BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig3892

Length=1358
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009628959.1|  PREDICTED: extensin-like                           313   9e-97   Nicotiana tomentosiformis
ref|XP_009782624.1|  PREDICTED: pollen-specific leucine-rich repe...    303   5e-93   Nicotiana sylvestris
ref|XP_004248167.1|  PREDICTED: bromodomain-containing protein 4        295   1e-89   Solanum lycopersicum
ref|XP_006367642.1|  PREDICTED: adenylate cyclase, terminal-diffe...    295   1e-89   Solanum tuberosum [potatoes]
ref|XP_009628597.1|  PREDICTED: ataxin-2 homolog                        286   2e-86   Nicotiana tomentosiformis
ref|XP_009782976.1|  PREDICTED: vacuolar protein sorting-associat...    283   3e-85   Nicotiana sylvestris
ref|XP_004243351.1|  PREDICTED: bromodomain-containing protein 4-...    278   3e-83   Solanum lycopersicum
ref|XP_007198900.1|  hypothetical protein PRUPE_ppa004117mg             276   7e-83   Prunus persica
ref|XP_006357482.1|  PREDICTED: transcription factor SPT20 homolog      276   2e-82   Solanum tuberosum [potatoes]
ref|XP_008229157.1|  PREDICTED: mediator of RNA polymerase II tra...    275   4e-82   Prunus mume [ume]
ref|XP_008229158.1|  PREDICTED: mediator of RNA polymerase II tra...    274   5e-82   Prunus mume [ume]
ref|XP_002272844.1|  PREDICTED: arginine-glutamic acid dipeptide ...    271   9e-81   Vitis vinifera
ref|XP_008337475.1|  PREDICTED: altered inheritance of mitochondr...    269   5e-80   
ref|XP_009357856.1|  PREDICTED: putative uncharacterized protein ...    266   3e-79   Pyrus x bretschneideri [bai li]
emb|CDP14783.1|  unnamed protein product                                265   1e-78   Coffea canephora [robusta coffee]
ref|XP_011098021.1|  PREDICTED: extensin                                259   1e-76   Sesamum indicum [beniseed]
ref|XP_009336198.1|  PREDICTED: mediator of RNA polymerase II tra...    256   2e-75   Pyrus x bretschneideri [bai li]
gb|EYU28592.1|  hypothetical protein MIMGU_mgv1a004659mg                256   3e-75   Erythranthe guttata [common monkey flower]
ref|XP_009336199.1|  PREDICTED: mediator of RNA polymerase II tra...    255   9e-75   Pyrus x bretschneideri [bai li]
ref|XP_012088286.1|  PREDICTED: mediator of RNA polymerase II tra...    253   9e-74   Jatropha curcas
gb|KEH17617.1|  structural constituent of cell wall protein, puta...    252   1e-73   Medicago truncatula
ref|XP_010110218.1|  hypothetical protein L484_009824                   251   4e-73   Morus notabilis
ref|XP_009341976.1|  PREDICTED: ATP-dependent helicase brm-like i...    251   4e-73   Pyrus x bretschneideri [bai li]
ref|XP_009341977.1|  PREDICTED: ATP-dependent helicase brm-like i...    249   2e-72   Pyrus x bretschneideri [bai li]
ref|XP_002517918.1|  structural constituent of cell wall, putative      247   1e-71   Ricinus communis
ref|XP_008342910.1|  PREDICTED: extensin-like isoform X1                246   2e-71   
ref|XP_008342911.1|  PREDICTED: extensin-like isoform X2                245   4e-71   
ref|XP_002325597.2|  hydroxyproline-rich glycoprotein                   245   8e-71   Populus trichocarpa [western balsam poplar]
ref|XP_007043595.1|  Structural constituent of cell wall                244   2e-70   
ref|XP_004506616.1|  PREDICTED: transcription factor SPT20 homolog      243   2e-70   Cicer arietinum [garbanzo]
ref|XP_004303103.1|  PREDICTED: transcriptional regulator DEF1          237   9e-68   Fragaria vesca subsp. vesca
ref|XP_010035753.1|  PREDICTED: RNA polymerase II degradation fac...    234   8e-67   Eucalyptus grandis [rose gum]
ref|XP_007132659.1|  hypothetical protein PHAVU_011G113900g             234   1e-66   Phaseolus vulgaris [French bean]
gb|KHN35253.1|  hypothetical protein glysoja_042323                     232   4e-66   Glycine soja [wild soybean]
gb|KHG27956.1|  S-adenosylmethionine synthase 1                         233   5e-66   Gossypium arboreum [tree cotton]
ref|XP_011002849.1|  PREDICTED: calcium-binding protein P-like          230   5e-65   Populus euphratica
ref|XP_008455322.1|  PREDICTED: transcription factor SPT20 homolog      229   6e-65   Cucumis melo [Oriental melon]
ref|XP_004136824.1|  PREDICTED: trithorax group protein osa             228   1e-64   Cucumis sativus [cucumbers]
gb|KFK35898.1|  hypothetical protein AALP_AA4G050800                    226   3e-64   Arabis alpina [alpine rockcress]
ref|XP_006582794.1|  PREDICTED: vacuolar protein sorting-associat...    226   4e-64   
ref|XP_011037329.1|  PREDICTED: bromodomain-containing protein 4-...    227   5e-64   Populus euphratica
ref|XP_002869511.1|  hypothetical protein ARALYDRAFT_491942             226   6e-64   
ref|XP_010448000.1|  PREDICTED: vacuolar protein-sorting protein ...    225   1e-63   Camelina sativa [gold-of-pleasure]
ref|XP_011037330.1|  PREDICTED: putative uncharacterized protein ...    225   2e-63   Populus euphratica
gb|KJB77268.1|  hypothetical protein B456_012G128800                    224   5e-63   Gossypium raimondii
ref|NP_194559.2|  uncharacterized protein                               223   5e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006376495.1|  hydroxyproline-rich glycoprotein                   224   6e-63   Populus trichocarpa [western balsam poplar]
gb|KHN31988.1|  hypothetical protein glysoja_025822                     222   2e-62   Glycine soja [wild soybean]
ref|XP_006592435.1|  PREDICTED: putative uncharacterized protein ...    222   3e-62   Glycine max [soybeans]
ref|XP_003540363.1|  PREDICTED: integrator complex subunit 3 homo...    222   3e-62   Glycine max [soybeans]
ref|XP_003539922.1|  PREDICTED: putative uncharacterized protein ...    221   9e-62   Glycine max [soybeans]
ref|NP_974630.1|  uncharacterized protein                               218   2e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010438481.1|  PREDICTED: formin-like protein 5                   219   2e-61   Camelina sativa [gold-of-pleasure]
gb|KJB31694.1|  hypothetical protein B456_005G201600                    220   2e-61   Gossypium raimondii
ref|XP_010433239.1|  PREDICTED: bromodomain-containing protein 4-...    219   2e-61   Camelina sativa [gold-of-pleasure]
ref|XP_006283593.1|  hypothetical protein CARUB_v10004649mg             217   9e-61   Capsella rubella
ref|XP_006412973.1|  hypothetical protein EUTSA_v10024987mg             216   2e-60   Eutrema salsugineum [saltwater cress]
ref|XP_010689008.1|  PREDICTED: RNA polymerase II degradation fac...    216   5e-60   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006447362.1|  hypothetical protein CICLE_v10014791mg             216   6e-60   Citrus clementina [clementine]
ref|XP_006447363.1|  hypothetical protein CICLE_v10014791mg             216   7e-60   Citrus clementina [clementine]
emb|CAB79632.1|  predicted proline-rich protein                         214   2e-59   Arabidopsis thaliana [mouse-ear cress]
gb|KDO51850.1|  hypothetical protein CISIN_1g008878mg                   214   3e-59   Citrus sinensis [apfelsine]
gb|KDO51849.1|  hypothetical protein CISIN_1g008878mg                   214   3e-59   Citrus sinensis [apfelsine]
gb|EPS62243.1|  hypothetical protein M569_12549                         213   5e-59   Genlisea aurea
gb|KJB77271.1|  hypothetical protein B456_012G128800                    214   5e-59   Gossypium raimondii
gb|KJB77274.1|  hypothetical protein B456_012G128800                    211   1e-58   Gossypium raimondii
ref|XP_003543336.1|  PREDICTED: RNA polymerase II degradation fac...    212   2e-58   Glycine max [soybeans]
ref|XP_010051997.1|  PREDICTED: LOW QUALITY PROTEIN: bromodomain-...    209   2e-57   Eucalyptus grandis [rose gum]
gb|KHN36637.1|  hypothetical protein glysoja_001368                     208   4e-57   Glycine soja [wild soybean]
ref|XP_010242911.1|  PREDICTED: RNA polymerase II degradation fac...    209   4e-57   Nelumbo nucifera [Indian lotus]
