGQ+WINGES+GRYW AY A G+C GC+YAG +   KC+  C
Sbjct  628   FNAPGGNEPLALDMGSMGKGQIWINGESIGRYWPAYKAYGSCGGCNYAGTYDEKKCRSNC  687

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +QRWYHVPRS L+PT N LV+FEE GG P  ISL +R+V SVC D+ E  P + NWE
Sbjct  688   GEASQRWYHVPRSWLRPTGNQLVIFEEWGGYPNWISLDKRTVQSVCADIYEWQPTLTNWE  747

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             ++S G+ Q   +PK HL CSPG  ISSIKFASFGTP G CGSFQ+G CHA  SY   ++ 
Sbjct  748   LQSSGKVQRPLRPKAHLWCSPGTKISSIKFASFGTPQGVCGSFQEGSCHAHKSYDAFQRN  807

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             CIG+Q CSV ++   F GDPCP+ +K+L+VEA+C+
Sbjct  808   CIGQQTCSVTVAPEVFGGDPCPSTMKKLSVEAICS  842



>gb|EYU21377.1| hypothetical protein MIMGU_mgv1a001631mg [Erythranthe guttata]
Length=782

 Score =   263 bits (671),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 130/215 (60%), Positives = 164/215 (76%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             FNAP+GDEPLALDM++M KGQ+WINGES+GRYW  Y A+G C  C+Y G F   KC   C
Sbjct  568   FNAPEGDEPLALDMNTMSKGQIWINGESIGRYWNQYKASGECVPCNYTGWFDEKKCLSKC  627

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
              + +QRWYHVPRS L+P+ NLLV+FEE GG+P  ISLV+R V SVC D+ E  PN+ NW+
Sbjct  628   DEASQRWYHVPRSWLRPSGNLLVVFEEWGGNPNGISLVKREVESVCADIYEWQPNLMNWQ  687

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             ++S G+  +  +PK HL C+PGQ ISS+KFASFGTP G CGSF+QG CHA  SY V E+ 
Sbjct  688   MQSSGKVTKALRPKAHLSCAPGQKISSVKFASFGTPEGACGSFRQGSCHAFHSYDVFERY  747

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             C+G+Q CSV I+   F GDPCPN++K+L+VEAVC+
Sbjct  748   CVGQQSCSVPITPEIFGGDPCPNIMKKLSVEAVCS  782



>dbj|BAF31233.1| beta-D-galactosidase [Persea americana]
Length=849

 Score =   262 bits (670),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 131/214 (61%), Positives = 154/214 (72%), Gaps = 2/214 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             FNAP+G+ P ALDMS MGKGQ+WING+S+GRYW AY A GNC  C Y G +   KC   C
Sbjct  635   FNAPEGNGPFALDMSMMGKGQIWINGQSIGRYWPAYKAYGNCGECSYTGRYNEKKCLANC  694

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +QRWYHVP S L PT NLLV+FEE GGDPT ISLVRR+  S C  + E HP +R W 
Sbjct  695   GEASQRWYHVPSSWLYPTANLLVVFEEWGGDPTGISLVRRTTGSACAFISEWHPTLRKWH  754

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             I+ YGR +   +PK HL C+ GQ ISSIKFASFGTP G CG+F +G CHA  SY + EK 
Sbjct  755   IKDYGRAERPRRPKAHLSCADGQKISSIKFASFGTPQGVCGNFTEGSCHAHKSYDIFEKN  814

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVC  476
             C+G+Q CSV IS   F GDPCPNV+K L VEA+C
Sbjct  815   CVGQQWCSVTISPDVFGGDPCPNVMKNLAVEAIC  848



>gb|ACC60981.1| beta-galactosidase 1 precursor [Petunia x hybrida]
Length=842

 Score =   262 bits (669),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 129/215 (60%), Positives = 163/215 (76%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             FNAP G+EPLALDM+SMGKGQVWING+S+GRYW  Y A+G C+ C+YAGPF   KC   C
Sbjct  628   FNAPAGNEPLALDMNSMGKGQVWINGQSIGRYWPGYKASGTCDACNYAGPFNEKKCLSNC  687

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G  +QRWYHVPRS L PT NLLV+FEE GGDP  ISLV+R ++SVC D+ E  P + NW+
Sbjct  688   GDASQRWYHVPRSWLHPTGNLLVVFEEWGGDPNGISLVKRELASVCADINEWQPQLVNWQ  747

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             +++ G+  +  +PK HL C+ GQ I+SIKFASFGTP G CGSF +G CHA  SY   EK 
Sbjct  748   LQASGKVDKPLRPKAHLSCTSGQKITSIKFASFGTPQGVCGSFSEGSCHAHHSYDAFEKY  807

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             CIG++ C+V ++   F GDPCP+V+K+L+VEAVC+
Sbjct  808   CIGQESCTVPVTPEIFGGDPCPSVMKKLSVEAVCS  842



>ref|XP_009789773.1| PREDICTED: beta-galactosidase-like [Nicotiana sylvestris]
Length=842

 Score =   261 bits (668),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 126/215 (59%), Positives = 164/215 (76%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             FNAP G+EPLALDM++MGKGQVWING+S+GRYW  Y A+G C  C+YAG F   KCQ  C
Sbjct  628   FNAPAGNEPLALDMNAMGKGQVWINGQSIGRYWPGYKASGTCGACNYAGYFNEDKCQSNC  687

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +QRWYHVPRS L PT NLLV+FEE GGDP  ISL++R ++SVC D+ E  P + NW+
Sbjct  688   GEASQRWYHVPRSWLHPTGNLLVVFEEWGGDPNAISLIKRELASVCADINEWQPQLVNWQ  747

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             +++ G+  +  +P+ HL C+PGQ I+SIKFASFGTP G CGSF++G CHA  SY   EK 
Sbjct  748   MQASGKVDKPLRPRAHLSCAPGQKITSIKFASFGTPQGVCGSFREGSCHAHHSYDAFEKY  807

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             CIG++ C+V ++   F GDPCP V+K+L+VEA+C+
Sbjct  808   CIGQESCTVPVTPEIFGGDPCPGVMKKLSVEAICS  842



>ref|XP_003597608.1| Beta-galactosidase [Medicago truncatula]
 gb|ABN08398.1| D-galactoside/L-rhamnose binding SUEL lectin; Galactose-binding 
like [Medicago truncatula]
 gb|AES67859.1| beta-galactosidase [Medicago truncatula]
Length=841

 Score =   261 bits (666),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 128/215 (60%), Positives = 163/215 (76%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             F+APDG  P ALDM SMGKGQVW+NG++LGRYW AY A+G C+ C YAG +   KC+  C
Sbjct  627   FDAPDGIAPFALDMGSMGKGQVWLNGQNLGRYWPAYKASGTCDNCDYAGTYNENKCRSNC  686

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +QRWYHVP S L PT NLLV+FEELGGDP  I LVRR + SVC D+ E  PN+ +++
Sbjct  687   GEASQRWYHVPHSWLIPTGNLLVVFEELGGDPNGIFLVRRDIDSVCADIYEWQPNLISYQ  746

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             +++ G+T +  +PK HL C PGQ ISSIKFASFGTP+G+CG+F +G CHA  SY+  EK 
Sbjct  747   MQTSGKTNKPVRPKAHLSCGPGQKISSIKFASFGTPVGSCGNFHEGSCHAHKSYNTFEKN  806

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             C+G+  C V +S  NF GDPCPNV+K+L+VEA+CT
Sbjct  807   CVGQNSCKVTVSPENFGGDPCPNVLKKLSVEAICT  841



>ref|XP_009783993.1| PREDICTED: beta-galactosidase [Nicotiana sylvestris]
Length=844

 Score =   260 bits (665),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 129/215 (60%), Positives = 162/215 (75%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             FNAP G+EPLALDM++MGKGQVWING+SLGR+W  Y ++GNC  C+Y G F   KC   C
Sbjct  630   FNAPAGNEPLALDMNTMGKGQVWINGQSLGRHWPGYKSSGNCTACYYTGWFDEKKCLSNC  689

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +QRWYHVPRS L PT NLLV+FEE GGDP  I+LV+R ++SVC D+ E  P + NW+
Sbjct  690   GEGSQRWYHVPRSWLHPTGNLLVVFEEWGGDPYGITLVKREIASVCADIYEWQPQLLNWQ  749

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
               + G+     +PK HL C+PGQ ISSIKFASFGTP G CGSFQQG CHA  SY   EK 
Sbjct  750   RLASGKFDRPLRPKAHLRCAPGQKISSIKFASFGTPEGVCGSFQQGSCHARHSYDAFEKN  809

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             C+G++ CSV+++  NF GDPC NV+K+L+VEA+C+
Sbjct  810   CVGQESCSVSVTPENFGGDPCRNVLKKLSVEAICS  844



>ref|XP_009606115.1| PREDICTED: beta-galactosidase-like [Nicotiana tomentosiformis]
Length=844

 Score =   260 bits (664),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 127/215 (59%), Positives = 163/215 (76%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             FNAP G+EPLALDM+ MGKGQVWING+SLGRYW  Y A+G C  C+YAG F   KCQ  C
Sbjct  630   FNAPAGNEPLALDMNVMGKGQVWINGQSLGRYWPGYKASGTCGACNYAGFFSEDKCQSNC  689

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +QRWYHVPRS L PT NLLV+FEE GGDP  ISLV+R ++SVC D+ E  P + NW+
Sbjct  690   GEASQRWYHVPRSWLHPTGNLLVVFEEWGGDPNAISLVKRELASVCADINEWQPQLVNWQ  749

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             +++ G+  +  +P+ HL C+PGQ I+SIKFASFG+P G CGSF++G CHA  SY   EK 
Sbjct  750   MQASGKVDKPLRPRAHLSCAPGQKITSIKFASFGSPQGVCGSFREGSCHAHHSYDAFEKY  809

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             CIG++ C+V ++   F GDPCP V+K+L+VEA+C+
Sbjct  810   CIGQESCTVPVTPEIFGGDPCPGVMKKLSVEAICS  844



>dbj|BAD95407.1| galactosidase [Arabidopsis thaliana]
Length=270

 Score =   245 bits (626),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 124/215 (58%), Positives = 156/215 (73%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             F+AP GD PLA+DM SMGKGQ+WING+SLGR+W AY A G+C+ C Y G F+  KC   C
Sbjct  56    FSAPAGDSPLAVDMGSMGKGQIWINGQSLGRHWPAYKAVGSCSECSYTGTFREDKCLRNC  115

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +QRWYHVPRS LKP+ NLLV+FEE GGDP  I+LVRR V SVC D+ E    + N++
Sbjct  116   GEASQRWYHVPRSWLKPSGNLLVVFEEWGGDPNGITLVRREVDSVCADIYEWQSTLVNYQ  175

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             + + G+  +   PK HL C PGQ I+++KFASFGTP GTCGS++QG CHA  SY    K 
Sbjct  176   LHASGKVNKPLHPKAHLQCGPGQKITTVKFASFGTPEGTCGSYRQGSCHAHHSYDAFNKL  235

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             C+G+  CSV ++   F GDPCPNV+K+L VEAVC 
Sbjct  236   CVGQNWCSVTVAPEMFGGDPCPNVMKKLAVEAVCA  270



>ref|XP_010062625.1| PREDICTED: beta-galactosidase 1 [Eucalyptus grandis]
Length=825

 Score =   259 bits (663),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 130/215 (60%), Positives = 160/215 (74%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             FNAP G  PLALDM SM KGQVWING+SLGRYW AY A+G CN C+Y G F   KC   C
Sbjct  611   FNAPGGSAPLALDMDSMSKGQVWINGQSLGRYWPAYKASGTCNSCNYTGTFNENKCLSNC  670

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +QRWYH+PRS L PT NLLV+ EE GG+P  ISLV+R + SVC D+ E  P + NW+
Sbjct  671   GEASQRWYHIPRSWLYPTGNLLVVLEEWGGEPNGISLVKREIDSVCSDIFEWQPTLMNWQ  730

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             +++ G+  +  +PK+HL CSPGQ ISSI+FASFGTP GTCGSF+QG CHA  SY V E+ 
Sbjct  731   MQASGKVTKPLRPKVHLWCSPGQQISSIRFASFGTPEGTCGSFRQGSCHAFHSYDVFERT  790

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             C+G   CSV ++   F GDPCPNV+K+L+VEAVC+
Sbjct  791   CLGLNSCSVTVAPEIFGGDPCPNVMKKLSVEAVCS  825



>ref|XP_009407297.1| PREDICTED: beta-galactosidase 2 [Musa acuminata subsp. malaccensis]
Length=836

 Score =   259 bits (663),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 134/216 (62%), Positives = 156/216 (72%), Gaps = 8/216 (4%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQL  941
             A FNAPDG+EPLALDMSSMGKGQVWING+S+GRYW  Y A G+C  C Y G +   KCQ 
Sbjct  626   AFFNAPDGNEPLALDMSSMGKGQVWINGQSIGRYWPGYMAYGSCGDCDYRGTYDEKKCQT  685

Query  940   GCGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRN  761
              CG+P+Q+WYHVPRS L PT NLLV+FEE  GDPT IS+V+RSV SVC D+ E  P++ N
Sbjct  686   NCGEPSQKWYHVPRSWLNPTGNLLVVFEEWAGDPTGISMVKRSVGSVCADISEWQPSMSN  745

Query  760   WEIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLE  581
             W    YG      KPK+ L C   Q+I++IKFASFGTP G CGSF +G CHA  SY   E
Sbjct  746   WHTRDYG------KPKVRLFCGTAQNITAIKFASFGTPQGACGSFSEGSCHAHKSYDAFE  799

Query  580   KKCIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVC  476
             K C+G QRCSV IS   F GDPCP  +KR+TVEAVC
Sbjct  800   KNCLGEQRCSVTISPEVFGGDPCPGTMKRITVEAVC  835



>gb|EEC70956.1| hypothetical protein OsI_02569 [Oryza sativa Indica Group]
Length=480

 Score =   252 bits (643),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 127/216 (59%), Positives = 155/216 (72%), Gaps = 8/216 (4%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQL  941
             A FNAPDGDEPLALDMSSMGKGQ+WING+ +GRYW  Y A+GNC  C Y G +   KCQ 
Sbjct  270   AFFNAPDGDEPLALDMSSMGKGQIWINGQGIGRYWPGYKASGNCGTCDYRGEYDETKCQT  329

Query  940   GCGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRN  761
              CG  +QRWYHVPRS L PT NLLV+FEE GGDPT IS+V+RS+ SVC DV E  P+++N
Sbjct  330   NCGDSSQRWYHVPRSWLSPTGNLLVIFEEWGGDPTGISMVKRSIGSVCADVSEWQPSMKN  389

Query  760   WEIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLE  581
             W       T++  K K+HL C  GQ I+ IKFASFGTP G+CGS+ +G CHA  SY +  
Sbjct  390   W------HTKDYEKAKVHLQCDNGQKITEIKFASFGTPQGSCGSYTEGGCHAHKSYDIFW  443

Query  580   KKCIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVC  476
             K C+G++RC V++    F GDPCP  +KR  VEA+C
Sbjct  444   KNCVGQERCGVSVVPEIFGGDPCPGTMKRAVVEAIC  479



>ref|XP_008466519.1| PREDICTED: beta-galactosidase 5-like [Cucumis melo]
Length=844

 Score =   259 bits (663),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 134/215 (62%), Positives = 165/215 (77%), Gaps = 6/215 (3%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A FNAP G+EPLALD+ SMGKGQ WING+S+GRYW AYA G C  C YAG ++P KC+ G
Sbjct  625   ASFNAPGGNEPLALDLRSMGKGQAWINGQSIGRYWMAYAKGGCGRCTYAGTYRPSKCENG  684

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQRWYH+PRS LKPT N+LVLFEELGGD ++ISL+RRSV+ +CG+  E H    ++
Sbjct  685   CGQPTQRWYHIPRSWLKPTNNVLVLFEELGGDASKISLLRRSVTGLCGEAVEHHAKNESY  744

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
              IES     E P   LHL C+PGQ IS+IKFASFGTP GTCGS+Q+G CHA  S++++EK
Sbjct  745   IIES----NEEPN-SLHLQCNPGQVISAIKFASFGTPSGTCGSYQKGTCHAPDSHAIIEK  799

Query  577   KCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVC  476
             KCIG + CSV+ +  NFG DPCP+ +K+L VE  C
Sbjct  800   KCIGLESCSVSTTRDNFGVDPCPSELKQLLVEVDC  834



>ref|XP_010915229.1| PREDICTED: beta-galactosidase isoform X2 [Elaeis guineensis]
Length=836

 Score =   259 bits (662),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 131/214 (61%), Positives = 156/214 (73%), Gaps = 8/214 (4%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             FNAP G+EPLALDM SMGKGQ+WINGES+GRYW AY A G+C GC Y G +   KCQ  C
Sbjct  628   FNAPSGNEPLALDMRSMGKGQIWINGESIGRYWPAYKAYGSCGGCDYRGTYNEKKCQTNC  687

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+P+QRWYHVPRS L PT NLLV+ EE GGDPT IS+V+R V SVC ++ E  P+ RNW+
Sbjct  688   GEPSQRWYHVPRSWLNPTGNLLVVLEEWGGDPTGISMVKRKVGSVCAEIFEWQPSARNWK  747

