BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig3930

Length=819
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ABC47163.2|  CDPK1                                                   272   5e-84   Ipomoea nil [qian niu]
ref|XP_009620189.1|  PREDICTED: calcium-dependent protein kinase 3      262   5e-80   Nicotiana tomentosiformis
ref|XP_004244622.1|  PREDICTED: calcium-dependent protein kinase 3      260   3e-79   Solanum lycopersicum
ref|XP_006352261.1|  PREDICTED: calcium-dependent protein kinase ...    259   8e-79   Solanum tuberosum [potatoes]
ref|XP_009786035.1|  PREDICTED: calcium-dependent protein kinase 3      258   2e-78   Nicotiana sylvestris
ref|XP_012086799.1|  PREDICTED: calcium-dependent protein kinase 3      255   3e-77   Jatropha curcas
gb|KHN25667.1|  Calcium-dependent protein kinase 3                      250   5e-77   Glycine soja [wild soybean]
gb|ACH85192.1|  calcium-dependent protein kinase CDPK5                  254   5e-77   Nicotiana tabacum [American tobacco]
ref|XP_010055801.1|  PREDICTED: calcium-dependent protein kinase 3      253   2e-76   Eucalyptus grandis [rose gum]
gb|KHN35055.1|  Calcium-dependent protein kinase 3                      248   3e-76   Glycine soja [wild soybean]
emb|CDP12100.1|  unnamed protein product                                248   4e-76   Coffea canephora [robusta coffee]
emb|CBI34415.3|  unnamed protein product                                248   7e-76   Vitis vinifera
ref|XP_003517491.2|  PREDICTED: calcium-dependent protein kinase ...    251   8e-76   
ref|XP_008239005.1|  PREDICTED: calcium-dependent protein kinase 3      247   1e-75   
gb|KHN16773.1|  Calcium-dependent protein kinase 3                      242   2e-75   Glycine soja [wild soybean]
emb|CAN61364.1|  hypothetical protein VITISV_032639                     248   5e-75   Vitis vinifera
ref|XP_011073451.1|  PREDICTED: calcium-dependent protein kinase ...    249   5e-75   Sesamum indicum [beniseed]
ref|XP_008451994.1|  PREDICTED: calcium-dependent protein kinase 3      249   6e-75   Cucumis melo [Oriental melon]
ref|XP_002272270.1|  PREDICTED: calcium-dependent protein kinase 3      248   1e-74   Vitis vinifera
gb|AGS15000.1|  calcium-dependent protein kinase 3                      248   1e-74   Vitis amurensis
ref|XP_003525360.1|  PREDICTED: calcium-dependent protein kinase ...    248   1e-74   Glycine max [soybeans]
ref|XP_003538256.1|  PREDICTED: calcium-dependent protein kinase ...    248   1e-74   Glycine max [soybeans]
ref|XP_009334485.1|  PREDICTED: calcium-dependent protein kinase 3      247   3e-74   Pyrus x bretschneideri [bai li]
ref|XP_002509886.1|  calcium-dependent protein kinase, putative         247   4e-74   Ricinus communis
ref|XP_007160124.1|  hypothetical protein PHAVU_002G294500g             245   1e-73   Phaseolus vulgaris [French bean]
ref|XP_006439443.1|  hypothetical protein CICLE_v10019724mg             245   2e-73   Citrus clementina [clementine]
gb|KDO76376.1|  hypothetical protein CISIN_1g010013mg                   245   2e-73   Citrus sinensis [apfelsine]
ref|XP_006476469.1|  PREDICTED: calcium-dependent protein kinase ...    245   2e-73   Citrus sinensis [apfelsine]
ref|XP_007040387.1|  Calcium-dependent protein kinase 6 isoform 1       245   2e-73   
ref|XP_010676387.1|  PREDICTED: calcium-dependent protein kinase 3      245   3e-73   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007209903.1|  hypothetical protein PRUPE_ppa004162mg             244   5e-73   Prunus persica
gb|KGN53365.1|  hypothetical protein Csa_4G050200                       244   6e-73   Cucumis sativus [cucumbers]
ref|XP_004298849.1|  PREDICTED: calcium-dependent protein kinase 3      243   9e-73   Fragaria vesca subsp. vesca
ref|XP_007158545.1|  hypothetical protein PHAVU_002G161200g             243   1e-72   Phaseolus vulgaris [French bean]
gb|KJB52214.1|  hypothetical protein B456_008G251000                    238   2e-72   Gossypium raimondii
ref|XP_002298000.1|  calcium-dependent protein kinase 1                 242   2e-72   Populus trichocarpa [western balsam poplar]
ref|XP_010261434.1|  PREDICTED: calcium-dependent protein kinase ...    243   2e-72   Nelumbo nucifera [Indian lotus]
ref|XP_011026960.1|  PREDICTED: calcium-dependent protein kinase 3      242   3e-72   Populus euphratica
emb|CAC83060.1|  calcium dependent calmodulin independent protein...    238   6e-72   Cucumis sativus [cucumbers]
ref|XP_004503656.1|  PREDICTED: calcium-dependent protein kinase ...    241   6e-72   Cicer arietinum [garbanzo]
ref|XP_010106587.1|  Calcium-dependent protein kinase 3                 244   7e-72   
ref|XP_002304529.2|  hypothetical protein POPTR_0003s13380g             241   1e-71   
ref|XP_011022588.1|  PREDICTED: calcium-dependent protein kinase ...    240   1e-71   Populus euphratica
gb|KHG11508.1|  Calcium-dependent protein kinase 3                      241   1e-71   Gossypium arboreum [tree cotton]
ref|XP_010251583.1|  PREDICTED: calcium-dependent protein kinase ...    240   1e-71   Nelumbo nucifera [Indian lotus]
ref|XP_003611046.1|  Calcium dependent protein kinase                   240   2e-71   Medicago truncatula
gb|KEH21166.1|  calmodulin-domain kinase CDPK protein                   240   2e-71   Medicago truncatula
gb|KJB52213.1|  hypothetical protein B456_008G251000                    240   3e-71   Gossypium raimondii
ref|NP_001267714.1|  calcium-dependent protein kinase 3-like            239   4e-71   Cucumis sativus [cucumbers]
ref|XP_004511540.1|  PREDICTED: calcium-dependent protein kinase ...    238   1e-70   Cicer arietinum [garbanzo]
ref|XP_008792394.1|  PREDICTED: calcium-dependent protein kinase ...    236   6e-70   Phoenix dactylifera
ref|XP_010924783.1|  PREDICTED: calcium-dependent protein kinase ...    235   1e-69   Elaeis guineensis
ref|XP_006849377.1|  PREDICTED: calcium-dependent protein kinase 3      233   8e-69   Amborella trichopoda
gb|KHG03431.1|  Calcium-dependent protein kinase 3                      233   5e-68   Gossypium arboreum [tree cotton]
ref|XP_010924782.1|  PREDICTED: calcium-dependent protein kinase ...    229   2e-67   Elaeis guineensis
ref|XP_009406794.1|  PREDICTED: calcium-dependent protein kinase ...    227   3e-67   
gb|KJB19075.1|  hypothetical protein B456_003G084000                    227   1e-66   Gossypium raimondii
ref|XP_011080890.1|  PREDICTED: calcium-dependent protein kinase 3      226   2e-66   Sesamum indicum [beniseed]
gb|EYU23402.1|  hypothetical protein MIMGU_mgv1a004683mg                226   2e-66   Erythranthe guttata [common monkey flower]
emb|CDY10955.1|  BnaA03g46140D                                          219   4e-65   Brassica napus [oilseed rape]
ref|XP_009137376.1|  PREDICTED: calcium-dependent protein kinase 3      219   4e-65   Brassica rapa
gb|AGF69185.1|  calcium-dependent protein kinase 3-like 1               214   5e-65   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010541306.1|  PREDICTED: calcium-dependent protein kinase 3      223   7e-65   Tarenaya hassleriana [spider flower]
gb|AIU98501.1|  calcium-dependent protein kinase                        222   1e-64   Musa acuminata AAA Group [Cavendish banana]
ref|XP_010529626.1|  PREDICTED: calcium-dependent protein kinase ...    222   1e-64   Tarenaya hassleriana [spider flower]
gb|KFK28919.1|  hypothetical protein AALP_AA7G065000                    222   1e-64   Arabis alpina [alpine rockcress]
ref|XP_010433881.1|  PREDICTED: calcium-dependent protein kinase ...    222   2e-64   Camelina sativa [gold-of-pleasure]
ref|XP_010509303.1|  PREDICTED: calcium-dependent protein kinase 3      221   2e-64   Camelina sativa [gold-of-pleasure]
ref|XP_003567831.1|  PREDICTED: calcium-dependent protein kinase ...    222   2e-64   Brachypodium distachyon [annual false brome]
ref|XP_006283520.1|  hypothetical protein CARUB_v10004572mg             221   3e-64   Capsella rubella
ref|XP_009416404.1|  PREDICTED: calcium-dependent protein kinase ...    221   4e-64   Musa acuminata subsp. malaccensis [pisang utan]
gb|AIU98505.1|  calcium-dependent protein kinase                        221   4e-64   Musa acuminata AAA Group [Cavendish banana]
tpg|DAA58513.1|  TPA: putative calcium-dependent protein kinase f...    214   4e-64   
emb|CDY62741.1|  BnaC07g50270D                                          221   1e-63   Brassica napus [oilseed rape]
ref|XP_008656081.1|  PREDICTED: calcium-dependent protein kinase ...    219   1e-63   Zea mays [maize]
ref|XP_009137374.1|  PREDICTED: calcium-dependent protein kinase ...    219   1e-63   Brassica rapa
gb|EMT22025.1|  Calcium-dependent protein kinase 3                      218   1e-63   
ref|XP_010439150.1|  PREDICTED: calcium-dependent protein kinase ...    219   2e-63   Camelina sativa [gold-of-pleasure]
gb|AGG35973.1|  calcium-dependent protein kinase 3                      219   2e-63   Brassica napus [oilseed rape]
emb|CDY44125.1|  BnaA01g13330D                                          219   2e-63   Brassica napus [oilseed rape]
gb|EMT20115.1|  Calcium-dependent protein kinase 3                      214   2e-63   
ref|XP_006655639.1|  PREDICTED: calcium-dependent protein kinase ...    218   2e-63   
gb|EEE64852.1|  hypothetical protein OsJ_19709                          219   2e-63   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009386326.1|  PREDICTED: calcium-dependent protein kinase ...    218   3e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009137281.1|  PREDICTED: calcium-dependent protein kinase ...    218   3e-63   Brassica rapa
dbj|BAJ94561.1|  predicted protein                                      218   4e-63   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEC79771.1|  hypothetical protein OsI_21169                          215   4e-63   Oryza sativa Indica Group [Indian rice]
ref|XP_002441592.1|  hypothetical protein SORBIDRAFT_09g029950          218   5e-63   Sorghum bicolor [broomcorn]
ref|XP_008802050.1|  PREDICTED: calcium-dependent protein kinase ...    218   5e-63   Phoenix dactylifera
ref|XP_003569386.1|  PREDICTED: calcium-dependent protein kinase ...    218   6e-63   Brachypodium distachyon [annual false brome]
gb|EMS46165.1|  Calcium-dependent protein kinase 3                      213   6e-63   Triticum urartu
ref|XP_002867697.1|  calcium-dependent protein kinase 6                 217   7e-63   
gb|AAL38596.1|AF446863_1  AT4g23650/F9D16_120                           218   7e-63   Arabidopsis thaliana [mouse-ear cress]
ref|NP_194096.1|  calcium-dependent protein kinase 6                    218   7e-63   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001056455.1|  Os05g0585500                                       218   8e-63   
gb|EAZ12734.1|  hypothetical protein OsJ_02652                          217   8e-63   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004969206.1|  PREDICTED: calcium-dependent protein kinase ...    217   9e-63   Setaria italica
dbj|BAD61167.1|  putative calcium-dependent protein kinase              221   1e-62   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001152509.1|  calcium-dependent protein kinase, isoform 2        217   1e-62   Zea mays [maize]
emb|CDY54853.1|  BnaC01g15460D                                          217   1e-62   Brassica napus [oilseed rape]
ref|XP_004961071.1|  PREDICTED: calcium-dependent protein kinase ...    217   1e-62   Setaria italica
ref|XP_006413532.1|  hypothetical protein EUTSA_v10024899mg             217   1e-62   Eutrema salsugineum [saltwater cress]
gb|AHN16201.1|  CPK3-2.1                                                216   2e-62   Brassica napus [oilseed rape]
tpg|DAA58514.1|  TPA: putative calcium-dependent protein kinase f...    214   3e-62   
gb|EEC71113.1|  hypothetical protein OsI_02910                          215   4e-62   Oryza sativa Indica Group [Indian rice]
ref|NP_001169721.1|  uncharacterized LOC100383602                       214   8e-62   Zea mays [maize]
gb|KDO62722.1|  hypothetical protein CISIN_1g0096581mg                  208   9e-62   Citrus sinensis [apfelsine]
ref|XP_002455974.1|  hypothetical protein SORBIDRAFT_03g028340          214   9e-62   Sorghum bicolor [broomcorn]
emb|CAF18446.1|  putative calcium-dependent protein kinase              214   1e-61   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006644382.1|  PREDICTED: calcium-dependent protein kinase ...    213   1e-61   Oryza brachyantha
dbj|BAJ95679.1|  predicted protein                                      214   2e-61   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009603797.1|  PREDICTED: calcium-dependent protein kinase ...    214   2e-61   Nicotiana tomentosiformis
gb|EYU35947.1|  hypothetical protein MIMGU_mgv1a004350mg                213   3e-61   Erythranthe guttata [common monkey flower]
gb|KJB39673.1|  hypothetical protein B456_007G025000                    213   5e-61   Gossypium raimondii
ref|XP_009789543.1|  PREDICTED: calcium-dependent protein kinase ...    212   1e-60   Nicotiana sylvestris
dbj|BAA81749.1|  calcium-dependent protein kinase                       212   1e-60   Marchantia polymorpha
gb|EPS65220.1|  hypothetical protein M569_09555                         209   2e-60   Genlisea aurea
ref|XP_009385897.1|  PREDICTED: calcium-dependent protein kinase ...    210   3e-60   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN11921.1|  Calcium-dependent protein kinase 9                      207   5e-60   Glycine soja [wild soybean]
ref|XP_009770081.1|  PREDICTED: calcium-dependent protein kinase ...    210   5e-60   Nicotiana sylvestris
gb|KHG14847.1|  Calcium-dependent protein kinase 3                      210   6e-60   Gossypium arboreum [tree cotton]
gb|ACA63885.1|  calcium-dependent protein kinase                        209   7e-60   Hordeum vulgare [barley]
ref|XP_009627158.1|  PREDICTED: calcium-dependent protein kinase ...    209   8e-60   Nicotiana tomentosiformis
gb|AAC25423.1|  calcium-dependent protein kinase                        210   8e-60   Nicotiana tabacum [American tobacco]
ref|XP_006452371.1|  hypothetical protein CICLE_v10007983mg             209   9e-60   Citrus clementina [clementine]
gb|ABY59010.1|  calcium-dependent protein kinase                        209   1e-59   Triticum aestivum [Canadian hard winter wheat]
ref|XP_011086186.1|  PREDICTED: calcium-dependent protein kinase-...    209   1e-59   Sesamum indicum [beniseed]
ref|XP_010247475.1|  PREDICTED: calcium-dependent protein kinase 34     209   1e-59   Nelumbo nucifera [Indian lotus]
ref|XP_010519814.1|  PREDICTED: calcium-dependent protein kinase ...    209   1e-59   Tarenaya hassleriana [spider flower]
gb|KHN38276.1|  Calcium-dependent protein kinase 33                     206   1e-59   Glycine soja [wild soybean]
gb|AAZ76712.1|  calcium-dependent protein kinase 1                      209   1e-59   Petunia integrifolia subsp. inflata
tpg|DAA62901.2|  TPA: putative calcium-dependent protein kinase f...    197   1e-59   
emb|CDP20327.1|  unnamed protein product                                209   2e-59   Coffea canephora [robusta coffee]
ref|XP_008449648.1|  PREDICTED: calcium-dependent protein kinase ...    209   2e-59   Cucumis melo [Oriental melon]
gb|KHN23929.1|  Calcium-dependent protein kinase 17                     207   2e-59   Glycine soja [wild soybean]
ref|XP_010519813.1|  PREDICTED: calcium-dependent protein kinase ...    209   2e-59   Tarenaya hassleriana [spider flower]
ref|XP_009630031.1|  PREDICTED: calcium-dependent protein kinase ...    208   2e-59   Nicotiana tomentosiformis
ref|XP_011090473.1|  PREDICTED: calcium-dependent protein kinase ...    207   3e-59   Sesamum indicum [beniseed]
gb|KJB09335.1|  hypothetical protein B456_001G135000                    207   3e-59   Gossypium raimondii
gb|EPS70504.1|  calcium dependent protein kinase 25                     208   3e-59   Genlisea aurea
emb|CDX97174.1|  BnaC09g44510D                                          208   3e-59   
ref|XP_011096067.1|  PREDICTED: calcium-dependent protein kinase-...    208   3e-59   Sesamum indicum [beniseed]
emb|CDX70450.1|  BnaC03g05340D                                          207   3e-59   
ref|XP_009131258.1|  PREDICTED: calcium-dependent protein kinase ...    207   3e-59   Brassica rapa
gb|KJB21813.1|  hypothetical protein B456_004G015100                    208   4e-59   Gossypium raimondii
ref|XP_003556786.1|  PREDICTED: calcium-dependent protein kinase ...    208   4e-59   Glycine max [soybeans]
emb|CDX78468.1|  BnaA03g03800D                                          207   4e-59   
gb|AHG06449.1|  calcium-dependent protein kinase 17                     207   4e-59   Brassica napus [oilseed rape]
gb|KFK26202.1|  hypothetical protein AALP_AA8G215800                    207   4e-59   Arabis alpina [alpine rockcress]
gb|ACY78680.1|  calcium-dependent protein kinase 1                      208   5e-59   Panax ginseng [Asiatic ginseng]
ref|XP_007015253.1|  Calcium-dependent protein kinase 17                207   5e-59   Theobroma cacao [chocolate]
ref|XP_009121874.1|  PREDICTED: calcium-dependent protein kinase 17     207   5e-59   Brassica rapa
dbj|BAA81748.1|  calcium-dependent protein kinase                       207   5e-59   Marchantia polymorpha
ref|XP_006413708.1|  hypothetical protein EUTSA_v100267671mg            199   5e-59   
gb|KFK25494.1|  hypothetical protein AALP_AA8G122000                    207   5e-59   Arabis alpina [alpine rockcress]
gb|AAL59948.1|  putative calcium-dependent protein kinase               207   5e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010673770.1|  PREDICTED: calcium-dependent protein kinase ...    207   5e-59   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_196779.1|  calcium-dependent protein kinase 17                   207   5e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006289327.1|  hypothetical protein CARUB_v10002812mg             207   6e-59   Capsella rubella
ref|XP_002871516.1|  calcium-dependent protein kinase 17                207   6e-59   
ref|XP_011080420.1|  PREDICTED: calcium-dependent protein kinase ...    207   6e-59   Sesamum indicum [beniseed]
ref|NP_001234806.1|  calcium-dependent protein kinase                   207   7e-59   Solanum lycopersicum
gb|AGG35954.1|  calcium-dependent protein kinase 34                     206   7e-59   Brassica napus [oilseed rape]
emb|CDY44912.1|  BnaA02g04170D                                          207   7e-59   Brassica napus [oilseed rape]
ref|XP_011095398.1|  PREDICTED: calcium-dependent protein kinase ...    207   8e-59   Sesamum indicum [beniseed]
ref|XP_006475136.1|  PREDICTED: calcium-dependent protein kinase ...    209   8e-59   
emb|CDY63783.1|  BnaCnng42690D                                          206   9e-59   Brassica napus [oilseed rape]
ref|XP_009126355.1|  PREDICTED: calcium-dependent protein kinase 34     206   9e-59   Brassica rapa
ref|XP_012065867.1|  PREDICTED: calcium-dependent protein kinase 34     207   9e-59   
ref|XP_009412989.1|  PREDICTED: calcium-dependent protein kinase ...    206   1e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009796949.1|  PREDICTED: calcium-dependent protein kinase ...    207   1e-58   Nicotiana sylvestris
gb|KDP43197.1|  hypothetical protein JCGZ_22749                         206   1e-58   Jatropha curcas
emb|CDX91168.1|  BnaC02g04290D                                          206   1e-58   
ref|XP_007153943.1|  hypothetical protein PHAVU_003G078400g             207   1e-58   Phaseolus vulgaris [French bean]
ref|XP_009120894.1|  PREDICTED: calcium-dependent protein kinase 34     206   1e-58   Brassica rapa
ref|XP_008227265.1|  PREDICTED: calcium-dependent protein kinase ...    206   1e-58   Prunus mume [ume]
emb|CAG27840.1|  calcium-dependent protein kinase 17                    206   1e-58   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_006349794.1|  PREDICTED: calcium-dependent protein kinase ...    206   1e-58   
gb|KDO78217.1|  hypothetical protein CISIN_1g009091mg                   206   1e-58   Citrus sinensis [apfelsine]
ref|XP_006467440.1|  PREDICTED: calcium-dependent protein kinase ...    206   1e-58   Citrus sinensis [apfelsine]
ref|XP_003610427.1|  Calcium-dependent protein kinase                   206   1e-58   
ref|XP_008384073.1|  PREDICTED: calcium-dependent protein kinase ...    203   1e-58   
ref|XP_010536137.1|  PREDICTED: calcium-dependent protein kinase 17     206   1e-58   Tarenaya hassleriana [spider flower]
ref|XP_004252886.1|  PREDICTED: calcium-dependent protein kinase ...    206   1e-58   Solanum lycopersicum
ref|XP_006449723.1|  hypothetical protein CICLE_v10014823mg             206   1e-58   Citrus clementina [clementine]
emb|CDY13993.1|  BnaC09g38330D                                          206   1e-58   Brassica napus [oilseed rape]
gb|ADZ52811.1|  calcium-dependent protein kinase 3                      206   1e-58   Solanum tuberosum [potatoes]
ref|XP_007026066.1|  Calcium-dependent protein kinase 21 isoform 1      206   1e-58   
dbj|BAE71239.1|  putative calcium dependent protein kinase              207   1e-58   Trifolium pratense [peavine clover]
gb|KHN35744.1|  Calcium-dependent protein kinase 33                     203   2e-58   Glycine soja [wild soybean]
gb|KJB68586.1|  hypothetical protein B456_010G252400                    206   2e-58   Gossypium raimondii
ref|XP_010106395.1|  Calcium-dependent protein kinase 17                206   2e-58   Morus notabilis
ref|XP_009135461.1|  PREDICTED: calcium-dependent protein kinase 15     207   2e-58   Brassica rapa
gb|ACR36994.1|  unknown                                                 194   2e-58   Zea mays [maize]
ref|XP_010099802.1|  Calcium-dependent protein kinase 17                206   2e-58   Morus notabilis
emb|CDX79112.1|  BnaA01g11790D                                          206   2e-58   
ref|XP_006399734.1|  hypothetical protein EUTSA_v10013236mg             206   2e-58   Eutrema salsugineum [saltwater cress]
ref|XP_010419805.1|  PREDICTED: calcium-dependent protein kinase ...    206   2e-58   
ref|XP_010492994.1|  PREDICTED: calcium-dependent protein kinase ...    206   2e-58   Camelina sativa [gold-of-pleasure]
gb|AET00506.2|  calcium-dependent kinase                                206   2e-58   Medicago truncatula
ref|XP_010453282.1|  PREDICTED: calcium-dependent protein kinase 17     206   2e-58   Camelina sativa [gold-of-pleasure]
ref|XP_002313265.1|  calcium-dependent protein kinase                   206   2e-58   Populus trichocarpa [western balsam poplar]
ref|XP_010420737.1|  PREDICTED: calcium-dependent protein kinase ...    205   2e-58   Camelina sativa [gold-of-pleasure]
ref|XP_010454209.1|  PREDICTED: calcium-dependent protein kinase 34     205   2e-58   Camelina sativa [gold-of-pleasure]
ref|XP_002873943.1|  calcium-dependent protein kinase 34                205   2e-58   Arabidopsis lyrata subsp. lyrata
ref|XP_010419806.1|  PREDICTED: calcium-dependent protein kinase ...    205   3e-58   Camelina sativa [gold-of-pleasure]
ref|XP_002526062.1|  calcium-dependent protein kinase, putative         205   3e-58   Ricinus communis
ref|XP_004140192.1|  PREDICTED: calcium-dependent protein kinase 34     205   3e-58   Cucumis sativus [cucumbers]
ref|XP_008439982.1|  PREDICTED: calcium-dependent protein kinase 2      206   3e-58   Cucumis melo [Oriental melon]
ref|XP_006400491.1|  hypothetical protein EUTSA_v10013240mg             205   3e-58   Eutrema salsugineum [saltwater cress]
ref|XP_010031714.1|  PREDICTED: calcium-dependent protein kinase ...    205   3e-58   Eucalyptus grandis [rose gum]
ref|XP_010434101.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-depe...    206   3e-58   Camelina sativa [gold-of-pleasure]
ref|XP_006389625.1|  hypothetical protein POPTR_0021s00750g             205   3e-58   Populus trichocarpa [western balsam poplar]
gb|EYU46187.1|  hypothetical protein MIMGU_mgv1a004352mg                205   3e-58   Erythranthe guttata [common monkey flower]
ref|XP_010538709.1|  PREDICTED: calcium-dependent protein kinase ...    205   3e-58   Tarenaya hassleriana [spider flower]
ref|XP_010092160.1|  Calcium-dependent protein kinase 9                 206   3e-58   Morus notabilis
ref|XP_009125853.1|  PREDICTED: calcium-dependent protein kinase ...    205   4e-58   Brassica rapa
ref|XP_003519577.1|  PREDICTED: calcium-dependent protein kinase ...    205   4e-58   Glycine max [soybeans]
ref|XP_011047988.1|  PREDICTED: calcium-dependent protein kinase-...    205   5e-58   Populus euphratica
ref|XP_011014420.1|  PREDICTED: calcium-dependent protein kinase ...    204   5e-58   Populus euphratica
gb|KJB83565.1|  hypothetical protein B456_013G253100                    204   5e-58   Gossypium raimondii
ref|XP_009776253.1|  PREDICTED: calcium-dependent protein kinase-...    205   5e-58   Nicotiana sylvestris
ref|XP_007213195.1|  hypothetical protein PRUPE_ppa026653mg             205   5e-58   Prunus persica
ref|XP_004134759.1|  PREDICTED: calcium-dependent protein kinase ...    205   6e-58   Cucumis sativus [cucumbers]
ref|XP_006289743.1|  hypothetical protein CARUB_v10003311mg             204   6e-58   Capsella rubella
gb|AGG35967.1|  calcium-dependent protein kinase 15                     205   6e-58   Brassica napus [oilseed rape]
ref|XP_011047987.1|  PREDICTED: calcium-dependent protein kinase-...    204   7e-58   Populus euphratica
gb|KJB35709.1|  hypothetical protein B456_006G124800                    204   7e-58   Gossypium raimondii
ref|XP_008798404.1|  PREDICTED: calcium-dependent protein kinase ...    204   7e-58   Phoenix dactylifera
ref|XP_002305576.2|  hypothetical protein POPTR_0004s01530g             204   7e-58   Populus trichocarpa [western balsam poplar]
emb|CDX82886.1|  BnaC01g13360D                                          205   7e-58   
ref|XP_002869852.1|  hypothetical protein ARALYDRAFT_354567             201   7e-58   Arabidopsis lyrata subsp. lyrata
ref|XP_011037643.1|  PREDICTED: calcium-dependent protein kinase-...    204   7e-58   Populus euphratica
ref|XP_003617233.1|  Calcium dependent protein kinase                   204   8e-58   Medicago truncatula
gb|KHN28162.1|  Calcium-dependent protein kinase 17                     203   8e-58   Glycine soja [wild soybean]
ref|XP_007212312.1|  hypothetical protein PRUPE_ppa006748mg             201   9e-58   
emb|CDP04396.1|  unnamed protein product                                204   9e-58   Coffea canephora [robusta coffee]
emb|CDX85697.1|  BnaA02g01160D                                          203   1e-57   
ref|NP_001275456.1|  calcium-dependent protein kinase 3                 204   1e-57   Solanum tuberosum [potatoes]
ref|XP_003528592.1|  PREDICTED: calcium-dependent protein kinase ...    204   1e-57   Glycine max [soybeans]
ref|XP_003529633.1|  PREDICTED: calcium-dependent protein kinase ...    204   1e-57   Glycine max [soybeans]
gb|KCW66998.1|  hypothetical protein EUGRSUZ_F007612                    193   1e-57   Eucalyptus grandis [rose gum]
ref|XP_009597333.1|  PREDICTED: calcium-dependent protein kinase-...    204   1e-57   Nicotiana tomentosiformis
ref|XP_003622837.1|  Calcium dependent protein kinase                   204   1e-57   
ref|XP_012070829.1|  PREDICTED: calcium-dependent protein kinase ...    203   2e-57   Jatropha curcas
ref|XP_009404695.1|  PREDICTED: calcium-dependent protein kinase ...    203   2e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011009111.1|  PREDICTED: calcium-dependent protein kinase ...    203   2e-57   Populus euphratica
gb|EPS59225.1|  calcium-dependent protein kinase 1                      202   2e-57   Genlisea aurea
gb|KJB62816.1|  hypothetical protein B456_009G438300                    203   2e-57   Gossypium raimondii
ref|XP_010448965.1|  PREDICTED: calcium-dependent protein kinase 15     203   2e-57   Camelina sativa [gold-of-pleasure]
ref|XP_002518484.1|  calcium-dependent protein kinase, putative         203   3e-57   Ricinus communis
ref|XP_010276092.1|  PREDICTED: calcium-dependent protein kinase ...    203   3e-57   Nelumbo nucifera [Indian lotus]
ref|NP_197437.1|  calcium-dependent protein kinase 34                   202   3e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006845045.1|  PREDICTED: calcium-dependent protein kinase 17     202   4e-57   Amborella trichopoda
ref|XP_010439398.1|  PREDICTED: calcium-dependent protein kinase ...    203   4e-57   Camelina sativa [gold-of-pleasure]
gb|KHG28675.1|  Calcium-dependent protein kinase 9                      202   4e-57   Gossypium arboreum [tree cotton]
ref|XP_012091348.1|  PREDICTED: calcium-dependent protein kinase ...    203   4e-57   Jatropha curcas
ref|XP_009419685.1|  PREDICTED: calcium-dependent protein kinase ...    202   4e-57   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB13679.1|  hypothetical protein B456_002G088800                    202   4e-57   Gossypium raimondii
ref|XP_009357448.1|  PREDICTED: calcium-dependent protein kinase ...    202   5e-57   Pyrus x bretschneideri [bai li]
ref|XP_010529441.1|  PREDICTED: calcium-dependent protein kinase 21     202   5e-57   Tarenaya hassleriana [spider flower]
ref|XP_004491231.1|  PREDICTED: calcium-dependent protein kinase ...    202   5e-57   Cicer arietinum [garbanzo]
ref|XP_002869856.1|  calcium-dependent protein kinase 15                202   5e-57   Arabidopsis lyrata subsp. lyrata
ref|XP_004961659.1|  PREDICTED: calcium-dependent protein kinase ...    203   5e-57   
ref|XP_004513232.1|  PREDICTED: calcium-dependent protein kinase ...    202   6e-57   
gb|KHG26977.1|  Calcium-dependent protein kinase 9                      201   7e-57   Gossypium arboreum [tree cotton]
gb|KFK28778.1|  hypothetical protein AALP_AA7G046400                    201   7e-57   Arabis alpina [alpine rockcress]
gb|KHN38392.1|  Calcium-dependent protein kinase 17                     201   8e-57   Glycine soja [wild soybean]
ref|XP_004293141.1|  PREDICTED: calcium-dependent protein kinase 34     201   8e-57   Fragaria vesca subsp. vesca
ref|XP_010929942.1|  PREDICTED: calcium-dependent protein kinase ...    202   8e-57   Elaeis guineensis
ref|NP_193925.1|  calcium-dependent protein kinase 15                   202   9e-57   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190794.1|  calcium-dependent protein kinase 15                202   9e-57   Arabidopsis thaliana [mouse-ear cress]
emb|CBI24256.3|  unnamed protein product                                201   9e-57   Vitis vinifera
ref|XP_006303970.1|  hypothetical protein CARUB_v10008860mg             201   9e-57   Capsella rubella
ref|XP_006575622.1|  PREDICTED: calcium-dependent protein kinase ...    201   1e-56   Glycine max [soybeans]
ref|XP_002441304.1|  hypothetical protein SORBIDRAFT_09g024100          201   1e-56   Sorghum bicolor [broomcorn]
ref|XP_003545165.1|  PREDICTED: calcium-dependent protein kinase ...    201   1e-56   Glycine max [soybeans]
ref|XP_010461925.1|  PREDICTED: calcium-dependent protein kinase 33     201   1e-56   Camelina sativa [gold-of-pleasure]
ref|XP_008224828.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-depe...    202   1e-56   Prunus mume [ume]
ref|XP_006655439.1|  PREDICTED: calcium-dependent protein kinase ...    200   1e-56   
ref|XP_010479536.1|  PREDICTED: calcium-dependent protein kinase ...    201   1e-56   
ref|XP_009368734.1|  PREDICTED: calcium-dependent protein kinase ...    201   1e-56   
ref|XP_006600312.1|  PREDICTED: calcium-dependent protein kinase ...    201   1e-56   
ref|XP_002532559.1|  calcium-dependent protein kinase, putative         201   1e-56   
ref|XP_006283446.1|  hypothetical protein CARUB_v10004493mg             201   1e-56   
ref|XP_002276630.2|  PREDICTED: calcium-dependent protein kinase ...    201   1e-56   
ref|XP_006356386.1|  PREDICTED: calcium-dependent protein kinase ...    201   1e-56   
gb|KHN12036.1|  Calcium-dependent protein kinase 17                     202   1e-56   
ref|XP_003617547.1|  Calcium dependent protein kinase                   206   2e-56   
ref|XP_004250895.1|  PREDICTED: calcium-dependent protein kinase ...    201   2e-56   
ref|XP_009360996.1|  PREDICTED: calcium-dependent protein kinase ...    201   2e-56   
emb|CAN62888.1|  hypothetical protein VITISV_025544                     201   2e-56   
gb|KJB55472.1|  hypothetical protein B456_009G078000                    201   2e-56   
ref|XP_010269425.1|  PREDICTED: calcium-dependent protein kinase ...    201   2e-56   
ref|XP_008651864.1|  PREDICTED: calcium-dependent protein kinase ...    201   2e-56   
gb|ACR34538.1|  unknown                                                 200   2e-56   
gb|AGT15898.1|  calcium-dependent protein kinase                        200   2e-56   
emb|CAN60225.1|  hypothetical protein VITISV_039919                     199   2e-56   
ref|XP_008804309.1|  PREDICTED: calcium-dependent protein kinase ...    201   2e-56   
gb|AGT17455.1|  hypothetical protein SHCRBa_258_F08_F_40                200   2e-56   
ref|XP_010269424.1|  PREDICTED: calcium-dependent protein kinase ...    200   2e-56   
ref|XP_010278695.1|  PREDICTED: calcium-dependent protein kinase ...    200   2e-56   
ref|XP_003568203.1|  PREDICTED: calcium-dependent protein kinase ...    200   3e-56   
ref|XP_004228884.1|  PREDICTED: calcium-dependent protein kinase ...    200   3e-56   
ref|XP_002977722.1|  calcium dependent protein kinase 17                201   3e-56   
gb|AGT17376.1|  calcium-dependent protein kinase                        200   3e-56   
ref|XP_007141507.1|  hypothetical protein PHAVU_008G201900g             200   3e-56   
gb|AIO04122.1|  calcium-dependent protein kinase                        201   3e-56   
gb|EEE64198.1|  hypothetical protein OsJ_19030                          200   3e-56   
ref|XP_009350446.1|  PREDICTED: calcium-dependent protein kinase ...    197   3e-56   
ref|XP_007146136.1|  hypothetical protein PHAVU_006G015300g             200   3e-56   
gb|EEC79448.1|  hypothetical protein OsI_20437                          199   4e-56   
ref|XP_007213894.1|  hypothetical protein PRUPE_ppa003830mg             200   4e-56   
ref|XP_010545509.1|  PREDICTED: calcium-dependent protein kinase 33     200   4e-56   
gb|ACB71246.2|  calcium-dependent protein kinase 1                      200   4e-56   
gb|EAZ40006.1|  hypothetical protein OsJ_24444                          198   4e-56   
ref|XP_004491400.1|  PREDICTED: calcium-dependent protein kinase ...    200   4e-56   
gb|AAT69647.1|  hypothetical protein                                    199   4e-56   
gb|AGT17166.1|  calcium-dependent protein kinase                        198   4e-56   
ref|XP_010466227.1|  PREDICTED: calcium-dependent protein kinase ...    200   5e-56   
gb|EYU33891.1|  hypothetical protein MIMGU_mgv1a004201mg                199   5e-56   
ref|NP_001105542.1|  calcium-dependent protein kinase 2                 199   5e-56   
ref|XP_007020820.1|  Calmodulin-domain protein kinase 9 isoform 1       199   5e-56   
ref|XP_004957849.1|  PREDICTED: calcium-dependent protein kinase ...    199   5e-56   
gb|KFK39368.1|  hypothetical protein AALP_AA3G235800                    199   5e-56   
gb|AFW82381.1|  putative calcium-dependent protein kinase family ...    201   5e-56   
ref|NP_001055912.1|  Os05g0491900                                       199   6e-56   
emb|CBI23246.3|  unnamed protein product                                199   6e-56   
gb|EYU27336.1|  hypothetical protein MIMGU_mgv1a004414mg                199   6e-56   
ref|XP_010923910.1|  PREDICTED: calcium-dependent protein kinase ...    199   6e-56   
ref|NP_188676.1|  calmodulin-domain protein kinase 9                    199   6e-56   
dbj|BAK07881.1|  predicted protein                                      199   7e-56   
ref|NP_001266075.1|  calcium-dependent protein kinase 21-like           199   7e-56   
ref|XP_004972225.1|  PREDICTED: calcium-dependent protein kinase ...    195   7e-56   
ref|XP_006657762.1|  PREDICTED: calcium-dependent protein kinase ...    199   8e-56   
ref|XP_004231610.1|  PREDICTED: calcium-dependent protein kinase ...    199   8e-56   
ref|XP_008806408.1|  PREDICTED: calcium-dependent protein kinase 2      199   9e-56   
ref|XP_002979552.1|  calcium dependent protein kinase 17                199   9e-56   
ref|XP_009773532.1|  PREDICTED: calcium-dependent protein kinase ...    199   9e-56   
emb|CDP05759.1|  unnamed protein product                                198   9e-56   
ref|XP_008226901.1|  PREDICTED: calcium-dependent protein kinase 2      199   9e-56   
ref|XP_006446309.1|  hypothetical protein CICLE_v10014854mg             199   1e-55   
ref|NP_001059775.1|  Os07g0515100                                       199   1e-55   
ref|XP_006406385.1|  hypothetical protein EUTSA_v10020475mg             199   1e-55   
ref|XP_006350481.1|  PREDICTED: calcium-dependent protein kinase-...    199   1e-55   
ref|XP_006297378.1|  hypothetical protein CARUB_v10013403mg             199   1e-55   
ref|XP_002268814.1|  PREDICTED: calcium-dependent protein kinase 2      199   1e-55   
emb|CAA57157.1|  calcium-dependent protein kinase                       199   1e-55   
ref|XP_006361005.1|  PREDICTED: calcium-dependent protein kinase ...    199   1e-55   
gb|AGT16545.1|  calcium-dependent protein kinase 34                     198   1e-55   
ref|XP_009144515.1|  PREDICTED: calcium-dependent protein kinase 21     198   1e-55   
ref|XP_008365176.1|  PREDICTED: calcium-dependent protein kinase ...    198   1e-55   
ref|XP_009360846.1|  PREDICTED: calcium-dependent protein kinase ...    198   1e-55   
emb|CAD70165.1|  calcium-dependent protein kinase                       198   1e-55   
ref|NP_001280761.1|  calcium-dependent protein kinase 2-like            198   2e-55   
ref|XP_009627412.1|  PREDICTED: calcium-dependent protein kinase ...    198   2e-55   
ref|XP_007142270.1|  hypothetical protein PHAVU_008G266600g             198   2e-55   
gb|AHN49725.1|  calcium-dependent protein kinase 1                      198   2e-55   
gb|EMS56466.1|  Calcium-dependent protein kinase 34                     198   2e-55   
gb|AGG35970.1|  calcium-dependent protein kinase 21                     198   2e-55   
ref|XP_002891589.1|  calcium-dependent protein kinase 33                197   2e-55   
ref|XP_010923909.1|  PREDICTED: calcium-dependent protein kinase ...    198   2e-55   
gb|KFK30983.1|  hypothetical protein AALP_AA6G053500                    198   2e-55   
ref|XP_002883243.1|  calmodulin-domain protein kinase 9                 198   2e-55   
gb|AGG35978.1|  calcium-dependent protein kinase 9                      198   2e-55   
ref|XP_008365060.1|  PREDICTED: calcium-dependent protein kinase 2      198   2e-55   
ref|XP_008463413.1|  PREDICTED: calcium-dependent protein kinase-...    197   2e-55   
emb|CDY36037.1|  BnaC03g41610D                                          197   3e-55   
ref|XP_006289661.1|  hypothetical protein CARUB_v10003219mg             197   3e-55   
ref|NP_001105306.1|  calcium-dependent protein kinase                   197   3e-55   
ref|XP_011024983.1|  PREDICTED: calcium-dependent protein kinase 17     197   3e-55   
ref|XP_004293286.1|  PREDICTED: calcium-dependent protein kinase ...    197   3e-55   
ref|XP_010508871.1|  PREDICTED: calcium-dependent protein kinase 9      197   3e-55   
ref|XP_002299975.2|  hypothetical protein POPTR_0001s28150g             197   3e-55   
ref|XP_010455773.1|  PREDICTED: calcium-dependent protein kinase ...    197   3e-55   
ref|XP_006470577.1|  PREDICTED: calcium-dependent protein kinase ...    197   3e-55   
ref|XP_002874811.1|  calcium-dependent protein kinase 21                197   3e-55   
ref|XP_006396672.1|  hypothetical protein EUTSA_v10028567mg             197   3e-55   
ref|XP_004152931.1|  PREDICTED: calcium-dependent protein kinase-...    197   3e-55   
ref|NP_175485.1|  calcium-dependent protein kinase 33                   197   3e-55   
ref|XP_010422295.1|  PREDICTED: calcium-dependent protein kinase 21     197   4e-55   
gb|AAD28192.2|  calcium-dependent protein kinase                        197   4e-55   
gb|EMT05629.1|  Calcium-dependent protein kinase 34                     196   5e-55   
ref|XP_002869854.1|  hypothetical protein ARALYDRAFT_914449             200   6e-55   
ref|XP_004294385.1|  PREDICTED: calcium-dependent protein kinase ...    197   6e-55   
gb|ABC59620.1|  calcium-dependent protein kinase                        196   6e-55   
gb|ABD98803.1|  calcium-dependent protein kinase                        196   6e-55   
gb|ABC59619.1|  calcium-dependent protein kinase                        196   6e-55   
ref|XP_010904692.1|  PREDICTED: calcium-dependent protein kinase ...    196   7e-55   
dbj|BAJ99143.1|  predicted protein                                      196   7e-55   
dbj|BAA13440.1|  calcium dependent protein kinase                       196   8e-55   
gb|AAK92828.1|  putative calcium dependent protein kinase               196   8e-55   
gb|AIU98507.1|  calcium-dependent protein kinase                        196   8e-55   
ref|XP_010093289.1|  Calcium-dependent protein kinase 15                196   8e-55   
gb|KFK30982.1|  hypothetical protein AALP_AA6G053400                    195   8e-55   
ref|NP_192381.1|  calcium-dependent protein kinase 21                   196   8e-55   
gb|KCW67039.1|  hypothetical protein EUGRSUZ_F00807                     195   9e-55   
gb|ABD98804.1|  calcium-dependent protein kinase                        196   9e-55   
ref|XP_009414363.1|  PREDICTED: calcium-dependent protein kinase 17     196   1e-54   
ref|XP_009798561.1|  PREDICTED: calcium-dependent protein kinase ...    196   1e-54   
ref|XP_009592788.1|  PREDICTED: calcium-dependent protein kinase 2      196   1e-54   
ref|XP_009406510.1|  PREDICTED: calcium-dependent protein kinase ...    196   1e-54   
gb|KJB81727.1|  hypothetical protein B456_013G159300                    196   1e-54   
emb|CAA65500.1|  protein kinase                                         196   1e-54   
gb|KEH33831.1|  calmodulin-domain kinase CDPK protein                   196   1e-54   
gb|ABE72958.1|  calcium dependent protein kinase 3                      196   1e-54   
gb|KHG17079.1|  Calcium-dependent protein kinase 9                      196   1e-54   
ref|XP_004500067.1|  PREDICTED: calcium-dependent protein kinase ...    196   1e-54   
ref|XP_009414364.1|  PREDICTED: calcium-dependent protein kinase ...    187   1e-54   
ref|XP_003563028.1|  PREDICTED: calcium-dependent protein kinase ...    196   1e-54   
ref|XP_009783685.1|  PREDICTED: calcium-dependent protein kinase ...    195   1e-54   
ref|XP_001767768.1|  cpk1 calcium-dependent protein kinase              196   1e-54   
ref|NP_001275322.1|  calcium-dependent protein kinase                   196   1e-54   
ref|XP_006365956.1|  PREDICTED: calcium-dependent protein kinase 2      195   1e-54   
ref|XP_011083439.1|  PREDICTED: calcium-dependent protein kinase 29     195   1e-54   
ref|XP_010922091.1|  PREDICTED: calcium-dependent protein kinase ...    195   2e-54   
gb|ADM14342.1|  calcium-dependent protein kinase 19                     195   2e-54   
ref|XP_010060346.1|  PREDICTED: calcium-dependent protein kinase ...    195   2e-54   
ref|XP_010060380.1|  PREDICTED: calcium-dependent protein kinase ...    195   2e-54   
ref|XP_010060348.1|  PREDICTED: calcium-dependent protein kinase ...    195   2e-54   
gb|AFY10519.1|  calcium dependent protein kinase 1                      195   2e-54   
gb|ABB54456.1|  calcium-dependent protein kinase                        195   2e-54   
ref|XP_006644875.1|  PREDICTED: calcium-dependent protein kinase ...    194   3e-54   
ref|XP_009135689.1|  PREDICTED: calcium-dependent protein kinase 9      194   4e-54   
ref|XP_002989102.1|  calcium dependent protein kinase                   194   4e-54   
emb|CDX82244.1|  BnaA03g35770D                                          194   4e-54   
ref|XP_002983821.1|  calcium dependent protein kinase 3                 194   5e-54   
ref|XP_006346214.1|  PREDICTED: calcium-dependent protein kinase ...    194   5e-54   
ref|NP_001275371.1|  calcium-dependent protein kinase 2                 194   5e-54   
gb|EAY76207.1|  hypothetical protein OsI_04143                          193   5e-54   
gb|AAQ17506.1|  calcium dependent protein kinase 3                      194   5e-54   
ref|XP_010100127.1|  Calcium-dependent protein kinase 29                194   5e-54   
ref|XP_008786936.1|  PREDICTED: calcium-dependent protein kinase ...    193   6e-54   
ref|XP_010467929.1|  PREDICTED: calcium-dependent protein kinase ...    197   6e-54   
ref|XP_010266896.1|  PREDICTED: calcium-dependent protein kinase ...    194   7e-54   
ref|NP_001044575.1|  Os01g0808400                                       193   7e-54   
gb|KHG10851.1|  Calcium-dependent protein kinase 21                     194   8e-54   
ref|NP_001234582.1|  calcium-dependent protein kinase CDPK1             193   8e-54   
gb|KFK35914.1|  hypothetical protein AALP_AA4G052700                    193   9e-54   
ref|XP_010266895.1|  PREDICTED: calcium-dependent protein kinase ...    193   9e-54   
gb|AAD17800.1|  Ca2+-dependent protein kinase                           193   1e-53   
gb|KCW75309.1|  hypothetical protein EUGRSUZ_E04057                     193   1e-53   
ref|XP_010057925.1|  PREDICTED: calcium-dependent protein kinase ...    193   1e-53   
gb|KCW75310.1|  hypothetical protein EUGRSUZ_E04057                     193   1e-53   
ref|XP_008788593.1|  PREDICTED: calcium-dependent protein kinase ...    193   1e-53   
ref|XP_009604147.1|  PREDICTED: calcium-dependent protein kinase ...    192   1e-53   
gb|AGJ83806.1|  calcium-dependent protein kinase 1d                     193   1e-53   
ref|XP_009388872.1|  PREDICTED: calcium-dependent protein kinase ...    193   1e-53   
ref|XP_006828852.1|  PREDICTED: calcium-dependent protein kinase ...    193   1e-53   
emb|CDP07348.1|  unnamed protein product                                192   2e-53   
ref|XP_006413705.1|  hypothetical protein EUTSA_v10027200mg             187   2e-53   
gb|EMT33574.1|  Calcium-dependent protein kinase 34                     191   2e-53   
gb|KJB69279.1|  hypothetical protein B456_011G014200                    192   3e-53   
emb|CDM84631.1|  unnamed protein product                                191   3e-53   
ref|NP_177731.2|  calcium-dependent protein kinase 29                   187   3e-53   
gb|EMS58754.1|  Calcium-dependent protein kinase 34                     191   3e-53   
tpg|DAA57188.1|  TPA: putative calcium-dependent protein kinase f...    191   4e-53   
emb|CBI26637.3|  unnamed protein product                                187   5e-53   
ref|XP_010501945.1|  PREDICTED: calcium-dependent protein kinase ...    192   5e-53   
ref|XP_008674922.1|  PREDICTED: calcium-dependent protein kinase 34     191   5e-53   
ref|XP_007160621.1|  hypothetical protein PHAVU_001G002800g             194   5e-53   
gb|ABV22575.1|  calcium-dependent protein kinase                        193   6e-53   
gb|AGG35971.1|  calcium-dependent protein kinase 29                     191   6e-53   
ref|XP_001771902.1|  predicted protein                                  190   6e-53   
ref|XP_009106253.1|  PREDICTED: calcium-dependent protein kinase 29     191   6e-53   
ref|XP_007146477.1|  hypothetical protein PHAVU_006G0437000g            189   7e-53   
emb|CDX73219.1|  BnaC06g36670D                                          191   7e-53   
gb|AFW84809.1|  putative calcium-dependent protein kinase family ...    189   8e-53   
ref|XP_008657141.1|  PREDICTED: calcium-dependent protein kinase ...    190   1e-52   
emb|CBX25340.1|  hypothetical_protein                                   190   1e-52   
ref|XP_006662719.1|  PREDICTED: calcium-dependent protein kinase ...    190   1e-52   
gb|AFR11230.1|  calcium dependent protein kinase 1                      190   1e-52   
gb|AES59823.2|  calcium-dependent kinase                                190   2e-52   
dbj|BAK06838.1|  predicted protein                                      190   2e-52   
ref|XP_004238385.1|  PREDICTED: calcium-dependent protein kinase 29     189   2e-52   
ref|XP_002456506.1|  hypothetical protein SORBIDRAFT_03g037570          188   2e-52   
ref|XP_006664312.1|  PREDICTED: calcium-dependent protein kinase ...    189   2e-52   
dbj|BAK06618.1|  predicted protein                                      189   3e-52   
gb|AGA83664.1|  calcium-dependent protein kinase 1                      189   3e-52   
gb|EYU17566.1|  hypothetical protein MIMGU_mgv1a004597mg                189   3e-52   
ref|NP_001266856.1|  calcium-dependent protein kinase                   189   4e-52   
ref|XP_010675716.1|  PREDICTED: calcium-dependent protein kinase ...    189   4e-52   
gb|EMS46504.1|  Calcium-dependent protein kinase 3                      186   5e-52   
gb|AEY99979.1|  calcium-dependent protein kinase                        189   5e-52   
ref|XP_006302092.1|  hypothetical protein CARUB_v10020082mg             189   5e-52   
ref|XP_003576346.1|  PREDICTED: calcium-dependent protein kinase ...    188   7e-52   
ref|XP_001781985.1|  predicted protein                                  187   8e-52   
ref|XP_003610425.1|  Calcium-dependent protein kinase                   188   9e-52   
ref|XP_003545013.1|  PREDICTED: calcium-dependent protein kinase ...    188   9e-52   
ref|XP_003564438.1|  PREDICTED: calcium-dependent protein kinase 34     187   1e-51   
gb|AAP03014.1|  seed calcium dependent protein kinase c                 187   1e-51   
ref|XP_010428651.1|  PREDICTED: calcium-dependent protein kinase ...    187   1e-51   
ref|XP_004980140.1|  PREDICTED: calcium-dependent protein kinase ...    187   1e-51   
gb|AEY99978.1|  calcium-dependent protein kinase                        187   1e-51   
ref|XP_002278179.1|  PREDICTED: calcium-dependent protein kinase 2      187   1e-51   
ref|NP_001235641.1|  calmodulin-like domain protein kinase isoenz...    187   1e-51   
sp|Q8RWL2.2|CDPKT_ARATH  RecName: Full=Calcium-dependent protein ...    187   1e-51   
gb|ACJ61504.1|  calcium-dependent protein kinase                        188   1e-51   
emb|CDX94570.1|  BnaC09g22660D                                          190   1e-51   
ref|XP_008800033.1|  PREDICTED: calcium-dependent protein kinase 29     187   2e-51   