ref|XP_008455323.1|  PREDICTED: mediator of RNA polymerase II tra...    206   2e-56   Cucumis melo [Oriental melon]
emb|CDX89188.1|  BnaA01g17050D                                          203   8e-56   
emb|CDX97433.1|  BnaC08g12980D                                          200   2e-54   
emb|CDY25250.1|  BnaA02g22060D                                          200   2e-54   Brassica napus [oilseed rape]
ref|XP_009144355.1|  PREDICTED: protein transport protein SEC31-like    199   2e-54   Brassica rapa
emb|CDY18985.1|  BnaC01g20830D                                          198   8e-54   Brassica napus [oilseed rape]
ref|XP_009109102.1|  PREDICTED: formin-like protein 3                   198   9e-54   Brassica rapa
ref|XP_009137778.1|  PREDICTED: basic salivary proline-rich prote...    196   9e-53   Brassica rapa
gb|KEH39132.1|  structural constituent of cell wall protein, puta...    193   5e-52   Medicago truncatula
emb|CDY14248.1|  BnaA08g13790D                                          193   6e-52   Brassica napus [oilseed rape]
emb|CDY67879.1|  BnaC07g50480D                                          193   7e-52   Brassica napus [oilseed rape]
ref|XP_004136823.1|  PREDICTED: trithorax group protein osa             192   4e-51   Cucumis sativus [cucumbers]
ref|XP_007149849.1|  hypothetical protein PHAVU_005G103700g             191   5e-51   Phaseolus vulgaris [French bean]
gb|KCW89535.1|  hypothetical protein EUGRSUZ_A01820                     188   4e-50   Eucalyptus grandis [rose gum]
ref|XP_010540875.1|  PREDICTED: extensin                                187   2e-49   Tarenaya hassleriana [spider flower]
gb|KEH39131.1|  structural constituent of cell wall protein, puta...    187   2e-49   Medicago truncatula
gb|ACU16150.1|  unknown                                                 175   3e-48   Glycine max [soybeans]
ref|XP_008810226.1|  PREDICTED: ataxin-2 homolog isoform X2             183   3e-48   Phoenix dactylifera
ref|XP_010919602.1|  PREDICTED: tyrosine-protein phosphatase non-...    183   3e-48   Elaeis guineensis
ref|XP_008810225.1|  PREDICTED: ataxin-2 homolog isoform X1             183   6e-48   Phoenix dactylifera
ref|XP_010919593.1|  PREDICTED: tyrosine-protein phosphatase non-...    182   1e-47   Elaeis guineensis
ref|XP_010924425.1|  PREDICTED: hepatocyte growth factor-regulate...    179   1e-46   Elaeis guineensis
ref|XP_008798248.1|  PREDICTED: putative cyclin-dependent serine/...    175   4e-45   Phoenix dactylifera
ref|XP_009395702.1|  PREDICTED: pollen-specific leucine-rich repe...    174   1e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004969990.1|  PREDICTED: trithorax group protein osa-like        170   5e-43   Setaria italica
gb|EMS50510.1|  hypothetical protein TRIUR3_23019                       170   7e-43   Triticum urartu
dbj|BAK01177.1|  predicted protein                                      168   3e-42   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002458505.1|  hypothetical protein SORBIDRAFT_03g034890          168   3e-42   Sorghum bicolor [broomcorn]
ref|XP_008655245.1|  PREDICTED: uncharacterized protein LOC100383...    166   1e-41   Zea mays [maize]
gb|EMT05386.1|  hypothetical protein F775_26441                         166   1e-41   
ref|XP_006644725.1|  PREDICTED: mediator of RNA polymerase II tra...    164   6e-41   Oryza brachyantha
emb|CDM84126.1|  unnamed protein product                                164   7e-41   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006644724.1|  PREDICTED: mediator of RNA polymerase II tra...    164   8e-41   Oryza brachyantha
ref|NP_001044280.1|  Os01g0754500                                       162   2e-40   
gb|EEC71500.1|  hypothetical protein OsI_03777                          162   3e-40   Oryza sativa Indica Group [Indian rice]
gb|ERN06562.1|  hypothetical protein AMTR_s00058p00125550               157   1e-38   Amborella trichopoda
ref|XP_011623594.1|  PREDICTED: transcriptional regulator DEF1          156   4e-38   Amborella trichopoda
ref|NP_001169238.1|  uncharacterized protein LOC100383096               154   1e-37   Zea mays [maize]
gb|EEE55398.1|  hypothetical protein OsJ_03493                          150   2e-37   Oryza sativa Japonica Group [Japonica rice]
emb|CBI21851.3|  unnamed protein product                                137   6e-35   Vitis vinifera
emb|CAN71577.1|  hypothetical protein VITISV_043279                     138   1e-33   Vitis vinifera
ref|XP_009396506.1|  PREDICTED: pinin-like                              140   7e-33   Musa acuminata subsp. malaccensis [pisang utan]
gb|EAY99014.1|  hypothetical protein OsI_20972                          129   3e-29   Oryza sativa Indica Group [Indian rice]
gb|AAU10648.1|  hypothetical protein                                    129   3e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006655586.1|  PREDICTED: adenylate cyclase, terminal-diffe...    126   3e-28   
ref|XP_002440244.1|  hypothetical protein SORBIDRAFT_09g028390          118   1e-25   Sorghum bicolor [broomcorn]
ref|XP_004961233.1|  PREDICTED: adenylate cyclase, terminal-diffe...    117   2e-25   Setaria italica
ref|XP_004961232.1|  PREDICTED: adenylate cyclase, terminal-diffe...    117   4e-25   Setaria italica
tpg|DAA58178.1|  TPA: putative DUF1421 domain family protein            115   1e-24   
gb|AFW79145.1|  putative DUF1421 domain family protein                  115   1e-24   
ref|NP_001143126.1|  uncharacterized protein LOC100275604               115   2e-24   Zea mays [maize]
gb|ACN33301.1|  unknown                                                 115   2e-24   Zea mays [maize]
ref|XP_006644504.1|  PREDICTED: mediator of RNA polymerase II tra...    114   3e-24   
ref|NP_001266367.1|  uncharacterized protein LOC101202710               114   3e-24   
ref|XP_002458299.1|  hypothetical protein SORBIDRAFT_03g030820          113   8e-24   Sorghum bicolor [broomcorn]
ref|XP_008654665.1|  PREDICTED: putative DUF1421 domain family pr...    112   1e-23   Zea mays [maize]
ref|XP_003567907.1|  PREDICTED: transcriptional regulator DEF1-like     112   2e-23   Brachypodium distachyon [annual false brome]
ref|NP_001142422.1|  putative DUF1421 domain family protein             112   2e-23   Zea mays [maize]
ref|XP_008654664.1|  PREDICTED: putative DUF1421 domain family pr...    112   2e-23   Zea mays [maize]
ref|XP_010232129.1|  PREDICTED: uncharacterized protein LOC100831431    112   2e-23   Brachypodium distachyon [annual false brome]
ref|XP_008666394.1|  PREDICTED: putative mediator of RNA polymera...    109   2e-23   Zea mays [maize]
gb|EMS64546.1|  hypothetical protein TRIUR3_27252                       112   3e-23   Triticum urartu
gb|EAY75332.1|  hypothetical protein OsI_03225                          111   4e-23   Oryza sativa Indica Group [Indian rice]
ref|XP_004960805.1|  PREDICTED: protein diaphanous homolog 1-like       111   4e-23   
gb|EAZ13051.1|  hypothetical protein OsJ_02970                          111   5e-23   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ85240.1|  predicted protein                                      111   5e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003568842.1|  PREDICTED: zyxin-like                              110   1e-22   Brachypodium distachyon [annual false brome]
gb|EMT01630.1|  hypothetical protein F775_09697                         110   2e-22   
ref|XP_002440684.1|  hypothetical protein SORBIDRAFT_09g005090          110   2e-22   
dbj|BAK01901.1|  predicted protein                                      109   2e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
tpg|DAA47389.1|  TPA: hypothetical protein ZEAMMB73_495059              105   3e-22   
dbj|BAJ94416.1|  predicted protein                                      107   1e-21   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS54596.1|  Tryptophan aminotransferase 1                           108   1e-21   Triticum urartu