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
              + YGR      PK HL C PGQ +S IKFASFGTP G CGSF +G CHA  SY   +K 
Sbjct  748   TKGYGR------PKAHLSCPPGQKMSKIKFASFGTPQGVCGSFSEGSCHAFHSYDAFQKN  801

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVC  476
             CIG+Q CSV ++   F GDPCP ++K+L VEA+C
Sbjct  802   CIGQQWCSVVVAPQMFGGDPCPGIMKKLAVEAIC  835



>ref|XP_007217146.1| hypothetical protein PRUPE_ppa001382mg [Prunus persica]
 gb|EMJ18345.1| hypothetical protein PRUPE_ppa001382mg [Prunus persica]
Length=841

 Score =   259 bits (662),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 126/215 (59%), Positives = 161/215 (75%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             FNAP G+ PLALDM SMGKGQVWING S+GRYW AY A+G+C  C+YAG +   KC   C
Sbjct  627   FNAPAGNSPLALDMGSMGKGQVWINGRSIGRYWPAYKASGSCGACNYAGTYHEKKCLSNC  686

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +QRWYHVPR+ L PT NLLV+ EE GGDP  I LVRR + S+C D+ E  PN+ +W+
Sbjct  687   GEASQRWYHVPRTWLNPTGNLLVVLEEWGGDPNGIFLVRREIDSICADIYEWQPNLMSWQ  746

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             +++ G+ ++  +PK HL C PGQ ISSIKFASFGTP G CGSF++G CHA  SY   ++ 
Sbjct  747   MQASGKVKKPVRPKAHLSCGPGQKISSIKFASFGTPEGGCGSFREGSCHAHNSYDAFQRS  806

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             CIG+  CSV ++  NF GDPCPNV+K+L+VEA+C+
Sbjct  807   CIGQNSCSVTVAPENFGGDPCPNVMKKLSVEAICS  841



>gb|ABV32545.1| beta-galactosidase protein 2 [Prunus persica]
Length=841

 Score =   259 bits (662),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 126/215 (59%), Positives = 161/215 (75%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             FNAP G+ PLALDM SMGKGQVWING S+GRYW AY A+G+C  C+YAG +   KC   C
Sbjct  627   FNAPAGNSPLALDMGSMGKGQVWINGRSIGRYWPAYKASGSCGACNYAGSYHEKKCLSNC  686

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +QRWYHVPR+ L PT NLLV+ EE GGDP  I LVRR + S+C D+ E  PN+ +W+
Sbjct  687   GEASQRWYHVPRTWLNPTGNLLVVLEEWGGDPNGIFLVRREIDSICADIYEWQPNLMSWQ  746

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             +++ G+ ++  +PK HL C PGQ ISSIKFASFGTP G CGSF++G CHA  SY   ++ 
Sbjct  747   MQASGKVKKPVRPKAHLSCGPGQKISSIKFASFGTPEGGCGSFREGSCHAHNSYDAFQRS  806

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             CIG+  CSV ++  NF GDPCPNV+K+L+VEA+C+
Sbjct  807   CIGQNSCSVTVAPENFGGDPCPNVMKKLSVEAICS  841



>ref|XP_008228300.1| PREDICTED: beta-galactosidase 1 [Prunus mume]
Length=841

 Score =   259 bits (662),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 126/215 (59%), Positives = 161/215 (75%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             FNAP G+ PLALDM SMGKGQVWING S+GRYW AY A+G+C  C+YAG +   KC   C
Sbjct  627   FNAPAGNSPLALDMGSMGKGQVWINGRSIGRYWPAYKASGSCGACNYAGTYHEKKCLSNC  686

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +QRWYHVPR+ L PT NLLV+ EE GGDP  I LVRR + S+C D+ E  PN+ +W+
Sbjct  687   GEASQRWYHVPRTWLNPTGNLLVVLEEWGGDPNGIFLVRREIDSICADIYEWQPNLMSWQ  746

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             +++ G+ ++  +PK HL C PGQ ISSIKFASFGTP G CGSF++G CHA  SY   ++ 
Sbjct  747   MQASGKVKKPVRPKAHLSCGPGQKISSIKFASFGTPEGGCGSFREGSCHAHNSYDAFQRS  806

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             CIG+  CSV ++  NF GDPCPNV+K+L+VEA+C+
Sbjct  807   CIGQNSCSVTVAPENFGGDPCPNVMKKLSVEAICS  841



>emb|CDO97918.1| unnamed protein product [Coffea canephora]
Length=835

 Score =   259 bits (661),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 133/215 (62%), Positives = 164/215 (76%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             F+AP G+EPLALDMS+M KGQVWING+S+GRY+ AY A+GNC  C YAG F   KC   C
Sbjct  621   FSAPSGNEPLALDMSAMSKGQVWINGQSIGRYYPAYKASGNCGACSYAGSFNEKKCLSNC  680

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +Q+WYHVPRS L PT NLLV+FEE GG+P  ISLV+R VSSVC D+ E  P + NW+
Sbjct  681   GEASQKWYHVPRSWLYPTGNLLVVFEEWGGNPYGISLVKREVSSVCADIYEWQPTLVNWQ  740

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             ++S G+  +  +PK HL C+PGQ ISSIKFASFGTP GTCG+F+QG CHA  SY   E  
Sbjct  741   LQSSGKVSKPLRPKAHLSCAPGQRISSIKFASFGTPEGTCGNFRQGGCHAFHSYDAFETY  800

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             CIG+Q CSV ++   F GDPCPNV+K+L+VEAVC+
Sbjct  801   CIGQQTCSVTVAPALFGGDPCPNVMKKLSVEAVCS  835



>ref|XP_009627536.1| PREDICTED: beta-galactosidase [Nicotiana tomentosiformis]
Length=845

 Score =   259 bits (661),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 130/215 (60%), Positives = 162/215 (75%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             FNAP G+EPLALDM++M KGQVWING+SLGR+W AY ++GNC  C+Y G F   KC   C
Sbjct  631   FNAPAGNEPLALDMNTMSKGQVWINGQSLGRHWPAYKSSGNCTACNYKGWFDEKKCLSNC  690

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +QRWYHVPRS L PT NLLV+FEE GGDP  I+LV+R V+SVC D+ E  P + NW+
Sbjct  691   GEGSQRWYHVPRSWLHPTGNLLVVFEEWGGDPYGITLVKREVASVCADIYEWQPQLLNWQ  750

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
               + G+     +PK HL C+PGQ ISSIKFASFGTP G CGSFQQG CHA  SY   EK 
Sbjct  751   RLASGKFDRPLRPKAHLRCAPGQKISSIKFASFGTPEGVCGSFQQGSCHARRSYDAFEKN  810

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             C+G++ CSV+++  NF GDPC NV+K+L+VEA+C+
Sbjct  811   CVGQEFCSVSVTPENFGGDPCRNVLKKLSVEAICS  845



>gb|KHN30042.1| Beta-galactosidase 1 [Glycine soja]
Length=831

 Score =   258 bits (660),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 129/215 (60%), Positives = 168/215 (78%), Gaps = 4/215 (2%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             F+APDG  PLALDM+SMGKGQVW+NG++LGRYW AY A+G C+ C YAG +   KC+  C
Sbjct  619   FDAPDGTAPLALDMNSMGKGQVWLNGQNLGRYWPAYKASGTCDYCDYAGTYNENKCRSNC  678

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +QRWYHVP+S LKPT NLLV+FEELGGD   ISLVRR + SVC D+ E  PN+ +++
Sbjct  679   GEASQRWYHVPQSWLKPTGNLLVVFEELGGDLNGISLVRRDIDSVCADIYEWQPNLISYQ  738

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             +++ G+     +PK+HL CSPGQ ISSIKFASFGTP+G+CG+F +G CHA  SY   E+ 
Sbjct  739   MQTSGKAPV--RPKVHLSCSPGQKISSIKFASFGTPVGSCGNFHEGSCHAHMSYDAFERN  796

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             C+G+  C+VA+S  NF GDPCPNV+K+L+VEA+C+
Sbjct  797   CVGQNLCTVAVSPENFGGDPCPNVLKKLSVEAICS  831



>gb|AHG94611.1| beta-galactosidase [Camellia sinensis]
Length=843

 Score =   258 bits (660),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 131/215 (61%), Positives = 162/215 (75%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             FNAP G+EPLALDM++MGKG VWING+S+GRYW  Y ATG+C+ C+YAG F   KC   C
Sbjct  629   FNAPVGNEPLALDMNTMGKGNVWINGKSIGRYWPGYKATGSCSACNYAGWFYEKKCLSNC  688

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +QRWYHVPRS L PT NLLV+FEE GG+P  ISLV+R V SVC D+ E  P + NW+
Sbjct  689   GEASQRWYHVPRSWLYPTGNLLVVFEEWGGNPYGISLVKRQVGSVCADIFEWQPTLVNWQ  748

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             +++ G+     +PK HL CSPGQ ISSIKFASFGTP G CGSF+QG CHA  SY + EK 
Sbjct  749   LQASGKVNRPLRPKAHLSCSPGQKISSIKFASFGTPEGVCGSFRQGSCHAFHSYDIFEKY  808

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             CIG+Q CSV +    F GDPCP+V+K+L+VE +C+
Sbjct  809   CIGQQSCSVPVVPEAFGGDPCPSVMKKLSVEVICS  843



>ref|XP_003543598.1| PREDICTED: beta-galactosidase 1-like [Glycine max]
Length=841

 Score =   258 bits (660),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 129/215 (60%), Positives = 168/215 (78%), Gaps = 4/215 (2%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             F+APDG  PLALDM+SMGKGQVW+NG++LGRYW AY A+G C+ C YAG +   KC+  C
Sbjct  629   FDAPDGTAPLALDMNSMGKGQVWLNGQNLGRYWPAYKASGTCDYCDYAGTYNENKCRSNC  688

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +QRWYHVP+S LKPT NLLV+FEELGGD   ISLVRR + SVC D+ E  PN+ +++
Sbjct  689   GEASQRWYHVPQSWLKPTGNLLVVFEELGGDLNGISLVRRDIDSVCADIYEWQPNLISYQ  748

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             +++ G+     +PK+HL CSPGQ ISSIKFASFGTP+G+CG+F +G CHA  SY   E+ 
Sbjct  749   MQTSGKAPV--RPKVHLSCSPGQKISSIKFASFGTPVGSCGNFHEGSCHAHMSYDAFERN  806

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             C+G+  C+VA+S  NF GDPCPNV+K+L+VEA+C+
Sbjct  807   CVGQNLCTVAVSPENFGGDPCPNVLKKLSVEAICS  841



>ref|XP_010262131.1| PREDICTED: beta-galactosidase isoform X1 [Nelumbo nucifera]
Length=847

 Score =   258 bits (660),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 131/220 (60%), Positives = 163/220 (74%), Gaps = 7/220 (3%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             FNAP G+EPLALDM SMGKGQ+WINGES+GRYW AY A G+C GC+YAG +   KC+  C
Sbjct  628   FNAPGGNEPLALDMGSMGKGQIWINGESIGRYWPAYKAYGSCGGCNYAGTYDEKKCRSNC  687

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +QRWYHVPRS L+PT N LV+FEE GG P  ISL +R+V SVC D+ E  P + NWE
Sbjct  688   GEASQRWYHVPRSWLRPTGNQLVIFEEWGGYPNWISLDKRTVQSVCADIYEWQPTLTNWE  747

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             ++S G+ Q   +PK HL CSPG  ISSIKFASFGTP G CGSFQ+G CHA  SY   +++
Sbjct  748   LQSSGKVQRPLRPKAHLWCSPGTKISSIKFASFGTPQGVCGSFQEGSCHAHKSYDAFQRE  807

Query  574   -----CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
                  CIG+Q CSV ++   F GDPCP+ +K+L+VEA+C+
Sbjct  808   DLLQNCIGQQTCSVTVAPEVFGGDPCPSTMKKLSVEAICS  847



>ref|XP_008391326.1| PREDICTED: beta-galactosidase 1 [Malus domestica]
Length=843

 Score =   258 bits (660),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 128/215 (60%), Positives = 160/215 (74%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             FNAP G+ PLALDM SMGKGQVWING S+GRYW AY A+GNC  C+YAG +   KC   C
Sbjct  629   FNAPAGNSPLALDMGSMGKGQVWINGRSIGRYWPAYTASGNCGACNYAGTYNEKKCLSNC  688

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             GQ +QRWYHVPRS L PT NLLV+ EE GGDP  I LVRR V S+C D+ E  PN+ +++
Sbjct  689   GQASQRWYHVPRSWLNPTGNLLVVLEEWGGDPNGIFLVRREVDSICADIYEWQPNLMSYQ  748

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             +++ G+ ++  +PK HL C PGQ ISSIKFASFGTP G CGSF++G CHA  SY   ++ 
Sbjct  749   MQASGKVKKPVRPKAHLTCGPGQKISSIKFASFGTPEGACGSFREGACHAHNSYDAFQRS  808

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             CIG+  CSV +   NF GDPCP+V+K+L+VEA+C+
Sbjct  809   CIGQNSCSVTVEPENFGGDPCPSVMKKLSVEAICS  843



>ref|XP_009768469.1| PREDICTED: beta-galactosidase-like [Nicotiana sylvestris]
Length=837

 Score =   258 bits (659),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 128/217 (59%), Positives = 164/217 (76%), Gaps = 3/217 (1%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQL  941
             A F+AP+G++PLALDM SMGKGQ+WINGE +GR+W  Y A GNC  C+YAG +   KC  
Sbjct  622   ATFDAPEGNDPLALDMRSMGKGQIWINGEGIGRHWPGYIAQGNCGECNYAGLYSEKKCHT  681

Query  940   GCGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRN  761
              CGQP+QRWYHVPRS LKP+ NLLV+FEE GGDPT ISLVRRS + VC D+ E  P+++N
Sbjct  682   NCGQPSQRWYHVPRSWLKPSGNLLVVFEEWGGDPTGISLVRRSTARVCADIVEGQPSLKN  741

Query  760   WEIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLE  581
             W + + G++  + +PK HL CS GQ IS+I+FAS+G P GTCG++++G CHA  SY   E
Sbjct  742   WRMATSGKSNNM-QPKAHLWCSAGQKISNIEFASYGLPQGTCGNYREGSCHAHKSYDAFE  800

Query  580   KKCIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             K CIGRQ CSV++    F GDPCPN  K+L+VEA+C+
Sbjct  801   KNCIGRQSCSVSVVPEVFGGDPCPNTSKKLSVEAICS  837



>emb|CAC44500.1| beta-galactosidase [Fragaria x ananassa]
Length=843

 Score =   258 bits (660),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 131/215 (61%), Positives = 157/215 (73%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             FN P G+ PLALDM SMGKGQVWIN  S+GRYW AY A+G C  C+YAG F   KC   C
Sbjct  629   FNRPAGNSPLALDMGSMGKGQVWINDRSIGRYWPAYKASGTCGECNYAGTFSEKKCLSNC  688

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +QRWYHVPRS L PT NLLV+ EE GGDP  I LVRR V SVC D+ E  PN+ +W+
Sbjct  689   GEASQRWYHVPRSWLNPTGNLLVVLEEWGGDPNGIFLVRREVDSVCADIYEWQPNLMSWQ  748

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             ++  GR  +  +PK HL C PGQ ISSIKFASFGTP G CGSF++G CHA  SY+  E+ 
Sbjct  749   MQVSGRVNKPLRPKAHLSCGPGQKISSIKFASFGTPEGVCGSFREGGCHAHKSYNAFERS  808

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             CIG+  CSV +S  NF GDPCPNV+K+L+VEA+C+
Sbjct  809   CIGQNSCSVTVSPENFGGDPCPNVMKKLSVEAICS  843



>ref|XP_011463326.1| PREDICTED: beta-galactosidase 1 [Fragaria vesca subsp. vesca]
Length=843

 Score =   258 bits (659),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 131/214 (61%), Positives = 156/214 (73%), Gaps = 2/214 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             FN P G+ PLALDM SMGKGQVWING S+GRYW AY A+G C  C+YAG F   KC   C
Sbjct  629   FNRPAGNSPLALDMGSMGKGQVWINGRSIGRYWPAYKASGTCGECNYAGTFSEKKCLCNC  688

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +QRWYHVPRS L P  NLLV+ EE GGDP  I LVRR V SVC D+ E  PN+ +W+
Sbjct  689   GEASQRWYHVPRSWLNPAGNLLVVLEEWGGDPNGIFLVRREVDSVCADIYEWQPNLMSWQ  748

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             ++  GR  +  +PK HL C PGQ ISSIKFASFGTP G CGSF++G CHA  SY+  E+ 
Sbjct  749   MQVSGRVNKPLRPKAHLSCGPGQKISSIKFASFGTPEGVCGSFREGGCHAHKSYNAFERS  808

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVC  476
             CIG+  CSV +S  NF GDPCPNV+K+L+VEA+C
Sbjct  809   CIGQNSCSVTVSPENFGGDPCPNVMKKLSVEAIC  842



>ref|XP_004486826.1| PREDICTED: beta-galactosidase 1-like [Cicer arietinum]
Length=847

 Score =   258 bits (659),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 127/215 (59%), Positives = 164/215 (76%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             F+APDG  P ALDM SMGKGQVW+NG+++GRYW AY A+G C+ C YAG +   KC+  C
Sbjct  633   FDAPDGIAPFALDMGSMGKGQVWLNGQNIGRYWPAYKASGTCDDCDYAGTYNENKCRSNC  692