>gb|ABC47163.2| CDPK1 [Ipomoea nil]
 gb|AFO63177.1| calcium dependent protein kinase 1 [Ipomoea nil]
Length=514

 Score =   272 bits (696),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 133/134 (99%), Positives = 133/134 (99%), Gaps = 0/134 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR
Sbjct  375  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  434

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII EVDTDNDGKINYD
Sbjct  435  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIVEVDTDNDGKINYD  494

Query  374  EFVAMMRKGTPDLV  333
            EFVAMMRKGTPDLV
Sbjct  495  EFVAMMRKGTPDLV  508



>ref|XP_009620189.1| PREDICTED: calcium-dependent protein kinase 3 [Nicotiana tomentosiformis]
Length=514

 Score =   262 bits (669),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 126/134 (94%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR
Sbjct  375  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  434

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +EREDHLYKAFEYFDKDKSGYITM+ELEH+LKKYNI+DEKTIKEIIAEVDTDNDG+INYD
Sbjct  435  MEREDHLYKAFEYFDKDKSGYITMDELEHALKKYNISDEKTIKEIIAEVDTDNDGRINYD  494

Query  374  EFVAMMRKGTPDLV  333
            EF AMMRKG PD V
Sbjct  495  EFAAMMRKGNPDFV  508



>ref|XP_004244622.1| PREDICTED: calcium-dependent protein kinase 3 [Solanum lycopersicum]
Length=516

 Score =   260 bits (664),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 125/134 (93%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            SIDTDDSGTIT+EELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR
Sbjct  377  SIDTDDSGTITFEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  436

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +EREDHLYKAFEYFDKDKSGYITMEELEH+LK+YNITD+KTIKEIIAEVDTDNDG+INYD
Sbjct  437  MEREDHLYKAFEYFDKDKSGYITMEELEHALKEYNITDDKTIKEIIAEVDTDNDGRINYD  496

Query  374  EFVAMMRKGTPDLV  333
            EF AMMRKG PD V
Sbjct  497  EFAAMMRKGNPDFV  510



>ref|XP_006352261.1| PREDICTED: calcium-dependent protein kinase 3-like [Solanum tuberosum]
Length=517

 Score =   259 bits (661),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            SIDTDDSGTIT+EELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMH+NR
Sbjct  378  SIDTDDSGTITFEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHLNR  437

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +EREDHLYKAFEYFDKDKSGYITMEELEH+LK+YNITDEKTIKEIIAEVDTDNDG+INYD
Sbjct  438  MEREDHLYKAFEYFDKDKSGYITMEELEHALKEYNITDEKTIKEIIAEVDTDNDGRINYD  497

Query  374  EFVAMMRKGTPDLV  333
            EF  MMRKG PD V
Sbjct  498  EFATMMRKGNPDFV  511



>ref|XP_009786035.1| PREDICTED: calcium-dependent protein kinase 3 [Nicotiana sylvestris]
Length=514

 Score =   258 bits (658),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/134 (93%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR
Sbjct  375  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  434

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +EREDHLYKAFEYFDKDKSGYITM+ELEH+LKKYNI+DEKTIKEIIAEVDTDNDG+INYD
Sbjct  435  MEREDHLYKAFEYFDKDKSGYITMDELEHALKKYNISDEKTIKEIIAEVDTDNDGRINYD  494

Query  374  EFVAMMRKGTPDLV  333
            EF AMMRKG  D V
Sbjct  495  EFAAMMRKGNLDFV  508



>ref|XP_012086799.1| PREDICTED: calcium-dependent protein kinase 3 [Jatropha curcas]
 gb|KDP25359.1| hypothetical protein JCGZ_20515 [Jatropha curcas]
Length=525

 Score =   255 bits (651),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 121/135 (90%), Positives = 131/135 (97%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT+EELKAGL K+GTKLSESEVRQLMEAADVDGNGTIDY+EFITATMHMNR
Sbjct  386  SMDTDNSGTITFEELKAGLPKLGTKLSESEVRQLMEAADVDGNGTIDYIEFITATMHMNR  445

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +EREDHLYKAFEYFDKDKSGYITMEELEH+LK+YN+ D KTIKEIIAEVDTDNDGKINY+
Sbjct  446  MEREDHLYKAFEYFDKDKSGYITMEELEHALKQYNMGDSKTIKEIIAEVDTDNDGKINYE  505

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMMRKG PDLVT
Sbjct  506  EFVAMMRKGNPDLVT  520



>gb|KHN25667.1| Calcium-dependent protein kinase 3 [Glycine soja]
Length=383

 Score =   250 bits (639),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT+EELKAGL K+GTK+SESEVRQLMEAADVDGNGTIDY+EFITATMHMNR
Sbjct  244  SMDTDNSGTITFEELKAGLPKLGTKVSESEVRQLMEAADVDGNGTIDYIEFITATMHMNR  303

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +EREDHLYKAFEYFDKD+SGYITMEELE +LKKYN+ DEKTIKEII EVDTDNDG+INYD
Sbjct  304  MEREDHLYKAFEYFDKDRSGYITMEELESTLKKYNMGDEKTIKEIIVEVDTDNDGRINYD  363

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMMRKG PDLVT
Sbjct  364  EFVAMMRKGKPDLVT  378



>gb|ACH85192.1| calcium-dependent protein kinase CDPK5 [Nicotiana tabacum]
Length=514

 Score =   254 bits (649),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 123/134 (92%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            SIDTDD+GTITYEELKAGLTKMGTKLSESEVRQL+EAADVDGNGTIDYLEFITATMHMNR
Sbjct  375  SIDTDDNGTITYEELKAGLTKMGTKLSESEVRQLVEAADVDGNGTIDYLEFITATMHMNR  434

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +EREDHLYKAFEYFDKDKSGYITM+ELEH+LKKYNI+DEKTIKEIIAEVDTDNDG+INYD
Sbjct  435  MEREDHLYKAFEYFDKDKSGYITMDELEHALKKYNISDEKTIKEIIAEVDTDNDGRINYD  494

Query  374  EFVAMMRKGTPDLV  333
            EF AMMRKG  D V
Sbjct  495  EFAAMMRKGNLDFV  508



>ref|XP_010055801.1| PREDICTED: calcium-dependent protein kinase 3 [Eucalyptus grandis]
 gb|KCW72352.1| hypothetical protein EUGRSUZ_E00806 [Eucalyptus grandis]
Length=539

 Score =   253 bits (647),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/135 (89%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTITYEELKAGL K+GTKLSESEV+QLMEAADVDGNGTIDYLEFITATMH+NR
Sbjct  395  SMDTDNSGTITYEELKAGLPKLGTKLSESEVKQLMEAADVDGNGTIDYLEFITATMHLNR  454

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            VEREDHLYKAFEYFDKDKSGYITMEELEH+LKKYN+ DEKTIKEIIAEVDTD+DG+INYD
Sbjct  455  VEREDHLYKAFEYFDKDKSGYITMEELEHALKKYNMGDEKTIKEIIAEVDTDHDGRINYD  514

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMMRKG PD+  
Sbjct  515  EFVAMMRKGNPDMAP  529



>gb|KHN35055.1| Calcium-dependent protein kinase 3 [Glycine soja]
Length=373

 Score =   248 bits (633),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 117/135 (87%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT+EELKAGL K+GTK+SESEVRQLMEAADVDGNGTIDY+EFITATMHMNR
Sbjct  234  SMDTDNSGTITFEELKAGLPKLGTKVSESEVRQLMEAADVDGNGTIDYIEFITATMHMNR  293

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +EREDHLYKAFEYFDKD+SGYIT+EELE +LKKYN+ DEKTIKEIIAEVD DNDG+INYD
Sbjct  294  MEREDHLYKAFEYFDKDRSGYITVEELESALKKYNMGDEKTIKEIIAEVDADNDGRINYD  353

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMMRKG PDLV 
Sbjct  354  EFVAMMRKGNPDLVN  368



>emb|CDP12100.1| unnamed protein product [Coffea canephora]
Length=400

 Score =   248 bits (634),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT+EELKAGL K+GTKLSESEVRQLMEAADVDGNGTIDY+EFITATMHMNR
Sbjct  261  SMDTDNSGTITFEELKAGLPKLGTKLSESEVRQLMEAADVDGNGTIDYIEFITATMHMNR  320

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            VEREDHLY+AFEYFDKDKSGYITMEELEH+LK+YN+ DEKTIKEIIAEVDTD+DG+INYD
Sbjct  321  VEREDHLYRAFEYFDKDKSGYITMEELEHALKEYNMGDEKTIKEIIAEVDTDHDGRINYD  380

Query  374  EFVAMMRKGTPDL  336
            EFVAMMRKG P++
Sbjct  381  EFVAMMRKGQPEM  393



>emb|CBI34415.3| unnamed protein product [Vitis vinifera]
Length=399

 Score =   248 bits (633),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 116/135 (86%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTITYEELK GL K+GTKLSESEVRQLMEAADVDGNGTIDY+EFI+ATMHMNR
Sbjct  260  SMDTDNSGTITYEELKNGLPKLGTKLSESEVRQLMEAADVDGNGTIDYIEFISATMHMNR  319

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +EREDHLY+AFEYFDKDKSGYITMEELEH+LK+YN+ DEKTIKEIIAEVDTD+DG+INY+
Sbjct  320  MEREDHLYRAFEYFDKDKSGYITMEELEHALKRYNMGDEKTIKEIIAEVDTDHDGRINYE  379

Query  374  EFVAMMRKGTPDLVT  330
            EF AMMRKG PDL+T
Sbjct  380  EFAAMMRKGNPDLIT  394



>ref|XP_003517491.2| PREDICTED: calcium-dependent protein kinase 3-like [Glycine max]
Length=528

 Score =   251 bits (642),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT+EELKAGL K+GTK+SESEVRQLMEAADVDGNGTIDY+EFITATMHMNR
Sbjct  389  SMDTDNSGTITFEELKAGLPKLGTKVSESEVRQLMEAADVDGNGTIDYIEFITATMHMNR  448

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +EREDHLYKAFEYFDKD+SGYITMEELE +LKKYN+ DEKTIKEII EVDTDNDG+INYD
Sbjct  449  MEREDHLYKAFEYFDKDRSGYITMEELESTLKKYNMGDEKTIKEIIVEVDTDNDGRINYD  508

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMMRKG PDLVT
Sbjct  509  EFVAMMRKGKPDLVT  523



>ref|XP_008239005.1| PREDICTED: calcium-dependent protein kinase 3 [Prunus mume]
Length=400

 Score =   247 bits (631),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT+EELKAGL K+GTKLSESEVRQLMEAADVDGNGTIDY+EFITATMHMNR
Sbjct  261  SMDTDNSGTITFEELKAGLPKLGTKLSESEVRQLMEAADVDGNGTIDYIEFITATMHMNR  320

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +EREDHLYKAFEYFDKDKSGYITMEELE +LKKYN+ DEKTIKEIIAEVDTD DG+INYD
Sbjct  321  MEREDHLYKAFEYFDKDKSGYITMEELEQALKKYNMGDEKTIKEIIAEVDTDLDGRINYD  380

Query  374  EFVAMMRKGTPDLVT  330
            EF AMMRKG P+LVT
Sbjct  381  EFAAMMRKGDPELVT  395



>gb|KHN16773.1| Calcium-dependent protein kinase 3 [Glycine soja]
Length=249

 Score =   242 bits (617),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT+EELKAGL K+G+KLSESEVRQLMEAAD+DGNGTIDY+EFITATMHMNR
Sbjct  108  SMDTDNSGTITFEELKAGLPKLGSKLSESEVRQLMEAADIDGNGTIDYIEFITATMHMNR  167

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +ERED LYKAFEYFD DKSGYITMEELE +LKKYN+ DEKTIKEIIAEVD+DNDG+INYD
Sbjct  168  MEREDRLYKAFEYFDNDKSGYITMEELESALKKYNMGDEKTIKEIIAEVDSDNDGRINYD  227

Query  374  EFVAMMRKGTPDL  336
            EFVAMMRKG PD+
Sbjct  228  EFVAMMRKGNPDI  240



>emb|CAN61364.1| hypothetical protein VITISV_032639 [Vitis vinifera]
Length=482

 Score =   248 bits (634),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 116/135 (86%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTITYEELK GL K+GTKLSESEVRQLMEAADVDGNGTIDY+EFI+ATMHMNR
Sbjct  343  SMDTDNSGTITYEELKNGLPKLGTKLSESEVRQLMEAADVDGNGTIDYIEFISATMHMNR  402

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +EREDHLY+AFEYFDKDKSGYITMEELEH+LK+YN+ DEKTIKEIIAEVDTD+DG+INY+
Sbjct  403  MEREDHLYRAFEYFDKDKSGYITMEELEHALKRYNMGDEKTIKEIIAEVDTDHDGRINYE  462

Query  374  EFVAMMRKGTPDLVT  330
            EF AMMRKG PDL+T
Sbjct  463  EFAAMMRKGNPDLIT  477



>ref|XP_011073451.1| PREDICTED: calcium-dependent protein kinase 3-like [Sesamum indicum]
Length=517

 Score =   249 bits (636),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 118/135 (87%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT+EELKAGL K+GT+LSESEVRQLMEAADVDGNGTIDY+EFITATMHMNR
Sbjct  378  SMDTDNSGTITFEELKAGLPKLGTRLSESEVRQLMEAADVDGNGTIDYIEFITATMHMNR  437

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            VEREDHLYKAFEYFDKDKSGYITMEELEH+LK+YN+ D KTIKEI+AEVDTD+DGKINYD
Sbjct  438  VEREDHLYKAFEYFDKDKSGYITMEELEHALKEYNMGDAKTIKEILAEVDTDHDGKINYD  497

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMMRKG PD+ T
Sbjct  498  EFVAMMRKGNPDIGT  512



>ref|XP_008451994.1| PREDICTED: calcium-dependent protein kinase 3 [Cucumis melo]
Length=527

 Score =   249 bits (636),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 118/135 (87%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT+EELKAGL K+GTKLSESEVRQLMEAADVDGNG+IDY+EFITATMHMNR
Sbjct  388  SMDTDNSGTITFEELKAGLPKLGTKLSESEVRQLMEAADVDGNGSIDYIEFITATMHMNR  447