emb|CDM83294.1|  unnamed protein product                                106   2e-21   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008656735.1|  PREDICTED: chromatin modification-related pr...    107   2e-21   Zea mays [maize]
gb|KJB77267.1|  hypothetical protein B456_012G128800                    105   2e-21   Gossypium raimondii
gb|ADE75761.1|  unknown                                                 105   4e-21   Picea sitchensis
emb|CBI34879.3|  unnamed protein product                                104   8e-21   Vitis vinifera
ref|XP_002275607.1|  PREDICTED: protein enabled                         104   1e-20   Vitis vinifera
ref|XP_006655038.1|  PREDICTED: vegetative cell wall protein gp1-...    104   1e-20   Oryza brachyantha
ref|XP_008801947.1|  PREDICTED: arginine-glutamic acid dipeptide ...    104   1e-20   Phoenix dactylifera
dbj|BAK07367.1|  predicted protein                                      103   2e-20   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001140648.1|  uncharacterized protein LOC100272723               103   2e-20   Zea mays [maize]
emb|CDM81418.1|  unnamed protein product                                103   4e-20   Triticum aestivum [Canadian hard winter wheat]
gb|EMS67668.1|  hypothetical protein TRIUR3_30524                       102   4e-20   Triticum urartu
gb|AFW80147.1|  putative DUF1421 domain family protein                  102   6e-20   
ref|NP_001054762.2|  Os05g0169400                                       102   6e-20   
ref|XP_008784980.1|  PREDICTED: uncharacterized protein LOC103703781    103   6e-20   Phoenix dactylifera
emb|CAN60421.1|  hypothetical protein VITISV_021069                     102   7e-20   Vitis vinifera
gb|EAY96697.1|  hypothetical protein OsI_18619                          101   1e-19   Oryza sativa Indica Group [Indian rice]
ref|XP_010108811.1|  hypothetical protein L484_020546                   101   1e-19   Morus notabilis
ref|XP_011097415.1|  PREDICTED: protein enabled-like                    100   2e-19   Sesamum indicum [beniseed]
ref|NP_001147786.1|  LOC100281396                                       100   3e-19   
ref|XP_008656734.1|  PREDICTED: mediator of RNA polymerase II tra...    100   3e-19   
gb|AFW83522.1|  putative DUF1421 domain family protein                  100   3e-19   
ref|XP_006643803.1|  PREDICTED: vegetative cell wall protein gp1-...    100   4e-19   Oryza brachyantha
ref|XP_011620611.1|  PREDICTED: altered inheritance of mitochondr...  99.8    5e-19   
ref|XP_002455112.1|  hypothetical protein SORBIDRAFT_03g004550        99.4    7e-19   
ref|XP_010248593.1|  PREDICTED: pollen-specific leucine-rich repe...  99.0    8e-19   Nelumbo nucifera [Indian lotus]
ref|XP_002985569.1|  hypothetical protein SELMODRAFT_446314           99.0    9e-19   Selaginella moellendorffii
ref|XP_004968338.1|  PREDICTED: class E vacuolar protein-sorting ...  99.0    9e-19   Setaria italica
ref|XP_010033310.1|  PREDICTED: pollen-specific leucine-rich repe...  99.0    1e-18   Eucalyptus grandis [rose gum]
ref|XP_002987005.1|  hypothetical protein SELMODRAFT_425866           98.6    1e-18   Selaginella moellendorffii
ref|XP_010940140.1|  PREDICTED: protein diaphanous homolog 1-like     98.6    1e-18   Elaeis guineensis
gb|ERM98731.1|  hypothetical protein AMTR_s00082p00053170             99.0    1e-18   Amborella trichopoda
ref|XP_004232320.1|  PREDICTED: pollen-specific leucine-rich repe...  98.2    1e-18   Solanum lycopersicum
ref|NP_001042136.2|  Os01g0169900                                     98.2    2e-18   
ref|XP_008795992.1|  PREDICTED: protein transport protein SEC31-like  97.4    2e-18   
ref|XP_010230500.1|  PREDICTED: uncharacterized protein LOC100838076  98.2    2e-18   Brachypodium distachyon [annual false brome]
gb|KFK25694.1|  hypothetical protein AALP_AA8G147000                  97.1    3e-18   Arabis alpina [alpine rockcress]
ref|XP_002873675.1|  predicted protein                                96.3    4e-18   
ref|XP_006338590.1|  PREDICTED: AT-rich interactive domain-contai...  96.7    5e-18   Solanum tuberosum [potatoes]
ref|XP_010906083.1|  PREDICTED: protein transport protein SEC31       96.3    6e-18   Elaeis guineensis
ref|XP_010551915.1|  PREDICTED: actin cytoskeleton-regulatory com...  95.9    9e-18   Tarenaya hassleriana [spider flower]
gb|KJB75894.1|  hypothetical protein B456_012G063600                  95.9    1e-17   Gossypium raimondii
ref|XP_003525675.1|  PREDICTED: arginine-glutamic acid dipeptide ...  95.5    1e-17   Glycine max [soybeans]
ref|XP_010492262.1|  PREDICTED: basic salivary proline-rich prote...  95.5    1e-17   Camelina sativa [gold-of-pleasure]
gb|KHN27460.1|  hypothetical protein glysoja_022169                   95.5    1e-17   Glycine soja [wild soybean]
ref|XP_010908580.1|  PREDICTED: pollen-specific leucine-rich repe...  95.1    1e-17   Elaeis guineensis
ref|XP_009334114.1|  PREDICTED: arginine-glutamic acid dipeptide ...  95.1    2e-17   Pyrus x bretschneideri [bai li]
ref|XP_012081352.1|  PREDICTED: WW domain-binding protein 11 isof...  95.1    2e-17   Jatropha curcas
ref|XP_012081360.1|  PREDICTED: WW domain-binding protein 11 isof...  95.1    2e-17   Jatropha curcas
emb|CDP02078.1|  unnamed protein product                              95.1    2e-17   Coffea canephora [robusta coffee]
emb|CAB87621.1|  putative protein                                     94.4    3e-17   Arabidopsis thaliana [mouse-ear cress]
ref|NP_196958.2|  uncharacterized protein                             94.0    3e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008379205.1|  PREDICTED: protein enabled                       94.0    4e-17   
ref|XP_008365379.1|  PREDICTED: protein enabled-like                  94.0    4e-17   
ref|XP_009388841.1|  PREDICTED: bromodomain-containing protein 4      94.0    4e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006289230.1|  hypothetical protein CARUB_v10002686mg           93.2    6e-17   Capsella rubella
ref|XP_009782100.1|  PREDICTED: pollen-specific leucine-rich repe...  93.2    8e-17   Nicotiana sylvestris
ref|XP_009403230.1|  PREDICTED: pollen-specific leucine-rich repe...  92.8    9e-17   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU44780.1|  hypothetical protein MIMGU_mgv1a004985mg              92.8    9e-17   Erythranthe guttata [common monkey flower]
ref|XP_006603779.1|  PREDICTED: vacuolar protein sorting-associat...  92.4    9e-17   
ref|XP_006446566.1|  hypothetical protein CICLE_v10014743mg           92.4    1e-16   Citrus clementina [clementine]
ref|XP_004299014.1|  PREDICTED: formin-like protein 3 isoform X1      92.4    1e-16   Fragaria vesca subsp. vesca
ref|XP_010037529.1|  PREDICTED: vegetative cell wall protein gp1-...  92.4    1e-16   Eucalyptus grandis [rose gum]
ref|XP_011464066.1|  PREDICTED: formin-like protein 3 isoform X2      92.4    1e-16   Fragaria vesca subsp. vesca
gb|KDO55180.1|  hypothetical protein CISIN_1g0084162mg                92.0    1e-16   Citrus sinensis [apfelsine]
ref|XP_003554822.1|  PREDICTED: vacuolar protein sorting-associat...  92.0    2e-16   Glycine max [soybeans]
ref|XP_010910341.1|  PREDICTED: pollen-specific leucine-rich repe...  91.7    2e-16   Elaeis guineensis
ref|XP_006470271.1|  PREDICTED: COPII coat assembly protein sec16...  91.7    2e-16   Citrus sinensis [apfelsine]
ref|XP_010910342.1|  PREDICTED: pollen-specific leucine-rich repe...  91.3    2e-16   Elaeis guineensis
ref|XP_009611188.1|  PREDICTED: transcriptional regulator DEF1 is...  91.3    2e-16   Nicotiana tomentosiformis
gb|KDO55179.1|  hypothetical protein CISIN_1g0084162mg                91.7    3e-16   Citrus sinensis [apfelsine]
ref|XP_009611187.1|  PREDICTED: transcriptional regulator DEF1 is...  91.3    3e-16   Nicotiana tomentosiformis
gb|KDO55178.1|  hypothetical protein CISIN_1g0084162mg                91.3    3e-16   Citrus sinensis [apfelsine]
gb|KHG02060.1|  Myosin-2                                              91.3    3e-16   Gossypium arboreum [tree cotton]
