BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig3938

Length=1030
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009608204.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      345   5e-112   Nicotiana tomentosiformis
ref|XP_009616292.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      344   2e-111   Nicotiana tomentosiformis
ref|XP_009783247.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      344   2e-111   Nicotiana sylvestris
ref|XP_009768456.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      341   3e-110   Nicotiana sylvestris
ref|XP_006360928.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      337   9e-109   Solanum tuberosum [potatoes]
ref|XP_004247883.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           337   1e-108   Solanum lycopersicum
emb|CDP21869.1|  unnamed protein product                                336   2e-108   Coffea canephora [robusta coffee]
ref|XP_011084213.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           333   2e-107   Sesamum indicum [beniseed]
ref|XP_006349916.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      333   3e-107   Solanum tuberosum [potatoes]
ref|XP_004239852.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      330   2e-106   Solanum lycopersicum
ref|XP_012071089.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           329   1e-105   Jatropha curcas
ref|XP_002522810.1|  UDP-glucuronate 5-epimerase, putative              327   1e-105   
ref|XP_010243459.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      328   5e-105   Nelumbo nucifera [Indian lotus]
ref|XP_008380476.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           327   7e-105   Malus domestica [apple tree]
ref|XP_006365466.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      326   1e-104   Solanum tuberosum [potatoes]
ref|XP_009373545.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           326   3e-104   Pyrus x bretschneideri [bai li]
ref|XP_010274074.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      325   5e-104   Nelumbo nucifera [Indian lotus]
ref|XP_006421024.1|  hypothetical protein CICLE_v10004881mg             325   1e-103   Citrus clementina [clementine]
ref|XP_006492536.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      325   1e-103   Citrus sinensis [apfelsine]
ref|XP_011003624.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      323   2e-103   Populus euphratica
ref|XP_002265088.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           323   3e-103   Vitis vinifera
ref|XP_007223132.1|  hypothetical protein PRUPE_ppa005434mg             323   3e-103   Prunus persica
ref|XP_002298679.1|  UDP-D-GLUCURONATE 4-EPIMERASE 6 family protein     323   3e-103   Populus trichocarpa [western balsam poplar]
ref|XP_011042175.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      323   4e-103   Populus euphratica
ref|XP_004502237.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      322   7e-103   Cicer arietinum [garbanzo]
ref|XP_010527460.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...    321   2e-102   Tarenaya hassleriana [spider flower]
ref|XP_003601662.1|  UDP-D-glucuronic acid 4-epimerase                  320   3e-102   Medicago truncatula
emb|CDX77481.1|  BnaA07g06190D                                          319   1e-101   
ref|XP_010093344.1|  UDP-glucuronate 4-epimerase 6                      319   1e-101   Morus notabilis
gb|AFK49564.1|  unknown                                                 318   1e-101   Medicago truncatula
emb|CDX85133.1|  BnaC07g07730D                                          318   2e-101   
ref|XP_010532756.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           318   2e-101   Tarenaya hassleriana [spider flower]
ref|XP_009102574.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           318   2e-101   Brassica rapa
ref|XP_004297013.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           318   2e-101   Fragaria vesca subsp. vesca
emb|CDX92990.1|  BnaA03g37120D                                          318   3e-101   
emb|CDY53207.1|  BnaC03g74010D                                          318   3e-101   Brassica napus [oilseed rape]
ref|XP_009106288.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           318   3e-101   Brassica rapa
emb|CDY64583.1|  BnaCnng44170D                                          318   4e-101   Brassica napus [oilseed rape]
emb|CDY18087.1|  BnaA01g23480D                                          317   5e-101   Brassica napus [oilseed rape]
gb|KFK39681.1|  hypothetical protein AALP_AA3G275400                    317   6e-101   Arabis alpina [alpine rockcress]
emb|CAN83418.1|  hypothetical protein VITISV_041351                     317   6e-101   Vitis vinifera
gb|ADB24769.1|  UDP-D-glucuronic acid 4-epimerase                       317   8e-101   Gossypium hirsutum [American cotton]
ref|XP_009135867.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      316   1e-100   Brassica rapa
gb|KJB72008.1|  hypothetical protein B456_011G153500                    315   3e-100   Gossypium raimondii
ref|XP_004138968.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           315   5e-100   Cucumis sativus [cucumbers]
ref|XP_007034225.1|  UDP-D-glucuronate 4-epimerase 6                    315   5e-100   Theobroma cacao [chocolate]
ref|XP_006297629.1|  hypothetical protein CARUB_v10013650mg             315   6e-100   Capsella rubella
gb|AAN60250.1|  unknown                                                 315   6e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010488461.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           315   6e-100   Camelina sativa [gold-of-pleasure]
ref|XP_006418833.1|  hypothetical protein EUTSA_v10002521mg             315   6e-100   Eutrema salsugineum [saltwater cress]
dbj|BAE71216.1|  putative NAD dependent epimerase                       314   7e-100   Trifolium pratense [peavine clover]
ref|NP_189024.1|  UDP-D-glucuronate 4-epimerase 6                       314   7e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002883465.1|  hypothetical protein ARALYDRAFT_898926             315   7e-100   Arabidopsis lyrata subsp. lyrata
ref|XP_008457221.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           314   9e-100   Cucumis melo [Oriental melon]
ref|XP_010468437.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      312   5e-99    Camelina sativa [gold-of-pleasure]
gb|KDO42082.1|  hypothetical protein CISIN_1g011841mg                   313   5e-99    Citrus sinensis [apfelsine]
ref|XP_003538527.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      311   2e-98    Glycine max [soybeans]
gb|ADB24770.1|  UDP-D-glucuronic acid 4-epimerase                       310   2e-98    Gossypium hirsutum [American cotton]
ref|XP_003524930.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-lik...    308   9e-98    Glycine max [soybeans]
ref|XP_010673389.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           308   2e-97    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010023657.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           303   2e-95    Eucalyptus grandis [rose gum]
ref|XP_007163818.1|  hypothetical protein PHAVU_001G267000g             302   2e-95    Phaseolus vulgaris [French bean]
ref|XP_006373087.1|  hypothetical protein POPTR_0017s08580g             302   5e-95    
ref|XP_003532740.2|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      303   6e-95    Glycine max [soybeans]
gb|AGV54436.1|  UDP-D-glucuronic acid 4-epimerase                       300   2e-94    Phaseolus vulgaris [French bean]
gb|AHA84281.1|  UDP-glucuronate 4-epimerase 6                           293   1e-91    Phaseolus vulgaris [French bean]
ref|XP_006580148.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-lik...    289   1e-90    
gb|EYU31498.1|  hypothetical protein MIMGU_mgv1a008581mg                287   2e-90    Erythranthe guttata [common monkey flower]
gb|ABR16292.1|  unknown                                                 288   7e-90    Picea sitchensis
ref|XP_009133725.1|  PREDICTED: UDP-glucuronate 4-epimerase 4           287   2e-89    Brassica rapa
emb|CDY67756.1|  BnaA03g56770D                                          287   2e-89    Brassica napus [oilseed rape]
emb|CDX95646.1|  BnaC03g25270D                                          286   4e-89    
ref|XP_002301280.2|  hypothetical protein POPTR_0002s14750g             283   4e-88    Populus trichocarpa [western balsam poplar]
ref|XP_006295696.1|  hypothetical protein CARUB_v10024814mg             283   5e-88    Capsella rubella
gb|ABK25339.1|  unknown                                                 283   6e-88    Picea sitchensis
ref|XP_011034154.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           283   8e-88    Populus euphratica
ref|XP_010506472.1|  PREDICTED: UDP-glucuronate 4-epimerase 4           283   1e-87    Camelina sativa [gold-of-pleasure]
ref|XP_010506473.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like      282   1e-87    
ref|XP_009781927.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      281   1e-87    Nicotiana sylvestris
ref|XP_011017483.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      281   4e-87    Populus euphratica
ref|XP_006397710.1|  hypothetical protein EUTSA_v10001454mg             281   4e-87    Eutrema salsugineum [saltwater cress]
ref|XP_006848494.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           281   5e-87    Amborella trichopoda
ref|XP_002320057.1|  UDP-D-GLUCURONATE 4-EPIMERASE 3 family protein     280   6e-87    Populus trichocarpa [western balsam poplar]
dbj|BAF00333.1|  putative nucleotide sugar epimerase                    275   6e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004248561.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      280   7e-87    Solanum lycopersicum
ref|XP_002880171.1|  UDP-D-glucuronate 4-epimerase 4                    280   7e-87    Arabidopsis lyrata subsp. lyrata
ref|XP_004234942.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      279   8e-87    Solanum lycopersicum
ref|NP_182056.1|  UDP-D-glucuronate 4-epimerase 4                       280   9e-87    Arabidopsis thaliana [mouse-ear cress]
gb|KHN25558.1|  UDP-glucuronate 4-epimerase 3                           274   1e-86    Glycine soja [wild soybean]
emb|CDP09891.1|  unnamed protein product                                280   1e-86    Coffea canephora [robusta coffee]
ref|XP_006837081.1|  PREDICTED: UDP-glucuronate 4-epimerase 2           279   2e-86    Amborella trichopoda
ref|XP_010508183.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like      279   2e-86    Camelina sativa [gold-of-pleasure]
gb|EYU31982.1|  hypothetical protein MIMGU_mgv1a012102mg                273   2e-86    Erythranthe guttata [common monkey flower]
emb|CDO97699.1|  unnamed protein product                                279   3e-86    Coffea canephora [robusta coffee]
ref|XP_009111519.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           278   3e-86    Brassica rapa
ref|XP_001761086.1|  predicted protein                                  278   5e-86    
ref|XP_002280967.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           278   5e-86    
ref|XP_006345514.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      278   6e-86    Solanum tuberosum [potatoes]
ref|XP_010544649.1|  PREDICTED: UDP-glucuronate 4-epimerase 4           278   7e-86    Tarenaya hassleriana [spider flower]
emb|CAN73016.1|  hypothetical protein VITISV_004388                     277   8e-86    Vitis vinifera
gb|KGN57287.1|  hypothetical protein Csa_3G176330                       271   9e-86    Cucumis sativus [cucumbers]
ref|XP_010906178.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      278   1e-85    Elaeis guineensis
ref|XP_009380772.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      277   1e-85    Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH16056.1|  UDP-D-glucuronate 4-epimerase                           276   1e-85    Medicago truncatula
ref|XP_008792930.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      278   1e-85    Phoenix dactylifera
ref|XP_006365249.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      276   1e-85    Solanum tuberosum [potatoes]
ref|XP_004513504.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      276   2e-85    Cicer arietinum [garbanzo]
ref|XP_003521958.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      277   2e-85    Glycine max [soybeans]
ref|XP_009621323.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      276   2e-85    Nicotiana tomentosiformis
ref|XP_008794651.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...    277   2e-85    Phoenix dactylifera
ref|XP_009386871.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      277   2e-85    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007052086.1|  UDP-D-glucuronate 4-epimerase 3                    276   3e-85    
ref|XP_004240046.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      276   3e-85    Solanum lycopersicum
ref|XP_009614886.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      276   3e-85    Nicotiana tomentosiformis
gb|AAM61323.1|  nucleotide sugar epimerase, putative                    275   3e-85    Arabidopsis thaliana [mouse-ear cress]
emb|CDY63064.1|  BnaAnng18570D                                          276   4e-85    Brassica napus [oilseed rape]
ref|XP_009784108.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      276   4e-85    Nicotiana sylvestris
ref|XP_010929207.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           276   4e-85    Elaeis guineensis
ref|XP_002993206.1|  hypothetical protein SELMODRAFT_136684             276   4e-85    
ref|XP_002965479.1|  hypothetical protein SELMODRAFT_84174              276   4e-85    
ref|XP_007218024.1|  hypothetical protein PRUPE_ppa005953mg             276   4e-85    Prunus persica
ref|XP_008438174.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           275   4e-85    Cucumis melo [Oriental melon]
ref|NP_171702.1|  UDP-D-glucuronate 4-epimerase 2                       275   5e-85    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011650790.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           275   5e-85    Cucumis sativus [cucumbers]
gb|ADB24771.1|  UDP-D-glucuronic acid 4-epimerase                       275   7e-85    Gossypium hirsutum [American cotton]
ref|XP_002962217.1|  hypothetical protein SELMODRAFT_77268              275   7e-85    Selaginella moellendorffii
gb|KFK42571.1|  hypothetical protein AALP_AA1G012900                    275   8e-85    Arabis alpina [alpine rockcress]
ref|XP_010053904.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           275   8e-85    Eucalyptus grandis [rose gum]
gb|KDP25603.1|  hypothetical protein JCGZ_20759                         275   9e-85    Jatropha curcas
ref|XP_002965131.1|  hypothetical protein SELMODRAFT_266836             275   9e-85    
ref|XP_002892033.1|  UDP-D-glucuronate 4-epimerase 2                    275   9e-85    Arabidopsis lyrata subsp. lyrata
ref|XP_012087106.1|  PREDICTED: UDP-glucuronate 4-epimerase 5           275   1e-84    Jatropha curcas
ref|XP_012083592.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           275   1e-84    Jatropha curcas
gb|KJB09908.1|  hypothetical protein B456_001G174300                    275   1e-84    Gossypium raimondii
ref|XP_009596624.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           274   1e-84    Nicotiana tomentosiformis
gb|KDP28767.1|  hypothetical protein JCGZ_14538                         274   2e-84    Jatropha curcas
ref|XP_010426564.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           274   2e-84    Camelina sativa [gold-of-pleasure]
gb|KHN17533.1|  UDP-glucuronate 4-epimerase 1                           268   2e-84    Glycine soja [wild soybean]
ref|XP_010098924.1|  UDP-glucuronate 4-epimerase 3                      274   2e-84    Morus notabilis
ref|XP_006347877.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      274   2e-84    Solanum tuberosum [potatoes]
ref|XP_010523080.1|  PREDICTED: UDP-glucuronate 4-epimerase 3 iso...    273   2e-84    Tarenaya hassleriana [spider flower]
ref|XP_006445275.1|  hypothetical protein CICLE_v10020187mg             274   3e-84    Citrus clementina [clementine]
ref|XP_006396209.1|  hypothetical protein EUTSA_v10028667mg             273   3e-84    Eutrema salsugineum [saltwater cress]
ref|XP_009781950.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      273   3e-84    Nicotiana sylvestris
ref|XP_006287814.1|  hypothetical protein CARUB_v10001027mg             273   3e-84    Capsella rubella
ref|XP_003517038.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      273   3e-84    Glycine max [soybeans]
ref|XP_010914055.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           273   3e-84    Elaeis guineensis
ref|XP_007134861.1|  hypothetical protein PHAVU_010G082300g             273   4e-84    Phaseolus vulgaris [French bean]
ref|XP_009409770.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      273   4e-84    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008781382.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      273   5e-84    Phoenix dactylifera
gb|KFK30589.1|  hypothetical protein AALP_AA6G001300                    273   5e-84    Arabis alpina [alpine rockcress]
ref|XP_011090565.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      272   6e-84    Sesamum indicum [beniseed]
ref|XP_008238641.1|  PREDICTED: UDP-glucuronate 4-epimerase 5           272   7e-84    Prunus mume [ume]
ref|XP_010905148.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      273   7e-84    Elaeis guineensis
ref|XP_011069826.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           272   9e-84    Sesamum indicum [beniseed]
ref|XP_004229804.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           272   1e-83    Solanum lycopersicum
ref|XP_010419541.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      271   1e-83    Camelina sativa [gold-of-pleasure]
ref|XP_002266529.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like      271   1e-83    Vitis vinifera
ref|XP_008794398.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           271   1e-83    Phoenix dactylifera
ref|XP_009412723.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      273   1e-83    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002528222.1|  UDP-glucuronate 5-epimerase, putative              271   1e-83    Ricinus communis
ref|XP_004148129.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      271   2e-83    Cucumis sativus [cucumbers]
ref|XP_009417460.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           271   2e-83    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010540291.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      270   2e-83    Tarenaya hassleriana [spider flower]
gb|KJB41101.1|  hypothetical protein B456_007G090500                    271   2e-83    Gossypium raimondii
gb|EPS72617.1|  hypothetical protein M569_02133                         271   2e-83    Genlisea aurea
ref|XP_009390535.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      271   2e-83    
ref|XP_008354844.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           271   2e-83    
ref|XP_010661665.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      271   2e-83    Vitis vinifera
ref|XP_006453511.1|  hypothetical protein CICLE_v10008355mg             271   2e-83    Citrus clementina [clementine]
ref|XP_011093361.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      271   2e-83    Sesamum indicum [beniseed]
ref|XP_001769370.1|  predicted protein                                  271   2e-83    
gb|EPS60141.1|  hypothetical protein M569_14661                         270   3e-83    Genlisea aurea
ref|XP_006359203.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      270   4e-83    Solanum tuberosum [potatoes]
ref|XP_009411848.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      271   4e-83    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007209167.1|  hypothetical protein PRUPE_ppa006148mg             270   4e-83    
ref|XP_010687680.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           270   4e-83    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008351675.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           270   4e-83    
ref|XP_009342752.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           270   5e-83    Pyrus x bretschneideri [bai li]
ref|XP_002281007.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      270   5e-83    Vitis vinifera
ref|XP_007013947.1|  UDP-D-glucuronate 4-epimerase 1                    270   6e-83    
ref|XP_011010511.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      270   6e-83    Populus euphratica
gb|KEH32594.1|  UDP-D-glucuronate 4-epimerase                           270   7e-83    Medicago truncatula
ref|XP_010268405.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      270   8e-83    Nelumbo nucifera [Indian lotus]
gb|KJB24820.1|  hypothetical protein B456_004G162700                    270   9e-83    Gossypium raimondii
ref|XP_006648037.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      270   9e-83    Oryza brachyantha
ref|XP_008364369.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           270   1e-82    
ref|XP_009586623.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           269   1e-82    Nicotiana tomentosiformis
ref|XP_009591830.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           269   1e-82    Nicotiana tomentosiformis
ref|NP_001048359.1|  Os02g0791500                                       269   1e-82    
ref|XP_004954186.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      269   1e-82    Setaria italica
dbj|BAJ85817.1|  predicted protein                                      269   1e-82    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007154841.1|  hypothetical protein PHAVU_003G152300g             269   1e-82    Phaseolus vulgaris [French bean]
ref|XP_004506538.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      269   1e-82    Cicer arietinum [garbanzo]
ref|XP_002309376.1|  hypothetical protein POPTR_0006s19240g             269   1e-82    Populus trichocarpa [western balsam poplar]
gb|KHN30291.1|  UDP-glucuronate 4-epimerase 1                           266   2e-82    Glycine soja [wild soybean]
ref|XP_008222861.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           269   2e-82    Prunus mume [ume]
ref|NP_191922.1|  UDP-D-glucuronate 4-epimerase 3                       269   2e-82    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004306933.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           268   2e-82    Fragaria vesca subsp. vesca
ref|XP_003605138.1|  UDP-glucuronate 4-epimerase                        269   2e-82    Medicago truncatula
ref|XP_009800153.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           268   2e-82    Nicotiana sylvestris
ref|XP_003549520.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      268   3e-82    Glycine max [soybeans]
ref|XP_010278008.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           268   4e-82    Nelumbo nucifera [Indian lotus]
gb|KJB76605.1|  hypothetical protein B456_012G096800                    268   4e-82    Gossypium raimondii
ref|XP_012071600.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           268   4e-82    Jatropha curcas
ref|XP_008223573.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           268   5e-82    Prunus mume [ume]
ref|XP_007222381.1|  hypothetical protein PRUPE_ppa006006mg             268   5e-82    Prunus persica
ref|XP_009408344.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      268   5e-82    Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO62346.1|  hypothetical protein CISIN_1g043169mg                   267   5e-82    Citrus sinensis [apfelsine]
ref|XP_003570280.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           268   5e-82    Brachypodium distachyon [annual false brome]
ref|XP_004507780.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      268   5e-82    Cicer arietinum [garbanzo]
ref|XP_010662214.1|  PREDICTED: UDP-glucuronate 4-epimerase 5           265   5e-82    Vitis vinifera
ref|XP_008465609.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           267   7e-82    Cucumis melo [Oriental melon]
ref|XP_010323223.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           267   7e-82    Solanum lycopersicum
ref|XP_010692224.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           268   8e-82    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006343570.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      267   8e-82    Solanum tuberosum [potatoes]
ref|XP_006350062.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      266   1e-81    Solanum tuberosum [potatoes]
ref|XP_010676680.1|  PREDICTED: UDP-glucuronate 4-epimerase 4           267   1e-81    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004298689.1|  PREDICTED: UDP-glucuronate 4-epimerase 4           266   1e-81    Fragaria vesca subsp. vesca
ref|XP_003519171.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      266   1e-81    Glycine max [soybeans]
gb|ACJ11754.1|  UDP-D-glucuronic acid 4-epimerase                       266   1e-81    Gossypium hirsutum [American cotton]
ref|XP_010103125.1|  UDP-glucuronate 4-epimerase 1                      266   1e-81    Morus notabilis
ref|XP_002452964.1|  hypothetical protein SORBIDRAFT_04g035630          266   1e-81    Sorghum bicolor [broomcorn]
gb|EYU30554.1|  hypothetical protein MIMGU_mgv1a006591mg                266   1e-81    Erythranthe guttata [common monkey flower]
ref|XP_001751991.1|  predicted protein                                  266   2e-81    
ref|NP_001142515.1|  hypothetical protein                               266   2e-81    Zea mays [maize]
ref|XP_004515772.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      266   2e-81    
ref|XP_002872971.1|  UDP-D-glucuronate 4-epimerase 2                    266   2e-81    Arabidopsis lyrata subsp. lyrata
ref|XP_001754001.1|  predicted protein                                  266   2e-81    
gb|EYU34305.1|  hypothetical protein MIMGU_mgv1a006903mg                266   2e-81    Erythranthe guttata [common monkey flower]
ref|XP_008677814.1|  PREDICTED: LOC732831 isoform X1                    266   3e-81    Zea mays [maize]
ref|NP_001105911.1|  LOC732831                                          266   3e-81    Zea mays [maize]
ref|XP_008234372.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like      265   3e-81    Prunus mume [ume]
gb|KFK29619.1|  hypothetical protein AALP_AA7G157500                    265   3e-81    Arabis alpina [alpine rockcress]
ref|XP_001777338.1|  predicted protein                                  266   3e-81    
ref|XP_008439108.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      265   4e-81    Cucumis melo [Oriental melon]
dbj|BAH20281.1|  AT4G30440                                              259   4e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010264164.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           265   5e-81    Nelumbo nucifera [Indian lotus]
ref|XP_008794557.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      266   5e-81    Phoenix dactylifera
ref|XP_002324510.1|  UDP-D-GLUCURONATE 4-EPIMERASE 1 family protein     265   6e-81    Populus trichocarpa [western balsam poplar]
ref|XP_001761984.1|  predicted protein                                  265   6e-81    
ref|XP_004245716.1|  PREDICTED: UDP-glucuronate 4-epimerase 5           265   7e-81    Solanum lycopersicum
ref|XP_007221187.1|  hypothetical protein PRUPE_ppa021672mg             264   7e-81    Prunus persica
ref|XP_008443815.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      265   7e-81    Cucumis melo [Oriental melon]
ref|XP_009127808.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           264   8e-81    Brassica rapa
ref|XP_004251783.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      264   8e-81    Solanum lycopersicum
gb|KEH31675.1|  UDP-D-glucuronate 4-epimerase                           265   9e-81    Medicago truncatula
ref|XP_011018096.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           264   9e-81    Populus euphratica
ref|XP_004144711.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           264   1e-80    Cucumis sativus [cucumbers]
emb|CDY70926.1|  BnaCnng70410D                                          264   1e-80    Brassica napus [oilseed rape]
gb|EYU37123.1|  hypothetical protein MIMGU_mgv1a006776mg                264   1e-80    Erythranthe guttata [common monkey flower]
ref|XP_001759693.1|  predicted protein                                  264   1e-80    
gb|EMT09376.1|  UDP-glucuronate 4-epimerase 1                           260   2e-80    
ref|XP_008361335.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           263   2e-80    Malus domestica [apple tree]
emb|CDP21367.1|  unnamed protein product                                263   2e-80    Coffea canephora [robusta coffee]
ref|XP_006845469.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           263   2e-80    Amborella trichopoda
ref|XP_002437985.1|  hypothetical protein SORBIDRAFT_10g005920          263   2e-80    Sorghum bicolor [broomcorn]
emb|CAN60968.1|  hypothetical protein VITISV_008097                     263   3e-80    Vitis vinifera
ref|XP_009399578.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           263   3e-80    
ref|XP_009786918.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      263   3e-80    Nicotiana sylvestris
ref|XP_009348282.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           263   4e-80    Pyrus x bretschneideri [bai li]
ref|XP_010055537.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      263   4e-80    Eucalyptus grandis [rose gum]
ref|XP_009600710.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      263   4e-80    Nicotiana tomentosiformis
ref|XP_003635586.2|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      263   4e-80    Vitis vinifera
ref|XP_004296420.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           262   5e-80    Fragaria vesca subsp. vesca
ref|XP_011076316.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      262   6e-80    Sesamum indicum [beniseed]
emb|CDX97356.1|  BnaA02g21470D                                          262   6e-80    
ref|XP_010438178.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           262   8e-80    Camelina sativa [gold-of-pleasure]
ref|XP_009370520.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like      259   1e-79    Pyrus x bretschneideri [bai li]
ref|XP_010276827.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      262   1e-79    Nelumbo nucifera [Indian lotus]
ref|XP_010447717.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      261   1e-79    Camelina sativa [gold-of-pleasure]
ref|XP_006363737.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      262   1e-79    Solanum tuberosum [potatoes]
dbj|BAJ88176.1|  predicted protein                                      263   1e-79    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008649176.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      261   1e-79    Zea mays [maize]
ref|XP_010909513.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...    262   1e-79    Elaeis guineensis
ref|XP_009372935.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like      259   1e-79    Pyrus x bretschneideri [bai li]
gb|KJB25649.1|  hypothetical protein B456_004G202200                    261   1e-79    Gossypium raimondii
ref|XP_010047039.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           261   1e-79    Eucalyptus grandis [rose gum]
emb|CDY04398.1|  BnaC02g28500D                                          261   2e-79    
ref|XP_011656020.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      261   2e-79    
ref|XP_011079342.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           261   2e-79    
ref|XP_010539138.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      261   3e-79    
ref|NP_194773.1|  UDP-D-glucuronate 4-epimerase 1                       260   3e-79    
ref|XP_006853046.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           260   3e-79    
emb|CDY39205.1|  BnaA03g50170D                                          260   3e-79    
ref|XP_006440401.1|  hypothetical protein CICLE_v10020257mg             260   4e-79    
ref|XP_003558346.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      261   4e-79    
ref|XP_004966666.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      260   4e-79    
emb|CDX72242.1|  BnaC07g42640D                                          260   4e-79    
ref|XP_010432987.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           259   6e-79    
ref|XP_006282616.1|  hypothetical protein CARUB_v10004864mg             259   7e-79    
ref|XP_008376451.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...    258   7e-79    
ref|XP_010047879.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           259   9e-79    
ref|XP_006477270.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      259   9e-79    
ref|XP_009128629.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      259   1e-78    
ref|XP_003564175.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      259   1e-78    
gb|EEC83913.1|  hypothetical protein OsI_29968                          253   1e-78    
ref|XP_001767292.1|  predicted protein                                  259   2e-78    
dbj|BAK06545.1|  predicted protein                                      259   2e-78    
ref|NP_001049561.1|  Os03g0249500                                       259   2e-78    
gb|EYU30447.1|  hypothetical protein MIMGU_mgv1a006641mg                258   2e-78    
gb|AFW85530.1|  hypothetical protein ZEAMMB73_797483                    257   2e-78    
ref|XP_009395225.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      258   3e-78    
ref|XP_010108144.1|  UDP-glucuronate 4-epimerase 3                      258   3e-78    
ref|NP_001147328.1|  protein capI                                       259   3e-78    
ref|XP_007039971.1|  UDP-D-glucuronate 4-epimerase 3                    258   3e-78    
gb|KFK37325.1|  hypothetical protein AALP_AA4G242100                    258   3e-78    
ref|XP_006651218.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      260   4e-78    
ref|XP_006490076.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      257   4e-78    
gb|KJB27035.1|  hypothetical protein B456_004G273500                    257   4e-78    
ref|XP_006660306.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      251   6e-78    
ref|XP_002318876.1|  hypothetical protein POPTR_0012s14480g             256   9e-78    
ref|XP_006412706.1|  hypothetical protein EUTSA_v10025193mg             257   9e-78    
ref|XP_011029969.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      256   1e-77    
gb|EMT23409.1|  UDP-glucuronate 4-epimerase 1                           257   1e-77    
ref|NP_001057015.1|  Os06g0187200                                       252   1e-77    
ref|XP_010525760.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           256   2e-77    
dbj|BAJ86203.1|  predicted protein                                      257   2e-77    
ref|XP_009137920.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      255   2e-77    
ref|XP_002462620.1|  hypothetical protein SORBIDRAFT_02g029130          257   3e-77    
ref|XP_009593138.1|  PREDICTED: UDP-glucuronate 4-epimerase 5           255   3e-77    
ref|XP_006421730.1|  hypothetical protein CICLE_v10005072mg             254   4e-77    
ref|XP_009789635.1|  PREDICTED: UDP-glucuronate 4-epimerase 5           255   5e-77    
gb|KDO65412.1|  hypothetical protein CISIN_1g015113mg                   254   6e-77    
ref|NP_001062295.1|  Os08g0526100                                       256   7e-77    
ref|XP_009397005.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      255   7e-77    
dbj|BAC75426.1|  putative type 1 capsule synthesis gene(CapI)           255   7e-77    
ref|XP_011081125.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           254   9e-77    
ref|XP_004957272.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      255   1e-76    
ref|XP_008372097.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           254   1e-76    
ref|XP_001781238.1|  predicted protein                                  253   1e-76    
gb|KJB43946.1|  hypothetical protein B456_007G225300                    253   2e-76    
dbj|BAD36515.1|  putative uridine diphosphate galacturonate 4-epi...    253   2e-76    
gb|EAY99954.1|  hypothetical protein OsI_21957                          253   2e-76    
gb|EAZ36080.1|  hypothetical protein OsJ_20391                          253   3e-76    
gb|EMS53276.1|  UDP-glucuronate 4-epimerase 1                           254   4e-76    
ref|XP_002444715.1|  hypothetical protein SORBIDRAFT_07g026520          253   4e-76    
ref|XP_003549880.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      252   5e-76    
gb|EMS47781.1|  UDP-glucuronate 4-epimerase 6                           250   8e-76    
gb|EEC83914.1|  hypothetical protein OsI_29969                          255   1e-75    
ref|XP_003533522.2|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...    249   2e-75    
ref|XP_012090411.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      249   2e-75    
ref|XP_006587717.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...    249   2e-75    
ref|XP_003525759.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      250   2e-75    
ref|XP_004147978.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           250   3e-75    
ref|XP_006660806.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      252   3e-75    
ref|XP_006587718.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...    249   3e-75    
ref|XP_004973970.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      251   4e-75    
ref|XP_006587716.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...    249   4e-75    
ref|XP_006587715.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...    249   5e-75    
ref|XP_006587714.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...    249   5e-75    
ref|XP_007155583.1|  hypothetical protein PHAVU_003G214400g             249   5e-75    
ref|XP_006286788.1|  hypothetical protein CARUB_v10003353mg             249   6e-75    
ref|XP_010539945.1|  PREDICTED: UDP-glucuronate 4-epimerase 5           249   6e-75    
ref|XP_008448903.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           249   7e-75    
gb|AFW61553.1|  NAD-dependent epimerase/dehydratase family protein      250   7e-75    
gb|EAZ43405.1|  hypothetical protein OsJ_28010                          254   1e-74    
dbj|BAJ99315.1|  predicted protein                                      249   2e-74    
ref|XP_002509598.1|  UDP-glucuronate 5-epimerase, putative              248   2e-74    
ref|XP_009114689.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      244   2e-74    
ref|XP_011014804.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      247   5e-74    
ref|XP_011033905.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      247   5e-74    
ref|XP_002303529.2|  hypothetical protein POPTR_0003s11410g             247   6e-74    
ref|XP_003578376.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      248   1e-73    
ref|NP_001150944.1|  NAD-dependent epimerase/dehydratase family p...    247   1e-73    
ref|XP_006396783.1|  hypothetical protein EUTSA_v10028672mg             246   1e-73    
gb|AAK93670.1|  putative nucleotide sugar epimerase                     246   1e-73    
ref|NP_192962.1|  UDP-D-glucuronate 4-epimerase 5                       246   1e-73    
ref|XP_002874760.1|  UDP-D-glucuronate 4-epimerase 5                    246   1e-73    
ref|XP_004985001.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      247   2e-73    
ref|XP_010433651.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      245   2e-73    
gb|EEC84839.1|  hypothetical protein OsI_31939                          246   3e-73    
ref|NP_001063595.1|  Os09g0504000                                       246   3e-73    
gb|KFK31963.1|  hypothetical protein AALP_AA6G182500                    244   4e-73    
ref|XP_009401924.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      245   4e-73    
ref|XP_010422190.1|  PREDICTED: UDP-glucuronate 4-epimerase 5 iso...    244   7e-73    
ref|XP_008664162.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      244   7e-73    
emb|CDX86716.1|  BnaA09g21060D                                          244   8e-73    
ref|XP_009114629.1|  PREDICTED: UDP-glucuronate 4-epimerase 5 iso...    243   1e-72    
ref|XP_002468173.1|  hypothetical protein SORBIDRAFT_01g041030          244   1e-72    
emb|CDX94504.1|  BnaC09g23320D                                          243   1e-72    
ref|XP_010053408.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           243   2e-72    
gb|EPS64795.1|  hypothetical protein M569_09984                         240   2e-72    
ref|XP_009114630.1|  PREDICTED: UDP-glucuronate 4-epimerase 5 iso...    243   2e-72    
ref|XP_008660337.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      244   2e-72    
ref|XP_008653512.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      243   3e-72    
tpg|DAA44393.1|  TPA: 40S ribosomal protein S20                         243   5e-72    
ref|XP_003611251.1|  UDP-glucuronate 4-epimerase                        241   6e-72    
gb|EMT02349.1|  UDP-glucuronate 4-epimerase 6                           248   7e-72    
ref|XP_010092236.1|  UDP-glucuronate 4-epimerase 3                      223   1e-67    
gb|KJB23560.1|  hypothetical protein B456_004G105200                    221   3e-65    
gb|KJB28115.1|  hypothetical protein B456_005G028000                    223   3e-65    
ref|XP_002970377.1|  hypothetical protein SELMODRAFT_93183              219   4e-64    
ref|XP_002968145.1|  hypothetical protein SELMODRAFT_89938              216   5e-63    
gb|KJB27036.1|  hypothetical protein B456_004G273500                    216   1e-62    
ref|XP_001416501.1|  predicted protein                                  211   4e-61    
gb|AEW07796.1|  hypothetical protein 0_11781_01                         202   3e-60    
ref|XP_003572425.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      211   5e-60    
gb|AFG68267.1|  hypothetical protein 0_11781_01                         201   6e-60    
gb|AFG68265.1|  hypothetical protein 0_11781_01                         200   2e-59    
ref|XP_003635629.2|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      206   5e-59    
ref|XP_003075335.1|  putative nucleotide sugar epimerase (ISS)          207   6e-59    
emb|CEG01274.1|  Nucleotide sugar epimerase                             207   7e-59    
ref|XP_002504144.1|  predicted protein                                  206   1e-58    
ref|XP_001422311.1|  predicted protein                                  201   3e-57    
ref|XP_002511693.1|  UDP-glucuronate 5-epimerase, putative              190   1e-55    
ref|XP_007512695.1|  predicted protein                                  197   6e-54    
gb|AFK41785.1|  unknown                                                 182   2e-52    
emb|CAN73017.1|  hypothetical protein VITISV_004389                     182   2e-52    
emb|CAN83831.1|  hypothetical protein VITISV_003974                     182   2e-52    
gb|EPS73152.1|  hypothetical protein M569_01604                         189   2e-52    
ref|XP_003060215.1|  protein arginine methyltransferase                 187   2e-52    
gb|EMT26004.1|  UDP-glucuronate 4-epimerase 4                           179   4e-51    
gb|EMS48913.1|  UDP-glucuronate 4-epimerase 2                           176   3e-48    
ref|XP_001698020.1|  NAD-dependent epimerase/dehydratase                175   2e-47    
emb|CAJ91140.1|  nucleotide sugar epimerase-like protein                167   2e-46    
ref|XP_008776445.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like      166   2e-46    
ref|XP_002945754.1|  NAD-dependent epimerase/dehydratase                173   2e-46    
gb|ERT06558.1|  polysaccharide biosynthesis family protein              171   5e-46    
ref|WP_040484163.1|  capsular biosynthesis protein CpsI                 171   5e-46    
ref|WP_017366130.1|  NAD dependent epimerase/dehydratase                170   7e-46    
ref|WP_010961674.1|  capsular polysaccharide biosynthesis protein I     170   1e-45    
ref|WP_026609545.1|  capsular biosynthesis protein CpsI                 169   2e-45    
ref|WP_011737215.1|  NAD-dependent epimerase/dehydratase                169   2e-45    
ref|WP_027083114.1|  capsular biosynthesis protein CpsI                 169   2e-45    
emb|CBI24539.3|  unnamed protein product                                168   2e-45    
ref|WP_029733863.1|  hypothetical protein                               168   3e-45    
ref|WP_006509051.1|  nucleoside-diphosphate-sugar epimerase             169   3e-45    
ref|WP_018604345.1|  NAD dependent epimerase/dehydratase                169   3e-45    
ref|WP_027071813.1|  capsular biosynthesis protein CpsI                 168   4e-45    
ref|WP_009631239.1|  nucleoside-diphosphate-sugar epimerase             168   5e-45    
ref|WP_041227251.1|  capsular biosynthesis protein CpsI                 168   5e-45    
emb|CAJ74935.1|  strongly similar to UDP-glucuronate 5'-epimerase       167   7e-45    
ref|WP_015222004.1|  NAD-dependent epimerase/dehydratase                167   1e-44    
ref|XP_010421811.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      168   1e-44    
ref|WP_017714779.1|  hypothetical protein                               167   1e-44    
gb|ETR69345.1|  NAD-dependent epimerase/dehydratase                     167   1e-44    
gb|ACC80084.1|  NAD-dependent epimerase/dehydratase                     167   2e-44    
ref|WP_041565964.1|  capsular biosynthesis protein CpsI                 167   2e-44    
ref|WP_028313401.1|  capsular biosynthesis protein CpsI                 166   3e-44    
ref|WP_011713745.1|  NAD-dependent epimerase/dehydratase                166   3e-44    
ref|WP_043359257.1|  protein CapI                                       166   4e-44    
ref|WP_037224794.1|  capsular biosynthesis protein CpsI                 166   4e-44    
ref|WP_015118268.1|  nucleoside-diphosphate-sugar epimerase             166   4e-44    
ref|WP_022948290.1|  NAD dependent epimerase/dehydratase                166   4e-44    
ref|XP_728710.1|  NAD dependent epimerase/dehydratase                   169   4e-44    
gb|EGK72373.1|  Uncharacterized 37.6 kDa protein in cld 5'region        166   5e-44    
ref|WP_011630411.1|  NAD-dependent epimerase/dehydratase                165   5e-44    
ref|WP_012610830.1|  NAD-dependent epimerase/dehydratase                165   5e-44    
ref|WP_026686095.1|  hypothetical protein                               165   8e-44    
ref|WP_013454786.1|  nad-dependent epimerase/dehydratase                165   8e-44    
ref|WP_034343461.1|  capsular biosynthesis protein CpsI                 164   1e-43    
ref|WP_004462894.1|  MULTISPECIES: nucleotide sugar epimerase           164   1e-43    
ref|WP_013111978.1|  NAD-dependent epimerase/dehydratase                164   1e-43    
ref|WP_045224964.1|  capsular biosynthesis protein CpsI                 164   1e-43    
ref|WP_029408437.1|  hypothetical protein                               164   2e-43    
ref|WP_013250660.1|  UDP-glucuronate 5'-epimerase                       164   2e-43    
ref|WP_012489003.1|  NAD dependent epimerase/dehydratase family s...    164   2e-43    
ref|WP_009787825.1|  NAD-dependent epimerase                            164   2e-43    
ref|WP_043815253.1|  protein CapI                                       164   2e-43    
ref|WP_027403384.1|  capsular biosynthesis protein CpsI                 164   2e-43    
ref|WP_009344412.1|  Nucleoside-diphosphate-sugar epimerase             164   2e-43    
ref|WP_019564031.1|  hypothetical protein                               160   2e-43    
ref|WP_018526605.1|  hypothetical protein                               164   3e-43    
ref|WP_026848679.1|  capsular biosynthesis protein CpsI                 163   3e-43    
ref|WP_012954589.1|  NAD-dependent epimerase                            163   3e-43    
ref|WP_007639465.1|  NAD dependent epimerase/dehydratase family s...    163   3e-43    
ref|WP_006276587.1|  3-beta hydroxysteroid dehydrogenase/isomerase      163   3e-43    
ref|WP_045053505.1|  capsular biosynthesis protein CpsI                 163   3e-43    
ref|WP_041136589.1|  capsule biosynthesis protein CapI                  164   3e-43    
ref|WP_042406657.1|  capsular biosynthesis protein CpsI                 163   3e-43    
ref|WP_029077107.1|  hypothetical protein                               163   3e-43    
ref|WP_018865970.1|  hypothetical protein                               160   3e-43    
ref|WP_040881537.1|  capsular biosynthesis protein CpsI                 163   4e-43    
ref|WP_034432547.1|  capsular biosynthesis protein CpsI                 163   4e-43    
ref|WP_002708148.1|  NAD-dependent epimerase                            163   4e-43    
ref|WP_045707280.1|  capsular biosynthesis protein CpsI                 163   4e-43    
ref|WP_013965623.1|  NAD-dependent epimerase/dehydratase                163   4e-43    
ref|WP_015188623.1|  UDP-glucuronate 5'-epimerase                       163   5e-43    
ref|WP_018950679.1|  NAD dependent epimerase/dehydratase                161   5e-43    
ref|WP_020160621.1|  MULTISPECIES: NAD dependent epimerase/dehydr...    163   5e-43    
ref|WP_018867265.1|  MULTISPECIES: hypothetical protein                 160   5e-43    
ref|WP_018988013.1|  NAD dependent epimerase/dehydratase                162   6e-43    
ref|WP_004513290.1|  NAD-dependent epimerase/dehydratase                162   6e-43    
ref|WP_002683323.1|  nucleoside-diphosphate-sugar epimerase             162   6e-43    
ref|WP_041274008.1|  capsular biosynthesis protein CpsI                 162   6e-43    
ref|WP_019568710.1|  hypothetical protein                               160   6e-43    
gb|ABS77216.2|  UDP-N-acetylglucosamine 4-epimerase                     162   7e-43    
ref|WP_039643797.1|  capsular biosynthesis protein CpsI                 162   7e-43    
ref|WP_014415759.1|  UDP-glucuronate 5'-epimerase                       162   7e-43    
ref|WP_020847554.1|  NAD-dependent epimerase/dehydratase family p...    162   7e-43    
ref|WP_036985444.1|  capsule biosynthesis protein CapI                  162   7e-43    
ref|WP_043880870.1|  capsular biosynthesis protein CpsI                 162   8e-43    
ref|WP_011289653.1|  NAD-dependent epimerase/dehydratase                162   8e-43    
ref|WP_020008853.1|  NAD dependent epimerase/dehydratase                160   8e-43    
ref|WP_009857338.1|  NAD-dependent epimerase/dehydratase                162   8e-43    
ref|WP_036012543.1|  capsular biosynthesis protein CpsI                 162   8e-43    
ref|WP_028579847.1|  capsular biosynthesis protein CpsI                 162   8e-43    
gb|ACN16058.1|  CapD1                                                   162   9e-43    
gb|ACJ18491.1|  UDP-N-acetylglucosamine 4-epimerase                     162   9e-43    