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            VEREDHL++AFEYFDKDKSGYITMEELE +LKKYN+ DEKTIKEIIAEVDTDNDG+INYD
Sbjct  448  VEREDHLFRAFEYFDKDKSGYITMEELETALKKYNMGDEKTIKEIIAEVDTDNDGRINYD  507

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMMRKG P+L T
Sbjct  508  EFVAMMRKGNPELTT  522



>ref|XP_002272270.1| PREDICTED: calcium-dependent protein kinase 3 [Vitis vinifera]
 ref|XP_010658560.1| PREDICTED: calcium-dependent protein kinase 3 [Vitis vinifera]
Length=528

 Score =   248 bits (634),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/135 (86%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTITYEELK GL K+GTKLSESEVRQLMEAADVDGNGTIDY+EFI+ATMHMNR
Sbjct  389  SMDTDNSGTITYEELKNGLPKLGTKLSESEVRQLMEAADVDGNGTIDYIEFISATMHMNR  448

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +EREDHLY+AFEYFDKDKSGYITMEELEH+LK+YN+ DEKTIKEIIAEVDTD+DG+INY+
Sbjct  449  MEREDHLYRAFEYFDKDKSGYITMEELEHALKRYNMGDEKTIKEIIAEVDTDHDGRINYE  508

Query  374  EFVAMMRKGTPDLVT  330
            EF AMMRKG PDL+T
Sbjct  509  EFAAMMRKGNPDLIT  523



>gb|AGS15000.1| calcium-dependent protein kinase 3 [Vitis amurensis]
Length=528

 Score =   248 bits (634),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/135 (86%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTITYEELK GL K+GTKLSESEVRQLMEAADVDGNGTIDY+EFI+ATMHMNR
Sbjct  389  SMDTDNSGTITYEELKNGLPKLGTKLSESEVRQLMEAADVDGNGTIDYIEFISATMHMNR  448

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +EREDHLY+AFEYFDKDKSGYITMEELEH+LK+YN+ DEKTIKEIIAEVDTD+DG+INY+
Sbjct  449  MEREDHLYRAFEYFDKDKSGYITMEELEHALKRYNMGDEKTIKEIIAEVDTDHDGRINYE  508

Query  374  EFVAMMRKGTPDLVT  330
            EF AMMRKG PDL+T
Sbjct  509  EFAAMMRKGNPDLIT  523



>ref|XP_003525360.1| PREDICTED: calcium-dependent protein kinase 3-like isoform 1 
[Glycine max]
Length=518

 Score =   248 bits (633),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT+EELKAGL K+GTKLSESEVRQLMEAADVDGNGTIDY+EFITATMHMNR
Sbjct  377  SMDTDNSGTITFEELKAGLPKLGTKLSESEVRQLMEAADVDGNGTIDYIEFITATMHMNR  436

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +EREDHLYKAFEYFD DKSGYITMEELE +LKKYN+ DEKTIKEIIAEVDTDNDG+INYD
Sbjct  437  MEREDHLYKAFEYFDNDKSGYITMEELESALKKYNMGDEKTIKEIIAEVDTDNDGRINYD  496

Query  374  EFVAMMRKGTPDL  336
            EFVAMMRKG PD+
Sbjct  497  EFVAMMRKGNPDI  509



>ref|XP_003538256.1| PREDICTED: calcium-dependent protein kinase 3-like isoform 1 
[Glycine max]
Length=505

 Score =   248 bits (632),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/134 (87%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT+EELKAGL K+GTK+SESEVRQLMEAADVDGNGTIDY+EFITATMHMNR
Sbjct  366  SMDTDNSGTITFEELKAGLPKLGTKVSESEVRQLMEAADVDGNGTIDYIEFITATMHMNR  425

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +EREDHLYKAFEYFDKD+SGYIT+EELE +LKKYN+ DEKTIKEIIAEVD DNDG+INYD
Sbjct  426  MEREDHLYKAFEYFDKDRSGYITVEELESALKKYNMGDEKTIKEIIAEVDADNDGRINYD  485

Query  374  EFVAMMRKGTPDLV  333
            EFVAMMRKG PDLV
Sbjct  486  EFVAMMRKGNPDLV  499



>ref|XP_009334485.1| PREDICTED: calcium-dependent protein kinase 3 [Pyrus x bretschneideri]
Length=525

 Score =   247 bits (631),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 118/135 (87%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTITYEELKAGL K+GTKLSESEVRQLMEAADVDGNGTIDY+EFITATMHMNR
Sbjct  386  SMDTDNSGTITYEELKAGLPKLGTKLSESEVRQLMEAADVDGNGTIDYIEFITATMHMNR  445

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +EREDHLY AFEYFDKDKSGYIT+EELE +LKKYN+ DEKTIKEIIAEVDTD DG+INYD
Sbjct  446  MEREDHLYTAFEYFDKDKSGYITVEELEQALKKYNMGDEKTIKEIIAEVDTDRDGRINYD  505

Query  374  EFVAMMRKGTPDLVT  330
            EF AMMRKG P+LVT
Sbjct  506  EFAAMMRKGNPELVT  520



>ref|XP_002509886.1| calcium-dependent protein kinase, putative [Ricinus communis]
 gb|EEF51273.1| calcium-dependent protein kinase, putative [Ricinus communis]
Length=528

 Score =   247 bits (630),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 116/135 (86%), Positives = 131/135 (97%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD++GTITYEELKAGL K+GTKLSESEV+QLMEAADVDGNGTIDY+EFITATMHMNR
Sbjct  389  SMDTDNNGTITYEELKAGLPKLGTKLSESEVKQLMEAADVDGNGTIDYIEFITATMHMNR  448

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +EREDHLYKAFEYFDKDKSGYITMEELEH+LK+YN+ D +TIKEIIAEVDTD+DG+INY+
Sbjct  449  MEREDHLYKAFEYFDKDKSGYITMEELEHALKEYNMGDARTIKEIIAEVDTDHDGRINYE  508

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMMRKG P+LVT
Sbjct  509  EFVAMMRKGNPELVT  523



>ref|XP_007160124.1| hypothetical protein PHAVU_002G294500g [Phaseolus vulgaris]
 gb|ESW32118.1| hypothetical protein PHAVU_002G294500g [Phaseolus vulgaris]
Length=519

 Score =   245 bits (626),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT+EELKAGL K+G+KLSESEVRQLM+AADVDGNGTIDY+EFITATMHMNR
Sbjct  378  SMDTDNSGTITFEELKAGLPKLGSKLSESEVRQLMDAADVDGNGTIDYIEFITATMHMNR  437

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +EREDHLYKAFEYFD D+SGYITMEELE +LKKYN+ DEKTIKEIIAEVDTDNDG+INYD
Sbjct  438  MEREDHLYKAFEYFDNDRSGYITMEELESALKKYNMGDEKTIKEIIAEVDTDNDGRINYD  497

Query  374  EFVAMMRKGTPDL  336
            EFVAMMRKG PD+
Sbjct  498  EFVAMMRKGNPDI  510



>ref|XP_006439443.1| hypothetical protein CICLE_v10019724mg [Citrus clementina]
 gb|ESR52683.1| hypothetical protein CICLE_v10019724mg [Citrus clementina]
Length=520

 Score =   245 bits (626),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/134 (86%), Positives = 127/134 (95%), Gaps = 0/134 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT+EELKAGL K+GT+LSESEVRQLMEAADVDGNGTIDY+EFITATMHMNR
Sbjct  381  SMDTDNSGTITFEELKAGLPKLGTRLSESEVRQLMEAADVDGNGTIDYIEFITATMHMNR  440

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            VERE+HLYKAFEYFDKD SGYITMEELEH+LKKYN+ D KTIKEIIAEVD DNDG+INY+
Sbjct  441  VEREEHLYKAFEYFDKDNSGYITMEELEHALKKYNMGDAKTIKEIIAEVDIDNDGRINYE  500

Query  374  EFVAMMRKGTPDLV  333
            EF AMMRKG PD+V
Sbjct  501  EFAAMMRKGNPDMV  514



>gb|KDO76376.1| hypothetical protein CISIN_1g010013mg [Citrus sinensis]
Length=520

 Score =   245 bits (626),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/134 (86%), Positives = 127/134 (95%), Gaps = 0/134 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT+EELKAGL K+GT+LSESEVRQLMEAADVDGNGTIDY+EFITATMHMNR
Sbjct  381  SMDTDNSGTITFEELKAGLPKLGTRLSESEVRQLMEAADVDGNGTIDYIEFITATMHMNR  440

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            VERE+HLYKAFEYFDKD SGYITMEELEH+LKKYN+ D KTIKEIIAEVD DNDG+INY+
Sbjct  441  VEREEHLYKAFEYFDKDNSGYITMEELEHALKKYNMGDAKTIKEIIAEVDIDNDGRINYE  500

Query  374  EFVAMMRKGTPDLV  333
            EF AMMRKG PD+V
Sbjct  501  EFAAMMRKGNPDMV  514



>ref|XP_006476469.1| PREDICTED: calcium-dependent protein kinase 3-like [Citrus sinensis]
Length=520

 Score =   245 bits (626),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/134 (86%), Positives = 127/134 (95%), Gaps = 0/134 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT+EELKAGL K+GT+LSESEVRQLMEAADVDGNGTIDY+EFITATMHMNR
Sbjct  381  SMDTDNSGTITFEELKAGLPKLGTRLSESEVRQLMEAADVDGNGTIDYIEFITATMHMNR  440

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            VERE+HLYKAFEYFDKD SGYITMEELEH+LKKYN+ D KTIKEIIAEVD DNDG+INY+
Sbjct  441  VEREEHLYKAFEYFDKDNSGYITMEELEHALKKYNMGDAKTIKEIIAEVDIDNDGRINYE  500

Query  374  EFVAMMRKGTPDLV  333
            EF AMMRKG PD+V
Sbjct  501  EFAAMMRKGNPDMV  514



>ref|XP_007040387.1| Calcium-dependent protein kinase 6 isoform 1 [Theobroma cacao]
 gb|EOY24888.1| Calcium-dependent protein kinase 6 isoform 1 [Theobroma cacao]
Length=531

 Score =   245 bits (626),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 127/134 (95%), Gaps = 0/134 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTITYEELKAGL K+GTKLSESEVRQLMEAADVDGNGTIDY+EFITATMHMNR
Sbjct  392  SMDTDNSGTITYEELKAGLPKLGTKLSESEVRQLMEAADVDGNGTIDYIEFITATMHMNR  451

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +ERE+HLY AF+YFDKD SGYITMEELE +L+KYN+ DEKTIKEIIAEVDTD DG+INYD
Sbjct  452  MEREEHLYTAFQYFDKDNSGYITMEELEQALRKYNMGDEKTIKEIIAEVDTDRDGRINYD  511

Query  374  EFVAMMRKGTPDLV  333
            EFVAMMRKG PDLV
Sbjct  512  EFVAMMRKGNPDLV  525



>ref|XP_010676387.1| PREDICTED: calcium-dependent protein kinase 3 [Beta vulgaris 
subsp. vulgaris]
Length=526

 Score =   245 bits (625),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/135 (85%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT+EELKAGL K+GTKLSESEVRQLMEAADVDGNGTIDY+EFITATMHMNR
Sbjct  387  SMDTDNSGTITFEELKAGLPKLGTKLSESEVRQLMEAADVDGNGTIDYMEFITATMHMNR  446

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +E+EDHLYKAFEYFD+DKSGYIT EELE +LKKYN+ DEKTI+EIIAEVDTDNDG+INYD
Sbjct  447  MEKEDHLYKAFEYFDEDKSGYITTEELEQALKKYNMGDEKTIREIIAEVDTDNDGRINYD  506

Query  374  EFVAMMRKGTPDLVT  330
            EF AMM+KG PDLV+
Sbjct  507  EFAAMMKKGNPDLVS  521



>ref|XP_007209903.1| hypothetical protein PRUPE_ppa004162mg [Prunus persica]
 gb|EMJ11102.1| hypothetical protein PRUPE_ppa004162mg [Prunus persica]
Length=526

 Score =   244 bits (623),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 117/135 (87%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT+EELKAGL K+GTKLSESEVRQLMEAADVDGNGTIDY+EFITATMHMNR
Sbjct  387  SMDTDNSGTITFEELKAGLPKLGTKLSESEVRQLMEAADVDGNGTIDYIEFITATMHMNR  446

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +EREDHLYKAFEYFDKDKSGYIT+EELE +LKKYN+ DEKTIKEII EVDTD DG+INYD
Sbjct  447  MEREDHLYKAFEYFDKDKSGYITVEELEQALKKYNMGDEKTIKEIIVEVDTDLDGRINYD  506

Query  374  EFVAMMRKGTPDLVT  330
            EF AMMRKG P+LVT
Sbjct  507  EFAAMMRKGDPELVT  521



>gb|KGN53365.1| hypothetical protein Csa_4G050200 [Cucumis sativus]
Length=527

 Score =   244 bits (622),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 117/135 (87%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT+EELKAGL K+GTKLSESEVRQLMEAADVDGNG+IDY+EFITATMHMNR
Sbjct  388  SMDTDNSGTITFEELKAGLPKLGTKLSESEVRQLMEAADVDGNGSIDYIEFITATMHMNR  447

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            VEREDHL+KAFEYFDKDKSGYITMEELE +LKKYN+ DE TIKEIIAEVDTDNDG+INYD
Sbjct  448  VEREDHLFKAFEYFDKDKSGYITMEELETALKKYNMGDETTIKEIIAEVDTDNDGRINYD  507

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMMRKG  +L T
Sbjct  508  EFVAMMRKGNQELTT  522



>ref|XP_004298849.1| PREDICTED: calcium-dependent protein kinase 3 [Fragaria vesca 
subsp. vesca]
Length=519

 Score =   243 bits (620),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 116/135 (86%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT+EELKAGL K+GTKLSESEVRQLMEAADVDGNGTIDY+EFITATMHMNR
Sbjct  380  SMDTDNSGTITFEELKAGLPKLGTKLSESEVRQLMEAADVDGNGTIDYIEFITATMHMNR  439

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            ++REDHLY AFEYFDKDKSGYITMEELE +LKKYN+ DE+TIKEII EVDTD DG+INYD
Sbjct  440  MDREDHLYTAFEYFDKDKSGYITMEELEQALKKYNMGDEQTIKEIITEVDTDLDGRINYD  499

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMMRKG P+LVT
Sbjct  500  EFVAMMRKGNPELVT  514



>ref|XP_007158545.1| hypothetical protein PHAVU_002G161200g [Phaseolus vulgaris]
 gb|ESW30539.1| hypothetical protein PHAVU_002G161200g [Phaseolus vulgaris]
Length=502

 Score =   243 bits (619),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 117/135 (87%), Positives = 129/135 (96%), Gaps = 1/135 (1%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD++GTIT+EELKAGL K+GTK+SESEV QLMEAADVDGNGTIDY+EFITATMHMNR
Sbjct  365  SMDTDNNGTITFEELKAGLPKLGTKISESEVSQLMEAADVDGNGTIDYIEFITATMHMNR  424

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +EREDHLYKAFEYFDKD+SGYITMEELE +LKKYN+ DEK IKEIIAEVDTDNDG+INYD
Sbjct  425  MEREDHLYKAFEYFDKDRSGYITMEELESALKKYNMGDEK-IKEIIAEVDTDNDGRINYD  483

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMMRKG PDLVT
Sbjct  484  EFVAMMRKGNPDLVT  498



>gb|KJB52214.1| hypothetical protein B456_008G251000 [Gossypium raimondii]
Length=374

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT+EELKAGL K+GTKLSE EVRQLMEAADVDGNG IDY+EFITATMHMNR
Sbjct  235  SMDTDNSGTITFEELKAGLPKLGTKLSEHEVRQLMEAADVDGNGAIDYIEFITATMHMNR  294

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +EREDHLY AF+YFDKD SGYITMEELE +LKKYN+ DEKTIKEIIAEVDTD DG+INYD
Sbjct  295  MEREDHLYTAFQYFDKDNSGYITMEELEQALKKYNMGDEKTIKEIIAEVDTDRDGRINYD  354

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMMRKG P+L  
Sbjct  355  EFVAMMRKGNPELAN  369



>ref|XP_002298000.1| calcium-dependent protein kinase 1 [Populus trichocarpa]
 gb|EEE82805.1| calcium-dependent protein kinase 1 [Populus trichocarpa]
Length=515

 Score =   242 bits (618),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/135 (84%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD++GTIT+EELKAGL K+GTKLSESEVRQLMEAADVDGNGTIDY+EFITATMHMNR
Sbjct  376  SMDTDNNGTITFEELKAGLPKLGTKLSESEVRQLMEAADVDGNGTIDYIEFITATMHMNR  435

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +EREDHLYKAFEYFDKDKSGYITMEELE +L KYN+ D KTIKEIIAEVDTD+DG+INY+
Sbjct  436  MEREDHLYKAFEYFDKDKSGYITMEELEQALMKYNMGDSKTIKEIIAEVDTDHDGRINYE  495

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMMRKG P+L +
Sbjct  496  EFVAMMRKGNPELAS  510



>ref|XP_010261434.1| PREDICTED: calcium-dependent protein kinase 3-like [Nelumbo nucifera]
Length=531

 Score =   243 bits (619),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/135 (85%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT+EELKAGL K+G+KLSESEVRQLMEAADVDGNGTIDY+EFITATMHMNR
Sbjct  392  SMDTDNSGTITFEELKAGLPKLGSKLSESEVRQLMEAADVDGNGTIDYIEFITATMHMNR  451

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +E+E+HLYKAFEYFDKDKSGYITMEELE +L KYN+ D KTIKEIIAEVDTD+DGKINYD
Sbjct  452  MEKEEHLYKAFEYFDKDKSGYITMEELEQALTKYNMGDMKTIKEIIAEVDTDHDGKINYD  511

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMM+KG P+LVT
Sbjct  512  EFVAMMKKGNPELVT  526



>ref|XP_011026960.1| PREDICTED: calcium-dependent protein kinase 3 [Populus euphratica]
Length=515

 Score =   242 bits (617),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 114/135 (84%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD++GTIT+EELKAGL K+GTKLSESEVRQLMEAADVDGNGTIDY+EFITATMHMNR
Sbjct  376  SMDTDNNGTITFEELKAGLPKLGTKLSESEVRQLMEAADVDGNGTIDYIEFITATMHMNR  435

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +EREDHLYKAFEYFDKDKSGYITMEELE +L KYN+ D KTIKEIIAEVDTD+DG+INY+
Sbjct  436  MEREDHLYKAFEYFDKDKSGYITMEELEQALMKYNMGDSKTIKEIIAEVDTDHDGRINYE  495

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMMRKG P+L +
Sbjct  496  EFVAMMRKGNPELAS  510



>emb|CAC83060.1| calcium dependent calmodulin independent protein kinase [Cucumis 
sativus]
Length=413

 Score =   238 bits (608),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 115/135 (85%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT+EELKAGL K+GTKLSESEVRQLMEAADVDGNG+IDY+EFITA MHMNR
Sbjct  274  SMDTDNSGTITFEELKAGLPKLGTKLSESEVRQLMEAADVDGNGSIDYIEFITAAMHMNR  333

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            VEREDHL+KAFEYFDKDKSGYITMEELE +LKKYN+ DE TIKEIIAEVDTDNDG+INYD
Sbjct  334  VEREDHLFKAFEYFDKDKSGYITMEELETALKKYNMGDETTIKEIIAEVDTDNDGRINYD  393

Query  374  EFVAMMRKGTPDLVT  330
            E VAMMRKG  +L T
Sbjct  394  EVVAMMRKGNQELTT  408



>ref|XP_004503656.1| PREDICTED: calcium-dependent protein kinase 3-like [Cicer arietinum]
Length=511

 Score =   241 bits (614),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT+EELKAGL K+G+K+SESEVRQLMEAADVDGNGTIDY+EFITATMHMNR
Sbjct  373  SMDTDNSGTITFEELKAGLPKLGSKMSESEVRQLMEAADVDGNGTIDYIEFITATMHMNR  432

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +EREDHLYKAFEYFD+DKSG+IT EELE +LKKYN+ DEKTIKEIIAEVDTDND +INYD
Sbjct  433  MEREDHLYKAFEYFDQDKSGFITKEELESALKKYNMGDEKTIKEIIAEVDTDNDARINYD  492

Query  374  EFVAMMRKGTPDL  336
            EFVAMMRKG PD+
Sbjct  493  EFVAMMRKGNPDI  505



>ref|XP_010106587.1| Calcium-dependent protein kinase 3 [Morus notabilis]
 gb|EXC10841.1| Calcium-dependent protein kinase 3 [Morus notabilis]
Length=639

 Score =   244 bits (622),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 115/135 (85%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTITYEELKAGL K+GTK+SESEVRQLMEAADVDGNGTIDY+EFITATMH+NR
Sbjct  500  SMDTDNSGTITYEELKAGLPKLGTKISESEVRQLMEAADVDGNGTIDYIEFITATMHLNR  559

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +ERE+HLY AFEYFDKDKSGYITMEELE +L KYNI DEKTIKEIIAEVDTD DG+INY+
Sbjct  560  MEREEHLYTAFEYFDKDKSGYITMEELEQALIKYNIGDEKTIKEIIAEVDTDRDGRINYE  619

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMMRKG PD+V 
Sbjct  620  EFVAMMRKGNPDMVP  634



>ref|XP_002304529.2| hypothetical protein POPTR_0003s13380g [Populus trichocarpa]
 gb|EEE79508.2| hypothetical protein POPTR_0003s13380g [Populus trichocarpa]
Length=523

 Score =   241 bits (614),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 114/135 (84%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD++GTIT+EELKAGL K+GTKLSESEVRQLMEAADVDGNGTIDY+EFITATMHMNR
Sbjct  384  SMDTDNNGTITFEELKAGLPKLGTKLSESEVRQLMEAADVDGNGTIDYIEFITATMHMNR  443

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +EREDHLYKAFEYFDKDKSGYITMEELE +L KYN+ D KTIKEIIAEVDTD+DG+INY+
Sbjct  444  MEREDHLYKAFEYFDKDKSGYITMEELEQALVKYNMGDTKTIKEIIAEVDTDHDGRINYE  503

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMMRKG P+L  
Sbjct  504  EFVAMMRKGNPELAP  518



>ref|XP_011022588.1| PREDICTED: calcium-dependent protein kinase 3-like [Populus euphratica]
 ref|XP_011022589.1| PREDICTED: calcium-dependent protein kinase 3-like [Populus euphratica]
 ref|XP_011022590.1| PREDICTED: calcium-dependent protein kinase 3-like [Populus euphratica]
Length=517

 Score =   240 bits (613),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 114/135 (84%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD++GTIT+EELKAGL K+GTKLSESEVRQLMEAADVDGNGTIDY+EFITATMHMNR
Sbjct  378  SMDTDNNGTITFEELKAGLPKLGTKLSESEVRQLMEAADVDGNGTIDYIEFITATMHMNR  437

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +EREDHLYKAFEYFDKDKSGYITMEELE +L KYN+ D KTIKEIIAEVDTD+DG+INY+
Sbjct  438  MEREDHLYKAFEYFDKDKSGYITMEELEQALMKYNMGDTKTIKEIIAEVDTDHDGRINYE  497

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMMRKG P+L  
Sbjct  498  EFVAMMRKGNPELAP  512



>gb|KHG11508.1| Calcium-dependent protein kinase 3 [Gossypium arboreum]
Length=534

 Score =   241 bits (614),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT+EELKAGL K+GTKLSE+EVRQLMEAADVDGNG IDY+EFITATMHMNR
Sbjct  395  SMDTDNSGTITFEELKAGLPKLGTKLSENEVRQLMEAADVDGNGAIDYIEFITATMHMNR  454

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +EREDHLY AF+YFDKD SGYITMEELE +LKKYN+ DEKTIKEIIAEVDTD DG+INYD
Sbjct  455  MEREDHLYTAFQYFDKDNSGYITMEELEQALKKYNMGDEKTIKEIIAEVDTDRDGRINYD  514

Query  374  EFVAMMRKGTPDLV  333
            EFVAMMRKG P+L 
Sbjct  515  EFVAMMRKGNPELA  528



>ref|XP_010251583.1| PREDICTED: calcium-dependent protein kinase 3-like [Nelumbo nucifera]
Length=522

 Score =   240 bits (613),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT+EELK GL K+GTK+SESEV+QLMEAADVDGNGTIDY+EFITATMHMNR
Sbjct  383  SMDTDNSGTITFEELKVGLPKLGTKVSESEVKQLMEAADVDGNGTIDYIEFITATMHMNR  442

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +E+E+HLYKAFEYFDKDKSGYITMEELE +LKKYN+ D KTIKEIIAEVDTD+DG+INYD
Sbjct  443  MEKEEHLYKAFEYFDKDKSGYITMEELEQALKKYNMGDTKTIKEIIAEVDTDHDGRINYD  502

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMMRKG P+L T
Sbjct  503  EFVAMMRKGNPELTT  517



>ref|XP_003611046.1| Calcium dependent protein kinase [Medicago truncatula]
 gb|AES94004.1| calmodulin-domain kinase CDPK protein [Medicago truncatula]
Length=517

 Score =   240 bits (612),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT+EELKAGL K+GTK+SESEVRQLMEAADVDGNGTIDY+EFITATMH+NR
Sbjct  378  SMDTDNSGTITFEELKAGLPKLGTKISESEVRQLMEAADVDGNGTIDYIEFITATMHLNR  437

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +EREDHLYKAFEYFD DKSGYIT EELE +L KYN+ DEKTIKEII EVD+DNDG+INY+
Sbjct  438  MEREDHLYKAFEYFDNDKSGYITKEELESALTKYNMGDEKTIKEIIDEVDSDNDGRINYE  497

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMMRKG PDL+T
Sbjct  498  EFVAMMRKGNPDLIT  512



>gb|KEH21166.1| calmodulin-domain kinase CDPK protein [Medicago truncatula]
Length=516

 Score =   240 bits (612),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT+EELKAGL K+G+K+SESEVRQLMEAADVDGNGTIDY+EFITATMHMNR
Sbjct  378  SMDTDNSGTITFEELKAGLPKLGSKMSESEVRQLMEAADVDGNGTIDYIEFITATMHMNR  437

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +EREDHLYKAFEYFD+DKSGYIT EELE +LKKYN+ DE TIKEIIAEVDTDND +INYD
Sbjct  438  MEREDHLYKAFEYFDQDKSGYITKEELESALKKYNMGDENTIKEIIAEVDTDNDARINYD  497

Query  374  EFVAMMRKGTPDL  336
            EFVAMMRKG PD+
Sbjct  498  EFVAMMRKGNPDI  510



>gb|KJB52213.1| hypothetical protein B456_008G251000 [Gossypium raimondii]
Length=534

 Score =   240 bits (612),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT+EELKAGL K+GTKLSE EVRQLMEAADVDGNG IDY+EFITATMHMNR
Sbjct  395  SMDTDNSGTITFEELKAGLPKLGTKLSEHEVRQLMEAADVDGNGAIDYIEFITATMHMNR  454

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +EREDHLY AF+YFDKD SGYITMEELE +LKKYN+ DEKTIKEIIAEVDTD DG+INYD
Sbjct  455  MEREDHLYTAFQYFDKDNSGYITMEELEQALKKYNMGDEKTIKEIIAEVDTDRDGRINYD  514

Query  374  EFVAMMRKGTPDLV  333
            EFVAMMRKG P+L 
Sbjct  515  EFVAMMRKGNPELA  528



>ref|NP_001267714.1| calcium-dependent protein kinase 3-like [Cucumis sativus]
 emb|CAC44471.1| calcium dependent calmodulin independent protein kinase [Cucumis 
sativus]
 gb|AAK26164.2| calcium-dependent calmodulin-independent protein kinase 5 [Cucumis 
sativus]
Length=514

 Score =   239 bits (609),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 115/135 (85%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT+EELKAGL K+GTKLSESEVRQLMEAADVDGNG+IDY+EFITA MHMNR
Sbjct  375  SMDTDNSGTITFEELKAGLPKLGTKLSESEVRQLMEAADVDGNGSIDYIEFITAAMHMNR  434

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            VEREDHL+KAFEYFDKDKSGYITMEELE +LKKYN+ DE TIKEIIAEVDTDNDG+INYD
Sbjct  435  VEREDHLFKAFEYFDKDKSGYITMEELETALKKYNMGDETTIKEIIAEVDTDNDGRINYD  494

Query  374  EFVAMMRKGTPDLVT  330
            E VAMMRKG  +L T
Sbjct  495  EVVAMMRKGNQELTT  509



>ref|XP_004511540.1| PREDICTED: calcium-dependent protein kinase 3-like [Cicer arietinum]
Length=509

 Score =   238 bits (606),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+S TIT+EELK GL+K+GTK+SESEVRQLMEAADVDGNGTIDY+EFITATMH+NR
Sbjct  370  SMDTDNSRTITFEELKDGLSKLGTKISESEVRQLMEAADVDGNGTIDYIEFITATMHLNR  429

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +ERE+HLYKAFEYFD DKSGYIT EELE +LKKYN+ DEKTIKEIIAEVD+DNDG+INY+
Sbjct  430  MERENHLYKAFEYFDNDKSGYITKEELESALKKYNMGDEKTIKEIIAEVDSDNDGRINYE  489

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMMRKG PDLVT
Sbjct  490  EFVAMMRKGNPDLVT  504



>ref|XP_008792394.1| PREDICTED: calcium-dependent protein kinase 3-like [Phoenix dactylifera]
Length=531

 Score =   236 bits (602),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT+EELKAGL K+GTK+SESEVRQLMEAADVDGNG IDY+EFITATMHMNR
Sbjct  392  SMDTDNSGTITFEELKAGLPKLGTKISESEVRQLMEAADVDGNGAIDYIEFITATMHMNR  451

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            VE+EDHLYKAFEYFDKDKSGYIT+EELE +L+KYN+ D+KTIKEIIAEVDTD+DGKINY+
Sbjct  452  VEKEDHLYKAFEYFDKDKSGYITVEELEQALRKYNMGDDKTIKEIIAEVDTDHDGKINYE  511

Query  374  EFVAMMRKGTPDLVT  330
            EF AMMRK +P +V 
Sbjct  512  EFAAMMRKDSPAIVP  526



>ref|XP_010924783.1| PREDICTED: calcium-dependent protein kinase 3-like isoform X2 
[Elaeis guineensis]
Length=527

 Score =   235 bits (600),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT+EELKAGL K+GTK+SESEVRQLMEAADVDGNGTIDY+EFI+ATMHMNR
Sbjct  388  SMDTDNSGTITFEELKAGLPKLGTKISESEVRQLMEAADVDGNGTIDYIEFISATMHMNR  447

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +E+EDHLYKAFEYFDKDKSGYIT+EELE +L+KYN+ D+KTIKEIIAEVDTD+DG+INY+
Sbjct  448  MEKEDHLYKAFEYFDKDKSGYITVEELEQALRKYNMGDDKTIKEIIAEVDTDHDGRINYE  507

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMMR+ +P +V 
Sbjct  508  EFVAMMRQDSPAMVA  522



>ref|XP_006849377.1| PREDICTED: calcium-dependent protein kinase 3 [Amborella trichopoda]
 gb|ERN10958.1| hypothetical protein AMTR_s00158p00082100 [Amborella trichopoda]
Length=538

 Score =   233 bits (595),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT+EELKAGL K+GT++SESEVRQLMEAADVDGNGTIDY+EFITATMH+NR
Sbjct  390  SMDTDNSGTITFEELKAGLPKLGTRISESEVRQLMEAADVDGNGTIDYIEFITATMHLNR  449

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +E+EDHLY AFEYFDKDKSGYITMEELE +LKKYN+ DEKTI EIIAEVDTD DG+INYD
Sbjct  450  MEKEDHLYTAFEYFDKDKSGYITMEELEQALKKYNMGDEKTINEIIAEVDTDRDGRINYD  509

Query  374  EFVAMMRKGTPDLVT  330
            EFV MMRKG  D+  
Sbjct  510  EFVTMMRKGNQDMAA  524



>gb|KHG03431.1| Calcium-dependent protein kinase 3 [Gossypium arboreum]
Length=604

 Score =   233 bits (594),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTI++EELK GL K+GTKLSESEVRQLMEAAD DGNG IDY+EFITATMHMNR
Sbjct  380  SMDTDNSGTISFEELKTGLPKLGTKLSESEVRQLMEAADFDGNGAIDYIEFITATMHMNR  439

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
             ERE+HLY AF+YFD+D SG+ITMEELE +L+KYN+ DEKTIKEIIAEVDTD DG+INYD
Sbjct  440  TEREEHLYTAFQYFDEDNSGFITMEELEQALRKYNMGDEKTIKEIIAEVDTDRDGRINYD  499

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMMRKG P+LV 
Sbjct  500  EFVAMMRKGNPELVA  514



>ref|XP_010924782.1| PREDICTED: calcium-dependent protein kinase 3-like isoform X1 
[Elaeis guineensis]
Length=531

 Score =   229 bits (585),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/139 (78%), Positives = 129/139 (93%), Gaps = 4/139 (3%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT+EELKAGL K+GTK+SESEVRQLMEAADVDGNGTIDY+EFI+ATMHMNR
Sbjct  388  SMDTDNSGTITFEELKAGLPKLGTKISESEVRQLMEAADVDGNGTIDYIEFISATMHMNR  447

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDN----DGK  387
            +E+EDHLYKAFEYFDKDKSGYIT+EELE +L+KYN+ D+KTIKEIIAEVDTD+    DG+
Sbjct  448  MEKEDHLYKAFEYFDKDKSGYITVEELEQALRKYNMGDDKTIKEIIAEVDTDHLMLQDGR  507

Query  386  INYDEFVAMMRKGTPDLVT  330
            INY+EFVAMMR+ +P +V 
Sbjct  508  INYEEFVAMMRQDSPAMVA  526



>ref|XP_009406794.1| PREDICTED: calcium-dependent protein kinase 3-like [Musa acuminata 
subsp. malaccensis]
Length=461

 Score =   227 bits (579),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 125/137 (91%), Gaps = 3/137 (2%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGT---KLSESEVRQLMEAADVDGNGTIDYLEFITATMH  564
            SIDTD+SGTIT+EELKAGL K+G    K+SESEVRQLMEAADVDGNG+IDY+EFITATMH
Sbjct  319  SIDTDNSGTITFEELKAGLPKLGNLGIKISESEVRQLMEAADVDGNGSIDYIEFITATMH  378