ref|XP_002524656.1|  DNA binding protein, putative                    90.9    4e-16   Ricinus communis
ref|XP_007031556.1|  Uncharacterized protein TCM_016944               90.9    4e-16   
ref|XP_010420094.1|  PREDICTED: protein transport protein sec31-like  90.5    5e-16   
ref|XP_010453577.1|  PREDICTED: basic salivary proline-rich prote...  90.1    6e-16   Camelina sativa [gold-of-pleasure]
ref|XP_009362961.1|  PREDICTED: histone acetyltransferase KAT6A-l...  88.2    9e-16   
ref|XP_009125983.1|  PREDICTED: WW domain-binding protein 11 isof...  89.4    1e-15   Brassica rapa
ref|XP_009125985.1|  PREDICTED: WW domain-binding protein 11 isof...  89.4    1e-15   Brassica rapa
ref|XP_004489226.1|  PREDICTED: vacuolar protein sorting-associat...  89.4    1e-15   Cicer arietinum [garbanzo]
ref|XP_011098435.1|  PREDICTED: protein diaphanous homolog 1-like     89.4    1e-15   Sesamum indicum [beniseed]
emb|CDX85594.1|  BnaA02g02190D                                        89.0    1e-15   
ref|XP_008393001.1|  PREDICTED: putative uncharacterized protein ...  89.0    2e-15   
ref|XP_007217219.1|  hypothetical protein PRUPE_ppa003425mg           89.0    2e-15   Prunus persica
emb|CBI14977.3|  unnamed protein product                              87.4    2e-15   Vitis vinifera
emb|CDX91045.1|  BnaC02g05520D                                        87.8    3e-15   
ref|XP_009362960.1|  PREDICTED: uncharacterized protein LOC103952...  87.4    3e-15   Pyrus x bretschneideri [bai li]
ref|XP_008230557.1|  PREDICTED: protein transport protein SEC31       87.8    4e-15   Prunus mume [ume]
gb|KFK37621.1|  hypothetical protein AALP_AA3G007100                  87.4    4e-15   Arabis alpina [alpine rockcress]
ref|XP_010663116.1|  PREDICTED: vegetative cell wall protein gp1-...  87.4    5e-15   Vitis vinifera
ref|XP_010663115.1|  PREDICTED: proline-rich receptor-like protei...  87.4    5e-15   Vitis vinifera
gb|KEH24794.1|  DNA-binding protein, putative                         87.0    6e-15   Medicago truncatula
gb|KJB40752.1|  hypothetical protein B456_007G076000                  85.9    2e-14   Gossypium raimondii
ref|XP_006341319.1|  PREDICTED: trithorax group protein osa-like      85.5    2e-14   Solanum tuberosum [potatoes]
gb|KJB40753.1|  hypothetical protein B456_007G076000                  85.1    3e-14   Gossypium raimondii
gb|KJB40754.1|  hypothetical protein B456_007G076000                  85.1    3e-14   Gossypium raimondii
tpg|DAA58177.1|  TPA: putative DUF1421 domain family protein          80.1    4e-14   
gb|ACN28687.1|  unknown                                               79.3    4e-14   Zea mays [maize]
tpg|DAA58176.1|  TPA: putative DUF1421 domain family protein          80.1    4e-14   
ref|XP_007150938.1|  hypothetical protein PHAVU_004G007500g           84.0    7e-14   Phaseolus vulgaris [French bean]
ref|XP_008374404.1|  PREDICTED: TSC22 domain family protein 1-like    84.0    7e-14   
gb|ACZ74657.1|  hypothetical protein                                  84.0    7e-14   Phaseolus vulgaris [French bean]
ref|XP_008219121.1|  PREDICTED: uncharacterized protein LOC103319367  84.3    9e-14   
gb|KHG20812.1|  Actin cytoskeleton-regulatory complex PAN1            82.4    2e-13   Gossypium arboreum [tree cotton]
ref|NP_186805.2|  uncharacterized protein                             81.6    3e-13   Arabidopsis thaliana [mouse-ear cress]
gb|AAF01541.1|AC009325_11  unknown protein                            81.6    4e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004252212.1|  PREDICTED: extensin-like                         81.6    4e-13   Solanum lycopersicum
gb|KCW54142.1|  hypothetical protein EUGRSUZ_I00119                   81.3    4e-13   Eucalyptus grandis [rose gum]
ref|XP_007222918.1|  hypothetical protein PRUPE_ppa003684mg           81.3    5e-13   Prunus persica
ref|XP_011047322.1|  PREDICTED: vacuolar protein sorting-associat...  80.9    7e-13   Populus euphratica
ref|XP_006408524.1|  hypothetical protein EUTSA_v10020517mg           79.7    1e-12   Eutrema salsugineum [saltwater cress]
ref|XP_004298978.1|  PREDICTED: uncharacterized protein LOC101312152  79.3    2e-12   Fragaria vesca subsp. vesca
ref|XP_011047825.1|  PREDICTED: altered inheritance of mitochondr...  78.6    3e-12   Populus euphratica
ref|XP_011047827.1|  PREDICTED: arginine-glutamic acid dipeptide ...  78.6    3e-12   Populus euphratica
ref|XP_002511348.1|  conserved hypothetical protein                   78.2    5e-12   
ref|XP_006297454.1|  hypothetical protein CARUB_v10013474mg           78.2    5e-12   
ref|XP_010924426.1|  PREDICTED: putative cyclin-dependent serine/...  77.8    5e-12   
ref|XP_002318061.2|  hypothetical protein POPTR_0012s08510g           77.8    6e-12   Populus trichocarpa [western balsam poplar]
ref|XP_010694912.1|  PREDICTED: putative uncharacterized protein ...  77.8    6e-12   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002884275.1|  hypothetical protein ARALYDRAFT_477359           77.8    6e-12   
ref|XP_001758183.1|  predicted protein                                77.4    6e-12   
ref|XP_008245310.1|  PREDICTED: uncharacterized protein LOC103343434  77.4    7e-12   Prunus mume [ume]
ref|XP_007036361.1|  Apoptosis-stimulating of p53 protein 1, puta...  76.6    1e-11   
gb|KDO69523.1|  hypothetical protein CISIN_1g009789mg                 75.9    3e-11   Citrus sinensis [apfelsine]
ref|XP_006476848.1|  PREDICTED: AT-rich interactive domain-contai...  75.5    3e-11   Citrus sinensis [apfelsine]
ref|XP_001770189.1|  predicted protein                                75.1    3e-11   
gb|KDO69524.1|  hypothetical protein CISIN_1g009789mg                 75.5    3e-11   Citrus sinensis [apfelsine]
ref|XP_007210457.1|  hypothetical protein PRUPE_ppa005168m1g          73.6    3e-11   
ref|XP_006439889.1|  hypothetical protein CICLE_v10019708mg           75.5    3e-11   Citrus clementina [clementine]
ref|XP_011046206.1|  PREDICTED: uncharacterized protein LOC105140870  75.1    4e-11   Populus euphratica
ref|XP_009613823.1|  PREDICTED: putative uncharacterized protein ...  74.3    6e-11   Nicotiana tomentosiformis
ref|XP_009613822.1|  PREDICTED: SH3 domain-containing protein C23...  74.7    6e-11   Nicotiana tomentosiformis
ref|XP_009766181.1|  PREDICTED: programmed cell death 6-interacti...  73.9    1e-10   Nicotiana sylvestris
ref|XP_001784568.1|  predicted protein                                72.8    2e-10   
gb|EPS66622.1|  hypothetical protein M569_08156                       68.2    6e-10   
ref|XP_010102503.1|  hypothetical protein L484_014559                 71.6    6e-10   
ref|XP_008245313.1|  PREDICTED: uncharacterized protein LOC103343438  68.2    2e-09   
ref|XP_005849501.1|  hypothetical protein CHLNCDRAFT_142823           63.2    3e-08   
ref|XP_012080003.1|  PREDICTED: arginine-glutamic acid dipeptide ...  65.5    5e-08   
ref|XP_012080002.1|  PREDICTED: uncharacterized protein LOC105640...  65.1    6e-08   
ref|XP_010496293.1|  PREDICTED: proline-rich receptor-like protei...  61.6    8e-07   
ref|XP_010435634.1|  PREDICTED: proline-rich receptor-like protei...  57.0    2e-05   
ref|XP_011400494.1|  hypothetical protein F751_5373                   56.6    2e-05   
ref|XP_008361778.1|  PREDICTED: uncharacterized protein LOC103425469  56.6    2e-05   
ref|XP_008341426.1|  PREDICTED: YLP motif-containing protein 1-like   56.6    4e-05   
gb|KDO69525.1|  hypothetical protein CISIN_1g009789mg                 54.7    1e-04   
ref|XP_002949828.1|  hypothetical protein VOLCADRAFT_90250            54.7    1e-04   
ref|XP_009595505.1|  PREDICTED: uncharacterized protein LOC104091...  51.6    1e-04   
ref|XP_009377181.1|  PREDICTED: protein transport protein SEC31-like  53.5    3e-04   
gb|KHN27461.1|  hypothetical protein glysoja_022170                   49.3    6e-04   
ref|XP_009595507.1|  PREDICTED: uncharacterized protein LOC104091...  49.3    7e-04   