>ref|XP_009608204.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nicotiana tomentosiformis]
Length=450

 Score =   345 bits (886),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 181/215 (84%), Positives = 189/215 (88%), Gaps = 3/215 (1%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  +TDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  239   KVPFSEEHKTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  298

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  +QGK INVYVTQ+DKEVARDFTYIDD+VKGCVGALDTAEKSTGSGGKKKGPAQLR
Sbjct  299   FTKDMIQGKSINVYVTQDDKEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKKGPAQLR  358

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             VYNLGNTSPVSVRKLVSILENLLS+KAKKNVVKMPRNGDVPFTHANVSLA +DFGYKPTT
Sbjct  359   VYNLGNTSPVSVRKLVSILENLLSVKAKKNVVKMPRNGDVPFTHANVSLALRDFGYKPTT  418

Query  489   DLSSGLRKFVKWYVSYYGIQSRVKTELHPTHQSDD  385
             DLS GLRKFVKWYVSYYGIQSRVK E     +SDD
Sbjct  419   DLSIGLRKFVKWYVSYYGIQSRVKKE---NDRSDD  450



>ref|XP_009616292.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nicotiana tomentosiformis]
Length=453

 Score =   344 bits (882),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 176/215 (82%), Positives = 190/215 (88%), Gaps = 1/215 (0%)
 Frame = -2

Query  1026  VPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFF  847
             VPF EN RTDQPA LYA TKKAGEEIAH  NHI+GLSLT   FF V GPWGRPD   FFF
Sbjct  239   VPFSENHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTALRFFTVYGPWGRPDMAYFFF  298

Query  846   XKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLRV  667
              K   QGKPINVYVTQ+DKEVARDFTYIDD+VKGC+GALDTAEKSTGSGGKKKGPAQLRV
Sbjct  299   TKDMTQGKPINVYVTQDDKEVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKKGPAQLRV  358

Query  666   YNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTD  487
             YNLGNTSPVSV+KLV+ILE+LL++KAKKNV+KMPRNGDVPFTHANVSLAY+DFGYKPTTD
Sbjct  359   YNLGNTSPVSVKKLVTILESLLNVKAKKNVIKMPRNGDVPFTHANVSLAYRDFGYKPTTD  418

Query  486   LSSGLRKFVKWYVSYYGIQSRVKTEL-HPTHQSDD  385
             LSSGLRKFVKWY+SYYGIQS+V  EL  P   S+D
Sbjct  419   LSSGLRKFVKWYLSYYGIQSKVNKELDSPNDHSED  453



>ref|XP_009783247.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nicotiana sylvestris]
Length=453

 Score =   344 bits (882),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 176/215 (82%), Positives = 191/215 (89%), Gaps = 1/215 (0%)
 Frame = -2

Query  1026  VPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFF  847
             VPF EN RTDQPA LYA TKKAGEEIAH  NHI+GLSLT   FF V GPWGRPD   FFF
Sbjct  239   VPFSENHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTALRFFTVYGPWGRPDMAYFFF  298

Query  846   XKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLRV  667
              K   QGKPINVYVTQ++KEVARDFTYIDDVVKGC+GALDTAEKSTGSGGKKKGPAQLRV
Sbjct  299   TKDMTQGKPINVYVTQDNKEVARDFTYIDDVVKGCLGALDTAEKSTGSGGKKKGPAQLRV  358

Query  666   YNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTD  487
             YNLGNTSPVSV+KLV+ILE+LL++KAKKNV+KMPRNGDVPFTHANVSLAY+DFGYKPTTD
Sbjct  359   YNLGNTSPVSVKKLVTILESLLNVKAKKNVIKMPRNGDVPFTHANVSLAYRDFGYKPTTD  418

Query  486   LSSGLRKFVKWYVSYYGIQSRVKTELH-PTHQSDD  385
             LSSGLRKFVKWY+SYYGIQS+V  EL+ P   S+D
Sbjct  419   LSSGLRKFVKWYLSYYGIQSKVNKELNSPNDHSED  453



>ref|XP_009768456.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nicotiana sylvestris]
Length=450

 Score =   341 bits (874),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 180/215 (84%), Positives = 186/215 (87%), Gaps = 3/215 (1%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  239   KVPFSEEHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  298

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  +QGK INVYVTQ+DKEVARDFTYIDD+VKGCVGALDTAEKSTGSGGKKKGPAQLR
Sbjct  299   FTKDMIQGKSINVYVTQDDKEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKKGPAQLR  358

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             VYNLGNTSPVSVRKLV ILENLL+IKAKKNVVKMPRNGDVPFTHANVSLA +DFGYKPTT
Sbjct  359   VYNLGNTSPVSVRKLVVILENLLNIKAKKNVVKMPRNGDVPFTHANVSLALRDFGYKPTT  418

Query  489   DLSSGLRKFVKWYVSYYGIQSRVKTELHPTHQSDD  385
             DLS GLRKFVKWYVSYYGIQ RVK E      SDD
Sbjct  419   DLSIGLRKFVKWYVSYYGIQPRVKKE---NDHSDD  450



>ref|XP_006360928.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Solanum tuberosum]
Length=448

 Score =   337 bits (864),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 171/204 (84%), Positives = 184/204 (90%), Gaps = 0/204 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E+ RTDQPA LYA TKKAGE IAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  238   KVPFSEDHRTDQPASLYAATKKAGEAIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  297

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  +QGK INVYVTQ+D+EVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+GPAQLR
Sbjct  298   FTKDMIQGKSINVYVTQDDREVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGPAQLR  357

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             VYNLGNTSPVSV+KLV+ILENLL++KAKKNV+KMPRNGDVPFTHANVSLA +DFGYKPTT
Sbjct  358   VYNLGNTSPVSVKKLVAILENLLNLKAKKNVIKMPRNGDVPFTHANVSLALRDFGYKPTT  417

Query  489   DLSSGLRKFVKWYVSYYGIQSRVK  418
             DLSSGLRKFVKWYVSYYGIQ RVK
Sbjct  418   DLSSGLRKFVKWYVSYYGIQPRVK  441



>ref|XP_004247883.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Solanum lycopersicum]
Length=452

 Score =   337 bits (864),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 172/206 (83%), Positives = 184/206 (89%), Gaps = 0/206 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E+ RTDQPA LYA TKKAGE IAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  242   KVPFSEDHRTDQPASLYAATKKAGEAIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  301

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  +QGK INVYVTQ+DKEVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+GPAQLR
Sbjct  302   FTKDMIQGKSINVYVTQDDKEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGPAQLR  361

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             VYNLGNTSPVSV+KLV+ILENLL++KAKK  +KMPRNGDVPFTHANVSLA +DFGYKPTT
Sbjct  362   VYNLGNTSPVSVKKLVAILENLLNLKAKKFFIKMPRNGDVPFTHANVSLALRDFGYKPTT  421

Query  489   DLSSGLRKFVKWYVSYYGIQSRVKTE  412
             DLSSGLRKFVKWYVSYYGIQSRVK E
Sbjct  422   DLSSGLRKFVKWYVSYYGIQSRVKKE  447



>emb|CDP21869.1| unnamed protein product [Coffea canephora]
Length=450

 Score =   336 bits (861),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 170/211 (81%), Positives = 187/211 (89%), Gaps = 0/211 (0%)
 Frame = -2

Query  1026  VPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFF  847
             VPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FFF
Sbjct  238   VPFSEEHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFF  297

Query  846   XKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLRV  667
              K  LQGK IN+YVTQ+DKEVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+ PAQLRV
Sbjct  298   TKDILQGKGINLYVTQDDKEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRAPAQLRV  357

Query  666   YNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTD  487
             YNLGNTSPVSV KLVSILE LL++KAKK+V+KMPRNGDVP+THANVSLAYKDFGY+PTTD
Sbjct  358   YNLGNTSPVSVGKLVSILEGLLNVKAKKHVIKMPRNGDVPYTHANVSLAYKDFGYQPTTD  417

Query  486   LSSGLRKFVKWYVSYYGIQSRVKTELHPTHQ  394
             LS+GLRKFVKWY+SYYGIQS+VK E+  T++
Sbjct  418   LSTGLRKFVKWYLSYYGIQSKVKKEIDATNE  448



>ref|XP_011084213.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Sesamum indicum]
Length=459

 Score =   333 bits (855),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 170/217 (78%), Positives = 187/217 (86%), Gaps = 2/217 (1%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             +VPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  243   QVPFSEIDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  302

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  LQGK INVYVTQEDKEVARDFTYIDD+VKGC+GALDTAEKSTGSGGKK+ PAQLR
Sbjct  303   FTKDILQGKGINVYVTQEDKEVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRAPAQLR  362

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             VYNLGNT+PV+V KLV ILE+LL++KAKK+V+KMPRNGDVPFTHANVSLAY+DFGYKPTT
Sbjct  363   VYNLGNTAPVTVGKLVGILESLLNVKAKKHVIKMPRNGDVPFTHANVSLAYRDFGYKPTT  422

Query  489   DLSSGLRKFVKWYVSYYGIQSRVKTELHPT--HQSDD  385
             DL++GLRKFVKWYVSYYGI+SR K   H +    SDD
Sbjct  423   DLAAGLRKFVKWYVSYYGIESRAKKGFHSSTNEHSDD  459



>ref|XP_006349916.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Solanum tuberosum]
Length=454

 Score =   333 bits (854),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 168/201 (84%), Positives = 182/201 (91%), Gaps = 0/201 (0%)
 Frame = -2

Query  1026  VPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFF  847
             VPF E+ RTDQPA LYA TKKAGEEIAH  NHI+GLSLT   FF V GPWGRPD   FFF
Sbjct  243   VPFSESHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTALRFFTVYGPWGRPDMAYFFF  302

Query  846   XKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLRV  667
              K  +QGKPINVYVTQ+DKEVARDFTYIDD+VKGC+G+LDTAEKSTGSGGKKKGPAQLRV
Sbjct  303   TKDMVQGKPINVYVTQDDKEVARDFTYIDDIVKGCIGSLDTAEKSTGSGGKKKGPAQLRV  362

Query  666   YNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTD  487
             YNLGNTSPVSV KLV+ILENLL++KAKKNV+KMPRNGDVPFTHAN++LA KDFGYKPTTD
Sbjct  363   YNLGNTSPVSVNKLVTILENLLNVKAKKNVIKMPRNGDVPFTHANITLAKKDFGYKPTTD  422

Query  486   LSSGLRKFVKWYVSYYGIQSR  424
             LSSGLRKFVKWYVSYYGIQS+
Sbjct  423   LSSGLRKFVKWYVSYYGIQSK  443



>ref|XP_004239852.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Solanum lycopersicum]
Length=433

 Score =   330 bits (847),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 185/204 (91%), Gaps = 2/204 (1%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF EN RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  232   KVPFSENDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  291

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  +QGKPI VYV+  DKEVARDFTYIDDVVKGC+GA+DTAEKSTGSGGKK+GPAQLR
Sbjct  292   FTKDMIQGKPIKVYVS--DKEVARDFTYIDDVVKGCLGAIDTAEKSTGSGGKKRGPAQLR  349

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             VYNLGNTSPVSV+KLV+ILENLL+IKAKKN+++MPRNGDVPFTHANVSLAY+DFGYKPTT
Sbjct  350   VYNLGNTSPVSVKKLVAILENLLNIKAKKNLIRMPRNGDVPFTHANVSLAYRDFGYKPTT  409

Query  489   DLSSGLRKFVKWYVSYYGIQSRVK  418
             +LSSGLRKFVKWY+SYYGIQ+R+K
Sbjct  410   NLSSGLRKFVKWYLSYYGIQARIK  433



>ref|XP_012071089.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Jatropha curcas]
 gb|KDP39331.1| hypothetical protein JCGZ_01088 [Jatropha curcas]
Length=458

 Score =   329 bits (844),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 168/206 (82%), Positives = 184/206 (89%), Gaps = 0/206 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             +VPF E+ RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  242   QVPFSESDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  301

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  L GKPI+VY TQ++K+VARDFTYIDD+VKGCVGALDTAEKSTGSGGKKKGPAQLR
Sbjct  302   FTKDILHGKPIDVYQTQDEKQVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKKGPAQLR  361

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             VYNLGNTSPV V KLV+ILE+LL+ KAKK+++KMPRNGDVP+THANVSLAYKDFGYKPTT
Sbjct  362   VYNLGNTSPVPVGKLVAILESLLNTKAKKHIIKMPRNGDVPYTHANVSLAYKDFGYKPTT  421

Query  489   DLSSGLRKFVKWYVSYYGIQSRVKTE  412
             DLSSGLRKFVKWYVSYYGIQ+RVK E
Sbjct  422   DLSSGLRKFVKWYVSYYGIQTRVKKE  447



>ref|XP_002522810.1| UDP-glucuronate 5-epimerase, putative [Ricinus communis]
 gb|EEF39661.1| UDP-glucuronate 5-epimerase, putative [Ricinus communis]
Length=401

 Score =   327 bits (838),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 169/206 (82%), Positives = 182/206 (88%), Gaps = 0/206 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             +VPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  186   EVPFSEIDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  245

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  LQGK I++Y TQ+ K+VARDFTYIDDVVKGCVGALDTAEKSTGSGGKKKGPAQLR
Sbjct  246   FTKDILQGKQIDIYQTQDQKQVARDFTYIDDVVKGCVGALDTAEKSTGSGGKKKGPAQLR  305

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             VYNLGNTSPV V KLVSILENLL+ KAKK+V+KMPRNGDVP+THANVSLAYKDFGYKPTT
Sbjct  306   VYNLGNTSPVPVGKLVSILENLLNTKAKKHVIKMPRNGDVPYTHANVSLAYKDFGYKPTT  365

Query  489   DLSSGLRKFVKWYVSYYGIQSRVKTE  412
             DLSSGLRKFVKWYV YYGIQ++VKT+
Sbjct  366   DLSSGLRKFVKWYVGYYGIQTKVKTQ  391



>ref|XP_010243459.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nelumbo nucifera]
Length=455

 Score =   328 bits (840),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 180/204 (88%), Gaps = 0/204 (0%)
 Frame = -2

Query  1023  PFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFFX  844
             PF E+ RTDQPA LYA TKKAGEEIAH  NHI+GLS+TG  FF V GPWGRPD   FFF 
Sbjct  238   PFSESHRTDQPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFFFT  297

Query  843   KXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLRVY  664
             K  LQGKPI +Y TQ+D+EVARDFTYIDDVVKGC+GALDTAEKSTGSGGKK+GPAQLR+Y
Sbjct  298   KDILQGKPITIYQTQDDREVARDFTYIDDVVKGCLGALDTAEKSTGSGGKKRGPAQLRIY  357

Query  663   NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  484
             NLGNTSPVSV KLVSILE LL++ AKKN++KMPRNGDVPFTHANVSLAY+DFGYKPTTDL
Sbjct  358   NLGNTSPVSVGKLVSILEGLLNVNAKKNILKMPRNGDVPFTHANVSLAYRDFGYKPTTDL  417

Query  483   SSGLRKFVKWYVSYYGIQSRVKTE  412
             ++GLRKFVKWYVSYYGIQSR   E
Sbjct  418   ATGLRKFVKWYVSYYGIQSRANKE  441



>ref|XP_008380476.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Malus domestica]
Length=465

 Score =   327 bits (839),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 169/205 (82%), Positives = 181/205 (88%), Gaps = 0/205 (0%)
 Frame = -2

Query  1023  PFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFFX  844
             PF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FFF 
Sbjct  247   PFSELHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFT  306

Query  843   KXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLRVY  664
             K  LQGKPINV+ T +DKEVARDFTYIDDVVKGC+GALDTAEKSTGSGGKKKGPAQLR+Y
Sbjct  307   KDILQGKPINVFKTVDDKEVARDFTYIDDVVKGCLGALDTAEKSTGSGGKKKGPAQLRIY  366

Query  663   NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  484
             NLGNTSPV V KLVSILE LLS KAKK+V+KMPRNGDVP+THANV+LAYKDFGYKPTTDL
Sbjct  367   NLGNTSPVPVGKLVSILEGLLSTKAKKHVIKMPRNGDVPYTHANVTLAYKDFGYKPTTDL  426

Query  483   SSGLRKFVKWYVSYYGIQSRVKTEL  409
             +SGLRKFVKWYVSYYGI+SRVK E+
Sbjct  427   ASGLRKFVKWYVSYYGIESRVKKEM  451



>ref|XP_006365466.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Solanum tuberosum]
Length=434

 Score =   326 bits (835),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 165/204 (81%), Positives = 184/204 (90%), Gaps = 2/204 (1%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF EN RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  233   KVPFSENDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  292

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  +QGKPI VYV+  DKEVARDFTYIDDVVKGC+GA+DTAEKSTGSGGKK+GPAQLR
Sbjct  293   FTKDMIQGKPIKVYVS--DKEVARDFTYIDDVVKGCLGAIDTAEKSTGSGGKKRGPAQLR  350

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             VYNLGNTSPVSV+KLV+ILENLL+IKAKKN+++MP+NGDVPFTHANVSLAY+DFGY+PTT
Sbjct  351   VYNLGNTSPVSVKKLVAILENLLNIKAKKNLIRMPQNGDVPFTHANVSLAYRDFGYRPTT  410

Query  489   DLSSGLRKFVKWYVSYYGIQSRVK  418
             +LSSGLRKFVKWY+SYYG+Q+R K
Sbjct  411   NLSSGLRKFVKWYLSYYGMQARTK  434



>ref|XP_009373545.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Pyrus x bretschneideri]
Length=465

 Score =   326 bits (836),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 168/205 (82%), Positives = 181/205 (88%), Gaps = 0/205 (0%)
 Frame = -2

Query  1023  PFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFFX  844
             PF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FFF 
Sbjct  247   PFSELHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFT  306

Query  843   KXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLRVY  664
             K  LQGKPI+VY T +DKEVARDFTYIDDVVKGC+GALDTA+KSTGSGGKKKGPAQLR+Y
Sbjct  307   KDILQGKPIDVYKTVDDKEVARDFTYIDDVVKGCLGALDTAQKSTGSGGKKKGPAQLRIY  366

Query  663   NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  484
             NLGNTSPV V KLVSILE LLS KAKK+V+KMPRNGDVP+THANV+LAYKDFGYKPTTDL
Sbjct  367   NLGNTSPVPVGKLVSILEGLLSTKAKKHVIKMPRNGDVPYTHANVTLAYKDFGYKPTTDL  426

Query  483   SSGLRKFVKWYVSYYGIQSRVKTEL  409
             +SGLRKFVKWYVSYYGI+SRVK E+
Sbjct  427   ASGLRKFVKWYVSYYGIESRVKKEM  451



>ref|XP_010274074.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nelumbo nucifera]
Length=456

 Score =   325 bits (833),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 177/204 (87%), Gaps = 0/204 (0%)
 Frame = -2

Query  1023  PFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFFX  844
             PF E+ RTDQPA LYA TKKAGEEIAH  NHI GLS+TG  FF V GPWGRPD   FFF 
Sbjct  239   PFSESHRTDQPASLYAATKKAGEEIAHTYNHIHGLSITGLRFFTVYGPWGRPDMAYFFFT  298

Query  843   KXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLRVY  664
             K  LQGKPI +Y TQ+DKEVARDFTYIDDVVKGC+GALDTAEKSTGSGGKK+GPAQLR+Y
Sbjct  299   KDILQGKPITIYRTQDDKEVARDFTYIDDVVKGCLGALDTAEKSTGSGGKKRGPAQLRIY  358

Query  663   NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  484
             NLGNTSPVSV KLVSILE  LS+KAKKNVVKMPRNGDVPFTHANVSLAY+DFGYKPTTDL
Sbjct  359   NLGNTSPVSVGKLVSILEGHLSMKAKKNVVKMPRNGDVPFTHANVSLAYRDFGYKPTTDL  418

Query  483   SSGLRKFVKWYVSYYGIQSRVKTE  412
             S+GLRKFVKWYV YYGI S+   E
Sbjct  419   STGLRKFVKWYVGYYGIHSKANKE  442



>ref|XP_006421024.1| hypothetical protein CICLE_v10004881mg [Citrus clementina]
 gb|ESR34264.1| hypothetical protein CICLE_v10004881mg [Citrus clementina]
Length=476

 Score =   325 bits (832),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 165/206 (80%), Positives = 181/206 (88%), Gaps = 0/206 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             +VPF E+ RTDQPA LYA TKKAGEEIAH  NHI+GL+LTG  FF V GPWGRPD   FF
Sbjct  254   QVPFSESHRTDQPASLYAATKKAGEEIAHTYNHIYGLALTGLRFFTVYGPWGRPDMAYFF  313

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  LQGK I+VY TQ+D+EVARDFTYIDDVVKGCVGALDTA KSTGS GKK+GPAQLR
Sbjct  314   FTKDILQGKTIDVYKTQDDREVARDFTYIDDVVKGCVGALDTAGKSTGSRGKKRGPAQLR  373

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             VYNLGNTSPV V +LVSILENLL+ KAKK+V++MPRNGDVP+THANVSLAYKDFGYKPTT
Sbjct  374   VYNLGNTSPVPVGRLVSILENLLNTKAKKHVIRMPRNGDVPYTHANVSLAYKDFGYKPTT  433

Query  489   DLSSGLRKFVKWYVSYYGIQSRVKTE  412
             DL++GLRKFVKWYVSYYGIQ RVK E
Sbjct  434   DLAAGLRKFVKWYVSYYGIQPRVKKE  459



>ref|XP_006492536.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Citrus sinensis]
 gb|KDO42081.1| hypothetical protein CISIN_1g011841mg [Citrus sinensis]
Length=476

 Score =   325 bits (832),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 166/206 (81%), Positives = 182/206 (88%), Gaps = 0/206 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             +VPF E+ RTDQPA LYA TKKAGEEIAH  NHI+GL+LTG  FF V GPWGRPD   FF
Sbjct  254   QVPFSESHRTDQPASLYAATKKAGEEIAHTYNHIYGLALTGLRFFTVYGPWGRPDMAYFF  313

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  LQGK I+VY TQ+D+EVARDFTYIDDVVKGCVGALDTA KSTGSGGKK+GPAQLR
Sbjct  314   FTKDILQGKTIDVYKTQDDREVARDFTYIDDVVKGCVGALDTAGKSTGSGGKKRGPAQLR  373

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             VYNLGNTSPV V +LVSILENLL+ KAKK+V++MPRNGDVP+THANVSLAYKDFGYKPTT
Sbjct  374   VYNLGNTSPVPVGRLVSILENLLNTKAKKHVIRMPRNGDVPYTHANVSLAYKDFGYKPTT  433

Query  489   DLSSGLRKFVKWYVSYYGIQSRVKTE  412
             DL++GLRKFVKWYVSYYGIQ RVK E
Sbjct  434   DLAAGLRKFVKWYVSYYGIQPRVKKE  459



>ref|XP_011003624.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Populus euphratica]
Length=456

 Score =   323 bits (829),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 181/204 (89%), Gaps = 0/204 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             +VPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  239   QVPFSELDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  298

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  LQGKPI+VY TQ+DK+VARDFTYIDDVVKGC+GALDTAEKSTGSGGKKKGPAQLR
Sbjct  299   FTKDILQGKPIDVYQTQDDKQVARDFTYIDDVVKGCLGALDTAEKSTGSGGKKKGPAQLR  358

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             VYNLGNTSPV V  LVSILE LLS KAKK+V+KMPRNGDVP+THANV+LA+KDFGYKPTT
Sbjct  359   VYNLGNTSPVPVGNLVSILEGLLSTKAKKHVIKMPRNGDVPYTHANVTLAFKDFGYKPTT  418

Query  489   DLSSGLRKFVKWYVSYYGIQSRVK  418
             DL++GLRKFVKWYV+YYGIQ+RVK
Sbjct  419   DLATGLRKFVKWYVNYYGIQTRVK  442



>ref|XP_002265088.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Vitis vinifera]
Length=451

 Score =   323 bits (828),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 162/204 (79%), Positives = 180/204 (88%), Gaps = 0/204 (0%)
 Frame = -2

Query  1023  PFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFFX  844
             PF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FFF 
Sbjct  236   PFSELHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFT  295

Query  843   KXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLRVY  664
             K  LQGKPI +Y TQ+DKEVARDFTYIDDVVKGC+GALDTAEKSTGSGGKK+GPAQLR+Y
Sbjct  296   KDILQGKPITIYQTQDDKEVARDFTYIDDVVKGCLGALDTAEKSTGSGGKKRGPAQLRIY  355

Query  663   NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  484
             NLGNTSPV V +LV ILE LL++KAKK+V+KMPRNGDVP+THANVSLAY+DFGYKP+TDL
Sbjct  356   NLGNTSPVPVGRLVGILEGLLNVKAKKHVIKMPRNGDVPYTHANVSLAYRDFGYKPSTDL  415

Query  483   SSGLRKFVKWYVSYYGIQSRVKTE  412
             ++GLR+FVKWYVSYYGIQ+RVK E
Sbjct  416   ATGLRRFVKWYVSYYGIQTRVKKE  439



>ref|XP_007223132.1| hypothetical protein PRUPE_ppa005434mg [Prunus persica]
 gb|EMJ24331.1| hypothetical protein PRUPE_ppa005434mg [Prunus persica]
Length=461

 Score =   323 bits (828),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 167/205 (81%), Positives = 179/205 (87%), Gaps = 0/205 (0%)
 Frame = -2

Query  1023  PFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFFX  844
             PF E  RTDQPA LYA TKKAGEEIAH  NHI+GL+LTG  FF V GPWGRPD   FFF 
Sbjct  243   PFSELHRTDQPASLYAATKKAGEEIAHTYNHIYGLALTGLRFFTVYGPWGRPDMAYFFFT  302

Query  843   KXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLRVY  664
             K  LQGKPI+VY T +DKEVARDFTYIDDVVKGC+GALDTAEKSTGSGGKKKGPAQLR+Y
Sbjct  303   KDILQGKPIDVYKTVDDKEVARDFTYIDDVVKGCLGALDTAEKSTGSGGKKKGPAQLRIY  362

Query  663   NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  484
             NLGNTSPV V KLVSILE LL  KAKK+V+KMPRNGDVP+THANVSLAYKDFGYKPTTDL
Sbjct  363   NLGNTSPVPVGKLVSILEGLLGTKAKKHVIKMPRNGDVPYTHANVSLAYKDFGYKPTTDL  422

Query  483   SSGLRKFVKWYVSYYGIQSRVKTEL  409
             +SGLRKFVKWYVSYYGI +RVK E+
Sbjct  423   ASGLRKFVKWYVSYYGIDTRVKREM  447



>ref|XP_002298679.1| UDP-D-GLUCURONATE 4-EPIMERASE 6 family protein [Populus trichocarpa]
 gb|ABK93061.1| unknown [Populus trichocarpa]
 gb|EEE83484.1| UDP-D-GLUCURONATE 4-EPIMERASE 6 family protein [Populus trichocarpa]
Length=457

 Score =   323 bits (828),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 165/204 (81%), Positives = 181/204 (89%), Gaps = 0/204 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             +VPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  240   QVPFSELDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  299

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  LQGKPI+VY TQ+DK+VARDFTYIDDVVKGC+GALDTAEKSTGSGGKKKGPAQLR
Sbjct  300   FTKDILQGKPIDVYQTQDDKQVARDFTYIDDVVKGCLGALDTAEKSTGSGGKKKGPAQLR  359

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             VYNLGNTSPV V  LVSILE LLS KAKK+V+KMPRNGDVP+THANV+LA+KDFGYKP+T
Sbjct  360   VYNLGNTSPVPVANLVSILEGLLSTKAKKHVIKMPRNGDVPYTHANVTLAFKDFGYKPST  419

Query  489   DLSSGLRKFVKWYVSYYGIQSRVK  418
             DL++GLRKFVKWYV+YYGIQ+RVK
Sbjct  420   DLATGLRKFVKWYVNYYGIQTRVK  443



>ref|XP_011042175.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Populus euphratica]
 ref|XP_011016239.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Populus euphratica]
Length=456

 Score =   323 bits (827),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 179/204 (88%), Gaps = 0/204 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             +VPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  239   QVPFSELDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  298

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  LQGKPI+VY TQ+ K+VARDFTYIDDVVKGC+GALDTAEKSTGS GKKKGPAQLR
Sbjct  299   FTKDILQGKPIDVYQTQDKKQVARDFTYIDDVVKGCLGALDTAEKSTGSSGKKKGPAQLR  358

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             VYNLGNTSPV V KLVSILE LLS KA+K+V+KMPRNGDVP+THANV+LAY+DFGYKPTT
Sbjct  359   VYNLGNTSPVPVGKLVSILEGLLSTKARKHVIKMPRNGDVPYTHANVTLAYRDFGYKPTT  418

Query  489   DLSSGLRKFVKWYVSYYGIQSRVK  418
             DL++GLRKFVKWYV YYGIQ+RVK
Sbjct  419   DLATGLRKFVKWYVDYYGIQTRVK  442



>ref|XP_004502237.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Cicer arietinum]
Length=451

 Score =   322 bits (825),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 164/206 (80%), Positives = 179/206 (87%), Gaps = 0/206 (0%)
 Frame = -2

Query  1023  PFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFFX  844
             PF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FFF 
Sbjct  236   PFSELHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFT  295

Query  843   KXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLRVY  664
             K  L GK ++VY TQ+ KEVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+GPAQLR+Y
Sbjct  296   KDILHGKTVDVYQTQDGKEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGPAQLRIY  355

Query  663   NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  484
             NLGNTSPV V KLVSILENLLS KAKK+++KMPRNGDVP+THANV+LAYKDFGYKPTTDL
Sbjct  356   NLGNTSPVPVGKLVSILENLLSTKAKKHIIKMPRNGDVPYTHANVTLAYKDFGYKPTTDL  415

Query  483   SSGLRKFVKWYVSYYGIQSRVKTELH  406
             ++GLRKFVKWYV YYGIQSR+K E H
Sbjct  416   ATGLRKFVKWYVRYYGIQSRLKKENH  441



>ref|XP_010527460.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glucuronate 4-epimerase 6-like 
[Tarenaya hassleriana]
Length=460

 Score =   321 bits (823),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 164/205 (80%), Positives = 177/205 (86%), Gaps = 0/205 (0%)
 Frame = -2

Query  1023  PFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFFX  844
             PF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FFF 
Sbjct  249   PFSEEHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFT  308

Query  843   KXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLRVY  664
             K  LQGK I+VY TQ+DKEVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+GPAQLRVY
Sbjct  309   KDILQGKSIDVYKTQDDKEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGPAQLRVY  368

Query  663   NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  484
             NLGNTSPV V +LV ILE LL  KAKK+V+KMPRNGDVP+THANVSLAY+DFGYKPTTDL
Sbjct  369   NLGNTSPVPVGRLVGILEGLLGTKAKKHVIKMPRNGDVPYTHANVSLAYRDFGYKPTTDL  428

Query  483   SSGLRKFVKWYVSYYGIQSRVKTEL  409
             ++GLRKFVKWYV YYGIQ RVK E+
Sbjct  429   AAGLRKFVKWYVGYYGIQPRVKREI  453



>ref|XP_003601662.1| UDP-D-glucuronic acid 4-epimerase [Medicago truncatula]
 gb|AES71913.1| UDP-D-glucuronate 4-epimerase [Medicago truncatula]
Length=447

 Score =   320 bits (820),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 177/204 (87%), Gaps = 0/204 (0%)
 Frame = -2

Query  1023  PFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFFX  844
             PF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FFF 
Sbjct  236   PFSELHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFT  295

Query  843   KXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLRVY  664
             K  L GK I+VY TQE KEVARDFTYIDD+VKGCVGALDTAEKSTGSGGKKKGPAQLR+Y
Sbjct  296   KDILHGKTIDVYQTQEGKEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKKGPAQLRIY  355

Query  663   NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  484
             NLGNTSPV V KLVSILENLLS KAKK+++KMPRNGDVP+THANV++AYKDF YKPTTDL
Sbjct  356   NLGNTSPVPVGKLVSILENLLSTKAKKHIIKMPRNGDVPYTHANVTMAYKDFAYKPTTDL  415

Query  483   SSGLRKFVKWYVSYYGIQSRVKTE  412
             ++GLRKFVKWYV YYGIQSR+K E
Sbjct  416   ATGLRKFVKWYVRYYGIQSRLKKE  439



>emb|CDX77481.1| BnaA07g06190D [Brassica napus]
Length=453

 Score =   319 bits (817),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 161/204 (79%), Positives = 177/204 (87%), Gaps = 0/204 (0%)
 Frame = -2

Query  1023  PFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFFX  844
             PF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FFF 
Sbjct  242   PFSEEHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFT  301

Query  843   KXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLRVY  664
             K  L GK I++Y TQ+++EVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+GPAQLRVY
Sbjct  302   KDILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGPAQLRVY  361

Query  663   NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  484
             NLGNTSPV V +LVSILE LL  KAKK+++KMPRNGDVP+THANVSLAY+DFGYKPTTDL
Sbjct  362   NLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNGDVPYTHANVSLAYRDFGYKPTTDL  421

Query  483   SSGLRKFVKWYVSYYGIQSRVKTE  412
             ++GLRKFVKWYVSYYGIQ RVK E
Sbjct  422   AAGLRKFVKWYVSYYGIQPRVKKE  445



>ref|XP_010093344.1| UDP-glucuronate 4-epimerase 6 [Morus notabilis]
 gb|EXB53916.1| UDP-glucuronate 4-epimerase 6 [Morus notabilis]
Length=454

 Score =   319 bits (817),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 163/204 (80%), Positives = 179/204 (88%), Gaps = 0/204 (0%)
 Frame = -2

Query  1023  PFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFFX  844
             PF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FFF 
Sbjct  242   PFSELHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFT  301

Query  843   KXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLRVY  664
             K  LQGK I+VY TQ+DKEVARDFTYIDDVVKGC+GALDTAEKSTGSGGKK+GPAQLR+Y
Sbjct  302   KDILQGKTIDVYKTQDDKEVARDFTYIDDVVKGCLGALDTAEKSTGSGGKKRGPAQLRIY  361

Query  663   NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  484
             NLGNTSPV V KLV ILE+LL+ KAKK+V++MPRNGDVP+THANVSLA +DFGYKPTTDL
Sbjct  362   NLGNTSPVPVGKLVGILESLLTTKAKKHVIRMPRNGDVPYTHANVSLANRDFGYKPTTDL  421

Query  483   SSGLRKFVKWYVSYYGIQSRVKTE  412
             S+GLRKFV+WYVSYYGIQ+RVK E
Sbjct  422   STGLRKFVRWYVSYYGIQTRVKKE  445



>gb|AFK49564.1| unknown [Medicago truncatula]
Length=447

 Score =   318 bits (816),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 163/204 (80%), Positives = 176/204 (86%), Gaps = 0/204 (0%)
 Frame = -2

Query  1023  PFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFFX  844
             PF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF   GPWGRPD   FFF 
Sbjct  236   PFSELHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTAYGPWGRPDMAYFFFT  295

Query  843   KXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLRVY  664
             K  L GK I+VY TQE KEVARDFTYIDD+VKGCVGALDTAEKSTGSGGKKKGPAQLR+Y
Sbjct  296   KDILHGKTIDVYQTQEGKEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKKGPAQLRIY  355

Query  663   NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  484
             NLGNTSPV V KLVSILENLLS KAKK+++KMPRNGDVP+THANV++AYKDF YKPTTDL
Sbjct  356   NLGNTSPVPVGKLVSILENLLSTKAKKHIIKMPRNGDVPYTHANVTMAYKDFAYKPTTDL  415

Query  483   SSGLRKFVKWYVSYYGIQSRVKTE  412
             ++GLRKFVKWYV YYGIQSR+K E
Sbjct  416   ATGLRKFVKWYVRYYGIQSRLKKE  439



>emb|CDX85133.1| BnaC07g07730D [Brassica napus]
Length=456

 Score =   318 bits (816),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 161/204 (79%), Positives = 177/204 (87%), Gaps = 0/204 (0%)
 Frame = -2

Query  1023  PFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFFX  844
             PF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FFF 
Sbjct  245   PFSEEHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFT  304

Query  843   KXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLRVY  664
             K  L GK I++Y TQ+++EVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+GPAQLRVY
Sbjct  305   KDILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGPAQLRVY  364

Query  663   NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  484
             NLGNTSPV V +LVSILE LL  KAKK+++KMPRNGDVP+THANVSLAY+DFGYKPTTDL
Sbjct  365   NLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNGDVPYTHANVSLAYRDFGYKPTTDL  424