Query  563  MNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKI  384
            MNRVEREDHLYKAFEYFD+DKSGYIT+EELE +LKKYN+ DEKTIKEIIAEVDTD DG+I
Sbjct  379  MNRVEREDHLYKAFEYFDEDKSGYITVEELEQALKKYNMGDEKTIKEIIAEVDTDKDGRI  438

Query  383  NYDEFVAMMRKGTPDLV  333
            NYDEFV MMRK + + +
Sbjct  439  NYDEFVTMMRKDSSEAI  455



>gb|KJB19075.1| hypothetical protein B456_003G084000 [Gossypium raimondii]
Length=508

 Score =   227 bits (578),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+ TD+SGTI +EELK GL K+GTKLSESEVRQLM AAD DGNG IDY+EFITATMHMNR
Sbjct  369  SMGTDNSGTICFEELKTGLPKLGTKLSESEVRQLMGAADFDGNGAIDYIEFITATMHMNR  428

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
             EREDH Y AF+YFD+D SG+ITMEELE +L+KYN+ DEKTIKEIIAEVDTD DG+INYD
Sbjct  429  TEREDHFYTAFQYFDEDNSGFITMEELEQALRKYNMGDEKTIKEIIAEVDTDRDGRINYD  488

Query  374  EFVAMMRKGTPDLV  333
            EFVAMMRKG P+LV
Sbjct  489  EFVAMMRKGNPELV  502



>ref|XP_011080890.1| PREDICTED: calcium-dependent protein kinase 3 [Sesamum indicum]
Length=481

 Score =   226 bits (575),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTITYEELK  L K+GTK SES VRQL+EAADVDGNGTIDY+EFITATM+M+R
Sbjct  346  SLDTDNSGTITYEELKTALPKLGTKFSESVVRQLIEAADVDGNGTIDYIEFITATMNMSR  405

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            VERED L KAFEYFDKDKSGYITMEELEH+L +YN+ D KT+KEI+AEVDTD+DGKINYD
Sbjct  406  VEREDRLDKAFEYFDKDKSGYITMEELEHALNEYNMGDAKTMKEILAEVDTDHDGKINYD  465

Query  374  EFVAMMRKGTPDL  336
            EFVAMMRKG PDL
Sbjct  466  EFVAMMRKGNPDL  478



>gb|EYU23402.1| hypothetical protein MIMGU_mgv1a004683mg [Erythranthe guttata]
Length=515

 Score =   226 bits (577),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+D D++G IT+EELK G++K+ TK+SESEVRQLMEAADVDGNGTIDY+EFITATMHMNR
Sbjct  373  SMDADNNGMITFEELKTGVSKLNTKISESEVRQLMEAADVDGNGTIDYIEFITATMHMNR  432

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +ERED LYKAFEYFDKD SGYIT EELEH+LK+YNI D K IKEI+AEVD D+DGKINYD
Sbjct  433  MEREDRLYKAFEYFDKDSSGYITTEELEHALKEYNIGDAKIIKEILAEVDIDHDGKINYD  492

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMMRKG  DLVT
Sbjct  493  EFVAMMRKGNTDLVT  507



>emb|CDY10955.1| BnaA03g46140D [Brassica napus]
Length=376

 Score =   219 bits (559),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 99/135 (73%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            ++DTD +G +T EEL+ GL K+G K+SE+E++QLMEAAD+DG+G+IDYLEFI+ATMHMNR
Sbjct  235  ALDTDKNGIVTLEELRTGLPKLGNKISEAEIKQLMEAADMDGDGSIDYLEFISATMHMNR  294

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +EREDHLY AF+YFDKD SGYITMEELE ++KKYN+ D+K+IKEIIAEVDTD DGKINY+
Sbjct  295  IEREDHLYTAFQYFDKDNSGYITMEELEQAMKKYNMGDDKSIKEIIAEVDTDRDGKINYE  354

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMM+KG P+LVT
Sbjct  355  EFVAMMKKGNPELVT  369



>ref|XP_009137376.1| PREDICTED: calcium-dependent protein kinase 3 [Brassica rapa]
Length=376

 Score =   219 bits (558),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 99/135 (73%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            ++DTD +G +T EEL+ GL K+G K+SE+E++QLMEAAD+DG+G+IDYLEFI+ATMHMNR
Sbjct  235  ALDTDKNGIVTLEELRTGLPKLGNKISEAEIKQLMEAADMDGDGSIDYLEFISATMHMNR  294

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +EREDHLY AF+YFDKD SGYITMEELE ++KKYN+ D+K+IKEIIAEVDTD DGKINY+
Sbjct  295  IEREDHLYTAFQYFDKDNSGYITMEELEQAMKKYNMGDDKSIKEIIAEVDTDRDGKINYE  354

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMM+KG P+LVT
Sbjct  355  EFVAMMKKGNPELVT  369



>gb|AGF69185.1| calcium-dependent protein kinase 3-like 1, partial [Triticum 
aestivum]
Length=226

 Score =   214 bits (545),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT +EL+AGL+K+GTK++ESE+RQLMEA DVDG+GTIDY+EFI+ATMHMNR
Sbjct  86   SLDTDNSGTITLDELRAGLSKLGTKITESEIRQLMEAVDVDGDGTIDYVEFISATMHMNR  145

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +E+EDH++KAFEYFDKD SGYIT++ELE +LKKY++ DE TIK+IIAEVDTD+DGKINY 
Sbjct  146  LEKEDHIFKAFEYFDKDHSGYITVDELEEALKKYDMGDEATIKDIIAEVDTDHDGKINYQ  205

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMM+  +P++V 
Sbjct  206  EFVAMMKNNSPEIVP  220



>ref|XP_010541306.1| PREDICTED: calcium-dependent protein kinase 3 [Tarenaya hassleriana]
Length=521

 Score =   223 bits (567),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 128/137 (93%), Gaps = 2/137 (1%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+D+D+SGTIT EE++AGL K+G+K++E+E+RQLMEAADVDG+G+IDYLEFI+ATMHMNR
Sbjct  380  SLDSDNSGTITLEEMRAGLPKLGSKITEAEIRQLMEAADVDGDGSIDYLEFISATMHMNR  439

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNIT--DEKTIKEIIAEVDTDNDGKIN  381
            +EREDHLY AF+YFDKD SGYITMEELE ++KKYN+   ++K+IKEIIAEVDTD+DG+IN
Sbjct  440  IEREDHLYTAFQYFDKDNSGYITMEELEQAMKKYNVGGDEKKSIKEIIAEVDTDHDGRIN  499

Query  380  YDEFVAMMRKGTPDLVT  330
            Y+EFVAMM+KG PD+VT
Sbjct  500  YEEFVAMMKKGNPDMVT  516



>gb|AIU98501.1| calcium-dependent protein kinase [Musa acuminata AAA Group]
Length=521

 Score =   222 bits (566),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 120/131 (92%), Gaps = 3/131 (2%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGT---KLSESEVRQLMEAADVDGNGTIDYLEFITATMH  564
            SIDTD+SGTITYEELKAGL K+G    K+SESEVRQLMEAADVDGNG+IDY+EFITATMH
Sbjct  379  SIDTDNSGTITYEELKAGLPKLGNLGIKISESEVRQLMEAADVDGNGSIDYIEFITATMH  438

Query  563  MNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKI  384
            MNR+E+EDHLY+AFEYFD+DKSGYIT+EELE +LKKYN+ DEKTIKEII EVDTD DG+I
Sbjct  439  MNRMEKEDHLYRAFEYFDEDKSGYITVEELEQALKKYNMGDEKTIKEIITEVDTDRDGRI  498

Query  383  NYDEFVAMMRK  351
            NYDEF  MMRK
Sbjct  499  NYDEFATMMRK  509



>ref|XP_010529626.1| PREDICTED: calcium-dependent protein kinase 3-like [Tarenaya 
hassleriana]
Length=513

 Score =   222 bits (565),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/135 (75%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT EEL+ G+ K+G+K++E E+RQLMEAADVDG+G+IDYLEFI++TMHMNR
Sbjct  374  SLDTDNSGTITLEELRDGVPKLGSKITEEEIRQLMEAADVDGDGSIDYLEFISSTMHMNR  433

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +ERED LY AF+YFDKD SGYITMEELE +LKKYN+ DEK+IKEI+AEVDTD+DG+INY+
Sbjct  434  IEREDRLYTAFQYFDKDNSGYITMEELEQALKKYNMGDEKSIKEILAEVDTDHDGRINYE  493

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMM+KG PD+VT
Sbjct  494  EFVAMMKKGNPDMVT  508



>gb|KFK28919.1| hypothetical protein AALP_AA7G065000 [Arabis alpina]
Length=529

 Score =   222 bits (566),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD++G +T EE++ GL K+G+K+SE+E+RQLMEAAD+DG+G+IDYLEFI+ATMHMNR
Sbjct  388  SLDTDNNGIVTLEEMRTGLPKLGSKISEAEIRQLMEAADMDGDGSIDYLEFISATMHMNR  447

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +EREDHLY AF+YFDKD SGYITMEELE ++KKYN+ D+K+IKEIIAEVDTD DGKINY+
Sbjct  448  IEREDHLYTAFQYFDKDNSGYITMEELEQAMKKYNMGDDKSIKEIIAEVDTDRDGKINYE  507

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMM+KG P+LVT
Sbjct  508  EFVAMMKKGHPELVT  522



>ref|XP_010433881.1| PREDICTED: calcium-dependent protein kinase 3-like [Camelina 
sativa]
Length=528

 Score =   222 bits (565),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD++G +T EEL+ GL K+G+K+SE+E+RQLMEAAD+DG+G+IDYLEFI+ATMHMNR
Sbjct  388  SLDTDNNGIVTLEELRTGLPKLGSKISEAEIRQLMEAADMDGDGSIDYLEFISATMHMNR  447

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +EREDHLY AF+YFD D SGYITMEELE ++KKYN+ D+K+IKEIIAEVDTD DGKINY+
Sbjct  448  IEREDHLYTAFQYFDNDNSGYITMEELEQAMKKYNMGDDKSIKEIIAEVDTDRDGKINYE  507

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMM+KG P+LVT
Sbjct  508  EFVAMMKKGNPELVT  522



>ref|XP_010509303.1| PREDICTED: calcium-dependent protein kinase 3 [Camelina sativa]
Length=529

 Score =   221 bits (564),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD++G +T EEL+ GL K+G+K+SE+E+RQLMEAAD+DG+G+IDYLEFI+ATMHMNR
Sbjct  390  SLDTDNNGIVTLEELRTGLPKLGSKISEAEIRQLMEAADMDGDGSIDYLEFISATMHMNR  449

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +EREDHLY AF+YFD D SGYITMEELE ++KKYN+ D+K+IKEIIAEVDTD DGKINY+
Sbjct  450  IEREDHLYTAFQYFDNDNSGYITMEELEQAMKKYNMGDDKSIKEIIAEVDTDRDGKINYE  509

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMM+KG P+LVT
Sbjct  510  EFVAMMKKGNPELVT  524



>ref|XP_003567831.1| PREDICTED: calcium-dependent protein kinase 3-like [Brachypodium 
distachyon]
Length=548

 Score =   222 bits (565),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/135 (76%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT EEL+AGL K+GTK++ESE+RQLMEAADVDGNGTIDY+EFI+ATMHMNR
Sbjct  408  SLDTDNSGTITLEELRAGLPKLGTKITESEIRQLMEAADVDGNGTIDYVEFISATMHMNR  467

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +E+EDH++KAFEYFDKD SGYIT++ELE +LKKY++ DE TIKEIIAEVDTD+DGKINY 
Sbjct  468  LEKEDHIFKAFEYFDKDHSGYITVDELEEALKKYDMGDEATIKEIIAEVDTDHDGKINYQ  527

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMM+  +P++V 
Sbjct  528  EFVAMMKNNSPEIVP  542



>ref|XP_006283520.1| hypothetical protein CARUB_v10004572mg [Capsella rubella]
 gb|ACC91261.1| putative calcium-dependent protein kinase [Capsella rubella]
 gb|EOA16418.1| hypothetical protein CARUB_v10004572mg [Capsella rubella]
Length=529

 Score =   221 bits (563),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD++G +T EEL+ GL K+G K+SE+E+RQLMEAAD+DG+G+IDYLEFI+ATMHMNR
Sbjct  389  SLDTDNNGIVTLEELRTGLPKLGNKISEAEIRQLMEAADMDGDGSIDYLEFISATMHMNR  448

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +EREDHLY AF+YFD D SGYITMEELE ++KKYN+ D+K+IKEIIAEVDTD DGKINY+
Sbjct  449  IEREDHLYTAFQYFDNDNSGYITMEELEQAMKKYNMGDDKSIKEIIAEVDTDRDGKINYE  508

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMM+KG P+LVT
Sbjct  509  EFVAMMKKGNPELVT  523



>ref|XP_009416404.1| PREDICTED: calcium-dependent protein kinase 3-like [Musa acuminata 
subsp. malaccensis]
Length=519

 Score =   221 bits (562),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 120/131 (92%), Gaps = 3/131 (2%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGT---KLSESEVRQLMEAADVDGNGTIDYLEFITATMH  564
            SIDTD+SGTITYEELKAGL K+G    K+SESEVRQLMEAADVDGNG+IDY+EFITATMH
Sbjct  377  SIDTDNSGTITYEELKAGLPKLGNLGIKISESEVRQLMEAADVDGNGSIDYIEFITATMH  436

Query  563  MNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKI  384
            MNR+E+EDHLY+AFEYFD+DKSGYIT+EELE +LKKYN+ DEKTIKEII EVDTD DG+I
Sbjct  437  MNRMEKEDHLYRAFEYFDEDKSGYITVEELEQALKKYNMGDEKTIKEIITEVDTDRDGRI  496

Query  383  NYDEFVAMMRK  351
            NY+EF  MMRK
Sbjct  497  NYEEFATMMRK  507



>gb|AIU98505.1| calcium-dependent protein kinase [Musa acuminata AAA Group]
Length=517

 Score =   221 bits (562),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 120/131 (92%), Gaps = 3/131 (2%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGT---KLSESEVRQLMEAADVDGNGTIDYLEFITATMH  564
            S+DTD+SGTIT+EELKAGL K+G    K+SESE+RQLMEAADVDGNG+IDY+EFITATMH
Sbjct  374  SMDTDNSGTITFEELKAGLPKLGNLGIKISESEIRQLMEAADVDGNGSIDYIEFITATMH  433

Query  563  MNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKI  384
            MNR+EREDHLYKAFE FDKDKSGYIT+EELE +LKKYN+ DEKTIKEI+AEVD D DG+I
Sbjct  434  MNRMEREDHLYKAFECFDKDKSGYITVEELEQALKKYNMGDEKTIKEILAEVDIDKDGRI  493

Query  383  NYDEFVAMMRK  351
            NYDEFV MMRK
Sbjct  494  NYDEFVTMMRK  504



>tpg|DAA58513.1| TPA: putative calcium-dependent protein kinase family protein 
[Zea mays]
Length=302

 Score =   214 bits (546),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT EEL++GL K+GTK+SESE++QLMEAADVDGNGTIDY EFI+ATMH+NR
Sbjct  162  SLDTDNSGTITLEELRSGLPKLGTKISESEIKQLMEAADVDGNGTIDYAEFISATMHLNR  221

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +E+ED + KAFEYFDKD SGYIT++ELE +LKKY++ D+KTIKEIIAEVDTD+DG+INY 
Sbjct  222  LEKEDRILKAFEYFDKDHSGYITVDELEEALKKYDMGDDKTIKEIIAEVDTDHDGRINYQ  281

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMMR  TP++V 
Sbjct  282  EFVAMMRNNTPEIVP  296



>emb|CDY62741.1| BnaC07g50270D [Brassica napus]
Length=615

 Score =   221 bits (564),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            ++DTD +G +T EEL+ GL K+G K+SE+E+RQLMEAAD+DG+G+IDYLEFI+ATMHMNR
Sbjct  474  ALDTDKNGIVTLEELRTGLPKLGNKISEAEIRQLMEAADMDGDGSIDYLEFISATMHMNR  533

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +EREDHLY AF+YFDKD SGYITMEELE ++KKYN+ D+K+IKEIIAEVDTD DGKINY+
Sbjct  534  IEREDHLYTAFQYFDKDNSGYITMEELEQAMKKYNMGDDKSIKEIIAEVDTDRDGKINYE  593

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMM+KG P+LVT
Sbjct  594  EFVAMMKKGNPELVT  608



>ref|XP_008656081.1| PREDICTED: calcium-dependent protein kinase 3-like [Zea mays]
 gb|AFW81270.1| putative calcium-dependent protein kinase family protein isoform 
1 [Zea mays]
 gb|AFW81271.1| putative calcium-dependent protein kinase family protein isoform 
2 [Zea mays]
Length=539

 Score =   219 bits (559),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT EEL+AGL K+GTK+SESE+RQLMEAADVDGNGTIDY+EFI+ATMHMNR
Sbjct  399  SLDTDNSGTITLEELRAGLPKLGTKISESEIRQLMEAADVDGNGTIDYVEFISATMHMNR  458

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +E+EDH++KAFEYFDKD SG+IT++ELE +LKKY++ DE T+KEIIAEVDTD+DG+INY 
Sbjct  459  LEKEDHIFKAFEYFDKDHSGHITVDELEEALKKYDMGDEATVKEIIAEVDTDHDGRINYQ  518

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMM+  +P++V 
Sbjct  519  EFVAMMKNNSPEIVP  533



>ref|XP_009137374.1| PREDICTED: calcium-dependent protein kinase 3-like [Brassica 
rapa]
 ref|XP_009137377.1| PREDICTED: calcium-dependent protein kinase 3-like [Brassica 
rapa]
Length=532

 Score =   219 bits (559),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/135 (73%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            ++DTD +G +T EEL+ GL K+G K+SE+E++QLMEAAD+DG+G+IDYLEFI+ATMHMNR
Sbjct  391  ALDTDKNGIVTLEELRTGLPKLGNKISEAEIKQLMEAADMDGDGSIDYLEFISATMHMNR  450

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +EREDHLY AF+YFDKD SGYITMEELE ++KKYN+ D+K+IKEIIAEVDTD DGKINY+
Sbjct  451  IEREDHLYTAFQYFDKDNSGYITMEELEQAMKKYNMGDDKSIKEIIAEVDTDRDGKINYE  510

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMM+KG P+LVT
Sbjct  511  EFVAMMKKGNPELVT  525



>gb|EMT22025.1| Calcium-dependent protein kinase 3 [Aegilops tauschii]
Length=481

 Score =   218 bits (556),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT +EL+AGL K+GTK++ESE+RQLMEAADVDGNGTIDY+EFI+ATMHMNR
Sbjct  341  SLDTDNSGTITLDELRAGLPKLGTKITESEIRQLMEAADVDGNGTIDYVEFISATMHMNR  400

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +E+EDH++KAFEYFDKD SGYIT++ELE +LKKY++ DE TIK+IIAEVDTD+DGKINY 
Sbjct  401  LEKEDHIFKAFEYFDKDHSGYITVDELEEALKKYDMGDEATIKDIIAEVDTDHDGKINYQ  460

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMM+  +P++V 
Sbjct  461  EFVAMMKNNSPEIVP  475



>ref|XP_010439150.1| PREDICTED: calcium-dependent protein kinase 3-like [Camelina 
sativa]
Length=528

 Score =   219 bits (558),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/135 (73%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD++G +T EEL+ GL K+G+K+SE+E+RQLMEAAD+DG+G+IDYLEFI+ATMHMNR
Sbjct  388  SLDTDNNGIVTLEELRTGLPKLGSKISEAEIRQLMEAADMDGDGSIDYLEFISATMHMNR  447

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +EREDHLY AF+YFD D SGYITMEELE ++ KYN+ D+K+IKEIIAEVDTD DGKINY+
Sbjct  448  IEREDHLYTAFQYFDNDNSGYITMEELEQAMTKYNMGDDKSIKEIIAEVDTDRDGKINYE  507

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMM+KG P+LVT
Sbjct  508  EFVAMMKKGNPELVT  522



>gb|AGG35973.1| calcium-dependent protein kinase 3, partial [Brassica napus]
Length=525

 Score =   219 bits (558),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/135 (73%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            ++DTD +G +T EEL+ GL K+G+K+SE+E++QLMEAAD+DG+G+IDYLEFI+ATMHMNR
Sbjct  384  ALDTDKNGIVTLEELRTGLPKLGSKISEAEIKQLMEAADMDGDGSIDYLEFISATMHMNR  443

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +EREDHLY AF+YFDKD SGYITMEELE ++KKYN+ D+K+IKEIIAEVDTD DGKINY+
Sbjct  444  IEREDHLYTAFQYFDKDNSGYITMEELEQAMKKYNMGDDKSIKEIIAEVDTDRDGKINYE  503

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMM+KG P+LVT
Sbjct  504  EFVAMMKKGHPELVT  518



>emb|CDY44125.1| BnaA01g13330D [Brassica napus]
Length=525

 Score =   219 bits (558),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/135 (73%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            ++DTD +G +T EEL+ GL K+G+K+SE+E++QLMEAAD+DG+G+IDYLEFI+ATMHMNR
Sbjct  384  ALDTDKNGIVTLEELRTGLPKLGSKISEAEIKQLMEAADMDGDGSIDYLEFISATMHMNR  443

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +EREDHLY AF+YFDKD SGYITMEELE ++KKYN+ D+K+IKEIIAEVDTD DGKINY+
Sbjct  444  IEREDHLYTAFQYFDKDNSGYITMEELEQAMKKYNMGDDKSIKEIIAEVDTDRDGKINYE  503

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMM+KG P+LVT
Sbjct  504  EFVAMMKKGHPELVT  518



>gb|EMT20115.1| Calcium-dependent protein kinase 3 [Aegilops tauschii]
Length=353

 Score =   214 bits (546),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/135 (73%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT EEL++GL K+GTK+SESE+ QLMEAADVDGNGTIDY EF++ATMHMNR
Sbjct  213  SLDTDNSGTITLEELRSGLPKLGTKISESEITQLMEAADVDGNGTIDYSEFVSATMHMNR  272

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +E+EDH+ KAFEYFDKD SGYIT++ELE +LKKY++ D+KTIK+IIAEVDTD+DG+INY 
Sbjct  273  LEKEDHILKAFEYFDKDHSGYITVDELEEALKKYDMGDDKTIKDIIAEVDTDHDGRINYQ  332

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMMR  +P++V 
Sbjct  333  EFVAMMRNNSPEIVP  347



>ref|XP_006655639.1| PREDICTED: calcium-dependent protein kinase 3-like, partial [Oryza 
brachyantha]
Length=470

 Score =   218 bits (554),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT EEL+AGL K+GTK+SESE+RQLMEAADVDGNG+IDY+EFI+ATMHMNR
Sbjct  330  SLDTDNSGTITLEELRAGLPKLGTKISESELRQLMEAADVDGNGSIDYVEFISATMHMNR  389

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +E+EDH+YKAFEYFDKD SG+IT++ELE +LKKY++ DE TIKEIIAEVDTD+DG+I+Y 
Sbjct  390  LEKEDHIYKAFEYFDKDHSGFITVDELEEALKKYDMGDEATIKEIIAEVDTDHDGRIDYQ  449

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMM+  +P++V 
Sbjct  450  EFVAMMKNNSPEIVP  464



>gb|EEE64852.1| hypothetical protein OsJ_19709 [Oryza sativa Japonica Group]
Length=543

 Score =   219 bits (558),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT EEL+AGL K+GTK+SESE+RQLMEAADVDGNG+IDY+EFI+ATMHMNR
Sbjct  403  SLDTDNSGTITLEELRAGLPKLGTKISESELRQLMEAADVDGNGSIDYVEFISATMHMNR  462

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +E+EDH+YKAFEYFDKD SG+IT++ELE +L KY++ DE TIKEIIAEVDTD+DG+INY 
Sbjct  463  LEKEDHIYKAFEYFDKDHSGFITVDELEEALTKYDMGDEATIKEIIAEVDTDHDGRINYQ  522

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMM+  +P++V 
Sbjct  523  EFVAMMKNNSPEIVP  537



>ref|XP_009386326.1| PREDICTED: calcium-dependent protein kinase 3-like [Musa acuminata 
subsp. malaccensis]
Length=517

 Score =   218 bits (556),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 123/137 (90%), Gaps = 3/137 (2%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGT---KLSESEVRQLMEAADVDGNGTIDYLEFITATMH  564
            S+DTD++GTIT+EELKAGL K+G    K+SESE+RQLMEAADVDGNG+IDY+EFITATMH
Sbjct  374  SMDTDNNGTITFEELKAGLPKLGNLGIKISESEIRQLMEAADVDGNGSIDYIEFITATMH  433

Query  563  MNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKI  384
            MNR+EREDHLYKAFE FDKDKSGYIT+EELE +LKKYN+ DEKTIKEI+AEVD D DG+I
Sbjct  434  MNRMEREDHLYKAFECFDKDKSGYITVEELEQALKKYNMGDEKTIKEILAEVDIDKDGRI  493

Query  383  NYDEFVAMMRKGTPDLV  333
            NYDEFV MM+K T + +
Sbjct  494  NYDEFVTMMKKDTSEAI  510



>ref|XP_009137281.1| PREDICTED: calcium-dependent protein kinase 3-like [Brassica 
rapa]
Length=525

 Score =   218 bits (556),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/135 (73%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            ++DTD +G +T EEL+ GL K+G K+SE+E++QLMEAAD+DG+G+IDYLEFI+ATMHMNR
Sbjct  384  ALDTDKNGIVTLEELRTGLPKLGNKISEAEIKQLMEAADMDGDGSIDYLEFISATMHMNR  443

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +EREDHLY AF+YFDKD SGYITMEELE ++KKYN+ D+K+IKEIIAEVDTD DGKINY+
Sbjct  444  IEREDHLYTAFQYFDKDNSGYITMEELEQAMKKYNMGDDKSIKEIIAEVDTDRDGKINYE  503

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMM+KG P+LVT
Sbjct  504  EFVAMMKKGHPELVT  518



>dbj|BAJ94561.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=527

 Score =   218 bits (555),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT +EL+AGL K+GTK++ESE+RQLMEAADVDGNGTIDY+EFI+ATMHMNR
Sbjct  387  SLDTDNSGTITLDELRAGLPKLGTKITESEIRQLMEAADVDGNGTIDYVEFISATMHMNR  446

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +E+EDH++KAFEYFDKD SGYIT++ELE +LKKY++ DE TIK+IIAEVDTD+DGKINY 
Sbjct  447  LEKEDHIFKAFEYFDKDHSGYITVDELEEALKKYDMGDEATIKDIIAEVDTDHDGKINYQ  506

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMM+  +P++V 
Sbjct  507  EFVAMMKNNSPEIVP  521



>gb|EEC79771.1| hypothetical protein OsI_21169 [Oryza sativa Indica Group]
Length=401

 Score =   215 bits (547),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 99/135 (73%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT EEL+AGL K+GTK+SESE+ QLMEAADVDGNG+IDY+EFI+ATMHMNR
Sbjct  261  SLDTDNSGTITLEELRAGLPKLGTKISESELMQLMEAADVDGNGSIDYVEFISATMHMNR  320

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +E+EDH+YKAFEYFDKD SG+IT++ELE +L KY++ DE TIKEIIAEVDTD+DG+INY 
Sbjct  321  LEKEDHIYKAFEYFDKDHSGFITVDELEEALTKYDMGDEATIKEIIAEVDTDHDGRINYQ  380

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMM+  +P++V 
Sbjct  381  EFVAMMKNNSPEIVP  395



>ref|XP_002441592.1| hypothetical protein SORBIDRAFT_09g029950 [Sorghum bicolor]
 gb|EES20022.1| hypothetical protein SORBIDRAFT_09g029950 [Sorghum bicolor]
Length=541

 Score =   218 bits (556),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 101/135 (75%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT EEL+AGL K+GTK+SESE+RQLMEAADVDGNGTIDY+EFI+ATMHMNR
Sbjct  401  SLDTDNSGTITLEELRAGLPKLGTKISESEIRQLMEAADVDGNGTIDYVEFISATMHMNR  460

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +E+EDH++KAFEYFDKD SG+IT++ELE +LKKY++ DE TIKEIIAEVDTD+DG+INY 
Sbjct  461  LEKEDHIFKAFEYFDKDHSGHITVDELEEALKKYDMGDEATIKEIIAEVDTDHDGRINYQ  520

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMM+  + D+V 
Sbjct  521  EFVAMMKNNSSDIVP  535



>ref|XP_008802050.1| PREDICTED: calcium-dependent protein kinase 3-like [Phoenix dactylifera]
Length=525

 Score =   218 bits (554),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 99/135 (73%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGT+T+EEL AG+ K+GTK+SESEVRQLMEAADVDGNGTIDY+EFITATMHMNR
Sbjct  382  SMDTDNSGTVTFEELNAGIPKLGTKISESEVRQLMEAADVDGNGTIDYIEFITATMHMNR  441

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +E+ED L+KAFEYFD+DKSGYIT++ELE +LKKYN+ D+K IKEII EVDTD+DG+INY+
Sbjct  442  MEKEDRLFKAFEYFDQDKSGYITLKELEQALKKYNVVDKKAIKEIITEVDTDHDGRINYE  501

Query  374  EFVAMMRKGTPDLVT  330
            EFV MMR+   +++ 
Sbjct  502  EFVVMMRQDNSEIIA  516



>ref|XP_003569386.1| PREDICTED: calcium-dependent protein kinase 3-like [Brachypodium 
distachyon]
Length=526

 Score =   218 bits (554),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 101/135 (75%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT EEL++GL K+GTK+SESE+ QLMEAADVDGNGTIDY EF++ATMHMNR
Sbjct  386  SLDTDNSGTITLEELRSGLPKLGTKISESEITQLMEAADVDGNGTIDYSEFVSATMHMNR  445

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +E+EDH+ KAFEYFDKD SGYIT++ELE +LKKY++ D+KTIKEIIAEVDTDNDG+INY 
Sbjct  446  LEKEDHILKAFEYFDKDHSGYITVDELEEALKKYDMGDDKTIKEIIAEVDTDNDGRINYQ  505

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMMR  +P++V 
Sbjct  506  EFVAMMRNNSPEIVP  520



>gb|EMS46165.1| Calcium-dependent protein kinase 3 [Triticum urartu]
Length=350

 Score =   213 bits (542),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 99/135 (73%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT EEL++GL K+GTK+SESE+ QLMEAADVDGNGTIDY EF++ATMHMNR
Sbjct  210  SLDTDNSGTITLEELRSGLPKLGTKISESEITQLMEAADVDGNGTIDYSEFVSATMHMNR  269

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +E+EDH+ KAFEYFDKD SGYIT++ELE +LKKY++ D+KTIK+IIAEVDTD+DG+INY 
Sbjct  270  LEKEDHILKAFEYFDKDHSGYITVDELEEALKKYDMGDDKTIKDIIAEVDTDHDGRINYQ  329

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMMR  +P++V 
Sbjct  330  EFVAMMRNNSPEIVP  344



>ref|XP_002867697.1| calcium-dependent protein kinase 6 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43956.1| calcium-dependent protein kinase 6 [Arabidopsis lyrata subsp. 
lyrata]
Length=519

 Score =   217 bits (553),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD++G +T EEL+ GL K+G+K+SE+E+RQLMEAAD+DG+G+IDYLEFI+ATMHMNR
Sbjct  380  SLDTDNNGIVTLEELRTGLPKLGSKISEAEIRQLMEAADMDGDGSIDYLEFISATMHMNR  439

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +EREDHLY AF++FD D SGYITMEELE ++KKYN+ D+K+IKEIIAEVDTD DGKINY+
Sbjct  440  IEREDHLYTAFQFFDNDNSGYITMEELELAMKKYNMGDDKSIKEIIAEVDTDRDGKINYE  499

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMM+KG P+LV 
Sbjct  500  EFVAMMKKGNPELVP  514



>gb|AAL38596.1|AF446863_1 AT4g23650/F9D16_120 [Arabidopsis thaliana]
 gb|AAK96512.1| AT4g23650/F9D16_120 [Arabidopsis thaliana]
Length=529

 Score =   218 bits (554),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD++G +T EEL+ GL K+G+K+SE+E+RQLMEAAD+DG+G+IDYLEFI+ATMHMNR
Sbjct  390  SLDTDNNGIVTLEELRTGLPKLGSKISEAEIRQLMEAADMDGDGSIDYLEFISATMHMNR  449

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +EREDHLY AF++FD D SGYITMEELE ++KKYN+ D+K+IKEIIAEVDTD DGKINY+
Sbjct  450  IEREDHLYTAFQFFDNDNSGYITMEELELAMKKYNMGDDKSIKEIIAEVDTDRDGKINYE  509

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMM+KG P+LV 
Sbjct  510  EFVAMMKKGNPELVP  524



>ref|NP_194096.1| calcium-dependent protein kinase 6 [Arabidopsis thaliana]
 sp|Q42479.1|CDPK3_ARATH RecName: Full=Calcium-dependent protein kinase 3; AltName: Full=Calcium-dependent 
protein kinase isoform CDPK6; Short=AtCDPK6 
[Arabidopsis thaliana]
 gb|AAK60302.1|AF385710_1 AT4g23650/F9D16_120 [Arabidopsis thaliana]
 gb|AAA67654.1| calcium-dependent protein kinase [Arabidopsis thaliana]
 gb|AAA67656.1| calcium-dependent protein kinase [Arabidopsis thaliana]
 emb|CAA23031.1| calcium-dependent protein kinase (CDPK6) [Arabidopsis thaliana]
 emb|CAB79320.1| calcium-dependent protein kinase (CDPK6) [Arabidopsis thaliana]
 gb|AAL87385.1| AT4g23650/F9D16_120 [Arabidopsis thaliana]
 gb|AAM65176.1| calcium-dependent protein kinase CDPK6 [Arabidopsis thaliana]
 gb|AAN31878.1| putative calcium-dependent protein kinase (CDPK6) [Arabidopsis 
thaliana]
 gb|AEE84789.1| calcium-dependent protein kinase 6 [Arabidopsis thaliana]
Length=529