>ref|XP_009628959.1| PREDICTED: extensin-like [Nicotiana tomentosiformis]
Length=534

 Score =   313 bits (801),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 183/243 (75%), Positives = 209/243 (86%), Gaps = 8/243 (3%)
 Frame = +2

Query  485   QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
             +EFHKSRMTRSSM PTS Y PPE+SSFNQD+I  VEK+MKKYADNLMRFLEG+SSRLSQL
Sbjct  53    KEFHKSRMTRSSMFPTSTYSPPEESSFNQDMICTVEKTMKKYADNLMRFLEGISSRLSQL  112

Query  665   ELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELA  844
             ELYCYNLDKSIGEMR+DLV DHGE DSKLK+LEKH+QEVHRSVQILRDKQELA+ QKELA
Sbjct  113   ELYCYNLDKSIGEMRADLVRDHGEADSKLKALEKHVQEVHRSVQILRDKQELAETQKELA  172

Query  845   KLQLAQKESGSANNSQQNEERASQPASDTKRSDSPCELHGQQLALALPHQVAPPQTSHTT  1024
             KLQLAQKE  + +NSQQNE+R +QP SD+K+S++  ++HGQQLALALPHQVA PQ S T+
Sbjct  173   KLQLAQKEPATPSNSQQNEDRNAQPVSDSKKSENSPDMHGQQLALALPHQVA-PQGSITS  231

Query  1025  RHMEqpqqpsvppipsqviTQSQGYYLSPTQMP-------LSQGQYMPSESQYRTPQMQE  1183
             R  EQPQQP  PPIPSQ +TQSQGYYL P QM        LSQGQY+PS+SQYRT QMQ+
Sbjct  232   RPTEQPQQPPPPPIPSQSMTQSQGYYLPPPQMSNPPAPTHLSQGQYLPSDSQYRTSQMQD  291

Query  1184  VAR  1192
             ++R
Sbjct  292   MSR  294



>ref|XP_009782624.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 2 [Nicotiana sylvestris]
Length=539

 Score =   303 bits (777),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 179/243 (74%), Positives = 210/243 (86%), Gaps = 8/243 (3%)
 Frame = +2

Query  485   QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
             +EFHKSRMTRSSM PTS Y PPE+SSFNQD+I  V+K+MKKYADN+MRFLEG+SSRLSQL
Sbjct  53    KEFHKSRMTRSSMFPTSTYSPPEESSFNQDMICTVDKTMKKYADNIMRFLEGISSRLSQL  112

Query  665   ELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELA  844
             ELYCYNLDKSIGEMR+DLV DHGE DSKLK+LEKH+QEVHRSVQILRDKQELA+ QKELA
Sbjct  113   ELYCYNLDKSIGEMRADLVRDHGEADSKLKALEKHVQEVHRSVQILRDKQELAETQKELA  172

Query  845   KLQLAQKESGSANNSQQNEERASQPASDTKRSDSPCELHGQQLALALPHQVAPPQTSHTT  1024
             KLQLAQKE  + +NSQQNE+R +QP SD+++S++  ++HGQQLALALPHQVA PQ S T+
Sbjct  173   KLQLAQKEPATPSNSQQNEDRNAQPVSDSQKSENSPDMHGQQLALALPHQVA-PQGSITS  231

Query  1025  RHMEqpqqpsvppipsqviTQSQGYYLSPTQMP-------LSQGQYMPSESQYRTPQMQE  1183
             + +EQPQQP  PPIPSQ +TQSQGYYL P QM        LSQGQY+PS+SQYRT QMQ+
Sbjct  232   QPVEQPQQPPPPPIPSQSMTQSQGYYLPPPQMSNPPAPTYLSQGQYLPSDSQYRTSQMQD  291

Query  1184  VAR  1192
             ++R
Sbjct  292   MSR  294



>ref|XP_004248167.1| PREDICTED: bromodomain-containing protein 4 [Solanum lycopersicum]
Length=545

 Score =   295 bits (754),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 174/243 (72%), Positives = 200/243 (82%), Gaps = 8/243 (3%)
 Frame = +2

Query  485   QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
             +EFHK+RMTRSSM PTS Y PPE+SSFNQD+I  VEK+MKKY DNLMRFLEG+SSRLSQL
Sbjct  53    KEFHKNRMTRSSMFPTSTYSPPEESSFNQDMICTVEKTMKKYTDNLMRFLEGISSRLSQL  112

Query  665   ELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELA  844
             ELYCYNLDKSIGEMRSDLV DHGE D KLK+LEKH+QEVHRSVQILRDKQELA+ QKELA
Sbjct  113   ELYCYNLDKSIGEMRSDLVRDHGEADLKLKALEKHVQEVHRSVQILRDKQELAETQKELA  172

Query  845   KLQLAQKESGSANNSQQNEERASQPASDTKRSDSPCELHGQQLALALPHQVAPPQTSHTT  1024
             KLQ A KE  SANNSQQNE+R +QP SD+ + D+  +++GQQLALALPHQVA P+   T 
Sbjct  173   KLQFAPKEPASANNSQQNEDRNAQPVSDSNKGDNSTDVNGQQLALALPHQVA-PRAPLTN  231

Query  1025  RHMEqpqqpsvppipsqviTQSQGYYLSPTQMP-------LSQGQYMPSESQYRTPQMQE  1183
             + +EQPQQ   PPIPSQ +TQSQGYYL P QM        LSQGQY+ S+ QYRT QMQ+
Sbjct  232   QPVEQPQQAPPPPIPSQSMTQSQGYYLPPVQMSNPPAPTHLSQGQYLSSDPQYRTSQMQD  291

Query  1184  VAR  1192
             ++R
Sbjct  292   LSR  294



>ref|XP_006367642.1| PREDICTED: adenylate cyclase, terminal-differentiation specific-like 
[Solanum tuberosum]
Length=548

 Score =   295 bits (754),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 173/243 (71%), Positives = 200/243 (82%), Gaps = 8/243 (3%)
 Frame = +2

Query  485   QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
             +EFHK+RMTRSSM PTS Y PPE+SSFNQD+I  VEK+MKKY DNLMRFLEG+SSRLSQL
Sbjct  53    KEFHKNRMTRSSMFPTSTYSPPEESSFNQDMICTVEKTMKKYTDNLMRFLEGISSRLSQL  112

Query  665   ELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELA  844
             ELYCYNLDKSIGEMRSDLV DHGE D KLK+LEKH+QEVHRSVQILRDKQELA+ QKELA
Sbjct  113   ELYCYNLDKSIGEMRSDLVRDHGEADLKLKALEKHVQEVHRSVQILRDKQELAETQKELA  172

Query  845   KLQLAQKESGSANNSQQNEERASQPASDTKRSDSPCELHGQQLALALPHQVAPPQTSHTT  1024
             KLQ AQKE  SANNSQQNE+R +QP SD+ + D+  +++GQ+LALALPHQVA P+   T 
Sbjct  173   KLQFAQKEPASANNSQQNEDRNAQPVSDSNKGDNSTDVNGQELALALPHQVA-PRAPLTN  231

Query  1025  RHMEqpqqpsvppipsqviTQSQGYYLSPTQMP-------LSQGQYMPSESQYRTPQMQE  1183
             + +EQPQQ    PIPSQ +TQSQGYYL P QM        LSQGQY+ S+ QYRT QMQ+
Sbjct  232   QPVEQPQQAPPQPIPSQSMTQSQGYYLPPVQMSNPPAPTHLSQGQYLSSDPQYRTSQMQD  291

Query  1184  VAR  1192
             ++R
Sbjct  292   LSR  294



>ref|XP_009628597.1| PREDICTED: ataxin-2 homolog [Nicotiana tomentosiformis]
Length=535

 Score =   286 bits (732),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 171/237 (72%), Positives = 192/237 (81%), Gaps = 11/237 (5%)
 Frame = +2

Query  485   QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
             +EFHKSRMTRSSM P  AY PPE+SSFNQD+I  VEK+MKKYADNLMRFLEG+SSRLSQL
Sbjct  50    KEFHKSRMTRSSMFPAPAYSPPEESSFNQDMICTVEKTMKKYADNLMRFLEGISSRLSQL  109