Query  483   SSGLRKFVKWYVSYYGIQSRVKTE  412
             ++GLRKFVKWYVSYYGIQ RVK E
Sbjct  425   AAGLRKFVKWYVSYYGIQPRVKKE  448



>ref|XP_010532756.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Tarenaya hassleriana]
Length=458

 Score =   318 bits (816),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 163/205 (80%), Positives = 175/205 (85%), Gaps = 0/205 (0%)
 Frame = -2

Query  1023  PFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFFX  844
             PF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FFF 
Sbjct  246   PFSEEHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFT  305

Query  843   KXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLRVY  664
             K  LQGK I++Y TQ+DKEVARDFTYIDD+VKGCVGALDTAEKSTGSGGKKKGPAQLRVY
Sbjct  306   KDILQGKSIDIYQTQDDKEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKKGPAQLRVY  365

Query  663   NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  484
             NLGNTSPV V KLV ILE LL  KAKK+V+KMPRNGDVP+THANVSLAY+DFGYKP TDL
Sbjct  366   NLGNTSPVPVGKLVGILEGLLGTKAKKHVIKMPRNGDVPYTHANVSLAYRDFGYKPATDL  425

Query  483   SSGLRKFVKWYVSYYGIQSRVKTEL  409
             ++GLRKFVKWYV YYGI  RVK E+
Sbjct  426   AAGLRKFVKWYVGYYGIHPRVKREI  450



>ref|XP_009102574.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Brassica rapa]
Length=454

 Score =   318 bits (816),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 161/204 (79%), Positives = 177/204 (87%), Gaps = 0/204 (0%)
 Frame = -2

Query  1023  PFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFFX  844
             PF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FFF 
Sbjct  243   PFSEEHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFT  302

Query  843   KXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLRVY  664
             K  L GK I++Y TQ+++EVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+GPAQLRVY
Sbjct  303   KDILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGPAQLRVY  362

Query  663   NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  484
             NLGNTSPV V +LVSILE LL  KAKK+++KMPRNGDVP+THANVSLAY+DFGYKPTTDL
Sbjct  363   NLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNGDVPYTHANVSLAYRDFGYKPTTDL  422

Query  483   SSGLRKFVKWYVSYYGIQSRVKTE  412
             ++GLRKFVKWYVSYYGIQ RVK E
Sbjct  423   AAGLRKFVKWYVSYYGIQPRVKKE  446



>ref|XP_004297013.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Fragaria vesca subsp. 
vesca]
Length=451

 Score =   318 bits (815),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 165/204 (81%), Positives = 178/204 (87%), Gaps = 0/204 (0%)
 Frame = -2

Query  1023  PFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFFX  844
             PF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FFF 
Sbjct  245   PFSELHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFT  304

Query  843   KXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLRVY  664
             K  LQGK I+VY T +DKEVARDFTYIDD+VKGC+GALDTAEKSTGSGGKKKGPAQLR+Y
Sbjct  305   KDILQGKTIDVYKTVDDKEVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKKGPAQLRIY  364

Query  663   NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  484
             NLGNTSPV V +LVSILE LL+ KAKK+V+KMPRNGDVP+THANVSLA  DFGYKPTTDL
Sbjct  365   NLGNTSPVPVGRLVSILEALLNSKAKKHVIKMPRNGDVPYTHANVSLALHDFGYKPTTDL  424

Query  483   SSGLRKFVKWYVSYYGIQSRVKTE  412
             +SGLRKFVKWYVSYYGI+SRVKTE
Sbjct  425   ASGLRKFVKWYVSYYGIESRVKTE  448



>emb|CDX92990.1| BnaA03g37120D [Brassica napus]
Length=456

 Score =   318 bits (815),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 160/204 (78%), Positives = 176/204 (86%), Gaps = 0/204 (0%)
 Frame = -2

Query  1023  PFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFFX  844
             PF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FFF 
Sbjct  245   PFSEEHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFT  304

Query  843   KXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLRVY  664
             K  L GK I++Y TQ+++EVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+GPAQLRVY
Sbjct  305   KAILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGPAQLRVY  364

Query  663   NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  484
             NLGNTSPV V +LVSILE LL  KAKK+++KMPRNGDVP+THANVSLAY+DFGYKPTTDL
Sbjct  365   NLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNGDVPYTHANVSLAYRDFGYKPTTDL  424

Query  483   SSGLRKFVKWYVSYYGIQSRVKTE  412
             ++GLRKFVKWYV YYGIQ RVK E
Sbjct  425   ATGLRKFVKWYVGYYGIQPRVKKE  448



>emb|CDY53207.1| BnaC03g74010D [Brassica napus]
Length=455

 Score =   318 bits (814),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 159/204 (78%), Positives = 175/204 (86%), Gaps = 0/204 (0%)
 Frame = -2

Query  1023  PFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFFX  844
             PF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FFF 
Sbjct  244   PFSEEHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFT  303

Query  843   KXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLRVY  664
             K  L GK I++Y TQ+++EVARDFTYIDD+VKGCVGALDTAEKSTGSG KK+GPAQLRVY
Sbjct  304   KAILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGRKKRGPAQLRVY  363

Query  663   NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  484
             NLGNTSPV V +LVSILE LL  KAKK+++KMPRNGDVP+THANVSLAY+DFGYKPTTDL
Sbjct  364   NLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNGDVPYTHANVSLAYRDFGYKPTTDL  423

Query  483   SSGLRKFVKWYVSYYGIQSRVKTE  412
             ++GLRKFVKWYV YYGIQ RVK E
Sbjct  424   ATGLRKFVKWYVGYYGIQPRVKKE  447



>ref|XP_009106288.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Brassica rapa]
Length=460

 Score =   318 bits (814),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 161/204 (79%), Positives = 176/204 (86%), Gaps = 0/204 (0%)
 Frame = -2

Query  1023  PFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFFX  844
             PF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FFF 
Sbjct  249   PFSEEHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFT  308

Query  843   KXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLRVY  664
             K  L GK I++Y TQ+++EVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+GPAQLRVY
Sbjct  309   KAILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGPAQLRVY  368

Query  663   NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  484
             NLGNTSPV V +LVSILE LL  KAKK+++KMPRNGDVP+THANVSLAYKDFGYKPTTDL
Sbjct  369   NLGNTSPVPVGRLVSILEGLLGSKAKKHLIKMPRNGDVPYTHANVSLAYKDFGYKPTTDL  428

Query  483   SSGLRKFVKWYVSYYGIQSRVKTE  412
             ++GLRKFVKWYV YYGIQ RVK E
Sbjct  429   AAGLRKFVKWYVGYYGIQPRVKRE  452



>emb|CDY64583.1| BnaCnng44170D [Brassica napus]
Length=460

 Score =   318 bits (814),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 161/204 (79%), Positives = 176/204 (86%), Gaps = 0/204 (0%)
 Frame = -2

Query  1023  PFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFFX  844
             PF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FFF 
Sbjct  249   PFSEEHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFT  308

Query  843   KXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLRVY  664
             K  L GK I++Y TQ+++EVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+GPAQLRVY
Sbjct  309   KAILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGPAQLRVY  368

Query  663   NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  484
             NLGNTSPV V +LVSILE LL  KAKK+++KMPRNGDVP+THANVSLAYKDFGYKPTTDL
Sbjct  369   NLGNTSPVPVGRLVSILEGLLGSKAKKHLIKMPRNGDVPYTHANVSLAYKDFGYKPTTDL  428

Query  483   SSGLRKFVKWYVSYYGIQSRVKTE  412
             ++GLRKFVKWYV YYGIQ RVK E
Sbjct  429   AAGLRKFVKWYVGYYGIQPRVKRE  452



>emb|CDY18087.1| BnaA01g23480D [Brassica napus]
Length=460

 Score =   317 bits (813),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 161/204 (79%), Positives = 176/204 (86%), Gaps = 0/204 (0%)
 Frame = -2

Query  1023  PFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFFX  844
             PF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FFF 
Sbjct  249   PFSEEHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFT  308

Query  843   KXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLRVY  664
             K  L GK I++Y TQ+++EVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+GPAQLRVY
Sbjct  309   KAILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGPAQLRVY  368

Query  663   NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  484
             NLGNTSPV V +LVSILE LL  KAKK+++KMPRNGDVP+THANVSLAYKDFGYKPTTDL
Sbjct  369   NLGNTSPVPVGRLVSILEGLLGSKAKKHLIKMPRNGDVPYTHANVSLAYKDFGYKPTTDL  428

Query  483   SSGLRKFVKWYVSYYGIQSRVKTE  412
             ++GLRKFVKWYV YYGIQ RVK E
Sbjct  429   AAGLRKFVKWYVGYYGIQPRVKRE  452



>gb|KFK39681.1| hypothetical protein AALP_AA3G275400 [Arabis alpina]
Length=458

 Score =   317 bits (813),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 161/211 (76%), Positives = 178/211 (84%), Gaps = 0/211 (0%)
 Frame = -2

Query  1023  PFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFFX  844
             PF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FFF 
Sbjct  247   PFSEEHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFT  306

Query  843   KXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLRVY  664
             K  L GK I++Y T ++KEVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+GPAQLRVY
Sbjct  307   KDILHGKSIDIYRTADNKEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGPAQLRVY  366

Query  663   NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  484
             NLGNTSPV V +LVSILE LL  KA+K+++KMPRNGDVP+THANVSLAYKDFGYKPTTDL
Sbjct  367   NLGNTSPVPVGRLVSILEGLLGTKARKHLIKMPRNGDVPYTHANVSLAYKDFGYKPTTDL  426

Query  483   SSGLRKFVKWYVSYYGIQSRVKTELHPTHQS  391
             ++GLRKFVKWYVSYYG+Q RVK E     +S
Sbjct  427   AAGLRKFVKWYVSYYGVQPRVKKETSHAEES  457



>emb|CAN83418.1| hypothetical protein VITISV_041351 [Vitis vinifera]
Length=459

 Score =   317 bits (813),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 159/201 (79%), Positives = 178/201 (89%), Gaps = 0/201 (0%)
 Frame = -2

Query  1023  PFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFFX  844
             PF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FFF 
Sbjct  236   PFSELHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFT  295

Query  843   KXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLRVY  664
             K  LQGKPI +Y TQ+DKEVARDFTYIDDVVKGC+GALDTAEKSTGSGGKK+GPAQLR+Y
Sbjct  296   KDILQGKPITIYQTQDDKEVARDFTYIDDVVKGCLGALDTAEKSTGSGGKKRGPAQLRIY  355

Query  663   NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  484
             NLGNTSPV V +LV ILE LL++KAKK+V+KMPRNGDVP+THANVSLAY+DFGYKP+TDL
Sbjct  356   NLGNTSPVPVGRLVGILEGLLNVKAKKHVIKMPRNGDVPYTHANVSLAYRDFGYKPSTDL  415

Query  483   SSGLRKFVKWYVSYYGIQSRV  421
             ++GLR+FVKWYVSYYGIQ+R+
Sbjct  416   ATGLRRFVKWYVSYYGIQTRL  436



>gb|ADB24769.1| UDP-D-glucuronic acid 4-epimerase [Gossypium hirsutum]
Length=454

 Score =   317 bits (811),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 162/211 (77%), Positives = 177/211 (84%), Gaps = 0/211 (0%)
 Frame = -2

Query  1023  PFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFFX  844
             PF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FFF 
Sbjct  243   PFSERDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFT  302

Query  843   KXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLRVY  664
             K  LQGK I++Y T + KEVARDFTYIDDVVKGC+GALDTAEKSTGSG KKKG AQLRVY
Sbjct  303   KDILQGKSIDIYKTHDQKEVARDFTYIDDVVKGCLGALDTAEKSTGSGEKKKGAAQLRVY  362

Query  663   NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  484
             NLGNTSPV V +LVSILE LLS KAKK+V+ MPRNGDVPFTHANV+LA+KDFGYKPTTDL
Sbjct  363   NLGNTSPVPVGRLVSILEGLLSTKAKKHVITMPRNGDVPFTHANVTLAFKDFGYKPTTDL  422

Query  483   SSGLRKFVKWYVSYYGIQSRVKTELHPTHQS  391
             S+GLRKFVKWY+SYYGIQS+ + E   T +S
Sbjct  423   STGLRKFVKWYISYYGIQSKTRKESQATGES  453



>ref|XP_009135867.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Brassica rapa]
Length=456

 Score =   316 bits (810),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 160/204 (78%), Positives = 175/204 (86%), Gaps = 0/204 (0%)
 Frame = -2

Query  1023  PFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFFX  844
             PF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FFF 
Sbjct  245   PFSEEHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFT  304

Query  843   KXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLRVY  664
             K  L GK I++Y TQ+++EVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+GPAQLRVY
Sbjct  305   KAILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGPAQLRVY  364

Query  663   NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  484
             NLGNTSPV V +LVSILE LL  KAKK+++KMPRNGDVPFTHANVSLAY+DFGYKPTTDL
Sbjct  365   NLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNGDVPFTHANVSLAYRDFGYKPTTDL  424

Query  483   SSGLRKFVKWYVSYYGIQSRVKTE  412
             ++GLRKFVKWYV YYGIQ R K E
Sbjct  425   ATGLRKFVKWYVGYYGIQPRGKKE  448



>gb|KJB72008.1| hypothetical protein B456_011G153500 [Gossypium raimondii]
Length=454

 Score =   315 bits (807),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 163/211 (77%), Positives = 177/211 (84%), Gaps = 0/211 (0%)
 Frame = -2

Query  1023  PFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFFX  844
             PF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FFF 
Sbjct  243   PFSERDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFT  302

Query  843   KXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLRVY  664
             K  LQGK I++Y T + KEVARDFTYIDDVVKGC+GALDTAEKSTGSGGKKKG AQLRVY
Sbjct  303   KDILQGKSIDIYKTHDQKEVARDFTYIDDVVKGCLGALDTAEKSTGSGGKKKGAAQLRVY  362

Query  663   NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  484
             NLGNTSPV V +LVSILE LLS KAKK+V+ MPRNGDVPFTHANV+LA+KDFGYKPTTDL
Sbjct  363   NLGNTSPVPVGRLVSILEGLLSTKAKKHVITMPRNGDVPFTHANVTLAFKDFGYKPTTDL  422

Query  483   SSGLRKFVKWYVSYYGIQSRVKTELHPTHQS  391
             S+GLRKFVKWY+SYYGIQS+   E   T +S
Sbjct  423   STGLRKFVKWYISYYGIQSKTGKESQATGES  453



>ref|XP_004138968.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Cucumis sativus]
 gb|KGN61492.1| hypothetical protein Csa_2G146400 [Cucumis sativus]
Length=463

 Score =   315 bits (807),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 161/204 (79%), Positives = 175/204 (86%), Gaps = 0/204 (0%)
 Frame = -2

Query  1023  PFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFFX  844
             PF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FFF 
Sbjct  247   PFSELHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFT  306

Query  843   KXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLRVY  664
             K  LQGK I++Y T + KEVARDFTYIDD+VKGC+GALDTAEKSTGSGGKKKGPAQLR+Y
Sbjct  307   KDILQGKQIDIYKTHDAKEVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKKGPAQLRIY  366

Query  663   NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  484
             NLGNTSPV V KLVS+LENLL+ KAKK+++ MPRNGDVPFTHANVSLA KDFGYKPTTDL
Sbjct  367   NLGNTSPVPVGKLVSVLENLLNTKAKKHIITMPRNGDVPFTHANVSLALKDFGYKPTTDL  426

Query  483   SSGLRKFVKWYVSYYGIQSRVKTE  412
              +GLRKFVKWYV YYGIQSRV+ E
Sbjct  427   PTGLRKFVKWYVGYYGIQSRVRKE  450



>ref|XP_007034225.1| UDP-D-glucuronate 4-epimerase 6 [Theobroma cacao]
 gb|EOY05151.1| UDP-D-glucuronate 4-epimerase 6 [Theobroma cacao]
Length=453

 Score =   315 bits (806),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 163/211 (77%), Positives = 178/211 (84%), Gaps = 0/211 (0%)
 Frame = -2

Query  1023  PFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFFX  844
             PF E  RTDQPA LYA TKKAGEEIAH  NHI+GL+LTG  FF V GPWGRPD   FFF 
Sbjct  242   PFSERDRTDQPASLYAATKKAGEEIAHTYNHIYGLALTGLRFFTVYGPWGRPDMAYFFFT  301

Query  843   KXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLRVY  664
             K  LQGK I++Y TQ+ KEVARDFTYIDDVVKGC+GALDTA KSTGSGGKKKGPAQLRVY
Sbjct  302   KDILQGKSIDIYQTQDQKEVARDFTYIDDVVKGCLGALDTAGKSTGSGGKKKGPAQLRVY  361

Query  663   NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  484
             NLGNTSPV V +LVSILE LL+ KAKK+V+ MPRNGDVPFTHANV+LAYKDFGYKPTTDL
Sbjct  362   NLGNTSPVPVGRLVSILEGLLNTKAKKHVITMPRNGDVPFTHANVTLAYKDFGYKPTTDL  421

Query  483   SSGLRKFVKWYVSYYGIQSRVKTELHPTHQS  391
             ++GLRKFVKWYVSY+GIQ RVK E     +S
Sbjct  422   ATGLRKFVKWYVSYFGIQRRVKKETQHADES  452



>ref|XP_006297629.1| hypothetical protein CARUB_v10013650mg [Capsella rubella]
 gb|EOA30527.1| hypothetical protein CARUB_v10013650mg [Capsella rubella]
Length=462

 Score =   315 bits (806),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 160/204 (78%), Positives = 175/204 (86%), Gaps = 0/204 (0%)
 Frame = -2

Query  1023  PFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFFX  844
             PF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FFF 
Sbjct  251   PFSEEHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFT  310

Query  843   KXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLRVY  664
             K  L GK I++Y TQ+++EVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+G AQLRVY
Sbjct  311   KDILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGQAQLRVY  370

Query  663   NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  484
             NLGNTSPV V +LVSILE LL  KAKK+++KMPRNGDVP+THANVSLAYKDFGYKPTTDL
Sbjct  371   NLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNGDVPYTHANVSLAYKDFGYKPTTDL  430

Query  483   SSGLRKFVKWYVSYYGIQSRVKTE  412
             ++GLRKFVKWYV YYGIQ RVK E
Sbjct  431   AAGLRKFVKWYVGYYGIQPRVKKE  454



>gb|AAN60250.1| unknown [Arabidopsis thaliana]
Length=460

 Score =   315 bits (806),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 162/212 (76%), Positives = 178/212 (84%), Gaps = 2/212 (1%)
 Frame = -2

Query  1023  PFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFFX  844
             PF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FFF 
Sbjct  249   PFSEEHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFT  308

Query  843   KXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLRVY  664
             K  L GK I++Y TQ+++EVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+G AQLRVY
Sbjct  309   KDILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGQAQLRVY  368

Query  663   NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  484
             NLGNTSPV V +LVSILE LL  KAKK+++KMPRNGDVP+THANVSLAYKDFGYKPTTDL
Sbjct  369   NLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNGDVPYTHANVSLAYKDFGYKPTTDL  428

Query  483   SSGLRKFVKWYVSYYGIQSRVKTELHPTHQSD  388
             ++GLRKFVKWYV YYGIQ RVK E   +H  D
Sbjct  429   AAGLRKFVKWYVGYYGIQPRVKKET--SHAED  458



>ref|XP_010488461.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Camelina sativa]
Length=462

 Score =   315 bits (806),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 162/212 (76%), Positives = 178/212 (84%), Gaps = 2/212 (1%)
 Frame = -2

Query  1023  PFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFFX  844
             PF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FFF 
Sbjct  251   PFSEEHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFT  310

Query  843   KXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLRVY  664
             K  L GK I++Y TQ+++EVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+G AQLRVY
Sbjct  311   KDILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGQAQLRVY  370

Query  663   NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  484
             NLGNTSPV V +LVSILE LL  KAKK+++KMPRNGDVP+THANVSLAYKDFGYKPTTDL
Sbjct  371   NLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNGDVPYTHANVSLAYKDFGYKPTTDL  430

Query  483   SSGLRKFVKWYVSYYGIQSRVKTELHPTHQSD  388
             ++GLRKFVKWYV YYGIQ RVK E   +H  D
Sbjct  431   AAGLRKFVKWYVGYYGIQPRVKKET--SHAED  460



>ref|XP_006418833.1| hypothetical protein EUTSA_v10002521mg [Eutrema salsugineum]
 gb|ESQ37269.1| hypothetical protein EUTSA_v10002521mg [Eutrema salsugineum]
Length=461

 Score =   315 bits (806),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 159/204 (78%), Positives = 175/204 (86%), Gaps = 0/204 (0%)
 Frame = -2

Query  1023  PFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFFX  844
             PF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FFF 
Sbjct  250   PFSEEHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFT  309

Query  843   KXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLRVY  664
             K  L GK I++Y TQ+++EVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+GPA LRVY
Sbjct  310   KDILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGPAMLRVY  369

Query  663   NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  484
             NLGNTSPV V +LVSILE LL  KAKK+++KMPRNGDVP+THANVSLAY+DFGYKPTTDL
Sbjct  370   NLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNGDVPYTHANVSLAYRDFGYKPTTDL  429

Query  483   SSGLRKFVKWYVSYYGIQSRVKTE  412
             ++GLRKFVKWYV YYGIQ RVK E
Sbjct  430   AAGLRKFVKWYVGYYGIQPRVKRE  453



>dbj|BAE71216.1| putative NAD dependent epimerase [Trifolium pratense]
Length=451

 Score =   314 bits (805),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 162/204 (79%), Positives = 176/204 (86%), Gaps = 0/204 (0%)
 Frame = -2

Query  1023  PFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFFX  844
             PF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FFF 
Sbjct  236   PFSELDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFT  295

Query  843   KXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLRVY  664
             K  L GK I+VY TQ+ KEVARDFTYIDD+VKGCVGALDTAEKSTGSGGKKKGPAQLR+Y
Sbjct  296   KDILHGKTIDVYQTQDGKEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKKGPAQLRIY  355

Query  663   NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  484
             NLGNTSPV V KLV+ILENLL+ KAKK+V+KMPRNGDVP+THANV+LAY+DFGYKP TDL
Sbjct  356   NLGNTSPVPVGKLVTILENLLTTKAKKHVIKMPRNGDVPYTHANVTLAYRDFGYKPVTDL  415

Query  483   SSGLRKFVKWYVSYYGIQSRVKTE  412
             S+GLRKFVKWYV YYGIQ R+K E
Sbjct  416   STGLRKFVKWYVRYYGIQPRLKKE  439



>ref|NP_189024.1| UDP-D-glucuronate 4-epimerase 6 [Arabidopsis thaliana]
 sp|Q9LIS3.1|GAE6_ARATH RecName: Full=UDP-glucuronate 4-epimerase 6; AltName: Full=UDP-glucuronic 
acid epimerase 6; Short=AtUGlcAE2 [Arabidopsis 
thaliana]
 gb|AAK44025.1|AF370210_1 putative NAD dependent epimerase [Arabidopsis thaliana]
 dbj|BAB03000.1| nucleotide sugar epimerase-like protein [Arabidopsis thaliana]
 gb|AAL07003.1| AT3g23820/F14O13_1 [Arabidopsis thaliana]
 gb|AAL32703.1| nucleotide sugar epimerase-like protein [Arabidopsis thaliana]
 gb|AAM91705.1| putative NAD dependent epimerase [Arabidopsis thaliana]
 emb|CAI53858.1| UDP-D-glucuronate 4-epimerase [Arabidopsis thaliana]
 gb|AEE76818.1| UDP-D-glucuronate 4-epimerase 6 [Arabidopsis thaliana]
 gb|AFI41201.1| UDP-D-glucuronate 4-epimerase 6, partial [Arabidopsis thaliana]
Length=460

 Score =   314 bits (805),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 162/212 (76%), Positives = 178/212 (84%), Gaps = 2/212 (1%)
 Frame = -2

Query  1023  PFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFFX  844
             PF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FFF 
Sbjct  249   PFSEEHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFT  308

Query  843   KXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLRVY  664
             K  L GK I++Y TQ+++EVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+G AQLRVY
Sbjct  309   KDILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGQAQLRVY  368

Query  663   NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  484
             NLGNTSPV V +LVSILE LL  KAKK+++KMPRNGDVP+THANVSLAYKDFGYKPTTDL
Sbjct  369   NLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNGDVPYTHANVSLAYKDFGYKPTTDL  428

Query  483   SSGLRKFVKWYVSYYGIQSRVKTELHPTHQSD  388
             ++GLRKFVKWYV YYGIQ RVK E   +H  D
Sbjct  429   AAGLRKFVKWYVGYYGIQPRVKKET--SHAED  458



>ref|XP_002883465.1| hypothetical protein ARALYDRAFT_898926 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59724.1| hypothetical protein ARALYDRAFT_898926 [Arabidopsis lyrata subsp. 
lyrata]
Length=461

 Score =   315 bits (806),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 160/204 (78%), Positives = 175/204 (86%), Gaps = 0/204 (0%)
 Frame = -2

Query  1023  PFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFFX  844
             PF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FFF 
Sbjct  250   PFSEEHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFT  309

Query  843   KXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLRVY  664
             K  L GK I++Y TQ+++EVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+G AQLRVY
Sbjct  310   KDILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGQAQLRVY  369

Query  663   NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  484
             NLGNTSPV V +LVSILE LL  KAKK+++KMPRNGDVP+THANVSLAYKDFGYKPTTDL
Sbjct  370   NLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNGDVPYTHANVSLAYKDFGYKPTTDL  429

Query  483   SSGLRKFVKWYVSYYGIQSRVKTE  412
             ++GLRKFVKWYV YYGIQ RVK E
Sbjct  430   AAGLRKFVKWYVGYYGIQPRVKKE  453



>ref|XP_008457221.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Cucumis melo]
Length=453

 Score =   314 bits (804),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 161/205 (79%), Positives = 176/205 (86%), Gaps = 0/205 (0%)
 Frame = -2

Query  1023  PFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFFX  844
             PF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FFF 
Sbjct  247   PFSELHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFT  306

Query  843   KXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLRVY  664
             K  LQGK I++Y T + KEVARDFTYIDD+VKGC+GALDTAEKSTGSGGKKKGPAQLR+Y
Sbjct  307   KDILQGKQIDIYKTHDAKEVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKKGPAQLRIY  366

Query  663   NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  484
             NLGNTSPV V KLVS+LENLL+ KAKK+++ MPRNGDVPFTHANVSLA KDFGYKPTTDL
Sbjct  367   NLGNTSPVPVGKLVSVLENLLNTKAKKHIITMPRNGDVPFTHANVSLALKDFGYKPTTDL  426

Query  483   SSGLRKFVKWYVSYYGIQSRVKTEL  409
              +GLRKFVKWYV YYGIQSRVK ++
Sbjct  427   PTGLRKFVKWYVGYYGIQSRVKRKV  451



>ref|XP_010468437.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Camelina sativa]
Length=456

 Score =   312 bits (800),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 159/202 (79%), Positives = 174/202 (86%), Gaps = 0/202 (0%)
 Frame = -2

Query  1023  PFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFFX  844
             PF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FFF 
Sbjct  251   PFSEEHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFT  310

Query  843   KXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLRVY  664
             K  L GK I++Y TQ+++EVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+G AQLRVY
Sbjct  311   KDILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGQAQLRVY  370

Query  663   NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  484
             NLGNTSPV V +LVSILE LL  KAKK+++KMPRNGDVP+THANVSLAYKDFGYKPTTDL
Sbjct  371   NLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNGDVPYTHANVSLAYKDFGYKPTTDL  430

Query  483   SSGLRKFVKWYVSYYGIQSRVK  418
             ++GLRKFVKWYV YYGIQ RVK
Sbjct  431   AAGLRKFVKWYVGYYGIQPRVK  452



>gb|KDO42082.1| hypothetical protein CISIN_1g011841mg [Citrus sinensis]
Length=469

 Score =   313 bits (801),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 156/206 (76%), Positives = 173/206 (84%), Gaps = 7/206 (3%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             +VPF E+ RTDQPA LYA TKKAGEEIAH  NHI+GL+LTG  FF V GPWGRPD   FF
Sbjct  254   QVPFSESHRTDQPASLYAATKKAGEEIAHTYNHIYGLALTGLRFFTVYGPWGRPDMAYFF  313

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  LQGK I+VY TQ+D+EVARDFTYIDDVVKGCVGA  +        GKK+GPAQLR
Sbjct  314   FTKDILQGKTIDVYKTQDDREVARDFTYIDDVVKGCVGATGSG-------GKKRGPAQLR  366

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             VYNLGNTSPV V +LVSILENLL+ KAKK+V++MPRNGDVP+THANVSLAYKDFGYKPTT
Sbjct  367   VYNLGNTSPVPVGRLVSILENLLNTKAKKHVIRMPRNGDVPYTHANVSLAYKDFGYKPTT  426

Query  489   DLSSGLRKFVKWYVSYYGIQSRVKTE  412
             DL++GLRKFVKWYVSYYGIQ RVK E
Sbjct  427   DLAAGLRKFVKWYVSYYGIQPRVKKE  452



>ref|XP_003538527.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Glycine max]
Length=462

 Score =   311 bits (796),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 160/206 (78%), Positives = 174/206 (84%), Gaps = 0/206 (0%)
 Frame = -2

Query  1023  PFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFFX  844
             PF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FFF 
Sbjct  253   PFSELHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFT  312

Query  843   KXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLRVY  664
             K  LQGK I+VY TQE K+VARDFTYIDD+VKGC+GALDTA+KSTGSGGKKKGPAQLRVY
Sbjct  313   KDILQGKTIDVYQTQEGKQVARDFTYIDDIVKGCLGALDTAQKSTGSGGKKKGPAQLRVY  372

Query  663   NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  484
             NLGNTSPV V  LVSILE LLS KAKK+V+KMP NGDVPFTHANVSLAY+DF Y PTTDL
Sbjct  373   NLGNTSPVPVGTLVSILEGLLSTKAKKHVIKMPSNGDVPFTHANVSLAYRDFSYNPTTDL  432

Query  483   SSGLRKFVKWYVSYYGIQSRVKTELH  406
             ++GLRKFVKWY+ YYG+Q R+K E H
Sbjct  433   ATGLRKFVKWYLGYYGLQQRLKKEYH  458



>gb|ADB24770.1| UDP-D-glucuronic acid 4-epimerase [Gossypium hirsutum]
 gb|KJB28114.1| hypothetical protein B456_005G028000 [Gossypium raimondii]
Length=453

 Score =   310 bits (795),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 160/204 (78%), Positives = 176/204 (86%), Gaps = 0/204 (0%)
 Frame = -2

Query  1023  PFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFFX  844
             PF E  RTD+PA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FFF 
Sbjct  242   PFSERDRTDRPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFT  301

Query  843   KXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLRVY  664
             K  LQGKPI++Y TQ+ K VARDFTYIDDVVKGC+GALDTAEKSTGSGGKKKGPAQLRVY
Sbjct  302   KDILQGKPIDIYRTQDQKAVARDFTYIDDVVKGCLGALDTAEKSTGSGGKKKGPAQLRVY  361

Query  663   NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  484
             NLGNTSPV V +LVSILE LL+ KAKK+VV +PRNGDVP+THANV+LAYKDFGYKPTTDL
Sbjct  362   NLGNTSPVPVGRLVSILEGLLNTKAKKHVVTLPRNGDVPYTHANVTLAYKDFGYKPTTDL  421

Query  483   SSGLRKFVKWYVSYYGIQSRVKTE  412
             SSGLRKFVKWYV+Y+GI+S+   E
Sbjct  422   SSGLRKFVKWYVNYFGIESKHSKE  445



>ref|XP_003524930.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like isoform X1 [Glycine 
max]
Length=416

 Score =   308 bits (788),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 174/204 (85%), Gaps = 0/204 (0%)
 Frame = -2

Query  1023  PFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFFX  844
             PF E  RTDQPA LYA TKKAGE IAH  NHI+GLSLTG  FF V GPWGRPD   FFF 
Sbjct  208   PFSELHRTDQPASLYAATKKAGEAIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFT  267

Query  843   KXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLRVY  664
             K  LQGKPI+VY TQ+++EVARDFTYIDDVVKGC+GALDTAEKSTG GGKK G AQLRVY
Sbjct  268   KSILQGKPIDVYQTQDEREVARDFTYIDDVVKGCLGALDTAEKSTGGGGKKHGAAQLRVY  327

Query  663   NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  484
             NLGNTSPV V KLVS+LE LL +KAKK+V+KMPRNGDVPFTHANVSLA++DFGYKPTTDL
Sbjct  328   NLGNTSPVPVGKLVSVLETLLRVKAKKHVIKMPRNGDVPFTHANVSLAWRDFGYKPTTDL  387

Query  483   SSGLRKFVKWYVSYYGIQSRVKTE  412
             ++GLRKFV+WYV YYG++  V+ E
Sbjct  388   ATGLRKFVQWYVGYYGVRLGVEKE  411



>ref|XP_010673389.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Beta vulgaris subsp. 
vulgaris]
Length=449

 Score =   308 bits (788),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 173/204 (85%), Gaps = 0/204 (0%)
 Frame = -2

Query  1023  PFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFFX  844
             PF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FFF 
Sbjct  239   PFSETDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFT  298

Query  843   KXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLRVY  664
             K  LQGKPI++Y T + +EV RDFTYIDD+VKGCVGALDTAEKSTGSGGKK+GPAQLRVY
Sbjct  299   KDILQGKPISIYKTHDGEEVQRDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGPAQLRVY  358

Query  663   NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  484
             NLGNTSPV V +LVSILE LL++KAKK+++ MPRNGDVP+THANV+LA KDF YKPTTDL
Sbjct  359   NLGNTSPVPVARLVSILEGLLNVKAKKHLITMPRNGDVPYTHANVTLARKDFAYKPTTDL  418

Query  483   SSGLRKFVKWYVSYYGIQSRVKTE  412
             ++GLRKFVKWYV YYG+Q  VK E
Sbjct  419   ATGLRKFVKWYVGYYGVQPSVKKE  442



>ref|XP_010023657.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Eucalyptus grandis]
 gb|KCW59958.1| hypothetical protein EUGRSUZ_H02683 [Eucalyptus grandis]
Length=459

 Score =   303 bits (776),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 152/204 (75%), Positives = 172/204 (84%), Gaps = 0/204 (0%)
 Frame = -2

Query  1023  PFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFFX  844
             PF E  RTD+PA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FFF 
Sbjct  239   PFSELHRTDRPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFT  298

Query  843   KXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLRVY  664
             K  LQGKPI+VY T +  EVARDFTYIDDVV+GC+GALDTA+KSTGSGG+KK PAQLRVY
Sbjct  299   KDILQGKPIDVYRTHDQHEVARDFTYIDDVVRGCLGALDTAQKSTGSGGRKKAPAQLRVY  358

Query  663   NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  484
             NLGNTSPV V +LV ILE+LL  KAK++V+ MPRNGDVPFTHANV+LA +DFGYKPTTDL
Sbjct  359   NLGNTSPVPVGRLVGILESLLGTKAKRHVITMPRNGDVPFTHANVTLAGRDFGYKPTTDL  418

Query  483   SSGLRKFVKWYVSYYGIQSRVKTE  412
             ++GLRKFVKWYVSYYG++ R K +
Sbjct  419   ATGLRKFVKWYVSYYGVEPRSKKD  442



>ref|XP_007163818.1| hypothetical protein PHAVU_001G267000g [Phaseolus vulgaris]
 gb|ESW35812.1| hypothetical protein PHAVU_001G267000g [Phaseolus vulgaris]
Length=437

 Score =   302 bits (774),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 171/204 (84%), Gaps = 0/204 (0%)
 Frame = -2

Query  1023  PFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFFX  844
             PF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FFF 
Sbjct  229   PFSELHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFT  288

Query  843   KXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLRVY  664
             K  LQGK I+VY TQ+ K+VARDFTYIDD+VKGC+GALDTAEKSTGSGGKK+GPAQLR+Y
Sbjct  289   KDILQGKTIDVYQTQDGKQVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRGPAQLRIY  348

Query  663   NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  484
             NLGNTSPV V  LVSILENLL+ KAK++V+KMP NGDVP+THANVS A++DF YKPTTDL
Sbjct  349   NLGNTSPVPVGNLVSILENLLNTKAKRHVIKMPSNGDVPYTHANVSQAFRDFSYKPTTDL  408

Query  483   SSGLRKFVKWYVSYYGIQSRVKTE  412
              SGLRKFVKWYV YYG Q R K E
Sbjct  409   PSGLRKFVKWYVGYYGPQLRPKKE  432



>ref|XP_006373087.1| hypothetical protein POPTR_0017s08580g [Populus trichocarpa]
 gb|ERP50884.1| hypothetical protein POPTR_0017s08580g [Populus trichocarpa]
Length=462

 Score =   302 bits (773),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 155/197 (79%), Positives = 171/197 (87%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             +VPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  239   QVPFSELDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  298

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  LQGKPI+VY TQ+ K+VARDFTYIDDVVKGC+GALDTAEKSTGSGGKKKGPAQLR
Sbjct  299   FTKDILQGKPIDVYQTQDKKQVARDFTYIDDVVKGCLGALDTAEKSTGSGGKKKGPAQLR  358

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             VYNLGNTSPV V KLVSILE LL  KA+K+V+KMPRNGDVP+THANV+LAY+DFGYKPTT
Sbjct  359   VYNLGNTSPVPVGKLVSILEGLLRTKARKHVIKMPRNGDVPYTHANVTLAYRDFGYKPTT  418

Query  489   DLSSGLRKFVKWYVSYY  439
             DL++GLRKFVKWY+  +
Sbjct  419   DLATGLRKFVKWYIKLW  435



>ref|XP_003532740.2| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Glycine max]
Length=493

 Score =   303 bits (775),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 154/207 (74%), Positives = 173/207 (84%), Gaps = 1/207 (0%)
 Frame = -2

Query  1023  PFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFFX  844
             PF E  RTDQPA LYA TKKAGE IAH  NHI+GLSLTG  FF V GPWGRPD   FFF 
Sbjct  283   PFSELHRTDQPASLYAATKKAGEAIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFT  342

Query  843   KXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkst-gsggkkkGPAQLRV  667
             K  LQ KPI+VY T +++EVARDFTYIDDVVKGC+GALDTAEKST G  GKK+GPAQLRV
Sbjct  343   KSILQRKPIDVYQTHDEREVARDFTYIDDVVKGCLGALDTAEKSTGGVVGKKRGPAQLRV  402

Query  666   YNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTD  487
             YNLGNTSPV V KLVS+LE LL +KAKK+V+KMPRNGDVPFTHANVSLA++D GYKPTTD
Sbjct  403   YNLGNTSPVPVGKLVSVLETLLGVKAKKHVIKMPRNGDVPFTHANVSLAWRDLGYKPTTD  462

Query  486   LSSGLRKFVKWYVSYYGIQSRVKTELH  406
             L++GLRKFV+WYV YYG++  V+ E H
Sbjct  463   LAAGLRKFVQWYVGYYGVRLGVEKEKH  489



>gb|AGV54436.1| UDP-D-glucuronic acid 4-epimerase [Phaseolus vulgaris]
Length=437

 Score =   300 bits (767),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 170/204 (83%), Gaps = 0/204 (0%)
 Frame = -2

Query  1023  PFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFFX  844
             PF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FFF 
Sbjct  229   PFFELHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFT  288

Query  843   KXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLRVY  664
             K  LQGK I+VY TQ+ K+VARDFTYIDD+VKGC+GALDTAEKSTGSGGKK+GPAQ R+Y
Sbjct  289   KDILQGKTIDVYQTQDGKQVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRGPAQFRIY  348

Query  663   NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  484
             NLGNTSPV V  LVSILENLL+ KAK++V+KMP NGDVP+THANVS A++DF YKPTTDL
Sbjct  349   NLGNTSPVPVGNLVSILENLLNTKAKRHVIKMPSNGDVPYTHANVSQAFRDFSYKPTTDL  408

Query  483   SSGLRKFVKWYVSYYGIQSRVKTE  412
              SGLRKFVKWYV YYG Q R K E
Sbjct  409   PSGLRKFVKWYVGYYGPQLRPKKE  432