 Score =   218 bits (554),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD++G +T EEL+ GL K+G+K+SE+E+RQLMEAAD+DG+G+IDYLEFI+ATMHMNR
Sbjct  390  SLDTDNNGIVTLEELRTGLPKLGSKISEAEIRQLMEAADMDGDGSIDYLEFISATMHMNR  449

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +EREDHLY AF++FD D SGYITMEELE ++KKYN+ D+K+IKEIIAEVDTD DGKINY+
Sbjct  450  IEREDHLYTAFQFFDNDNSGYITMEELELAMKKYNMGDDKSIKEIIAEVDTDRDGKINYE  509

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMM+KG P+LV 
Sbjct  510  EFVAMMKKGNPELVP  524



>ref|NP_001056455.1| Os05g0585500 [Oryza sativa Japonica Group]
 gb|AAT47064.1| putative calcium-dependent protein kinase [Oryza sativa Japonica 
Group]
 dbj|BAF18369.1| Os05g0585500 [Oryza sativa Japonica Group]
Length=542

 Score =   218 bits (554),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT EEL+AGL K+GTK+SESE+RQLMEAADVDGNG+IDY+EFI+ATMHMNR
Sbjct  402  SLDTDNSGTITLEELRAGLPKLGTKISESELRQLMEAADVDGNGSIDYVEFISATMHMNR  461

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +E+EDH+YKAFEYFDKD SG+IT++ELE +L KY++ DE TIKEIIAEVDTD+DG+INY 
Sbjct  462  LEKEDHIYKAFEYFDKDHSGFITVDELEEALTKYDMGDEATIKEIIAEVDTDHDGRINYQ  521

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMM+  +P++V 
Sbjct  522  EFVAMMKNNSPEIVP  536



>gb|EAZ12734.1| hypothetical protein OsJ_02652 [Oryza sativa Japonica Group]
 dbj|BAH01699.1| unnamed protein product [Oryza sativa Japonica Group]
Length=518

 Score =   217 bits (553),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 101/135 (75%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT EEL++GL K+GTK+SESE+RQLMEAADVDGNGTIDY EFI+ATMHMNR
Sbjct  378  SLDTDNSGTITLEELRSGLPKLGTKISESEIRQLMEAADVDGNGTIDYAEFISATMHMNR  437

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +E+EDH+ KAFEYFDKD SGYIT++ELE +LKKY++ D+KTIKEIIAEVDTD+DG+INY 
Sbjct  438  LEKEDHILKAFEYFDKDHSGYITVDELEEALKKYDMGDDKTIKEIIAEVDTDHDGRINYQ  497

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMMR   P++  
Sbjct  498  EFVAMMRNNNPEIAP  512



>ref|XP_004969206.1| PREDICTED: calcium-dependent protein kinase 3-like [Setaria italica]
Length=522

 Score =   217 bits (553),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+D D+SGTIT EEL++GL K+GTK+SESE+RQLMEAADVDGNGTIDY EFI+ATMH+NR
Sbjct  382  SLDADNSGTITLEELRSGLPKLGTKISESEIRQLMEAADVDGNGTIDYAEFISATMHLNR  441

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +E+EDH+ KAFEYFDKD SGYIT++ELE +LKKY++ D+KTIKEIIAEVDTD+DG+INY 
Sbjct  442  LEKEDHILKAFEYFDKDHSGYITVDELEEALKKYDMGDDKTIKEIIAEVDTDHDGRINYQ  501

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMMR  +P++V 
Sbjct  502  EFVAMMRNNSPEIVP  516



>dbj|BAD61167.1| putative calcium-dependent protein kinase [Oryza sativa Japonica 
Group]
Length=713

 Score =   221 bits (562),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/135 (75%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT EEL++GL K+GTK+SESE+RQLMEAADVDGNGTIDY EFI+ATMHMNR
Sbjct  573  SLDTDNSGTITLEELRSGLPKLGTKISESEIRQLMEAADVDGNGTIDYAEFISATMHMNR  632

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +E+EDH+ KAFEYFDKD SGYIT++ELE +LKKY++ D+KTIKEIIAEVDTD+DG+INY 
Sbjct  633  LEKEDHILKAFEYFDKDHSGYITVDELEEALKKYDMGDDKTIKEIIAEVDTDHDGRINYQ  692

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMMR   P++  
Sbjct  693  EFVAMMRNNNPEIAP  707



>ref|NP_001152509.1| calcium-dependent protein kinase, isoform 2 [Zea mays]
 gb|ACG47976.1| calcium-dependent protein kinase, isoform 2 [Zea mays]
 gb|AFW83318.1| putative calcium-dependent protein kinase family protein isoform 
1 [Zea mays]
 gb|AFW83319.1| putative calcium-dependent protein kinase family protein isoform 
2 [Zea mays]
Length=530

 Score =   217 bits (553),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT EEL++GL K+GTK+SESE++QLMEAADVDGNGTIDY EFI+ATMH+NR
Sbjct  390  SLDTDNSGTITLEELRSGLPKLGTKISESEIKQLMEAADVDGNGTIDYAEFISATMHLNR  449

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +E+EDH+ KAFEYFDKD SGYIT++ELE +LKKY++ D+KTIKEIIAEVDTD+DG+INY 
Sbjct  450  LEKEDHILKAFEYFDKDHSGYITVDELEEALKKYDMGDDKTIKEIIAEVDTDHDGRINYQ  509

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMMR  +P++V 
Sbjct  510  EFVAMMRNNSPEIVP  524



>emb|CDY54853.1| BnaC01g15460D [Brassica napus]
Length=525

 Score =   217 bits (552),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            ++DTD +G +T EEL+ GL K+G K+SE+E++QLMEAAD+DG+G+IDYLEFI+ATMHMNR
Sbjct  384  ALDTDKNGIVTLEELRTGLPKLGNKISEAEIKQLMEAADMDGDGSIDYLEFISATMHMNR  443

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +EREDHLY AF+YFD D SGYITMEELE ++KKYN+ D+K+IKEIIAEVDTD DGKINY+
Sbjct  444  IEREDHLYTAFQYFDNDNSGYITMEELEQAMKKYNMGDDKSIKEIIAEVDTDRDGKINYE  503

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMM+KG P+LVT
Sbjct  504  EFVAMMKKGHPELVT  518



>ref|XP_004961071.1| PREDICTED: calcium-dependent protein kinase 3-like [Setaria italica]
Length=546

 Score =   217 bits (553),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT EEL+ GL K+GTK+SESE+RQLMEAADVDGNGTIDY+EFI+ATMHMNR
Sbjct  406  SLDTDNSGTITLEELRTGLPKLGTKISESEIRQLMEAADVDGNGTIDYVEFISATMHMNR  465

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +E+EDH+YKAFEYFDKD SG+IT++ELE +LKKY++ DE TIKEIIAEVDTD+DG+I+Y 
Sbjct  466  LEKEDHIYKAFEYFDKDHSGHITVDELEEALKKYDMGDEATIKEIIAEVDTDHDGRIDYQ  525

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMM+  +P++V 
Sbjct  526  EFVAMMKNNSPEIVP  540



>ref|XP_006413532.1| hypothetical protein EUTSA_v10024899mg [Eutrema salsugineum]
 gb|ESQ54985.1| hypothetical protein EUTSA_v10024899mg [Eutrema salsugineum]
Length=527

 Score =   217 bits (552),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD++G +T EEL+ GL K+G+K+SE+E++QLMEAAD+DG+G+IDYLEFI+ATMHMNR
Sbjct  386  SLDTDNNGIVTLEELRTGLPKLGSKISEAEIKQLMEAADMDGDGSIDYLEFISATMHMNR  445

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +EREDHLY AF+YFD D SGYITMEELE ++KKYN+ D+K+IKEIIAEVDTD D KINY+
Sbjct  446  IEREDHLYTAFQYFDNDNSGYITMEELEQAMKKYNMGDDKSIKEIIAEVDTDRDEKINYE  505

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMM+KG P+LVT
Sbjct  506  EFVAMMKKGNPELVT  520



>gb|AHN16201.1| CPK3-2.1 [Brassica napus]
Length=527

 Score =   216 bits (551),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            ++DTD +G +T EEL+ GL K+G K+SE+E++QLMEAAD+DG+G+IDYLEFI+ATMHMNR
Sbjct  386  ALDTDKNGIVTLEELRTGLPKLGNKISEAEIKQLMEAADMDGDGSIDYLEFISATMHMNR  445

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +EREDHLY AF+YFD D SGYITMEELE ++KKYN+ D+K+IKEIIAEVDTD DGKINY+
Sbjct  446  IEREDHLYTAFQYFDNDNSGYITMEELEQAMKKYNMGDDKSIKEIIAEVDTDRDGKINYE  505

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMM+KG P+LVT
Sbjct  506  EFVAMMKKGHPELVT  520



>tpg|DAA58514.1| TPA: putative calcium-dependent protein kinase family protein 
[Zea mays]
Length=460

 Score =   214 bits (545),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT EEL++GL K+GTK+SESE++QLMEAADVDGNGTIDY EFI+ATMH+NR
Sbjct  320  SLDTDNSGTITLEELRSGLPKLGTKISESEIKQLMEAADVDGNGTIDYAEFISATMHLNR  379

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +E+ED + KAFEYFDKD SGYIT++ELE +LKKY++ D+KTIKEIIAEVDTD+DG+INY 
Sbjct  380  LEKEDRILKAFEYFDKDHSGYITVDELEEALKKYDMGDDKTIKEIIAEVDTDHDGRINYQ  439

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMMR  TP++V 
Sbjct  440  EFVAMMRNNTPEIVP  454



>gb|EEC71113.1| hypothetical protein OsI_02910 [Oryza sativa Indica Group]
Length=520

 Score =   215 bits (548),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT EEL++GL K+GTK+SESE++QLMEAADVDGNGTIDY EFI+ATMHMNR
Sbjct  380  SLDTDNSGTITLEELRSGLPKLGTKISESEIKQLMEAADVDGNGTIDYAEFISATMHMNR  439

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +E+EDH+ KAFEYFDKD SGYIT++ELE +LKKY++ D+KTIKEIIAEVDTD+DG+INY 
Sbjct  440  LEKEDHILKAFEYFDKDHSGYITVDELEEALKKYDMGDDKTIKEIIAEVDTDHDGRINYQ  499

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMMR   P++  
Sbjct  500  EFVAMMRNNNPEIAP  514



>ref|NP_001169721.1| uncharacterized LOC100383602 [Zea mays]
 gb|ACN34646.1| unknown [Zea mays]
 tpg|DAA58515.1| TPA: putative calcium-dependent protein kinase family protein 
[Zea mays]
Length=524

 Score =   214 bits (546),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT EEL++GL K+GTK+SESE++QLMEAADVDGNGTIDY EFI+ATMH+NR
Sbjct  384  SLDTDNSGTITLEELRSGLPKLGTKISESEIKQLMEAADVDGNGTIDYAEFISATMHLNR  443

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +E+ED + KAFEYFDKD SGYIT++ELE +LKKY++ D+KTIKEIIAEVDTD+DG+INY 
Sbjct  444  LEKEDRILKAFEYFDKDHSGYITVDELEEALKKYDMGDDKTIKEIIAEVDTDHDGRINYQ  503

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMMR  TP++V 
Sbjct  504  EFVAMMRNNTPEIVP  518



>gb|KDO62722.1| hypothetical protein CISIN_1g0096581mg, partial [Citrus sinensis]
 gb|KDO62723.1| hypothetical protein CISIN_1g0096581mg, partial [Citrus sinensis]
Length=293

 Score =   208 bits (530),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            +IDTD+SGTITYEELKAGL ++G+KL+E+EV+QLMEAADVDGNGTIDY+EFITATMH ++
Sbjct  157  NIDTDNSGTITYEELKAGLARLGSKLTEAEVQQLMEAADVDGNGTIDYIEFITATMHRHK  216

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +ER+DHLYKAF++FDKD SG+IT++ELE ++K Y + D+ TIKEII+EVDTDNDG+INYD
Sbjct  217  LERDDHLYKAFQHFDKDNSGFITIDELEIAMKDYGMGDDDTIKEIISEVDTDNDGRINYD  276

Query  374  EFVAMMRKGT  345
            EF AMMR GT
Sbjct  277  EFCAMMRSGT  286



>ref|XP_002455974.1| hypothetical protein SORBIDRAFT_03g028340 [Sorghum bicolor]
 gb|EES01094.1| hypothetical protein SORBIDRAFT_03g028340 [Sorghum bicolor]
Length=525

 Score =   214 bits (546),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 99/135 (73%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT EEL++GL K+GTK+SESE++QLMEAADVDGNGTIDY EFI+ATMH+NR
Sbjct  385  SLDTDNSGTITLEELRSGLPKLGTKISESEIKQLMEAADVDGNGTIDYGEFISATMHLNR  444

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +E+EDH+ KAFEYFDKD SGYIT++ELE +LKKY++ D+KTIKEIIAEVD+D+DG+INY 
Sbjct  445  LEKEDHILKAFEYFDKDHSGYITVDELEEALKKYDMGDDKTIKEIIAEVDSDHDGRINYQ  504

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMMR  +P++V 
Sbjct  505  EFVAMMRNNSPEIVP  519



>emb|CAF18446.1| putative calcium-dependent protein kinase [Triticum aestivum]
 emb|CDM83446.1| unnamed protein product [Triticum aestivum]
Length=518

 Score =   214 bits (544),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/135 (73%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT EEL++GL K+GTK+SESE+ QLMEAADVDGNGTIDY EF++ATMHMNR
Sbjct  378  SLDTDNSGTITLEELRSGLPKLGTKISESEITQLMEAADVDGNGTIDYSEFVSATMHMNR  437

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +E+EDH+ KAFEYFDKD SGYIT++ELE +LKKY++ D+KTIK+IIAEVDTD+DG+INY 
Sbjct  438  LEKEDHILKAFEYFDKDHSGYITVDELEEALKKYDMGDDKTIKDIIAEVDTDHDGRINYQ  497

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMMR  +P++V 
Sbjct  498  EFVAMMRNNSPEIVP  512



>ref|XP_006644382.1| PREDICTED: calcium-dependent protein kinase 3-like isoform X1 
[Oryza brachyantha]
 ref|XP_006644383.1| PREDICTED: calcium-dependent protein kinase 3-like isoform X2 
[Oryza brachyantha]
Length=460

 Score =   213 bits (541),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/135 (73%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT EEL++GL K+GTK+SESE+RQLMEAADVDGNGTIDY EFI+ATMHMN+
Sbjct  320  SLDTDNSGTITLEELRSGLPKLGTKISESEIRQLMEAADVDGNGTIDYAEFISATMHMNK  379

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +E+EDH+ KAFEYFDKD SG IT++ELE +LKKY++ D+KTIKEIIAEVDTD+DG+INY 
Sbjct  380  LEKEDHILKAFEYFDKDHSGCITVDELEEALKKYDMGDDKTIKEIIAEVDTDHDGRINYQ  439

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMMR   P++  
Sbjct  440  EFVAMMRNNNPEIAP  454



>dbj|BAJ95679.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=520

 Score =   214 bits (544),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/135 (73%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT EEL++GL K+GTK+SESE+ QLMEAADVDGNGTIDY EF++ATMHMNR
Sbjct  380  SLDTDNSGTITLEELRSGLPKLGTKISESEITQLMEAADVDGNGTIDYSEFVSATMHMNR  439

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +E+EDH+ KAFEYFDKD SGYIT++ELE +LKKY++ D+KTIK+IIAEVDTD+DG+INY 
Sbjct  440  LEKEDHILKAFEYFDKDHSGYITVDELEEALKKYDMGDDKTIKDIIAEVDTDHDGRINYQ  499

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMMR  +P++V 
Sbjct  500  EFVAMMRNNSPEIVP  514



>ref|XP_009603797.1| PREDICTED: calcium-dependent protein kinase 17-like [Nicotiana 
tomentosiformis]
Length=536

 Score =   214 bits (545),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/134 (74%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = -2

Query  731  IDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNRV  552
            +DTD+SGTIT EELK GL K G KLS+ E++QLMEAAD DGNGTIDY EFITATMHMNR+
Sbjct  392  MDTDNSGTITLEELKQGLAKQGNKLSDYEIKQLMEAADADGNGTIDYEEFITATMHMNRM  451

Query  551  EREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYDE  372
            +RE+HLYKAF+YFDKDKSGYITMEELE +L+++ + D K IKEII+EVD+DNDG+INYDE
Sbjct  452  DREEHLYKAFQYFDKDKSGYITMEELEQALREFGMNDAKDIKEIISEVDSDNDGRINYDE  511

Query  371  FVAMMRKGTPDLVT  330
            FVAMM+KG P+  T
Sbjct  512  FVAMMKKGNPEAAT  525



>gb|EYU35947.1| hypothetical protein MIMGU_mgv1a004350mg [Erythranthe guttata]
Length=532

 Score =   213 bits (543),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 99/134 (74%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = -2

Query  731  IDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNRV  552
            +DTD SGTIT EELK GL+K GTKL+ESEV+QLMEAAD DGNGTIDY EFITATMHMNR+
Sbjct  387  MDTDSSGTITLEELKQGLSKQGTKLTESEVKQLMEAADADGNGTIDYEEFITATMHMNRM  446

Query  551  EREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYDE  372
            +RE+HLY AF+YFDKD SGYIT+EELE +L+++ + D+K IKEII+EVD DNDG+INYDE
Sbjct  447  DREEHLYTAFQYFDKDNSGYITIEELEQALREFGMGDDKDIKEIISEVDADNDGRINYDE  506

Query  371  FVAMMRKGTPDLVT  330
            F AMM+KG PD+V 
Sbjct  507  FAAMMKKGNPDMVA  520



>gb|KJB39673.1| hypothetical protein B456_007G025000 [Gossypium raimondii]
Length=530

 Score =   213 bits (541),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = -2

Query  731  IDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNRV  552
            +DTD+S TITY+ELKAGL K+GT +SESEVR LMEA D+DGNGTIDY+EFITATMHMNR+
Sbjct  392  MDTDNSRTITYDELKAGLCKLGTNVSESEVRLLMEATDIDGNGTIDYVEFITATMHMNRM  451

Query  551  EREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYDE  372
            E+E  LY AF++FDKD SGYITMEEL+ +L+KYN  DEKTI EI+AEVD D DG+INYDE
Sbjct  452  EKEKRLYTAFQHFDKDNSGYITMEELKQALQKYNTRDEKTINEILAEVDIDKDGRINYDE  511

Query  371  FVAMMRKGTPDLV  333
            FVAMMRKG P+LV
Sbjct  512  FVAMMRKGNPELV  524



>ref|XP_009789543.1| PREDICTED: calcium-dependent protein kinase 34-like [Nicotiana 
sylvestris]
Length=532

 Score =   212 bits (539),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = -2

Query  731  IDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNRV  552
            +DTD+SGTIT EELK GL K G KLS+ E++QLMEAAD DGNGTIDY EFITATMHMNR+
Sbjct  388  MDTDNSGTITLEELKQGLAKQGNKLSDYEIKQLMEAADADGNGTIDYEEFITATMHMNRM  447

Query  551  EREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYDE  372
            +RE+HLYKAF+YFDKD SGYITMEELE +L+++ + D K IKEII+EVD+DNDG+INYDE
Sbjct  448  DREEHLYKAFQYFDKDNSGYITMEELEQALREFGMNDAKDIKEIISEVDSDNDGRINYDE  507

Query  371  FVAMMRKGTPDLVT  330
            FVAMM+KG P+  T
Sbjct  508  FVAMMKKGNPEAAT  521



>dbj|BAA81749.1| calcium-dependent protein kinase [Marchantia polymorpha]
 dbj|BAA81751.1| calcium-dependent protein kinase [Marchantia polymorpha]
Length=548

 Score =   212 bits (540),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT+EELK GL K G+ L+ESEVRQLM AADVDGNGTIDYLEFITATMH+N+
Sbjct  393  SMDTDNSGTITFEELKDGLQKQGSNLAESEVRQLMAAADVDGNGTIDYLEFITATMHLNK  452

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +E+EDHLY AF++FD+D SG+ITMEELE +L K+ + D  T+KEII EVDTD+DG+INYD
Sbjct  453  IEKEDHLYAAFQHFDEDSSGFITMEELEQALIKHGMGDPDTLKEIIREVDTDHDGRINYD  512

Query  374  EFVAMMRKGTP  342
            EFVAMMRKGTP
Sbjct  513  EFVAMMRKGTP  523



>gb|EPS65220.1| hypothetical protein M569_09555, partial [Genlisea aurea]
Length=457

 Score =   209 bits (533),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGT+T+EELK GL K+GTKLSE EVR+ MEAADVDGNG+IDY+EF+TATMH NR
Sbjct  329  SMDTDNSGTLTFEELKVGLPKLGTKLSEKEVREFMEAADVDGNGSIDYMEFVTATMHANR  388

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +ER DHLYKAFE+ D DKSGYIT EELEH LK Y+  D K +KEI++EVDTD DGKINYD
Sbjct  389  MERGDHLYKAFEFLDADKSGYITPEELEHVLKDYDTGDGKAVKEILSEVDTDQDGKINYD  448

Query  374  EFVAMMRKG  348
            EFVAMMRKG
Sbjct  449  EFVAMMRKG  457



>ref|XP_009385897.1| PREDICTED: calcium-dependent protein kinase 3-like [Musa acuminata 
subsp. malaccensis]
Length=506

 Score =   210 bits (534),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 100/130 (77%), Positives = 120/130 (92%), Gaps = 3/130 (2%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGT---KLSESEVRQLMEAADVDGNGTIDYLEFITATMH  564
            S+DTD+SGT+T EELKAGL K+G    K+SESEV+QL+EAADVDGNG+IDYLEFITATMH
Sbjct  366  SMDTDNSGTLTVEELKAGLPKLGNLGIKISESEVKQLIEAADVDGNGSIDYLEFITATMH  425

Query  563  MNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKI  384
            MN++E+EDHL+KAFEYFDKDKSGYIT+EELE +L KYN+ D++TIKEIIAEVD +NDG+I
Sbjct  426  MNKMEKEDHLFKAFEYFDKDKSGYITIEELEQALTKYNMGDQQTIKEIIAEVDINNDGRI  485

Query  383  NYDEFVAMMR  354
            NY+EFVAMMR
Sbjct  486  NYEEFVAMMR  495



>gb|KHN11921.1| Calcium-dependent protein kinase 9 [Glycine soja]
Length=404

 Score =   207 bits (527),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            +IDTD+SGTITYEEL+AGL ++G+KL+E+EVRQLM+AADVDGNGTIDY+EFITATMH +R
Sbjct  268  NIDTDNSGTITYEELRAGLQRLGSKLTETEVRQLMDAADVDGNGTIDYIEFITATMHRHR  327

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +ER++HLYKAF+YFDKD SGYIT +ELE ++K+Y + DE TI+EII+EVDTDNDG+INY+
Sbjct  328  LERDEHLYKAFQYFDKDGSGYITRDELEIAMKEYGMGDEATIREIISEVDTDNDGRINYE  387

Query  374  EFVAMMRKGT  345
            EF  MMR GT
Sbjct  388  EFCTMMRSGT  397



>ref|XP_009770081.1| PREDICTED: calcium-dependent protein kinase 21-like [Nicotiana 
sylvestris]
Length=542

 Score =   210 bits (535),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            +IDTD+SGTITYEELK+GL ++G+KL+E+EV+QLMEAADVDGNGTIDY+EFITATMH +R
Sbjct  406  NIDTDNSGTITYEELKSGLARLGSKLTETEVKQLMEAADVDGNGTIDYIEFITATMHRHR  465

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +ER++HL+KAF+YFDKD SG+IT +ELE ++K+Y + DE TIKEIIAEVDTDNDG+INY+
Sbjct  466  LERDEHLFKAFQYFDKDHSGFITRDELESAMKEYGMGDEATIKEIIAEVDTDNDGRINYE  525

Query  374  EFVAMMRKGT  345
            EF AMMR GT
Sbjct  526  EFCAMMRSGT  535



>gb|KHG14847.1| Calcium-dependent protein kinase 3 [Gossypium arboreum]
Length=530

 Score =   210 bits (534),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = -2

Query  731  IDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNRV  552
            +DTD+S TIT++ELKAGL K+GT +SESEVR LMEA D+DGNGTIDY+EFITATMHMNR+
Sbjct  392  MDTDNSQTITFDELKAGLCKLGTNVSESEVRLLMEATDIDGNGTIDYVEFITATMHMNRM  451

Query  551  EREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYDE  372
            E+E  LY AF++FDKD SGYIT+EEL+ +L+KYN  DEKTI EI+AEVDTD DG+INYDE
Sbjct  452  EKEKRLYAAFQHFDKDNSGYITIEELKQALQKYNTRDEKTINEILAEVDTDKDGRINYDE  511

Query  371  FVAMMRKGTPDLV  333
            FVAMMRK  P+LV
Sbjct  512  FVAMMRKSNPELV  524



>gb|ACA63885.1| calcium-dependent protein kinase [Hordeum vulgare]
Length=520

 Score =   209 bits (533),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 120/135 (89%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT EEL++GL K+GTK+SESE+ QLMEAADVDGNGTIDY EF++ATMHMNR
Sbjct  380  SLDTDNSGTITLEELRSGLPKLGTKISESEITQLMEAADVDGNGTIDYSEFVSATMHMNR  439

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +E+EDH+ KAFEYFDKD SGYI ++ELE  LKKY++ D+K IK+IIAEVDTD+DG+INY 
Sbjct  440  LEKEDHILKAFEYFDKDHSGYIPVDELEEVLKKYDMGDDKPIKDIIAEVDTDHDGRINYQ  499

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMMR  +P++V 
Sbjct  500  EFVAMMRNNSPEIVP  514



>ref|XP_009627158.1| PREDICTED: calcium-dependent protein kinase 21-like [Nicotiana 
tomentosiformis]
Length=534

 Score =   209 bits (533),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            +IDTD+SGTITYEELK+GL ++G+KL+E+EV+QLMEAADVDGNGTIDY+EFITATMH +R
Sbjct  398  NIDTDNSGTITYEELKSGLARLGSKLTETEVKQLMEAADVDGNGTIDYIEFITATMHRHR  457

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +ER++HL+KAF+YFDKD SG+IT +ELE ++K+Y + DE TIKEIIAEVDTDNDG+INY+
Sbjct  458  LERDEHLFKAFQYFDKDHSGFITRDELESAMKEYGMGDEATIKEIIAEVDTDNDGRINYE  517

Query  374  EFVAMMRKGT  345
            EF AMMR GT
Sbjct  518  EFCAMMRSGT  527



>gb|AAC25423.1| calcium-dependent protein kinase [Nicotiana tabacum]
Length=540

 Score =   210 bits (534),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            +IDTD+SGTITYEELK+GL ++G+KL+E+EV+QLMEAADVDGNGTIDY+EFITATMH +R
Sbjct  404  NIDTDNSGTITYEELKSGLARLGSKLTETEVKQLMEAADVDGNGTIDYIEFITATMHRHR  463

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +ER++HL+KAF+YFDKD SG+IT +ELE ++K+Y + DE TIKEIIAEVDTDNDG+INY+
Sbjct  464  LERDEHLFKAFQYFDKDHSGFITRDELESAMKEYGMGDEATIKEIIAEVDTDNDGRINYE  523

Query  374  EFVAMMRKGT  345
            EF AMMR GT
Sbjct  524  EFCAMMRSGT  533



>ref|XP_006452371.1| hypothetical protein CICLE_v10007983mg [Citrus clementina]
 gb|ESR65611.1| hypothetical protein CICLE_v10007983mg [Citrus clementina]
Length=529

 Score =   209 bits (533),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            +IDTD+SGTITYEELKAGL ++G+KL+E+EV+QLMEAADVDGNGTIDY+EFITATMH ++
Sbjct  393  NIDTDNSGTITYEELKAGLARLGSKLTEAEVQQLMEAADVDGNGTIDYIEFITATMHRHK  452

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +ER+DHLYKAF++FDKD SG+IT++ELE ++K Y + D+ TIKEII+EVDTDNDG+INYD
Sbjct  453  LERDDHLYKAFQHFDKDNSGFITIDELEIAMKDYGMGDDDTIKEIISEVDTDNDGRINYD  512

Query  374  EFVAMMRKGT  345
            EF AMMR GT
Sbjct  513  EFCAMMRSGT  522



>gb|ABY59010.1| calcium-dependent protein kinase [Triticum aestivum]
Length=518

 Score =   209 bits (531),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT EEL++GL K+GTK+SESE+ QLMEAADVDGNGTIDY EF++AT+HMNR
Sbjct  378  SLDTDNSGTITLEELRSGLPKLGTKISESEITQLMEAADVDGNGTIDYSEFVSATIHMNR  437

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +E+EDH+ KAFEYFDKD SGYIT++ELE +LKKY++ D+KT K+IIAEVDTD+DG+INY 
Sbjct  438  LEKEDHILKAFEYFDKDHSGYITVDELEEALKKYDMGDDKTNKDIIAEVDTDHDGRINYQ  497

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMMR  +P++V 
Sbjct  498  EFVAMMRNNSPEIVP  512



>ref|XP_011086186.1| PREDICTED: calcium-dependent protein kinase-like [Sesamum indicum]
Length=543

 Score =   209 bits (533),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/134 (72%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            ++DTD SGTITYEELK+GL ++G+KLSE+EV+QLMEAADVDGNGTIDY+EFITATMH ++
Sbjct  407  NMDTDKSGTITYEELKSGLARLGSKLSEAEVKQLMEAADVDGNGTIDYIEFITATMHRHK  466

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +ER++HLY AF+YFDKD SGYIT +ELE ++K+Y + DE TIKEII+EVDTDNDG+INYD
Sbjct  467  LERDEHLYSAFQYFDKDSSGYITRDELETAMKEYGMGDEATIKEIISEVDTDNDGRINYD  526

Query  374  EFVAMMRKGTPDLV  333
            EF AMMR GT   V
Sbjct  527  EFCAMMRSGTQQPV  540



>ref|XP_010247475.1| PREDICTED: calcium-dependent protein kinase 34 [Nelumbo nucifera]
Length=521

 Score =   209 bits (531),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 117/132 (89%), Gaps = 0/132 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT EELK GL+K GTKLSE EV+QLMEAAD DGNGTIDY EFITATMHMNR
Sbjct  379  SMDTDNSGTITLEELKQGLSKQGTKLSEYEVKQLMEAADADGNGTIDYDEFITATMHMNR  438

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            ++RE+HLY AF+YFDKD SGYIT EELE +L+++ + D + IKEI++EVD+DNDG+INYD
Sbjct  439  MDREEHLYTAFQYFDKDNSGYITTEELEQALREFGMHDGRDIKEILSEVDSDNDGRINYD  498

Query  374  EFVAMMRKGTPD  339
            EFVAMMRKG P+
Sbjct  499  EFVAMMRKGNPE  510



>ref|XP_010519814.1| PREDICTED: calcium-dependent protein kinase 34 isoform X2 [Tarenaya 
hassleriana]
Length=526

 Score =   209 bits (531),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = -2

Query  731  IDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNRV  552
            +DTD+SGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTIDY EFI ATMH+NR+
Sbjct  384  MDTDNSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTIDYGEFIAATMHINRL  443

Query  551  EREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYDE  372
            +RE+HLY AF++FDKD SGYITMEELE +L+++ ++D + IKEII+EVD+DNDG+INYDE
Sbjct  444  DREEHLYSAFQHFDKDNSGYITMEELEQALREFGMSDGRDIKEIISEVDSDNDGRINYDE  503

Query  371  FVAMMRKGTPD  339
            FVAMMRKG PD
Sbjct  504  FVAMMRKGNPD  514



>gb|KHN38276.1| Calcium-dependent protein kinase 33 [Glycine soja]
Length=391

 Score =   206 bits (523),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            +IDTD+SGTITYEEL+AGL ++G+KL+E+EV+QLM+AADVDGNGTIDY+EFITATMH +R
Sbjct  255  NIDTDNSGTITYEELRAGLQRLGSKLTEAEVQQLMDAADVDGNGTIDYIEFITATMHRHR  314

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +ER++HL+KAF+YFDKD SGYIT +ELE ++K+Y + DE TI+EII+EVDTDNDG+INYD
Sbjct  315  LERDEHLHKAFQYFDKDGSGYITRDELETAMKEYGMGDEATIREIISEVDTDNDGRINYD  374

Query  374  EFVAMMRKGT  345
            EF  MMR GT
Sbjct  375  EFCTMMRSGT  384



>gb|AAZ76712.1| calcium-dependent protein kinase 1 [Petunia integrifolia subsp. 
inflata]
Length=532

 Score =   209 bits (532),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 118/132 (89%), Gaps = 0/132 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SG IT EELK GL K GTKLS+ E++QLMEAAD DGNGTIDY EFITATMHMNR
Sbjct  386  SMDTDNSGAITLEELKTGLAKQGTKLSDYEIQQLMEAADADGNGTIDYEEFITATMHMNR  445

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +++E+HLY AF+YFDKD SGYIT+EELE +L+++ ITD K IK+I+AEVD++NDG+INYD
Sbjct  446  MDKEEHLYTAFQYFDKDNSGYITVEELEQALREFGITDGKDIKDIVAEVDSNNDGRINYD  505

Query  374  EFVAMMRKGTPD  339
            EFVAMM+KGTPD
Sbjct  506  EFVAMMKKGTPD  517



>tpg|DAA62901.2| TPA: putative calcium-dependent protein kinase family protein 
isoform 1 [Zea mays]
Length=140

 Score =   197 bits (501),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            ++DTD+SGTITYEELKAGL K+G+KLSE+EV+QLMEAADVDGNG+IDY+EFITATMH ++
Sbjct  4    NMDTDNSGTITYEELKAGLAKLGSKLSEAEVKQLMEAADVDGNGSIDYVEFITATMHRHK  63