Query  665   ELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELA  844
             ELYCYNLDKSIGEMRSDLV DHGE DSKLK+LEKH+QEVHR+VQILRDKQELA+ QKELA
Sbjct  110   ELYCYNLDKSIGEMRSDLVRDHGEADSKLKALEKHVQEVHRAVQILRDKQELAETQKELA  169

Query  845   KLQLAQKESGSANNSQQNEERASQPASDTKRSDSPCELHGQQLALALPHQVAPPQTSHTT  1024
             KLQLAQK+S S++N QQNEE+ +Q  SD K+SD+  E+HGQQLALALPHQVA PQ S T 
Sbjct  170   KLQLAQKDSTSSSNCQQNEEKNAQHLSDAKKSDNSHEVHGQQLALALPHQVA-PQASLTN  228

Query  1025  RHME---qpqqpsvppipsqviTQSQGYYLSPTQM-----P--LSQGQYMPSESQYR  1165
             R +E   Q       PIPSQ +  SQGYYL P QM     P  LSQGQY+ S+SQYR
Sbjct  229   RPVEQPQQLPVQPPQPIPSQSMPPSQGYYLPPPQMVNQQAPTQLSQGQYLSSDSQYR  285



>ref|XP_009782976.1| PREDICTED: vacuolar protein sorting-associated protein 27-like 
[Nicotiana sylvestris]
Length=535

 Score =   283 bits (723),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 170/239 (71%), Positives = 191/239 (80%), Gaps = 15/239 (6%)
 Frame = +2

Query  485   QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
             +EFHKSRMTRSSM P  AY PPE+SSFNQD+I  VEK+MKKYADNLMRFLEG+SSRLSQL
Sbjct  50    KEFHKSRMTRSSMFPAPAYSPPEESSFNQDMISTVEKTMKKYADNLMRFLEGISSRLSQL  109

Query  665   ELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELA  844
             ELYCYNLDKSIGEMRSDLV DHGE DSKLK+LEKH+QEVHRSVQILRDKQELA+ QKELA
Sbjct  110   ELYCYNLDKSIGEMRSDLVRDHGEADSKLKALEKHVQEVHRSVQILRDKQELAETQKELA  169

Query  845   KLQLAQKESGSANNSQQNEERASQPASDTKRSDSPCELHGQQLALALPHQVAPPQTSHTT  1024
             KLQLAQK+S S++ SQQN+E+ +Q  SD K+SD+  E HGQQLALALPHQVA PQ S T 
Sbjct  170   KLQLAQKDSTSSSISQQNDEKNAQHLSDAKKSDNSPEGHGQQLALALPHQVA-PQASLTN  228

Query  1025  RHME---qpqqpsvppipsqviTQSQGYYL---------SPTQMPLSQGQYMPSESQYR  1165
             R +E   Q       PIPSQ + QSQGYYL         +PTQ P  QGQY+ S+SQYR
Sbjct  229   RPVEQPQQLPVQPPQPIPSQSMPQSQGYYLPSPQMVNQQAPTQFP--QGQYLSSDSQYR  285



>ref|XP_004243351.1| PREDICTED: bromodomain-containing protein 4-like [Solanum lycopersicum]
Length=537

 Score =   278 bits (710),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 177/242 (73%), Positives = 196/242 (81%), Gaps = 11/242 (5%)
 Frame = +2

Query  485   QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
             +EFHKSRMTRSSM P  AY PPE+SSFNQD+I  +EK+MKKY DNLMRFLEG+SSRLSQL
Sbjct  52    KEFHKSRMTRSSMFPAPAYSPPEESSFNQDMICTIEKTMKKYTDNLMRFLEGISSRLSQL  111

Query  665   ELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELA  844
             ELYCYNLDKSIGEMRSDLV DHGE DSKLK+LEKH+QEVHRSVQILRDKQELA+ QKELA
Sbjct  112   ELYCYNLDKSIGEMRSDLVRDHGEADSKLKALEKHVQEVHRSVQILRDKQELAETQKELA  171

Query  845   KLQLAQKESGSANNSQQNEERASQPASDTKRSDSPCELHGQQLALALPHQVAPPQTSHTT  1024
             KLQLAQK S S++NSQQNEER++Q  SD K+SD   E+HGQQLALALPHQVA PQ S T 
Sbjct  172   KLQLAQKGSTSSSNSQQNEERSAQHLSDDKKSDDAPEVHGQQLALALPHQVA-PQASLTN  230

Query  1025  RHMEqpqqpsvppipsqvi---TQSQGYYLSPTQMP-------LSQGQYMPSESQYRTPQ  1174
             R +EQPQQP VPP  S       QSQGYYL P QM        LSQGQ++ S+ QYR PQ
Sbjct  231   RPVEQPQQPPVPPPQSIPPQSMPQSQGYYLPPPQMANQQAPTQLSQGQFLSSDPQYRNPQ  290

Query  1175  MQ  1180
             MQ
Sbjct  291   MQ  292



>ref|XP_007198900.1| hypothetical protein PRUPE_ppa004117mg [Prunus persica]
 gb|EMJ00099.1| hypothetical protein PRUPE_ppa004117mg [Prunus persica]
Length=529

 Score =   276 bits (707),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 165/243 (68%), Positives = 187/243 (77%), Gaps = 17/243 (7%)
 Frame = +2

Query  482   EQEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQ  661
             +Q+FHKSRM R SM  ++AY  PEDS  +QDVI  VEKSMKKYADNLMRFLEG+SSRLSQ
Sbjct  51    KQDFHKSRMARQSMFSSAAYSQPEDS-LHQDVIATVEKSMKKYADNLMRFLEGISSRLSQ  109

Query  662   LELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKEL  841
             LELYCYNLDKSIGEMRSDLV DHGE DSKLKSLEKHLQEVHRSVQILRDKQELA+ QKEL
Sbjct  110   LELYCYNLDKSIGEMRSDLVRDHGEADSKLKSLEKHLQEVHRSVQILRDKQELAETQKEL  169

Query  842   AKLQLAQKESGSANNSQQNEERASQPASDTKRSDSPCELHGQQLALALPHQVAPPQTSHT  1021
             AKLQLAQK S S+ +SQ NEERAS P SD +++D+  E H QQLALALPHQVA       
Sbjct  170   AKLQLAQKGSASSTHSQSNEERASPPTSDGQKTDNTPETHNQQLALALPHQVA-------  222

Query  1022  TRHMEqpqqpsvppipsqviTQSQGYYLSPTQM---PL---SQGQYMPSESQYRTPQMQE  1183
                 +       P  P+Q +TQ Q YYLSPTQ+   P    SQ QY+PS+SQYRTPQ+Q+
Sbjct  223   ---PQPQPVAPPPQAPTQNVTQQQSYYLSPTQLQNQPPPQHSQNQYLPSDSQYRTPQVQD  279

Query  1184  VAR  1192
             + R
Sbjct  280   IPR  282



>ref|XP_006357482.1| PREDICTED: transcription factor SPT20 homolog [Solanum tuberosum]
Length=537

 Score =   276 bits (705),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 174/242 (72%), Positives = 193/242 (80%), Gaps = 11/242 (5%)
 Frame = +2

Query  485   QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
             +EFHKSRMTRSSM P  AY PPE+SSFNQD+I  +EK+MKKY DNLMRFLEG+SSRLSQL
Sbjct  52    KEFHKSRMTRSSMFPAPAYSPPEESSFNQDMICTIEKTMKKYTDNLMRFLEGISSRLSQL  111

Query  665   ELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELA  844
             ELYCYNLDKSIGEMRSDLV DHGE DSKLK+LEKH+QEVHRSVQILRDKQELA+ QKELA
Sbjct  112   ELYCYNLDKSIGEMRSDLVRDHGEADSKLKALEKHVQEVHRSVQILRDKQELAETQKELA  171

Query  845   KLQLAQKESGSANNSQQNEERASQPASDTKRSDSPCELHGQQLALALPHQVAPPQTSHTT  1024
             KLQLAQK S S++NSQQNEER +Q  SD K+SD   E+HGQQLALALPHQVA PQ S T 
Sbjct  172   KLQLAQKGSTSSSNSQQNEERNAQHLSDDKKSDDSPEVHGQQLALALPHQVA-PQASLTN  230

Query  1025  R---HMEqpqqpsvppipsqviTQSQGYYLSPTQMP-------LSQGQYMPSESQYRTPQ  1174
             R     +QP  P    IPSQ + QSQGYYL P QM        LSQGQ++ S+ QYR PQ
Sbjct  231   RPVEQPQQPPVPPPQSIPSQSMPQSQGYYLPPPQMANQQAPTQLSQGQFLSSDLQYRNPQ  290