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +Q WYHVPRS L PT NLLV+FEELGGDP  ISLVRR + SVC D+ E  PN+ +++
Sbjct  693   GEASQTWYHVPRSWLIPTGNLLVVFEELGGDPNGISLVRRDIDSVCADIYEWQPNLISYQ  752

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             +++ G+  +  +PK HL C PGQ ISSIKFASFGTP+G+CG+F +G CHA  SY+  E+ 
Sbjct  753   MQTSGKVSKPVRPKAHLSCGPGQKISSIKFASFGTPVGSCGNFHEGSCHAHKSYNAFERN  812

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             CIG+  C+V +S  NF GDPCPNV+K+L+VEA+CT
Sbjct  813   CIGQNLCTVTVSPENFGGDPCPNVMKKLSVEAICT  847



>ref|XP_010242207.1| PREDICTED: beta-galactosidase [Nelumbo nucifera]
Length=846

 Score =   258 bits (658),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 132/217 (61%), Positives = 163/217 (75%), Gaps = 8/217 (4%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQL  941
             A F+AP G+EPLALDMSSMGKGQ+WING+S+GRYW AY A+G C  C YAG +   KCQ 
Sbjct  636   AIFDAPTGNEPLALDMSSMGKGQIWINGQSIGRYWPAYKASGTCGNCSYAGEYDDSKCQS  695

Query  940   GCGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRN  761
              CG+ +QRWYHVPRS L PT NL V+FEE GGDPT ISL +R+V S+C D+ E  P+ R+
Sbjct  696   NCGEASQRWYHVPRSWLNPTGNLFVIFEEWGGDPTWISLNKRTVGSLCADIHEWQPSQRS  755

Query  760   WEIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLE  581
              +I   GR   L +PK HL CSPG  I+SIKFASFGTP G CGSFQ+G CHA  SY   E
Sbjct  756   SKI---GR---LLRPKAHLQCSPGTKITSIKFASFGTPQGICGSFQEGSCHAHKSYDAFE  809

Query  580   KKCIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             K CIG+Q C+V+++   F GDPCPN++K+L+VEA+C+
Sbjct  810   KNCIGKQMCAVSVAPEVFGGDPCPNIMKKLSVEAICS  846



>ref|XP_012076927.1| PREDICTED: beta-galactosidase-like [Jatropha curcas]
 gb|KDP33829.1| hypothetical protein JCGZ_07400 [Jatropha curcas]
Length=838

 Score =   258 bits (658),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 124/214 (58%), Positives = 165/214 (77%), Gaps = 3/214 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             F+AP+G++PLALDMSSMGKGQ+W+NG+S+GR+W AY A G+C  C+YAG F   KC+  C
Sbjct  625   FDAPEGNDPLALDMSSMGKGQIWVNGQSIGRHWPAYTARGSCGDCNYAGTFDDKKCRRNC  684

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+P+QRWYHVPRS L P+ NLLV+FEE GG+P+ ISLV+R+  +VC D+ E  P ++NW+
Sbjct  685   GEPSQRWYHVPRSWLNPSGNLLVVFEEFGGNPSGISLVKRTTGTVCADIYEGQPALKNWQ  744

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             + + G+   L +PK HL C PGQ IS IKFAS+G P G CGSF++G CHA  SY+  EKK
Sbjct  745   MIALGKLDHL-QPKAHLWCPPGQKISQIKFASYGVPQGACGSFREGSCHAHKSYNAFEKK  803

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVC  476
             C+G+Q CSV +++  F GDPCP+  K+L+VEAVC
Sbjct  804   CVGKQSCSVTVASEVFGGDPCPDTAKKLSVEAVC  837



>ref|XP_011080179.1| PREDICTED: beta-galactosidase-like [Sesamum indicum]
Length=842

 Score =   257 bits (656),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 127/215 (59%), Positives = 164/215 (76%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             FNAP G+EPLALDM +M KGQVWING+S+GRYW  Y A+GNC  C+YAG F   KC   C
Sbjct  628   FNAPSGNEPLALDMDTMSKGQVWINGQSIGRYWNEYKASGNCGACNYAGWFNEKKCLSNC  687

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +QRWYHVPRS L+PT NLLV+ EE GG+P  ISLV+R V+SVC D+ E  P + NW+
Sbjct  688   GKASQRWYHVPRSWLRPTGNLLVVLEEWGGNPYGISLVKREVASVCADIYEWQPTLVNWQ  747

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             +++ G+  +  +PK HL C+ GQ ISSIKFASFGTP G+CG+FQ+G CHA  SY V E+ 
Sbjct  748   LQASGKVNKPLRPKAHLSCAAGQKISSIKFASFGTPQGSCGNFQEGSCHAFHSYDVFERY  807

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             CIG+Q C+V ++   F GDPCP+V+K+L+VEA+C+
Sbjct  808   CIGQQSCTVPVTPEIFGGDPCPSVMKKLSVEAICS  842



>ref|XP_009367552.1| PREDICTED: beta-galactosidase 1 [Pyrus x bretschneideri]
Length=843

 Score =   257 bits (656),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 127/215 (59%), Positives = 160/215 (74%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             FN P G+ PLALDM SMGKGQVWING S+GRYW AY A+GNC  C+YAG +   KC   C
Sbjct  629   FNEPAGNSPLALDMISMGKGQVWINGRSIGRYWPAYTASGNCGACNYAGTYNEKKCLSNC  688

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             GQ +QRWYHVPRS L PT NLLV+ EE GGDP  I LVRR V S+C D+ E  PN+ +++
Sbjct  689   GQASQRWYHVPRSWLNPTGNLLVVLEEWGGDPNGIFLVRREVDSICADIYEWQPNLMSYQ  748

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             +++ G+ ++  +PK HL C PGQ ISSIKFASFGTP G CGSF++G CHA  SY   ++ 
Sbjct  749   MQASGKVKKPVRPKAHLSCGPGQKISSIKFASFGTPEGACGSFREGACHAHNSYDAFQRS  808

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             CIG+  CSV ++  NF GDPCP+V+K+L+VEA+C+
Sbjct  809   CIGQNSCSVTVAPENFGGDPCPSVMKKLSVEAICS  843



>gb|EYU45851.1| hypothetical protein MIMGU_mgv1a002308mg [Erythranthe guttata]
Length=689

 Score =   254 bits (649),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 125/215 (58%), Positives = 164/215 (76%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             FNAP G+EPLALDM++M KGQVWING+++GRYW  Y A+GNC  C+YAG F   KC   C
Sbjct  475   FNAPSGNEPLALDMNTMSKGQVWINGQNIGRYWNQYKASGNCGACNYAGWFNEKKCLTNC  534

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +QRWYH+PRS L PT NLLV+FEE GG+P  ISLV+R V+SVC D+ E  P + NW+
Sbjct  535   GEASQRWYHIPRSWLYPTGNLLVVFEEWGGNPYGISLVKREVASVCADIYEWQPTLVNWQ  594

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             ++S G+  +  +PK HL C  GQ ISSIKFASFGTP G+CG+F++G CHA  SY V EK 
Sbjct  595   LQSSGKVNKPLRPKAHLSCDAGQKISSIKFASFGTPQGSCGNFREGNCHAFHSYDVFEKY  654

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             C+G++ C+V ++   F GDPCP+V+K+L+VEA+C+
Sbjct  655   CVGQESCTVPVTPEIFGGDPCPSVMKKLSVEAICS  689



>ref|XP_002514108.1| beta-galactosidase, putative [Ricinus communis]
 gb|EEF48062.1| beta-galactosidase, putative [Ricinus communis]
Length=840

 Score =   257 bits (656),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 127/217 (59%), Positives = 166/217 (76%), Gaps = 3/217 (1%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQL  941
             A F+AP+G++P+ALDMSSMGKGQ+W+NG+S+GR+W AY A G+C+ C+YAG +   KC+ 
Sbjct  625   ATFDAPEGNDPVALDMSSMGKGQIWVNGQSIGRHWPAYTARGSCSACNYAGTYDDKKCRS  684

Query  940   GCGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRN  761
              CG+P+QRWYHVPRS L P+ NLLV+FEE GG+P+ ISLV+R+  SVC D+ E  P ++N
Sbjct  685   NCGEPSQRWYHVPRSWLNPSGNLLVVFEEWGGEPSGISLVKRTTGSVCADIFEGQPALKN  744

Query  760   WEIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLE  581
             W++ + GR   L +PK HL C  GQ IS IKFAS+G+P GTCGSF+ G CHA  SY   E
Sbjct  745   WQMIALGRLDHL-QPKAHLWCPHGQKISKIKFASYGSPQGTCGSFKAGSCHAHKSYDAFE  803

Query  580   KKCIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             KKCIG+Q CSV ++   F GDPCP+  K+L+VEAVCT
Sbjct  804   KKCIGKQSCSVTVAAEVFGGDPCPDSSKKLSVEAVCT  840



>ref|NP_001234465.1| beta-galactosidase precursor [Solanum lycopersicum]
 sp|P48980.1|BGAL_SOLLC RecName: Full=Beta-galactosidase; AltName: Full=Acid beta-galactosidase; 
Short=Lactase; AltName: Full=Exo-(1-->4)-beta-D-galactanase; 
Flags: Precursor [Solanum lycopersicum]
 gb|AAF21626.1|AF023847_1 beta-galactosidase precursor [Solanum lycopersicum]
 emb|CAA58734.1| putative beta-galactosidase/galactanase [Solanum lycopersicum]
 emb|CAA10174.1| ss-galactosidase [Solanum lycopersicum]
Length=835

 Score =   256 bits (655),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 128/215 (60%), Positives = 162/215 (75%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             FNAPDG+EPLALDM++MGKGQVWING+SLGR+W AY ++G+C+ C+Y G F   KC   C
Sbjct  621   FNAPDGNEPLALDMNTMGKGQVWINGQSLGRHWPAYKSSGSCSVCNYTGWFDEKKCLTNC  680

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +QRWYHVPRS L PT NLLV+FEE GGDP  I+LV+R + SVC D+ E  P + NW+
Sbjct  681   GEGSQRWYHVPRSWLYPTGNLLVVFEEWGGDPYGITLVKREIGSVCADIYEWQPQLLNWQ  740

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
                 G+     +PK HL C+PGQ ISSIKFASFGTP G CG+FQQG CHA  SY   +K 
Sbjct  741   RLVSGKFDRPLRPKAHLKCAPGQKISSIKFASFGTPEGVCGNFQQGSCHAPRSYDAFKKN  800

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             C+G++ CSV ++  NF GDPC NV+K+L+VEA+C+
Sbjct  801   CVGKESCSVQVTPENFGGDPCRNVLKKLSVEAICS  835



>ref|XP_006366152.1| PREDICTED: beta-galactosidase-like [Solanum tuberosum]
Length=839

 Score =   256 bits (655),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 128/215 (60%), Positives = 164/215 (76%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             FNAPDG+EPLALDM++MGKGQVWING+SLGR+W AY ++G+C+ C+Y G F   KC   C
Sbjct  625   FNAPDGNEPLALDMNTMGKGQVWINGQSLGRHWPAYKSSGSCSVCNYTGWFDEKKCLTNC  684

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +QRWYHVPRS L PT NLLV+FEE GGDP  I+LV+R ++SVC ++ E  P + NW+
Sbjct  685   GEGSQRWYHVPRSWLYPTGNLLVVFEEWGGDPYGITLVKREIASVCANIYEWQPQLLNWQ  744

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
                 G+     +PK+HL C+PGQ ISSIKFASFGTP G CGSFQQG CHA  SY   +K 
Sbjct  745   RLVSGKFDRPLRPKVHLKCAPGQKISSIKFASFGTPGGVCGSFQQGSCHAPRSYDAFKKN  804

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             C+G++ CSV ++  NF GDPC NV+K+L+VEA+C+
Sbjct  805   CVGQESCSVQVTPENFGGDPCRNVLKKLSVEAICS  839



>ref|XP_010910613.1| PREDICTED: beta-galactosidase-like, partial [Elaeis guineensis]
Length=399

 Score =   246 bits (629),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 126/214 (59%), Positives = 154/214 (72%), Gaps = 8/214 (4%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             FNAP G+EPLALDM+SMGKGQ+WINGES+GRYW  Y A G+C GC Y G +   KCQ  C
Sbjct  191   FNAPAGNEPLALDMNSMGKGQIWINGESIGRYWPGYKAYGSCGGCDYRGTYNEKKCQTNC  250

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +QRWYHVPRS L PT NLLV+FEE GGDPT IS+V+R V SV  ++ E  P++ NW 
Sbjct  251   GESSQRWYHVPRSWLNPTGNLLVVFEEWGGDPTGISMVKRKVGSVGAELSEWQPSLNNWN  310

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
              ++YGR      PK  L C PGQ +++I FASFGTP G  GSF +G CHAS SY   +K 
Sbjct  311   TKAYGR------PKAQLSCPPGQKMTNINFASFGTPQGVHGSFSEGTCHASHSYDAFKKN  364

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVC  476
             C+G+Q CSV +S+  F GDPCP  +K+L VEAVC
Sbjct  365   CVGQQWCSVTVSSEMFGGDPCPGTMKKLAVEAVC  398



>gb|ADO34788.1| beta-galactosidase STBG3 [Solanum lycopersicum]
Length=838

 Score =   256 bits (654),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 127/215 (59%), Positives = 163/215 (76%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             FNAP G++PLALD+++MGKGQVWING+SLGRYW  Y A+GNC  C+YAG F   KC   C
Sbjct  624   FNAPAGNDPLALDLNTMGKGQVWINGQSLGRYWPGYKASGNCGACNYAGWFNEKKCLSNC  683

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +QRWYHVPRS L PT NLLVLFEE GG+P  ISLV+R V+SVC D+ E  P + NW+
Sbjct  684   GEASQRWYHVPRSWLYPTGNLLVLFEEWGGEPHGISLVKREVASVCADINEWQPQLVNWQ  743

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             +++ G+  +  +PK HL C+PGQ I+SIKFASFGTP G CGSF++G CHA  SY   E+ 
Sbjct  744   MQASGKVDKPLRPKAHLSCAPGQKITSIKFASFGTPQGVCGSFREGSCHAFHSYDAFERY  803

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             CIG+  CSV ++   F GDPCP+V+K+L+VE +C+
Sbjct  804   CIGQNSCSVPVTPEIFGGDPCPHVMKKLSVEVICS  838



>ref|NP_001266102.1| beta-galactosidase 1-like precursor [Cicer arietinum]
 emb|CAA07236.2| beta-galactosidase precursor [Cicer arietinum]
Length=839

 Score =   255 bits (652),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 125/215 (58%), Positives = 163/215 (76%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             F+AP G  PLALDM+SMGKGQVW+NG+SLGRYW AY ATG+C+ C+YAG +   KC   C
Sbjct  625   FDAPAGVAPLALDMNSMGKGQVWLNGQSLGRYWPAYKATGSCDYCNYAGTYNEKKCGTNC  684

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +QRWYHVP S LKPT NLLV+FEELGGDP  + LVRR + SVC D+ E  PN+ +++
Sbjct  685   GEASQRWYHVPHSWLKPTGNLLVMFEELGGDPNGVFLVRRDIDSVCADIYEWQPNLVSYQ  744

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             +++ G+      PK HL C PGQ ISSIKFASFGTP+G+CG++++G CHA  SY   ++ 
Sbjct  745   MQASGKVSRPVSPKAHLSCGPGQKISSIKFASFGTPVGSCGNYREGSCHAHKSYDAFQRN  804

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             C+G+  C+V +S   F GDPCPNV+K+L+VEA+CT
Sbjct  805   CVGQSSCTVTVSPEIFGGDPCPNVMKKLSVEAICT  839



>ref|XP_007135555.1| hypothetical protein PHAVU_010G139300g [Phaseolus vulgaris]
 gb|ESW07549.1| hypothetical protein PHAVU_010G139300g [Phaseolus vulgaris]
Length=844

 Score =   255 bits (652),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 127/215 (59%), Positives = 164/215 (76%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             F+AP G  PLALDM+SMGKGQVWING+SLGRYW AY A+G+C  C+YAG +   KC   C
Sbjct  630   FDAPVGVAPLALDMASMGKGQVWINGQSLGRYWPAYKASGSCGYCNYAGTYNEKKCASNC  689

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +QRWYHVP S LKPT NLLV+FEELGGDP  I LVRR + SVC D+ E  PN+ ++E
Sbjct  690   GEASQRWYHVPHSWLKPTGNLLVVFEELGGDPNGIFLVRRDIDSVCADIYEWQPNLVSYE  749

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             +++ G+ +   +PK HL C PGQ ISSIKFASFGTP+G+CGS+++G CHA  SY   +K 
Sbjct  750   MQASGKVRSPVRPKAHLSCGPGQKISSIKFASFGTPVGSCGSYREGSCHAHKSYDAFQKN  809

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             C+G+  C+V ++   F GDPCP+V+K+L+VEA+CT
Sbjct  810   CVGQSWCTVTVAPEIFGGDPCPSVMKKLSVEAICT  844



>gb|KHN32687.1| Beta-galactosidase 1 [Glycine soja]
Length=831

 Score =   255 bits (651),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 127/215 (59%), Positives = 164/215 (76%), Gaps = 4/215 (2%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             F+AP G  PLALDM SMGKGQVW+NG++LGRYW AY A+G C+ C YAG +   KC+  C
Sbjct  619   FDAPAGTAPLALDMDSMGKGQVWLNGQNLGRYWPAYKASGTCDYCDYAGTYNENKCRSNC  678