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +ER++HL+KAF+YFDKD SG+IT +ELE +L ++ + D  TIKEII+EVDTDNDG+INY+
Sbjct  64   LERDEHLFKAFQYFDKDNSGFITRDELESALIEHEMGDTSTIKEIISEVDTDNDGRINYE  123

Query  374  EFVAMMRKG  348
            EF AMMR G
Sbjct  124  EFCAMMRGG  132



>emb|CDP20327.1| unnamed protein product [Coffea canephora]
Length=530

 Score =   209 bits (531),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 116/134 (87%), Gaps = 0/134 (0%)
 Frame = -2

Query  731  IDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNRV  552
            +DTD+SGTIT EELK GL + GTKLSE EV+QLMEAAD DGNGTIDY EFITATMH+NR+
Sbjct  386  MDTDNSGTITLEELKQGLAEQGTKLSEYEVKQLMEAADADGNGTIDYEEFITATMHLNRM  445

Query  551  EREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYDE  372
            +RE+HLY AF+YFDKD SGYIT+EELE +L+ + ++D K IKEII+EVD DNDG+INYDE
Sbjct  446  DREEHLYTAFQYFDKDNSGYITIEELEQALRDFGMSDGKDIKEIISEVDADNDGRINYDE  505

Query  371  FVAMMRKGTPDLVT  330
            FVAMM+KG PD  T
Sbjct  506  FVAMMKKGQPDAPT  519



>ref|XP_008449648.1| PREDICTED: calcium-dependent protein kinase 34-like [Cucumis 
melo]
Length=535

 Score =   209 bits (531),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT EELK GL K GTKLSE EV+QLMEAAD DGNGTIDY EFITATMH+NR
Sbjct  393  SMDTDNSGTITLEELKQGLAKQGTKLSEYEVKQLMEAADADGNGTIDYDEFITATMHLNR  452

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            ++RE+HLY AF+YFDKD SGYIT EELE +L++Y + D + IKEI++EVD DNDG+INYD
Sbjct  453  MDREEHLYTAFQYFDKDNSGYITTEELEQALREYGMHDGRDIKEILSEVDADNDGRINYD  512

Query  374  EFVAMMRKGTPD  339
            EFVAMMRKG P+
Sbjct  513  EFVAMMRKGNPE  524



>gb|KHN23929.1| Calcium-dependent protein kinase 17 [Glycine soja]
Length=474

 Score =   207 bits (527),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 115/135 (85%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
             +DTD+SGTIT EELK GL K GTKL+E EV+QLMEAAD DGNGTIDY EFITATMHMNR
Sbjct  328  GMDTDNSGTITIEELKQGLAKQGTKLTEQEVKQLMEAADADGNGTIDYDEFITATMHMNR  387

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            + RE+HLY AF+YFDKD SG+IT EELE +L++YN+ D + IKEI+ EVD DNDG+INYD
Sbjct  388  MNREEHLYTAFQYFDKDNSGFITTEELEQALREYNMHDGRDIKEILQEVDGDNDGRINYD  447

Query  374  EFVAMMRKGTPDLVT  330
            EF AMMRKG P+++T
Sbjct  448  EFAAMMRKGNPEVMT  462



>ref|XP_010519813.1| PREDICTED: calcium-dependent protein kinase 34 isoform X1 [Tarenaya 
hassleriana]
Length=562

 Score =   209 bits (532),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = -2

Query  731  IDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNRV  552
            +DTD+SGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTIDY EFI ATMH+NR+
Sbjct  420  MDTDNSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTIDYGEFIAATMHINRL  479

Query  551  EREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYDE  372
            +RE+HLY AF++FDKD SGYITMEELE +L+++ ++D + IKEII+EVD+DNDG+INYDE
Sbjct  480  DREEHLYSAFQHFDKDNSGYITMEELEQALREFGMSDGRDIKEIISEVDSDNDGRINYDE  539

Query  371  FVAMMRKGTPD  339
            FVAMMRKG PD
Sbjct  540  FVAMMRKGNPD  550



>ref|XP_009630031.1| PREDICTED: calcium-dependent protein kinase 17-like [Nicotiana 
tomentosiformis]
Length=536

 Score =   208 bits (530),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 118/132 (89%), Gaps = 0/132 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SG IT EELK GL K GTKLS+ E++QLMEAAD DGNGTIDY EFITATMHMNR
Sbjct  391  SMDTDNSGAITLEELKQGLAKQGTKLSDYEIQQLMEAADADGNGTIDYEEFITATMHMNR  450

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +++E+HLY AF+YFDKD SGYIT+EELE +L+++ +TD K IKEI+AEVD++NDG+INY+
Sbjct  451  MDKEEHLYTAFQYFDKDNSGYITIEELEQALREFGMTDGKDIKEIVAEVDSNNDGRINYE  510

Query  374  EFVAMMRKGTPD  339
            EFVAMMRKGTP+
Sbjct  511  EFVAMMRKGTPE  522



>ref|XP_011090473.1| PREDICTED: calcium-dependent protein kinase 17-like [Sesamum 
indicum]
Length=488

 Score =   207 bits (527),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 117/135 (87%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+D+D +GTIT EEL+ GL K GTKLSE EV+QLMEAAD DGNGTIDY EFITATMHMNR
Sbjct  343  SMDSDGNGTITLEELRQGLAKQGTKLSEYEVKQLMEAADADGNGTIDYEEFITATMHMNR  402

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            ++RE+HLY AF+YFDKD SGYIT+EELE +L+++ + D K IKEI++EVDTDNDG+INYD
Sbjct  403  MDREEHLYTAFQYFDKDNSGYITIEELEQALREFGMGDGKDIKEIVSEVDTDNDGRINYD  462

Query  374  EFVAMMRKGTPDLVT  330
            EF AMM+KG P++V 
Sbjct  463  EFAAMMKKGNPEIVA  477



>gb|KJB09335.1| hypothetical protein B456_001G135000 [Gossypium raimondii]
Length=513

 Score =   207 bits (528),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
             +DTD+SGTIT EELK GL K GTKLSE EV+QLMEAAD DGNGTIDY EFITATMHMNR
Sbjct  371  GMDTDNSGTITLEELKQGLAKQGTKLSEYEVKQLMEAADADGNGTIDYDEFITATMHMNR  430

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            ++REDHLY AF++FDKD SGYIT EEL+ +L++Y + D++ IKEII+EVD DNDG+INYD
Sbjct  431  MDREDHLYHAFQHFDKDNSGYITTEELDQALREYGMHDDQDIKEIISEVDIDNDGRINYD  490

Query  374  EFVAMMRKGTPD  339
            EFVAMMRKG P+
Sbjct  491  EFVAMMRKGNPE  502



>gb|EPS70504.1| calcium dependent protein kinase 25 [Genlisea aurea]
Length=527

 Score =   208 bits (529),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 116/135 (86%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
             +DTD+SGTIT EELK GLT  GTKL+E+EV+QL+EAAD DGNGTIDY EFITATMHMNR
Sbjct  381  GMDTDNSGTITLEELKHGLTNQGTKLTETEVKQLLEAADSDGNGTIDYEEFITATMHMNR  440

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            ++RE+HLY AF+YFDKD SGYIT+EELE +L+ Y + D K I EI++EVD DNDG+INYD
Sbjct  441  MDREEHLYTAFQYFDKDNSGYITIEELEQALRDYGMADGKNITEIVSEVDADNDGRINYD  500

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMM+KG P+LV 
Sbjct  501  EFVAMMKKGNPELVA  515



>emb|CDX97174.1| BnaC09g44510D [Brassica napus]
 emb|CDX69700.1| BnaA10g20490D [Brassica napus]
Length=522

 Score =   208 bits (529),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 115/135 (85%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
             +DTD+SGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTIDY EFI ATMH+NR
Sbjct  379  GMDTDNSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTIDYGEFIAATMHINR  438

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            ++RE+HLY AF++FDKD SGYITMEELE +L+++ + D + IKEII+EVD DNDG+INYD
Sbjct  439  LDREEHLYSAFQHFDKDNSGYITMEELEQALREFGMNDGRDIKEIISEVDGDNDGRINYD  498

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMMRKG PD + 
Sbjct  499  EFVAMMRKGNPDPIP  513



>ref|XP_011096067.1| PREDICTED: calcium-dependent protein kinase-like [Sesamum indicum]
Length=541

 Score =   208 bits (529),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/134 (72%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            +IDTD SGTITYEELK+GL ++G+KLSE+EV+QLMEAADVDGNGTIDY+EFITATMH ++
Sbjct  405  NIDTDRSGTITYEELKSGLARLGSKLSEAEVKQLMEAADVDGNGTIDYIEFITATMHRHK  464

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +ER++HL+KAF++FDKD SGYIT +ELE ++K+Y + DE TIKEII+EVDTDNDG+INY+
Sbjct  465  LERDEHLFKAFQFFDKDSSGYITRDELETAMKEYGMGDEATIKEIISEVDTDNDGRINYE  524

Query  374  EFVAMMRKGTPDLV  333
            EF AMMR GT   V
Sbjct  525  EFCAMMRSGTQQQV  538



>emb|CDX70450.1| BnaC03g05340D [Brassica napus]
Length=523

 Score =   207 bits (528),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 115/135 (85%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
             +DTD SGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTIDY EFI ATMH+NR
Sbjct  380  GMDTDSSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTIDYGEFIAATMHINR  439

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            ++RE+HLY AF++FDKD SGYITMEELE +L+++ ++D + IKEII+EVD DNDG+INYD
Sbjct  440  LDREEHLYSAFQHFDKDNSGYITMEELEQALREFGMSDGRDIKEIISEVDGDNDGRINYD  499

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMMRKG PD + 
Sbjct  500  EFVAMMRKGNPDPIP  514



>ref|XP_009131258.1| PREDICTED: calcium-dependent protein kinase 17-like [Brassica 
rapa]
Length=523

 Score =   207 bits (528),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 95/134 (71%), Positives = 115/134 (86%), Gaps = 0/134 (0%)
 Frame = -2

Query  731  IDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNRV  552
            +DTD SGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTIDY EFI ATMH+NR+
Sbjct  381  MDTDSSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTIDYGEFIAATMHINRL  440

Query  551  EREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYDE  372
            +RE+HLY AF++FDKD SGYITMEELE +L+++ ++D + IKEII+EVD DNDG+INYDE
Sbjct  441  DREEHLYSAFQHFDKDNSGYITMEELEQALREFGMSDGRDIKEIISEVDGDNDGRINYDE  500

Query  371  FVAMMRKGTPDLVT  330
            FVAMMRKG PD + 
Sbjct  501  FVAMMRKGNPDQIP  514



>gb|KJB21813.1| hypothetical protein B456_004G015100 [Gossypium raimondii]
Length=538

 Score =   208 bits (529),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 116/132 (88%), Gaps = 0/132 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            +ID+D+SGTIT EELK GL K GTKL+E EV+QLMEAAD D NGTIDY EFITATMHMNR
Sbjct  391  TIDSDNSGTITLEELKQGLAKQGTKLTEYEVKQLMEAADADSNGTIDYEEFITATMHMNR  450

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            ++RE+HLY+AF++FDKD SGYIT+EELE +L++Y + D K IKEII+EVD DNDGKINYD
Sbjct  451  MDREEHLYRAFQHFDKDNSGYITIEELEQALREYGMHDGKDIKEIISEVDNDNDGKINYD  510

Query  374  EFVAMMRKGTPD  339
            EFVAMMR+G P+
Sbjct  511  EFVAMMRRGNPE  522



>ref|XP_003556786.1| PREDICTED: calcium-dependent protein kinase 17-like [Glycine 
max]
Length=546

 Score =   208 bits (529),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 115/135 (85%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
             +DTD+SGTIT EELK GL K GTKL+E EV+QLMEAAD DGNGTIDY EFITATMHMNR
Sbjct  400  GMDTDNSGTITIEELKQGLAKQGTKLTEQEVKQLMEAADADGNGTIDYDEFITATMHMNR  459

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            + RE+HLY AF+YFDKD SG+IT EELE +L++YN+ D + IKEI+ EVD DNDG+INYD
Sbjct  460  MNREEHLYTAFQYFDKDNSGFITTEELEQALREYNMHDGRDIKEILQEVDGDNDGRINYD  519

Query  374  EFVAMMRKGTPDLVT  330
            EF AMMRKG P+++T
Sbjct  520  EFAAMMRKGNPEVMT  534



>emb|CDX78468.1| BnaA03g03800D [Brassica napus]
Length=523

 Score =   207 bits (528),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 95/134 (71%), Positives = 115/134 (86%), Gaps = 0/134 (0%)
 Frame = -2

Query  731  IDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNRV  552
            +DTD SGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTIDY EFI ATMH+NR+
Sbjct  381  MDTDSSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTIDYGEFIAATMHINRL  440

Query  551  EREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYDE  372
            +RE+HLY AF++FDKD SGYITMEELE +L+++ ++D + IKEII+EVD DNDG+INYDE
Sbjct  441  DREEHLYSAFQHFDKDNSGYITMEELEQALREFGMSDGRDIKEIISEVDGDNDGRINYDE  500

Query  371  FVAMMRKGTPDLVT  330
            FVAMMRKG PD + 
Sbjct  501  FVAMMRKGNPDQIP  514



>gb|AHG06449.1| calcium-dependent protein kinase 17 [Brassica napus]
Length=523

 Score =   207 bits (528),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 95/134 (71%), Positives = 115/134 (86%), Gaps = 0/134 (0%)
 Frame = -2

Query  731  IDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNRV  552
            +DTD SGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTIDY EFI ATMH+NR+
Sbjct  381  MDTDSSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTIDYGEFIAATMHINRL  440

Query  551  EREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYDE  372
            +RE+HLY AF++FDKD SGYITMEELE +L+++ ++D + IKEII+EVD DNDG+INYDE
Sbjct  441  DREEHLYSAFQHFDKDNSGYITMEELEQALREFGMSDGRDIKEIISEVDGDNDGRINYDE  500

Query  371  FVAMMRKGTPDLVT  330
            FVAMMRKG PD + 
Sbjct  501  FVAMMRKGNPDQIP  514



>gb|KFK26202.1| hypothetical protein AALP_AA8G215800 [Arabis alpina]
Length=523

 Score =   207 bits (528),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
             +DTD SGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTIDY EFI ATMH+NR
Sbjct  380  GMDTDSSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTIDYGEFIAATMHINR  439

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            ++RE+HLY AF++FDKD SGYITMEELE +L+++ + D + IKEII+EVD+DNDG+INYD
Sbjct  440  LDREEHLYSAFQHFDKDNSGYITMEELEQALREFGMNDGRDIKEIISEVDSDNDGRINYD  499

Query  374  EFVAMMRKGTPD  339
            EFVAMMRKG PD
Sbjct  500  EFVAMMRKGNPD  511



>gb|ACY78680.1| calcium-dependent protein kinase 1 [Panax ginseng]
Length=549

 Score =   208 bits (529),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            +IDTD+SGTITYEELK+GL ++G+KLSE+EV+QLMEAADVDGNGTIDY+EFITATMH ++
Sbjct  412  NIDTDNSGTITYEELKSGLARLGSKLSEAEVQQLMEAADVDGNGTIDYIEFITATMHRHK  471

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +ER++HLYKAF+YFDKD SG+IT +ELE ++K+Y + DE TIKEII+EVDTDNDG+INY+
Sbjct  472  LERDEHLYKAFQYFDKDSSGFITRDELESAMKEYGMGDEATIKEIISEVDTDNDGRINYE  531

Query  374  EFVAMMRKGT  345
            EF  MMR GT
Sbjct  532  EFCTMMRSGT  541



>ref|XP_007015253.1| Calcium-dependent protein kinase 17 [Theobroma cacao]
 gb|EOY32872.1| Calcium-dependent protein kinase 17 [Theobroma cacao]
Length=535

 Score =   207 bits (528),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
             +DTD+SGTIT EELK GL K GTKLSE EV+QLMEAAD DGNGTIDY EFITATMHMNR
Sbjct  393  GMDTDNSGTITLEELKQGLAKQGTKLSEYEVKQLMEAADADGNGTIDYDEFITATMHMNR  452

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            ++REDHLY AF++FDKD SGYIT EELE  L++Y + D + IKEI++EVD+DNDG+INYD
Sbjct  453  MDREDHLYHAFQHFDKDNSGYITTEELEQVLREYGMHDGRDIKEILSEVDSDNDGRINYD  512

Query  374  EFVAMMRKGTPD  339
            EFVAMMRKG P+
Sbjct  513  EFVAMMRKGNPE  524



>ref|XP_009121874.1| PREDICTED: calcium-dependent protein kinase 17 [Brassica rapa]
Length=522

 Score =   207 bits (527),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
             +DTD SGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTIDY EFI ATMH+NR
Sbjct  379  GMDTDSSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTIDYGEFIAATMHINR  438

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            ++RE+HLY AF++FDKD SGYITMEELE +L+++ + D + IKEII+EVD DNDG+INYD
Sbjct  439  LDREEHLYSAFQHFDKDNSGYITMEELEQALREFGMNDGRDIKEIISEVDGDNDGRINYD  498

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMMRKG PD + 
Sbjct  499  EFVAMMRKGNPDPIP  513



>dbj|BAA81748.1| calcium-dependent protein kinase [Marchantia polymorpha]
 dbj|BAA81750.1| calcium-dependent protein kinase [Marchantia polymorpha]
Length=548

 Score =   207 bits (528),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT+EELK GL K G+ L+ESEVRQLM AADVDG+GTIDYLEFITATMH+N+
Sbjct  393  SMDTDNSGTITFEELKDGLQKQGSNLAESEVRQLMAAADVDGDGTIDYLEFITATMHLNK  452

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +++EDHLY AF++FD D SG+ITMEELE +L K+ + D  T+KEII EVDTD+DG+INYD
Sbjct  453  IDKEDHLYAAFQHFDGDNSGFITMEELEQALIKHGMGDPDTLKEIIREVDTDHDGRINYD  512

Query  374  EFVAMMRKGTP  342
            EFVAMMRKGTP
Sbjct  513  EFVAMMRKGTP  523



>ref|XP_006413708.1| hypothetical protein EUTSA_v100267671mg, partial [Eutrema salsugineum]
 gb|ESQ55161.1| hypothetical protein EUTSA_v100267671mg, partial [Eutrema salsugineum]
Length=218

 Score =   199 bits (505),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 117/129 (91%), Gaps = 1/129 (1%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            ++DTD SGTITYEELK GL K+G+KLSE+EV+QLMEAADVDGNGTIDY+EF++ATMH   
Sbjct  57   NMDTDQSGTITYEELKTGLAKLGSKLSEAEVKQLMEAADVDGNGTIDYIEFMSATMH-RY  115

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            ++R++HL+KAF+YFDKD SG+ITM+ELE ++K+Y++ DE +IKEIIAEVDTDNDG+INY+
Sbjct  116  IDRDEHLFKAFQYFDKDNSGFITMDELESAMKEYDMGDEASIKEIIAEVDTDNDGRINYE  175

Query  374  EFVAMMRKG  348
            EF AMMR G
Sbjct  176  EFCAMMRSG  184



>gb|KFK25494.1| hypothetical protein AALP_AA8G122000 [Arabis alpina]
Length=528

 Score =   207 bits (527),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
             +DTD SGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTIDY EFI ATMH+NR
Sbjct  385  GMDTDSSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTIDYGEFIAATMHINR  444

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            ++RE+HLY AF++FDKD SGYITMEELE +L+++ + D + IKEII+EVD DNDG+INYD
Sbjct  445  LDREEHLYSAFQHFDKDNSGYITMEELEQALREFGMNDGRDIKEIISEVDGDNDGRINYD  504

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMMRKG PD + 
Sbjct  505  EFVAMMRKGNPDPIP  519



>gb|AAL59948.1| putative calcium-dependent protein kinase [Arabidopsis thaliana]
Length=528

 Score =   207 bits (527),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 95/134 (71%), Positives = 114/134 (85%), Gaps = 0/134 (0%)
 Frame = -2

Query  731  IDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNRV  552
            +DTD SGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTIDY EFI ATMH+NR+
Sbjct  386  MDTDSSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTIDYGEFIAATMHINRL  445

Query  551  EREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYDE  372
            +RE+HLY AF++FDKD SGYITMEELE +L+++ + D + IKEII+EVD DNDG+INYDE
Sbjct  446  DREEHLYSAFQHFDKDNSGYITMEELEQALREFGMNDGRDIKEIISEVDGDNDGRINYDE  505

Query  371  FVAMMRKGTPDLVT  330
            FVAMMRKG PD + 
Sbjct  506  FVAMMRKGNPDPIP  519



>ref|XP_010673770.1| PREDICTED: calcium-dependent protein kinase 17-like [Beta vulgaris 
subsp. vulgaris]
Length=534

 Score =   207 bits (527),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+D D+SG+IT EELK G+ K GTKLSE EV+QLMEAAD DGNGTIDY EFITATMHMNR
Sbjct  391  SMDADNSGSITLEELKQGMQKQGTKLSEYEVKQLMEAADADGNGTIDYEEFITATMHMNR  450

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            ++RE+HLY AF+YFDKD SGYITMEELE +L+++ + D + IKEI++EVD DNDG+INYD
Sbjct  451  MDREEHLYTAFQYFDKDNSGYITMEELEQALQEFGMHDGRDIKEIVSEVDGDNDGRINYD  510

Query  374  EFVAMMRKGTPD  339
            EFVAMMRKG P+
Sbjct  511  EFVAMMRKGNPE  522



>ref|NP_196779.1| calcium-dependent protein kinase 17 [Arabidopsis thaliana]
 sp|Q9FMP5.1|CDPKH_ARATH RecName: Full=Calcium-dependent protein kinase 17 [Arabidopsis 
thaliana]
 dbj|BAB10036.1| calcium-dependent protein kinase [Arabidopsis thaliana]
 gb|AAU95457.1| At5g12180 [Arabidopsis thaliana]
 gb|AED91771.1| calcium-dependent protein kinase 17 [Arabidopsis thaliana]
Length=528

 Score =   207 bits (527),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
             +DTD SGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTIDY EFI ATMH+NR
Sbjct  385  GMDTDSSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTIDYGEFIAATMHINR  444

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            ++RE+HLY AF++FDKD SGYITMEELE +L+++ + D + IKEII+EVD DNDG+INYD
Sbjct  445  LDREEHLYSAFQHFDKDNSGYITMEELEQALREFGMNDGRDIKEIISEVDGDNDGRINYD  504

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMMRKG PD + 
Sbjct  505  EFVAMMRKGNPDPIP  519



>ref|XP_006289327.1| hypothetical protein CARUB_v10002812mg [Capsella rubella]
 gb|EOA22225.1| hypothetical protein CARUB_v10002812mg [Capsella rubella]
Length=530

 Score =   207 bits (527),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
             +DTD SGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTIDY EFI ATMH+NR
Sbjct  387  GMDTDSSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTIDYGEFIAATMHINR  446

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            ++RE+HLY AF++FDKD SGYITMEELE +L+++ + D + IKEII+EVD DNDG+INYD
Sbjct  447  LDREEHLYSAFQHFDKDNSGYITMEELEQALREFGMNDGRDIKEIISEVDGDNDGRINYD  506

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMMRKG PD + 
Sbjct  507  EFVAMMRKGNPDPIP  521



>ref|XP_002871516.1| calcium-dependent protein kinase 17 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47775.1| calcium-dependent protein kinase 17 [Arabidopsis lyrata subsp. 
lyrata]
Length=530

 Score =   207 bits (527),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
             +DTD SGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTIDY EFI ATMH+NR
Sbjct  387  GMDTDSSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTIDYGEFIAATMHINR  446

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            ++RE+HLY AF++FDKD SGYITMEELE +L+++ + D + IKEII+EVD DNDG+INYD
Sbjct  447  LDREEHLYSAFQHFDKDNSGYITMEELEQALREFGMNDGRDIKEIISEVDGDNDGRINYD  506

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMMRKG PD + 
Sbjct  507  EFVAMMRKGNPDPIP  521



>ref|XP_011080420.1| PREDICTED: calcium-dependent protein kinase 34-like [Sesamum 
indicum]
Length=532

 Score =   207 bits (527),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 116/132 (88%), Gaps = 0/132 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
             +D+D+SGTIT EELK GL K GTKLSE EV+QLMEAAD DGNGTIDY EFITATMHMNR
Sbjct  386  GMDSDNSGTITLEELKRGLAKQGTKLSEYEVKQLMEAADADGNGTIDYEEFITATMHMNR  445

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +++E+HLY AF+YFDKDKSGYIT+EELE +L+++ + D K IK+II+EVD+DNDG+INYD
Sbjct  446  MDKEEHLYTAFQYFDKDKSGYITVEELEQALREFGMDDGKDIKDIISEVDSDNDGRINYD  505

Query  374  EFVAMMRKGTPD  339
            EF AMMRKG PD
Sbjct  506  EFAAMMRKGNPD  517



>ref|NP_001234806.1| calcium-dependent protein kinase [Solanum lycopersicum]
 emb|CAC87494.1| calcium-dependent protein kinase [Solanum lycopersicum]
Length=553

 Score =   207 bits (528),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            +IDTD+SGTITYEELK+GL ++G+KL+E+EV+QLMEAADVDGNG+IDY+EFITATMH +R
Sbjct  416  NIDTDNSGTITYEELKSGLARLGSKLTETEVKQLMEAADVDGNGSIDYIEFITATMHRHR  475

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +ER++HL+KAF++FDKD SG+IT +ELE+++K+Y + DE TIKEIIAEVDTDNDG+INY+
Sbjct  476  LERDEHLFKAFQHFDKDHSGFITRDELENAMKEYGMGDEATIKEIIAEVDTDNDGRINYE  535

Query  374  EFVAMMRKGT  345
            EF AMMR GT
Sbjct  536  EFCAMMRSGT  545



>gb|AGG35954.1| calcium-dependent protein kinase 34 [Brassica napus]
Length=484

 Score =   206 bits (524),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
             +DTDDSGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTIDY EFI ATMH+NR
Sbjct  341  GMDTDDSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTIDYGEFIAATMHINR  400

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            ++RE+HLY AF++FDKD SGYITMEELE +L+++ + D + IKEII+EVD DNDG+INY+
Sbjct  401  LDREEHLYSAFQHFDKDNSGYITMEELEQALREFGMNDGRDIKEIISEVDGDNDGRINYE  460

Query  374  EFVAMMRKGTPD  339
            EFVAMMRKG PD
Sbjct  461  EFVAMMRKGNPD  472



>emb|CDY44912.1| BnaA02g04170D [Brassica napus]
Length=517

 Score =   207 bits (526),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
             +DTDDSGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTIDY EFI ATMH+NR
Sbjct  374  GMDTDDSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTIDYGEFIAATMHINR  433

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            ++RE+HLY AF++FDKD SGYITMEELE +L+++ + D + IKEII+EVD DNDG+INY+
Sbjct  434  LDREEHLYSAFQHFDKDNSGYITMEELEQALREFGMNDGRDIKEIISEVDGDNDGRINYE  493

Query  374  EFVAMMRKGTPD  339
            EFVAMMRKG PD
Sbjct  494  EFVAMMRKGNPD  505



>ref|XP_011095398.1| PREDICTED: calcium-dependent protein kinase 33-like [Sesamum 
indicum]
Length=523

 Score =   207 bits (526),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            ++DTD+SGTITYEELKAGL ++G+KL+E+EVRQLM+AADVDGNG+IDY+EFITATMH +R
Sbjct  387  NMDTDNSGTITYEELKAGLARLGSKLTEAEVRQLMDAADVDGNGSIDYIEFITATMHRHR  446

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +ERE++LYKAF+YFDKD SG+IT +ELE ++++Y I D  TIKEIIAEVDTDNDG+INY+
Sbjct  447  LEREENLYKAFQYFDKDSSGFITRDELETAMQEYGIGDASTIKEIIAEVDTDNDGRINYE  506

Query  374  EFVAMMRKGTP  342
            EF  MMR G P
Sbjct  507  EFCTMMRTGNP  517



>ref|XP_006475136.1| PREDICTED: calcium-dependent protein kinase 9-like [Citrus sinensis]
Length=680

 Score =   209 bits (533),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            +IDTD+SGTITYEELKAGL ++G+KL+E+EV+QLMEAADVDGNGTIDY+EFITATMH ++
Sbjct  393  NIDTDNSGTITYEELKAGLARLGSKLTEAEVQQLMEAADVDGNGTIDYIEFITATMHRHK  452

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +ER+DHLYKAF++FDKD SG+IT++ELE ++K Y + D+ TIKEII+EVDTDNDG+INYD
Sbjct  453  LERDDHLYKAFQHFDKDNSGFITIDELEIAMKDYGMGDDDTIKEIISEVDTDNDGRINYD  512

Query  374  EFVAMMRKGT  345
            EF AMMR GT
Sbjct  513  EFCAMMRSGT  522


 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 59/93 (63%), Gaps = 4/93 (4%)
 Frame = -2

Query  614  DGNGTIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSG---YITMEELEHSLKKYNIT  444
            D +G I Y EF  AT+ M      D  +K  E F         +IT++ELE ++K Y + 
Sbjct  582  DSDGRISYEEF-CATIAMRLAFDRDQRFKVTELFSFSLQCLYRFITIDELEIAMKDYGMG  640

Query  443  DEKTIKEIIAEVDTDNDGKINYDEFVAMMRKGT  345
            D+ TIKEII+EVDTDNDG+INYDEF AMMR GT
Sbjct  641  DDDTIKEIISEVDTDNDGRINYDEFCAMMRSGT  673



>emb|CDY63783.1| BnaCnng42690D [Brassica napus]
Length=517

 Score =   206 bits (525),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
             +DTDDSGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTIDY EFI ATMH+NR
Sbjct  374  GMDTDDSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTIDYGEFIAATMHINR  433

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            ++RE+HLY AF++FDKD SGYITMEELE +L+++ + D + IKEII+EVD DNDG+INY+
Sbjct  434  LDREEHLYSAFQHFDKDNSGYITMEELEQALREFGMNDGRDIKEIISEVDGDNDGRINYE  493

Query  374  EFVAMMRKGTPD  339
            EFVAMMRKG PD
Sbjct  494  EFVAMMRKGNPD  505



>ref|XP_009126355.1| PREDICTED: calcium-dependent protein kinase 34 [Brassica rapa]
Length=517

 Score =   206 bits (525),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
             +DTDDSGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTIDY EFI ATMH+NR
Sbjct  374  GMDTDDSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTIDYGEFIAATMHINR  433

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            ++RE+HLY AF++FDKD SGYITMEELE +L+++ + D + IKEII+EVD DNDG+INY+
Sbjct  434  LDREEHLYSAFQHFDKDNSGYITMEELEQALREFGMNDGRDIKEIISEVDGDNDGRINYE  493

Query  374  EFVAMMRKGTPD  339
            EFVAMMRKG PD
Sbjct  494  EFVAMMRKGNPD  505



>ref|XP_012065867.1| PREDICTED: calcium-dependent protein kinase 34 [Jatropha curcas]
Length=538

 Score =   207 bits (526),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
             IDTD+SGTIT EELK GL K GTKLSE EV+QLMEAAD DGNGTIDY EFITATMHMNR
Sbjct  395  GIDTDNSGTITLEELKQGLAKQGTKLSEFEVKQLMEAADADGNGTIDYDEFITATMHMNR  454

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            ++RE+HLY AF++FDKD SG+IT EELE +L++Y + D + IKEII+EVD DNDG+INYD
Sbjct  455  MDREEHLYTAFQHFDKDNSGFITTEELEQALREYGMHDGRDIKEIISEVDGDNDGRINYD  514

Query  374  EFVAMMRKGTPD  339
            EFVAMMRKG P+
Sbjct  515  EFVAMMRKGNPE  526



>ref|XP_009412989.1| PREDICTED: calcium-dependent protein kinase 17-like [Musa acuminata 
subsp. malaccensis]
Length=523

 Score =   206 bits (525),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            ++D+D+SGTIT EELK GL K GTKLSE EV+QLMEAAD DGNGTIDY EFITAT+HMNR
Sbjct  381  NMDSDNSGTITLEELKQGLAKQGTKLSEHEVKQLMEAADADGNGTIDYEEFITATVHMNR  440

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            ++RE+HLY AF+YFDKD SGYITMEELE +LK+  + DEK IK+II+E D DNDG+INYD
Sbjct  441  MDREEHLYTAFQYFDKDNSGYITMEELEQALKEKGLYDEKEIKDIISEADVDNDGRINYD  500

Query  374  EFVAMMRKGTPD  339
            EF AMMRKG P+
Sbjct  501  EFAAMMRKGNPE  512



>ref|XP_009796949.1| PREDICTED: calcium-dependent protein kinase 34-like [Nicotiana 
sylvestris]
Length=537

 Score =   207 bits (526),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 118/132 (89%), Gaps = 0/132 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SG IT EELK GL K GTKLS+ E++QLMEAAD DGNGTIDY EFITATMHMNR
Sbjct  392  SMDTDNSGAITLEELKQGLAKQGTKLSDYEIQQLMEAADADGNGTIDYEEFITATMHMNR  451

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +++E+HLY AF+YFDKD SG+IT+EELE +L+++ +TD K IKEI+AEVD++NDG+INY+
Sbjct  452  MDKEEHLYTAFQYFDKDNSGFITVEELEQALREFGMTDGKDIKEIVAEVDSNNDGRINYE  511

Query  374  EFVAMMRKGTPD  339
            EFVAMMRKGTP+
Sbjct  512  EFVAMMRKGTPE  523



>gb|KDP43197.1| hypothetical protein JCGZ_22749 [Jatropha curcas]
Length=531

 Score =   206 bits (525),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
             IDTD+SGTIT EELK GL K GTKLSE EV+QLMEAAD DGNGTIDY EFITATMHMNR
Sbjct  388  GIDTDNSGTITLEELKQGLAKQGTKLSEFEVKQLMEAADADGNGTIDYDEFITATMHMNR  447

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            ++RE+HLY AF++FDKD SG+IT EELE +L++Y + D + IKEII+EVD DNDG+INYD
Sbjct  448  MDREEHLYTAFQHFDKDNSGFITTEELEQALREYGMHDGRDIKEIISEVDGDNDGRINYD  507