>gb|AHA84281.1| UDP-glucuronate 4-epimerase 6 [Phaseolus vulgaris]
Length=444

 Score =   293 bits (749),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 168/205 (82%), Gaps = 0/205 (0%)
 Frame = -2

Query  1023  PFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFFX  844
             PF E   TDQPA LYA  KK GEEIAH  NHI+GLSLTG  FF V GPWGRPD   FFF 
Sbjct  229   PFSELHPTDQPASLYAAPKKGGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFT  288

Query  843   KXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLRVY  664
             K  LQGK I+VY TQ+ K+VARDFTYIDD+VKGC+GALDTAEKSTGSGGKK+GPAQLR+Y
Sbjct  289   KDILQGKTIDVYQTQDGKQVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRGPAQLRIY  348

Query  663   NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  484
             NLGNTSPV V  LVSILENLL+ KAK++V+KMP NGDVP+THANVS A++DF YKPTTDL
Sbjct  349   NLGNTSPVPVGNLVSILENLLNTKAKRHVIKMPSNGDVPYTHANVSQAFRDFFYKPTTDL  408

Query  483   SSGLRKFVKWYVSYYGIQSRVKTEL  409
              SGLRKFVKWYV YYG Q R K E 
Sbjct  409   PSGLRKFVKWYVGYYGPQLRPKKEF  433



>ref|XP_006580148.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like isoform X2 [Glycine 
max]
Length=405

 Score =   289 bits (739),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 163/189 (86%), Gaps = 0/189 (0%)
 Frame = -2

Query  1023  PFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFFX  844
             PF E  RTDQPA LYA TKKAGE IAH  NHI+GLSLTG  FF V GPWGRPD   FFF 
Sbjct  208   PFSELHRTDQPASLYAATKKAGEAIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFT  267

Query  843   KXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLRVY  664
             K  LQGKPI+VY TQ+++EVARDFTYIDDVVKGC+GALDTAEKSTG GGKK G AQLRVY
Sbjct  268   KSILQGKPIDVYQTQDEREVARDFTYIDDVVKGCLGALDTAEKSTGGGGKKHGAAQLRVY  327

Query  663   NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  484
             NLGNTSPV V KLVS+LE LL +KAKK+V+KMPRNGDVPFTHANVSLA++DFGYKPTTDL
Sbjct  328   NLGNTSPVPVGKLVSVLETLLRVKAKKHVIKMPRNGDVPFTHANVSLAWRDFGYKPTTDL  387

Query  483   SSGLRKFVK  457
             ++GLRKFV+
Sbjct  388   ATGLRKFVQ  396



>gb|EYU31498.1| hypothetical protein MIMGU_mgv1a008581mg [Erythranthe guttata]
Length=369

 Score =   287 bits (735),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 144/210 (69%), Positives = 158/210 (75%), Gaps = 1/210 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             +VPF EN RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  152   EVPFSENHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  211

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGP-AQL  673
             F K  L GK INVYVTQ++KEVARDFTYIDD+VKGCVGAL+   +      ++  P A  
Sbjct  212   FTKDILHGKGINVYVTQDEKEVARDFTYIDDIVKGCVGALEHGGEEHRKRREEARPGAAP  271

Query  672   RVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPT  493
              +   G   P     LV ILE LL  KAKK VVKMPRNGDVP+THANVSLAYKDFGYKPT
Sbjct  272   GLQPWGTPPPSPSESLVGILETLLGTKAKKRVVKMPRNGDVPYTHANVSLAYKDFGYKPT  331

Query  492   TDLSSGLRKFVKWYVSYYGIQSRVKTELHP  403
             TDL++GLRKFVKWYVSYYGI+SRVK E  P
Sbjct  332   TDLATGLRKFVKWYVSYYGIESRVKKENEP  361



>gb|ABR16292.1| unknown [Picea sitchensis]
Length=437

 Score =   288 bits (737),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 167/203 (82%), Gaps = 0/203 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E+ RTDQPA LYA TKKAGEEIAH  NHI+GLS+TG  FF V GPWGRPD   FF
Sbjct  232   KVPFSESDRTDQPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  291

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  LQGK I+VY      +VARDFTYIDD+ KGCV ALDTA+KSTGSGGKKKGPAQLR
Sbjct  292   FTKDILQGKSIDVYQGLNKVDVARDFTYIDDIAKGCVAALDTAKKSTGSGGKKKGPAQLR  351

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             +YNLGNTSPVSV  LV+ILE LL +KAKKN++ MP NGDVPFTHANVSLA+ + GY+PTT
Sbjct  352   IYNLGNTSPVSVPDLVNILERLLKVKAKKNIISMPSNGDVPFTHANVSLAHTELGYQPTT  411

Query  489   DLSSGLRKFVKWYVSYYGIQSRV  421
             DL +GL+KFVKWY+SYYG+  R+
Sbjct  412   DLQTGLKKFVKWYLSYYGVPGRI  434



>ref|XP_009133725.1| PREDICTED: UDP-glucuronate 4-epimerase 4 [Brassica rapa]
Length=435

 Score =   287 bits (734),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 144/197 (73%), Positives = 164/197 (83%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  230   KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  289

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  L+GK I+++ +     VARDFTYIDD+VKGC+GALDTAEKSTG+GGKK+GPAQLR
Sbjct  290   FTKDILKGKSISIFESANHGTVARDFTYIDDIVKGCLGALDTAEKSTGTGGKKRGPAQLR  349

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LVSILE  L +KAKKNV+KMPRNGDVPFTHAN+SLA ++ GYKPTT
Sbjct  350   VFNLGNTSPVPVSDLVSILERQLKVKAKKNVIKMPRNGDVPFTHANISLAQRELGYKPTT  409

Query  489   DLSSGLRKFVKWYVSYY  439
             DL +GL+KFV+WY+SYY
Sbjct  410   DLQTGLKKFVRWYLSYY  426



>emb|CDY67756.1| BnaA03g56770D [Brassica napus]
Length=435

 Score =   287 bits (734),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 144/197 (73%), Positives = 164/197 (83%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  230   KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  289

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  L+GK I+++ +     VARDFTYIDD+VKGC+GALDTAEKSTG+GGKK+GPAQLR
Sbjct  290   FTKDILKGKSISIFESANHGTVARDFTYIDDIVKGCLGALDTAEKSTGTGGKKRGPAQLR  349

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LVSILE  L +KAKKNV+KMPRNGDVPFTHAN+SLA ++ GYKPTT
Sbjct  350   VFNLGNTSPVPVSDLVSILERQLKVKAKKNVIKMPRNGDVPFTHANISLAQRELGYKPTT  409

Query  489   DLSSGLRKFVKWYVSYY  439
             DL +GL+KFV+WY+SYY
Sbjct  410   DLQTGLKKFVRWYLSYY  426



>emb|CDX95646.1| BnaC03g25270D [Brassica napus]
Length=435

 Score =   286 bits (732),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 143/197 (73%), Positives = 164/197 (83%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  230   KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  289

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  L+GK I+++ +     VARDFTYIDD+VKGC+GALDTAEKSTG+GGKK+GPAQLR
Sbjct  290   FTKDILKGKSISIFESANHGTVARDFTYIDDIVKGCLGALDTAEKSTGTGGKKRGPAQLR  349

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LVSILE  L +KAK+NV+KMPRNGDVPFTHAN+SLA ++ GYKPTT
Sbjct  350   VFNLGNTSPVPVSDLVSILERQLKVKAKRNVIKMPRNGDVPFTHANISLAQRELGYKPTT  409

Query  489   DLSSGLRKFVKWYVSYY  439
             DL +GL+KFV+WY+SYY
Sbjct  410   DLQTGLKKFVRWYLSYY  426



>ref|XP_002301280.2| hypothetical protein POPTR_0002s14750g [Populus trichocarpa]
 gb|EEE80553.2| hypothetical protein POPTR_0002s14750g [Populus trichocarpa]
Length=435

 Score =   283 bits (725),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 146/203 (72%), Positives = 166/203 (82%), Gaps = 0/203 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  231   KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVFGPWGRPDMAYFF  290

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  L+GK I ++       VARDFTYIDD+VKGC+G+LDTAEKSTGSGGKKKGPAQLR
Sbjct  291   FTKDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLGSLDTAEKSTGSGGKKKGPAQLR  350

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LVSILE LL +KAK+NV+K+PRNGDVP+THAN+S A K+FGYKPTT
Sbjct  351   VFNLGNTSPVPVTDLVSILERLLKVKAKRNVMKLPRNGDVPYTHANISYAQKEFGYKPTT  410

Query  489   DLSSGLRKFVKWYVSYYGIQSRV  421
             DL +GL+KFV+WY+SYYG +  V
Sbjct  411   DLQTGLKKFVRWYLSYYGDKKAV  433



>ref|XP_006295696.1| hypothetical protein CARUB_v10024814mg [Capsella rubella]
 gb|EOA28594.1| hypothetical protein CARUB_v10024814mg [Capsella rubella]
Length=436

 Score =   283 bits (724),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 165/203 (81%), Gaps = 0/203 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  231   KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  290

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  L+GK I+++ +     VARDFTYIDD+VKGC+ +LDTAEKSTG+GGKK+GPAQLR
Sbjct  291   FTKDILKGKSISIFESANHGTVARDFTYIDDIVKGCLASLDTAEKSTGTGGKKRGPAQLR  350

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LVSILE  L +KAKKN++KMPRNGDVP+THAN+SLA ++ GYKPTT
Sbjct  351   VFNLGNTSPVPVSDLVSILERQLKVKAKKNLIKMPRNGDVPYTHANISLAQRELGYKPTT  410

Query  489   DLSSGLRKFVKWYVSYYGIQSRV  421
             DL +GL+KFV+WY+SYY  Q + 
Sbjct  411   DLQTGLKKFVRWYLSYYSGQKKA  433



>gb|ABK25339.1| unknown [Picea sitchensis]
Length=430

 Score =   283 bits (723),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 144/201 (72%), Positives = 165/201 (82%), Gaps = 0/201 (0%)
 Frame = -2

Query  1023  PFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFFX  844
             PF E+ RTDQPA LYA +KKAGE IAH  NHI+GLS+TG  FF V GPWGRPD   FFF 
Sbjct  227   PFSEHDRTDQPASLYAASKKAGEAIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFFFT  286

Query  843   KXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLRVY  664
             K  LQGK I ++      +VARDFTYIDD+VKGCVGALDTAEKSTGSG KKKGPAQLR+Y
Sbjct  287   KDILQGKTIPIFQGPNQVDVARDFTYIDDIVKGCVGALDTAEKSTGSGEKKKGPAQLRIY  346

Query  663   NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  484
             NLGNTSPVSV +LV ILE LL +KAKKNV++MP NGDVPFTHANV+LA  + GYKPTTDL
Sbjct  347   NLGNTSPVSVPELVRILEELLKVKAKKNVLRMPSNGDVPFTHANVTLASMELGYKPTTDL  406

Query  483   SSGLRKFVKWYVSYYGIQSRV  421
             ++GL+KFVKWY+SYYG+  R+
Sbjct  407   ATGLKKFVKWYLSYYGVPGRI  427



>ref|XP_011034154.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Populus euphratica]
Length=431

 Score =   283 bits (723),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 145/203 (71%), Positives = 165/203 (81%), Gaps = 0/203 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  227   KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  286

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  L GK I ++       VARDFTYIDD+VKGC+G+LDTAEKSTGSGGKKKGPAQLR
Sbjct  287   FTKDILNGKTIPIFEAANHGNVARDFTYIDDIVKGCLGSLDTAEKSTGSGGKKKGPAQLR  346

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LVSILE LL +KAK+N++K+PRNGDVP+THAN+S A K+FGYKPTT
Sbjct  347   VFNLGNTSPVPVTDLVSILERLLKVKAKRNIMKLPRNGDVPYTHANISYAQKEFGYKPTT  406

Query  489   DLSSGLRKFVKWYVSYYGIQSRV  421
             DL +GL+KFV+WY+SYYG +  V
Sbjct  407   DLQTGLKKFVRWYLSYYGNKKAV  429



>ref|XP_010506472.1| PREDICTED: UDP-glucuronate 4-epimerase 4 [Camelina sativa]
Length=444

 Score =   283 bits (723),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 141/197 (72%), Positives = 162/197 (82%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  237   KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  296

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  L+GK I+++ +     VARDFTYIDD+VKGC+ +LDTAEKSTG+GGKK+GPAQLR
Sbjct  297   FTKDILKGKSISIFESANHGTVARDFTYIDDIVKGCLASLDTAEKSTGTGGKKRGPAQLR  356

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LV ILE  L +KAKKNV+KMPRNGDVPFTHAN+SLA ++ GYKPTT
Sbjct  357   VFNLGNTSPVPVSDLVRILERQLKVKAKKNVIKMPRNGDVPFTHANISLAQRELGYKPTT  416

Query  489   DLSSGLRKFVKWYVSYY  439
             DL +GL+KFV+WY+SYY
Sbjct  417   DLQTGLKKFVRWYLSYY  433



>ref|XP_010506473.1| PREDICTED: UDP-glucuronate 4-epimerase 4-like [Camelina sativa]
Length=442

 Score =   282 bits (722),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 141/197 (72%), Positives = 162/197 (82%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  235   KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  294

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  L+GK I+++ +     VARDFTYIDD+VKGC+ +LDTAEKSTG+GGKK+GPAQLR
Sbjct  295   FTKDILKGKSISIFESANHGTVARDFTYIDDIVKGCLASLDTAEKSTGTGGKKRGPAQLR  354

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LV ILE  L +KAKKNV+KMPRNGDVPFTHAN+SLA ++ GYKPTT
Sbjct  355   VFNLGNTSPVPVSDLVRILERQLKVKAKKNVIKMPRNGDVPFTHANISLAQRELGYKPTT  414

Query  489   DLSSGLRKFVKWYVSYY  439
             DL +GL+KFV+WY+SYY
Sbjct  415   DLQTGLKKFVRWYLSYY  431



>ref|XP_009781927.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Nicotiana sylvestris]
Length=408

 Score =   281 bits (719),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 166/205 (81%), Gaps = 0/205 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLS+TG  FF V GPWGRPD   FF
Sbjct  202   KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  261

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  L+GK INV+    +K VARDFTYIDD+VKGC+GALDTAEKSTGSGGKKKG AQLR
Sbjct  262   FTKDILKGKSINVFEGSNNKSVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKKGNAQLR  321

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V KLVSILE LL +KAKKNV+ +PRNGDV FTHAN+S A+K+FGYKPTT
Sbjct  322   VFNLGNTSPVPVTKLVSILEKLLKVKAKKNVLPLPRNGDVMFTHANISYAHKEFGYKPTT  381

Query  489   DLSSGLRKFVKWYVSYYGIQSRVKT  415
             +L  GL+KFV WY+ YY +  + K+
Sbjct  382   NLQMGLQKFVNWYLDYYSVSEKKKS  406



>ref|XP_011017483.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Populus euphratica]
Length=435

 Score =   281 bits (718),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 144/203 (71%), Positives = 164/203 (81%), Gaps = 0/203 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  231   KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  290

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  L+GK I ++       VARDFTYIDD+VKGC+G+LDTAEKSTGSGGKKK PAQLR
Sbjct  291   FTKDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLGSLDTAEKSTGSGGKKKRPAQLR  350

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LVSILE LL +KAK+NV+K+PRNGDVP+THAN+S A K+FGYK TT
Sbjct  351   VFNLGNTSPVPVTDLVSILERLLKVKAKRNVMKLPRNGDVPYTHANISYAQKEFGYKATT  410

Query  489   DLSSGLRKFVKWYVSYYGIQSRV  421
             DL +GL+KFV+WY+SYYG +  V
Sbjct  411   DLQTGLKKFVRWYLSYYGDKKAV  433



>ref|XP_006397710.1| hypothetical protein EUTSA_v10001454mg [Eutrema salsugineum]
 gb|ESQ39163.1| hypothetical protein EUTSA_v10001454mg [Eutrema salsugineum]
Length=435

 Score =   281 bits (718),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 142/197 (72%), Positives = 162/197 (82%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  +TDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  230   KVPFSEKDKTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  289

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  L+GK I+++ +     VARDFTYIDD+VKGC+ ALDTAEKSTGSGGKK+GPAQLR
Sbjct  290   FTKDILKGKSISIFESANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKRGPAQLR  349

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LVSILE  L +KAK+NV+KMPRNGDVPFTHAN+SLA  + GYKPTT
Sbjct  350   VFNLGNTSPVPVSDLVSILERQLKVKAKRNVIKMPRNGDVPFTHANISLAQHELGYKPTT  409

Query  489   DLSSGLRKFVKWYVSYY  439
             DL +GL+KFV+WY+SYY
Sbjct  410   DLQTGLKKFVRWYLSYY  426



>ref|XP_006848494.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Amborella trichopoda]
 gb|ERN10075.1| hypothetical protein AMTR_s00013p00257170 [Amborella trichopoda]
Length=446

 Score =   281 bits (718),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 139/200 (70%), Positives = 165/200 (83%), Gaps = 0/200 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             K PF E  RTD+PA LYA TKK+GE IAH  NHI+GLSLT   FF V GPWGRPD   F 
Sbjct  230   KAPFSEVDRTDRPASLYAATKKSGEAIAHAYNHIYGLSLTALRFFTVYGPWGRPDMAYFS  289

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  LQGK I ++   + ++VARDFTYIDD+V+GC+GALDTA++STGSGG+K+GPAQLR
Sbjct  290   FTKDILQGKAITIFERADGQDVARDFTYIDDIVRGCIGALDTAQRSTGSGGRKRGPAQLR  349

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             VYNLGNTSPV+V+ LV ILE LL + AKKNVV+MP NGDVPFTHANVS + +DFGY+PTT
Sbjct  350   VYNLGNTSPVTVKGLVGILEGLLGLTAKKNVVRMPGNGDVPFTHANVSSSVRDFGYRPTT  409

Query  489   DLSSGLRKFVKWYVSYYGIQ  430
             DL++GLRKFVKWYV+YYGI+
Sbjct  410   DLATGLRKFVKWYVNYYGIK  429



>ref|XP_002320057.1| UDP-D-GLUCURONATE 4-EPIMERASE 3 family protein [Populus trichocarpa]
 gb|EEE98372.1| UDP-D-GLUCURONATE 4-EPIMERASE 3 family protein [Populus trichocarpa]
Length=431

 Score =   280 bits (717),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 144/203 (71%), Positives = 164/203 (81%), Gaps = 0/203 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  227   KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  286

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  L GK I ++       VARDFTYIDD+VKGC+G+LDTAEKSTGSGGKKKGPAQLR
Sbjct  287   FTKDILNGKTIPIFEAANHGNVARDFTYIDDIVKGCLGSLDTAEKSTGSGGKKKGPAQLR  346

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LVSILE LL +KAK+ ++K+PRNGDVP+THAN+S A K+FGYKPTT
Sbjct  347   VFNLGNTSPVPVTDLVSILERLLKVKAKRKIMKLPRNGDVPYTHANISYAQKEFGYKPTT  406

Query  489   DLSSGLRKFVKWYVSYYGIQSRV  421
             DL +GL+KFV+WY+SYYG +  V
Sbjct  407   DLQTGLKKFVRWYLSYYGNKKAV  429



>dbj|BAF00333.1| putative nucleotide sugar epimerase [Arabidopsis thaliana]
Length=292

 Score =   275 bits (704),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 139/197 (71%), Positives = 162/197 (82%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  85    KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  144

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GK I+++       VARDFTYIDD+VKGC+GALDTAEKSTGSGGKK+G AQLR
Sbjct  145   FTRDILKGKAISIFEGANHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRGAAQLR  204

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LVSILE LL +KAK+N++K+PRNGDVPFTHAN+S A ++FGYKP+T
Sbjct  205   VFNLGNTSPVPVTDLVSILERLLKVKAKRNMMKLPRNGDVPFTHANISSAQREFGYKPST  264

Query  489   DLSSGLRKFVKWYVSYY  439
             DL +GL+KFV+WY+ YY
Sbjct  265   DLQTGLKKFVRWYLGYY  281



>ref|XP_004248561.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum lycopersicum]
Length=435

 Score =   280 bits (717),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 142/198 (72%), Positives = 165/198 (83%), Gaps = 0/198 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E+ RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  231   KVPFSESDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  290

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GK I+++   +   VARDFTYIDD+VKGC+GALDTAEKSTGSGGKKKGPAQLR
Sbjct  291   FTRDMLKGKSISIFEGADHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKKGPAQLR  350

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LV+ILE LL +KAK+ V+K+PRNGDV FTHAN+SLA ++ GYKPTT
Sbjct  351   VFNLGNTSPVPVSDLVTILERLLKVKAKRAVMKLPRNGDVQFTHANISLAQRELGYKPTT  410

Query  489   DLSSGLRKFVKWYVSYYG  436
             DL +GL+KFV+WY+SYYG
Sbjct  411   DLQTGLKKFVRWYLSYYG  428



>ref|XP_002880171.1| UDP-D-glucuronate 4-epimerase 4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56430.1| UDP-D-glucuronate 4-epimerase 4 [Arabidopsis lyrata subsp. lyrata]
Length=437

 Score =   280 bits (717),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 141/197 (72%), Positives = 162/197 (82%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  +TDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  232   KVPFSEKDKTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  291

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  L+GK I+++ +     VARDFTYIDD+VKGC+ ALDTAEKSTGSGGKK+GPAQLR
Sbjct  292   FTKDILKGKSISIFESANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKRGPAQLR  351

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LV ILE  L +KAKKN++KMPRNGDVPFTHAN+SLA ++ GYKPTT
Sbjct  352   VFNLGNTSPVPVSDLVRILERQLKVKAKKNLIKMPRNGDVPFTHANISLAQRELGYKPTT  411

Query  489   DLSSGLRKFVKWYVSYY  439
             DL +GL+KFV+WY+SYY
Sbjct  412   DLQTGLKKFVRWYLSYY  428



>ref|XP_004234942.1| PREDICTED: UDP-glucuronate 4-epimerase 2-like [Solanum lycopersicum]
Length=406

 Score =   279 bits (714),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 142/202 (70%), Positives = 163/202 (81%), Gaps = 0/202 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  +TDQPA LYA TKKAGEEIAH  NHI+GLS+TG  FF V GPWGRPD   FF
Sbjct  202   KVPFSEKDQTDQPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  261

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  L+GKPI+V+    +K VARDFTYIDD+VKGC+GALDTAEKSTGSGGKKK  AQLR
Sbjct  262   FTKNILKGKPISVFQGSNNKSVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKKKNAQLR  321

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V KLVSILE LL +KAK+NV+ +P NGDV FTHAN+S A+K+FGYKPTT
Sbjct  322   VFNLGNTSPVPVTKLVSILEKLLKVKAKRNVLPLPTNGDVMFTHANISYAHKEFGYKPTT  381

Query  489   DLSSGLRKFVKWYVSYYGIQSR  424
             DL +GL KFV WY+ YY +  +
Sbjct  382   DLQTGLHKFVNWYLDYYSVSEK  403



>ref|NP_182056.1| UDP-D-glucuronate 4-epimerase 4 [Arabidopsis thaliana]
 sp|O22141.1|GAE4_ARATH RecName: Full=UDP-glucuronate 4-epimerase 4; AltName: Full=UDP-glucuronic 
acid epimerase 4; Short=AtUGlcAE1 [Arabidopsis 
thaliana]
 gb|AAB82632.1| putative nucleotide sugar epimerase [Arabidopsis thaliana]
 gb|AAO42241.1| putative nucleotide sugar epimerase [Arabidopsis thaliana]
 gb|AAO64072.1| putative nucleotide sugar epimerase [Arabidopsis thaliana]
 gb|AAT06796.1| UDP-glucuronic acid epimerase 1 [Arabidopsis thaliana]
 gb|AEC10537.1| UDP-D-glucuronate 4-epimerase 4 [Arabidopsis thaliana]
Length=437

 Score =   280 bits (716),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 141/197 (72%), Positives = 162/197 (82%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  +TDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  232   KVPFSEKDKTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  291

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  L+GK I+++ +     VARDFTYIDD+VKGC+ ALDTAEKSTGSGGKK+GPAQLR
Sbjct  292   FTKDILKGKSISIFESANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKRGPAQLR  351

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LV ILE  L +KAKKN++KMPRNGDVPFTHAN+SLA ++ GYKPTT
Sbjct  352   VFNLGNTSPVPVSDLVRILERQLKVKAKKNLIKMPRNGDVPFTHANISLAQRELGYKPTT  411

Query  489   DLSSGLRKFVKWYVSYY  439
             DL +GL+KFV+WY+SYY
Sbjct  412   DLQTGLKKFVRWYLSYY  428



>gb|KHN25558.1| UDP-glucuronate 4-epimerase 3 [Glycine soja]
Length=261

 Score =   274 bits (700),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 138/197 (70%), Positives = 160/197 (81%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  57    KVPFSERDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  116

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GK I ++       VARDFTYIDD+V+GC+GALDTAEKSTGSGGKK+GPAQLR
Sbjct  117   FTRDLLKGKSIPIFEAANHGTVARDFTYIDDIVRGCLGALDTAEKSTGSGGKKRGPAQLR  176

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             ++NLGNTSPV V  LVSILE LL +KAK+N++K+PRNGDV FTHAN+S A  + GYKPTT
Sbjct  177   IFNLGNTSPVPVSDLVSILERLLKVKAKRNIMKLPRNGDVQFTHANISYAQSELGYKPTT  236

Query  489   DLSSGLRKFVKWYVSYY  439
             DL SGL+KFV+WY++YY
Sbjct  237   DLQSGLKKFVRWYLNYY  253



>emb|CDP09891.1| unnamed protein product [Coffea canephora]
Length=454

 Score =   280 bits (716),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 142/202 (70%), Positives = 164/202 (81%), Gaps = 0/202 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   +F
Sbjct  250   KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYYF  309

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  L+GK I +Y   +   VARDFTYIDDVVKGC+ ALDTA+KSTGSGGKK+G AQ R
Sbjct  310   FTKDILRGKEIKIYEGVDHGTVARDFTYIDDVVKGCLAALDTAKKSTGSGGKKRGAAQFR  369

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             +YNLGNT+PV + +LVSILE LL +KAKK V++MPRNGDVPFTHAN+SLA+K+ GYKPTT
Sbjct  370   IYNLGNTTPVPIGRLVSILEKLLRVKAKKKVIQMPRNGDVPFTHANISLAHKELGYKPTT  429

Query  489   DLSSGLRKFVKWYVSYYGIQSR  424
             DL +GL+KFVKWYV YYG + +
Sbjct  430   DLEAGLKKFVKWYVGYYGSKKK  451



>ref|XP_006837081.1| PREDICTED: UDP-glucuronate 4-epimerase 2 [Amborella trichopoda]
 gb|ERM99934.1| hypothetical protein AMTR_s00110p00097630 [Amborella trichopoda]
Length=434

 Score =   279 bits (713),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 139/197 (71%), Positives = 163/197 (83%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             +VPF E+ RTD+PA LYA TKKAGEEIAH  NHI+GLS+TG  FF V GPWGRPD   FF
Sbjct  229   EVPFSESDRTDRPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  288

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  LQGK I ++       VARDFTYIDD+VKGC+G+LDTAEKSTG+GGKK+GPAQLR
Sbjct  289   FTKDILQGKTIPIFEGPNHGTVARDFTYIDDIVKGCLGSLDTAEKSTGTGGKKRGPAQLR  348

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             ++NLGNTSPV V+ LVSILE LL +KAKK ++KMPRNGDVPFTHAN+SLA ++ GYKPTT
Sbjct  349   IFNLGNTSPVPVKDLVSILERLLKVKAKKTIIKMPRNGDVPFTHANISLAQRELGYKPTT  408

Query  489   DLSSGLRKFVKWYVSYY  439
             DL +GL+KFVKWY+ YY
Sbjct  409   DLQTGLKKFVKWYLGYY  425



>ref|XP_010508183.1| PREDICTED: UDP-glucuronate 4-epimerase 4-like [Camelina sativa]
Length=443

 Score =   279 bits (714),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 163/204 (80%), Gaps = 0/204 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  236   KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  295

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  L+GK I+++ +     VARDFTYIDD+VKGC+ +LDTAEKSTG+GGKK+GPA LR
Sbjct  296   FTKDILKGKSISIFESANHGTVARDFTYIDDIVKGCLASLDTAEKSTGTGGKKRGPAMLR  355

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LV ILE  L +KAKKN++KMPRNGDVPFTHAN+SLA ++ GYKPTT
Sbjct  356   VFNLGNTSPVPVSDLVRILERQLKVKAKKNLIKMPRNGDVPFTHANISLAQRELGYKPTT  415

Query  489   DLSSGLRKFVKWYVSYYGIQSRVK  418
             DL +GL+KFV+WY+SYY    + K
Sbjct  416   DLQTGLKKFVRWYLSYYSSSGQSK  439



>gb|EYU31982.1| hypothetical protein MIMGU_mgv1a012102mg [Erythranthe guttata]
Length=261

 Score =   273 bits (698),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 141/202 (70%), Positives = 162/202 (80%), Gaps = 0/202 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI GLSLTG  FF V GPWGRPD   FF
Sbjct  57    KVPFSELDRTDQPASLYAATKKAGEEIAHTYNHIHGLSLTGLRFFTVYGPWGRPDMAYFF  116

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GK I ++       VARDFTYIDD+VKGC+GALDTAEKSTGSGGKKKG AQLR
Sbjct  117   FTRDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKKGAAQLR  176

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LVSILE LL +KAK+ ++K+PRNGDV FTHAN+SLA ++ GYKPTT
Sbjct  177   VFNLGNTSPVPVSDLVSILERLLKVKAKRLIMKLPRNGDVQFTHANISLAQRELGYKPTT  236

Query  489   DLSSGLRKFVKWYVSYYGIQSR  424
             DL +GL+KFV+WY+SYYG + +
Sbjct  237   DLQTGLKKFVRWYLSYYGNEKK  258



>emb|CDO97699.1| unnamed protein product [Coffea canephora]
Length=437

 Score =   279 bits (713),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 142/198 (72%), Positives = 160/198 (81%), Gaps = 0/198 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTD PA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  233   KVPFSEKDRTDNPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  292

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  L+GK I ++       VARDFTYIDD+VKGC+ ALDTAEKSTGSGGKKKGPAQLR
Sbjct  293   FTKDILKGKAIQIFEAANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKKGPAQLR  352

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             VYNLGNTSPV V  LVSILE LL +KAK+ ++K+PRNGDV FTHAN+SLA ++ GYKPTT
Sbjct  353   VYNLGNTSPVPVSDLVSILERLLKVKAKRTIMKLPRNGDVQFTHANISLAQRELGYKPTT  412

Query  489   DLSSGLRKFVKWYVSYYG  436
             DL +GL+KFV+WY+SYYG
Sbjct  413   DLQTGLKKFVRWYLSYYG  430



>ref|XP_009111519.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Brassica rapa]
Length=430

 Score =   278 bits (712),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 141/197 (72%), Positives = 161/197 (82%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  226   KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  285

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GKPI+V+       VARDFTYIDD+VKGC+GALDTAEKSTGSGGKK+G AQLR
Sbjct  286   FTRDILKGKPISVFQGANHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRGAAQLR  345

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LV+ILE LL +KAK+N+VKMPRNGDVPFTHAN+S A ++ GYKPTT
Sbjct  346   VFNLGNTSPVPVTDLVTILERLLKVKAKRNIVKMPRNGDVPFTHANISSAQRELGYKPTT  405

Query  489   DLSSGLRKFVKWYVSYY  439
             DL +GL+KF +WY+ YY
Sbjct  406   DLQTGLKKFARWYLGYY  422



>ref|XP_001761086.1| predicted protein [Physcomitrella patens]
 gb|EDQ74153.1| predicted protein [Physcomitrella patens]
Length=450

 Score =   278 bits (712),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 144/212 (68%), Positives = 165/212 (78%), Gaps = 0/212 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E+ RTDQPA LYA TKKAGEEIAH  NHI+GLS+TG  FF V GPWGRPD   F 
Sbjct  237   KVPFSESDRTDQPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  296

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GK IN+Y     K++ARDFTYIDD+VKGCVGALDTAEKSTGSGGKK GPAQLR
Sbjct  297   FTRDILRGKAINIYTGNGGKDLARDFTYIDDIVKGCVGALDTAEKSTGSGGKKTGPAQLR  356

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV+V  LV ILE  L  KAK+N++KMPRNGDVPFTHAN+S A   F Y PTT
Sbjct  357   VFNLGNTSPVTVPTLVDILEKYLKQKAKRNIIKMPRNGDVPFTHANISYAQSQFNYHPTT  416

Query  489   DLSSGLRKFVKWYVSYYGIQSRVKTELHPTHQ  394
             +L +GL+KFVKWY+SYYG+ +  K  L    Q
Sbjct  417   NLDTGLKKFVKWYLSYYGVGTDHKLWLGDHEQ  448



>ref|XP_002280967.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Vitis vinifera]
Length=433

 Score =   278 bits (710),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 142/197 (72%), Positives = 159/197 (81%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  229   KVPFSERDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  288

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  L+GK I ++       VARDFTYIDD+VKGCV ALDTAEKSTGSGGKKKGPAQLR
Sbjct  289   FTKDILKGKSIRIFEAPNHGTVARDFTYIDDIVKGCVAALDTAEKSTGSGGKKKGPAQLR  348

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LVSILE LL +KAK+ ++KMPRNGDV FTHAN+SLA ++ GYKPTT
Sbjct  349   VFNLGNTSPVPVTDLVSILERLLKVKAKRTMMKMPRNGDVQFTHANISLAQRELGYKPTT  408

Query  489   DLSSGLRKFVKWYVSYY  439
             DL +GL+KFV+WY+ YY
Sbjct  409   DLQTGLKKFVRWYIKYY  425



>ref|XP_006345514.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum tuberosum]
Length=435

 Score =   278 bits (710),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 142/198 (72%), Positives = 163/198 (82%), Gaps = 0/198 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLS+TG  FF V GPWGRPD   FF
Sbjct  231   KVPFSERDRTDQPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  290

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GK I ++       VARDFTYIDD+VKGC+GALDTA+KSTGSGGKKKGPAQLR
Sbjct  291   FTRDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLGALDTAKKSTGSGGKKKGPAQLR  350

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LVSILE LL +KAK+ ++K+PRNGDV FTHAN+SLA K+FGYKPTT
Sbjct  351   VFNLGNTSPVPVSDLVSILEKLLKVKAKRLIMKLPRNGDVQFTHANISLAQKEFGYKPTT  410

Query  489   DLSSGLRKFVKWYVSYYG  436
             DL +GL+KFV+WY+SYYG
Sbjct  411   DLQTGLKKFVRWYLSYYG  428



>ref|XP_010544649.1| PREDICTED: UDP-glucuronate 4-epimerase 4 [Tarenaya hassleriana]
Length=436

 Score =   278 bits (710),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 141/197 (72%), Positives = 158/197 (80%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  229   KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  288

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  LQGK I ++       VARDFTYIDD+VKGC+ ALDTAEKSTGS GKKKGPAQLR
Sbjct  289   FTRDILQGKTIPIFEAANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSRGKKKGPAQLR  348

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LV ILE LL +KAK+N++KMPRNGDVPFTHAN+S A  + GYKP+T
Sbjct  349   VFNLGNTSPVPVSDLVGILERLLKVKAKRNIMKMPRNGDVPFTHANISSAQHELGYKPST  408

Query  489   DLSSGLRKFVKWYVSYY  439
             DL +GL+KFV+WYVSYY
Sbjct  409   DLQTGLKKFVRWYVSYY  425



>emb|CAN73016.1| hypothetical protein VITISV_004388 [Vitis vinifera]
Length=427

 Score =   277 bits (709),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 142/197 (72%), Positives = 159/197 (81%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  223   KVPFSERDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  282

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  L+GK I ++       VARDFTYIDD+VKGCV ALDTAEKSTGSGGKKKGPAQLR
Sbjct  283   FTKDILKGKSIRIFEAPNHGTVARDFTYIDDIVKGCVAALDTAEKSTGSGGKKKGPAQLR  342

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LVSILE LL +KAK+ ++KMPRNGDV FTHAN+SLA ++ GYKPTT
Sbjct  343   VFNLGNTSPVPVTDLVSILERLLKVKAKRTMMKMPRNGDVQFTHANISLAQRELGYKPTT  402

Query  489   DLSSGLRKFVKWYVSYY  439
             DL +GL+KFV+WY+ YY
Sbjct  403   DLQTGLKKFVRWYIKYY  419



>gb|KGN57287.1| hypothetical protein Csa_3G176330 [Cucumis sativus]
Length=262

 Score =   271 bits (694),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 140/202 (69%), Positives = 162/202 (80%), Gaps = 0/202 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             +VPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLS+TG  FF V GPWGRPD   FF
Sbjct  57    RVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  116

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  L+GK I V+   + K VARDFTYIDD+VKGC+GALDTAEKSTGSGG+KKG AQLR
Sbjct  117   FTKDILKGKKIRVFEGADQKSVARDFTYIDDIVKGCLGALDTAEKSTGSGGRKKGKAQLR  176

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV+V +LV  LE LL++KAK+ V+ MPRNGDVPFTHAN+SLA K+ GYKPTT
Sbjct  177   VFNLGNTSPVTVSELVDNLEKLLNLKAKRMVLPMPRNGDVPFTHANISLAQKELGYKPTT  236

Query  489   DLSSGLRKFVKWYVSYYGIQSR  424
             DL +GL++FV WY  YY   S+
Sbjct  237   DLKTGLKEFVDWYRLYYSNSSK  258



>ref|XP_010906178.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Elaeis guineensis]
Length=467

 Score =   278 bits (711),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 141/201 (70%), Positives = 162/201 (81%), Gaps = 1/201 (0%)
 Frame = -2

Query  1026  VPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFF  847
             VPF E  RTD+PA LYA TKKAGE +AH  NHI+GLS+TG  FF V GPWGRPD   FFF
Sbjct  241   VPFSELHRTDRPASLYAATKKAGEAVAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFFF  300

Query  846   XKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkst-gsggkkkGPAQLR  670
              K  L G  I ++ T++  +V RDFTYIDDVVKGC+GALDTAEKST   GGK++G AQLR
Sbjct  301   TKSILSGNAITLFKTRDGADVQRDFTYIDDVVKGCLGALDTAEKSTGSRGGKRRGAAQLR  360

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             VYNLGNTSPV V K+V+ILE LL  KAKKNVV MPRNGDVP+THANVSLA KDFGY+PTT
Sbjct  361   VYNLGNTSPVPVGKMVAILEELLGKKAKKNVVTMPRNGDVPYTHANVSLAEKDFGYRPTT  420

Query  489   DLSSGLRKFVKWYVSYYGIQS  427
             DL++GLR+FVKWYV YYG+ +
Sbjct  421   DLTAGLRRFVKWYVEYYGVTA  441



>ref|XP_009380772.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Musa acuminata 
subsp. malaccensis]
Length=435

 Score =   277 bits (708),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 135/203 (67%), Positives = 159/203 (78%), Gaps = 0/203 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E+ RTD+PA LYA TKKAGEEI H  NHI+GLS+TG  FF V GPWGRPD   F 
Sbjct  228   KVPFSESDRTDRPASLYAATKKAGEEITHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  287

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  LQGKPI VY  ++  ++ARDFTYIDD+VKGCV ALDTAE STG G +K+ PAQ R
Sbjct  288   FTRNILQGKPITVYRGRDGTDLARDFTYIDDIVKGCVAALDTAEASTGIGKQKRRPAQYR  347

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             +YNLGNTSPV+V  LV ILE  L +KA+KN+V+MP NGDVPFTHAN+SLA  + GYKPTT
Sbjct  348   IYNLGNTSPVTVPALVRILERYLKVKARKNMVEMPGNGDVPFTHANISLARAELGYKPTT  407

Query  489   DLSSGLRKFVKWYVSYYGIQSRV  421
             +L +GL+KFVKWY+SYYG   R 
Sbjct  408   NLETGLKKFVKWYLSYYGYSRRA  430



>gb|KEH16056.1| UDP-D-glucuronate 4-epimerase [Medicago truncatula]
Length=421

 Score =   276 bits (707),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 143/197 (73%), Positives = 161/197 (82%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  217   KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  276