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +QRWYHVP+S LKPT NLLV+FEELGGDP  I LVRR + SVC D+ E  PN+ +++
Sbjct  679   GEASQRWYHVPQSWLKPTGNLLVVFEELGGDPNGIFLVRRDIDSVCADIYEWQPNLISYQ  738

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             +++ G+     +PK+HL CSPGQ ISSIKFASFGTP G+CG+F +G CHA  SY   E+ 
Sbjct  739   MQTSGKAPV--RPKVHLSCSPGQKISSIKFASFGTPAGSCGNFHEGSCHAHKSYDAFERN  796

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             C+G+  C+V +S  NF GDPCPNV+K+L+VEA+C+
Sbjct  797   CVGQNWCTVTVSPENFGGDPCPNVLKKLSVEAICS  831



>ref|XP_003546676.1| PREDICTED: beta-galactosidase 1-like [Glycine max]
Length=840

 Score =   255 bits (651),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 127/215 (59%), Positives = 164/215 (76%), Gaps = 4/215 (2%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             F+AP G  PLALDM SMGKGQVW+NG++LGRYW AY A+G C+ C YAG +   KC+  C
Sbjct  628   FDAPAGTAPLALDMDSMGKGQVWLNGQNLGRYWPAYKASGTCDYCDYAGTYNENKCRSNC  687

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +QRWYHVP+S LKPT NLLV+FEELGGDP  I LVRR + SVC D+ E  PN+ +++
Sbjct  688   GEASQRWYHVPQSWLKPTGNLLVVFEELGGDPNGIFLVRRDIDSVCADIYEWQPNLISYQ  747

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             +++ G+     +PK+HL CSPGQ ISSIKFASFGTP G+CG+F +G CHA  SY   E+ 
Sbjct  748   MQTSGKAPV--RPKVHLSCSPGQKISSIKFASFGTPAGSCGNFHEGSCHAHKSYDAFERN  805

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             C+G+  C+V +S  NF GDPCPNV+K+L+VEA+C+
Sbjct  806   CVGQNWCTVTVSPENFGGDPCPNVLKKLSVEAICS  840



>ref|XP_010033786.1| PREDICTED: beta-galactosidase 1-like [Eucalyptus grandis]
 gb|KCW53599.1| hypothetical protein EUGRSUZ_J02867 [Eucalyptus grandis]
 gb|KCW53600.1| hypothetical protein EUGRSUZ_J02867 [Eucalyptus grandis]
Length=844

 Score =   255 bits (651),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 128/215 (60%), Positives = 164/215 (76%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             F+AP G+ PLALDM+SMGKGQ+WING+S+GRYW AY A+G C GC+YAG +   KC   C
Sbjct  630   FSAPAGNTPLALDMNSMGKGQIWINGQSIGRYWPAYKASGTCGGCNYAGTYGEKKCLSNC  689

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +QRWYHVPRS L PT NLLV+FEE GGDP  ISLVRR V SVC D+ E  P + N++
Sbjct  690   GEASQRWYHVPRSWLNPTGNLLVVFEEWGGDPNGISLVRRDVDSVCADIYEWQPTLMNYQ  749

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             +++ G+  +  +PK HL CSPGQ ISSIKFASFGTP G CGSF++G CHA  SY V +K 
Sbjct  750   MQASGKVNKPLRPKAHLSCSPGQKISSIKFASFGTPEGICGSFREGSCHAFHSYDVFQKT  809

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             C+G+  C+V ++   F GDPCP+V+K+L+VEA+C+
Sbjct  810   CVGQNSCTVPVTPEIFGGDPCPSVMKKLSVEAICS  844



>ref|XP_010106660.1| Beta-galactosidase 1 [Morus notabilis]
 gb|EXC11109.1| Beta-galactosidase 1 [Morus notabilis]
Length=845

 Score =   255 bits (651),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 126/215 (59%), Positives = 156/215 (73%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             F+AP G  PLALDM SMGKGQ+WING+SLGRYW AY A G+C GC YAG +   KC   C
Sbjct  631   FDAPAGYAPLALDMGSMGKGQIWINGQSLGRYWPAYKAQGSCGGCDYAGTYNEKKCLSNC  690

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G  +QRWYHVP+S LKPT NLLV+FEE GGDP  + LVRR V +VC D+ E  P + NW+
Sbjct  691   GDASQRWYHVPKSWLKPTGNLLVVFEEWGGDPNGVFLVRRDVDTVCADIYEWQPTLMNWQ  750

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             ++S G+  +  +PK HL C  GQ IS IKFASFGTP G CGSF++G CHA  SY   E+ 
Sbjct  751   MQSSGKVDKPLRPKAHLSCGAGQKISKIKFASFGTPEGACGSFREGSCHAHHSYDAFERL  810

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             C+G+  CSV ++   F GDPCP+V+K+L+VEA+CT
Sbjct  811   CVGQNSCSVTVAAEMFGGDPCPSVMKKLSVEAICT  845



>emb|CBI27912.3| unnamed protein product [Vitis vinifera]
Length=833

 Score =   254 bits (650),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 127/215 (59%), Positives = 164/215 (76%), Gaps = 3/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             FNAP G++PLALDMSSMGKGQ+WINGES+GR+W AY A GNCNGC+YAG F   KCQ GC
Sbjct  620   FNAPGGNDPLALDMSSMGKGQIWINGESIGRHWPAYTAHGNCNGCNYAGIFNDKKCQTGC  679

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G P+QRWYHVPRS LKP+ N L++FEELGG+P  I+LV+R++  VC D+ E  P+++N +
Sbjct  680   GGPSQRWYHVPRSWLKPSGNQLIVFEELGGNPAGITLVKRTMDRVCADIFEGQPSLKNSQ  739

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             I    +   L + K HL C+PG  IS I+FASFG P GTCGSF++G CHA  SY  L++ 
Sbjct  740   IIGSSKVNSL-QSKAHLWCAPGLKISKIQFASFGVPQGTCGSFREGSCHAHKSYDALQRN  798

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             CIG+Q CSV+++   F GDPCP  +K+L+VEA+C+
Sbjct  799   CIGKQSCSVSVAPEVFGGDPCPGSMKKLSVEALCS  833



>ref|XP_002282132.1| PREDICTED: beta-galactosidase [Vitis vinifera]
Length=836

 Score =   254 bits (650),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 127/215 (59%), Positives = 164/215 (76%), Gaps = 3/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             FNAP G++PLALDMSSMGKGQ+WINGES+GR+W AY A GNCNGC+YAG F   KCQ GC
Sbjct  623   FNAPGGNDPLALDMSSMGKGQIWINGESIGRHWPAYTAHGNCNGCNYAGIFNDKKCQTGC  682

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G P+QRWYHVPRS LKP+ N L++FEELGG+P  I+LV+R++  VC D+ E  P+++N +
Sbjct  683   GGPSQRWYHVPRSWLKPSGNQLIVFEELGGNPAGITLVKRTMDRVCADIFEGQPSLKNSQ  742

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             I    +   L + K HL C+PG  IS I+FASFG P GTCGSF++G CHA  SY  L++ 
Sbjct  743   IIGSSKVNSL-QSKAHLWCAPGLKISKIQFASFGVPQGTCGSFREGSCHAHKSYDALQRN  801

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             CIG+Q CSV+++   F GDPCP  +K+L+VEA+C+
Sbjct  802   CIGKQSCSVSVAPEVFGGDPCPGSMKKLSVEALCS  836



>ref|XP_009769408.1| PREDICTED: beta-galactosidase-like [Nicotiana sylvestris]
Length=840

 Score =   254 bits (650),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 128/215 (60%), Positives = 161/215 (75%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             FNAP G+EPLALD+++MGKGQVWING+S+GRYW  Y A+GNC  C+YAG F   KC   C
Sbjct  626   FNAPAGNEPLALDLNTMGKGQVWINGQSIGRYWPGYKASGNCGACNYAGWFDEKKCLSNC  685

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +QRWYHVPRS L PT NLLVLFEE GG+P  ISLV+R V+SVC D+ E  P + NW+
Sbjct  686   GEASQRWYHVPRSWLYPTGNLLVLFEEWGGEPHGISLVKREVASVCADINEWQPQLVNWQ  745

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             +++ G+     +PK HL C+ GQ ISSIKFASFGTP G CGSF++G CHA  SY   E+ 
Sbjct  746   MQASGKVDRPLRPKAHLSCASGQKISSIKFASFGTPQGVCGSFREGSCHAFHSYDAFERY  805

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             CIG+  CSV ++   F GDPCP+V+K+L+VE VC+
Sbjct  806   CIGQNSCSVPVTPEIFGGDPCPHVMKKLSVEVVCS  840



>ref|XP_011072510.1| PREDICTED: beta-galactosidase-like [Sesamum indicum]
Length=842

 Score =   254 bits (649),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 129/215 (60%), Positives = 161/215 (75%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             FNAP+GDEPLALDM+SM KGQVWING+S+GRYW  Y A+G+C  C+YAG F   KC   C
Sbjct  628   FNAPEGDEPLALDMNSMSKGQVWINGQSIGRYWNQYKASGDCVPCNYAGWFNEKKCLGNC  687

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +QRWYHVPRS L PT NLLV+FEE GG+P  ISLV+R V+SVC D+ E  P + NW+
Sbjct  688   GEASQRWYHVPRSWLYPTGNLLVVFEEWGGNPYEISLVKREVASVCADIFEWQPTLVNWQ  747

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             + + G   +  +PK HL C+ GQ ISSIKFASFGTP G CG F+QG CHA  SY V E+ 
Sbjct  748   MLASGEVNKPLRPKAHLSCASGQKISSIKFASFGTPEGVCGDFRQGSCHAFHSYDVFERY  807

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             C+G+Q C+V ++   F GDPCPN++K+L VEAVC+
Sbjct  808   CVGQQSCTVPVTPEIFGGDPCPNIMKKLFVEAVCS  842



>gb|KHN39301.1| Beta-galactosidase 1 [Glycine soja]
Length=838

 Score =   254 bits (649),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 127/215 (59%), Positives = 163/215 (76%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             F+AP G  PLALDM SMGKGQVWING+SLGRYW AY A+G+C  C+YAG +   KC   C
Sbjct  624   FDAPAGVAPLALDMGSMGKGQVWINGQSLGRYWPAYKASGSCGYCNYAGTYNEKKCGSNC  683

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             GQ +QRWYHVP S LKPT NLLV+FEELGGDP  I LVRR + SVC D+ E  PN+ +++
Sbjct  684   GQASQRWYHVPHSWLKPTGNLLVVFEELGGDPNGIFLVRRDIDSVCADIYEWQPNLVSYD  743

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             +++ G+ +   +PK HL C PGQ ISSIKFASFGTP+G+CG++++G CHA  SY   +K 
Sbjct  744   MQASGKVRSPVRPKAHLSCGPGQKISSIKFASFGTPVGSCGNYREGSCHAHKSYDAFQKN  803

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             C+G+  C+V +S   F GDPCP+V+K+L+VEA+CT
Sbjct  804   CVGQSWCTVTVSPEIFGGDPCPSVMKKLSVEAICT  838



>ref|XP_003529875.1| PREDICTED: beta-galactosidase 1-like [Glycine max]
Length=845

 Score =   254 bits (648),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 127/215 (59%), Positives = 163/215 (76%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             F+AP G  PLALDM SMGKGQVWING+SLGRYW AY A+G+C  C+YAG +   KC   C
Sbjct  631   FDAPAGVAPLALDMGSMGKGQVWINGQSLGRYWPAYKASGSCGYCNYAGTYNEKKCGSNC  690

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             GQ +QRWYHVP S LKPT NLLV+FEELGGDP  I LVRR + SVC D+ E  PN+ +++
Sbjct  691   GQASQRWYHVPHSWLKPTGNLLVVFEELGGDPNGIFLVRRDIDSVCADIYEWQPNLVSYD  750

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             +++ G+ +   +PK HL C PGQ ISSIKFASFGTP+G+CG++++G CHA  SY   +K 
Sbjct  751   MQASGKVRSPVRPKAHLSCGPGQKISSIKFASFGTPVGSCGNYREGSCHAHKSYDAFQKN  810

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             C+G+  C+V +S   F GDPCP+V+K+L+VEA+CT
Sbjct  811   CVGQSWCTVTVSPEIFGGDPCPSVMKKLSVEAICT  845



>gb|AGW47883.1| beta-galactosidase precursor [Nicotiana tabacum]
Length=841

 Score =   254 bits (648),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 127/215 (59%), Positives = 161/215 (75%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             FNAP G++PLALD+++MGKGQVWING+S+GRYW  Y A+GNC  C+YAG F   KC   C
Sbjct  627   FNAPAGNDPLALDLNTMGKGQVWINGQSIGRYWPGYKASGNCGACNYAGWFDEKKCLSNC  686

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +QRWYHVPRS L PT NLLVLFEE GG+P  ISLV+R V+SVC D+ E  P + NW+
Sbjct  687   GEASQRWYHVPRSWLYPTGNLLVLFEEWGGEPHGISLVKREVASVCADINEWQPQLVNWQ  746

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             +++ G+     +PK HL C+ GQ ISSIKFASFGTP G CGSF++G CHA  SY   E+ 
Sbjct  747   MQASGKVDRPLRPKAHLSCASGQKISSIKFASFGTPQGVCGSFREGSCHAFHSYDAFERY  806

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             CIG+  CSV ++   F GDPCP+V+K+L+VE VC+
Sbjct  807   CIGQNSCSVPVTPEIFGGDPCPHVMKKLSVEVVCS  841



>ref|XP_010915228.1| PREDICTED: beta-galactosidase isoform X1 [Elaeis guineensis]
Length=841

 Score =   253 bits (647),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 131/219 (60%), Positives = 157/219 (72%), Gaps = 13/219 (6%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             FNAP G+EPLALDM SMGKGQ+WINGES+GRYW AY A G+C GC Y G +   KCQ  C
Sbjct  628   FNAPSGNEPLALDMRSMGKGQIWINGESIGRYWPAYKAYGSCGGCDYRGTYNEKKCQTNC  687

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+P+QRWYHVPRS L PT NLLV+ EE GGDPT IS+V+R V SVC ++ E  P+ RNW+
Sbjct  688   GEPSQRWYHVPRSWLNPTGNLLVVLEEWGGDPTGISMVKRKVGSVCAEIFEWQPSARNWK  747

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
              + YGR      PK HL C PGQ +S IKFASFGTP G CGSF +G CHA  SY   +K+
Sbjct  748   TKGYGR------PKAHLSCPPGQKMSKIKFASFGTPQGVCGSFSEGSCHAFHSYDAFQKE  801

Query  574   -----CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVC  476
                  CIG+Q CSV ++   F GDPCP ++K+L VEA+C
Sbjct  802   SLLQNCIGQQWCSVVVAPQMFGGDPCPGIMKKLAVEAIC  840



>ref|XP_011045966.1| PREDICTED: beta-galactosidase-like isoform X2 [Populus euphratica]
Length=838

 Score =   253 bits (647),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 125/215 (58%), Positives = 161/215 (75%), Gaps = 3/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             F+AP G++PLALDMSSMGKGQ+WING+++GR+W  Y A G+C  C+YAG F   KC+  C
Sbjct  625   FDAPPGNDPLALDMSSMGKGQMWINGQNIGRHWPGYIAHGSCGDCNYAGTFDDKKCRTNC  684

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+P+QRWYHVPRS LKP+ NLL +FEE GGDPT IS V+R+ +SVC D+ E  P ++NW+
Sbjct  685   GEPSQRWYHVPRSWLKPSGNLLAVFEEWGGDPTGISFVKRTTASVCADIFEGQPALKNWQ  744

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
               + G+    P+PK HL C PGQ IS IKFASFG P GTCGSF++G CHA  SY   E+ 
Sbjct  745   AIASGKVIS-PQPKAHLWCPPGQKISQIKFASFGMPQGTCGSFREGSCHAHKSYDAFERN  803

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             C+G+Q CSV ++   F GDPCP+  K+L+VEAVC+
Sbjct  804   CVGKQSCSVTVAPEVFGGDPCPDSAKKLSVEAVCS  838



>ref|NP_001234303.1| beta-galactosidase precursor [Solanum lycopersicum]
 gb|AAF70822.1|AF154421_1 beta-galactosidase [Solanum lycopersicum]
 emb|CAA10173.1| ss-galactosidase [Solanum lycopersicum]
Length=838

 Score =   253 bits (647),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 126/215 (59%), Positives = 162/215 (75%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             FNAP G++PLALD+++MGKGQVWING+SLGRYW  Y A+GNC  C+YAG F   KC   C
Sbjct  624   FNAPAGNDPLALDLNTMGKGQVWINGQSLGRYWPGYKASGNCGACNYAGWFNEKKCLSNC  683

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +QRWYHVPRS L PT NLLVLFEE GG+P  ISLV+R V+SVC D+ E  P + NW+
Sbjct  684   GEASQRWYHVPRSWLYPTGNLLVLFEEWGGEPHGISLVKREVASVCADINEWQPQLVNWQ  743

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             +++ G+  +  +PK HL C+ GQ I+SIKFASFGTP G CGSF++G CHA  SY   E+ 
Sbjct  744   MQASGKVDKPLRPKAHLSCASGQKITSIKFASFGTPQGVCGSFREGSCHAFHSYDAFERY  803