Query  1175  MQ  1180
             MQ
Sbjct  291   MQ  292



>ref|XP_008229157.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15 isoform X1 [Prunus mume]
Length=530

 Score =   275 bits (702),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 164/243 (67%), Positives = 186/243 (77%), Gaps = 17/243 (7%)
 Frame = +2

Query  482   EQEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQ  661
             +Q+FHKSRM R SM  ++AY  PEDS  +QDVI  VEKSMKKYADNLMRFLEG+SSRLSQ
Sbjct  52    QQDFHKSRMARQSMFSSAAYSQPEDS-LHQDVIATVEKSMKKYADNLMRFLEGISSRLSQ  110

Query  662   LELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKEL  841
             LELYCYNLDKSIGEMRSDLV DHGE DSKLKSLEKHLQEVHRSVQILRDKQELA+ QKEL
Sbjct  111   LELYCYNLDKSIGEMRSDLVRDHGEADSKLKSLEKHLQEVHRSVQILRDKQELAETQKEL  170

Query  842   AKLQLAQKESGSANNSQQNEERASQPASDTKRSDSPCELHGQQLALALPHQVAPPQTSHT  1021
             AKLQLAQK S S+ +SQ NEERAS P SD +++D+  E H QQLALALPHQVA       
Sbjct  171   AKLQLAQKGSASSTHSQPNEERASPPTSDGQKTDNTPETHNQQLALALPHQVA-------  223

Query  1022  TRHMEqpqqpsvppipsqviTQSQGYYLSPTQM--PL----SQGQYMPSESQYRTPQMQE  1183
                 +       P  P+Q +TQ   YYLSPTQ+  P     SQ QY+PS+SQYRTPQ+Q+
Sbjct  224   ---PQPQPVAPPPQAPTQNVTQQSSYYLSPTQLQNPPPPQHSQNQYLPSDSQYRTPQVQD  280

Query  1184  VAR  1192
             + R
Sbjct  281   IPR  283



>ref|XP_008229158.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15 isoform X2 [Prunus mume]
Length=529

 Score =   274 bits (701),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 164/243 (67%), Positives = 186/243 (77%), Gaps = 17/243 (7%)
 Frame = +2

Query  482   EQEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQ  661
             +Q+FHKSRM R SM  ++AY  PEDS  +QDVI  VEKSMKKYADNLMRFLEG+SSRLSQ
Sbjct  51    KQDFHKSRMARQSMFSSAAYSQPEDS-LHQDVIATVEKSMKKYADNLMRFLEGISSRLSQ  109

Query  662   LELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKEL  841
             LELYCYNLDKSIGEMRSDLV DHGE DSKLKSLEKHLQEVHRSVQILRDKQELA+ QKEL
Sbjct  110   LELYCYNLDKSIGEMRSDLVRDHGEADSKLKSLEKHLQEVHRSVQILRDKQELAETQKEL  169

Query  842   AKLQLAQKESGSANNSQQNEERASQPASDTKRSDSPCELHGQQLALALPHQVAPPQTSHT  1021
             AKLQLAQK S S+ +SQ NEERAS P SD +++D+  E H QQLALALPHQVA       
Sbjct  170   AKLQLAQKGSASSTHSQPNEERASPPTSDGQKTDNTPETHNQQLALALPHQVA-------  222

Query  1022  TRHMEqpqqpsvppipsqviTQSQGYYLSPTQM--PL----SQGQYMPSESQYRTPQMQE  1183
                 +       P  P+Q +TQ   YYLSPTQ+  P     SQ QY+PS+SQYRTPQ+Q+
Sbjct  223   ---PQPQPVAPPPQAPTQNVTQQSSYYLSPTQLQNPPPPQHSQNQYLPSDSQYRTPQVQD  279

Query  1184  VAR  1192
             + R
Sbjct  280   IPR  282



>ref|XP_002272844.1| PREDICTED: arginine-glutamic acid dipeptide repeats protein [Vitis 
vinifera]
Length=550

 Score =   271 bits (694),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 148/222 (67%), Positives = 175/222 (79%), Gaps = 10/222 (5%)
 Frame = +2

Query  551   EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  730
             E+SS NQ++I  VEK++KKYADNLMRFLEG+SSRLSQLELYCYNLDKSIGEMRSDLV DH
Sbjct  70    EESSLNQEMISTVEKTVKKYADNLMRFLEGISSRLSQLELYCYNLDKSIGEMRSDLVRDH  129

Query  731   GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERA  910
             GE DSKLKSL+KH+QEVHRSVQILRDKQELADAQKELAKLQL QKES ++++S QNEERA
Sbjct  130   GEADSKLKSLDKHIQEVHRSVQILRDKQELADAQKELAKLQLVQKESSTSSHS-QNEERA  188

Query  911   SQPASDTKRSDSPCELHGQQLALALPHQVAPPQTSHTTRHMEqpqqpsvppipsqvi-TQ  1087
             + PASD K+ D   ++H QQLALALPHQVA PQ + +TR +EQ Q  + P        TQ
Sbjct  189   ATPASDPKKPDKMSDVHNQQLALALPHQVA-PQPALSTRPVEQQQPVAAPTQSPPQNITQ  247

Query  1088  SQGYYLSPTQMPLS-------QGQYMPSESQYRTPQMQEVAR  1192
             S  YYL  TQ+P +       Q QY+PS+ QYRT Q+Q++ R
Sbjct  248   SPSYYLPSTQLPNATAQTQHPQSQYLPSDPQYRTQQLQDIPR  289



>ref|XP_008337475.1| PREDICTED: altered inheritance of mitochondria protein 3-like 
[Malus domestica]
Length=521

 Score =   269 bits (687),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 159/242 (66%), Positives = 183/242 (76%), Gaps = 18/242 (7%)
 Frame = +2

Query  485   QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
             ++FHKSRM+R SM  + AY  PE+S  +QDVI  VEKSMKKYADNLMRFLEG+SSRLSQL
Sbjct  51    KDFHKSRMSRQSMFSSPAYSQPEES-LHQDVIATVEKSMKKYADNLMRFLEGISSRLSQL  109

Query  665   ELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELA  844
             ELYCYNLDKSIGEMR+DL  DHGE DSKLKSLEKHLQEVHRSVQILRDKQELA+ QKELA
Sbjct  110   ELYCYNLDKSIGEMRTDLGRDHGEADSKLKSLEKHLQEVHRSVQILRDKQELAETQKELA  169

Query  845   KLQLAQKESGSANNSQQNEERASQPASDTKRSDSPCELHGQQLALALPHQVAPPQTSHTT  1024
             KLQLAQK SGS+ +SQ NEERAS   SD +++D+P E H QQLALALPHQVAP       
Sbjct  170   KLQLAQKGSGSSTHSQSNEERASPHTSDAQKADNPSETHNQQLALALPHQVAP-------  222

Query  1025  RHMEqpqqpsvppipsqviTQSQGYYLSPTQM----PLS--QGQYMPSESQYRTPQMQEV  1186
                +Q    +    P Q +TQ Q YYL PTQ+    P +  Q QY+P +SQY  PQ+QE+
Sbjct  223   ---QQQPVAAPTQPPPQNVTQQQSYYL-PTQLQNPPPQAHPQNQYLPPDSQYXNPQVQEM  278

Query  1187  AR  1192
              R
Sbjct  279   PR  280



>ref|XP_009357856.1| PREDICTED: putative uncharacterized protein DDB_G0294196 [Pyrus 
x bretschneideri]
 ref|XP_009357877.1| PREDICTED: arginine-glutamic acid dipeptide repeats protein-like 
[Pyrus x bretschneideri]
Length=521

 Score =   266 bits (681),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 160/242 (66%), Positives = 183/242 (76%), Gaps = 18/242 (7%)
 Frame = +2

Query  485   QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
             ++FHKSRM+R SM  + AY  PE+S  +QDVI  VEKSMKKYADNLMRFLEG+SSRLSQL
Sbjct  51    KDFHKSRMSRQSMFSSPAYSQPEES-LHQDVIATVEKSMKKYADNLMRFLEGISSRLSQL  109

Query  665   ELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELA  844
             ELYCYNLDKSIGEMRSDL  DH E DSKLKSLEKHLQEVHRSVQILRDKQELA+ QKELA
Sbjct  110   ELYCYNLDKSIGEMRSDLGRDHEEADSKLKSLEKHLQEVHRSVQILRDKQELAETQKELA  169