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  L+GK I ++       VARDFTYIDD+V+GC+GALDTAEKSTGSGGKK+G AQLR
Sbjct  277   FTKDILRGKSITIFEGPNHGTVARDFTYIDDIVRGCLGALDTAEKSTGSGGKKRGTAQLR  336

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LVSILE LL +KAK+NV+KMPRNGDV FTHAN+S A K+FGYKPTT
Sbjct  337   VFNLGNTSPVPVTDLVSILERLLKVKAKRNVMKMPRNGDVQFTHANISYAKKEFGYKPTT  396

Query  489   DLSSGLRKFVKWYVSYY  439
             DL +GL+KFV+WYV+YY
Sbjct  397   DLQTGLKKFVRWYVNYY  413



>ref|XP_008792930.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Phoenix dactylifera]
Length=464

 Score =   278 bits (710),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 145/205 (71%), Positives = 164/205 (80%), Gaps = 2/205 (1%)
 Frame = -2

Query  1026  VPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFF  847
             VPF E  RTD+PA LYA TKKAGE IAH  N+I+GLS+TG  FF V GPWGRPD   FFF
Sbjct  238   VPFSELHRTDRPASLYAATKKAGEAIAHTYNNIYGLSITGLRFFTVYGPWGRPDMAYFFF  297

Query  846   XKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkG-PAQLR  670
              K  L G  I ++ T++  +V RDFTYIDDVVKGC+GALDTA+KSTGS G KK  PAQLR
Sbjct  298   TKSILSGDAITLFKTRDGADVQRDFTYIDDVVKGCLGALDTAQKSTGSRGGKKHGPAQLR  357

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             VYNLGNTSPVSV K+V+ILE LL  KAKKNVV MPRNGDVP+THANVSLA KDFGY+PTT
Sbjct  358   VYNLGNTSPVSVGKMVAILEELLGKKAKKNVVTMPRNGDVPYTHANVSLAEKDFGYRPTT  417

Query  489   DLSSGLRKFVKWYVSYYGIQ-SRVK  418
             DL++GLR+FVKWYV Y G+  SR K
Sbjct  418   DLATGLRRFVKWYVEYNGVAVSRAK  442



>ref|XP_006365249.1| PREDICTED: UDP-glucuronate 4-epimerase 2-like [Solanum tuberosum]
Length=406

 Score =   276 bits (706),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 142/199 (71%), Positives = 161/199 (81%), Gaps = 0/199 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  +TDQPA LYA TKKAGEEIAH  NHI+GLS+TG  FF V GPWGRPD   FF
Sbjct  202   KVPFSEKDQTDQPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  261

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  L+G PI+V+    +K VARDFTYID++VKGC+GALDTAEKSTGSGGKKK  AQLR
Sbjct  262   FTKNILKGNPISVFQGSNNKSVARDFTYIDEIVKGCLGALDTAEKSTGSGGKKKKNAQLR  321

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V KLVSILE LL +KAK+NV+ +PRNGDV FTHAN+S A K+FGYKPTT
Sbjct  322   VFNLGNTSPVPVTKLVSILEKLLKVKAKRNVLPLPRNGDVMFTHANISYAQKEFGYKPTT  381

Query  489   DLSSGLRKFVKWYVSYYGI  433
             DL  GL+KFV WY+ YY I
Sbjct  382   DLQMGLQKFVNWYLDYYSI  400



>ref|XP_004513504.1| PREDICTED: UDP-glucuronate 4-epimerase 2-like [Cicer arietinum]
Length=426

 Score =   276 bits (707),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 140/201 (70%), Positives = 164/201 (82%), Gaps = 0/201 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  +TDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  223   KVPFSEKDKTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  282

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  L+G  I+++       VARDFTYIDD+V+GC+GALDTAEKSTGSGGKK+GPAQLR
Sbjct  283   FTKDILKGNSISIFEAPNHGTVARDFTYIDDIVRGCLGALDTAEKSTGSGGKKRGPAQLR  342

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V +LVSILE LL +KAK+NV+KMPRNGDV FTHAN+S A K+FGYKPTT
Sbjct  343   VFNLGNTSPVPVTELVSILERLLKVKAKRNVMKMPRNGDVQFTHANISYAKKEFGYKPTT  402

Query  489   DLSSGLRKFVKWYVSYYGIQS  427
             DL +GL+ FV+WY++YY + +
Sbjct  403   DLETGLKNFVRWYLNYYSVAA  423



>ref|XP_003521958.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Glycine max]
Length=438

 Score =   277 bits (708),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 140/197 (71%), Positives = 161/197 (82%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  234   KVPFSERDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  293

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GKPI ++       VARDFTYIDD+V+GC+GALDTAEKSTGSGGKK+GPAQLR
Sbjct  294   FTRDLLKGKPIPIFEAANHGTVARDFTYIDDIVRGCLGALDTAEKSTGSGGKKRGPAQLR  353

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LVSILE LL +KAK+N++K+PRNGDV FTHAN+S A  + GYKPTT
Sbjct  354   VFNLGNTSPVPVSDLVSILERLLKVKAKRNIMKLPRNGDVQFTHANISYAQSELGYKPTT  413

Query  489   DLSSGLRKFVKWYVSYY  439
             DL SGL+KFV+WY++YY
Sbjct  414   DLQSGLKKFVRWYLNYY  430



>ref|XP_009621323.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Nicotiana tomentosiformis]
Length=408

 Score =   276 bits (705),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 164/205 (80%), Gaps = 0/205 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             K PF E  RTDQPA LYA TKKAGEEIAH  NHI+GLS+TG  FF V GPWGRPD   FF
Sbjct  202   KAPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  261

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  L+GK INV+    +K VARDFTYIDD+VKGC+GALDTAEKSTGSGGKKKG AQLR
Sbjct  262   FTKNILKGKSINVFEGSNNKSVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKKGNAQLR  321

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V KLVS+LE LL +KA+KNV+ +PRNGDV FTHAN+S A K+FGYKP+T
Sbjct  322   VFNLGNTSPVPVTKLVSLLEKLLKVKARKNVLPLPRNGDVMFTHANISYAQKEFGYKPST  381

Query  489   DLSSGLRKFVKWYVSYYGIQSRVKT  415
             DL  G++KF+ WY+ YY I  + K+
Sbjct  382   DLQMGIQKFLNWYLDYYSISEKKKS  406



>ref|XP_008794651.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glucuronate 4-epimerase 6-like 
[Phoenix dactylifera]
Length=468

 Score =   277 bits (709),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 141/200 (71%), Positives = 163/200 (82%), Gaps = 0/200 (0%)
 Frame = -2

Query  1026  VPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFF  847
             VPF E  RTD+PA LYA TKKAGE IAH  NHI+GLS+TG  FF V GPWGRPD   FFF
Sbjct  240   VPFSELHRTDRPASLYAATKKAGEAIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFFF  299

Query  846   XKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLRV  667
              K  L G  I ++ T++  +V RDFTYIDDVV+GC+GALDTA KSTG+GGKK+GPAQLRV
Sbjct  300   TKAILSGNAITLFKTRDGVDVQRDFTYIDDVVQGCLGALDTAGKSTGTGGKKRGPAQLRV  359

Query  666   YNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTD  487
             YNLGNTSPV V K+V+ILE LL  KAKKNVV MPRNGDVP+THANV+LA KDF Y+PTTD
Sbjct  360   YNLGNTSPVPVGKMVAILEELLGKKAKKNVVTMPRNGDVPYTHANVTLAQKDFKYRPTTD  419

Query  486   LSSGLRKFVKWYVSYYGIQS  427
             L++GLR+FVKWYV YYG+ +
Sbjct  420   LATGLRRFVKWYVEYYGVAA  439



>ref|XP_009386871.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Musa acuminata 
subsp. malaccensis]
Length=465

 Score =   277 bits (709),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 139/199 (70%), Positives = 160/199 (80%), Gaps = 0/199 (0%)
 Frame = -2

Query  1023  PFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFFX  844
             PF E  RTD+PA LYA TKKAGE IAH  NHI+GLS+TG  FF V GPWGRPD   F F 
Sbjct  245   PFSELHRTDRPASLYAATKKAGEAIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFSFT  304

Query  843   KXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLRVY  664
                + GKPI ++  Q+   V RDFTYIDDVVKGC+GALDTA+ STGSG KK+GPAQLRVY
Sbjct  305   NDIISGKPITLFRMQDGAAVQRDFTYIDDVVKGCLGALDTAKPSTGSGSKKRGPAQLRVY  364

Query  663   NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  484
             NLGNTSPV V K+V ILE LL  KAKKNVV +P+NGDVP+THANVSLA KDFGY+PTTDL
Sbjct  365   NLGNTSPVPVAKMVGILEELLGKKAKKNVVTLPQNGDVPYTHANVSLAEKDFGYRPTTDL  424

Query  483   SSGLRKFVKWYVSYYGIQS  427
             ++GL+KFVKWYV YYG+++
Sbjct  425   ATGLKKFVKWYVEYYGVKT  443



>ref|XP_007052086.1| UDP-D-glucuronate 4-epimerase 3 [Theobroma cacao]
 gb|EOX96243.1| UDP-D-glucuronate 4-epimerase 3 [Theobroma cacao]
Length=437

 Score =   276 bits (706),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 141/197 (72%), Positives = 160/197 (81%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  233   KVPFSERDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  292

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GK I ++       VARDFTYIDD+VKGC+ ALDTAEKSTGSGGKKKGPAQLR
Sbjct  293   FTRDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKKGPAQLR  352

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             VYNLGNTSPV V  LVSILE LL + AK+N++K+PRNGDV FTHAN+SLA ++ GYKPTT
Sbjct  353   VYNLGNTSPVPVSDLVSILERLLKVNAKRNIMKLPRNGDVQFTHANISLAQRELGYKPTT  412

Query  489   DLSSGLRKFVKWYVSYY  439
             DL +GL+KFV+WY+SYY
Sbjct  413   DLQTGLKKFVRWYLSYY  429



>ref|XP_004240046.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum lycopersicum]
Length=435

 Score =   276 bits (706),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 142/198 (72%), Positives = 163/198 (82%), Gaps = 0/198 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLS+TG  FF V GPWGRPD   FF
Sbjct  231   KVPFSEWDRTDQPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  290

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GK I ++       VARDFTYIDD+VKGC+GALDTA+KSTGSGGKKKGPAQLR
Sbjct  291   FTRDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLGALDTAKKSTGSGGKKKGPAQLR  350

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LVSILE LL +KAK+ ++K+PRNGDV FTHAN+SLA K+FGYKPTT
Sbjct  351   VFNLGNTSPVPVSDLVSILEKLLKVKAKRLIMKLPRNGDVQFTHANISLAQKEFGYKPTT  410

Query  489   DLSSGLRKFVKWYVSYYG  436
             DL +GL+KFV+WY+SYYG
Sbjct  411   DLQTGLKKFVRWYLSYYG  428



>ref|XP_009614886.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Nicotiana tomentosiformis]
Length=434

 Score =   276 bits (706),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 141/202 (70%), Positives = 164/202 (81%), Gaps = 0/202 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  232   KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  291

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GK I ++       VARDFTYIDD+VKGC+ ALDTAEKSTGSGGKKKGPAQLR
Sbjct  292   FTRDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKKGPAQLR  351

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LVSILE LL +KAK++V+K+PRNGDV FTHAN+S A ++ GYKPTT
Sbjct  352   VFNLGNTSPVPVSDLVSILERLLKVKAKRSVMKLPRNGDVQFTHANISFAKRELGYKPTT  411

Query  489   DLSSGLRKFVKWYVSYYGIQSR  424
             DL +GL+KFV+WY+SYYG +++
Sbjct  412   DLHTGLKKFVRWYLSYYGDETK  433



>gb|AAM61323.1| nucleotide sugar epimerase, putative [Arabidopsis thaliana]
Length=419

 Score =   275 bits (704),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 138/197 (70%), Positives = 162/197 (82%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAG+EIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  212   KVPFSEKDRTDQPASLYAATKKAGZEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  271

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GK I+++       VARDFTYIDD+VKGC+GALDTAEKSTGSGGKK+G AQLR
Sbjct  272   FTRDILKGKAISIFEGANHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRGAAQLR  331

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LVSILE LL +KAK+N++K+PRNGDVPFTHAN+S A ++FGYKP+T
Sbjct  332   VFNLGNTSPVPVTDLVSILERLLKVKAKRNMMKLPRNGDVPFTHANISSAQREFGYKPST  391

Query  489   DLSSGLRKFVKWYVSYY  439
             DL +GL+KFV+WY+ YY
Sbjct  392   DLQTGLKKFVRWYLGYY  408



>emb|CDY63064.1| BnaAnng18570D [Brassica napus]
Length=430

 Score =   276 bits (705),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 140/197 (71%), Positives = 160/197 (81%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  226   KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  285

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GK I+V+       VARDFTYIDD+VKGC+GALDTAEKSTGSGGKK+G AQLR
Sbjct  286   FTRDILKGKAISVFQGANHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRGAAQLR  345

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LV+ILE LL +KAK+N+VKMPRNGDVPFTHAN+S A ++ GYKPTT
Sbjct  346   VFNLGNTSPVPVTDLVTILERLLKVKAKRNIVKMPRNGDVPFTHANISSAQRELGYKPTT  405

Query  489   DLSSGLRKFVKWYVSYY  439
             DL +GL+KF +WY+ YY
Sbjct  406   DLQTGLKKFARWYLGYY  422



>ref|XP_009784108.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Nicotiana sylvestris]
Length=435

 Score =   276 bits (705),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 142/198 (72%), Positives = 162/198 (82%), Gaps = 0/198 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLS+TG  FF V GPWGRPD   FF
Sbjct  231   KVPFSERDRTDQPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  290

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GK I ++       VARDFTYIDD+VKGCVGALDTA+KSTGSGGKKKGPAQLR
Sbjct  291   FTRDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCVGALDTAKKSTGSGGKKKGPAQLR  350

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LVSILE LL +KAK+ V+K+PRNGDV FTHAN+S A+K+ GYKPTT
Sbjct  351   VFNLGNTSPVPVSDLVSILEKLLKVKAKRLVMKLPRNGDVQFTHANISSAHKELGYKPTT  410

Query  489   DLSSGLRKFVKWYVSYYG  436
             DL +GL+KFV+WY+SYYG
Sbjct  411   DLQTGLKKFVRWYLSYYG  428



>ref|XP_010929207.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Elaeis guineensis]
Length=432

 Score =   276 bits (705),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 137/202 (68%), Positives = 164/202 (81%), Gaps = 0/202 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E+ RTD+PA LYA TKK+GEEI H  NHI+GLS+TG  FF V GPWGRPD   F 
Sbjct  226   KVPFSESDRTDRPASLYAATKKSGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  285

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  LQGKPI +Y  ++  ++ARDFTYIDD+VKGC+G+LDTAEKSTGSGGKK+ PAQ R
Sbjct  286   FTRNILQGKPITIYRGKDRVDLARDFTYIDDIVKGCLGSLDTAEKSTGSGGKKRRPAQYR  345

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             +YNLGNTSPV+V  LVSILE  L +KAK+NVV+MP NGDVPFTHAN+SLA  + GYKPTT
Sbjct  346   IYNLGNTSPVTVPTLVSILERYLKVKAKRNVVEMPGNGDVPFTHANISLARAELGYKPTT  405

Query  489   DLSSGLRKFVKWYVSYYGIQSR  424
             +L +GL+KFVKWY+ YYG + R
Sbjct  406   NLETGLKKFVKWYLHYYGYRPR  427



>ref|XP_002993206.1| hypothetical protein SELMODRAFT_136684 [Selaginella moellendorffii]
 gb|EFJ05726.1| hypothetical protein SELMODRAFT_136684 [Selaginella moellendorffii]
Length=455

 Score =   276 bits (706),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 141/197 (72%), Positives = 159/197 (81%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLS+TG  FF V GPWGRPD   FF
Sbjct  241   KVPFSEIDRTDQPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  300

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  LQGKP+N+Y      ++ARDFTYIDD+VKGC GALDTA  STG+GGKK+GPAQLR
Sbjct  301   FTKAILQGKPVNIYQGPNQVDLARDFTYIDDIVKGCFGALDTATPSTGTGGKKRGPAQLR  360

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             VYNLGNTSPV+V  LV+ILE  L +KAK+NVV+MPRNGDVPFTHANV+LA  + GY PTT
Sbjct  361   VYNLGNTSPVTVPTLVAILEKHLKVKAKRNVVRMPRNGDVPFTHANVTLARVELGYNPTT  420

Query  489   DLSSGLRKFVKWYVSYY  439
             DL +GL+KFVKWY  YY
Sbjct  421   DLQTGLKKFVKWYQLYY  437



>ref|XP_002965479.1| hypothetical protein SELMODRAFT_84174 [Selaginella moellendorffii]
 gb|EFJ32899.1| hypothetical protein SELMODRAFT_84174 [Selaginella moellendorffii]
Length=456

 Score =   276 bits (706),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 141/197 (72%), Positives = 159/197 (81%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLS+TG  FF V GPWGRPD   FF
Sbjct  241   KVPFSEIDRTDQPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  300

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  LQGKP+N+Y      ++ARDFTYIDD+VKGC GALDTA  STG+GGKK+GPAQLR
Sbjct  301   FTKAILQGKPVNIYQGPNQVDLARDFTYIDDIVKGCFGALDTATPSTGTGGKKRGPAQLR  360

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             VYNLGNTSPV+V  LV+ILE  L +KAK+NVV+MPRNGDVPFTHANV+LA  + GY PTT
Sbjct  361   VYNLGNTSPVTVPTLVAILEKHLKVKAKRNVVRMPRNGDVPFTHANVTLARVELGYNPTT  420

Query  489   DLSSGLRKFVKWYVSYY  439
             DL +GL+KFVKWY  YY
Sbjct  421   DLQTGLKKFVKWYQLYY  437



>ref|XP_007218024.1| hypothetical protein PRUPE_ppa005953mg [Prunus persica]
 ref|XP_008232642.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Prunus mume]
 gb|EMJ19223.1| hypothetical protein PRUPE_ppa005953mg [Prunus persica]
Length=435

 Score =   276 bits (705),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 140/197 (71%), Positives = 161/197 (82%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  231   KVPFSERDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  290

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GK I ++       VARDFTYIDD+VKGC+ +LDTAEKSTGSGGKKKGPAQLR
Sbjct  291   FTRDILKGKTIPIFEAANHGTVARDFTYIDDIVKGCLASLDTAEKSTGSGGKKKGPAQLR  350

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LV+ILE LL +KAK+N++K+PRNGDVPFTHAN+S A ++ GYKPTT
Sbjct  351   VFNLGNTSPVPVSDLVTILERLLKVKAKRNIMKLPRNGDVPFTHANISSAQRELGYKPTT  410

Query  489   DLSSGLRKFVKWYVSYY  439
             DL +GL+KFV+WYVSYY
Sbjct  411   DLQTGLKKFVRWYVSYY  427



>ref|XP_008438174.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Cucumis melo]
Length=432

 Score =   275 bits (704),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 140/197 (71%), Positives = 162/197 (82%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  228   KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  287

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GK I ++   +   VARDFTYIDD+VKGC+ ALDTAEKSTGSGGKKKGPAQLR
Sbjct  288   FTRDILKGKSIPIFEGADHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKKGPAQLR  347

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LVSILE LL +KAK+N++K+PRNGDV FTHAN+SLA ++ GYKPTT
Sbjct  348   VFNLGNTSPVPVSDLVSILEKLLKVKAKRNIMKLPRNGDVQFTHANISLAQRELGYKPTT  407

Query  489   DLSSGLRKFVKWYVSYY  439
             DL +GL+KFV+WY++YY
Sbjct  408   DLQTGLKKFVRWYLNYY  424



>ref|NP_171702.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis thaliana]
 sp|Q9LPC1.1|GAE2_ARATH RecName: Full=UDP-glucuronate 4-epimerase 2; AltName: Full=UDP-glucuronic 
acid epimerase 2 [Arabidopsis thaliana]
 gb|AAF76478.1|AC020622_12 Contains similarity to CAPI protein from Staphylococcus aureus 
gi|P39858 and contains a NAD dependent epimerase/dehydratase 
PF|01370 domain. ESTs gb|N97076, gb|AI997010 come from this 
gene [Arabidopsis thaliana]
 gb|AAG50112.1|AF334734_1 putative nucleotide sugar epimerase [Arabidopsis thaliana]
 gb|AEE27364.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis thaliana]
Length=434

 Score =   275 bits (704),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 139/197 (71%), Positives = 162/197 (82%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  227   KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  286

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GK I+++       VARDFTYIDD+VKGC+GALDTAEKSTGSGGKK+G AQLR
Sbjct  287   FTRDILKGKAISIFEGANHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRGAAQLR  346

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LVSILE LL +KAK+N++K+PRNGDVPFTHAN+S A ++FGYKP+T
Sbjct  347   VFNLGNTSPVPVTDLVSILERLLKVKAKRNMMKLPRNGDVPFTHANISSAQREFGYKPST  406

Query  489   DLSSGLRKFVKWYVSYY  439
             DL +GL+KFV+WY+ YY
Sbjct  407   DLQTGLKKFVRWYLGYY  423



>ref|XP_011650790.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Cucumis sativus]
 gb|KGN56607.1| UDP-glucuronate 4-epimerase 3 [Cucumis sativus]
Length=432

 Score =   275 bits (704),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 140/197 (71%), Positives = 162/197 (82%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  228   KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  287

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GK I ++   +   VARDFTYIDD+VKGC+ ALDTAEKSTGSGGKKKGPAQLR
Sbjct  288   FTRDILKGKSIPIFEGADHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKKGPAQLR  347

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LVSILE LL +KAK+N++K+PRNGDV FTHAN+SLA ++ GYKPTT
Sbjct  348   VFNLGNTSPVPVSDLVSILEKLLKMKAKRNIMKLPRNGDVQFTHANISLAQRELGYKPTT  407

Query  489   DLSSGLRKFVKWYVSYY  439
             DL +GL+KFV+WY++YY
Sbjct  408   DLQTGLKKFVRWYMNYY  424



>gb|ADB24771.1| UDP-D-glucuronic acid 4-epimerase [Gossypium hirsutum]
 gb|KJB22312.1| hypothetical protein B456_004G040600 [Gossypium raimondii]
Length=435

 Score =   275 bits (703),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 141/197 (72%), Positives = 159/197 (81%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  231   KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  290

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+ KPI ++       VARDFTYIDD+VKGC+ ALDTAEKSTG+GGKKKGPAQLR
Sbjct  291   FTRDILKRKPIPIFEAANHGTVARDFTYIDDIVKGCLAALDTAEKSTGTGGKKKGPAQLR  350

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             VYNLGNTSPV V  LVSILE LL +K K+N++K+PRNGDV FTHANVSLA ++ GYKPTT
Sbjct  351   VYNLGNTSPVPVSTLVSILERLLKVKVKRNIMKLPRNGDVQFTHANVSLAQRELGYKPTT  410

Query  489   DLSSGLRKFVKWYVSYY  439
             DL +GL+KFVKWY S+Y
Sbjct  411   DLQTGLKKFVKWYTSFY  427



>ref|XP_002962217.1| hypothetical protein SELMODRAFT_77268 [Selaginella moellendorffii]
 gb|EFJ37477.1| hypothetical protein SELMODRAFT_77268 [Selaginella moellendorffii]
Length=450

 Score =   275 bits (704),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 142/201 (71%), Positives = 162/201 (81%), Gaps = 0/201 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGE IAH  NHI+GLS+TG  FF V GP+GRPD   F 
Sbjct  236   KVPFSEMDRTDQPASLYAATKKAGEAIAHSYNHIYGLSITGLRFFTVYGPYGRPDMAYFS  295

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  LQGKPIN+Y   +  ++ARDFTYIDD+VKGC+GALDTA  STG+GGKK+GPAQLR
Sbjct  296   FTKDILQGKPINIYQGPDQTDLARDFTYIDDIVKGCLGALDTALLSTGTGGKKRGPAQLR  355

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             VYNLGNTSPV+V +LVSILE  L +KAKKN VKMPRNGDVPFTHANV+LA  +  Y P+T
Sbjct  356   VYNLGNTSPVTVPELVSILEKHLKVKAKKNFVKMPRNGDVPFTHANVTLARNELRYNPST  415

Query  489   DLSSGLRKFVKWYVSYYGIQS  427
             DL +GL+KFVKWY SYYG+ S
Sbjct  416   DLYTGLKKFVKWYESYYGLTS  436



>gb|KFK42571.1| hypothetical protein AALP_AA1G012900 [Arabis alpina]
Length=436

 Score =   275 bits (703),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 140/197 (71%), Positives = 161/197 (82%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  232   KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  291

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GK I+++       VARDFTYIDD+VKGC+GALDTAEKSTGSGGKK+G AQLR
Sbjct  292   FTRDILKGKAISIFEGANHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRGQAQLR  351

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LVSILE LL +KAKKN++K+PRNGDVPFTHAN+S A ++ GYKPTT
Sbjct  352   VFNLGNTSPVPVTDLVSILERLLKVKAKKNMMKLPRNGDVPFTHANISSAQRELGYKPTT  411

Query  489   DLSSGLRKFVKWYVSYY  439
             DL +GL+KFV+WY+ YY
Sbjct  412   DLQTGLKKFVRWYLGYY  428



>ref|XP_010053904.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Eucalyptus grandis]
 gb|KCW78281.1| hypothetical protein EUGRSUZ_D02464 [Eucalyptus grandis]
Length=436

 Score =   275 bits (703),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 138/198 (70%), Positives = 161/198 (81%), Gaps = 0/198 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  232   KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  291

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GK I+++       VARDFTYIDD+V+GC+ ALDTAEKSTGSGGKKKGPAQLR
Sbjct  292   FTRDILKGKSISIFEAANHGTVARDFTYIDDIVRGCLAALDTAEKSTGSGGKKKGPAQLR  351

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             VYNLGNTSPV V  LVSILE LL +KAK+N++++PRNGDV +THAN+SLA ++ GYKPTT
Sbjct  352   VYNLGNTSPVPVSDLVSILERLLKLKAKRNILRLPRNGDVQYTHANISLAQRELGYKPTT  411

Query  489   DLSSGLRKFVKWYVSYYG  436
             DL SGL+KFV+WY+ +Y 
Sbjct  412   DLQSGLKKFVRWYLRFYA  429



>gb|KDP25603.1| hypothetical protein JCGZ_20759 [Jatropha curcas]
Length=436

 Score =   275 bits (702),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 140/197 (71%), Positives = 161/197 (82%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLS+TG  FF V GPWGRPD   FF
Sbjct  230   KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  289

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  L+GK I V+ T + + VARDFTYIDD+V GC+ ALDTA+KSTGSGGKK+GPAQ R
Sbjct  290   FTKDILKGKEIGVFETADGRSVARDFTYIDDIVNGCLAALDTAKKSTGSGGKKRGPAQFR  349

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V +LV ILE+LL +KAKK V+ +PRNGDV FTHAN+SLA KD GYKPTT
Sbjct  350   VFNLGNTSPVPVSRLVGILESLLQVKAKKKVLPLPRNGDVEFTHANISLAQKDLGYKPTT  409

Query  489   DLSSGLRKFVKWYVSYY  439
             DL +GL+KFV+WY+SYY
Sbjct  410   DLETGLKKFVRWYLSYY  426



>ref|XP_002965131.1| hypothetical protein SELMODRAFT_266836 [Selaginella moellendorffii]
 gb|EFJ33969.1| hypothetical protein SELMODRAFT_266836 [Selaginella moellendorffii]
Length=445

 Score =   275 bits (703),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 142/201 (71%), Positives = 162/201 (81%), Gaps = 0/201 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGE IAH  NHI+GLS+TG  FF V GP+GRPD   F 
Sbjct  231   KVPFSEVDRTDQPASLYAATKKAGEAIAHSYNHIYGLSITGLRFFTVYGPYGRPDMAYFS  290

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  LQGKPIN+Y   +  ++ARDFTYIDD+VKGC+GALDTA  STG+GGKK+GPAQLR
Sbjct  291   FTKDILQGKPINIYQGPDQTDLARDFTYIDDIVKGCLGALDTALLSTGTGGKKRGPAQLR  350

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             VYNLGNTSPV+V +LVSILE  L +KAKKN VKMPRNGDVPFTHANV+LA  +  Y P+T
Sbjct  351   VYNLGNTSPVTVPELVSILEKHLKVKAKKNFVKMPRNGDVPFTHANVTLARNELRYNPST  410

Query  489   DLSSGLRKFVKWYVSYYGIQS  427
             DL +GL+KFVKWY SYYG+ S
Sbjct  411   DLYTGLKKFVKWYESYYGLTS  431



>ref|XP_002892033.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68292.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis lyrata subsp. lyrata]
Length=434

 Score =   275 bits (702),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 139/201 (69%), Positives = 164/201 (82%), Gaps = 0/201 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  227   KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  286

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GK I+++       VARDFTYIDD+VKGC+GALDTAEKSTGSGGKK+G AQLR
Sbjct  287   FTRDILKGKAISIFQGANHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRGAAQLR  346

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V +LVSILE LL +KAK+N++K+PRNGDV FTHAN+S A ++FGYKP+T
Sbjct  347   VFNLGNTSPVPVTELVSILERLLKVKAKRNMMKLPRNGDVAFTHANISWAEREFGYKPST  406

Query  489   DLSSGLRKFVKWYVSYYGIQS  427
             DL +GL+KFV+WY+ YY  Q+
Sbjct  407   DLQTGLKKFVRWYLGYYKQQA  427



>ref|XP_012087106.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [Jatropha curcas]
Length=448

 Score =   275 bits (703),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 140/197 (71%), Positives = 161/197 (82%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLS+TG  FF V GPWGRPD   FF
Sbjct  230   KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  289

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  L+GK I V+ T + + VARDFTYIDD+V GC+ ALDTA+KSTGSGGKK+GPAQ R
Sbjct  290   FTKDILKGKEIGVFETADGRSVARDFTYIDDIVNGCLAALDTAKKSTGSGGKKRGPAQFR  349

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V +LV ILE+LL +KAKK V+ +PRNGDV FTHAN+SLA KD GYKPTT
Sbjct  350   VFNLGNTSPVPVSRLVGILESLLQVKAKKKVLPLPRNGDVEFTHANISLAQKDLGYKPTT  409

Query  489   DLSSGLRKFVKWYVSYY  439
             DL +GL+KFV+WY+SYY
Sbjct  410   DLETGLKKFVRWYLSYY  426



>ref|XP_012083592.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Jatropha curcas]
Length=441

 Score =   275 bits (702),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 140/199 (70%), Positives = 161/199 (81%), Gaps = 0/199 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  236   KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  295

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GK I ++       VARDFTYIDD+VKGC+ ALDTAEKSTGSGGKKKGPAQLR
Sbjct  296   FTRDILKGKSIPIFEAASHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKKGPAQLR  355

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LVSILE LL  KAK+N++K+PRNGDV FTHAN+SLA ++ GYKP+T
Sbjct  356   VFNLGNTSPVPVTDLVSILERLLKAKAKRNIMKLPRNGDVQFTHANISLAQRELGYKPST  415

Query  489   DLSSGLRKFVKWYVSYYGI  433
             DL +GL+KFV+WY+SYY +
Sbjct  416   DLQTGLKKFVRWYLSYYRV  434



>gb|KJB09908.1| hypothetical protein B456_001G174300 [Gossypium raimondii]
Length=437

 Score =   275 bits (702),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 139/197 (71%), Positives = 161/197 (82%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  233   KVPFSERDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  292

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GK I+++       VARDFTYIDD+VKGC+ ALDTAEKSTGSGGKKKGPAQLR
Sbjct  293   FTRDILKGKSISIFEAANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKKGPAQLR  352

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LVSILE LL + AK+N++K+PRNGDV FTHAN+SLA ++ GYKP+T
Sbjct  353   VFNLGNTSPVPVSDLVSILERLLKVNAKRNIMKLPRNGDVQFTHANISLAQRELGYKPST  412

Query  489   DLSSGLRKFVKWYVSYY  439
             DL +GL+KFV+WY+SYY
Sbjct  413   DLQTGLKKFVRWYLSYY  429



>ref|XP_009596624.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nicotiana tomentosiformis]
Length=435

 Score =   274 bits (701),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 141/198 (71%), Positives = 162/198 (82%), Gaps = 0/198 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLS+TG  FF V GPWGRPD   FF
Sbjct  231   KVPFSERDRTDQPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  290

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GK I ++       VARDFTYIDD+VKGC+GALDTA+KSTGSGGKKKGPAQLR
Sbjct  291   FTRDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLGALDTAKKSTGSGGKKKGPAQLR  350

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LVSILE LL +KAK+ V+K+PRNGDV FTHAN+S A+K+ GYKPTT
Sbjct  351   VFNLGNTSPVPVSDLVSILEKLLKVKAKRLVMKLPRNGDVQFTHANISSAHKELGYKPTT  410

Query  489   DLSSGLRKFVKWYVSYYG  436
             DL +GL+KFV+WY+SYYG
Sbjct  411   DLQTGLKKFVRWYLSYYG  428



>gb|KDP28767.1| hypothetical protein JCGZ_14538 [Jatropha curcas]
Length=435

 Score =   274 bits (700),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 140/199 (70%), Positives = 161/199 (81%), Gaps = 0/199 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  230   KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  289

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GK I ++       VARDFTYIDD+VKGC+ ALDTAEKSTGSGGKKKGPAQLR
Sbjct  290   FTRDILKGKSIPIFEAASHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKKGPAQLR  349

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LVSILE LL  KAK+N++K+PRNGDV FTHAN+SLA ++ GYKP+T
Sbjct  350   VFNLGNTSPVPVTDLVSILERLLKAKAKRNIMKLPRNGDVQFTHANISLAQRELGYKPST  409

Query  489   DLSSGLRKFVKWYVSYYGI  433
             DL +GL+KFV+WY+SYY +
Sbjct  410   DLQTGLKKFVRWYLSYYRV  428



>ref|XP_010426564.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Camelina sativa]
 ref|XP_010456322.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Camelina sativa]
Length=428

 Score =   274 bits (700),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 137/197 (70%), Positives = 161/197 (82%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  224   KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  283

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GKPI+++       VARDFTYIDD+VKGC+GALDTAEKSTG+GGKK+G AQLR
Sbjct  284   FTRDILKGKPISIFEGVNHGTVARDFTYIDDIVKGCLGALDTAEKSTGTGGKKRGAAQLR  343

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LV+ILE LL +KAK+N++K+PRNGDVPFTHAN+S A ++ GYKPTT
Sbjct  344   VFNLGNTSPVPVTDLVTILERLLKLKAKRNIMKLPRNGDVPFTHANISSAQRELGYKPTT  403

Query  489   DLSSGLRKFVKWYVSYY  439
             DL +GL+KF +WY+ YY
Sbjct  404   DLQTGLKKFARWYLGYY  420



>gb|KHN17533.1| UDP-glucuronate 4-epimerase 1 [Glycine soja]
Length=262

 Score =   268 bits (685),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 136/198 (69%), Positives = 160/198 (81%), Gaps = 0/198 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E+ +TDQPA LYA TKKAGEEI H  NHI+GLS+TG  FF V GPWGRPD   F 
Sbjct  57    KVPFSESDQTDQPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  116

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  LQGKPI VY  +   ++ARDFTYIDD+VKGCVG+LDT+ KSTGSGGKK+GPA  R
Sbjct  117   FTRNILQGKPITVYRGKNHVDLARDFTYIDDIVKGCVGSLDTSAKSTGSGGKKRGPAPYR  176

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             ++NLGNTSPV+V  LVSILE  L +KAK+N+V MP NGDVPFTHAN+S A ++ GYKPTT
Sbjct  177   IFNLGNTSPVTVPTLVSILERHLKVKAKRNIVDMPGNGDVPFTHANISSARRELGYKPTT  236

Query  489   DLSSGLRKFVKWYVSYYG  436
             DL +GL+KFVKWY+SYYG
Sbjct  237   DLQTGLKKFVKWYLSYYG  254



>ref|XP_010098924.1| UDP-glucuronate 4-epimerase 3 [Morus notabilis]
 gb|EXB76226.1| UDP-glucuronate 4-epimerase 3 [Morus notabilis]
Length=445

 Score =   274 bits (701),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 139/197 (71%), Positives = 161/197 (82%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  241   KVPFSERDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  300

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GK I+++       VARDFTYIDD+VKGC+ ALDTAEKSTGSGGKKKGPAQLR
Sbjct  301   FTRDILKGKAISIFEAANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKKGPAQLR  360

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LVSILE LL +KAK++++K+PRNGDV FTHAN+S A ++ GYKPTT
Sbjct  361   VFNLGNTSPVPVSDLVSILERLLKVKAKRHIMKLPRNGDVQFTHANISWAQRELGYKPTT  420

Query  489   DLSSGLRKFVKWYVSYY  439
             DL +GL+KFV+WY+SYY
Sbjct  421   DLQTGLKKFVRWYLSYY  437



>ref|XP_006347877.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum tuberosum]
Length=435

 Score =   274 bits (700),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 141/198 (71%), Positives = 161/198 (81%), Gaps = 0/198 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  231   KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  290

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GK I ++       VARDFTYIDD+VKGC+ ALDTAEKSTGSGGKKKG AQLR
Sbjct  291   FTRDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKKGAAQLR  350

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LVSILE LL +KAK+ V+K+PRNGDVPFTHAN+S A+K+ GYKPTT
Sbjct  351   VFNLGNTSPVPVSDLVSILERLLKVKAKRLVMKLPRNGDVPFTHANISSAHKELGYKPTT  410

Query  489   DLSSGLRKFVKWYVSYYG  436
             DL +GL+KFV+WY++YYG
Sbjct  411   DLQTGLKKFVRWYLNYYG  428



>ref|XP_010523080.1| PREDICTED: UDP-glucuronate 4-epimerase 3 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010523081.1| PREDICTED: UDP-glucuronate 4-epimerase 3 isoform X2 [Tarenaya 
hassleriana]
Length=435

 Score =   273 bits (699),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 140/199 (70%), Positives = 161/199 (81%), Gaps = 0/199 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  231   KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  290

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GK I+++       VARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+G AQLR
Sbjct  291   FTRDILKGKAISIFEGANHGTVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGAAQLR  350

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V +LVSILE  L +KAK+N++K+PRNGDV FTHAN+SLA  + GYKPTT
Sbjct  351   VFNLGNTSPVPVSELVSILERHLKVKAKRNIMKLPRNGDVQFTHANISLAQGELGYKPTT  410

Query  489   DLSSGLRKFVKWYVSYYGI  433
             DL +GL+KFVKWY+ YY +
Sbjct  411   DLHTGLKKFVKWYLGYYNV  429



>ref|XP_006445275.1| hypothetical protein CICLE_v10020187mg [Citrus clementina]
 ref|XP_006490911.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Citrus sinensis]
 gb|ESR58515.1| hypothetical protein CICLE_v10020187mg [Citrus clementina]
 gb|KDO85806.1| hypothetical protein CISIN_1g013602mg [Citrus sinensis]
Length=439

 Score =   274 bits (700),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 139/198 (70%), Positives = 161/198 (81%), Gaps = 0/198 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  235   KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  294

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L  K I ++ + +   VARDFTYIDD+VKGC+ ALDTAEKSTGSGGKK+G AQLR
Sbjct  295   FTRDILNRKSIPIFESPDHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKRGRAQLR  354

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LVSILE LL +KAK+N++K+PRNGDVPFTHAN+SLA ++ GYKPTT
Sbjct  355   VFNLGNTSPVPVSDLVSILERLLKVKAKRNIMKLPRNGDVPFTHANISLAQRELGYKPTT  414

Query  489   DLSSGLRKFVKWYVSYYG  436
             DL +GL+KFV+WY+SYY 
Sbjct  415   DLQTGLKKFVRWYLSYYA  432



>ref|XP_006396209.1| hypothetical protein EUTSA_v10028667mg [Eutrema salsugineum]
 gb|ESQ37662.1| hypothetical protein EUTSA_v10028667mg [Eutrema salsugineum]
Length=437

 Score =   273 bits (699),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 137/197 (70%), Positives = 159/197 (81%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E   TDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  233   KVPFSEKDATDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  292

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GKPI+++       VARDFTYIDD+VKGC+GALDTAEKSTGSGGKK+ PAQLR
Sbjct  293   FTRDILKGKPISIFEGANHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRRPAQLR  352