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             CIG+  CSV ++   F GDPCP+V+K+L+VE +C+
Sbjct  804   CIGQNSCSVPVTPEIFGGDPCPHVMKKLSVEVICS  838



>ref|XP_009622143.1| PREDICTED: beta-galactosidase-like [Nicotiana tomentosiformis]
Length=840

 Score =   253 bits (647),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 127/215 (59%), Positives = 161/215 (75%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             FNAP G++PLALD+++MGKGQVWING+S+GRYW  Y A+GNC  C+YAG F   KC   C
Sbjct  626   FNAPAGNDPLALDLNTMGKGQVWINGQSIGRYWPGYKASGNCGACNYAGWFDEKKCLSNC  685

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +QRWYHVPRS L PT NLLVLFEE GG+P  ISLV+R V+SVC D+ E  P + NW+
Sbjct  686   GEASQRWYHVPRSWLYPTGNLLVLFEEWGGEPHGISLVKREVASVCADINEWQPQLVNWQ  745

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             +++ G+     +PK HL C+ GQ ISSIKFASFGTP G CGSF++G CHA  SY   E+ 
Sbjct  746   MQASGKVDRPLRPKAHLSCASGQKISSIKFASFGTPQGVCGSFREGSCHAFHSYDAFERY  805

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             CIG+  CSV ++   F GDPCP+V+K+L+VE VC+
Sbjct  806   CIGQNSCSVPVTPEIFGGDPCPHVMKKLSVEVVCS  840



>ref|XP_008447606.1| PREDICTED: beta-galactosidase 1 [Cucumis melo]
Length=844

 Score =   253 bits (647),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 124/215 (58%), Positives = 158/215 (73%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             FNAP G+ PLALDM SMGKGQ+W+NG+SLGRYW AY +TG+C  C Y G +   KC   C
Sbjct  630   FNAPAGNSPLALDMGSMGKGQIWLNGQSLGRYWPAYKSTGSCGSCDYTGTYNEKKCSSNC  689

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +QRWYHVPRS LKPT NLLV+FEE GGDP  I LVRR V SVC ++ E  P + NW+
Sbjct  690   GEASQRWYHVPRSWLKPTGNLLVVFEEWGGDPNGIHLVRRDVDSVCVNINEWQPTLMNWQ  749

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             ++S G+  +  +PK HL C PGQ ISS+KFASFGTP G CGSF++G CHA  SY   ++ 
Sbjct  750   MQSSGKVNKPLRPKAHLSCGPGQKISSVKFASFGTPEGECGSFREGSCHAHHSYDAFQRT  809

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             C+G+  C+V ++   F GDPCPNV+K+L+VE +C+
Sbjct  810   CVGQNFCTVTVAPEMFGGDPCPNVMKKLSVEVICS  844



>ref|XP_007150529.1| hypothetical protein PHAVU_005G160000g [Phaseolus vulgaris]
 gb|ESW22523.1| hypothetical protein PHAVU_005G160000g [Phaseolus vulgaris]
Length=837

 Score =   253 bits (646),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 127/215 (59%), Positives = 163/215 (76%), Gaps = 4/215 (2%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             F+AP G  PLALDM SMGKGQVW+NG++LGR+W AY A G C+ C YAG +   KC+  C
Sbjct  625   FDAPAGTAPLALDMDSMGKGQVWLNGQNLGRFWPAYKAAGACDHCDYAGTYNENKCRSNC  684

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +QRWYHVP+S LKPT NLLV+FEELGGDP  I LVRR + SVC D+ E  PN+ +++
Sbjct  685   GEASQRWYHVPQSWLKPTGNLLVVFEELGGDPNGIFLVRRDIDSVCADIYEWQPNLISYQ  744

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             ++  G+     +PK+HL CSPGQ ISSIKFASFGTP+G+CG+F +G CHA  SY   E+ 
Sbjct  745   MQVAGKPPV--RPKVHLTCSPGQKISSIKFASFGTPVGSCGNFHEGSCHAHKSYDAFERN  802

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             C+G+  C+V +S  NF GDPCPNV+K+L+VEA+CT
Sbjct  803   CVGQNWCTVTVSPENFGGDPCPNVMKKLSVEAICT  837



>ref|XP_010686091.1| PREDICTED: beta-galactosidase 1 [Beta vulgaris subsp. vulgaris]
Length=841

 Score =   253 bits (646),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 122/215 (57%), Positives = 160/215 (74%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             FNAP G+EPLALDM +MGKGQVWING+++GRYW AY A G+C+ C YAG F   KC   C
Sbjct  627   FNAPSGNEPLALDMGAMGKGQVWINGQNIGRYWPAYTAKGSCSDCSYAGYFSEKKCLTYC  686

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G  +QRWYHVPRS LKP  NL+V+FEE+ G P  ISL+++ +SS+C D+ E  P + NW 
Sbjct  687   GDASQRWYHVPRSWLKPRGNLMVVFEEMSGAPNFISLMKKEISSICADINEWQPTLVNWH  746

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             ++S GR  +  +PK HL C+PGQ ISSIKFASFGTP G+CG+++QG CHA  SY + +K 
Sbjct  747   LKSSGRIDKPLRPKAHLWCAPGQKISSIKFASFGTPEGSCGNYKQGNCHAHNSYDIFQKD  806

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             C+G+  C++ +    F GDPCPNV+K+L VEA+C+
Sbjct  807   CVGQPGCAITVEPRLFGGDPCPNVMKKLAVEAICS  841



>ref|NP_001043405.1| Os01g0580200 [Oryza sativa Japonica Group]
 sp|Q8W0A1.1|BGAL2_ORYSJ RecName: Full=Beta-galactosidase 2; Short=Lactase 2; Flags: Precursor 
[Oryza sativa Japonica Group]
 dbj|BAB84455.1| putative beta-galactosidase [Oryza sativa Japonica Group]
 dbj|BAF05319.1| Os01g0580200 [Oryza sativa Japonica Group]
 dbj|BAG95853.1| unnamed protein product [Oryza sativa Japonica Group]
Length=827

 Score =   253 bits (645),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 127/216 (59%), Positives = 155/216 (72%), Gaps = 8/216 (4%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQL  941
             A FNAPDGDEPLALDMSSMGKGQ+WING+ +GRYW  Y A+GNC  C Y G +   KCQ 
Sbjct  617   AFFNAPDGDEPLALDMSSMGKGQIWINGQGIGRYWPGYKASGNCGTCDYRGEYDETKCQT  676

Query  940   GCGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRN  761
              CG  +QRWYHVPRS L PT NLLV+FEE GGDPT IS+V+RS+ SVC DV E  P+++N
Sbjct  677   NCGDSSQRWYHVPRSWLSPTGNLLVIFEEWGGDPTGISMVKRSIGSVCADVSEWQPSMKN  736

Query  760   WEIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLE  581
             W       T++  K K+HL C  GQ I+ IKFASFGTP G+CGS+ +G CHA  SY +  
Sbjct  737   W------HTKDYEKAKVHLQCDNGQKITEIKFASFGTPQGSCGSYTEGGCHAHKSYDIFW  790

Query  580   KKCIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVC  476
             K C+G++RC V++    F GDPCP  +KR  VEA+C
Sbjct  791   KNCVGQERCGVSVVPEIFGGDPCPGTMKRAVVEAIC  826



>gb|EEE54862.1| hypothetical protein OsJ_02342 [Oryza sativa Japonica Group]
Length=839

 Score =   253 bits (646),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 127/216 (59%), Positives = 155/216 (72%), Gaps = 8/216 (4%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQL  941
             A FNAPDGDEPLALDMSSMGKGQ+WING+ +GRYW  Y A+GNC  C Y G +   KCQ 
Sbjct  629   AFFNAPDGDEPLALDMSSMGKGQIWINGQGIGRYWPGYKASGNCGTCDYRGEYDETKCQT  688

Query  940   GCGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRN  761
              CG  +QRWYHVPRS L PT NLLV+FEE GGDPT IS+V+RS+ SVC DV E  P+++N
Sbjct  689   NCGDSSQRWYHVPRSWLSPTGNLLVIFEEWGGDPTGISMVKRSIGSVCADVSEWQPSMKN  748

Query  760   WEIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLE  581
             W       T++  K K+HL C  GQ I+ IKFASFGTP G+CGS+ +G CHA  SY +  
Sbjct  749   W------HTKDYEKAKVHLQCDNGQKITEIKFASFGTPQGSCGSYTEGGCHAHKSYDIFW  802

Query  580   KKCIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVC  476
             K C+G++RC V++    F GDPCP  +KR  VEA+C
Sbjct  803   KNCVGQERCGVSVVPEIFGGDPCPGTMKRAVVEAIC  838



>gb|EEC70952.1| hypothetical protein OsI_02561 [Oryza sativa Indica Group]
Length=822

 Score =   253 bits (645),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 127/216 (59%), Positives = 155/216 (72%), Gaps = 8/216 (4%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQL  941
             A FNAPDGDEPLALDMSSMGKGQ+WING+ +GRYW  Y A+GNC  C Y G +   KCQ 
Sbjct  612   AFFNAPDGDEPLALDMSSMGKGQIWINGQGIGRYWPGYKASGNCGTCDYRGEYDETKCQT  671

Query  940   GCGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRN  761
              CG  +QRWYHVPRS L PT NLLV+FEE GGDPT IS+V+RS+ SVC DV E  P+++N
Sbjct  672   NCGDSSQRWYHVPRSWLSPTGNLLVIFEEWGGDPTGISMVKRSIGSVCADVSEWQPSMKN  731

Query  760   WEIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLE  581
             W       T++  K K+HL C  GQ I+ IKFASFGTP G+CGS+ +G CHA  SY +  
Sbjct  732   W------HTKDYEKAKVHLQCDNGQKITEIKFASFGTPQGSCGSYSEGGCHAHKSYDIFW  785

Query  580   KKCIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVC  476
             K C+G++RC V++    F GDPCP  +KR  VEA+C
Sbjct  786   KNCVGQERCGVSVVPEIFGGDPCPGTMKRAVVEAIC  821



>ref|XP_011045964.1| PREDICTED: beta-galactosidase-like isoform X1 [Populus euphratica]
Length=880

 Score =   253 bits (647),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 125/215 (58%), Positives = 161/215 (75%), Gaps = 3/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             F+AP G++PLALDMSSMGKGQ+WING+++GR+W  Y A G+C  C+YAG F   KC+  C
Sbjct  667   FDAPPGNDPLALDMSSMGKGQMWINGQNIGRHWPGYIAHGSCGDCNYAGTFDDKKCRTNC  726

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+P+QRWYHVPRS LKP+ NLL +FEE GGDPT IS V+R+ +SVC D+ E  P ++NW+
Sbjct  727   GEPSQRWYHVPRSWLKPSGNLLAVFEEWGGDPTGISFVKRTTASVCADIFEGQPALKNWQ  786

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
               + G+    P+PK HL C PGQ IS IKFASFG P GTCGSF++G CHA  SY   E+ 
Sbjct  787   AIASGKVIS-PQPKAHLWCPPGQKISQIKFASFGMPQGTCGSFREGSCHAHKSYDAFERN  845

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             C+G+Q CSV ++   F GDPCP+  K+L+VEAVC+
Sbjct  846   CVGKQSCSVTVAPEVFGGDPCPDSAKKLSVEAVCS  880



>ref|XP_004150073.1| PREDICTED: beta-galactosidase 5 [Cucumis sativus]
 gb|KGN61834.1| hypothetical protein Csa_2G249880 [Cucumis sativus]
Length=848

 Score =   253 bits (645),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 129/218 (59%), Positives = 165/218 (76%), Gaps = 2/218 (1%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A F+AP+GDEPLALDM SM KGQVWING+++GRYWT  A GNC  C Y+G ++P KCQ G
Sbjct  628   AYFDAPEGDEPLALDMGSMQKGQVWINGQNVGRYWTITANGNCTDCSYSGTYRPRKCQFG  687

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CGQPTQ+WYHVPRS L PT+NL+V+FEE+GG+P+RISLV+RSV+S+C +  +  P I+N 
Sbjct  688   CGQPTQQWYHVPRSWLMPTKNLIVVFEEVGGNPSRISLVKRSVTSICTEASQYRPVIKNV  747

Query  757   EI-ESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLE  581
              + ++ G   E    K++LHC+ GQ IS+IKFASFGTP G CGS +QG CH+  S  VL+
Sbjct  748   HMHQNNGELNEQNVLKINLHCAAGQFISAIKFASFGTPSGACGSHKQGTCHSPKSDYVLQ  807

Query  580   KKCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTP  470
             K C+GRQRC   I  + FG DPCPN+ K+L+ E VC P
Sbjct  808   KLCVGRQRCLATIPTSIFGEDPCPNLRKKLSAEVVCQP  845



>gb|AEC33272.1| beta-galactosidase [Ziziphus jujuba]
Length=730

 Score =   251 bits (640),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 129/218 (59%), Positives = 165/218 (76%), Gaps = 2/218 (1%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A FNAP+G+EPLALD+ SMGKGQV ING+S+GRYWTAYA G+C  C Y G        L 
Sbjct  500   AYFNAPNGNEPLALDLRSMGKGQVRINGQSIGRYWTAYAKGDCEACSYTGHSGRQNVNLV  559

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
                PTQRWYHVPRS LKP +NLLV+FEELGGD ++I+L+RRS+++VC +  E HP++  +
Sbjct  560   VASPTQRWYHVPRSWLKPKQNLLVIFEELGGDASKIALLRRSLTNVCANAFENHPSMAKY  619

Query  757   EIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEK  578
                S   ++ + +  ++L C PGQSIS+I+FASFGTP GTCGSF  G CHA  S S++EK
Sbjct  620   STSSQDGSK-VKEATVNLQCGPGQSISAIEFASFGTPSGTCGSFHIGTCHAPNSRSIIEK  678

Query  577   KCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTPS  467
             KC+G++ CSV ISN+ FG DPCPNV+KRLTVEAVC+ +
Sbjct  679   KCVGQKSCSVTISNSIFGADPCPNVLKRLTVEAVCSKA  716



>ref|XP_006646030.1| PREDICTED: beta-galactosidase 2-like [Oryza brachyantha]
Length=827

 Score =   252 bits (644),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 127/216 (59%), Positives = 153/216 (71%), Gaps = 8/216 (4%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQL  941
             A FNAPDGDEPLALDMSSMGKGQ+WING+ +GRYW  Y ATGNC  C Y G +   KCQ 
Sbjct  617   AFFNAPDGDEPLALDMSSMGKGQIWINGQGIGRYWPGYKATGNCGTCDYRGEYDESKCQT  676

Query  940   GCGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRN  761
              CG  +QRWYHVPRS L PT NLLV+FEE GGD T IS+ +RS+ SVC DV E  P+++N
Sbjct  677   NCGDSSQRWYHVPRSWLNPTGNLLVIFEEWGGDHTGISMAKRSIGSVCADVSEWQPSMKN  736

Query  760   WEIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLE  581
             W      RT++  K K+HL C  GQ I+ IKFASFGTP G+CGS+ +G CHA  SY +  
Sbjct  737   W------RTKDYEKAKVHLQCDNGQKITEIKFASFGTPQGSCGSYSEGGCHAHKSYDIFW  790

Query  580   KKCIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVC  476
             K C+G++RC V++    F GDPCP  +KR  VEA C
Sbjct  791   KNCVGQERCGVSVVPEVFGGDPCPGTMKRAVVEATC  826



>ref|XP_003531618.1| PREDICTED: beta-galactosidase 1-like [Glycine max]
 gb|KHN11289.1| Beta-galactosidase 1 [Glycine soja]
Length=843

 Score =   252 bits (644),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 127/215 (59%), Positives = 161/215 (75%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             F+AP G  PLALDM SMGKGQVWING+SLGRYW AY A+G+C  C+YAG +   KC   C
Sbjct  629   FDAPAGVAPLALDMGSMGKGQVWINGQSLGRYWPAYKASGSCGYCNYAGTYNEKKCGSNC  688

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +QRWYHVP S LKP+ NLLV+FEELGGDP  I LVRR + SVC D+ E  PN+ ++E
Sbjct  689   GEASQRWYHVPHSWLKPSGNLLVVFEELGGDPNGIFLVRRDIDSVCADIYEWQPNLVSYE  748

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             +++ G+ +   +PK HL C PGQ ISSIKFASFGTP+G+CGS+++G CHA  SY    K 
Sbjct  749   MQASGKVRSPVRPKAHLSCGPGQKISSIKFASFGTPVGSCGSYREGSCHAHKSYDAFLKN  808

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             C+G+  C+V +S   F GDPCP V+K+L+VEA+CT
Sbjct  809   CVGQSWCTVTVSPEIFGGDPCPRVMKKLSVEAICT  843



>ref|XP_010654522.1| PREDICTED: beta-galactosidase 1 [Vitis vinifera]
Length=850

 Score =   252 bits (644),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 125/215 (58%), Positives = 159/215 (74%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             FNAP G+ PLALDM SMGKGQ+WING+++GRYW AY ATG C  C+YAG +   KC   C
Sbjct  636   FNAPGGNTPLALDMGSMGKGQIWINGQNVGRYWPAYKATGGCGDCNYAGTYSEKKCLSNC  695

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+P+QRWYHVP S L PT NLLV+FEE GG+P  ISLV R + SVC D+ E  P + N+E
Sbjct  696   GEPSQRWYHVPHSWLSPTGNLLVVFEESGGNPAGISLVEREIESVCADIYEWQPTLMNYE  755