Query  374  EFVAMMRKGTPD  339
            EFVAMMRKG P+
Sbjct  508  EFVAMMRKGNPE  519



>emb|CDX91168.1| BnaC02g04290D [Brassica napus]
Length=523

 Score =   206 bits (525),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
             +DTD SGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTIDY EFI ATMH+NR
Sbjct  320  GMDTDSSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTIDYGEFIAATMHINR  379

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            ++RE+HLY AF++FDKD SGYITMEELE +L+++ + D + IKEII+EVD DNDG+INYD
Sbjct  380  LDREEHLYSAFQHFDKDNSGYITMEELEQALREFGMNDGRDIKEIISEVDGDNDGRINYD  439

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMMRKG PD + 
Sbjct  440  EFVAMMRKGNPDPIP  454



>ref|XP_007153943.1| hypothetical protein PHAVU_003G078400g [Phaseolus vulgaris]
 gb|ESW25937.1| hypothetical protein PHAVU_003G078400g [Phaseolus vulgaris]
Length=546

 Score =   207 bits (526),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            ++DTD+SGTITYEELK GL ++G++LSE+EV+QLMEAADVDGNG+IDYLEFI+ATMH +R
Sbjct  403  NMDTDNSGTITYEELKTGLARIGSRLSEAEVKQLMEAADVDGNGSIDYLEFISATMHRHR  462

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +ER++HLYKAF+YFDKD SGYIT +ELE ++ ++ + DE TIKEII+EVDTDNDG+INY+
Sbjct  463  LERDEHLYKAFQYFDKDNSGYITRDELETAMTQHGMGDEATIKEIISEVDTDNDGRINYE  522

Query  374  EFVAMMRKGTP  342
            EF AMMR G P
Sbjct  523  EFCAMMRSGMP  533



>ref|XP_009120894.1| PREDICTED: calcium-dependent protein kinase 34 [Brassica rapa]
 emb|CDX92536.1| BnaA10g15750D [Brassica napus]
Length=517

 Score =   206 bits (524),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
             +DTDDSGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTIDY EFI ATMH+NR
Sbjct  372  GMDTDDSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTIDYGEFIAATMHINR  431

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            ++RE+HL+ AF++FDKD SGYITMEELE +L+++ ++D + IKEII+EVD DNDG+INY+
Sbjct  432  LDREEHLFSAFQHFDKDNSGYITMEELEQALREFGMSDGRDIKEIISEVDGDNDGRINYE  491

Query  374  EFVAMMRKGTPD  339
            EFVAMMRKG PD
Sbjct  492  EFVAMMRKGNPD  503



>ref|XP_008227265.1| PREDICTED: calcium-dependent protein kinase 34-like [Prunus mume]
Length=534

 Score =   206 bits (525),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 112/132 (85%), Gaps = 0/132 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            SIDTD+SGTIT EELK GL K GTKLSE E +QLMEAAD DGNGTIDY EFITATMH+NR
Sbjct  391  SIDTDNSGTITLEELKQGLAKQGTKLSEFEAKQLMEAADADGNGTIDYDEFITATMHLNR  450

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            ++RE+HLY AF++FDKD SGYIT EELE +L++Y + D + I EIIAEVD DNDG+INYD
Sbjct  451  MDREEHLYTAFQHFDKDNSGYITTEELEQALREYGMHDGRDILEIIAEVDADNDGRINYD  510

Query  374  EFVAMMRKGTPD  339
            EF AMMRKG PD
Sbjct  511  EFCAMMRKGNPD  522



>emb|CAG27840.1| calcium-dependent protein kinase 17 [Nicotiana plumbaginifolia]
Length=534

 Score =   206 bits (525),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 117/132 (89%), Gaps = 0/132 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SG IT EELK GL K GTKLS+ E+ QLMEAAD DGNGTIDY EFITATMHMNR
Sbjct  389  SMDTDNSGAITLEELKQGLAKQGTKLSDHEIEQLMEAADADGNGTIDYEEFITATMHMNR  448

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +++E+HLY AF+YFDKD SG+IT+EELE +L+++ +TD K IKEI+AEVD++NDG+INY+
Sbjct  449  MDKEEHLYTAFQYFDKDNSGFITIEELEQALREFGMTDGKDIKEIVAEVDSNNDGRINYE  508

Query  374  EFVAMMRKGTPD  339
            EFVAMMRKGTP+
Sbjct  509  EFVAMMRKGTPE  520



>ref|XP_006349794.1| PREDICTED: calcium-dependent protein kinase 17-like isoform X1 
[Solanum tuberosum]
 ref|XP_006349795.1| PREDICTED: calcium-dependent protein kinase 17-like isoform X2 
[Solanum tuberosum]
 ref|XP_006349796.1| PREDICTED: calcium-dependent protein kinase 17-like isoform X3 
[Solanum tuberosum]
 ref|XP_010314698.1| PREDICTED: calcium-dependent protein kinase 17-like isoform X2 
[Solanum lycopersicum]
 ref|XP_010314699.1| PREDICTED: calcium-dependent protein kinase 17-like isoform X2 
[Solanum lycopersicum]
Length=500

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/134 (72%), Positives = 116/134 (87%), Gaps = 0/134 (0%)
 Frame = -2

Query  731  IDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNRV  552
            IDTD+SGTIT EELK GL K G KLS+ E++QLME+AD DGNGTIDY EFITATM MN++
Sbjct  356  IDTDNSGTITLEELKQGLAKQGNKLSDYEIKQLMESADADGNGTIDYEEFITATMQMNKM  415

Query  551  EREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYDE  372
            +RE+HLYKAF+YFDKD SGYITMEELE +L ++ + D K IKEII+EVD+DNDG+INYDE
Sbjct  416  DREEHLYKAFQYFDKDSSGYITMEELEQALIEFGMNDAKDIKEIISEVDSDNDGRINYDE  475

Query  371  FVAMMRKGTPDLVT  330
            FVAMM+KG P++ T
Sbjct  476  FVAMMKKGNPEVAT  489



>gb|KDO78217.1| hypothetical protein CISIN_1g009091mg [Citrus sinensis]
Length=544

 Score =   206 bits (525),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            ++DTD SGTITYEELK GL ++G+KLSE+EV+QLM+AADVDGNGTIDY+EFI+ATMH  R
Sbjct  408  NMDTDKSGTITYEELKTGLARLGSKLSETEVKQLMDAADVDGNGTIDYIEFISATMHRYR  467

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +ER++HLYKAF+YFDKD SGYIT +ELE ++K Y I DE +IKEII+EVDTDNDG+INY+
Sbjct  468  LERDEHLYKAFQYFDKDNSGYITRDELETAMKDYGIGDEASIKEIISEVDTDNDGRINYE  527

Query  374  EFVAMMRKGTP  342
            EF  MMR GTP
Sbjct  528  EFCTMMRSGTP  538



>ref|XP_006467440.1| PREDICTED: calcium-dependent protein kinase 21-like [Citrus sinensis]
Length=544

 Score =   206 bits (525),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            ++DTD SGTITYEELK GL ++G+KLSE+EV+QLM+AADVDGNGTIDY+EFI+ATMH  R
Sbjct  408  NMDTDKSGTITYEELKTGLARLGSKLSETEVKQLMDAADVDGNGTIDYIEFISATMHRYR  467

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +ER++HLYKAF+YFDKD SGYIT +ELE ++K Y I DE +IKEII+EVDTDNDG+INY+
Sbjct  468  LERDEHLYKAFQYFDKDNSGYITRDELETAMKDYGIGDEASIKEIISEVDTDNDGRINYE  527

Query  374  EFVAMMRKGTP  342
            EF  MMR GTP
Sbjct  528  EFCTMMRSGTP  538



>ref|XP_003610427.1| Calcium-dependent protein kinase [Medicago truncatula]
 gb|AES92624.1| calmodulin-domain kinase CDPK protein [Medicago truncatula]
Length=539

 Score =   206 bits (525),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            ++DTD SGTITYEELK GL ++G++LSE+EV+QLMEAADVDGNG+IDYLEFI+ATMH +R
Sbjct  403  NMDTDSSGTITYEELKTGLARIGSRLSEAEVKQLMEAADVDGNGSIDYLEFISATMHRHR  462

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +ER++HLYKAF+YFDKD SG+IT EELE ++ K+ + DE TIKEII+EVDTDNDG+INY+
Sbjct  463  LERDEHLYKAFQYFDKDNSGHITREELETAMTKHGMGDEATIKEIISEVDTDNDGRINYE  522

Query  374  EFVAMMRKGTP  342
            EF AMMR G P
Sbjct  523  EFCAMMRSGMP  533



>ref|XP_008384073.1| PREDICTED: calcium-dependent protein kinase 33-like [Malus domestica]
Length=397

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            ++DTD+SGTITYEELK GL ++G++LSE+EVRQLM+AADVDGNG+IDY+EFI+ATMH  R
Sbjct  261  NMDTDNSGTITYEELKTGLARIGSRLSETEVRQLMDAADVDGNGSIDYIEFISATMHRQR  320

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +ER++HLYKAF+YFDKD SGYIT +ELE ++K+Y + D+ TI+EII+EVD DNDGKINY 
Sbjct  321  LERDEHLYKAFQYFDKDSSGYITRDELEAAMKEYGMGDDNTIREIISEVDADNDGKINYS  380

Query  374  EFVAMMRKGT  345
            EF AMMR GT
Sbjct  381  EFCAMMRSGT  390



>ref|XP_010536137.1| PREDICTED: calcium-dependent protein kinase 17 [Tarenaya hassleriana]
Length=521

 Score =   206 bits (524),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 114/131 (87%), Gaps = 0/131 (0%)
 Frame = -2

Query  731  IDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNRV  552
            +DTD+SGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTIDY EFI ATMH+NR+
Sbjct  379  MDTDNSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTIDYGEFIAATMHINRL  438

Query  551  EREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYDE  372
            +RE+HLY AF++FDKD SGYITMEELE +L+++ + D + I EII+EVD+DNDG+INYDE
Sbjct  439  DREEHLYSAFQHFDKDNSGYITMEELEQALREFGMNDGRDITEIISEVDSDNDGRINYDE  498

Query  371  FVAMMRKGTPD  339
            FVAMMRKG PD
Sbjct  499  FVAMMRKGNPD  509



>ref|XP_004252886.1| PREDICTED: calcium-dependent protein kinase 17-like isoform X1 
[Solanum lycopersicum]
Length=535

 Score =   206 bits (525),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/134 (72%), Positives = 116/134 (87%), Gaps = 0/134 (0%)
 Frame = -2

Query  731  IDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNRV  552
            IDTD+SGTIT EELK GL K G KLS+ E++QLME+AD DGNGTIDY EFITATM MN++
Sbjct  391  IDTDNSGTITLEELKQGLAKQGNKLSDYEIKQLMESADADGNGTIDYEEFITATMQMNKM  450

Query  551  EREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYDE  372
            +RE+HLYKAF+YFDKD SGYITMEELE +L ++ + D K IKEII+EVD+DNDG+INYDE
Sbjct  451  DREEHLYKAFQYFDKDSSGYITMEELEQALIEFGMNDAKDIKEIISEVDSDNDGRINYDE  510

Query  371  FVAMMRKGTPDLVT  330
            FVAMM+KG P++ T
Sbjct  511  FVAMMKKGNPEVAT  524



>ref|XP_006449723.1| hypothetical protein CICLE_v10014823mg [Citrus clementina]
 gb|ESR62963.1| hypothetical protein CICLE_v10014823mg [Citrus clementina]
Length=544

 Score =   206 bits (525),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            ++DTD SGTITYEELK GL ++G+KLSE+EV+QLM+AADVDGNGTIDY+EFI+ATMH  R
Sbjct  408  NMDTDKSGTITYEELKTGLARLGSKLSETEVKQLMDAADVDGNGTIDYIEFISATMHRYR  467

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +ER++HLYKAF+YFDKD SGYIT +ELE ++K Y I DE +IKEII+EVDTDNDG+INY+
Sbjct  468  LERDEHLYKAFQYFDKDNSGYITRDELETAMKDYGIGDEASIKEIISEVDTDNDGRINYE  527

Query  374  EFVAMMRKGTP  342
            EF  MMR GTP
Sbjct  528  EFCTMMRSGTP  538



>emb|CDY13993.1| BnaC09g38330D [Brassica napus]
Length=517

 Score =   206 bits (524),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
             +DTDDSGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTIDY EFI ATMH+NR
Sbjct  372  GMDTDDSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTIDYGEFIAATMHINR  431

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            ++RE+HL+ AF++FDKD SGYITMEELE +L+++ ++D + IKEII+EVD DNDG+INY+
Sbjct  432  LDREEHLFSAFQHFDKDNSGYITMEELEQALREFGMSDGRDIKEIISEVDGDNDGRINYE  491

Query  374  EFVAMMRKGTPD  339
            EFVAMMRKG PD
Sbjct  492  EFVAMMRKGNPD  503



>gb|ADZ52811.1| calcium-dependent protein kinase 3 [Solanum tuberosum]
Length=554

 Score =   206 bits (525),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            +IDTD+SGTITYEELK+GL ++G+KL+E+EV+QLMEAADVDGNGTIDY+EFITATMH +R
Sbjct  417  NIDTDNSGTITYEELKSGLARLGSKLTETEVKQLMEAADVDGNGTIDYIEFITATMHRHR  476

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +ER++HL+KAF++FDKD SG+IT +ELE+++K+Y + DE TIKEII EVDTDNDG+INY+
Sbjct  477  LERDEHLFKAFQHFDKDHSGFITRDELENAMKEYGMGDEATIKEIITEVDTDNDGRINYE  536

Query  374  EFVAMMRKGT  345
            EF AMMR GT
Sbjct  537  EFCAMMRSGT  546



>ref|XP_007026066.1| Calcium-dependent protein kinase 21 isoform 1 [Theobroma cacao]
 gb|EOY28688.1| Calcium-dependent protein kinase 21 isoform 1 [Theobroma cacao]
Length=538

 Score =   206 bits (525),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            ++DTD SGTITYEELKAGL ++G+KLSE+EV+QLM+AADVDGNGTIDY+EFI+ATMH  R
Sbjct  402  NMDTDKSGTITYEELKAGLARLGSKLSEAEVKQLMQAADVDGNGTIDYIEFISATMHRYR  461

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +ER++HLYKAF+YFDKD SGYIT +ELE ++K+Y + DE +I+E+I+EVDTDNDGKINY+
Sbjct  462  LERDEHLYKAFQYFDKDNSGYITKDELETAMKEYGMGDEASIREVISEVDTDNDGKINYE  521

Query  374  EFVAMMRKGT  345
            EF  MMR GT
Sbjct  522  EFCTMMRSGT  531



>dbj|BAE71239.1| putative calcium dependent protein kinase [Trifolium pratense]
Length=558

 Score =   207 bits (526),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            ++DTD SGTITYEELK+GL ++G++LSE EV+QLMEAADVDGNG+IDYLEFI+ATMH +R
Sbjct  422  NMDTDGSGTITYEELKSGLARIGSRLSEPEVKQLMEAADVDGNGSIDYLEFISATMHRHR  481

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +ER++HLYKAF+YFDKD SG+IT EELE ++ K+ + DE TIKEII+EVDTDNDG+INY+
Sbjct  482  LERDEHLYKAFQYFDKDNSGHITREELETAMTKHGMGDEATIKEIISEVDTDNDGRINYE  541

Query  374  EFVAMMRKGTP  342
            EF AMMR G P
Sbjct  542  EFCAMMRSGMP  552



>gb|KHN35744.1| Calcium-dependent protein kinase 33 [Glycine soja]
Length=404

 Score =   203 bits (516),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            ++DTD SGTITYEELK GL ++G++LSE+EV+QLM+AADVDGNG+IDYLEFI+ATMH +R
Sbjct  268  NMDTDSSGTITYEELKTGLARIGSRLSEAEVKQLMDAADVDGNGSIDYLEFISATMHRHR  327

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +ER++HLYKAF+YFDKD SGYIT +ELE ++ ++ + DE TIKEII+EVDTDNDG+INY+
Sbjct  328  LERDEHLYKAFQYFDKDNSGYITRDELETAMTQHGMGDEATIKEIISEVDTDNDGRINYE  387

Query  374  EFVAMMRKGTP  342
            EF AMMR G P
Sbjct  388  EFCAMMRSGMP  398



>gb|KJB68586.1| hypothetical protein B456_010G252400 [Gossypium raimondii]
Length=527

 Score =   206 bits (524),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            +IDTD+SG+ITYEELK GL ++G+KL+E+EV+QLMEAADVDGNGTIDY+EFI+ATMH  R
Sbjct  391  NIDTDESGSITYEELKEGLARLGSKLTEAEVKQLMEAADVDGNGTIDYIEFISATMHRYR  450

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +ER++ LYKAF+YFDKD SG+ITM+ELE ++K Y + DE +IK+II+EVDTDNDGKINYD
Sbjct  451  LERDEDLYKAFQYFDKDNSGFITMDELEAAMKDYRMGDEASIKQIISEVDTDNDGKINYD  510

Query  374  EFVAMMRKGTP  342
            EF AMMR G P
Sbjct  511  EFCAMMRGGAP  521



>ref|XP_010106395.1| Calcium-dependent protein kinase 17 [Morus notabilis]
 gb|EXC10389.1| Calcium-dependent protein kinase 17 [Morus notabilis]
Length=538

 Score =   206 bits (524),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            ++DTD+SGTIT EELK GL K GT+LSE EV+QLMEAAD DGNGTIDY EFITATMHMNR
Sbjct  395  AMDTDNSGTITLEELKQGLAKQGTRLSELEVKQLMEAADADGNGTIDYDEFITATMHMNR  454

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            ++RE+HLY AF++FDKD SG+IT EELE +L+++ + D + IKEII+EVD DNDG+INYD
Sbjct  455  MDREEHLYTAFQHFDKDNSGFITTEELEQALREFGMHDGRDIKEIISEVDADNDGRINYD  514

Query  374  EFVAMMRKGTPD  339
            EFVAMMRKG PD
Sbjct  515  EFVAMMRKGNPD  526



>ref|XP_009135461.1| PREDICTED: calcium-dependent protein kinase 15 [Brassica rapa]
Length=573

 Score =   207 bits (526),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            ++DTD SGTITYEELK GL ++G+KLSE+EV+QLMEAADVDGNGTIDY+EFI+ATMH  R
Sbjct  429  NMDTDQSGTITYEELKTGLARLGSKLSEAEVKQLMEAADVDGNGTIDYIEFISATMHRYR  488

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            ++R++HL+KAF+YFDKD SG+ITM+ELE ++K+Y + DE +IKE+IAEVDTDNDG+INY+
Sbjct  489  LDRDEHLFKAFQYFDKDNSGFITMDELESAMKEYGMGDETSIKEVIAEVDTDNDGRINYE  548

Query  374  EFVAMMRKGT  345
            EF AMMR GT
Sbjct  549  EFCAMMRSGT  558



>gb|ACR36994.1| unknown [Zea mays]
Length=140

 Score =   194 bits (494),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            ++DTD+SGTITYEELKAGL K+G+KLSE+EV+QLMEAADVDGNG+IDY+EFITATMH ++
Sbjct  4    NMDTDNSGTITYEELKAGLAKLGSKLSEAEVKQLMEAADVDGNGSIDYVEFITATMHRHK  63

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +ER+++L+KAF+YFDKD SG+IT +ELE +L ++ + D  TIKEII+EVDTDNDG+INY+
Sbjct  64   LERDEYLFKAFQYFDKDNSGFITRDELESALIEHEMGDTSTIKEIISEVDTDNDGRINYE  123

Query  374  EFVAMMRKG  348
            EF AMMR G
Sbjct  124  EFCAMMRGG  132



>ref|XP_010099802.1| Calcium-dependent protein kinase 17 [Morus notabilis]
 gb|EXB80470.1| Calcium-dependent protein kinase 17 [Morus notabilis]
Length=538

 Score =   206 bits (524),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            ++DTD+SGTIT EELK GL K GT+LSE EV+QLMEAAD DGNGTIDY EFITATMHMNR
Sbjct  395  AMDTDNSGTITLEELKQGLAKQGTRLSELEVKQLMEAADADGNGTIDYDEFITATMHMNR  454

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            ++RE+HLY AF++FDKD SG+IT EELE +L+++ + D + IKEII+EVD DNDG+INYD
Sbjct  455  MDREEHLYTAFQHFDKDNSGFITTEELEQALREFGMHDGRDIKEIISEVDADNDGRINYD  514

Query  374  EFVAMMRKGTPD  339
            EFVAMMRKG PD
Sbjct  515  EFVAMMRKGNPD  526



>emb|CDX79112.1| BnaA01g11790D [Brassica napus]
Length=563

 Score =   206 bits (525),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            ++DTD SGTITYEELK GL ++G+KLSE+EV+QLMEAADVDGNGTIDY+EFI+ATMH  R
Sbjct  419  NMDTDQSGTITYEELKTGLARLGSKLSEAEVKQLMEAADVDGNGTIDYIEFISATMHRYR  478

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            ++R++HL+KAF+YFDKD SG+ITM+ELE ++K+Y + DE +IKE+IAEVDTDNDG+INY+
Sbjct  479  LDRDEHLFKAFQYFDKDNSGFITMDELESAMKEYGMGDETSIKEVIAEVDTDNDGRINYE  538

Query  374  EFVAMMRKGT  345
            EF AMMR GT
Sbjct  539  EFCAMMRSGT  548



>ref|XP_006399734.1| hypothetical protein EUTSA_v10013236mg [Eutrema salsugineum]
 gb|ESQ41187.1| hypothetical protein EUTSA_v10013236mg [Eutrema salsugineum]
Length=528

 Score =   206 bits (523),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
             +DTD SGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTIDY EFI ATMH+NR
Sbjct  385  GMDTDSSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTIDYGEFIAATMHINR  444

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            ++RE+HLY AF++FDKD SGYITMEELE +L+++ + D + IKEII+EVD DNDG+INY+
Sbjct  445  LDREEHLYSAFQHFDKDNSGYITMEELEQALREFGMNDGRDIKEIISEVDGDNDGRINYE  504

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMMRKG PD + 
Sbjct  505  EFVAMMRKGNPDPIP  519



>ref|XP_010419805.1| PREDICTED: calcium-dependent protein kinase 17-like isoform X1 
[Camelina sativa]
 ref|XP_010491975.1| PREDICTED: calcium-dependent protein kinase 17-like [Camelina 
sativa]
Length=527

 Score =   206 bits (523),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
             +DTD SGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTIDY EFI ATMH+NR
Sbjct  384  GMDTDSSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTIDYGEFIAATMHINR  443

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +++E+HLY AF++FDKD SGYITMEELE +L+++ + D + IKEII+EVD DNDG+INYD
Sbjct  444  LDKEEHLYSAFQHFDKDNSGYITMEELEQALREFGMNDGRDIKEIISEVDGDNDGRINYD  503

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMMRKG PD + 
Sbjct  504  EFVAMMRKGNPDPIP  518



>ref|XP_010492994.1| PREDICTED: calcium-dependent protein kinase 34-like [Camelina 
sativa]
Length=525

 Score =   206 bits (523),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
             +DTD+SGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTIDY EFI ATMH+NR
Sbjct  382  GMDTDNSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTIDYGEFIAATMHINR  441

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            ++RE+HLY AF++FDKD SGYITMEELE +L+++ + D + IKEII+EVD DNDG+INY+
Sbjct  442  LDREEHLYSAFQHFDKDNSGYITMEELEQALREFGMNDGRDIKEIISEVDGDNDGRINYE  501

Query  374  EFVAMMRKGTPD  339
            EFVAMMRKG PD
Sbjct  502  EFVAMMRKGNPD  513



>gb|AET00506.2| calcium-dependent kinase [Medicago truncatula]
Length=540

 Score =   206 bits (523),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            ++DTD SGTITYEEL+AGL ++G+KL+E+EVRQLMEAADVDGNGTIDY+EFITATMH +R
Sbjct  404  NMDTDKSGTITYEELRAGLQRLGSKLTEAEVRQLMEAADVDGNGTIDYIEFITATMHRHR  463

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +ER++HLYKAF+YFDKD SG+IT +ELE ++K+Y + DE+TI+EII+EVDTDNDG+INY+
Sbjct  464  LERDEHLYKAFQYFDKDNSGFITRDELETAMKEYGMGDEETIREIISEVDTDNDGRINYE  523

Query  374  EFVAMMRKGT  345
            EF  MMR G 
Sbjct  524  EFCTMMRSGV  533



>ref|XP_010453282.1| PREDICTED: calcium-dependent protein kinase 17 [Camelina sativa]
Length=530

 Score =   206 bits (523),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
             +DTD SGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTIDY EFI ATMH+NR
Sbjct  387  GMDTDSSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTIDYGEFIAATMHINR  446

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +++E+HLY AF++FDKD SGYITMEELE +L+++ + D + IKEII+EVD DNDG+INYD
Sbjct  447  LDKEEHLYSAFQHFDKDNSGYITMEELEQALREFGMNDGRDIKEIISEVDGDNDGRINYD  506

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMMRKG PD + 
Sbjct  507  EFVAMMRKGNPDPIP  521



>ref|XP_002313265.1| calcium-dependent protein kinase [Populus trichocarpa]
 gb|EEE87220.1| calcium-dependent protein kinase [Populus trichocarpa]
Length=525

 Score =   206 bits (523),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
             +DTD+SGTIT EELK GL K GTKLSE EV+QLMEAAD DGNGTIDY EFITATMHMNR
Sbjct  382  GMDTDNSGTITLEELKQGLAKQGTKLSEYEVKQLMEAADADGNGTIDYDEFITATMHMNR  441

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            ++RE+HLY AF++FDKD SGYIT EELE +L+++ + D + IKEII+EVD DNDG+INYD
Sbjct  442  MDREEHLYTAFQHFDKDNSGYITTEELEQALREFGMHDGRDIKEIISEVDADNDGRINYD  501

Query  374  EFVAMMRKGTPD  339
            EFVAMMRKG P+
Sbjct  502  EFVAMMRKGNPE  513



>ref|XP_010420737.1| PREDICTED: calcium-dependent protein kinase 34-like [Camelina 
sativa]
Length=523

 Score =   205 bits (522),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
             +DTD+SGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTIDY EFI ATMH+NR
Sbjct  380  GMDTDNSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTIDYGEFIAATMHINR  439

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            ++RE+HLY AF++FDKD SGYITMEELE +L+++ + D + IKEII+EVD DNDG+INY+
Sbjct  440  LDREEHLYSAFQHFDKDNSGYITMEELEQALREFGMNDGRDIKEIISEVDGDNDGRINYE  499

Query  374  EFVAMMRKGTPD  339
            EFVAMMRKG PD
Sbjct  500  EFVAMMRKGNPD  511



>ref|XP_010454209.1| PREDICTED: calcium-dependent protein kinase 34 [Camelina sativa]
Length=523

 Score =   205 bits (522),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
             +DTD+SGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTIDY EFI ATMH+NR
Sbjct  380  GMDTDNSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTIDYGEFIAATMHINR  439

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            ++RE+HLY AF++FDKD SGYITMEELE +L+++ + D + IKEII+EVD DNDG+INY+
Sbjct  440  LDREEHLYSAFQHFDKDNSGYITMEELEQALREFGMNDGRDIKEIISEVDGDNDGRINYE  499

Query  374  EFVAMMRKGTPD  339
            EFVAMMRKG PD
Sbjct  500  EFVAMMRKGNPD  511



>ref|XP_002873943.1| calcium-dependent protein kinase 34 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50202.1| calcium-dependent protein kinase 34 [Arabidopsis lyrata subsp. 
lyrata]
Length=525

 Score =   205 bits (522),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
             +DTD+SGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTIDY EFI ATMH+NR
Sbjct  382  GMDTDNSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTIDYGEFIAATMHINR  441

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            ++RE+HLY AF++FDKD SGYITMEELE +L+++ + D + IKEII+EVD DNDG+INY+
Sbjct  442  LDREEHLYSAFQHFDKDNSGYITMEELEQALREFGMNDGRDIKEIISEVDGDNDGRINYE  501

Query  374  EFVAMMRKGTPD  339
            EFVAMMRKG PD
Sbjct  502  EFVAMMRKGNPD  513



>ref|XP_010419806.1| PREDICTED: calcium-dependent protein kinase 17-like isoform X2 
[Camelina sativa]
Length=528

 Score =   205 bits (522),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
             +DTD SGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTIDY EFI ATMH+NR
Sbjct  385  GMDTDSSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTIDYGEFIAATMHINR  444

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +++E+HLY AF++FDKD SGYITMEELE +L+++ + D + IKEII+EVD DNDG+INYD
Sbjct  445  LDKEEHLYSAFQHFDKDNSGYITMEELEQALREFGMNDGRDIKEIISEVDGDNDGRINYD  504

Query  374  EFVAMMRKGTPDLVT  330
            EFVAMMRKG PD + 
Sbjct  505  EFVAMMRKGNPDPIP  519



>ref|XP_002526062.1| calcium-dependent protein kinase, putative [Ricinus communis]
 gb|EEF36339.1| calcium-dependent protein kinase, putative [Ricinus communis]
Length=536

 Score =   205 bits (522),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
             IDTD+SGTIT EELK GL K GTKLSE EV+QLMEAAD DGNGTIDY EFITATMH+NR
Sbjct  393  GIDTDNSGTITLEELKQGLAKQGTKLSEYEVKQLMEAADADGNGTIDYDEFITATMHLNR  452

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            ++RE+HLY AF++FDKD SGYIT EELE +L++Y + D + IKEII+EVD+D+DG+INYD
Sbjct  453  MDREEHLYTAFQHFDKDNSGYITTEELEQALREYGMHDGRDIKEIISEVDSDHDGRINYD  512

Query  374  EFVAMMRKGTPD  339
            EFVAMMRKG P+
Sbjct  513  EFVAMMRKGNPE  524



>ref|XP_004140192.1| PREDICTED: calcium-dependent protein kinase 34 [Cucumis sativus]
 gb|KGN48093.1| hypothetical protein Csa_6G430690 [Cucumis sativus]
Length=535

 Score =   205 bits (522),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD+SGTIT EELK GL K GTKLSE EV+QLMEAAD DGNGTIDY EFITATMH+NR
Sbjct  393  SMDTDNSGTITLEELKQGLAKQGTKLSEYEVKQLMEAADADGNGTIDYDEFITATMHLNR  452

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            ++RE+HLY AF+YFDKD SG+IT EELE +L++Y + D + IKEI++EVD DNDG INYD
Sbjct  453  MDREEHLYTAFQYFDKDNSGFITTEELEQALREYGMHDGRDIKEILSEVDGDNDGHINYD  512

Query  374  EFVAMMRKGTPD  339
            EFVAMMRKG P+
Sbjct  513  EFVAMMRKGNPE  524



>ref|XP_008439982.1| PREDICTED: calcium-dependent protein kinase 2 [Cucumis melo]
Length=552

 Score =   206 bits (523),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            +IDTD+SGTITYEELK GL ++G++LSE+EV+QLMEAADVDGNG+IDY+EFI+ATMH +R
Sbjct  416  NIDTDNSGTITYEELKTGLARLGSRLSEAEVKQLMEAADVDGNGSIDYIEFISATMHRHR  475

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +ER++HLYKAF++FDKD SGYIT +ELE ++K Y + DE +I+EII+EVDTDNDG+INY 
Sbjct  476  LERDEHLYKAFQFFDKDSSGYITKDELETAMKDYGMGDEASIREIISEVDTDNDGRINYQ  535

Query  374  EFVAMMRKGT  345
            EF AMMR GT
Sbjct  536  EFCAMMRSGT  545



>ref|XP_006400491.1| hypothetical protein EUTSA_v10013240mg [Eutrema salsugineum]
 gb|ESQ41944.1| hypothetical protein EUTSA_v10013240mg [Eutrema salsugineum]
Length=527

 Score =   205 bits (522),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
             +DTD+SGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTIDY EFI ATMH+NR
Sbjct  384  GMDTDNSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTIDYGEFIAATMHINR  443

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            ++RE+HLY AF++FDKD SGYITMEELE +L+++ + D + IKEII+EVD DNDG+INY+
Sbjct  444  LDREEHLYSAFQHFDKDNSGYITMEELEQALREFGMNDGRDIKEIISEVDGDNDGRINYE  503

Query  374  EFVAMMRKGTPD  339
            EFVAMMRKG PD
Sbjct  504  EFVAMMRKGNPD  515



>ref|XP_010031714.1| PREDICTED: calcium-dependent protein kinase 34-like [Eucalyptus 
grandis]
 gb|KCW51080.1| hypothetical protein EUGRSUZ_J00686 [Eucalyptus grandis]
Length=534

 Score =   205 bits (522),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = -2

Query  731  IDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNRV  552
            +DTD+SGTIT EELK GL+K GT+LSE EV+QLMEAAD DGNGTIDY EFI ATMHMNR+
Sbjct  393  MDTDNSGTITLEELKQGLSKQGTRLSEYEVKQLMEAADADGNGTIDYDEFIAATMHMNRM  452

Query  551  EREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYDE  372
            +RE+HLY AF+YFDKD SG+IT EELE +L+ + + D + IKEI++EVD DNDG+INYDE
Sbjct  453  DREEHLYTAFQYFDKDNSGFITTEELEQALRDFGMHDGRDIKEILSEVDADNDGRINYDE  512

Query  371  FVAMMRKGTPD  339
            FVAMMRKG PD
Sbjct  513  FVAMMRKGNPD  523



>ref|XP_010434101.1| PREDICTED: LOW QUALITY PROTEIN: calcium-dependent protein kinase 
15-like [Camelina sativa]
Length=556

 Score =   206 bits (523),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            ++DTD SGTITYEELK GL ++G+KL+E+EV+QLMEAADVDGNGTIDY+EFI+ATMH  R
Sbjct  415  NMDTDKSGTITYEELKTGLARLGSKLTEAEVKQLMEAADVDGNGTIDYIEFISATMHRYR  474