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LV+ILE LL +KAK+N++K+PRNGDV FTHAN+S A ++ GYKPTT
Sbjct  353   VFNLGNTSPVPVTDLVTILERLLKVKAKRNIMKLPRNGDVQFTHANISSAQRELGYKPTT  412

Query  489   DLSSGLRKFVKWYVSYY  439
             DL SGL+KF +WY+ YY
Sbjct  413   DLQSGLKKFARWYLGYY  429



>ref|XP_009781950.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Nicotiana sylvestris]
Length=436

 Score =   273 bits (699),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 140/198 (71%), Positives = 160/198 (81%), Gaps = 0/198 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  232   KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  291

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GK I ++       VARDFTYIDD+VKGC+ ALDT EKSTGSGGKKKGPAQLR
Sbjct  292   FTRDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLAALDTGEKSTGSGGKKKGPAQLR  351

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LVSILE LL +KAK++V+K+PRNGDV FTHAN+S A ++ GYKPTT
Sbjct  352   VFNLGNTSPVPVSDLVSILERLLKVKAKRSVMKLPRNGDVQFTHANISFAKRELGYKPTT  411

Query  489   DLSSGLRKFVKWYVSYYG  436
             DL +GL+KFV+WY+SYYG
Sbjct  412   DLQTGLKKFVRWYLSYYG  429



>ref|XP_006287814.1| hypothetical protein CARUB_v10001027mg [Capsella rubella]
 gb|EOA20712.1| hypothetical protein CARUB_v10001027mg [Capsella rubella]
Length=426

 Score =   273 bits (698),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 138/197 (70%), Positives = 160/197 (81%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  222   KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  281

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GKPI+++       VARDFTYIDD+VKGC+GALDTAEKSTGSGGKK+G AQLR
Sbjct  282   FTRDILKGKPISIFEGVNHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRGAAQLR  341

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LV+ILE LL +KAK+N +K+PRNGDVPFTHAN+S A ++ GYKPTT
Sbjct  342   VFNLGNTSPVPVTDLVTILERLLKVKAKRNTMKLPRNGDVPFTHANISSAQRELGYKPTT  401

Query  489   DLSSGLRKFVKWYVSYY  439
             DL +GL+KF +WY+ YY
Sbjct  402   DLQTGLKKFARWYLGYY  418



>ref|XP_003517038.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Glycine max]
Length=438

 Score =   273 bits (699),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 138/197 (70%), Positives = 160/197 (81%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  234   KVPFSERDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  293

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GK I ++       VARDFTYIDD+V+GC+GALDTAEKSTGSGGKK+GPAQLR
Sbjct  294   FTRDLLKGKSIPIFEAANHGTVARDFTYIDDIVRGCLGALDTAEKSTGSGGKKRGPAQLR  353

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             ++NLGNTSPV V  LVSILE LL +KAK+N++K+PRNGDV FTHAN+S A  + GYKPTT
Sbjct  354   IFNLGNTSPVPVSDLVSILERLLKVKAKRNIMKLPRNGDVQFTHANISYAQMELGYKPTT  413

Query  489   DLSSGLRKFVKWYVSYY  439
             DL SGL+KFV+WY++YY
Sbjct  414   DLQSGLKKFVRWYLNYY  430



>ref|XP_010914055.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Elaeis guineensis]
Length=432

 Score =   273 bits (698),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 138/202 (68%), Positives = 163/202 (81%), Gaps = 0/202 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E+ RTD+PA LYA TKKAGEEI H  NHI+GLS+TG  FF V GPWGRPD   F 
Sbjct  226   KVPFSESDRTDRPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  285

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  LQGKPI VY  +   ++ARDFTYIDD+VKGC+G+LDTA+KSTGSGGKK+GPAQ R
Sbjct  286   FTRNILQGKPITVYSGKNRVDLARDFTYIDDIVKGCLGSLDTAKKSTGSGGKKRGPAQYR  345

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             +YNLGNTSPV+V  LVSILE  L +KAK+NV++MP NGDVPFTHAN+SLA  + GYKPTT
Sbjct  346   IYNLGNTSPVTVPMLVSILERHLKVKAKRNVMEMPGNGDVPFTHANISLARAELGYKPTT  405

Query  489   DLSSGLRKFVKWYVSYYGIQSR  424
             +L +GL+KFVKWY+ YYG   R
Sbjct  406   NLETGLKKFVKWYLQYYGYSRR  427



>ref|XP_007134861.1| hypothetical protein PHAVU_010G082300g [Phaseolus vulgaris]
 gb|ESW06855.1| hypothetical protein PHAVU_010G082300g [Phaseolus vulgaris]
Length=432

 Score =   273 bits (698),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 139/197 (71%), Positives = 160/197 (81%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  228   KVPFSERDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  287

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GK I ++       VARDFTYIDD+V+GC+GALDTAEKSTGSGGKK+GPAQLR
Sbjct  288   FTRDILKGKVIPIFEAANHGTVARDFTYIDDIVRGCLGALDTAEKSTGSGGKKRGPAQLR  347

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LV ILE LL IKAK+N++K+PRNGDV FTHAN+S A ++ GYKPTT
Sbjct  348   VFNLGNTSPVPVSDLVGILERLLKIKAKRNIMKLPRNGDVQFTHANISYAQRELGYKPTT  407

Query  489   DLSSGLRKFVKWYVSYY  439
             DL SGL+KFV+WY++YY
Sbjct  408   DLHSGLKKFVRWYLNYY  424



>ref|XP_009409770.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Musa acuminata 
subsp. malaccensis]
Length=434

 Score =   273 bits (698),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 138/203 (68%), Positives = 159/203 (78%), Gaps = 0/203 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E   TD+PA LYA TKKAGEEI H  NHI+GLS+TG  FF V GPWGRPD   F 
Sbjct  228   KVPFSELDGTDRPASLYAATKKAGEEITHCYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  287

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  LQGKPI V+  ++  ++ARDFTYIDDVVKGCV ALDTAE STGSGG+K+ PAQ R
Sbjct  288   FTRNILQGKPITVFRGRDGTDLARDFTYIDDVVKGCVAALDTAEASTGSGGRKRSPAQYR  347

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             +YNLGNTSPV+V  LV ILE  L +KAKKNV +MP NGDVPFTHAN+SLA  + GYKPTT
Sbjct  348   IYNLGNTSPVTVPALVGILERHLKMKAKKNVAEMPGNGDVPFTHANISLARAELGYKPTT  407

Query  489   DLSSGLRKFVKWYVSYYGIQSRV  421
             +L +GL+KFVKWY+SYYG   RV
Sbjct  408   NLETGLKKFVKWYLSYYGYSRRV  430



>ref|XP_008781382.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Phoenix dactylifera]
Length=432

 Score =   273 bits (697),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 139/202 (69%), Positives = 161/202 (80%), Gaps = 0/202 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             K PF E+ RTD+PA LYA TKKAGEEI H  NHI+GLS+TG  FF V GPWGRPD   F 
Sbjct  226   KAPFSESDRTDRPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  285

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  LQGKPI VY  ++  ++ARDFTYIDD+VKGC+G+LDTAEKSTGSGGKK+GPAQ R
Sbjct  286   FTRNILQGKPITVYSGKDRVDLARDFTYIDDIVKGCLGSLDTAEKSTGSGGKKRGPAQYR  345

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             +YNLGNTSPV+V  LVSILE  L  KAK+NVV MP NGDVPFTHAN+SLA  + GYKPTT
Sbjct  346   IYNLGNTSPVTVPMLVSILERHLKAKAKRNVVAMPGNGDVPFTHANISLARAELGYKPTT  405

Query  489   DLSSGLRKFVKWYVSYYGIQSR  424
             +L +GL+KFVKWY+ YYG   R
Sbjct  406   NLETGLKKFVKWYLHYYGYSPR  427



>gb|KFK30589.1| hypothetical protein AALP_AA6G001300 [Arabis alpina]
Length=432

 Score =   273 bits (697),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 139/197 (71%), Positives = 160/197 (81%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  228   KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  287

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GK I+++       VARDFTYIDD+VKGC+GALDTAEKSTGSGGKK+G AQLR
Sbjct  288   FTRDILKGKAISIFEGVNHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRGQAQLR  347

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LVSILE LL +KAKKN++K+PRNGDVPFTHAN+S A ++ GYKPTT
Sbjct  348   VFNLGNTSPVPVTDLVSILERLLKVKAKKNMMKLPRNGDVPFTHANISSAQRELGYKPTT  407

Query  489   DLSSGLRKFVKWYVSYY  439
             DL +GL+KF +WY+ YY
Sbjct  408   DLQTGLKKFARWYLGYY  424



>ref|XP_011090565.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Sesamum indicum]
 ref|XP_011090567.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Sesamum indicum]
Length=432

 Score =   272 bits (696),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 141/197 (72%), Positives = 159/197 (81%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  228   KVPFSERDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  287

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GK I ++       VARDFTYIDD+VKGC+ ALDTAEKSTGSGGKKKGPAQLR
Sbjct  288   FTRDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKKGPAQLR  347

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             VYNLGNTSPV V  LVSILE LL  KAK+ V+K+PRNGDV FTHAN+SLA ++ GYKPTT
Sbjct  348   VYNLGNTSPVPVSDLVSILERLLKTKAKRLVMKLPRNGDVQFTHANISLAQRELGYKPTT  407

Query  489   DLSSGLRKFVKWYVSYY  439
             DL +GL+KFV+WY++YY
Sbjct  408   DLQTGLKKFVRWYLNYY  424



>ref|XP_008238641.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [Prunus mume]
Length=434

 Score =   272 bits (696),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 140/197 (71%), Positives = 161/197 (82%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLS+TG  FF V GPWGRPD   FF
Sbjct  229   KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  288

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  L+GKPI ++   +   VARDFTYIDDVVKGCV ALDTA+KSTGSGGKKKGPAQLR
Sbjct  289   FTKDILKGKPITIFEAPDRGSVARDFTYIDDVVKGCVAALDTAKKSTGSGGKKKGPAQLR  348

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             ++NLGNTSPV V +LV+ILE LL +KAK+ V+ MPRNGDV FTHAN+SLA+K+  YKP T
Sbjct  349   IFNLGNTSPVPVSELVNILEKLLKVKAKRKVLPMPRNGDVKFTHANISLAHKELKYKPGT  408

Query  489   DLSSGLRKFVKWYVSYY  439
             DL +GL+KFV+WY+SYY
Sbjct  409   DLETGLKKFVRWYLSYY  425



>ref|XP_010905148.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Elaeis guineensis]
Length=463

 Score =   273 bits (698),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 142/198 (72%), Positives = 159/198 (80%), Gaps = 0/198 (0%)
 Frame = -2

Query  1026  VPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFF  847
             VPF E  RTD+PA LYA TKKAGE IAH  NHI+GLS+TG  FF V GPWGRPD   FFF
Sbjct  238   VPFSELHRTDRPASLYAATKKAGEAIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFFF  297

Query  846   XKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLRV  667
              K  L GK I ++ T +   V RDFTYIDDVV+GC+GALDTA KSTGSGGKK+GPAQLRV
Sbjct  298   TKSILSGKAITLFKTHDGVGVRRDFTYIDDVVQGCLGALDTAGKSTGSGGKKRGPAQLRV  357

Query  666   YNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTD  487
             YNLGN SPV V K+V+ILE LL  KAKKNVV MP NGDVP+THANVS A KDFGY+PTTD
Sbjct  358   YNLGNKSPVPVSKMVAILEELLGKKAKKNVVTMPMNGDVPYTHANVSSAEKDFGYRPTTD  417

Query  486   LSSGLRKFVKWYVSYYGI  433
             L++GLR+FVKWYV YYG+
Sbjct  418   LATGLRRFVKWYVEYYGV  435



>ref|XP_011069826.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Sesamum indicum]
Length=432

 Score =   272 bits (695),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 136/198 (69%), Positives = 161/198 (81%), Gaps = 0/198 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E+ RTDQPA LYA TKKAGEEI H  NHI+GLS+TG  FF V GPWGRPD   F 
Sbjct  227   KVPFSESDRTDQPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  286

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  LQGKPI +Y  +   ++ARDFTYIDD+VKGCV +LDTA+KSTGSGGKK+GPAQ R
Sbjct  287   FTRNILQGKPITIYRGKNRVDLARDFTYIDDIVKGCVASLDTAKKSTGSGGKKRGPAQYR  346

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             ++NLGNTSP++V  +V ILE  L +KAKKNV++MP NGDVPFTHAN+S A ++ GYKPTT
Sbjct  347   IFNLGNTSPITVPMMVGILEKHLKVKAKKNVIEMPGNGDVPFTHANISSARRELGYKPTT  406

Query  489   DLSSGLRKFVKWYVSYYG  436
             DL +GLRKFVKWY+SYYG
Sbjct  407   DLQTGLRKFVKWYLSYYG  424



>ref|XP_004229804.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Solanum lycopersicum]
Length=435

 Score =   272 bits (695),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 140/198 (71%), Positives = 160/198 (81%), Gaps = 0/198 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  231   KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  290

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GK I ++       VARDFTYIDD+VKGC+ ALDTAEKSTGSGGKKKG AQLR
Sbjct  291   FTRDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKKGAAQLR  350

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LV ILE LL +KAK+ V+K+PRNGDVPFTHAN+S A+K+ GYKPTT
Sbjct  351   VFNLGNTSPVPVSDLVGILERLLKVKAKRLVMKLPRNGDVPFTHANISSAHKELGYKPTT  410

Query  489   DLSSGLRKFVKWYVSYYG  436
             DL +GL+KFV+WY++YYG
Sbjct  411   DLQTGLKKFVRWYLNYYG  428



>ref|XP_010419541.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Camelina sativa]
Length=428

 Score =   271 bits (694),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 136/197 (69%), Positives = 160/197 (81%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  224   KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  283

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GKPI+++       VARDFTYIDD+VKGC+GALDTAEKSTG+GGKK+G AQLR
Sbjct  284   FTRDILKGKPISIFEGVNHGTVARDFTYIDDIVKGCLGALDTAEKSTGTGGKKRGAAQLR  343

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LV+ILE LL +KAK+N++K+PRNGDVPFTHAN+S A ++ GYKPT 
Sbjct  344   VFNLGNTSPVPVTDLVTILERLLKLKAKRNIMKLPRNGDVPFTHANISSAQRELGYKPTI  403

Query  489   DLSSGLRKFVKWYVSYY  439
             DL +GL+KF +WY+ YY
Sbjct  404   DLQTGLKKFARWYLGYY  420



>ref|XP_002266529.1| PREDICTED: UDP-glucuronate 4-epimerase 4-like [Vitis vinifera]
Length=408

 Score =   271 bits (692),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 139/197 (71%), Positives = 154/197 (78%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLS+TG  FF V GPWGRPD   FF
Sbjct  206   KVPFSETDRTDQPASLYAATKKAGEEIAHSYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  265

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  LQG  I ++   +   VARDFTYIDD+VKGC+ ALDTAEKSTGSGGKK  PAQLR
Sbjct  266   FTKDILQGNSIRIFEGGKGGVVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKMRPAQLR  325

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             VYNLGNTSPV V  LVSILE LL +KA++    MPRNGDV +THAN+SLA K+ GYKPTT
Sbjct  326   VYNLGNTSPVEVGSLVSILERLLKVKARRVATPMPRNGDVMYTHANISLAEKELGYKPTT  385

Query  489   DLSSGLRKFVKWYVSYY  439
             DL SGL KFVKWY++YY
Sbjct  386   DLRSGLEKFVKWYLTYY  402



>ref|XP_008794398.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Phoenix dactylifera]
Length=432

 Score =   271 bits (694),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 137/202 (68%), Positives = 161/202 (80%), Gaps = 0/202 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E+ RTD+PA LYA TKKAGEEI H  NHI+GLS+TG  FF V GPWGRPD   F 
Sbjct  226   KVPFSESDRTDRPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  285

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  LQGKPI +Y  +   ++ARDFTYIDD+VKGC+G+LDTAEKSTGSGGKK+ PAQ R
Sbjct  286   FTRNILQGKPITIYRGKNRVDLARDFTYIDDIVKGCLGSLDTAEKSTGSGGKKRRPAQYR  345

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             +YNLGNTSPV+V  LVSILE  L +KAK+NVV+MP NGDVPFTHAN+SLA  +  YKPTT
Sbjct  346   IYNLGNTSPVTVPTLVSILERHLKVKAKRNVVEMPGNGDVPFTHANISLARAELRYKPTT  405

Query  489   DLSSGLRKFVKWYVSYYGIQSR  424
             +L +GL+KFVKWY+ YYG   R
Sbjct  406   NLETGLKKFVKWYLRYYGYSPR  427



>ref|XP_009412723.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Musa acuminata 
subsp. malaccensis]
Length=466

 Score =   273 bits (697),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 163/203 (80%), Gaps = 2/203 (1%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             + PF E  RTD+PA LYA TKKAGE IAH  NHI+GLS+TG  FF V GPWGRPD   F 
Sbjct  242   EAPFSEIHRTDRPASLYAATKKAGEAIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  301

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgs--ggkkkGPAQ  676
             F K  L GKPI ++   +   V RDFTYIDDVVKGC+GAL+TA+KSTG   GGKK+GPAQ
Sbjct  302   FTKSILSGKPITLFRMPDGTAVQRDFTYIDDVVKGCLGALNTAKKSTGVPGGGKKRGPAQ  361

Query  675   LRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKP  496
             LRVYNLGNTSPV V ++VSILE+L+  KAKKNVV +P+NGDVPFTHANVSLA  DFGY+P
Sbjct  362   LRVYNLGNTSPVPVAEMVSILEHLIGKKAKKNVVTLPQNGDVPFTHANVSLAKTDFGYRP  421

Query  495   TTDLSSGLRKFVKWYVSYYGIQS  427
             TTDL++GLRKFVKWYV YYG+Q+
Sbjct  422   TTDLATGLRKFVKWYVEYYGVQT  444



>ref|XP_002528222.1| UDP-glucuronate 5-epimerase, putative [Ricinus communis]
 gb|EEF34179.1| UDP-glucuronate 5-epimerase, putative [Ricinus communis]
Length=433

 Score =   271 bits (694),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 139/198 (70%), Positives = 161/198 (81%), Gaps = 0/198 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E+ RTDQPA LYA TKKAGEEI H  NHI+GLS+TG  FF V GPWGRPD   F 
Sbjct  228   KVPFSESDRTDQPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  287

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  LQGKPI VY  +   ++ARDFTYIDD+VKGCVG+LDTA KSTGSGGKK+GPA  R
Sbjct  288   FTRNILQGKPITVYRGKNRVDLARDFTYIDDIVKGCVGSLDTAGKSTGSGGKKRGPAPYR  347

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             ++NLGNTSPV+V  LVSILE  L +KAK+NVV MP NGDVPFTHAN+SLA ++ GYKPTT
Sbjct  348   IFNLGNTSPVTVPTLVSILEKHLKMKAKRNVVDMPGNGDVPFTHANISLARRELGYKPTT  407

Query  489   DLSSGLRKFVKWYVSYYG  436
             DL +GL+KFV+WY+SYYG
Sbjct  408   DLQTGLKKFVRWYLSYYG  425



>ref|XP_004148129.1| PREDICTED: UDP-glucuronate 4-epimerase 2-like [Cucumis sativus]
Length=408

 Score =   271 bits (692),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 140/202 (69%), Positives = 162/202 (80%), Gaps = 0/202 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             +VPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLS+TG  FF V GPWGRPD   FF
Sbjct  203   RVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  262

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  L+GK I V+   + K VARDFTYIDD+VKGC+GALDTAEKSTGSGG+KKG AQLR
Sbjct  263   FTKDILKGKKIRVFEGADQKSVARDFTYIDDIVKGCLGALDTAEKSTGSGGRKKGKAQLR  322

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV+V +LV  LE LL++KAK+ V+ MPRNGDVPFTHAN+SLA K+ GYKPTT
Sbjct  323   VFNLGNTSPVTVSELVDNLEKLLNLKAKRMVLPMPRNGDVPFTHANISLAQKELGYKPTT  382

Query  489   DLSSGLRKFVKWYVSYYGIQSR  424
             DL +GL++FV WY  YY   S+
Sbjct  383   DLKTGLKEFVDWYRLYYSNSSK  404



>ref|XP_009417460.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Musa acuminata subsp. 
malaccensis]
Length=444

 Score =   271 bits (694),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 136/202 (67%), Positives = 158/202 (78%), Gaps = 0/202 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             K PF E  RTD+PA LYA TKKAGEEI H  NHI+GLS+TG  FF V GPWGRPD   F 
Sbjct  227   KAPFSEADRTDRPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  286

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  LQGKPI VY  +   ++ARDFT+IDD+VKGCV +LDTAEKSTGSGG+K  PAQ R
Sbjct  287   FTRNILQGKPITVYRGKNRVDLARDFTFIDDIVKGCVASLDTAEKSTGSGGRKGSPAQYR  346

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             +YNLGNTSPV+V  LV ILE  L +KAKKNVV+MP NGDVPFTHAN+SLA  + GYKPTT
Sbjct  347   IYNLGNTSPVTVPALVGILERHLKVKAKKNVVEMPGNGDVPFTHANISLARAELGYKPTT  406

Query  489   DLSSGLRKFVKWYVSYYGIQSR  424
             +L +GL+KFV+WY+SYYG   R
Sbjct  407   NLETGLKKFVRWYLSYYGYSPR  428



>ref|XP_010540291.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Tarenaya hassleriana]
Length=393

 Score =   270 bits (690),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 137/197 (70%), Positives = 161/197 (82%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  +HI+GLSLTG  FF V GPWGRPD   FF
Sbjct  189   KVPFSEKDRTDQPASLYAATKKAGEEIAHTYSHIYGLSLTGLRFFTVYGPWGRPDMAYFF  248

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GK I+++       VARDFTYIDD+VKGC+GALDTAEKSTGSGGKK+G AQLR
Sbjct  249   FTRDILKGKAISIFEGANHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRGAAQLR  308

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V +LVSILE  L +KAK+NV+K+PRNGDV FTHAN+S+A ++ GYKPTT
Sbjct  309   VFNLGNTSPVPVSELVSILERHLKVKAKRNVMKLPRNGDVQFTHANISMAQRELGYKPTT  368

Query  489   DLSSGLRKFVKWYVSYY  439
             DL +GL+KFV+WY+ YY
Sbjct  369   DLQTGLKKFVRWYMGYY  385



>gb|KJB41101.1| hypothetical protein B456_007G090500 [Gossypium raimondii]
Length=437

 Score =   271 bits (693),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 138/197 (70%), Positives = 159/197 (81%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  233   KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  292

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GK I ++       VARDFTYIDD+VKGC+ ALDTAEKSTGSGGKKKGPAQLR
Sbjct  293   FTRDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKKGPAQLR  352

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             VYNLGNTSPV V  LVSILE LL + AK++++K+PRNGDV FTHAN+SLA ++ GYKP+T
Sbjct  353   VYNLGNTSPVPVSDLVSILERLLKVNAKRDIMKLPRNGDVQFTHANISLAQRELGYKPST  412

Query  489   DLSSGLRKFVKWYVSYY  439
             DL +GL+KFV+WY+ YY
Sbjct  413   DLQTGLKKFVRWYLGYY  429



>gb|EPS72617.1| hypothetical protein M569_02133, partial [Genlisea aurea]
Length=435

 Score =   271 bits (693),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 139/201 (69%), Positives = 159/201 (79%), Gaps = 0/201 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  228   KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  287

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GKPI ++       VARDFT+IDD+VKGCV ALDTAEKSTGSGGKKKGPAQLR
Sbjct  288   FTRDILKGKPIPIFEASNHGTVARDFTFIDDIVKGCVSALDTAEKSTGSGGKKKGPAQLR  347

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             VYNLGNTSPV V  LV+ILE LL  KA + V+K+PRNGDV FTHAN+SLA ++  YKPTT
Sbjct  348   VYNLGNTSPVPVSDLVTILEKLLKKKANRMVMKLPRNGDVQFTHANISLAQRELDYKPTT  407

Query  489   DLSSGLRKFVKWYVSYYGIQS  427
             DL +GL+KFV+WY+ YY + +
Sbjct  408   DLQTGLKKFVRWYLDYYAVDA  428



>ref|XP_009390535.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Musa acuminata 
subsp. malaccensis]
Length=438

 Score =   271 bits (693),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 135/202 (67%), Positives = 163/202 (81%), Gaps = 0/202 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E+ RTD+PA LYA TKKAGEEI H  NHI+GLS TG  FF V GPWGRPD   F 
Sbjct  226   KVPFSESDRTDRPASLYAATKKAGEEITHTYNHIYGLSTTGLRFFTVYGPWGRPDMAYFS  285

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  LQGKPI VY  ++  ++ARDFTYIDD+VKGCV +LDTAEKSTG+GG+K+GPAQ R
Sbjct  286   FTRNILQGKPITVYRGKDRVDLARDFTYIDDIVKGCVASLDTAEKSTGTGGRKRGPAQYR  345

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             +YNLGNTSPV+V  LV ILE+ L +KAK+NVV+MP NGDVPFTHAN+SLA  + GYKPTT
Sbjct  346   IYNLGNTSPVTVPALVGILEHHLKMKAKRNVVEMPGNGDVPFTHANISLARAELGYKPTT  405

Query  489   DLSSGLRKFVKWYVSYYGIQSR  424
             +L +GL++FV+WY+ YYG  +R
Sbjct  406   NLETGLKRFVRWYLLYYGYNTR  427



>ref|XP_008354844.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Malus domestica]
Length=432

 Score =   271 bits (693),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 138/197 (70%), Positives = 160/197 (81%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  228   KVPFSERDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  287

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GK I ++       VARDFTYIDD+VKGC+ +LDTAEKSTGSGGKKKGPAQLR
Sbjct  288   FTRDILKGKTIPIFEAANHGTVARDFTYIDDIVKGCLASLDTAEKSTGSGGKKKGPAQLR  347

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LV+ILE LL +KAK+N++K+PRNGDV FTHAN+S A ++ GYKPTT
Sbjct  348   VFNLGNTSPVPVTDLVTILERLLKVKAKRNIMKLPRNGDVQFTHANISSAQRELGYKPTT  407

Query  489   DLSSGLRKFVKWYVSYY  439
             DL +GL+KFV+WY+SYY
Sbjct  408   DLQTGLKKFVRWYLSYY  424



>ref|XP_010661665.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Vitis vinifera]
Length=427

 Score =   271 bits (692),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 139/197 (71%), Positives = 158/197 (80%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  223   KVPFSERDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  282

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+ K I ++       VARDFTYIDD+VKGCV ALDTAEKSTGSGGKKKGPAQLR
Sbjct  283   FTRDILKEKSIPIFEAPNRGTVARDFTYIDDIVKGCVAALDTAEKSTGSGGKKKGPAQLR  342

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             ++NLGNTSPV V  LVSILE LL +KAK+ ++KMPRNGDV FTHAN+SLA ++ GYKPTT
Sbjct  343   IFNLGNTSPVPVTDLVSILERLLKVKAKRKMIKMPRNGDVQFTHANISLAQRELGYKPTT  402

Query  489   DLSSGLRKFVKWYVSYY  439
             DL +GL+KFV+WY+ YY
Sbjct  403   DLQTGLKKFVRWYLKYY  419



>ref|XP_006453511.1| hypothetical protein CICLE_v10008355mg [Citrus clementina]
 ref|XP_006474082.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Citrus sinensis]
 gb|ESR66751.1| hypothetical protein CICLE_v10008355mg [Citrus clementina]
Length=431

 Score =   271 bits (693),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 137/197 (70%), Positives = 162/197 (82%), Gaps = 0/197 (0%)
 Frame = -2

Query  1026  VPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFF  847
             VPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLS+TG  FF V GPWGRPD   F F
Sbjct  227   VPFSEADRTDQPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFSF  286

Query  846   XKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLRV  667
              +  LQGKPI VY  +   ++ARDFTYIDD+VKGC+G+LDT+ KSTGSGGKK+GPA  R+
Sbjct  287   TRNILQGKPITVYRGKNHVDLARDFTYIDDIVKGCLGSLDTSGKSTGSGGKKRGPAPYRI  346

Query  666   YNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTD  487
             +NLGNTSPV+V KLV+ILE  L +KAKKNV++MP NGDVPFTHAN+S A K+FGY+PTTD
Sbjct  347   FNLGNTSPVTVPKLVNILERHLKVKAKKNVIEMPGNGDVPFTHANISSAQKEFGYRPTTD  406

Query  486   LSSGLRKFVKWYVSYYG  436
             L +GL+KFV+WY+SYYG
Sbjct  407   LQTGLKKFVRWYLSYYG  423



>ref|XP_011093361.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Sesamum indicum]
Length=434

 Score =   271 bits (693),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 140/197 (71%), Positives = 158/197 (80%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  230   KVPFSERDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  289

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GK I ++       VARDFTYIDD+VKGC+ ALDTAEKSTGSGGKKKGPAQLR
Sbjct  290   FTRDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKKGPAQLR  349

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             VYNLGNTSPV V  LVSILE LL +KAK+ V+K+PRNGDV FTHAN+S A ++ GYKPTT
Sbjct  350   VYNLGNTSPVPVSDLVSILEKLLKVKAKRLVMKLPRNGDVQFTHANISSAQRELGYKPTT  409

Query  489   DLSSGLRKFVKWYVSYY  439
             DL +GL+KFV+WY+ YY
Sbjct  410   DLKTGLKKFVEWYLGYY  426



>ref|XP_001769370.1| predicted protein [Physcomitrella patens]
 gb|EDQ65739.1| predicted protein [Physcomitrella patens]
Length=450

 Score =   271 bits (694),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 139/206 (67%), Positives = 161/206 (78%), Gaps = 0/206 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E+ RTDQPA LYA TKKAGEEIAH  NHI+GLS+TG  FF V GPWGRPD   F 
Sbjct  242   KVPFSESDRTDQPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  301

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GKPIN+Y    DK++ARDFT+IDD+VKGCVGALDTA +STGSGGKKKGPA LR
Sbjct  302   FTRDILKGKPINIYQGPHDKDLARDFTFIDDIVKGCVGALDTAGESTGSGGKKKGPAMLR  361

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             ++NLGNTSPV+V  LV +LE  L +KA K  +KMPRNGDVPFTHANVSLA     YKPTT
Sbjct  362   LFNLGNTSPVTVPVLVELLEKHLKVKAVKQFIKMPRNGDVPFTHANVSLAQAQLAYKPTT  421

Query  489   DLSSGLRKFVKWYVSYYGIQSRVKTE  412
             +L +GL+KFV WY+ YY +QS   T 
Sbjct  422   NLDTGLKKFVTWYLKYYNVQSTKSTR  447



>gb|EPS60141.1| hypothetical protein M569_14661, partial [Genlisea aurea]
Length=429

 Score =   270 bits (691),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 159/198 (80%), Gaps = 0/198 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             +VPF E+ RTDQPA LYA TKKAGEEI H  NHI+GLS+TG  FF V GPWGRPD   F 
Sbjct  225   RVPFSESDRTDQPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  284

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  L+GKPI +Y  +   ++ARDFTYIDDVVKGCV +LDTAEKSTGSGGKK+ PAQ R
Sbjct  285   FTKNILKGKPITIYRGKNQVDLARDFTYIDDVVKGCVASLDTAEKSTGSGGKKRRPAQYR  344

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             ++NLGNTSPV+V  +VSILE  L +KAKKNVV MP NGDVPFTHAN++ A ++  YKPTT
Sbjct  345   IFNLGNTSPVTVPMMVSILEKHLKVKAKKNVVDMPGNGDVPFTHANITAARRELAYKPTT  404

Query  489   DLSSGLRKFVKWYVSYYG  436
             DL +GL+KFV+WY+SYYG
Sbjct  405   DLQTGLKKFVRWYLSYYG  422



>ref|XP_006359203.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum tuberosum]
Length=435

 Score =   270 bits (691),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 138/197 (70%), Positives = 161/197 (82%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E+ RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  231   KVPFSESDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  290

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GK I+++       VARDFTYIDD+VKGC+GALDTAEKSTGSGGKKKGPAQLR
Sbjct  291   FTRDILKGKSISIFEGANHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKKGPAQLR  350

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LV+ILE LL +KAK+ ++K+PRNGDV FTHAN+S A ++ GYKPTT
Sbjct  351   VFNLGNTSPVPVSDLVTILERLLKVKAKRALMKLPRNGDVQFTHANISFAQRELGYKPTT  410

Query  489   DLSSGLRKFVKWYVSYY  439
              L +GL+KFV+WY+SYY
Sbjct  411   YLQTGLKKFVRWYLSYY  427



>ref|XP_009411848.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Musa acuminata 
subsp. malaccensis]
Length=466

 Score =   271 bits (694),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 138/202 (68%), Positives = 162/202 (80%), Gaps = 2/202 (1%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             + PF E  RTD+PA LYA TKKAGE IAH  NHI+GLS+TG  FF V GPWGRPD   F 
Sbjct  242   EAPFSELHRTDRPASLYAATKKAGEAIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  301

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsgg--kkkGPAQ  676
             F K  L GKPI ++   +   V RDFT+I+DVVKGC+GALDTA+KSTG  G  KK+GPAQ
Sbjct  302   FTKSILSGKPITLFRMPDGTAVQRDFTFIEDVVKGCLGALDTAKKSTGVAGGGKKRGPAQ  361

Query  675   LRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKP  496
             LR+YNLGNTSPV V K+VSILE+LL  KAKKNVV +P+NGDVPFTHANVSLA +DFGY+P
Sbjct  362   LRIYNLGNTSPVPVAKMVSILEDLLRKKAKKNVVTLPQNGDVPFTHANVSLAERDFGYRP  421

Query  495   TTDLSSGLRKFVKWYVSYYGIQ  430
             TTDL++GL+KFVKWYV YYG++
Sbjct  422   TTDLATGLKKFVKWYVEYYGVE  443



>ref|XP_007209167.1| hypothetical protein PRUPE_ppa006148mg [Prunus persica]
 gb|EMJ10366.1| hypothetical protein PRUPE_ppa006148mg [Prunus persica]
Length=425

 Score =   270 bits (690),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 139/197 (71%), Positives = 160/197 (81%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLS+TG  FF V GPWGRPD   FF
Sbjct  220   KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  279

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  L+GK I ++   +   VARDFTYIDDVVKGCV ALDTA+KSTGSGGKKKGPAQLR
Sbjct  280   FTKDILKGKTITIFEASDHGSVARDFTYIDDVVKGCVAALDTAKKSTGSGGKKKGPAQLR  339

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             ++NLGNTSPV V +LV+ILE LL +KAK+ V+ MPRNGDV FTHAN+SLA+K+  YKP T
Sbjct  340   IFNLGNTSPVPVSELVNILEKLLKVKAKRKVLPMPRNGDVKFTHANISLAHKELRYKPGT  399

Query  489   DLSSGLRKFVKWYVSYY  439
             DL +GL+KFV+WY+SYY
Sbjct  400   DLETGLKKFVRWYLSYY  416



>ref|XP_010687680.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Beta vulgaris subsp. 
vulgaris]
Length=434

 Score =   270 bits (691),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 139/198 (70%), Positives = 160/198 (81%), Gaps = 0/198 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             K PF E  RTDQPA LYA TKKAGEEI H  NHI+GLS+TG  FF V GPWGRPD   F 
Sbjct  229   KSPFSELDRTDQPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  288

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  LQGKPI +Y  +   ++ARDFTYIDDVVKGC+GALD++ KSTGSGGKK+GPA  R
Sbjct  289   FTRNILQGKPITIYRGKNKVDLARDFTYIDDVVKGCLGALDSSGKSTGSGGKKRGPAPYR  348

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             +YNLGNT PV+V  LVSILE  L +KAKKNVV+MP NGDVPFTHAN+SLA +DFGYKPTT
Sbjct  349   IYNLGNTQPVTVPTLVSILEKSLKVKAKKNVVEMPGNGDVPFTHANISLARRDFGYKPTT  408

Query  489   DLSSGLRKFVKWYVSYYG  436
             DL +GL+KFV+WY+SYYG
Sbjct  409   DLQTGLKKFVRWYLSYYG  426



>ref|XP_008351675.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Malus domestica]
Length=438

 Score =   270 bits (691),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 138/197 (70%), Positives = 160/197 (81%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  234   KVPFSERDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  293

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GK I ++       VARDFTYIDD+VKGC+ +LDTAEKSTGSGGKKKGPAQLR
Sbjct  294   FTRDILKGKTIPIFEGANHGTVARDFTYIDDIVKGCLASLDTAEKSTGSGGKKKGPAQLR  353

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LV+ILE LL +KAK+N++K+PRNGDV FTHAN+S A ++ GYKPTT
Sbjct  354   VFNLGNTSPVPVMDLVTILERLLKVKAKRNIMKLPRNGDVQFTHANISSAQRELGYKPTT  413

Query  489   DLSSGLRKFVKWYVSYY  439
             DL +GL+KFV+WY+SYY
Sbjct  414   DLQTGLKKFVRWYLSYY  430



>ref|XP_009342752.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Pyrus x bretschneideri]
Length=438

 Score =   270 bits (691),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 138/197 (70%), Positives = 160/197 (81%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  234   KVPFSERDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  293

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GK I ++       VARDFTYIDD+VKGC+ +LDTAEKSTGSGGKKKGPAQLR
Sbjct  294   FTRDILKGKTIPIFEGANHGTVARDFTYIDDIVKGCLASLDTAEKSTGSGGKKKGPAQLR  353

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LV+ILE LL +KAK+N++K+PRNGDV FTHAN+S A ++ GYKPTT
Sbjct  354   VFNLGNTSPVPVTDLVTILERLLKVKAKRNIMKLPRNGDVQFTHANISSAQRELGYKPTT  413

Query  489   DLSSGLRKFVKWYVSYY  439
             DL +GL+KFV+WY+SYY
Sbjct  414   DLQTGLKKFVRWYLSYY  430



>ref|XP_002281007.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Vitis vinifera]
Length=433

 Score =   270 bits (690),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 139/197 (71%), Positives = 159/197 (81%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEE+AH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  229   KVPFSERDRTDQPASLYAATKKAGEEMAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  288

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+ K I ++       VARDFTYIDD+VKGCV ALDTAEKSTGSGGKKKGPAQLR
Sbjct  289   FTRDILKEKSIPIFEAPNHGTVARDFTYIDDIVKGCVAALDTAEKSTGSGGKKKGPAQLR  348

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LV+ILE LL +KAK+ ++KMPRNGDV FTHAN+SLA ++ GYKPTT
Sbjct  349   VFNLGNTSPVPVTDLVNILERLLKVKAKRKMIKMPRNGDVQFTHANISLAQRELGYKPTT  408

Query  489   DLSSGLRKFVKWYVSYY  439
             DL +GL+KFVKWY++YY
Sbjct  409   DLQTGLKKFVKWYLNYY  425



>ref|XP_007013947.1| UDP-D-glucuronate 4-epimerase 1 [Theobroma cacao]
 gb|EOY31566.1| UDP-D-glucuronate 4-epimerase 1 [Theobroma cacao]
Length=433

 Score =   270 bits (690),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 135/202 (67%), Positives = 162/202 (80%), Gaps = 0/202 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEI H  NHI+GLS+TG  FF V GPWGRPD   F 
Sbjct  228   KVPFSEEDRTDQPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  287

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  LQGKPI +Y  +   ++ARDFTYIDD+VKGC+G+LDT+ KSTGSGGKK+GPA  R
Sbjct  288   FTRNILQGKPITIYRGKNRADLARDFTYIDDIVKGCLGSLDTSGKSTGSGGKKRGPAPYR  347

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             ++NLGNTSPV V +LV+ILE  L +KAK+N+V MP NGDVPFTHAN+S A ++FGYKPTT
Sbjct  348   IFNLGNTSPVKVPELVNILERHLKVKAKRNIVDMPGNGDVPFTHANISSAQREFGYKPTT  407

Query  489   DLSSGLRKFVKWYVSYYGIQSR  424
             DL +GL+KFV+WY+SYYG  +R
Sbjct  408   DLQTGLKKFVRWYLSYYGYNNR  429



>ref|XP_011010511.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Populus euphratica]
 ref|XP_011014870.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Populus euphratica]
Length=431