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             +++ G+  +  +PK HL C+PGQ ISSIKFASFGTP G CGS+++G CHA  SY   E+ 
Sbjct  756   MQASGKVNKPLRPKAHLWCAPGQKISSIKFASFGTPEGVCGSYREGSCHAHKSYDAFERS  815

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             CIG   CSV ++   F GDPCP+V+K+L+VEA+C+
Sbjct  816   CIGMNSCSVTVAPEIFGGDPCPSVMKKLSVEAICS  850



>ref|XP_004241849.1| PREDICTED: beta-galactosidase-like [Solanum lycopersicum]
Length=841

 Score =   252 bits (643),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 125/215 (58%), Positives = 161/215 (75%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             FNAP G+EPLALDM++MGKGQ+WING+SLGRYW  Y ++G C+ C+YAG F   KC   C
Sbjct  627   FNAPAGNEPLALDMNTMGKGQMWINGQSLGRYWPGYKSSGTCSACNYAGYFNENKCLSNC  686

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +QRWYHVPRS L PT NLLV+FEE GGDP  ISLV+R ++SVC D+ E  P + N++
Sbjct  687   GEASQRWYHVPRSWLHPTGNLLVVFEEWGGDPNAISLVKRELASVCADINEWQPQLVNYK  746

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             +++ G      +PK HL C+ GQ I+SIKFASFGTP+G CGSF +G CHA  SY   EK 
Sbjct  747   MQASGEVDRPLRPKAHLRCATGQKITSIKFASFGTPVGVCGSFSEGSCHAHHSYDAFEKY  806

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             CIG++ CSV ++   F GDPCP V+K+L+VEA+C+
Sbjct  807   CIGQESCSVPVTPEIFGGDPCPGVMKKLSVEALCS  841



>ref|XP_006357461.1| PREDICTED: beta-galactosidase-like, partial [Solanum tuberosum]
Length=866

 Score =   252 bits (644),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 125/215 (58%), Positives = 161/215 (75%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             FNAP G+EPLALDM++MGKGQ+WING+SLGRYW  Y ++G C+ C+YAG F   KC   C
Sbjct  652   FNAPAGNEPLALDMNTMGKGQMWINGQSLGRYWPGYKSSGTCSACNYAGYFNENKCLSNC  711

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +QRWYHVPRS L PT NLLV+FEE GGDP  ISLV+R ++SVC D+ E  P + N++
Sbjct  712   GEASQRWYHVPRSWLHPTGNLLVVFEEWGGDPNAISLVKRELASVCADINEWQPQLVNYK  771

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             +++ G      +PK HL C+PGQ I+SIKFASFGTP+G CGSF +G C A  SY   EK 
Sbjct  772   MQASGEVDRPLRPKAHLRCAPGQKITSIKFASFGTPVGVCGSFSEGSCRAHHSYDAFEKY  831

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             CIG++ CSV ++   F GDPCP V+K+L+VEA+C+
Sbjct  832   CIGKESCSVPVTPEIFGGDPCPGVMKKLSVEALCS  866



>emb|CBI35944.3| unnamed protein product [Vitis vinifera]
Length=841

 Score =   252 bits (643),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 125/215 (58%), Positives = 159/215 (74%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             FNAP G+ PLALDM SMGKGQ+WING+++GRYW AY ATG C  C+YAG +   KC   C
Sbjct  627   FNAPGGNTPLALDMGSMGKGQIWINGQNVGRYWPAYKATGGCGDCNYAGTYSEKKCLSNC  686

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+P+QRWYHVP S L PT NLLV+FEE GG+P  ISLV R + SVC D+ E  P + N+E
Sbjct  687   GEPSQRWYHVPHSWLSPTGNLLVVFEESGGNPAGISLVEREIESVCADIYEWQPTLMNYE  746

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             +++ G+  +  +PK HL C+PGQ ISSIKFASFGTP G CGS+++G CHA  SY   E+ 
Sbjct  747   MQASGKVNKPLRPKAHLWCAPGQKISSIKFASFGTPEGVCGSYREGSCHAHKSYDAFERS  806

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             CIG   CSV ++   F GDPCP+V+K+L+VEA+C+
Sbjct  807   CIGMNSCSVTVAPEIFGGDPCPSVMKKLSVEAICS  841



>ref|XP_002308268.2| hypothetical protein POPTR_0006s14680g [Populus trichocarpa]
 gb|EEE91791.2| hypothetical protein POPTR_0006s14680g [Populus trichocarpa]
Length=837

 Score =   251 bits (642),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 124/215 (58%), Positives = 160/215 (74%), Gaps = 3/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             F+AP G++PLALDMSSMGKGQ+WING+++GR+W  Y A G+C  C+YAG F   KC+  C
Sbjct  624   FDAPQGNDPLALDMSSMGKGQMWINGQNIGRHWPGYIAHGSCGDCNYAGTFDDKKCRTNC  683

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+P+QRWYHVPRS LKP+ NLL +FEE GGDPT IS V+R+ +SVC D+ E  P ++NW+
Sbjct  684   GEPSQRWYHVPRSWLKPSGNLLAVFEEWGGDPTGISFVKRTTASVCADIFEGQPALKNWQ  743

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
               + G+    P+PK HL C  GQ IS IKFASFG P GTCGSF++G CHA  SY   E+ 
Sbjct  744   AIASGKVIS-PQPKAHLWCPTGQKISQIKFASFGMPQGTCGSFREGSCHAHKSYDAFERN  802

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             C+G+Q CSV ++   F GDPCP+  K+L+VEAVC+
Sbjct  803   CVGKQSCSVTVAPEVFGGDPCPDSAKKLSVEAVCS  837



>ref|XP_004146823.1| PREDICTED: beta-galactosidase 1 [Cucumis sativus]
Length=841

 Score =   251 bits (642),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 123/215 (57%), Positives = 157/215 (73%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             FNAP G+ PLALDM SMGKGQ+W+NG+SLGRYW AY +TG+C  C Y G +   KC   C
Sbjct  627   FNAPAGNSPLALDMGSMGKGQIWLNGQSLGRYWPAYKSTGSCGSCDYTGTYNEKKCSSNC  686

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +QRWYHVPRS L PT NLLV+FEE GGDP  I LVRR V SVC ++ E  P + NW+
Sbjct  687   GEASQRWYHVPRSWLNPTGNLLVVFEEWGGDPNGIHLVRRDVDSVCVNINEWQPTLMNWQ  746

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             ++S G+  +  +PK HL C PGQ ISS+KFASFGTP G CGSF++G CHA  SY   ++ 
Sbjct  747   MQSSGKVNKPLRPKAHLSCGPGQKISSVKFASFGTPEGECGSFREGSCHAHHSYDAFQRT  806

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             C+G+  C+V ++   F GDPCPNV+K+L+VE +C+
Sbjct  807   CVGQNFCTVTVAPEMFGGDPCPNVMKKLSVEVICS  841



>gb|KEH18344.1| beta-galactosidase [Medicago truncatula]
Length=838

 Score =   251 bits (641),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 123/215 (57%), Positives = 166/215 (77%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             F+AP G  PLALDM+SMGKGQ+W+NG++LGRYW AY A+G+C+ C+YAG +   KC   C
Sbjct  624   FDAPAGVAPLALDMNSMGKGQMWLNGQNLGRYWPAYKASGSCDYCNYAGTYNEKKCGSNC  683

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +QRWYHVP+S LKPT NLLV+FEELGGDP  +SLVRR + SVC D+ E  PN+ +++
Sbjct  684   GEASQRWYHVPKSWLKPTGNLLVMFEELGGDPNGVSLVRRDIDSVCADIYEWQPNLVSYQ  743

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             +++ G+ +    PK HL C PGQ ISSIKFASFGTP+G+CG++++G CHA  SY   +K 
Sbjct  744   MQASGKVKIPVSPKAHLSCGPGQKISSIKFASFGTPVGSCGNYREGSCHAHKSYDAFQKN  803

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             C+G+  C+V +S   F GDPCP+V+K+L+VEA+CT
Sbjct  804   CVGQSSCTVTVSPGIFGGDPCPHVMKKLSVEAICT  838



>ref|XP_008460995.1| PREDICTED: beta-galactosidase 5-like [Cucumis melo]
Length=845

 Score =   251 bits (641),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 127/218 (58%), Positives = 164/218 (75%), Gaps = 2/218 (1%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAYATGNCNGCHYAGPFKPPKCQLG  938
             A F+AP+GDEPLALDM SM KGQVWING+++GRYWT  A GNC  C Y+G ++P KCQ  
Sbjct  625   AYFDAPEGDEPLALDMGSMQKGQVWINGQNVGRYWTIIANGNCTDCSYSGTYRPWKCQFD  684

Query  937   CGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNW  758
             CG PTQ+WYHVPRS L PT+NL+V+FEE+GG+P+RISLV+RSV+S+C +  +  P I+N 
Sbjct  685   CGHPTQQWYHVPRSWLMPTKNLIVVFEEVGGNPSRISLVKRSVTSICTEASQYRPVIKNV  744

Query  757   EI-ESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLE  581
              + ++Y    E    K++LHC+ GQ IS+IKFASFGTP G CGS +QG CH+  S SVL+
Sbjct  745   HMHQNYAELNEQNVLKINLHCAAGQFISAIKFASFGTPTGACGSHEQGTCHSPKSDSVLQ  804

Query  580   KKCIGRQRCSVAISNTNFG-DPCPNVVKRLTVEAVCTP  470
             K C+GR+RC   I  + FG DPCPN+ K+L+ E VC P
Sbjct  805   KLCVGRRRCLATIPTSIFGEDPCPNLRKKLSAEVVCQP  842



>gb|KJB70255.1| hypothetical protein B456_011G065300 [Gossypium raimondii]
Length=690

 Score =   248 bits (634),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 122/215 (57%), Positives = 157/215 (73%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             FNAP G+ PLALDM SMGKGQ+WING+S+GR+W AY A+GNC  C YAG F   KC   C
Sbjct  476   FNAPAGNSPLALDMGSMGKGQIWINGKSIGRHWPAYKASGNCGVCSYAGTFNEKKCGTNC  535

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +QRWYHVPRS L PT NLLV+FEE GGDP  I+LVRR   SVC D+ E  PN+ N+ 
Sbjct  536   GEASQRWYHVPRSWLNPTGNLLVVFEEWGGDPNGITLVRRETDSVCADIYEWQPNLMNYL  595

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             +++ G+  +  +PK+HL C  GQ IS++KFASFGTP G CGS+++G CHA  SY    + 
Sbjct  596   MKASGKVNKPLRPKVHLECDAGQKISAVKFASFGTPEGVCGSYREGSCHAHHSYDAFNRL  655

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             C+G+  CSV ++   F GDPCPNV+K+L+VE +C+
Sbjct  656   CVGQNFCSVTVAPEMFGGDPCPNVMKKLSVEVICS  690



>dbj|BAF02242.1| putative galactosidase [Arabidopsis thaliana]
Length=592

 Score =   246 bits (629),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 124/215 (58%), Positives = 156/215 (73%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             F+AP GD PLA+DM SMGKGQ+WING+SLGR+W AY A G+C+ C Y G F+  KC   C
Sbjct  378   FSAPAGDSPLAVDMGSMGKGQIWINGQSLGRHWPAYKAVGSCSECSYTGTFREDKCLRNC  437

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +QRWYHVPRS LKP+ NLLV+FEE GGDP  I+LVRR V SVC D+ E    + N++
Sbjct  438   GEASQRWYHVPRSWLKPSGNLLVVFEEWGGDPNGITLVRREVDSVCADIYEWQSTLVNYQ  497

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             + + G+  +   PK HL C PGQ I+++KFASFGTP GTCGS++QG CHA  SY    K 
Sbjct  498   LHASGKVNKPLHPKAHLQCGPGQKITTVKFASFGTPEGTCGSYRQGSCHAHHSYDAFNKL  557

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             C+G+  CSV ++   F GDPCPNV+K+L VEAVC 
Sbjct  558   CVGQNWCSVTVAPEMFGGDPCPNVMKKLAVEAVCA  592



>tpg|DAA58691.1| TPA: hypothetical protein ZEAMMB73_223728 [Zea mays]
Length=655

 Score =   247 bits (631),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 124/216 (57%), Positives = 151/216 (70%), Gaps = 8/216 (4%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQL  941
             A FNAPDGDEPLALDMSSMGKGQ+WING+ +GRYW  Y A+G C  C Y G +   KCQ 
Sbjct  445   AFFNAPDGDEPLALDMSSMGKGQIWINGQGIGRYWPGYKASGTCGICDYRGEYDEKKCQT  504

Query  940   GCGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRN  761
              CG  +QRWYHVPRS L PT NLLV+FEE GGDPT IS+V+R   S+C DV E  P++ N
Sbjct  505   NCGDSSQRWYHVPRSWLNPTGNLLVIFEEWGGDPTGISMVKRIAGSICADVSEWQPSMAN  564

Query  760   WEIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLE  581
             W      RT+   K K+HL C  G+ ++ IKFASFGTP G+CGS+ +G CHA  SY +  
Sbjct  565   W------RTKGYEKAKVHLQCDHGRKMTHIKFASFGTPQGSCGSYSEGGCHAHKSYDIFW  618

Query  580   KKCIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVC  476
             K CIG++RC V++    F GDPCP  +KR  VEA+C
Sbjct  619   KSCIGQERCGVSVVPDAFGGDPCPGTMKRAVVEAIC  654



>ref|XP_008242341.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase [Prunus mume]
Length=836

 Score =   250 bits (639),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 131/217 (60%), Positives = 160/217 (74%), Gaps = 5/217 (2%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQL  941
             A FNAP G+ PLALDMSSMGKGQ+WING+S+GR+W AY A GNC  C+YAG +   KC+ 
Sbjct  623   ATFNAPPGNGPLALDMSSMGKGQIWINGQSIGRHWPAYTARGNCGNCYYAGTYDDKKCRT  682

Query  940   GCGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRN  761
              CG+P+QRWYHVPRS L P+ENLLV+FEE GGDPT+ISLV R  SSVC D+ E  P + N
Sbjct  683   HCGEPSQRWYHVPRSWLTPSENLLVVFEEWGGDPTKISLVERRTSSVCADIFEGQPTLTN  742

Query  760   WEIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLE  581
              +  + G+   L +PK HL C PGQ IS IKFAS+G P GTCGSFQ+G CHA  SY   +
Sbjct  743   SQKLASGK---LNRPKAHLWCPPGQVISDIKFASYGLPQGTCGSFQEGSCHAHKSYDAPK  799

Query  580   KKCIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             + CIG+Q CSV ++   F GDPCP   K+L+VEAVC+
Sbjct  800   RNCIGKQSCSVTVAPEVFGGDPCPGSTKKLSVEAVCS  836



>ref|XP_002455836.1| hypothetical protein SORBIDRAFT_03g025990 [Sorghum bicolor]
 gb|EES00956.1| hypothetical protein SORBIDRAFT_03g025990 [Sorghum bicolor]
Length=785

 Score =   249 bits (637),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 124/216 (57%), Positives = 153/216 (71%), Gaps = 8/216 (4%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQL  941
             A FNAPDGDEPLALDMSSMGKGQ+WING+ +GRYW  Y A+G C  C Y G +   KCQ 
Sbjct  575   AFFNAPDGDEPLALDMSSMGKGQIWINGQGIGRYWPGYKASGTCGICDYRGEYDEKKCQT  634

Query  940   GCGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRN  761
              CG  +QRWYHVPRS L PT NLLV+FEE GGDPT IS+V+R+  S+C DV E  P++ N
Sbjct  635   NCGDSSQRWYHVPRSWLNPTGNLLVIFEEWGGDPTGISMVKRTTGSICADVSEWQPSMTN  694

Query  760   WEIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLE  581
             W      RT++  K K+HL C  G+ ++ IKFASFGTP G+CGS+ +G CHA  SY +  
Sbjct  695   W------RTKDYEKAKIHLQCDHGRKMTDIKFASFGTPQGSCGSYSEGGCHAHKSYDIFW  748

Query  580   KKCIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVC  476
             K CIG++RC V++    F GDPCP  +KR  VEA+C
Sbjct  749   KNCIGQERCGVSVVPNVFGGDPCPGTMKRAVVEAIC  784



>gb|AAQ21370.1| beta-galactosidase [Sandersonia aurantiaca]
Length=568

 Score =   245 bits (625),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 128/219 (58%), Positives = 158/219 (72%), Gaps = 13/219 (6%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             FNAP G++PLALDM SMGKGQVWING+S+GRYW AY A+G+C GC Y G +   KCQ  C
Sbjct  355   FNAPAGNDPLALDMGSMGKGQVWINGQSVGRYWPAYKASGSCGGCDYRGTYNEKKCQSNC  414

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ TQRWYHVPRS L PT NLLV+FEE GGDP+ IS+VRR V SVC ++ E  PN+ N  
Sbjct  415   GESTQRWYHVPRSWLNPTGNLLVVFEEWGGDPSGISMVRRKVESVCAEIAEWQPNMDNVH  474

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
               +YGR+      K HL C+PGQ +++IKFASFGTP GTCG+F +G CHA  SY   EK+
Sbjct  475   TGNYGRS------KAHLSCAPGQKMTNIKFASFGTPQGTCGAFSEGTCHAHKSYDAFEKE  528

Query  574   -----CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVC  476
                  CIG+Q C+V ++   F GDPCP  +K+L VEA+C
Sbjct  529   SLLQNCIGQQSCAVLVAPEVFGGDPCPGTMKKLAVEAIC  567