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
             +R++H++KAF+YFDKD SG+ITM+ELE ++KKY + DE +IKEIIAEVDTDNDG+INY+
Sbjct  475  FDRDEHVFKAFQYFDKDNSGFITMDELESAMKKYGMGDEASIKEIIAEVDTDNDGRINYE  534

Query  374  EFVAMMRKGT  345
            EF AMMR GT
Sbjct  535  EFCAMMRSGT  544



>ref|XP_006389625.1| hypothetical protein POPTR_0021s00750g [Populus trichocarpa]
 gb|ERP48539.1| hypothetical protein POPTR_0021s00750g [Populus trichocarpa]
 emb|CEH19767.1| Calcium-dependent protein kinase [Populus tremula x Populus tremuloides]
Length=532

 Score =   205 bits (522),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            ++DTD SGTITYEELK GL ++G+KLSE+EV+QLMEAADVDGNG+IDY+EFI+ATMH  +
Sbjct  396  NMDTDKSGTITYEELKTGLARLGSKLSEAEVKQLMEAADVDGNGSIDYIEFISATMHRYK  455

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +ER++HLYKAF+YFDKD SGYIT +ELE ++K+Y + DE TIKEIIAEVD DNDGKINY+
Sbjct  456  LERDEHLYKAFQYFDKDSSGYITRDELESAMKEYGMGDEATIKEIIAEVDADNDGKINYE  515

Query  374  EFVAMMRKGT  345
            EF AMMR GT
Sbjct  516  EFCAMMRSGT  525



>gb|EYU46187.1| hypothetical protein MIMGU_mgv1a004352mg [Erythranthe guttata]
Length=531

 Score =   205 bits (522),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
             +DTD+SGTIT EELK GL K GTKLSE EV+QLMEAAD DGNGTIDY EFITATMHMNR
Sbjct  385  GMDTDNSGTITLEELKQGLAKQGTKLSEYEVKQLMEAADADGNGTIDYEEFITATMHMNR  444

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            ++RE+HLY AF+YFDKD SGYIT+EELE +L++  + D K I+EII+EVD DNDG+INYD
Sbjct  445  MDREEHLYTAFQYFDKDNSGYITIEELEQALREMGMEDGKDIREIISEVDGDNDGRINYD  504

Query  374  EFVAMMRKGTPD  339
            EF AMM+KG PD
Sbjct  505  EFAAMMKKGNPD  516



>ref|XP_010538709.1| PREDICTED: calcium-dependent protein kinase 21-like [Tarenaya 
hassleriana]
Length=545

 Score =   205 bits (522),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            ++DTD SGTITYEELK GL ++G+KLSESEV+QLMEAADVDGNGTIDY+EFI+AT H  R
Sbjct  405  NMDTDKSGTITYEELKTGLARLGSKLSESEVKQLMEAADVDGNGTIDYIEFISATTHRYR  464

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +ER+DHLYKAF+YFDKD SGYIT +ELE ++K+Y + DE +I+E+IAEVDTDNDG+INY+
Sbjct  465  MERDDHLYKAFQYFDKDNSGYITRDELETAMKEYGMGDEASIREVIAEVDTDNDGRINYE  524

Query  374  EFVAMMRKGT  345
            EF AMMR G+
Sbjct  525  EFCAMMRSGS  534



>ref|XP_010092160.1| Calcium-dependent protein kinase 9 [Morus notabilis]
 gb|EXB50311.1| Calcium-dependent protein kinase 9 [Morus notabilis]
Length=548

 Score =   206 bits (523),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            +IDTD+SGTITY+ELK+GL ++G+KL+E+EV+QLMEAADVDGNGTIDY+EFITATMH +R
Sbjct  412  NIDTDNSGTITYDELKSGLARLGSKLTETEVKQLMEAADVDGNGTIDYIEFITATMHRHR  471

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +ERE+HL+KAF++FDKD SG+IT +ELE ++K Y + DE TI+EII+EVDTDNDG+INY 
Sbjct  472  LEREEHLFKAFQFFDKDSSGFITRDELETAMKDYGMGDEATIREIISEVDTDNDGRINYS  531

Query  374  EFVAMMRKGT  345
            EF AMMR GT
Sbjct  532  EFCAMMRSGT  541



>ref|XP_009125853.1| PREDICTED: calcium-dependent protein kinase 17-like [Brassica 
rapa]
Length=522

 Score =   205 bits (521),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
             +DTD SGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTIDY EFI ATMH+NR
Sbjct  379  GMDTDSSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTIDYGEFIAATMHINR  438

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            ++RE+HLY AF++FDKD SGYITMEELE +L+++ + D + IKEII+EVD DNDG+INYD
Sbjct  439  LDREEHLYSAFQHFDKDNSGYITMEELEQALREFGMNDGRDIKEIISEVDGDNDGRINYD  498

Query  374  EFVAMMRKGTPDLVT  330
            EFV MMRKG PD + 
Sbjct  499  EFVTMMRKGNPDPIP  513



>ref|XP_003519577.1| PREDICTED: calcium-dependent protein kinase 9-like isoform 1 
[Glycine max]
Length=528

 Score =   205 bits (521),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            +IDTD+SGTITYEEL+AGL ++G+KL+E+EV+QLM+AADVDGNGTIDY+EFITATMH +R
Sbjct  392  NIDTDNSGTITYEELRAGLQRLGSKLTEAEVQQLMDAADVDGNGTIDYIEFITATMHRHR  451

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +ER++HL+KAF+YFDKD SGYIT +ELE ++K+Y + +E TI+EII+EVDTDNDG+INYD
Sbjct  452  LERDEHLHKAFQYFDKDGSGYITRDELETAMKEYGMGNEATIREIISEVDTDNDGRINYD  511

Query  374  EFVAMMRKGT  345
            EF  MMR GT
Sbjct  512  EFCTMMRSGT  521



>ref|XP_011047988.1| PREDICTED: calcium-dependent protein kinase-like isoform X2 [Populus 
euphratica]
Length=533

 Score =   205 bits (521),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            ++DTD SGTITYEELK GL ++G+KLSE+EV+QLMEAADVDGNG+IDY+EFI+ATMH  +
Sbjct  397  NMDTDKSGTITYEELKTGLARLGSKLSEAEVKQLMEAADVDGNGSIDYIEFISATMHRYK  456

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +ER++HLYKAF+YFDKD SGYIT +ELE ++K+Y + DE TIKEIIAEVD DNDG+INY+
Sbjct  457  LERDEHLYKAFQYFDKDSSGYITRDELESAMKEYGMGDEATIKEIIAEVDADNDGRINYE  516

Query  374  EFVAMMRKGT  345
            EF AMMR GT
Sbjct  517  EFCAMMRSGT  526



>ref|XP_011014420.1| PREDICTED: calcium-dependent protein kinase 34-like [Populus 
euphratica]
Length=525

 Score =   204 bits (520),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
             +DTD+SGTIT EELK GL K GTKLSE EV+QLMEAAD DGNGTIDY EFITATMHMNR
Sbjct  382  GMDTDNSGTITLEELKQGLAKQGTKLSEYEVKQLMEAADADGNGTIDYDEFITATMHMNR  441

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            ++R++HLY AF++FDKD SGYIT EELE +L+++ + D + IKEII+EVD DNDG+INYD
Sbjct  442  MDRQEHLYTAFQHFDKDNSGYITTEELEQALREFGMHDGRDIKEIISEVDADNDGRINYD  501

Query  374  EFVAMMRKGTPD  339
            EFVAMMRKG P+
Sbjct  502  EFVAMMRKGNPE  513



>gb|KJB83565.1| hypothetical protein B456_013G253100 [Gossypium raimondii]
Length=527

 Score =   204 bits (520),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            ++DTD+SGTIT EEL+ GL K GTKLSE EV+QLMEAAD DGNGTIDY EFITATMHMNR
Sbjct  385  AMDTDNSGTITLEELRQGLAKQGTKLSEYEVKQLMEAADADGNGTIDYDEFITATMHMNR  444

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            ++RE+HLY AF++FDKD SGYIT EELE +L++Y I D   IK+I++EVD DNDG+INYD
Sbjct  445  MDREEHLYHAFQHFDKDNSGYITTEELEQALREYGINDSTDIKQILSEVDADNDGRINYD  504

Query  374  EFVAMMRKGTPD  339
            EFVAMM+KG P+
Sbjct  505  EFVAMMKKGNPE  516



>ref|XP_009776253.1| PREDICTED: calcium-dependent protein kinase-like isoform X1 [Nicotiana 
sylvestris]
Length=551

 Score =   205 bits (522),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            ++DTD+SGTITYEELK+GL ++G+KLSE+EV+QLMEAADVDGNGTIDY+EF+TATMH +R
Sbjct  415  NMDTDNSGTITYEELKSGLARLGSKLSEAEVKQLMEAADVDGNGTIDYIEFVTATMHRHR  474

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +ER+DHL+KAF++FD D SG+IT +ELE ++K+Y + DE TIKEIIAEVDTD+DG+INY+
Sbjct  475  LERDDHLFKAFQFFDTDHSGFITKDELESAMKEYGMGDEATIKEIIAEVDTDHDGRINYE  534

Query  374  EFVAMMRKGT  345
            EF AMMR GT
Sbjct  535  EFCAMMRSGT  544



>ref|XP_007213195.1| hypothetical protein PRUPE_ppa026653mg [Prunus persica]
 gb|EMJ14394.1| hypothetical protein PRUPE_ppa026653mg [Prunus persica]
Length=534

 Score =   205 bits (521),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 112/132 (85%), Gaps = 0/132 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            SIDTD+SGTIT EELK GL K GTKLSE E +QLMEAAD DGNGTIDY EFITATMH+NR
Sbjct  391  SIDTDNSGTITLEELKQGLAKQGTKLSEFEAKQLMEAADADGNGTIDYDEFITATMHLNR  450

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            ++RE+HLY AF++FDKD SGYIT EELE +L++Y + D + I EIIAEVD DNDG+INYD
Sbjct  451  MDREEHLYTAFQHFDKDNSGYITTEELEQALREYGMHDGRDILEIIAEVDADNDGRINYD  510

Query  374  EFVAMMRKGTPD  339
            EF AMMRKG P+
Sbjct  511  EFCAMMRKGNPE  522



>ref|XP_004134759.1| PREDICTED: calcium-dependent protein kinase 2-like [Cucumis sativus]
 gb|KGN49114.1| hypothetical protein Csa_6G513780 [Cucumis sativus]
Length=552

 Score =   205 bits (521),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            +IDTD+SGTITYEELK GL ++G++LSE+EV+QLMEAADVDGNG+IDY+EFI+ATMH +R
Sbjct  416  NIDTDNSGTITYEELKTGLARLGSRLSEAEVKQLMEAADVDGNGSIDYIEFISATMHRHR  475

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +ER++HLYKAF++FDKD SGYIT +ELE ++K Y + DE +I+EII+EVDTDNDG+INY 
Sbjct  476  LERDEHLYKAFQFFDKDSSGYITKDELETAMKDYGMGDEASIREIISEVDTDNDGRINYQ  535

Query  374  EFVAMMRKGT  345
            EF AMMR GT
Sbjct  536  EFCAMMRSGT  545



>ref|XP_006289743.1| hypothetical protein CARUB_v10003311mg [Capsella rubella]
 gb|EOA22641.1| hypothetical protein CARUB_v10003311mg [Capsella rubella]
Length=524

 Score =   204 bits (520),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
             +DTD+SGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTIDY EFI ATMH+NR
Sbjct  381  GMDTDNSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTIDYGEFIAATMHINR  440

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            ++RE+H+Y AF++FDKD SGYITMEELE +L+++ + D + IKEII+EVD DNDG+INY+
Sbjct  441  LDREEHIYSAFQHFDKDNSGYITMEELEQALREFGMNDGRDIKEIISEVDGDNDGRINYE  500

Query  374  EFVAMMRKGTPD  339
            EFVAMMRKG PD
Sbjct  501  EFVAMMRKGNPD  512



>gb|AGG35967.1| calcium-dependent protein kinase 15, partial [Brassica napus]
Length=570

 Score =   205 bits (522),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            ++DTD SGTITYEELK GL ++G+KLSE+EV+QLMEAADVDGNGTIDY+EFI+ATMH  R
Sbjct  428  NMDTDQSGTITYEELKTGLARLGSKLSEAEVKQLMEAADVDGNGTIDYIEFISATMHRYR  487

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            ++R++HL+KAF+YFDKD SG+ITM+EL+ ++K+Y + DE +IKE+IAEVDTDNDG+INY+
Sbjct  488  LDRDEHLFKAFQYFDKDNSGFITMDELKSAMKEYGMGDETSIKEVIAEVDTDNDGRINYE  547

Query  374  EFVAMMRKGT  345
            EF AMMR GT
Sbjct  548  EFCAMMRSGT  557



>ref|XP_011047987.1| PREDICTED: calcium-dependent protein kinase-like isoform X1 [Populus 
euphratica]
Length=544

 Score =   204 bits (520),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            ++DTD SGTITYEELK GL ++G+KLSE+EV+QLMEAADVDGNG+IDY+EFI+ATMH  +
Sbjct  408  NMDTDKSGTITYEELKTGLARLGSKLSEAEVKQLMEAADVDGNGSIDYIEFISATMHRYK  467

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +ER++HLYKAF+YFDKD SGYIT +ELE ++K+Y + DE TIKEIIAEVD DNDG+INY+
Sbjct  468  LERDEHLYKAFQYFDKDSSGYITRDELESAMKEYGMGDEATIKEIIAEVDADNDGRINYE  527

Query  374  EFVAMMRKGT  345
            EF AMMR GT
Sbjct  528  EFCAMMRSGT  537



>gb|KJB35709.1| hypothetical protein B456_006G124800 [Gossypium raimondii]
Length=524

 Score =   204 bits (519),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
             +DTD+SGTIT EEL+ GL K GTKLSE EV+QLMEAAD DGNGTIDY EFITATMHMNR
Sbjct  384  GMDTDNSGTITLEELRQGLAKQGTKLSEYEVKQLMEAADADGNGTIDYDEFITATMHMNR  443

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            ++RE+HLY AF++FDKD SG+IT EELE +L++Y + D + +KEII+EVD DNDGKINYD
Sbjct  444  MDREEHLYHAFQHFDKDNSGFITTEELEQALREYGMHDGRDLKEIISEVDIDNDGKINYD  503

Query  374  EFVAMMRKGTP  342
            EFVAMMRKG P
Sbjct  504  EFVAMMRKGNP  514



>ref|XP_008798404.1| PREDICTED: calcium-dependent protein kinase 17-like [Phoenix 
dactylifera]
Length=525

 Score =   204 bits (519),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            S+DTD++GTIT+EELK GL+K G+KLSE EV+QLMEAAD DGNGTIDY EFITATMHMNR
Sbjct  383  SMDTDNNGTITFEELKQGLSKQGSKLSEYEVQQLMEAADADGNGTIDYEEFITATMHMNR  442

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            ++RE+HLY AF+YFDKD SGYIT EELE +LK+  + D + IK+IIAE D DNDG+INYD
Sbjct  443  MDREEHLYTAFQYFDKDNSGYITREELEQALKEKGMYDGRDIKDIIAEADADNDGRINYD  502

Query  374  EFVAMMRKGTPD  339
            EFVAMM+KG P+
Sbjct  503  EFVAMMKKGNPE  514



>ref|XP_002305576.2| hypothetical protein POPTR_0004s01530g [Populus trichocarpa]
 gb|EEE86087.2| hypothetical protein POPTR_0004s01530g [Populus trichocarpa]
Length=532

 Score =   204 bits (520),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            ++DTD SGTITYEELK GL ++G+KLSE+EV+ LMEAADVDGNG+IDY+EFI+ATMH  +
Sbjct  396  NMDTDKSGTITYEELKTGLARLGSKLSEAEVKNLMEAADVDGNGSIDYIEFISATMHRYK  455

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +ER++HLYKAF+YFDKD SGYIT +ELE ++K+Y + DE +IKEIIAEVD DNDG+INY+
Sbjct  456  LERDEHLYKAFQYFDKDSSGYITRDELELAMKEYGMGDESSIKEIIAEVDADNDGRINYE  515

Query  374  EFVAMMRKGTP  342
            EF AMMR GTP
Sbjct  516  EFCAMMRSGTP  526



>emb|CDX82886.1| BnaC01g13360D [Brassica napus]
Length=557

 Score =   205 bits (521),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            ++DTD SGTITYEELK GL ++G+KLSE+EV+QLMEAADVDGNGTIDY+EFI+ATMH  R
Sbjct  413  NMDTDQSGTITYEELKTGLARLGSKLSEAEVKQLMEAADVDGNGTIDYIEFISATMHRYR  472

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            ++R++HL+KAF+YFDKD SG+ITM+EL+ ++K+Y + DE +IKE+IAEVDTDNDG+INY+
Sbjct  473  LDRDEHLFKAFQYFDKDNSGFITMDELKSAMKEYGMGDETSIKEVIAEVDTDNDGRINYE  532

Query  374  EFVAMMRKGT  345
            EF AMMR GT
Sbjct  533  EFCAMMRSGT  542



>ref|XP_002869852.1| hypothetical protein ARALYDRAFT_354567 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46111.1| hypothetical protein ARALYDRAFT_354567 [Arabidopsis lyrata subsp. 
lyrata]
Length=396

 Score =   201 bits (511),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            ++DTD SGTITYEELK GL K+G+KL+E+EV+QLMEAADVDGNGTIDY+EFI+ATMH  R
Sbjct  255  NMDTDKSGTITYEELKTGLAKLGSKLTEAEVKQLMEAADVDGNGTIDYIEFISATMHRYR  314

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
             +R++H++KAF+YFDKD SG+ITM+ELE ++K+Y + DE +IKE+IAEVDTDNDG+INY+
Sbjct  315  FDRDEHVFKAFQYFDKDNSGFITMDELESAMKEYGMGDEASIKEVIAEVDTDNDGRINYE  374

Query  374  EFVAMMRKG  348
            EF AMMR G
Sbjct  375  EFCAMMRSG  383



>ref|XP_011037643.1| PREDICTED: calcium-dependent protein kinase-like [Populus euphratica]
 ref|XP_011037644.1| PREDICTED: calcium-dependent protein kinase-like [Populus euphratica]
 ref|XP_011037646.1| PREDICTED: calcium-dependent protein kinase-like [Populus euphratica]
Length=532

 Score =   204 bits (519),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            ++DTD SGTITYEELK GL ++G+KLSE+EV  LMEAADVDGNG+IDY+EFI+ATMH  +
Sbjct  396  NMDTDKSGTITYEELKTGLARLGSKLSEAEVENLMEAADVDGNGSIDYIEFISATMHRYK  455

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +ERE+HLYKAF+YFDKD SGYIT +ELE ++K+Y + DE +IKEIIAEVD DNDG+INY+
Sbjct  456  LEREEHLYKAFQYFDKDSSGYITRDELELAMKEYGMGDESSIKEIIAEVDADNDGRINYE  515

Query  374  EFVAMMRKGTP  342
            EF AMMR GTP
Sbjct  516  EFCAMMRSGTP  526



>ref|XP_003617233.1| Calcium dependent protein kinase [Medicago truncatula]
 gb|AET00192.1| calmodulin-domain kinase CDPK protein [Medicago truncatula]
Length=523

 Score =   204 bits (519),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 96/134 (72%), Positives = 114/134 (85%), Gaps = 0/134 (0%)
 Frame = -2

Query  731  IDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNRV  552
            +DTD+SGTIT EELK GL K GT+LSE+EV+QLMEAAD DGNG IDY EFITATMHMNR+
Sbjct  381  MDTDNSGTITIEELKQGLAKQGTRLSETEVKQLMEAADADGNGIIDYDEFITATMHMNRL  440

Query  551  EREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYDE  372
             RE+H+Y AF++FDKD SGYIT+EELE +L +YN+ D + IKEII+EVD DNDG+INYDE
Sbjct  441  NREEHVYTAFQFFDKDNSGYITIEELEQALHEYNMHDGRDIKEIISEVDADNDGRINYDE  500

Query  371  FVAMMRKGTPDLVT  330
            FVAMM KG P+  T
Sbjct  501  FVAMMGKGNPEANT  514



>gb|KHN28162.1| Calcium-dependent protein kinase 17 [Glycine soja]
Length=472

 Score =   203 bits (516),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
             +DTD+SGTIT EELK GL K GTKL+E EV+QL+EAAD DGNGTIDY EFITATM MNR
Sbjct  328  GMDTDNSGTITIEELKQGLAKQGTKLTEQEVKQLLEAADADGNGTIDYDEFITATMQMNR  387

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            + RE+HLY AF+YFDKD SG+IT EELE +L++YN+ D + IKEI+ EVD DNDG+INYD
Sbjct  388  MNREEHLYTAFQYFDKDNSGFITTEELEQALREYNMHDGRDIKEILQEVDGDNDGRINYD  447

Query  374  EFVAMMRKGTPDLVT  330
            EF AMMRKG P+++T
Sbjct  448  EFAAMMRKGNPEVMT  462



>ref|XP_007212312.1| hypothetical protein PRUPE_ppa006748mg [Prunus persica]
 gb|EMJ13511.1| hypothetical protein PRUPE_ppa006748mg [Prunus persica]
Length=397

 Score =   201 bits (511),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            ++DTD SGTITYEELK GL ++G++LSE+EVRQLM+AADVDGNG+IDY+EFI+ATMH  R
Sbjct  261  NMDTDKSGTITYEELKTGLARIGSRLSEAEVRQLMDAADVDGNGSIDYIEFISATMHRQR  320

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +ER++HLYKAF+YFDKD SGYIT +ELE ++K++ + DE TI+EII+EVD DNDG+INY 
Sbjct  321  LERDEHLYKAFQYFDKDSSGYITRDELEAAMKEHAMGDENTIREIISEVDADNDGRINYS  380

Query  374  EFVAMMRKGT  345
            EF AMMR GT
Sbjct  381  EFCAMMRSGT  390



>emb|CDP04396.1| unnamed protein product [Coffea canephora]
Length=549

 Score =   204 bits (520),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            +IDTD+SGTITYEELK+GL ++G+KLSE+EV+QLMEAADVDGNG+IDY+EFITATMH +R
Sbjct  413  NIDTDNSGTITYEELKSGLARLGSKLSENEVKQLMEAADVDGNGSIDYIEFITATMHRHR  472

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +ER++HLYKAF++FD D SG+IT +ELE ++ +Y + DE TIKEII+EVDTDNDG+INY+
Sbjct  473  LERDEHLYKAFQHFDTDHSGFITRDELESAMMEYGMGDEATIKEIISEVDTDNDGRINYE  532

Query  374  EFVAMMRKGT  345
            EF AMMR GT
Sbjct  533  EFCAMMRSGT  542



>emb|CDX85697.1| BnaA02g01160D [Brassica napus]
Length=513

 Score =   203 bits (517),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
             +DTD SGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTIDY EFI ATMH+NR
Sbjct  320  GMDTDSSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTIDYGEFIAATMHINR  379

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            ++RE+HLY AF++FDKD SGYITMEELE +L+++ + D + IKEII+EVD DNDG+INYD
Sbjct  380  LDREEHLYSAFQHFDKDNSGYITMEELEQALREFGMNDGRDIKEIISEVDGDNDGRINYD  439

Query  374  EFVAMMRKGTPDLVT  330
            EFV MMRKG PD + 
Sbjct  440  EFVTMMRKGNPDPIP  454



>ref|NP_001275456.1| calcium-dependent protein kinase 3 [Solanum tuberosum]
 gb|AAQ08324.2| calcium-dependent protein kinase 3 [Solanum tuberosum]
Length=558

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            +IDTD+SGTITYEELK+GL ++G+KL+ +EV+QLMEAADVDGNGTIDY+EFITATMH +R
Sbjct  421  NIDTDNSGTITYEELKSGLARLGSKLTGTEVKQLMEAADVDGNGTIDYIEFITATMHRHR  480

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +ER++HL+KAF+ FDKD SG+IT +ELE+++K+Y + DE TIKEIIAEVDTDNDG+INY+
Sbjct  481  LERDEHLFKAFQNFDKDHSGFITRDELENAMKEYGMGDETTIKEIIAEVDTDNDGRINYE  540

Query  374  EFVAMMRKGT  345
            EF AMMR GT
Sbjct  541  EFCAMMRSGT  550



>ref|XP_003528592.1| PREDICTED: calcium-dependent protein kinase 17-like [Glycine 
max]
Length=541

 Score =   204 bits (518),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
             +DTD+SGTIT EELK GL K GTKL+E EV+QL+EAAD DGNGTIDY EFITATM MNR
Sbjct  397  GMDTDNSGTITIEELKQGLAKQGTKLTEQEVKQLLEAADADGNGTIDYDEFITATMQMNR  456

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            + RE+HLY AF+YFDKD SG+IT EELE +L++YN+ D + IKEI+ EVD DNDG+INYD
Sbjct  457  MNREEHLYTAFQYFDKDNSGFITTEELEQALREYNMHDGRDIKEILQEVDGDNDGRINYD  516

Query  374  EFVAMMRKGTPDLVT  330
            EF AMMRKG P+++T
Sbjct  517  EFAAMMRKGNPEVMT  531



>ref|XP_003529633.1| PREDICTED: calcium-dependent protein kinase isoform [Glycine 
max]
Length=529

 Score =   204 bits (518),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            ++DTD SGTITYEELK GL ++G++LSE+EV+QLM+AADVDGNG+IDYLEFI+ATMH +R
Sbjct  393  NMDTDSSGTITYEELKTGLARIGSRLSEAEVKQLMDAADVDGNGSIDYLEFISATMHRHR  452

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +ER++HLYKAF+YFDKD SGYIT +ELE ++ ++ + DE TIKEII+EVDTDNDG+INY+
Sbjct  453  LERDEHLYKAFQYFDKDNSGYITRDELETAMTQHGMGDEATIKEIISEVDTDNDGRINYE  512

Query  374  EFVAMMRKGTP  342
            EF AMMR G P
Sbjct  513  EFCAMMRSGMP  523



>gb|KCW66998.1| hypothetical protein EUGRSUZ_F007612, partial [Eucalyptus grandis]
Length=170

 Score =   193 bits (491),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            ++DTD SGTITYEELK GL ++G+KL+E+EV+QLMEAADVDGNG+IDY+EFITATMH ++
Sbjct  34   NMDTDKSGTITYEELKTGLARLGSKLTEAEVKQLMEAADVDGNGSIDYIEFITATMHRHK  93

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +E ++HLYKAF++FDKD SG+ITM+E+E +L+ Y + DE+TI++IIAEVDTDNDG+I+Y 
Sbjct  94   LETDEHLYKAFQHFDKDNSGFITMDEIETALRGYGMGDEETIRDIIAEVDTDNDGRIDYQ  153

Query  374  EFVAMMRKGTP  342
            EF AMMR G  
Sbjct  154  EFCAMMRSGNQ  164



>ref|XP_009597333.1| PREDICTED: calcium-dependent protein kinase-like [Nicotiana tomentosiformis]
Length=539

 Score =   204 bits (518),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            ++DTD+SGTITYEELK+GL ++G+KLSE EV+QLMEAADVDGNGTIDY+EF+TATMH +R
Sbjct  403  NMDTDNSGTITYEELKSGLARLGSKLSEVEVKQLMEAADVDGNGTIDYIEFVTATMHRHR  462

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +ER+DHL+KAF+YFD D SG+IT +ELE ++K+Y + DE TIK+IIAEVDTD+DG+INY+
Sbjct  463  LERDDHLFKAFQYFDTDHSGFITKDELESAMKEYGMGDEATIKDIIAEVDTDHDGRINYE  522

Query  374  EFVAMMRKGT  345
            EF AMMR GT
Sbjct  523  EFCAMMRSGT  532



>ref|XP_003622837.1| Calcium dependent protein kinase [Medicago truncatula]
 gb|KEH17263.1| calmodulin-domain kinase CDPK protein [Medicago truncatula]
Length=534

 Score =   204 bits (518),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
             +DTD+SGTIT EELK GL K GTKLSE EV+QLM+AAD DGNGTIDY EFITATMHMNR
Sbjct  390  GMDTDNSGTITVEELKQGLAKQGTKLSEQEVKQLMDAADADGNGTIDYDEFITATMHMNR  449

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            + RE+HLY AF+YFDKD SG+IT EEL+ +L++YN+ D + IKEI+ EVD DNDG+INYD
Sbjct  450  MNREEHLYTAFQYFDKDNSGFITTEELDQALREYNMHDGRDIKEILQEVDGDNDGRINYD  509

Query  374  EFVAMMRKGTPDLVT  330
            EF AMMRKG P+  T
Sbjct  510  EFAAMMRKGNPEAHT  524



>ref|XP_012070829.1| PREDICTED: calcium-dependent protein kinase 33-like [Jatropha 
curcas]
 ref|XP_012070830.1| PREDICTED: calcium-dependent protein kinase 33-like [Jatropha 
curcas]
 gb|KDP39132.1| hypothetical protein JCGZ_00889 [Jatropha curcas]
Length=535

 Score =   203 bits (517),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            +IDTD+SGTITY+ELK GL ++G+KL+E+EV+QLMEAADVDGNGTIDY+EFITATMH +R
Sbjct  399  NIDTDNSGTITYDELKTGLARLGSKLTEAEVKQLMEAADVDGNGTIDYIEFITATMHRHR  458

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +ERE+HLYKAF+YFDKD SG+IT +ELE ++K + + D+ TIKEII+EVDTDNDG+INY+
Sbjct  459  LEREEHLYKAFQYFDKDNSGFITTDELETAMKDFGMGDDATIKEIISEVDTDNDGRINYE  518

Query  374  EFVAMMRKG  348
            EF AMMR G
Sbjct  519  EFCAMMRTG  527



>ref|XP_009404695.1| PREDICTED: calcium-dependent protein kinase 34-like [Musa acuminata 
subsp. malaccensis]
Length=515

 Score =   203 bits (516),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            ++D+D+SGTIT EELK GLTK GTKLSE EV+QL+EAAD DGNGTIDY EFITAT+HMNR
Sbjct  373  NMDSDNSGTITVEELKEGLTKQGTKLSEDEVKQLLEAADADGNGTIDYDEFITATVHMNR  432

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            ++RE+HLYKAF+YFDKD SGYIT EELE +LK+  + D + IK+IIAE D DNDG+INYD
Sbjct  433  MDREEHLYKAFQYFDKDNSGYITREELEQALKEKGMYDGQEIKDIIAEADADNDGRINYD  492

Query  374  EFVAMMRKGTPD  339
            EFVAMMRKG P+
Sbjct  493  EFVAMMRKGNPE  504



>ref|XP_011009111.1| PREDICTED: calcium-dependent protein kinase 34-like [Populus 
euphratica]
Length=525

 Score =   203 bits (516),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
             +DTD+SGTIT EELK GL K GTKLSE EV+QLMEAAD DGNGTIDY EFI ATMHMNR
Sbjct  382  GMDTDNSGTITLEELKQGLAKQGTKLSEYEVKQLMEAADADGNGTIDYDEFIPATMHMNR  441

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            ++R++HLY AF++FDKD SGYIT EELE +L+++ + D + IKEII+EVD DNDG+INYD
Sbjct  442  MDRQEHLYTAFQHFDKDNSGYITTEELEQALREFGMHDGRDIKEIISEVDADNDGRINYD  501

Query  374  EFVAMMRKGTPD  339
            EFVAMMRKG P+
Sbjct  502  EFVAMMRKGNPE  513



>gb|EPS59225.1| calcium-dependent protein kinase 1, partial [Genlisea aurea]
Length=503

 Score =   202 bits (515),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            ++DTD+SGTITYEELK GL ++G+KLSE+EV+QLMEAADVDGNGTIDY+EFITATMH +R
Sbjct  366  NMDTDNSGTITYEELKTGLARLGSKLSEAEVKQLMEAADVDGNGTIDYIEFITATMHRHR  425

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +ER++HL+ AF++FD D SGYIT +ELE ++KKY + DE TI+EII+EVDTDNDG+INY+
Sbjct  426  LERDEHLFGAFQFFDTDNSGYITRDELETAMKKYGMGDEATIREIISEVDTDNDGRINYE  485

Query  374  EFVAMMRKGT  345
            EF  MMR GT
Sbjct  486  EFCTMMRSGT  495



>gb|KJB62816.1| hypothetical protein B456_009G438300 [Gossypium raimondii]
Length=524

 Score =   203 bits (516),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            +IDTD+SGTITY+ELK GL ++G+KL+E+EV+QLMEAADVDGNGTIDY+EFITATMH +R
Sbjct  389  NIDTDNSGTITYDELKNGLARLGSKLTEAEVKQLMEAADVDGNGTIDYIEFITATMHRHR  448

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
            +ER++HLYKAF++FDKD SG+IT +ELE ++K+Y + D+ TIKEII+EVDTDNDGKINY+
Sbjct  449  LERDEHLYKAFQHFDKDNSGHITRDELEAAMKEYGMGDDDTIKEIISEVDTDNDGKINYE  508

Query  374  EFVAMMRKGT  345
            EF AMMR GT
Sbjct  509  EFRAMMRSGT  518



>ref|XP_010448965.1| PREDICTED: calcium-dependent protein kinase 15 [Camelina sativa]
Length=558

 Score =   203 bits (517),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = -2

Query  734  SIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTIDYLEFITATMHMNR  555
            ++DTD SGTITYEELK GL ++G+KL+E+EV+QLMEAADVDGNGTIDY+EFI+ATMH  R
Sbjct  417  NMDTDKSGTITYEELKTGLARLGSKLTEAEVKQLMEAADVDGNGTIDYIEFISATMHRYR  476

Query  554  VEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYD  375
             +R++H++KAF+YFDKD SG+ITM+ELE ++K+Y + DE +IKE+IAEVDTDNDG+INY+
Sbjct  477  FDRDEHVFKAFQYFDKDNSGFITMDELESAMKEYGMGDEASIKEVIAEVDTDNDGRINYE  536

Query  374  EFVAMMRKGT  345
            EF AMMR GT
Sbjct  537  EFCAMMRSGT  546



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1738401790104