 Score =   270 bits (690),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 162/198 (82%), Gaps = 0/198 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E+ RTDQPA LYA TKKAGEEI H  NHI+GLS+TG  FF V GPWGRPD   F 
Sbjct  226   KVPFSESDRTDQPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  285

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  LQGKPI VY  ++  ++ARDFT+IDD+VKGCVG+LDT+ KS GSGGKK+GPA  R
Sbjct  286   FTRNILQGKPITVYRGKDRADLARDFTFIDDIVKGCVGSLDTSGKSPGSGGKKRGPAPYR  345

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             ++NLGNTSPV+V  LVS+LE  L +KAK+N V MP NGDVPFTHAN+SLA+++ GYKPTT
Sbjct  346   IFNLGNTSPVTVPTLVSLLERHLKVKAKRNFVDMPGNGDVPFTHANISLAHRELGYKPTT  405

Query  489   DLSSGLRKFVKWYVSYYG  436
             DL++GL+KFVKWY+SYYG
Sbjct  406   DLATGLKKFVKWYLSYYG  423



>gb|KEH32594.1| UDP-D-glucuronate 4-epimerase [Medicago truncatula]
Length=434

 Score =   270 bits (689),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 136/198 (69%), Positives = 161/198 (81%), Gaps = 0/198 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E+ RTDQPA LYA TKKAGEEI H  NHI+GLS+TG  FF V GPWGRPD   F 
Sbjct  230   KVPFSESDRTDQPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAIFT  289

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  LQGKPI VY  +   +++RDFTYIDD+VKGCVG+LDT+ KSTGSGGKK+G A  R
Sbjct  290   FTRNMLQGKPITVYRGKNRVDLSRDFTYIDDIVKGCVGSLDTSGKSTGSGGKKRGAAPYR  349

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             ++NLGNTSPV+V  LVSILE LL +KAKKN+V MP NGDVPFTHAN++ A ++FGYKPTT
Sbjct  350   IFNLGNTSPVTVPTLVSILERLLKVKAKKNIVDMPGNGDVPFTHANITSARREFGYKPTT  409

Query  489   DLSSGLRKFVKWYVSYYG  436
             D+ +GL+KFVKWY+SYYG
Sbjct  410   DIQTGLKKFVKWYLSYYG  427



>ref|XP_010268405.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Nelumbo nucifera]
Length=431

 Score =   270 bits (689),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 158/198 (80%), Gaps = 0/198 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E+ RTDQPA LYA TKKAGEEI H  NHI+GLS+TG  FF V GPWGRPD   FF
Sbjct  224   KVPFSESDRTDQPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  283

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  LQGKPI VY  +   ++ARDFTYIDD+VKGC+G+LDTA KSTGS GKK GPA  R
Sbjct  284   FTRNILQGKPITVYRGKNRVDLARDFTYIDDIVKGCLGSLDTAGKSTGSRGKKHGPAPYR  343

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             ++NLGNTSPV+V  LV ILE  L +KAKKN++ MP NGDVPFTHAN+S A ++ GYKPTT
Sbjct  344   IFNLGNTSPVTVPALVGILERNLKMKAKKNIIDMPGNGDVPFTHANISSARRELGYKPTT  403

Query  489   DLSSGLRKFVKWYVSYYG  436
             DL +GL+KFV+WY+SYYG
Sbjct  404   DLQTGLKKFVRWYLSYYG  421



>gb|KJB24820.1| hypothetical protein B456_004G162700 [Gossypium raimondii]
Length=433

 Score =   270 bits (689),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 137/197 (70%), Positives = 159/197 (81%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLT   FF V GPWGRPD   FF
Sbjct  229   KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTALRFFTVYGPWGRPDMAYFF  288

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GK I+++       VARDFTYIDD+VKGC+ ALDTAEKSTGSGGKKKGPAQ R
Sbjct  289   FTRDILKGKTISIFEAANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKKGPAQFR  348

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             VYNLGNTSPV V  LVSILE LL + AK+NV+K+P+NGDV FTHAN+SLA ++ GYKP+T
Sbjct  349   VYNLGNTSPVPVSDLVSILERLLKVDAKRNVMKLPQNGDVRFTHANISLAQRELGYKPST  408

Query  489   DLSSGLRKFVKWYVSYY  439
             DL +G++KFV+WY+SYY
Sbjct  409   DLQTGMKKFVRWYLSYY  425



>ref|XP_006648037.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Oryza brachyantha]
Length=437

 Score =   270 bits (689),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 138/198 (70%), Positives = 160/198 (81%), Gaps = 0/198 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E+ RTDQPA LYA TKKAGEEI H  NHI+GLS+TG  FF V GPWGRPD   F 
Sbjct  232   KVPFTESDRTDQPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  291

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  LQGKPI VY  +   ++ARDFTYIDD+VKGC+G+LDTA KSTG+GGKK+GPA  R
Sbjct  292   FTRNILQGKPITVYRGKNHVDLARDFTYIDDIVKGCLGSLDTAGKSTGTGGKKRGPAPYR  351

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             ++NLGNTSPV+V  LVSILE  L +KAKKNVV+MP NGDVPFTHAN+SLA +  GYKPTT
Sbjct  352   IFNLGNTSPVTVPSLVSILEKHLRVKAKKNVVEMPGNGDVPFTHANISLARQQLGYKPTT  411

Query  489   DLSSGLRKFVKWYVSYYG  436
             +L  GL+KFVKWY+SYYG
Sbjct  412   NLDVGLKKFVKWYLSYYG  429



>ref|XP_008364369.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Malus domestica]
Length=438

 Score =   270 bits (689),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 137/197 (70%), Positives = 159/197 (81%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  234   KVPFSERDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  293

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GK   ++     + VARDFTYIDD+VKGC+ +LDTAEKSTGSGGKKKGPAQLR
Sbjct  294   FTRDILKGKTXPIFEGANHRTVARDFTYIDDIVKGCLASLDTAEKSTGSGGKKKGPAQLR  353

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LV+ILE LL +KAK+ + K+PRNGDV FTHAN+SLA ++ GYKPTT
Sbjct  354   VFNLGNTSPVPVTDLVTILERLLKVKAKRKITKLPRNGDVQFTHANISLAQRELGYKPTT  413

Query  489   DLSSGLRKFVKWYVSYY  439
             DL +GL+KFV+WY+SYY
Sbjct  414   DLQTGLKKFVRWYLSYY  430



>ref|XP_009586623.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Nicotiana tomentosiformis]
Length=426

 Score =   269 bits (688),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 138/198 (70%), Positives = 160/198 (81%), Gaps = 0/198 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E+ RTDQPA LYA TKKAGEEI H  NHI+GLS+TG  FF V GPWGRPD   F 
Sbjct  221   KVPFSESDRTDQPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  280

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  LQGKPI VY  +   ++ARDFTYIDDVVKGC+G+LDT+ KSTGSGGKK+GPA  R
Sbjct  281   FTRNILQGKPITVYRGKNRVDLARDFTYIDDVVKGCIGSLDTSGKSTGSGGKKRGPAPYR  340

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             ++NLGNTSPV+V  +V ILE  L +KAKKN V+MP NGDVPFTHAN+S A K+FGYKPTT
Sbjct  341   IFNLGNTSPVTVPMMVGILEKHLKVKAKKNFVEMPGNGDVPFTHANISSARKEFGYKPTT  400

Query  489   DLSSGLRKFVKWYVSYYG  436
             DL +GL+KFVKWY+SYYG
Sbjct  401   DLQTGLKKFVKWYLSYYG  418



>ref|XP_009591830.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nicotiana tomentosiformis]
 ref|XP_009591831.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nicotiana tomentosiformis]
 ref|XP_009802117.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nicotiana sylvestris]
Length=435

 Score =   269 bits (688),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 138/198 (70%), Positives = 160/198 (81%), Gaps = 0/198 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  231   KVPFSERDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  290

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GK I ++       VARDFTY+DD+VKGC+ ALDTAEKSTGSGGKKKGPAQLR
Sbjct  291   FTRDILKGKSIPIFEAANHGTVARDFTYVDDIVKGCLAALDTAEKSTGSGGKKKGPAQLR  350

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LVSILE LL +KAK+ V+K+PRNGDV FTHAN+S A ++ GYKP+T
Sbjct  351   VFNLGNTSPVPVSDLVSILERLLKVKAKRLVMKLPRNGDVQFTHANISSAQRELGYKPST  410

Query  489   DLSSGLRKFVKWYVSYYG  436
             DL +GL+KFV+WY++YYG
Sbjct  411   DLQTGLKKFVRWYLNYYG  428



>ref|NP_001048359.1| Os02g0791500 [Oryza sativa Japonica Group]
 dbj|BAD19123.1| putative nucleotide sugar epimerase [Oryza sativa Japonica Group]
 dbj|BAD19172.1| putative nucleotide sugar epimerase [Oryza sativa Japonica Group]
 gb|ABC59069.1| UDP-glucuronic acid 4-epimerase isoform 2 [Oryza sativa Japonica 
Group]
 dbj|BAF10273.1| Os02g0791500 [Oryza sativa Japonica Group]
 gb|EAY87821.1| hypothetical protein OsI_09239 [Oryza sativa Indica Group]
 gb|EAZ24901.1| hypothetical protein OsJ_08679 [Oryza sativa Japonica Group]
Length=437

 Score =   269 bits (688),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 138/198 (70%), Positives = 160/198 (81%), Gaps = 0/198 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E+ RTDQPA LYA TKKAGEEI H  NHI+GLS+TG  FF V GPWGRPD   F 
Sbjct  232   KVPFTESDRTDQPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  291

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  LQGKPI VY  +   ++ARDFTYIDD+VKGC+G+LDTA KSTG+GGKK+GPA  R
Sbjct  292   FTRNILQGKPITVYRGKNRVDLARDFTYIDDIVKGCLGSLDTAGKSTGTGGKKRGPAPYR  351

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             ++NLGNTSPV+V  LVSILE  L +KAKKNVV+MP NGDVPFTHAN+SLA +  GYKPTT
Sbjct  352   IFNLGNTSPVTVPNLVSILEKHLRVKAKKNVVEMPGNGDVPFTHANISLARQQLGYKPTT  411

Query  489   DLSSGLRKFVKWYVSYYG  436
             +L  GL+KFVKWY+SYYG
Sbjct  412   NLDVGLKKFVKWYLSYYG  429



>ref|XP_004954186.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Setaria italica]
Length=439

 Score =   269 bits (688),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 138/198 (70%), Positives = 160/198 (81%), Gaps = 0/198 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEI H  NHI+GLS+TG  FF V GPWGRPD   F 
Sbjct  232   KVPFSERDRTDQPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  291

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  LQGKPI VY  ++  ++ARDFTYIDD+VKGC+G+LDTA KSTG+GGKK+GPA  R
Sbjct  292   FTRNILQGKPITVYRGKDHVDLARDFTYIDDIVKGCLGSLDTAGKSTGTGGKKRGPAPYR  351

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             ++NLGNTSPV+V  LVSILE  L +KAKKNVV+MP NGDVPFTHAN+SLA +  GYKPTT
Sbjct  352   IFNLGNTSPVTVPNLVSILEKHLRVKAKKNVVEMPGNGDVPFTHANISLAREQLGYKPTT  411

Query  489   DLSSGLRKFVKWYVSYYG  436
             +L  GL+KFVKWY+SYYG
Sbjct  412   NLDVGLKKFVKWYLSYYG  429



>dbj|BAJ85817.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96031.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96148.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88803.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08139.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=438

 Score =   269 bits (688),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 136/198 (69%), Positives = 161/198 (81%), Gaps = 0/198 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E+ RTDQPA LYA TKKAGEEI H  NHI+GLS+TG  FF V GPWGRPD   F 
Sbjct  233   KVPFSESHRTDQPASLYAATKKAGEEITHSYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  292

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  LQGKPI VY  +   ++ARDFTYIDD+VKGC+G+LDTA +STG+GGKK+GPA  R
Sbjct  293   FTRNILQGKPITVYRGKNHVDLARDFTYIDDIVKGCLGSLDTAGRSTGTGGKKRGPAPYR  352

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             ++NLGNTSPV+V  LVSILE  L +KAKK+VV+MP NGDVPFTHAN+SLA +  GYKPTT
Sbjct  353   IFNLGNTSPVTVPTLVSILEKHLRVKAKKHVVEMPGNGDVPFTHANISLARQQLGYKPTT  412

Query  489   DLSSGLRKFVKWYVSYYG  436
             +L +GL+KFVKWY+SYYG
Sbjct  413   NLDAGLKKFVKWYLSYYG  430



>ref|XP_007154841.1| hypothetical protein PHAVU_003G152300g [Phaseolus vulgaris]
 gb|ESW26835.1| hypothetical protein PHAVU_003G152300g [Phaseolus vulgaris]
Length=431

 Score =   269 bits (688),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 138/198 (70%), Positives = 159/198 (80%), Gaps = 0/198 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E+ RTDQPA LYA TKKAGEEI H  NHI+GLS+TG  FF V GPWGRPD   F 
Sbjct  226   KVPFSESDRTDQPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  285

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  LQGKPI VY  +   ++ARDFTYIDD+VKGCVG+LDTA KSTGSGGKK+GPA  R
Sbjct  286   FTRNILQGKPITVYRGKNRVDLARDFTYIDDIVKGCVGSLDTAGKSTGSGGKKRGPAPYR  345

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             ++NLGNTSPV+V  LVSILE  L +KAK+N+V MP NGDVPFTHAN+S A  + GYKPTT
Sbjct  346   IFNLGNTSPVTVPTLVSILERHLKVKAKRNIVDMPGNGDVPFTHANISSARAELGYKPTT  405

Query  489   DLSSGLRKFVKWYVSYYG  436
             DL +GL+KFVKWY+SYYG
Sbjct  406   DLQTGLKKFVKWYLSYYG  423



>ref|XP_004506538.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Cicer arietinum]
Length=440

 Score =   269 bits (688),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 139/197 (71%), Positives = 158/197 (80%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  236   KVPFSERDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  295

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GK I ++       VARDFTYIDD+V+GC+GALDTAEKSTGSGGKKKGPAQLR
Sbjct  296   FTRDILKGKTIPIFEAPNHGTVARDFTYIDDIVRGCLGALDTAEKSTGSGGKKKGPAQLR  355

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LVSILE LL  KAK+NV+K+PRNGDV FTHAN+S A  + GYKP T
Sbjct  356   VFNLGNTSPVPVSDLVSILERLLKTKAKRNVMKLPRNGDVQFTHANISYAQTELGYKPVT  415

Query  489   DLSSGLRKFVKWYVSYY  439
             DL +GL+KFV+WY++YY
Sbjct  416   DLQTGLKKFVRWYLNYY  432



>ref|XP_002309376.1| hypothetical protein POPTR_0006s19240g [Populus trichocarpa]
 gb|EEE92899.1| hypothetical protein POPTR_0006s19240g [Populus trichocarpa]
Length=431

 Score =   269 bits (687),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 135/197 (69%), Positives = 162/197 (82%), Gaps = 0/197 (0%)
 Frame = -2

Query  1026  VPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFF  847
             VPF E+ RTDQPA LYA TKKAGEEI H  NHI+GLS+TG  FF V GPWGRPD   F F
Sbjct  227   VPFSESDRTDQPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFSF  286

Query  846   XKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLRV  667
              +  LQGKPI VY  ++  ++ARDFT+IDD+VKGCVG+LDT+ KSTGSGGKK+GPA  R+
Sbjct  287   TRNILQGKPITVYRGKDRADLARDFTFIDDIVKGCVGSLDTSGKSTGSGGKKRGPAPYRI  346

Query  666   YNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTD  487
             +NLGNTSPV+V  LVS+LE  L +KAK+N V MP NGDVPFTHAN+SLA+++ GYKPTTD
Sbjct  347   FNLGNTSPVTVPTLVSLLERHLKVKAKRNFVDMPGNGDVPFTHANISLAHRELGYKPTTD  406

Query  486   LSSGLRKFVKWYVSYYG  436
             L++GL+KFVKWY+SYYG
Sbjct  407   LATGLKKFVKWYLSYYG  423



>gb|KHN30291.1| UDP-glucuronate 4-epimerase 1 [Glycine soja]
Length=341

 Score =   266 bits (679),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 160/198 (81%), Gaps = 0/198 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E+ +TD+PA LYA TKKAGEEI H  NHI+GLS+TG  FF V GPWGRPD   F 
Sbjct  136   KVPFSESDQTDRPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  195

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  LQGKPI VY  +   ++ARDFTYIDD+VKGCVG+LDT+ KSTGSGGKK+GPA  R
Sbjct  196   FTRNILQGKPITVYRGKNHVDLARDFTYIDDIVKGCVGSLDTSAKSTGSGGKKRGPAPYR  255

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             ++NLGNTSPV+V  LVSILE  L +KAK+N+V MP NGDVPFTHAN+S A ++ GYKPTT
Sbjct  256   IFNLGNTSPVTVPTLVSILERHLKVKAKRNIVDMPGNGDVPFTHANISSARRELGYKPTT  315

Query  489   DLSSGLRKFVKWYVSYYG  436
             DL +GL+KFVKWY+SYYG
Sbjct  316   DLQTGLKKFVKWYLSYYG  333



>ref|XP_008222861.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Prunus mume]
Length=440

 Score =   269 bits (687),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 147/205 (72%), Positives = 159/205 (78%), Gaps = 21/205 (10%)
 Frame = -2

Query  1023  PFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFFX  844
             PF E  RTDQPA LYA TKKAGEEIAH  NHI+GL+LTG  FF V GPWGRPD   FFF 
Sbjct  243   PFSELHRTDQPASLYAATKKAGEEIAHTYNHIYGLALTGLRFFTVYGPWGRPDMAYFFFT  302

Query  843   KXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLRVY  664
             K  LQGKPI+VY T +DKEVARDFTYIDDVVKGC+GALDTAEKSTGSGGKKKGPAQLR+Y
Sbjct  303   KDILQGKPIDVYKTVDDKEVARDFTYIDDVVKGCLGALDTAEKSTGSGGKKKGPAQLRIY  362

Query  663   NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  484
             NLGNTSPV V KLVSILE LL  KAKK+V+KMPR                     PTTDL
Sbjct  363   NLGNTSPVPVGKLVSILEGLLGTKAKKHVIKMPR---------------------PTTDL  401

Query  483   SSGLRKFVKWYVSYYGIQSRVKTEL  409
             +SGLRKFVKWYVSYYGI++RVK E+
Sbjct  402   ASGLRKFVKWYVSYYGIETRVKREM  426



>ref|NP_191922.1| UDP-D-glucuronate 4-epimerase 3 [Arabidopsis thaliana]
 sp|O81312.1|GAE3_ARATH RecName: Full=UDP-glucuronate 4-epimerase 3; AltName: Full=UDP-glucuronic 
acid epimerase 3 [Arabidopsis thaliana]
 gb|AAC19298.1| contains similarity to nucleotide sugar epimerases [Arabidopsis 
thaliana]
 emb|CAB80769.1| putative nucleotide sugar epimerase [Arabidopsis thaliana]
 gb|ABH04594.1| At4g00110 [Arabidopsis thaliana]
 gb|AEE81824.1| UDP-D-glucuronate 4-epimerase 3 [Arabidopsis thaliana]
Length=430

 Score =   269 bits (687),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 136/197 (69%), Positives = 159/197 (81%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  226   KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  285

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GK I+++       VARDFTYIDD+VKGC+GALDTAEKSTGSGGKK+G AQLR
Sbjct  286   FTRDILKGKAISIFEGVNHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRGAAQLR  345

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LV+ILE LL +KAK+N++K+PRNGDV FTHAN+S A ++ GYKPTT
Sbjct  346   VFNLGNTSPVPVTDLVTILERLLKVKAKRNIMKLPRNGDVQFTHANISSAQRELGYKPTT  405

Query  489   DLSSGLRKFVKWYVSYY  439
             DL +GL+KF +WY+ YY
Sbjct  406   DLQTGLKKFARWYLGYY  422



>ref|XP_004306933.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Fragaria vesca subsp. 
vesca]
Length=434

 Score =   268 bits (686),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 136/197 (69%), Positives = 160/197 (81%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  230   KVPFSERDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  289

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GK I ++       VARDFTYIDD+VKGC+ +LDTAEKSTGSGGKKKGPAQLR
Sbjct  290   FTRDILKGKTIPIFEAANHGTVARDFTYIDDIVKGCLASLDTAEKSTGSGGKKKGPAQLR  349

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LV+ILE LL +KAK++++K+PRNGDV FTHAN+S A ++ GYKPTT
Sbjct  350   VFNLGNTSPVPVSDLVTILERLLKVKAKRSILKLPRNGDVQFTHANISSAQRELGYKPTT  409

Query  489   DLSSGLRKFVKWYVSYY  439
             DL +GL+KFV+WY++YY
Sbjct  410   DLQTGLKKFVRWYLTYY  426



>ref|XP_003605138.1| UDP-glucuronate 4-epimerase [Medicago truncatula]
 gb|AES87335.1| UDP-D-glucuronate 4-epimerase [Medicago truncatula]
Length=440

 Score =   269 bits (687),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 136/197 (69%), Positives = 158/197 (80%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  236   KVPFSERDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  295

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GK I ++       VARDFTYIDD+V+GC+GALDTAEKSTGSGGKK+GPAQLR
Sbjct  296   FTRDILKGKTIPIFEAANHGTVARDFTYIDDIVRGCLGALDTAEKSTGSGGKKRGPAQLR  355

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LV ILE LL  KAK+N++K+PRNGDV FTHAN+S A ++ GYKP T
Sbjct  356   VFNLGNTSPVPVSDLVGILERLLKTKAKRNIMKLPRNGDVQFTHANISYAQRELGYKPVT  415

Query  489   DLSSGLRKFVKWYVSYY  439
             DL +GL+KFV+WY++YY
Sbjct  416   DLQAGLKKFVRWYLNYY  432



>ref|XP_009800153.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Nicotiana sylvestris]
Length=426

 Score =   268 bits (686),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 137/198 (69%), Positives = 160/198 (81%), Gaps = 0/198 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E+ RTDQPA LYA TKKAGEEI H  NHI+GLS+TG  FF V GPWGRPD   F 
Sbjct  221   KVPFSESDRTDQPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  280

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  LQGKPI VY  +   ++ARDFTYIDDVVKGC+G+LDT+ KSTGSGGKK+GPA  R
Sbjct  281   FTRNILQGKPITVYRGKNRVDLARDFTYIDDVVKGCIGSLDTSGKSTGSGGKKRGPAPYR  340

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             ++NLGNTSPV+V  +V ILE  L +KAKKN V+MP NGDVPFTHAN+S A K+FGYKPTT
Sbjct  341   IFNLGNTSPVTVPMMVGILEKHLKVKAKKNFVEMPGNGDVPFTHANISSARKEFGYKPTT  400

Query  489   DLSSGLRKFVKWYVSYYG  436
             DL +GL+KFV+WY+SYYG
Sbjct  401   DLQTGLKKFVRWYLSYYG  418



>ref|XP_003549520.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Glycine max]
Length=431

 Score =   268 bits (685),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 136/198 (69%), Positives = 160/198 (81%), Gaps = 0/198 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E+ +TDQPA LYA TKKAGEEI H  NHI+GLS+TG  FF V GPWGRPD   F 
Sbjct  226   KVPFSESDQTDQPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  285

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  LQGKPI VY  +   ++ARDFTYIDD+VKGCVG+LDT+ KSTGSGGKK+GPA  R
Sbjct  286   FTRNILQGKPITVYRGKNHVDLARDFTYIDDIVKGCVGSLDTSAKSTGSGGKKRGPAPYR  345

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             ++NLGNTSPV+V  LVSILE  L +KAK+N+V MP NGDVPFTHAN+S A ++ GYKPTT
Sbjct  346   IFNLGNTSPVTVPTLVSILERHLKVKAKRNIVDMPGNGDVPFTHANISSARRELGYKPTT  405

Query  489   DLSSGLRKFVKWYVSYYG  436
             DL +GL+KFVKWY+SYYG
Sbjct  406   DLQTGLKKFVKWYLSYYG  423



>ref|XP_010278008.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Nelumbo nucifera]
Length=433

 Score =   268 bits (685),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 137/198 (69%), Positives = 159/198 (80%), Gaps = 0/198 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEI H  NHI+GLS+TG  FF V GPWGRPD   F 
Sbjct  226   KVPFSEADRTDQPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  285

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  LQGKPI VY  +   ++ARDFTYIDD+VKGC+G+LDTA KSTGSGGKK+GPA  R
Sbjct  286   FTRNILQGKPITVYRGKNRVDLARDFTYIDDIVKGCLGSLDTAGKSTGSGGKKRGPAPYR  345

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             ++NLGNTSPV+V  LV ILE  L +KAKKN+V MP NGDVPFTHAN+SLA  +FGYKPTT
Sbjct  346   IFNLGNTSPVTVPTLVGILERHLKMKAKKNIVDMPGNGDVPFTHANISLARMEFGYKPTT  405

Query  489   DLSSGLRKFVKWYVSYYG  436
             DL +GL+KFV+WY++YYG
Sbjct  406   DLQTGLKKFVRWYLNYYG  423



>gb|KJB76605.1| hypothetical protein B456_012G096800 [Gossypium raimondii]
Length=431

 Score =   268 bits (684),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 136/202 (67%), Positives = 162/202 (80%), Gaps = 0/202 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEI H  NHI+GLS+TG  FF V GPWGRPD   F 
Sbjct  226   KVPFSEADRTDQPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  285

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  LQGKPI +Y  +   ++ARDFTYIDD+VKGC+G+LDT+ KSTGSGGKKKG A  R
Sbjct  286   FTRNILQGKPITIYRGKNRVDLARDFTYIDDIVKGCLGSLDTSGKSTGSGGKKKGNAPYR  345

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             ++NLGNTSPV V +LV+ILE  L +KAK+N+V MP NGDVPFTHAN+SLA ++FGYKPTT
Sbjct  346   IFNLGNTSPVKVPELVNILERHLKVKAKRNIVDMPGNGDVPFTHANISLAQREFGYKPTT  405

Query  489   DLSSGLRKFVKWYVSYYGIQSR  424
             DL +GL+KFV+WY+SYYG  +R
Sbjct  406   DLQTGLKKFVRWYLSYYGYNNR  427



>ref|XP_012071600.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Jatropha curcas]
 gb|KDP38751.1| hypothetical protein JCGZ_04104 [Jatropha curcas]
Length=431

 Score =   268 bits (684),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 137/198 (69%), Positives = 160/198 (81%), Gaps = 0/198 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E+ RTDQPA LYA TKKAGEEI H  NHI+GLS+TG  FF V GPWGRPD   F 
Sbjct  226   KVPFSESDRTDQPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  285

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  LQGKPI VY  +   ++ARDFTYIDD+VKGCVG+LDTA KSTGSGGKK+GPA  R
Sbjct  286   FTRNILQGKPITVYRGKNRVDLARDFTYIDDIVKGCVGSLDTAGKSTGSGGKKRGPAPYR  345

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             ++NLGNTSPV+V  LVSILE  L  KAK+++V MP NGDVPFTHAN++LA ++FGYKPTT
Sbjct  346   IFNLGNTSPVTVPTLVSILEKHLKTKAKRHIVDMPGNGDVPFTHANITLARREFGYKPTT  405

Query  489   DLSSGLRKFVKWYVSYYG  436
             DL +GL+KFVKWY+ YYG
Sbjct  406   DLQTGLKKFVKWYLWYYG  423



>ref|XP_008223573.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Prunus mume]
Length=432

 Score =   268 bits (684),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 136/197 (69%), Positives = 160/197 (81%), Gaps = 0/197 (0%)
 Frame = -2

Query  1026  VPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFF  847
             VPF E+ RTDQPA LYA TKKAGEEI H  NHI+GLS+TG  FF V GPWGRPD   F F
Sbjct  228   VPFSESDRTDQPASLYAATKKAGEEITHTYNHIYGLSVTGLRFFTVYGPWGRPDMAYFSF  287

Query  846   XKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLRV  667
              +  LQGKPI +Y  +   ++ARDFTYIDD+VKGC+G+LDT+ KSTGSGGKK+GPA  R+
Sbjct  288   TRNILQGKPITIYRGKNRVDLARDFTYIDDIVKGCLGSLDTSGKSTGSGGKKRGPAPYRI  347

Query  666   YNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTD  487
             +NLGNTSPV+V  LVSILE  L +KAKKN V MP NGDVPFTHAN+SLA ++FGYKPTTD
Sbjct  348   FNLGNTSPVTVPTLVSILERHLKMKAKKNFVDMPGNGDVPFTHANISLARREFGYKPTTD  407

Query  486   LSSGLRKFVKWYVSYYG  436
             L +GL+KFV+WY+SYYG
Sbjct  408   LQTGLKKFVRWYLSYYG  424



>ref|XP_007222381.1| hypothetical protein PRUPE_ppa006006mg [Prunus persica]
 gb|EMJ23580.1| hypothetical protein PRUPE_ppa006006mg [Prunus persica]
Length=432

 Score =   268 bits (684),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 136/197 (69%), Positives = 160/197 (81%), Gaps = 0/197 (0%)
 Frame = -2

Query  1026  VPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFF  847
             VPF E+ RTDQPA LYA TKKAGEEI H  NHI+GLS+TG  FF V GPWGRPD   F F
Sbjct  228   VPFSESDRTDQPASLYAATKKAGEEITHTYNHIYGLSVTGLRFFTVYGPWGRPDMAYFSF  287

Query  846   XKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLRV  667
              +  LQGKPI +Y  +   ++ARDFTYIDD+VKGC+G+LDT+ KSTGSGGKK+GPA  R+
Sbjct  288   TRNILQGKPITIYRGKNRVDLARDFTYIDDIVKGCLGSLDTSGKSTGSGGKKRGPAPYRI  347

Query  666   YNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTD  487
             +NLGNTSPV+V  LVSILE  L +KAKKN V MP NGDVPFTHAN+SLA ++FGYKPTTD
Sbjct  348   FNLGNTSPVTVPTLVSILERHLKMKAKKNFVDMPGNGDVPFTHANISLARREFGYKPTTD  407

Query  486   LSSGLRKFVKWYVSYYG  436
             L +GL+KFV+WY+SYYG
Sbjct  408   LQTGLKKFVRWYLSYYG  424



>ref|XP_009408344.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Musa acuminata 
subsp. malaccensis]
Length=447

 Score =   268 bits (685),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 136/200 (68%), Positives = 160/200 (80%), Gaps = 0/200 (0%)
 Frame = -2

Query  1023  PFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFFX  844
             PF E  RTD+PA LYA TKKAGE IAH  NHI+GLS+TG  FF V GPWGRPD   F F 
Sbjct  243   PFSELHRTDRPASLYAATKKAGEAIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFSFT  302

Query  843   KXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLRVY  664
                L+GKPI ++  Q+   V RDFTYIDDVVKGC+GALDTAE+STGSGGKK+GPAQLRVY
Sbjct  303   NNILRGKPITLFRVQDGTAVQRDFTYIDDVVKGCLGALDTAERSTGSGGKKRGPAQLRVY  362

Query  663   NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  484
             NLGNTSPV V K+V ILE LL  KAKK+VV +P+NGDVP+THANVS+A +D GY+ TTDL
Sbjct  363   NLGNTSPVPVAKMVGILEELLGKKAKKHVVTLPQNGDVPYTHANVSMAERDLGYRATTDL  422

Query  483   SSGLRKFVKWYVSYYGIQSR  424
             ++GL+KFV+WYV YY  +S+
Sbjct  423   ATGLKKFVRWYVEYYDRKSK  442



>gb|KDO62346.1| hypothetical protein CISIN_1g043169mg [Citrus sinensis]
Length=421

 Score =   267 bits (683),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 128/197 (65%), Positives = 152/197 (77%), Gaps = 10/197 (5%)
 Frame = -2

Query  1026  VPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFFF  847
             VPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLS+TG  FF V GPWGRPD   F F
Sbjct  227   VPFSEADRTDQPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFSF  286

Query  846   XKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLRV  667
              +  LQGKPI VY  +   ++ARDFTYIDD+VKGC+G+LDT+           GPA  R+
Sbjct  287   TRNILQGKPITVYRGKNHVDLARDFTYIDDIVKGCLGSLDTS----------AGPAPYRI  336

Query  666   YNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTD  487
             +NLGNTSPV+V KLV+ILE  L +KAKKNV++MP NGDVPFTHAN+S A K+FGY+PTTD
Sbjct  337   FNLGNTSPVTVPKLVNILERHLKVKAKKNVIEMPGNGDVPFTHANISSAQKEFGYRPTTD  396

Query  486   LSSGLRKFVKWYVSYYG  436
             L +GL+KFV+WY+SYYG
Sbjct  397   LQTGLKKFVRWYLSYYG  413



>ref|XP_003570280.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Brachypodium distachyon]
Length=441

 Score =   268 bits (684),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 160/198 (81%), Gaps = 0/198 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEI H  NHI+GLS+TG  FF V GPWGRPD   F 
Sbjct  236   KVPFSEADRTDQPASLYAATKKAGEEITHSYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  295

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  LQGKPI VY  +   ++ARDFTYIDD+VKGC+G+LDTA +STG+GGKK+GPA  R
Sbjct  296   FTRNILQGKPITVYRGKNHVDLARDFTYIDDIVKGCLGSLDTAGRSTGTGGKKRGPAPYR  355

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             ++NLGNTSPV+V  LVSILE  L +KAKK+V++MP NGDVPFTHAN+SLA +  GYKPTT
Sbjct  356   IFNLGNTSPVTVPTLVSILEKHLRVKAKKHVIEMPGNGDVPFTHANISLARQQLGYKPTT  415

Query  489   DLSSGLRKFVKWYVSYYG  436
             +L +GL+KFVKWY+SYYG
Sbjct  416   NLDAGLKKFVKWYLSYYG  433



>ref|XP_004507780.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Cicer arietinum]
Length=432

 Score =   268 bits (684),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 136/198 (69%), Positives = 160/198 (81%), Gaps = 0/198 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E+ +TDQPA LYA TKKAGEEI H  NHI+GLS+TG  FF V GPWGRPD   F 
Sbjct  229   KVPFSESDQTDQPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  288

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  LQGKPI VY  +   ++ARDFTYIDD+VKGCVG+LDT+ KSTGSGGKK+G A  R
Sbjct  289   FTRNILQGKPITVYRGKNHVDLARDFTYIDDIVKGCVGSLDTSGKSTGSGGKKRGSAPYR  348

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             ++NLGNTSPV+V  LVSILE  L +KAK+N+V MP NGDVPFTHAN+SLA ++ GYKPTT
Sbjct  349   IFNLGNTSPVTVPTLVSILERHLKVKAKRNIVDMPGNGDVPFTHANISLARRELGYKPTT  408

Query  489   DLSSGLRKFVKWYVSYYG  436
             DL +GL+KFVKWY+SYYG
Sbjct  409   DLQTGLKKFVKWYLSYYG  426



>ref|XP_010662214.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [Vitis vinifera]
Length=341

 Score =   265 bits (676),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 132/196 (67%), Positives = 157/196 (80%), Gaps = 0/196 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTD+PA LYA TKKAGE IAH  NHI+GLS+TG  FF V GPWGRPD   FF
Sbjct  136   KVPFSEKDRTDRPASLYAATKKAGEAIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  195

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L GKPI ++   +   VARDFTYIDD+VKGC+ +LDTA+KSTG+GGKKKG AQ R
Sbjct  196   FTRDILTGKPITIFEGPDHGSVARDFTYIDDIVKGCLASLDTAKKSTGTGGKKKGAAQFR  255

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             ++NLGNTSPV V KLVSILE LL +KAK+ V+ MPRNGDV +THAN+SLA ++ GYKPTT
Sbjct  256   IFNLGNTSPVDVSKLVSILEKLLKVKAKRRVLPMPRNGDVQYTHANISLAQRELGYKPTT  315

Query  489   DLSSGLRKFVKWYVSY  442
             DL SGL+KFV+WY++Y
Sbjct  316   DLESGLKKFVRWYITY  331



>ref|XP_008465609.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Cucumis melo]
Length=431

 Score =   267 bits (683),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 136/198 (69%), Positives = 160/198 (81%), Gaps = 0/198 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E+ RTDQPA LYA TKKAGEEI H  NHI+GLS+TG  FF V GPWGRPD   F 
Sbjct  226   KVPFSESDRTDQPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  285

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  LQGKPI V+  +   ++ARDFTYIDD+VKGC+G+LDT+ KSTGSGGKK GPA  R
Sbjct  286   FTRNILQGKPITVFRGKNRVDLARDFTYIDDIVKGCLGSLDTSGKSTGSGGKKTGPAPYR  345

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             ++NLGNTSPV+V  LVSILE  L +KAKKNVV+MP NGDVPFTHAN+S A ++ GYKPTT
Sbjct  346   IFNLGNTSPVTVPTLVSILERHLKVKAKKNVVEMPGNGDVPFTHANISSARRELGYKPTT  405

Query  489   DLSSGLRKFVKWYVSYYG  436
             DL +GL+KFV+WY+SYYG
Sbjct  406   DLQTGLKKFVRWYLSYYG  423



>ref|XP_010323223.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Solanum lycopersicum]
Length=425

 Score =   267 bits (682),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 137/198 (69%), Positives = 160/198 (81%), Gaps = 0/198 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E+ RTDQPA LYA TKKAGEEI H  NHI+GLS+TG  FF V GPWGRPD   F 
Sbjct  222   KVPFSESDRTDQPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  281

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  LQGKPI VY  +   ++ARDFTYIDDVVKGC+G+LDT+ KSTGSGGKK+GPA  R
Sbjct  282   FTRNILQGKPITVYRGKNRVDLARDFTYIDDVVKGCIGSLDTSGKSTGSGGKKRGPAPYR  341

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             ++NLGNTSPV+V  +V++LE  L +KAKKN V MP NGDVPFTHAN+S A K+FGYKPTT
Sbjct  342   IFNLGNTSPVTVPMMVAMLEKHLKVKAKKNFVVMPGNGDVPFTHANISSARKEFGYKPTT  401

Query  489   DLSSGLRKFVKWYVSYYG  436
             DL +GL+KFVKWY+SYYG
Sbjct  402   DLQTGLKKFVKWYLSYYG  419



>ref|XP_010692224.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Beta vulgaris subsp. 
vulgaris]
Length=450

 Score =   268 bits (684),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 138/197 (70%), Positives = 159/197 (81%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLT   FF V GPWGRPD   FF
Sbjct  245   KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTALRFFTVYGPWGRPDMAYFF  304

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  L+GK I ++       VARDFTYIDD+VKGC+GALDTA+KSTGSGGKKKGPAQLR
Sbjct  305   FTKDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLGALDTAQKSTGSGGKKKGPAQLR  364

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LVSILE+LL +KAK+ V+K+PRNGDV +THAN+S A ++ GYKPTT
Sbjct  365   VFNLGNTSPVPVSDLVSILESLLKVKAKRTVMKLPRNGDVQYTHANISYAKRELGYKPTT  424

Query  489   DLSSGLRKFVKWYVSYY  439
             DL  GL+KFV+WY++YY
Sbjct  425   DLQGGLKKFVRWYLNYY  441



>ref|XP_006343570.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Solanum tuberosum]
Length=425

 Score =   267 bits (682),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 137/198 (69%), Positives = 160/198 (81%), Gaps = 0/198 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E+ RTDQPA LYA TKKAGEEI H  NHI+GLS+TG  FF V GPWGRPD   F 
Sbjct  222   KVPFSESDRTDQPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  281

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  LQGKPI VY  +   ++ARDFTYIDDVVKGC+G+LDT+ KSTGSGGKK+GPA  R
Sbjct  282   FTRNILQGKPITVYRGKNRVDLARDFTYIDDVVKGCIGSLDTSGKSTGSGGKKRGPAPYR  341

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             ++NLGNTSPV+V  +V++LE  L +KAKKN V MP NGDVPFTHAN+S A K+FGYKPTT
Sbjct  342   IFNLGNTSPVTVPMMVAMLEKHLKVKAKKNFVVMPGNGDVPFTHANISSARKEFGYKPTT  401