>ref|XP_007012844.1| Beta-galactosidase [Theobroma cacao]
 gb|EOY30463.1| Beta-galactosidase [Theobroma cacao]
Length=847

 Score =   250 bits (638),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 124/214 (58%), Positives = 157/214 (73%), Gaps = 5/214 (2%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             FNAP G+EPLALDMSSMGKGQ+WING+S+GR+W  Y A G C  C YAG +   KC+  C
Sbjct  636   FNAPGGNEPLALDMSSMGKGQIWINGQSIGRHWPGYIARGACGACDYAGTYSDKKCRTNC  695

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+P+QRWYHVPRS L P+ NL+V+FEE GGDP+ ISLV+R+  SVC D+ E  P ++NW 
Sbjct  696   GEPSQRWYHVPRSWLNPSGNLMVVFEEWGGDPSGISLVKRTTGSVCADIFEAQPTMKNWG  755

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             + + G+   + +PK HL C PGQ IS IKFAS+G P GTCGSF +G CHA  SY   +K 
Sbjct  756   MLASGK---INRPKAHLWCPPGQKISEIKFASYGIPEGTCGSFSEGSCHAHRSYDAFQKN  812

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVC  476
             CIG+Q CSV ++   F GDPCP+ +K+L+VEA C
Sbjct  813   CIGKQSCSVTVAPEVFGGDPCPDSMKKLSVEAAC  846



>dbj|BAH20412.1| AT3G13750 [Arabidopsis thaliana]
Length=625

 Score =   246 bits (627),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 124/215 (58%), Positives = 156/215 (73%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             F+AP GD PLA+DM SMGKGQ+WING+SLGR+W AY A G+C+ C Y G F+  KC   C
Sbjct  411   FSAPAGDSPLAVDMGSMGKGQIWINGQSLGRHWPAYKAVGSCSECSYTGTFREDKCLRNC  470

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +QRWYHVPRS LKP+ NLLV+FEE GGDP  I+LVRR V SVC D+ E    + N++
Sbjct  471   GEASQRWYHVPRSWLKPSGNLLVVFEEWGGDPNGITLVRREVDSVCADIYEWQSTLVNYQ  530

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             + + G+  +   PK HL C PGQ I+++KFASFGTP GTCGS++QG CHA  SY    K 
Sbjct  531   LHASGKVNKPLHPKAHLQCGPGQKITTVKFASFGTPEGTCGSYRQGSCHAHHSYDAFNKL  590

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             C+G+  CSV ++   F GDPCPNV+K+L VEAVC 
Sbjct  591   CVGQNWCSVTVAPEMFGGDPCPNVMKKLAVEAVCA  625



>ref|XP_007204656.1| hypothetical protein PRUPE_ppa001412mg [Prunus persica]
 gb|EMJ05855.1| hypothetical protein PRUPE_ppa001412mg [Prunus persica]
Length=836

 Score =   249 bits (637),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 131/217 (60%), Positives = 160/217 (74%), Gaps = 5/217 (2%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQL  941
             A FNAP G+ PLALDMSSMGKGQ+WING+S+GR+W AY A GNC  C+YAG +   KC+ 
Sbjct  623   ATFNAPPGNGPLALDMSSMGKGQIWINGQSIGRHWPAYTARGNCGNCYYAGTYDDKKCRT  682

Query  940   GCGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRN  761
              CG+P+QRWYHVPRS L P+ NLLV+FEE GGDPT+ISLV R  SSVC D+ E  P + N
Sbjct  683   HCGEPSQRWYHVPRSWLTPSGNLLVVFEEWGGDPTKISLVERRTSSVCADIFEGQPTLTN  742

Query  760   WEIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLE  581
              +  + G+   L +PK HL C PGQ IS IKFAS+G P GTCGSFQ+G CHA  SY   +
Sbjct  743   SQKLASGK---LNRPKAHLWCPPGQVISDIKFASYGLPQGTCGSFQEGSCHAHKSYDAPK  799

Query  580   KKCIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             + CIG+Q CSVA++   F GDPCP   K+L+VEAVC+
Sbjct  800   RNCIGKQSCSVAVAPEAFGGDPCPGSTKKLSVEAVCS  836



>ref|XP_006300095.1| hypothetical protein CARUB_v10016323mg [Capsella rubella]
 gb|EOA32993.1| hypothetical protein CARUB_v10016323mg [Capsella rubella]
Length=846

 Score =   249 bits (636),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 125/215 (58%), Positives = 158/215 (73%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             F+AP GD PLA+DM SMGKGQ+WING+SLGR+W AY A G+C+ C YAG FK  KC   C
Sbjct  632   FSAPAGDSPLAVDMGSMGKGQIWINGQSLGRHWPAYKAVGSCSECSYAGTFKEDKCLRNC  691

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +QRWYHVPRS LKP+ NLLV+FEE GGDP  ISLVRR V +VC D+ E    + N++
Sbjct  692   GEASQRWYHVPRSWLKPSGNLLVVFEEWGGDPNGISLVRREVDTVCADIYEWQSTLVNYQ  751

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             + + G+  +   PK+HL C PGQ I+++KFASFGTP GTCGS++QG CHA  SY    + 
Sbjct  752   LHASGKVNKPLHPKVHLQCGPGQKITTVKFASFGTPEGTCGSYRQGSCHAHHSYDAFNRL  811

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             C+G+  CSV ++   F GDPCPNV+K+L VEAVC 
Sbjct  812   CVGQNWCSVTVAPAMFGGDPCPNVMKKLAVEAVCA  846



>gb|ABV32546.1| beta-galactosidase protein 1 [Prunus persica]
Length=836

 Score =   249 bits (636),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 131/217 (60%), Positives = 160/217 (74%), Gaps = 5/217 (2%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQL  941
             A FNAP G+ PLALDMSSMGKGQ+WING+S+GR+W AY A GNC  C+YAG +   KC+ 
Sbjct  623   ATFNAPPGNGPLALDMSSMGKGQIWINGQSIGRHWPAYTARGNCGNCYYAGTYDDKKCRT  682

Query  940   GCGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRN  761
              CG+P+QRWYHVPRS L P+ NLLV+FEE GGDPT+ISLV R  SSVC D+ E  P + N
Sbjct  683   HCGEPSQRWYHVPRSWLTPSGNLLVVFEEWGGDPTKISLVERRTSSVCADIFEGQPTLTN  742

Query  760   WEIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLE  581
              +  + G+   L +PK HL C PGQ IS IKFAS+G P GTCGSFQ+G CHA  SY   +
Sbjct  743   SQKLASGK---LNRPKAHLWCPPGQVISDIKFASYGLPQGTCGSFQEGSCHAHKSYDAPK  799

Query  580   KKCIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             + CIG+Q CSVA++   F GDPCP   K+L+VEAVC+
Sbjct  800   RNCIGKQSCSVAVAPEVFGGDPCPGSTKKLSVEAVCS  836



>gb|KJB70254.1| hypothetical protein B456_011G065300 [Gossypium raimondii]
Length=784

 Score =   248 bits (633),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 122/215 (57%), Positives = 157/215 (73%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             FNAP G+ PLALDM SMGKGQ+WING+S+GR+W AY A+GNC  C YAG F   KC   C
Sbjct  570   FNAPAGNSPLALDMGSMGKGQIWINGKSIGRHWPAYKASGNCGVCSYAGTFNEKKCGTNC  629

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +QRWYHVPRS L PT NLLV+FEE GGDP  I+LVRR   SVC D+ E  PN+ N+ 
Sbjct  630   GEASQRWYHVPRSWLNPTGNLLVVFEEWGGDPNGITLVRRETDSVCADIYEWQPNLMNYL  689

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             +++ G+  +  +PK+HL C  GQ IS++KFASFGTP G CGS+++G CHA  SY    + 
Sbjct  690   MKASGKVNKPLRPKVHLECDAGQKISAVKFASFGTPEGVCGSYREGSCHAHHSYDAFNRL  749

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             C+G+  CSV ++   F GDPCPNV+K+L+VE +C+
Sbjct  750   CVGQNFCSVTVAPEMFGGDPCPNVMKKLSVEVICS  784



>gb|KJB56893.1| hypothetical protein B456_009G140800 [Gossypium raimondii]
Length=806

 Score =   248 bits (633),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 121/215 (56%), Positives = 160/215 (74%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             FNAP G+ PLALDM+SMGKGQ+WING+S+GR+W AY A+GNC  C+YAG F+  KC   C
Sbjct  592   FNAPAGNAPLALDMNSMGKGQIWINGQSIGRHWPAYKASGNCGACNYAGTFRENKCGTNC  651

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +QRWYHVPRS L PT NLLV+FEE GGDP  ISLVRR   SVC D+ E  P + N+E
Sbjct  652   GEASQRWYHVPRSWLNPTGNLLVVFEESGGDPNGISLVRRETDSVCADIYEWQPTLMNYE  711

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             +++ G+  +  +PK+HL C  GQ IS++KFASFGTP G CGS+++G CHA  SY    + 
Sbjct  712   MQASGKVNKPLRPKVHLECDAGQKISAVKFASFGTPEGVCGSYREGSCHAHHSYDAFNRL  771

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             C+G+  C+V ++   F GDPCP+V+K+L+VE +C+
Sbjct  772   CLGQNFCTVTVAPEMFGGDPCPSVMKKLSVEVICS  806



>ref|XP_006342989.1| PREDICTED: beta-galactosidase-like [Solanum tuberosum]
Length=838

 Score =   249 bits (635),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 125/215 (58%), Positives = 161/215 (75%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             FNAP G++PLALD+++MGKGQVWING+SLGRYW  Y A+GNC  C+YAG F   KC   C
Sbjct  624   FNAPAGNDPLALDLNTMGKGQVWINGQSLGRYWPGYKASGNCGACNYAGWFNEKKCLSNC  683

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +QR YHVPRS L PT NLLVLFEE GG+P  ISLV+R V+SVC D+ E  P + NW+
Sbjct  684   GEASQRMYHVPRSWLYPTGNLLVLFEESGGEPHGISLVKREVASVCADINEWQPQLMNWQ  743

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             +++ G+  +  +PK HL C+ GQ I+SIKFASFGTP G CGSF++G CHA  SY   E+ 
Sbjct  744   MQASGKVDKPLRPKAHLSCASGQKITSIKFASFGTPQGVCGSFREGSCHAFHSYDAFERY  803

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             CIG+  CSV ++   F GDPCP+V+K+L+VE +C+
Sbjct  804   CIGQNSCSVPVTPEIFGGDPCPHVMKKLSVEVICS  838



>ref|XP_004969419.1| PREDICTED: beta-galactosidase 2-like [Setaria italica]
Length=825

 Score =   248 bits (634),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 123/216 (57%), Positives = 153/216 (71%), Gaps = 8/216 (4%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQL  941
             A FNAPDGDEPLALDMSSMGKGQ+WING+ +GRYW  Y A+G C  C Y G +   KCQ 
Sbjct  615   AFFNAPDGDEPLALDMSSMGKGQIWINGQGIGRYWPGYKASGTCGNCDYRGEYDEKKCQT  674

Query  940   GCGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRN  761
              CG  +QRWYHVPRS L PT NLLV+FEE GGDPT IS+V+R+  S+C DV E  P++++
Sbjct  675   NCGDSSQRWYHVPRSWLNPTGNLLVIFEEWGGDPTGISMVKRTTGSICADVSEWQPSMKS  734

Query  760   WEIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLE  581
             W       T++  K K+HL C  G+ I+ IKFASFGTP G+CGS+ +G CHA  SY +  
Sbjct  735   W------HTKDYEKAKVHLQCDHGRKITEIKFASFGTPQGSCGSYSEGTCHAHKSYDIFL  788

Query  580   KKCIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVC  476
             K CIG++RC V++    F GDPCP  +KR  VEA+C
Sbjct  789   KNCIGQERCGVSVVPDVFGGDPCPGTMKRAVVEAIC  824



>gb|KJB56892.1| hypothetical protein B456_009G140800 [Gossypium raimondii]
Length=845

 Score =   248 bits (634),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 121/215 (56%), Positives = 160/215 (74%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             FNAP G+ PLALDM+SMGKGQ+WING+S+GR+W AY A+GNC  C+YAG F+  KC   C
Sbjct  631   FNAPAGNAPLALDMNSMGKGQIWINGQSIGRHWPAYKASGNCGACNYAGTFRENKCGTNC  690

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +QRWYHVPRS L PT NLLV+FEE GGDP  ISLVRR   SVC D+ E  P + N+E
Sbjct  691   GEASQRWYHVPRSWLNPTGNLLVVFEESGGDPNGISLVRRETDSVCADIYEWQPTLMNYE  750

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             +++ G+  +  +PK+HL C  GQ IS++KFASFGTP G CGS+++G CHA  SY    + 
Sbjct  751   MQASGKVNKPLRPKVHLECDAGQKISAVKFASFGTPEGVCGSYREGSCHAHHSYDAFNRL  810

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             C+G+  C+V ++   F GDPCP+V+K+L+VE +C+
Sbjct  811   CLGQNFCTVTVAPEMFGGDPCPSVMKKLSVEVICS  845



>ref|XP_002527409.1| beta-galactosidase, putative [Ricinus communis]
 gb|EEF34975.1| beta-galactosidase, putative [Ricinus communis]
Length=845

 Score =   248 bits (634),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 128/215 (60%), Positives = 155/215 (72%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             FNAP G+ PLALDM SMGKGQVWING+S+GRYW AY A+GNC  C+YAG F   KC   C
Sbjct  631   FNAPAGNSPLALDMGSMGKGQVWINGQSVGRYWPAYKASGNCGVCNYAGTFNEKKCLTNC  690

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +QRWYHVPRS L    NLLV+FEE GGDP  ISLVRR V SVC D+ E  P + N+ 
Sbjct  691   GEASQRWYHVPRSWLNTAGNLLVVFEEWGGDPNGISLVRREVDSVCADIYEWQPTLMNYM  750

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             ++S G+  +  +PK+HL C  GQ IS IKFASFGTP G CGS++QG CHA  SY    + 
Sbjct  751   MQSSGKVNKPLRPKVHLQCGAGQKISLIKFASFGTPEGVCGSYRQGSCHAFHSYDAFNRL  810

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             C+G+  CSV ++   F GDPCPNV+K+L VEAVC+
Sbjct  811   CVGQNWCSVTVAPEMFGGDPCPNVMKKLAVEAVCS  845



>gb|KJB70251.1| hypothetical protein B456_011G065300 [Gossypium raimondii]
Length=846

 Score =   248 bits (634),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 122/215 (57%), Positives = 157/215 (73%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             FNAP G+ PLALDM SMGKGQ+WING+S+GR+W AY A+GNC  C YAG F   KC   C
Sbjct  632   FNAPAGNSPLALDMGSMGKGQIWINGKSIGRHWPAYKASGNCGVCSYAGTFNEKKCGTNC  691

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +QRWYHVPRS L PT NLLV+FEE GGDP  I+LVRR   SVC D+ E  PN+ N+ 
Sbjct  692   GEASQRWYHVPRSWLNPTGNLLVVFEEWGGDPNGITLVRRETDSVCADIYEWQPNLMNYL  751

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             +++ G+  +  +PK+HL C  GQ IS++KFASFGTP G CGS+++G CHA  SY    + 
Sbjct  752   MKASGKVNKPLRPKVHLECDAGQKISAVKFASFGTPEGVCGSYREGSCHAHHSYDAFNRL  811

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             C+G+  CSV ++   F GDPCPNV+K+L+VE +C+
Sbjct  812   CVGQNFCSVTVAPEMFGGDPCPNVMKKLSVEVICS  846



>ref|XP_008805774.1| PREDICTED: beta-galactosidase-like isoform X2 [Phoenix dactylifera]
Length=841

 Score =   248 bits (633),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 127/214 (59%), Positives = 153/214 (71%), Gaps = 8/214 (4%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTA-YATGNCNGCHYAGPFKPPKCQLGC  935
             FNAP G+EPLALDM SMGKGQ+WINGES+GRYW    A G+C  C Y G +   KCQ  C
Sbjct  627   FNAPAGNEPLALDMRSMGKGQIWINGESIGRYWPGNKAYGSCGVCDYRGTYDEKKCQTNC  686

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+P+QRWYHVPRS L PT NLLV+ EE GGDPT IS+V+R V SVC ++ E  P+  NW+
Sbjct  687   GEPSQRWYHVPRSWLNPTGNLLVVLEEWGGDPTGISMVKRKVGSVCAEISEWQPSFNNWK  746

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
              +  GR      PK HL C  GQ ++SIKFASFGTP G CGSF +G CHA  SY + +KK
Sbjct  747   TKGNGR------PKAHLSCPTGQQMTSIKFASFGTPQGACGSFSEGSCHAFHSYDIFQKK  800

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVC  476
             CIG+QRCSV + +  F GDPCP  +K+L VEA+C
Sbjct  801   CIGQQRCSVPVVSEMFGGDPCPGTMKKLAVEAIC  834



>gb|KHF99404.1| Beta-galactosidase 1 -like protein [Gossypium arboreum]
Length=808

 Score =   247 bits (631),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 120/215 (56%), Positives = 159/215 (74%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             FNAP G+ PLALDM+SMGKGQ+WING+S+GR+W AY A+GNC  C+YAG F+  KC   C
Sbjct  594   FNAPAGNAPLALDMNSMGKGQIWINGQSIGRHWPAYKASGNCGACNYAGTFRENKCGTNC  653