Query  489   DLSSGLRKFVKWYVSYYG  436
             DL +GL+KFVKWY+SYYG
Sbjct  402   DLQTGLKKFVKWYLSYYG  419



>ref|XP_006350062.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Solanum tuberosum]
Length=431

 Score =   266 bits (681),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 160/198 (81%), Gaps = 0/198 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E+ RTDQPA LYA TKKAGEEI H  NHI+GLS+TG  FF V GPWGRPD   F 
Sbjct  226   KVPFSESDRTDQPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  285

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  LQGKPI VY  +   ++ARDFTYIDD+VKGCVG+LDTA KSTGSGGKK+GPA  R
Sbjct  286   FTRNILQGKPITVYRGKNRVDLARDFTYIDDIVKGCVGSLDTAGKSTGSGGKKRGPAMFR  345

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             ++NLGNTSPV+V  +V++LE  L +KAKK+V+ MP NGDVPFTHAN+SLA K+ GYKPTT
Sbjct  346   IFNLGNTSPVTVPMMVAMLEKHLKVKAKKHVLDMPGNGDVPFTHANISLAQKELGYKPTT  405

Query  489   DLSSGLRKFVKWYVSYYG  436
             +L +GL KFV+WY+SYYG
Sbjct  406   NLQTGLGKFVRWYLSYYG  423



>ref|XP_010676680.1| PREDICTED: UDP-glucuronate 4-epimerase 4 [Beta vulgaris subsp. 
vulgaris]
Length=451

 Score =   267 bits (683),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 136/207 (66%), Positives = 161/207 (78%), Gaps = 0/207 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTD+PA LYA TKKAGEEI H  NHI+GLS+TG  FF V GPWGRPD   FF
Sbjct  244   KVPFSEKDRTDEPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  303

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  L+GK I V+       VARDFTYIDD+VKGC+GALDTA+KSTG+GGKKKGPAQ R
Sbjct  304   FTKDMLKGKEITVFEGPNHSTVARDFTYIDDIVKGCLGALDTAKKSTGTGGKKKGPAQFR  363

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             ++NLGNTSPVSV +LVSILE LL +K+ K V+ +PRNGDV FTHAN++LA ++  YKPTT
Sbjct  364   IFNLGNTSPVSVNQLVSILEKLLKVKSNKKVLPLPRNGDVQFTHANITLAQRELRYKPTT  423

Query  489   DLSSGLRKFVKWYVSYYGIQSRVKTEL  409
             DL +GL+KFV+WY+SYY    R  T +
Sbjct  424   DLQTGLKKFVRWYLSYYSGTKRKTTSV  450



>ref|XP_004298689.1| PREDICTED: UDP-glucuronate 4-epimerase 4 [Fragaria vesca subsp. 
vesca]
Length=437

 Score =   266 bits (681),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 139/197 (71%), Positives = 158/197 (80%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLS+TG  FF V GPWGRPD   FF
Sbjct  231   KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  290

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  L+GKPI ++       VARDFTYIDD+VKGCV +LDTA+KSTGSGGKKKGPAQLR
Sbjct  291   FTKDILKGKPITIFEAPGHGSVARDFTYIDDIVKGCVASLDTAKKSTGSGGKKKGPAQLR  350

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V NLGNTSPV V  LVSILE  L +KAK+ V+ MPRNGDV FTHAN+SLA+K+  YKPTT
Sbjct  351   VINLGNTSPVPVSNLVSILEKHLKVKAKRKVLPMPRNGDVRFTHANISLAHKELRYKPTT  410

Query  489   DLSSGLRKFVKWYVSYY  439
             DL +GL+KFVKWY+++Y
Sbjct  411   DLETGLKKFVKWYLTHY  427



>ref|XP_003519171.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Glycine max]
Length=431

 Score =   266 bits (681),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 160/198 (81%), Gaps = 0/198 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E+ +TD+PA LYA TKKAGEEI H  NHI+GLS+TG  FF V GPWGRPD   F 
Sbjct  226   KVPFSESDQTDRPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  285

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  LQGKPI VY  +   ++ARDFTYIDD+VKGCVG+LDT+ KSTGSGGKK+GPA  R
Sbjct  286   FTRNILQGKPITVYRGKNHVDLARDFTYIDDIVKGCVGSLDTSAKSTGSGGKKRGPAPYR  345

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             ++NLGNTSPV+V  LVSILE  L +KAK+N+V MP NGDVPFTHAN+S A ++ GYKPTT
Sbjct  346   IFNLGNTSPVTVPTLVSILERHLKVKAKRNIVDMPGNGDVPFTHANISSARRELGYKPTT  405

Query  489   DLSSGLRKFVKWYVSYYG  436
             DL +GL+KFVKWY+SYYG
Sbjct  406   DLQTGLKKFVKWYLSYYG  423



>gb|ACJ11754.1| UDP-D-glucuronic acid 4-epimerase [Gossypium hirsutum]
Length=431

 Score =   266 bits (681),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 135/202 (67%), Positives = 162/202 (80%), Gaps = 0/202 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEI H  NHI+GLS+TG  FF V GPWGRPD   F 
Sbjct  226   KVPFSEADRTDQPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  285

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  LQGKPI +Y  +   ++ARDFTYIDD+VKGC+G+LDT+ KSTGSGGKKKG A  R
Sbjct  286   FTRNILQGKPITIYRGKNRVDLARDFTYIDDIVKGCLGSLDTSGKSTGSGGKKKGNAPYR  345

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             ++NLGNTSPV V +LV+ILE  L +KAK+N+V MP NGDVPFTHAN+SLA ++FGYKP+T
Sbjct  346   IFNLGNTSPVKVPELVNILERHLKVKAKRNIVDMPGNGDVPFTHANISLAQREFGYKPST  405

Query  489   DLSSGLRKFVKWYVSYYGIQSR  424
             DL +GL+KFV+WY+SYYG  +R
Sbjct  406   DLQTGLKKFVRWYLSYYGYNNR  427



>ref|XP_010103125.1| UDP-glucuronate 4-epimerase 1 [Morus notabilis]
 gb|EXB94890.1| UDP-glucuronate 4-epimerase 1 [Morus notabilis]
Length=432

 Score =   266 bits (681),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 158/198 (80%), Gaps = 0/198 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E+ RTDQPA LYA TKKAGEEI H  NHI+GLS+TG  FF V GPWGRPD   F 
Sbjct  226   KVPFSESDRTDQPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  285

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  LQGKPI VY  +   ++ARDFTYIDD+VKGC+G+LDTA KSTGSGGKKK PA  R
Sbjct  286   FTRNILQGKPITVYRGKNRVDLARDFTYIDDIVKGCLGSLDTAGKSTGSGGKKKRPAPYR  345

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             ++NLGNTSPV+V  LV ILE  L +KAK+NVV MP NGDVPFTHAN++ A ++ GYKPTT
Sbjct  346   IFNLGNTSPVTVPTLVDILERHLKVKAKRNVVDMPGNGDVPFTHANITSARRELGYKPTT  405

Query  489   DLSSGLRKFVKWYVSYYG  436
             DL +GL+KFV+WY+SYYG
Sbjct  406   DLQTGLKKFVRWYLSYYG  423



>ref|XP_002452964.1| hypothetical protein SORBIDRAFT_04g035630 [Sorghum bicolor]
 gb|EES05940.1| hypothetical protein SORBIDRAFT_04g035630 [Sorghum bicolor]
Length=439

 Score =   266 bits (681),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 136/198 (69%), Positives = 160/198 (81%), Gaps = 0/198 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEI H  NHI+GLS+TG  FF V GPWGRPD   F 
Sbjct  232   KVPFSERDRTDQPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  291

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  LQGKPI VY  ++  ++ARDFTYIDD+VKGC+G+LDTA KSTG+GGKK+GPA  R
Sbjct  292   FTRNILQGKPITVYRGKDHVDLARDFTYIDDIVKGCLGSLDTAGKSTGTGGKKRGPAPYR  351

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             ++NLGNTSPV+V  LVSILE  L +KAKK+VV+MP NGDVPFTHAN+SLA +  GYKP+T
Sbjct  352   IFNLGNTSPVTVPNLVSILEKHLRVKAKKHVVEMPGNGDVPFTHANISLAREQLGYKPST  411

Query  489   DLSSGLRKFVKWYVSYYG  436
             +L  GL+KFVKWY+SYYG
Sbjct  412   NLDVGLKKFVKWYLSYYG  429



>gb|EYU30554.1| hypothetical protein MIMGU_mgv1a006591mg [Erythranthe guttata]
Length=438

 Score =   266 bits (681),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 138/197 (70%), Positives = 158/197 (80%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEE AH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  234   KVPFSEKDRTDQPASLYAATKKAGEEFAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  293

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GK I ++       VARDFTYIDD+VKGC+GALDTAEKSTGSGGKKKG AQLR
Sbjct  294   FTRDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKKGVAQLR  353

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LV ILE LL +KAK+ V+K+PRNGDV FTHAN+SLA ++ GYKP+T
Sbjct  354   VFNLGNTSPVPVSDLVGILEKLLKVKAKRLVMKLPRNGDVQFTHANISLAEREIGYKPST  413

Query  489   DLSSGLRKFVKWYVSYY  439
             DL +GL+KFV+WY+SYY
Sbjct  414   DLQTGLKKFVQWYLSYY  430



>ref|XP_001751991.1| predicted protein [Physcomitrella patens]
 gb|EDQ83426.1| predicted protein [Physcomitrella patens]
Length=446

 Score =   266 bits (681),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 138/204 (68%), Positives = 158/204 (77%), Gaps = 0/204 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLS+TG  FF V GPWGRPD   F 
Sbjct  233   KVPFSEADRTDQPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  292

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GKPI++Y     K++ARDFTYIDD+VKGCV +LDTAEKSTGSGGKK GPA LR
Sbjct  293   FTRDILKGKPISIYSGAGGKDLARDFTYIDDIVKGCVASLDTAEKSTGSGGKKSGPAMLR  352

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV+V  LV ILE  L +KAK+  +KMPRNGDVPFTHAN+S A     YKP T
Sbjct  353   VFNLGNTSPVTVPTLVDILEKYLKVKAKRETIKMPRNGDVPFTHANISSAELQLHYKPVT  412

Query  489   DLSSGLRKFVKWYVSYYGIQSRVK  418
             +L +GL+KFVKWY+SYYG  S  K
Sbjct  413   NLDTGLKKFVKWYLSYYGDSSNRK  436



>ref|NP_001142515.1| hypothetical protein [Zea mays]
 gb|ACG24575.1| hypothetical protein [Zea mays]
 gb|ACN27084.1| unknown [Zea mays]
 gb|AFW73831.1| hypothetical protein ZEAMMB73_770166 [Zea mays]
Length=439

 Score =   266 bits (681),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 136/198 (69%), Positives = 159/198 (80%), Gaps = 0/198 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEI H  NHI+GLS+TG  FF V GPWGRPD   F 
Sbjct  232   KVPFSERDRTDQPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  291

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  LQGKPI VY  ++  ++ARDFTYIDD+VKGC+G+LDTA KSTG+GGKK+GPA  R
Sbjct  292   FTRNILQGKPITVYRGKDRVDLARDFTYIDDIVKGCLGSLDTAGKSTGTGGKKRGPAPYR  351

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             ++NLGNT+PV+V  LVSILE  L +KAKKNVV+MP NGDVPFTHAN++LA +  GYKPTT
Sbjct  352   IFNLGNTAPVTVPNLVSILEKHLRVKAKKNVVEMPGNGDVPFTHANITLARQQLGYKPTT  411

Query  489   DLSSGLRKFVKWYVSYYG  436
             +L  GL+KFVKWY SYYG
Sbjct  412   NLDVGLKKFVKWYQSYYG  429



>ref|XP_004515772.1| PREDICTED: UDP-glucuronate 4-epimerase 5-like [Cicer arietinum]
Length=438

 Score =   266 bits (680),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 139/204 (68%), Positives = 159/204 (78%), Gaps = 0/204 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLS+T   FF V GPWGRPD   FF
Sbjct  231   KVPFSEKDRTDQPASLYAATKKAGEEIAHSYNHIYGLSITALRFFTVYGPWGRPDMAYFF  290

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  L+GK I V+ + +   V+RDFTYIDD+VKGC+GALDTA+KSTGSGGKKKG AQ R
Sbjct  291   FTKDILKGKTITVFESPDGGTVSRDFTYIDDIVKGCLGALDTAKKSTGSGGKKKGSAQFR  350

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LV+ILE LL + AKK V+ MPRNGDV FTHAN+SLA+KD GY+PT 
Sbjct  351   VFNLGNTSPVPVSDLVAILERLLKVTAKKKVLPMPRNGDVKFTHANISLAHKDLGYRPTI  410

Query  489   DLSSGLRKFVKWYVSYYGIQSRVK  418
             DL +GLRKFVKWY+ +Y   S  K
Sbjct  411   DLETGLRKFVKWYLEFYSSGSNYK  434



>ref|XP_002872971.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49230.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis lyrata subsp. lyrata]
Length=429

 Score =   266 bits (679),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 134/197 (68%), Positives = 159/197 (81%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             +VPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLSLTG  FF V GPWGRPD   FF
Sbjct  225   RVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  284

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GK I+++       VARDFTYIDD+VKGC+GALDTAEKSTGSGGKK+G AQLR
Sbjct  285   FTRDILKGKAISIFEGVNHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRGAAQLR  344

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V  LV+ILE LL +KAK+N++K+PRNGDV FTHAN+S A ++ GYKPTT
Sbjct  345   VFNLGNTSPVPVTDLVTILERLLKVKAKRNIMKLPRNGDVQFTHANISSAQRELGYKPTT  404

Query  489   DLSSGLRKFVKWYVSYY  439
             +L +GL+KF +WY+ YY
Sbjct  405   NLQTGLKKFARWYLGYY  421



>ref|XP_001754001.1| predicted protein [Physcomitrella patens]
 gb|EDQ81323.1| predicted protein [Physcomitrella patens]
Length=446

 Score =   266 bits (680),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 138/212 (65%), Positives = 162/212 (76%), Gaps = 0/212 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLS+TG  FF V GPWGRPD   F 
Sbjct  233   KVPFSEADRTDQPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  292

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GKPI+VY     K++ARDFT+IDD+VKGCV +LDTAEKSTGSGGKK GPA LR
Sbjct  293   FTRDILKGKPISVYSGPGGKDLARDFTFIDDIVKGCVASLDTAEKSTGSGGKKTGPAMLR  352

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV+V  LV ILE  L++KAK+ ++ MPRNGDVPFTHAN+S A +   Y+P T
Sbjct  353   VFNLGNTSPVTVPALVDILEKYLNVKAKREIINMPRNGDVPFTHANISSAQEQLHYRPVT  412

Query  489   DLSSGLRKFVKWYVSYYGIQSRVKTELHPTHQ  394
             +L +GL+KFVKWY+SYYG  S  K  L    Q
Sbjct  413   NLDTGLKKFVKWYLSYYGDNSNRKLWLGKHEQ  444



>gb|EYU34305.1| hypothetical protein MIMGU_mgv1a006903mg [Erythranthe guttata]
Length=427

 Score =   266 bits (679),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 134/198 (68%), Positives = 157/198 (79%), Gaps = 0/198 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             K PF E+ RTD+PA LYA TKKAGEEI H  NHI+GLS+TG  FF V GPWGRPD   F 
Sbjct  227   KAPFSESDRTDRPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  286

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  LQGKPI +Y  +   E+ARDFTYIDD+VKGCV +LDTA++STGSGGKK+GPAQ R
Sbjct  287   FTKNILQGKPITIYRGKNRVELARDFTYIDDIVKGCVASLDTAKRSTGSGGKKRGPAQFR  346

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             ++NLGNTSPV+V  +V ILE  L  KA KNVV+MP NGDVPFTHAN+S A  + GYKPTT
Sbjct  347   IFNLGNTSPVTVPMMVGILEKQLKTKAHKNVVEMPGNGDVPFTHANISSARIELGYKPTT  406

Query  489   DLSSGLRKFVKWYVSYYG  436
             DL +GL+KFV+WY+SYYG
Sbjct  407   DLQTGLKKFVRWYLSYYG  424



>ref|XP_008677814.1| PREDICTED: LOC732831 isoform X1 [Zea mays]
 gb|ACF78800.1| unknown [Zea mays]
 gb|ACN28799.1| unknown [Zea mays]
 gb|ACR36221.1| unknown [Zea mays]
 gb|AFW64179.1| UDP-glucuronic acid 4-epimerase [Zea mays]
Length=440

 Score =   266 bits (679),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 136/198 (69%), Positives = 159/198 (80%), Gaps = 0/198 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEI H  NHI+GLS+TG  FF V GPWGRPD   F 
Sbjct  232   KVPFSERDRTDQPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  291

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  LQGKPI VY  ++  ++ARDFTYIDD+VKGC+ +L+TA KSTG+GGKK+GPA  R
Sbjct  292   FTRNILQGKPITVYRGKDHVDLARDFTYIDDIVKGCLASLETAGKSTGTGGKKRGPAPYR  351

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             ++NLGNTSPV+V  LVSILE  L +KAKKNVV+MP NGDVPFTHAN+SLA +  GYKPTT
Sbjct  352   IFNLGNTSPVTVPNLVSILEKHLRVKAKKNVVEMPGNGDVPFTHANISLAREQLGYKPTT  411

Query  489   DLSSGLRKFVKWYVSYYG  436
             +L  GL+KFVKWY+SYYG
Sbjct  412   NLDVGLKKFVKWYLSYYG  429



>ref|NP_001105911.1| LOC732831 [Zea mays]
 gb|ABB51650.1| UDP-glucuronic acid 4-epimerase [Zea mays]
Length=440

 Score =   266 bits (679),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 136/198 (69%), Positives = 159/198 (80%), Gaps = 0/198 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEI H  NHI+GLS+TG  FF V GPWGRPD   F 
Sbjct  232   KVPFSERDRTDQPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  291

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  LQGKPI VY  ++  ++ARDFTYIDD+VKGC+ +L+TA KSTG+GGKK+GPA  R
Sbjct  292   FTRNILQGKPITVYRGKDHVDLARDFTYIDDIVKGCLASLETAGKSTGTGGKKRGPAPYR  351

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             ++NLGNTSPV+V  LVSILE  L +KAKKNVV+MP NGDVPFTHAN+SLA +  GYKPTT
Sbjct  352   IFNLGNTSPVTVPNLVSILEKHLRVKAKKNVVEMPGNGDVPFTHANISLAREQLGYKPTT  411

Query  489   DLSSGLRKFVKWYVSYYG  436
             +L  GL+KFVKWY+SYYG
Sbjct  412   NLDVGLKKFVKWYLSYYG  429



>ref|XP_008234372.1| PREDICTED: UDP-glucuronate 4-epimerase 4-like [Prunus mume]
Length=409

 Score =   265 bits (677),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 138/202 (68%), Positives = 156/202 (77%), Gaps = 0/202 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  R DQPA LYA TKKAGEEIAH  NHI GLS+TG  FF V GPWGRPD   F 
Sbjct  206   KVPFSEEDRADQPASLYAATKKAGEEIAHAYNHIHGLSITGLRFFTVYGPWGRPDMMYFS  265

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  L+GKPI V+   +   VARDFTYIDDVVKGC+ ALDTAEKSTGSGG+ +GPAQLR
Sbjct  266   FTKNMLRGKPIVVFEGPDHGSVARDFTYIDDVVKGCLAALDTAEKSTGSGGRVEGPAQLR  325

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V ++VSI+E LL +KAKK VV MPRNGDV FTHAN+SLA ++ GY PTT
Sbjct  326   VFNLGNTSPVPVSEVVSIMERLLRVKAKKVVVPMPRNGDVLFTHANISLARRELGYMPTT  385

Query  489   DLSSGLRKFVKWYVSYYGIQSR  424
             DL +GLRKF+ WY+ YY    R
Sbjct  386   DLKTGLRKFLNWYLDYYSESKR  407



>gb|KFK29619.1| hypothetical protein AALP_AA7G157500 [Arabis alpina]
Length=430

 Score =   265 bits (678),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 134/208 (64%), Positives = 163/208 (78%), Gaps = 0/208 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E+ RTDQPA LYA TKKAGEEI H  NHI+GLS+TG  FF V GPWGRPD   F 
Sbjct  223   KVPFSESDRTDQPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  282

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  LQGKPI +Y  +   ++ARDFTYIDD+VKGC+G+LD++ KSTGSGGKK+G A  R
Sbjct  283   FTRNILQGKPITIYRGKNRVDLARDFTYIDDIVKGCLGSLDSSGKSTGSGGKKRGSAPYR  342

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             ++NLGNTSPV+V  LV ILE  L +KAK+N V+MP NGDVPFTHAN+S A  +FGYKPTT
Sbjct  343   IFNLGNTSPVTVPILVDILEKHLKVKAKRNFVEMPGNGDVPFTHANISFARNEFGYKPTT  402

Query  489   DLSSGLRKFVKWYVSYYGIQSRVKTELH  406
             DL +GL+KFV+WY+SYYG  ++ K  +H
Sbjct  403   DLETGLKKFVRWYLSYYGYNTKAKLNVH  430



>ref|XP_001777338.1| predicted protein [Physcomitrella patens]
 gb|EDQ57868.1| predicted protein [Physcomitrella patens]
Length=450

 Score =   266 bits (680),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 138/199 (69%), Positives = 156/199 (78%), Gaps = 0/199 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E+ RTDQPA LYA TKKAGE IAH  NHI+GLS+TG  FF V GPWGRPD   F 
Sbjct  237   KVPFSESDRTDQPASLYAATKKAGEGIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  296

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GK IN+Y     K++ARDFTYIDD+VKGC+ ALDTAEKSTGSGGKK GPAQLR
Sbjct  297   FTQDILRGKAINIYTGSGGKDLARDFTYIDDIVKGCMRALDTAEKSTGSGGKKTGPAQLR  356

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV+V  LV ILE  L  KA +N+VKMPRNGDVPFTHAN S A     Y PTT
Sbjct  357   VFNLGNTSPVTVPILVDILEKHLKQKAIRNIVKMPRNGDVPFTHANTSSAQSQLNYHPTT  416

Query  489   DLSSGLRKFVKWYVSYYGI  433
             +L +GLRKFVKWY+SYYG+
Sbjct  417   NLDTGLRKFVKWYLSYYGV  435



>ref|XP_008439108.1| PREDICTED: UDP-glucuronate 4-epimerase 2-like [Cucumis melo]
Length=408

 Score =   265 bits (676),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 141/207 (68%), Positives = 162/207 (78%), Gaps = 1/207 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             +VPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLS+TG  FF V GPWGRPD   FF
Sbjct  203   RVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  262

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  L+ K I V+   + K VARDFTYIDD+VKGC+GALDTAEKSTGSGG+KKG AQLR
Sbjct  263   FTKDILKRKTIRVFEGADQKSVARDFTYIDDIVKGCLGALDTAEKSTGSGGRKKGKAQLR  322

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV+V +LV  LE LL++KAK+ V+ MP NGDVPFTHAN+SLA K+ GYKPTT
Sbjct  323   VFNLGNTSPVTVSELVDNLEKLLNMKAKRLVLPMPMNGDVPFTHANISLAQKELGYKPTT  382

Query  489   DLSSGLRKFVKWYVSYYGIQSRVKTEL  409
             DL +GL++FV WY  YY   SR K  L
Sbjct  383   DLKTGLKEFVDWYRLYYS-NSRKKIVL  408



>dbj|BAH20281.1| AT4G30440 [Arabidopsis thaliana]
Length=257

 Score =   259 bits (662),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 161/204 (79%), Gaps = 0/204 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E+ RTDQPA LYA TKKAGEEI H  NHI+GL++TG  FF V GPWGRPD   F 
Sbjct  51    KVPFSESDRTDQPASLYAATKKAGEEITHTYNHIYGLAITGLRFFTVYGPWGRPDMAYFS  110

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  LQGKPI +Y  +   ++ARDFTYIDD+VKGC+G+LD++ KSTGSGGKK+G A  R
Sbjct  111   FTRNILQGKPITIYRGKNRVDLARDFTYIDDIVKGCLGSLDSSGKSTGSGGKKRGAAPYR  170

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             ++NLGNTSPV+V  LV ILE  L +KAK+N V+MP NGDVPFTHAN+S A  +FGYKPTT
Sbjct  171   IFNLGNTSPVTVPILVDILEKHLKVKAKRNFVEMPGNGDVPFTHANISSARNEFGYKPTT  230

Query  489   DLSSGLRKFVKWYVSYYGIQSRVK  418
             DL +GL+KFV+WY+SYYG  ++ K
Sbjct  231   DLETGLKKFVRWYLSYYGYNTKAK  254



>ref|XP_010264164.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nelumbo nucifera]
Length=438

 Score =   265 bits (678),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 135/194 (70%), Positives = 156/194 (80%), Gaps = 0/194 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLS+TG  FF V GPWGRPD   FF
Sbjct  233   KVPFSEEDRTDQPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  292

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GK I ++       VARDFTYIDD+VKGC+ ALDTAEKSTG GGKKKGPAQLR
Sbjct  293   FTRDILKGKQIQIFEAPNHGTVARDFTYIDDIVKGCLAALDTAEKSTGRGGKKKGPAQLR  352

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V +LVSILE LL +KA + ++KMPRNGDV FTHAN+SLA ++ GYKPTT
Sbjct  353   VFNLGNTSPVPVTELVSILERLLKVKANRLMLKMPRNGDVQFTHANISLAQRELGYKPTT  412

Query  489   DLSSGLRKFVKWYV  448
             DL +GL+KFV+WY+
Sbjct  413   DLQTGLKKFVRWYL  426



>ref|XP_008794557.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Phoenix dactylifera]
Length=462

 Score =   266 bits (679),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 135/197 (69%), Positives = 158/197 (80%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E+ RTD+PA LYA TKKAGEEIAH  NHI+GLS+TG  FF V GPWGRPD   FF
Sbjct  249   KVPFSESDRTDRPASLYAATKKAGEEIAHVYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  308

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GKPI+++       VARDFTYIDD+V+GCV ALDTA KSTGSGGKK+GPA LR
Sbjct  309   FTRNILRGKPISIFEGPGHATVARDFTYIDDIVRGCVAALDTAGKSTGSGGKKRGPAPLR  368

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             VYNLGNTSPV V  LVSILENLL +KA +  VKMPRNGDV FTHAN+SLA ++ GY PTT
Sbjct  369   VYNLGNTSPVPVADLVSILENLLGVKAVRKAVKMPRNGDVQFTHANISLAQRELGYHPTT  428

Query  489   DLSSGLRKFVKWYVSYY  439
             +L +GL++FV+WY+ YY
Sbjct  429   NLHTGLKRFVRWYLQYY  445



>ref|XP_002324510.1| UDP-D-GLUCURONATE 4-EPIMERASE 1 family protein [Populus trichocarpa]
 gb|EEF03075.1| UDP-D-GLUCURONATE 4-EPIMERASE 1 family protein [Populus trichocarpa]
Length=431

 Score =   265 bits (676),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 161/198 (81%), Gaps = 0/198 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E+ RTDQPA LYA TKKAGEEI H  NHI+GLS+TG  FF V GP+GRPD   F 
Sbjct  226   KVPFSESDRTDQPASLYAATKKAGEEITHTYNHIYGLSVTGLRFFTVYGPFGRPDMAYFS  285

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  LQGKPI VY  +   ++ARDFTYIDD+VKGCVG+LDT+ KSTGSGGKK+GPA  R
Sbjct  286   FTRNILQGKPITVYRGKNRVDLARDFTYIDDIVKGCVGSLDTSGKSTGSGGKKRGPAPYR  345

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             ++NLGNTSPV+V  LV+ILE  L +KAK+N+V MP NGDVPFTHAN+SLA ++ GYKPTT
Sbjct  346   IFNLGNTSPVTVPTLVNILERHLKVKAKRNIVDMPGNGDVPFTHANISLAQRELGYKPTT  405

Query  489   DLSSGLRKFVKWYVSYYG  436
             DL +GL+KFVKWY++YYG
Sbjct  406   DLETGLKKFVKWYLTYYG  423



>ref|XP_001761984.1| predicted protein [Physcomitrella patens]
 gb|EDQ73088.1| predicted protein [Physcomitrella patens]
Length=446

 Score =   265 bits (677),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 135/201 (67%), Positives = 157/201 (78%), Gaps = 0/201 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEE+AH  NHI+GLS+TG  FF V GPWGRPD   F 
Sbjct  240   KVPFSEADRTDQPASLYAATKKAGEELAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  299

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GK IN+Y  Q D+++ARDFT+IDD+VKGCV +LDTA +STGSGGKK+G A  R
Sbjct  300   FTRDILKGKEINIYKGQNDRDLARDFTFIDDIVKGCVASLDTAGRSTGSGGKKRGAALFR  359

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
              +NLGNTSPVSV  LV ILE  L + AKK  +KMPRNGDVPFTHANVSLA    GYKPTT
Sbjct  360   TFNLGNTSPVSVPVLVEILEKYLKVPAKKVFIKMPRNGDVPFTHANVSLAQTQLGYKPTT  419

Query  489   DLSSGLRKFVKWYVSYYGIQS  427
             +L +GL+KFV WY+ YYG+QS
Sbjct  420   NLDTGLKKFVTWYMKYYGVQS  440



>ref|XP_004245716.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [Solanum lycopersicum]
Length=445

 Score =   265 bits (677),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 143/202 (71%), Positives = 165/202 (82%), Gaps = 0/202 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEIAH  NHI+GLS+TG  FF V GPWGRPD   FF
Sbjct  241   KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  300

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  L+GK I ++ T +   VARDFTY+DDVVKGC+GALDTA+KSTGSGGKKKG AQLR
Sbjct  301   FTKDILRGKEIKIFETSDQGSVARDFTYVDDVVKGCLGALDTAKKSTGSGGKKKGAAQLR  360

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             ++NLGNT PV V +LVSILE LL +KAKK V++MPRNGDVPFTHAN++LA+ + GYKPTT
Sbjct  361   IFNLGNTKPVPVGRLVSILEKLLKVKAKKKVIQMPRNGDVPFTHANITLAHTELGYKPTT  420

Query  489   DLSSGLRKFVKWYVSYYGIQSR  424
             DL  GL+KFVKWYVSYYG + +
Sbjct  421   DLEMGLKKFVKWYVSYYGSKKK  442



>ref|XP_007221187.1| hypothetical protein PRUPE_ppa021672mg [Prunus persica]
 gb|EMJ22386.1| hypothetical protein PRUPE_ppa021672mg [Prunus persica]
Length=410

 Score =   264 bits (674),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 137/202 (68%), Positives = 156/202 (77%), Gaps = 0/202 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  R DQPA LYA TKKAGEEIAH  +HI+GLS+TG  FF V GPWGRPD   F 
Sbjct  206   KVPFSEEDRADQPASLYAATKKAGEEIAHAYHHIYGLSITGLRFFTVYGPWGRPDMVYFS  265

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  L GKPI V+   +   VARDFTYIDDVVKGC+ ALDTAEKSTGSGG+ +GPAQLR
Sbjct  266   FTKNMLSGKPIVVFEGPDHGSVARDFTYIDDVVKGCLAALDTAEKSTGSGGRVEGPAQLR  325

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V ++VSI+E LL +KAKK VV MPRNGDV FTHAN+SLA ++ GY PTT
Sbjct  326   VFNLGNTSPVPVSEVVSIMERLLRVKAKKVVVPMPRNGDVLFTHANISLARRELGYMPTT  385

Query  489   DLSSGLRKFVKWYVSYYGIQSR  424
             DL +GLRKF+ WY+ YY    R
Sbjct  386   DLKTGLRKFLNWYLDYYSESKR  407



>ref|XP_008443815.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Cucumis melo]
Length=432

 Score =   265 bits (676),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 137/200 (69%), Positives = 159/200 (80%), Gaps = 0/200 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGEEI H  NHI+GLS+TG  FF V GPWGRPD   F 
Sbjct  227   KVPFSELDRTDQPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  286

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  LQGKPI VY  + + ++ARDFTYIDD+VKGC+G+LDT+ KSTGSGGKKKGPA  R
Sbjct  287   FTRNILQGKPITVYRGKNEVDLARDFTYIDDIVKGCLGSLDTSGKSTGSGGKKKGPAPYR  346

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             ++NLGNTSPV+V  LVSILE  L   AKKN+V MP NGDVPFTHAN+S A  +FGYKPTT
Sbjct  347   IFNLGNTSPVTVPALVSILEEHLKTPAKKNIVDMPGNGDVPFTHANISSARIEFGYKPTT  406

Query  489   DLSSGLRKFVKWYVSYYGIQ  430
             DL +GL+KFV+WY+SYYG +
Sbjct  407   DLQTGLKKFVRWYLSYYGYE  426



>ref|XP_009127808.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Brassica rapa]
Length=429

 Score =   264 bits (675),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 134/204 (66%), Positives = 162/204 (79%), Gaps = 0/204 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E+ RTDQPA LYA TKKAGEEI H  NHI+GL++TG  FF V GPWGRPD   F 
Sbjct  223   KVPFSESDRTDQPASLYAATKKAGEEITHTYNHIYGLAITGLRFFTVYGPWGRPDMAYFS  282

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  LQGKPI +Y  +   ++ARDFTYIDD+VKGC+G+LD++ KSTGSGGKK+G A  R
Sbjct  283   FTRNILQGKPITIYRGKNRVDLARDFTYIDDIVKGCLGSLDSSGKSTGSGGKKRGSAPYR  342

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             ++NLGNTSPV+V  LV ILE  L +KAK+N V+MP NGDVPFTHAN+S A K+FGYKPTT
Sbjct  343   IFNLGNTSPVTVPILVDILEKHLKVKAKRNCVEMPGNGDVPFTHANISSARKEFGYKPTT  402

Query  489   DLSSGLRKFVKWYVSYYGIQSRVK  418
             DL +GLRKFV+WY+SYYG  ++ K
Sbjct  403   DLETGLRKFVRWYLSYYGYNTKAK  426



>ref|XP_004251783.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Solanum lycopersicum]
Length=432

 Score =   264 bits (675),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 134/198 (68%), Positives = 160/198 (81%), Gaps = 0/198 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E+ RTDQPA LYA TKKAGEEI H  NHI+GLS+TG  FF V GPWGRPD   F 
Sbjct  226   KVPFSESDRTDQPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  285

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  L+GKPI VY  +   ++ARDFTYIDD+VKGCVG+LDTA KSTGSGGKK+GPA  R
Sbjct  286   FTRNILRGKPITVYRGKNRVDLARDFTYIDDIVKGCVGSLDTAGKSTGSGGKKRGPAMFR  345

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             ++NLGNTSPV+V  +V++LE  L +KAKK+V+ MP NGDVPFTHAN+SLA K+ GYKPTT
Sbjct  346   IFNLGNTSPVTVPMMVAMLEKHLKVKAKKHVLDMPGNGDVPFTHANISLAQKELGYKPTT  405

Query  489   DLSSGLRKFVKWYVSYYG  436
             +L +GL KFV+WY+SYYG
Sbjct  406   NLQTGLGKFVRWYLSYYG  423



>gb|KEH31675.1| UDP-D-glucuronate 4-epimerase [Medicago truncatula]
Length=436

 Score =   265 bits (676),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 139/197 (71%), Positives = 157/197 (80%), Gaps = 0/197 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E  RTDQPA LYA TKKAGE IAH  NHI+GLS+T   FF V GPWGRPD   FF
Sbjct  228   KVPFSEKDRTDQPASLYAATKKAGEGIAHTYNHIYGLSITALRFFTVYGPWGRPDMAYFF  287

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F K  L+GK I V+ + +   VARDFTYIDDVVKGC+GALDTA+KSTGSGGKKKG AQ R
Sbjct  288   FTKDILKGKQITVFESPDGGSVARDFTYIDDVVKGCLGALDTAKKSTGSGGKKKGSAQFR  347

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             V+NLGNTSPV V KLV+ILE LL + AKK V+ MPRNGDV FTHAN+SLA ++FGYKPT 
Sbjct  348   VFNLGNTSPVPVSKLVAILEKLLKVNAKKRVLPMPRNGDVKFTHANISLAQREFGYKPTI  407

Query  489   DLSSGLRKFVKWYVSYY  439
             DL +GLRKFVKWY+ +Y
Sbjct  408   DLETGLRKFVKWYLEFY  424



>ref|XP_011018096.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Populus euphratica]
Length=431

 Score =   264 bits (675),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 134/198 (68%), Positives = 161/198 (81%), Gaps = 0/198 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E+ RTDQPA LYA TKKAGEEI H  NHI+GLS+TG  FF V GP+GRPD   F 
Sbjct  226   KVPFSESDRTDQPASLYAATKKAGEEITHTYNHIYGLSVTGLRFFTVYGPFGRPDMAYFS  285

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  LQGKPI +Y  +   ++ARDFTYIDD+VKGCVG+LDT+ KSTGSGGKK+GPA  R
Sbjct  286   FTRNILQGKPITIYRGKNRVDLARDFTYIDDIVKGCVGSLDTSGKSTGSGGKKRGPAPYR  345

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             ++NLGNTSPV+V  LV+ILE  L +KAK+N+V MP NGDVPFTHAN+SLA ++ GYKPTT
Sbjct  346   IFNLGNTSPVTVPTLVNILERHLRVKAKRNIVDMPGNGDVPFTHANISLAQRELGYKPTT  405

Query  489   DLSSGLRKFVKWYVSYYG  436
             DL +GL+KFVKWY++YYG
Sbjct  406   DLETGLKKFVKWYLTYYG  423



>ref|XP_004144711.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Cucumis sativus]
 gb|KGN61076.1| UDP-glucuronate 5-epimerase [Cucumis sativus]
Length=431

 Score =   264 bits (675),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 159/198 (80%), Gaps = 0/198 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E+ RTDQPA LYA TKKAGEEI H  NHI+GLS+TG  FF V GPWGRPD   F 
Sbjct  226   KVPFSESDRTDQPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  285

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  LQGKPI V+  +   ++ARDFTYIDD+VKGC+G+LDT+ KSTGSGGKK G A  R
Sbjct  286   FTRNILQGKPITVFRGKNRVDLARDFTYIDDIVKGCLGSLDTSGKSTGSGGKKTGAAPYR  345

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             ++NLGNTSPV+V  LVSILE  L +KAKKNVV+MP NGDVPFTHAN+S A ++ GYKPTT
Sbjct  346   IFNLGNTSPVTVPTLVSILERHLKVKAKKNVVEMPGNGDVPFTHANISSARRELGYKPTT  405

Query  489   DLSSGLRKFVKWYVSYYG  436
             DL +GL+KFV+WY+SYYG
Sbjct  406   DLQTGLKKFVRWYLSYYG  423



>emb|CDY70926.1| BnaCnng70410D [Brassica napus]
 emb|CDY28188.1| BnaA01g06610D [Brassica napus]
Length=429

 Score =   264 bits (674),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 134/204 (66%), Positives = 162/204 (79%), Gaps = 0/204 (0%)
 Frame = -2

Query  1029  KVPFXENXRTDQPAXLYAXTKKAGEEIAHXXNHIFGLSLTGXXFFXVXGPWGRPDXGXFF  850
             KVPF E+ RTDQPA LYA TKKAGEEI H  NHI+GL++TG  FF V GPWGRPD   F 
Sbjct  223   KVPFSESDRTDQPASLYAATKKAGEEITHTYNHIYGLAITGLRFFTVYGPWGRPDMAYFS  282

Query  849   FXKXXLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkGPAQLR  670
             F +  LQGKPI +Y  +   ++ARDFTYIDD+VKGC+G+LD++ KSTGSGGKK+G A  R
Sbjct  283   FTRNILQGKPITIYRGKNRVDLARDFTYIDDIVKGCLGSLDSSGKSTGSGGKKRGSAPYR  342

Query  669   VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  490
             ++NLGNTSPV+V  LV ILE  L +KAK+N V+MP NGDVPFTHAN+S A K+FGYKPTT
Sbjct  343   IFNLGNTSPVTVPILVDILEKHLKVKAKRNFVEMPGNGDVPFTHANISSARKEFGYKPTT  402

Query  489   DLSSGLRKFVKWYVSYYGIQSRVK  418
             DL +GLRKFV+WY+SYYG  ++ K
Sbjct  403   DLETGLRKFVRWYLSYYGYNTKAK  426



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2624981012963