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +QRWYHVPRS L PT N LV+FEE GGDP  ISLVRR   SVC D+ E  P + N+E
Sbjct  654   GEASQRWYHVPRSWLNPTGNFLVVFEESGGDPNGISLVRRETDSVCADIYEWQPTLMNYE  713

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             +++ G+  +  +PK+HL C  GQ IS++KFASFGTP G CGS+++G CHA  SY    + 
Sbjct  714   MQASGKVNKPLRPKVHLECDAGQKISAVKFASFGTPEGVCGSYREGSCHAHHSYDAFNRL  773

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             C+G+  C+V ++   F GDPCP+V+K+L+VE +C+
Sbjct  774   CLGQNFCTVTVAPEMFGGDPCPSVMKKLSVEVICS  808



>ref|XP_008775429.1| PREDICTED: beta-galactosidase 2-like [Phoenix dactylifera]
Length=832

 Score =   247 bits (631),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 125/216 (58%), Positives = 156/216 (72%), Gaps = 9/216 (4%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQL  941
             A FNAP+G+EPLALDMSSMGKGQVWING+S+GRYW  Y A G C+ C Y G +   KCQ 
Sbjct  623   AFFNAPEGNEPLALDMSSMGKGQVWINGQSIGRYWPGYKAYGTCSNCDYRGEYDEKKCQT  682

Query  940   GCGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRN  761
              CG+ +Q+WYHVPRS L PT NLLVLFEE GGDP  IS+V+R++ SVC D+ E  P ++N
Sbjct  683   NCGESSQKWYHVPRSWLNPTGNLLVLFEEWGGDPKGISMVKRTIGSVCADISEWQPAMKN  742

Query  760   WEIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLE  581
             W      RT++  + K+HL C PG+ ++ IKFASFGTP G CGSF +G CHA  SY   E
Sbjct  743   W------RTKDYERSKVHLSCDPGRKVTKIKFASFGTPQGVCGSFSEGSCHAHESYDAFE  796

Query  580   KKCIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVC  476
              KC+G+++CSV I    F GDPCP  +KR+ VEA+C
Sbjct  797   -KCVGQEKCSVTIVPEVFGGDPCPGTMKRIAVEALC  831



>ref|XP_010939579.1| PREDICTED: beta-galactosidase 2-like [Elaeis guineensis]
Length=833

 Score =   247 bits (631),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 124/216 (57%), Positives = 153/216 (71%), Gaps = 8/216 (4%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQL  941
             A FNAP+G+EPLA+DMSSMGKGQVWING+S+GRYW  Y A G C  C Y G +   KCQ 
Sbjct  623   AFFNAPEGNEPLAIDMSSMGKGQVWINGQSIGRYWPGYKAYGTCGNCDYRGEYDEKKCQT  682

Query  940   GCGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRN  761
              CG+ +Q WYHVPRS L PT NLLV+FEE GGDP  IS+V+R+V S C D+ E  P ++N
Sbjct  683   NCGESSQIWYHVPRSWLNPTGNLLVVFEEWGGDPKGISMVKRTVGSACADISEWQPAMKN  742

Query  760   WEIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLE  581
             W  ++YGR+      K+HL C  G+ I+ IKFASFGTP G CGSF +G CHA  SY   E
Sbjct  743   WHTKNYGRS------KVHLSCDHGRKITKIKFASFGTPQGVCGSFSEGSCHAHESYDAFE  796

Query  580   KKCIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVC  476
             K C+G+++CSV I    F GDPCP  +KR+ VEA+C
Sbjct  797   KNCVGQEKCSVTIVPEVFGGDPCPGTMKRIAVEALC  832



>ref|XP_008672351.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 tpg|DAA58688.1| TPA: hypothetical protein ZEAMMB73_223728 [Zea mays]
Length=830

 Score =   247 bits (631),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 124/216 (57%), Positives = 151/216 (70%), Gaps = 8/216 (4%)
 Frame = -3

Query  1117  ARFNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQL  941
             A FNAPDGDEPLALDMSSMGKGQ+WING+ +GRYW  Y A+G C  C Y G +   KCQ 
Sbjct  620   AFFNAPDGDEPLALDMSSMGKGQIWINGQGIGRYWPGYKASGTCGICDYRGEYDEKKCQT  679

Query  940   GCGQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRN  761
              CG  +QRWYHVPRS L PT NLLV+FEE GGDPT IS+V+R   S+C DV E  P++ N
Sbjct  680   NCGDSSQRWYHVPRSWLNPTGNLLVIFEEWGGDPTGISMVKRIAGSICADVSEWQPSMAN  739

Query  760   WEIESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLE  581
             W      RT+   K K+HL C  G+ ++ IKFASFGTP G+CGS+ +G CHA  SY +  
Sbjct  740   W------RTKGYEKAKVHLQCDHGRKMTHIKFASFGTPQGSCGSYSEGGCHAHKSYDIFW  793

Query  580   KKCIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVC  476
             K CIG++RC V++    F GDPCP  +KR  VEA+C
Sbjct  794   KSCIGQERCGVSVVPDAFGGDPCPGTMKRAVVEAIC  829



>ref|XP_010542431.1| PREDICTED: beta-galactosidase 1-like [Tarenaya hassleriana]
Length=847

 Score =   247 bits (630),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 123/215 (57%), Positives = 159/215 (74%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             F+ P G+ PLA+DM SMGKGQ+WING+SLGRYW AY A+G+C+ C YAG F   KC   C
Sbjct  633   FSGPTGNSPLAIDMGSMGKGQIWINGQSLGRYWPAYKASGSCSECSYAGSFDENKCLRNC  692

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +QRWYHVPRS LKP+ NLLV+FEE GGDP  ISLVRR V SVC D+ E  P + N+E
Sbjct  693   GEASQRWYHVPRSWLKPSGNLLVVFEEWGGDPNGISLVRREVDSVCADIYEWQPTLMNYE  752

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             +++ G+  +  +PK+HL C  GQ +S++KFASFGTP GTCGS+++G CHA  SY    + 
Sbjct  753   MQASGKVNKPLRPKVHLQCGDGQKMSAVKFASFGTPEGTCGSYREGSCHALHSYDAFNRV  812

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             C+G+  CSV ++   F GDPCPNV+K+L VE VC+
Sbjct  813   CVGQNWCSVTVAPEMFGGDPCPNVMKKLAVEVVCS  847



>ref|NP_187988.1| beta galactosidase 1 [Arabidopsis thaliana]
 sp|Q9SCW1.1|BGAL1_ARATH RecName: Full=Beta-galactosidase 1; Short=Lactase 1; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAB64737.1| putative beta-galactosidase [Arabidopsis thaliana]
 dbj|BAB01923.1| beta-galactosidase [Arabidopsis thaliana]
 gb|AEE75407.1| beta galactosidase 1 [Arabidopsis thaliana]
Length=847

 Score =   246 bits (629),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 124/215 (58%), Positives = 156/215 (73%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             F+AP GD PLA+DM SMGKGQ+WING+SLGR+W AY A G+C+ C Y G F+  KC   C
Sbjct  633   FSAPAGDSPLAVDMGSMGKGQIWINGQSLGRHWPAYKAVGSCSECSYTGTFREDKCLRNC  692

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +QRWYHVPRS LKP+ NLLV+FEE GGDP  I+LVRR V SVC D+ E    + N++
Sbjct  693   GEASQRWYHVPRSWLKPSGNLLVVFEEWGGDPNGITLVRREVDSVCADIYEWQSTLVNYQ  752

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             + + G+  +   PK HL C PGQ I+++KFASFGTP GTCGS++QG CHA  SY    K 
Sbjct  753   LHASGKVNKPLHPKAHLQCGPGQKITTVKFASFGTPEGTCGSYRQGSCHAHHSYDAFNKL  812

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             C+G+  CSV ++   F GDPCPNV+K+L VEAVC 
Sbjct  813   CVGQNWCSVTVAPEMFGGDPCPNVMKKLAVEAVCA  847



>gb|AAM13196.1| galactosidase, putative [Arabidopsis thaliana]
Length=847

 Score =   246 bits (629),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 124/215 (58%), Positives = 156/215 (73%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             F+AP GD PLA+DM SMGKGQ+WING+SLGR+W AY A G+C+ C Y G F+  KC   C
Sbjct  633   FSAPAGDSPLAVDMGSMGKGQIWINGQSLGRHWPAYKAVGSCSECSYTGTFREDKCLRNC  692

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +QRWYHVPRS LKP+ NLLV+FEE GGDP  I+LVRR V SVC D+ E    + N++
Sbjct  693   GEASQRWYHVPRSWLKPSGNLLVVFEEWGGDPNGITLVRREVDSVCADIYEWQSTLVNYQ  752

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             + + G+  +   PK HL C PGQ I+++KFASFGTP GTCGS++QG CHA  SY    K 
Sbjct  753   LHASGKVNKPLHPKAHLQCGPGQKITTVKFASFGTPEGTCGSYRQGSCHAHHSYDAFNKL  812

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             C+G+  CSV ++   F GDPCPNV+K+L VEAVC 
Sbjct  813   CVGQNWCSVTVAPEMFGGDPCPNVMKKLAVEAVCA  847



>emb|CDY37486.1| BnaC01g37460D [Brassica napus]
Length=839

 Score =   246 bits (628),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 124/215 (58%), Positives = 154/215 (72%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             F+AP GD PLA+DM SMGKGQ+WING+S+GR+W AY A G C  C Y G F   KC   C
Sbjct  625   FSAPAGDSPLAVDMGSMGKGQIWINGQSVGRHWPAYKAVGTCRECSYIGTFNENKCLRNC  684

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +QRWYHVPRS LKPT NLLV+FEE GGDP  ISLVRR V +VC D+ E    + N++
Sbjct  685   GEASQRWYHVPRSWLKPTGNLLVVFEEWGGDPNGISLVRREVDTVCADIYEWQSTLVNYQ  744

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             + + G+  +   PK+HL C PGQ I+++KFASFGTP GTCGS++QG CHA  SY    + 
Sbjct  745   LHASGKVNKPLHPKVHLQCGPGQKITTVKFASFGTPQGTCGSYRQGSCHAHHSYDAFNRL  804

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             CIG+  CSV ++   F GDPCPNV+K+L VEAVC 
Sbjct  805   CIGQNWCSVTVAPAMFGGDPCPNVMKKLAVEAVCA  839



>gb|KHG25378.1| Beta-galactosidase 1 -like protein [Gossypium arboreum]
Length=843

 Score =   246 bits (627),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 119/215 (55%), Positives = 157/215 (73%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             FNAP G+ PLALDM SMGKGQ+WING+S+GR+W AY A+GNC+ C+YAG +   KC+  C
Sbjct  629   FNAPTGNAPLALDMRSMGKGQIWINGQSIGRHWPAYKASGNCSVCNYAGTYDEYKCRTNC  688

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +QRWYHVPRS L PT NLLV+ EE GGDP  ISLV R   SVC D+ E  P + N++
Sbjct  689   GEASQRWYHVPRSWLNPTGNLLVVIEEWGGDPNAISLVHRETDSVCADIYEWQPTLMNYQ  748

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             + + G+  +  +PK+HL C  GQ IS++KFASFGTP G CGS+++G CHA  SY    + 
Sbjct  749   MHASGKADKPLRPKVHLECDMGQKISAVKFASFGTPEGVCGSYREGSCHAYHSYDAFNRL  808

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             C+G+  CSV ++   F GDPCPNV+K+L+VE +C+
Sbjct  809   CVGQNFCSVTVAPEMFGGDPCPNVMKKLSVEVICS  843



>ref|XP_009117469.1| PREDICTED: beta-galactosidase 1-like [Brassica rapa]
Length=839

 Score =   246 bits (627),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 123/215 (57%), Positives = 155/215 (72%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             F+AP GD PLA+DM SMGKGQ+WING+S+GR+W AY A G C  C Y G F   KC   C
Sbjct  625   FSAPAGDSPLAVDMGSMGKGQIWINGQSVGRHWPAYKAVGTCRECSYIGTFNENKCLRNC  684

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +QRWYHVPRS LKPT NLLV+FEE GGDP  ISLVRR V +VC D+ E    + N++
Sbjct  685   GEASQRWYHVPRSWLKPTGNLLVVFEEWGGDPNGISLVRREVDTVCADIYEWQSTLVNYQ  744

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             + + G+  +   PK+HL C PGQ I+++KFASFGTP GTCGS++QG CHA  SY    + 
Sbjct  745   LHASGKVNKPLHPKVHLQCGPGQKITTVKFASFGTPQGTCGSYRQGSCHAHHSYDAFNRL  804

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             C+G+  CSV ++   F GDPCPNV+K+L+VEAVC 
Sbjct  805   CVGQNWCSVTVAPAMFGGDPCPNVMKKLSVEAVCA  839



>ref|XP_010047575.1| PREDICTED: beta-galactosidase-like [Eucalyptus grandis]
 gb|KCW79521.1| hypothetical protein EUGRSUZ_C00898 [Eucalyptus grandis]
Length=874

 Score =   246 bits (627),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 124/215 (58%), Positives = 160/215 (74%), Gaps = 3/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             F+AP+GD+PLALDMSSMGKGQ+WING+S+GR+W +Y A G+C  C+YAG F   KC+  C
Sbjct  642   FDAPEGDDPLALDMSSMGKGQIWINGQSIGRHWPSYVAGGSCGECNYAGIFVENKCRTNC  701

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             GQP+QRWYH+PRS L PT NLLV+FEE GG+P  ISLV+R   SVC D+ +  P +++  
Sbjct  702   GQPSQRWYHIPRSWLNPTANLLVVFEEWGGEPAGISLVKRMTGSVCADIFDGQPALKDRH  761

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             + S G++     PK+HL C  GQ IS IKFAS+G P GTCG++Q+GPCHA  SY  L K 
Sbjct  762   LVSSGKSNS-TYPKVHLTCPRGQEISEIKFASYGLPQGTCGNYQEGPCHAHRSYDALRKN  820

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             CIG+Q CSV ++   F GDPCPN  K+L+VEA+C+
Sbjct  821   CIGKQLCSVTVAPEVFGGDPCPNSEKKLSVEAICS  855



>emb|CDY51738.1| BnaA01g37210D [Brassica napus]
Length=839

 Score =   245 bits (626),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 123/215 (57%), Positives = 154/215 (72%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             F+AP GD PLA+DM SMGKGQ+WING+S+GR+W AY A G C  C Y G F   KC   C
Sbjct  625   FSAPAGDSPLAVDMGSMGKGQIWINGQSVGRHWPAYKAVGTCRECSYIGTFNENKCLRNC  684

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +QRWYHVPRS LKPT NLLV+FEE GGDP  ISLVRR V +VC D+ E    + N++
Sbjct  685   GEASQRWYHVPRSWLKPTGNLLVVFEEWGGDPNGISLVRREVDTVCADIYEWQSTLVNYQ  744

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             + + G+  +   PK+HL C PGQ I+++KFASFGTP GTCGS++QG CHA  SY    + 
Sbjct  745   LHASGKVNKPLHPKVHLQCGPGQKITTVKFASFGTPQGTCGSYRQGSCHAHHSYDAFNRL  804

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             C+G+  CSV ++   F GDPCPNV+K+L VEAVC 
Sbjct  805   CVGQNWCSVTVAPAMFGGDPCPNVMKKLAVEAVCA  839



>ref|XP_006407174.1| hypothetical protein EUTSA_v10020056mg [Eutrema salsugineum]
 gb|ESQ48627.1| hypothetical protein EUTSA_v10020056mg [Eutrema salsugineum]
Length=846

 Score =   245 bits (626),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 124/215 (58%), Positives = 156/215 (73%), Gaps = 2/215 (1%)
 Frame = -3

Query  1111  FNAPDGDEPLALDMSSMGKGQVWINGESLGRYWTAY-ATGNCNGCHYAGPFKPPKCQLGC  935
             F+AP GD PLA+DM SMGKGQ+WING+S+GR+W AY A G+C+ C Y G F   KC   C
Sbjct  632   FSAPAGDSPLAVDMGSMGKGQIWINGQSVGRHWPAYKAVGSCSECSYKGTFNENKCLRNC  691

Query  934   GQPTQRWYHVPRSLLKPTENLLVLFEELGGDPTrislvrrsvssVCGDVGEIHPNIRNWE  755
             G+ +QRWYHVPRS LKPT NLLV+FEE GGDP  ISLVRR V SVC D+ E    + N++
Sbjct  692   GEASQRWYHVPRSWLKPTGNLLVVFEEWGGDPNGISLVRREVDSVCADIYEWQSTLVNYQ  751

Query  754   IESYGRTQELPKPKLHLHCSPGQSISSIKFASFGTPLGTCGSFQQGPCHASTSYSVLEKK  575
             + + G+  +   PK+HL C PGQ I+++KFASFGTP GTCGS++QG CHA  SY    + 
Sbjct  752   LHASGKVNKPLHPKVHLQCGPGQKITTVKFASFGTPEGTCGSYRQGSCHAHHSYDAFNRL  811

Query  574   CIGRQRCSVAISNTNF-GDPCPNVVKRLTVEAVCT  473
             C+G+  CSV ++   F GDPCPNV+K+L VEAVC 
Sbjct  812   CVGQNWCSVTVAPAMFGGDPCPNVMKKLAVEAVCA  846



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3515757891489