Query  845   KLQLAQKESGSANNSQQNEERASQPASDTKRSDSPCELHGQQLALALPHQVAPPQTSHTT  1024
             KLQLAQK SGS+ +SQ NEERAS   SD +++D+P E H QQLALALPHQVAP       
Sbjct  170   KLQLAQKGSGSSIHSQSNEERASPHTSDAQKADNPSETHNQQLALALPHQVAP-------  222

Query  1025  RHMEqpqqpsvppipsqviTQSQGYYLSPTQM----PLS--QGQYMPSESQYRTPQMQEV  1186
                +Q    +    P Q +TQ Q YYL PTQ+    P +  Q QY+P +SQYR PQ+QE+
Sbjct  223   ---QQQPVAAPTQPPPQNVTQQQSYYL-PTQLQNPPPQAHPQNQYLPPDSQYRNPQVQEM  278

Query  1187  AR  1192
              R
Sbjct  279   PR  280



>emb|CDP14783.1| unnamed protein product [Coffea canephora]
Length=539

 Score =   265 bits (678),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 156/244 (64%), Positives = 185/244 (76%), Gaps = 14/244 (6%)
 Frame = +2

Query  485   QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
             +EFHK+RM RSS+ P ++Y PPE+SSFNQDVI  VE++MKKYADNLMRFLEG+SSRLSQL
Sbjct  54    KEFHKNRMARSSVFPAASYSPPEESSFNQDVIATVERTMKKYADNLMRFLEGISSRLSQL  113

Query  665   ELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELA  844
             ELYCYNLDKSI EMRS+L  DH E ++KLKSLEKHLQEVHRSVQILRDKQELA+AQKELA
Sbjct  114   ELYCYNLDKSIAEMRSELGGDHTEAETKLKSLEKHLQEVHRSVQILRDKQELAEAQKELA  173

Query  845   KLQLAQKESGSANNSQQNEERASQPASDTKRSDSPCELHGQQLALALPHQVAPPQTSHTT  1024
             KL LAQKES SA+N  Q EER S PASD K+S++  + HGQQLALAL      P      
Sbjct  174   KLHLAQKESSSASNLPQKEERVSAPASDAKKSENSSDSHGQQLALAL------PHQVPQP  227

Query  1025  RHMEqpqqpsvppipsqviTQSQGYYLSPTQMP--------LSQGQYMPSESQYRTPQMQ  1180
             +  + P     PP+PSQ + Q+Q YYL P Q+P         SQGQY+P +S YR PQ+Q
Sbjct  228   QQQQPPSVAPPPPMPSQSVPQAQAYYLPPHQLPNVPAAASQPSQGQYLPPDSHYRAPQLQ  287

Query  1181  EVAR  1192
             +V+R
Sbjct  288   DVSR  291



>ref|XP_011098021.1| PREDICTED: extensin [Sesamum indicum]
Length=525

 Score =   259 bits (663),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 154/241 (64%), Positives = 180/241 (75%), Gaps = 14/241 (6%)
 Frame = +2

Query  464   SSKLCIEQEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGL  643
             SS     +EF+KSRM RSS+ P S Y PPE+SSFNQ VI  VE +MKKY DN+MRFLEG+
Sbjct  45    SSATNSTKEFNKSRMARSSVFPASTYSPPEESSFNQGVITTVENTMKKYTDNIMRFLEGI  104

Query  644   SSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELA  823
             SSR+SQLELYCYNLDKSIGEMRSDL+ DHGE++SKLKSLEKH+QEVHRSVQILRDKQELA
Sbjct  105   SSRMSQLELYCYNLDKSIGEMRSDLLRDHGESESKLKSLEKHIQEVHRSVQILRDKQELA  164

Query  824   DAQKELAKLQLAQKESGSANNSQQNEERASQPASDTKRSDSPCELHGQQLALALPHQVAP  1003
             D QKELAKLQLAQKES    ++QQNE+RAS PAS+ K+S++  + H QQLALALPHQV+ 
Sbjct  165   DTQKELAKLQLAQKES----SNQQNEDRASTPASEVKKSENSSDTHDQQLALALPHQVS-  219

Query  1004  PQTSHTTRHMEqpqqpsvppipsqviT--QSQGYYLSPTQMP-------LSQGQYMPSES  1156
             PQ S   R +E  Q    PP      +  Q Q YYL P QM         SQ QY+P++S
Sbjct  220   PQPSIPARPLEHQQPSMAPPSSMPPQSMPQVQAYYLPPPQMSNVGASSQPSQTQYLPAQS  279

Query  1157  Q  1159
             Q
Sbjct  280   Q  280



>ref|XP_009336198.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15-like isoform X1 [Pyrus x bretschneideri]
Length=522

 Score =   256 bits (655),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 148/243 (61%), Positives = 174/243 (72%), Gaps = 17/243 (7%)
 Frame = +2

Query  482   EQEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQ  661
             +Q+ H+SR+ R  M  + A+  PE+S  +QDV   VEKSMKKYADNLMRFLEG+SSRLSQ
Sbjct  51    KQDIHRSRLARQPMFSSPAFSQPEES-LHQDVTATVEKSMKKYADNLMRFLEGISSRLSQ  109

Query  662   LELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKEL  841
             LELYCYN+DKSIGEMRS+L  DH E +SKLKSLEKHLQEVHRSVQI+RDKQELA+AQKEL
Sbjct  110   LELYCYNVDKSIGEMRSELGRDHEEAESKLKSLEKHLQEVHRSVQIIRDKQELAEAQKEL  169

Query  842   AKLQLAQKESGSANNSQQNEERASQPASDTKRSDSPCELHGQQLALALPHQVAPPQTSHT  1021
             AKLQLAQK S S+ +SQ NE+RAS P SD +++D P E H QQLALALPHQVAP      
Sbjct  170   AKLQLAQKGSASSTHSQSNEDRASPPTSDAQKADHPSETHNQQLALALPHQVAP------  223

Query  1022  TRHMEqpqqpsvppipsqviTQSQGYYL------SPTQMPLSQGQYMPSESQYRTPQMQE  1183
                 +Q         P Q +T  Q YYL       P Q    Q QY+P +SQYR PQ+QE
Sbjct  224   ----QQQPVAPSTQPPPQNVTPQQSYYLPTQLQNPPPQAQHPQNQYLPPDSQYRNPQVQE  279

Query  1184  VAR  1192
             + R
Sbjct  280   MPR  282



>gb|EYU28592.1| hypothetical protein MIMGU_mgv1a004659mg [Erythranthe guttata]
Length=516

 Score =   256 bits (654),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 144/216 (67%), Positives = 164/216 (76%), Gaps = 7/216 (3%)
 Frame = +2

Query  485   QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
             +EF+KSRM RSS+ P   Y  PE+SSFNQ VI  VE +MKK+ DNLMRFLEG+SSRLSQL
Sbjct  52    KEFNKSRMARSSVFPAPTYGTPEESSFNQGVISTVENTMKKHTDNLMRFLEGISSRLSQL  111

Query  665   ELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELA  844
             ELYCYNLDKSIGEMRSDLV DHGE++SKLKSL+KH+QEVHRSVQILRDKQELAD QKELA
Sbjct  112   ELYCYNLDKSIGEMRSDLVRDHGESESKLKSLDKHIQEVHRSVQILRDKQELADTQKELA  171

Query  845   KLQLAQKESGSANNSQQNEERASQPASDTKRSDSPCELHGQQLALALPHQVAPPQTSHTT  1024
             KL LAQKESGSA N+QQNE+RAS P S+ K+ D+  +   QQLALALPHQVA PQ S   
Sbjct  172   KLHLAQKESGSATNTQQNEDRASTPNSEAKKGDNTSD--SQQLALALPHQVA-PQPSLPA  228

Query  1025  RHME----qpqqpsvppipsqviTQSQGYYLSPTQM  1120
             R +E           P     +  Q QGYY+ P QM
Sbjct  229   RPLEHQQPTMAMAPPPSSTQSMPPQVQGYYMPPPQM  264



>ref|XP_009336199.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15-like isoform X2 [Pyrus x bretschneideri]
Length=521

 Score =   255 bits (651),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 147/242 (61%), Positives = 173/242 (71%), Gaps = 17/242 (7%)
 Frame = +2

Query  485   QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
             ++ H+SR+ R  M  + A+  PE+S  +QDV   VEKSMKKYADNLMRFLEG+SSRLSQL
Sbjct  51    KDIHRSRLARQPMFSSPAFSQPEES-LHQDVTATVEKSMKKYADNLMRFLEGISSRLSQL  109

Query  665   ELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELA  844
             ELYCYN+DKSIGEMRS+L  DH E +SKLKSLEKHLQEVHRSVQI+RDKQELA+AQKELA
Sbjct  110   ELYCYNVDKSIGEMRSELGRDHEEAESKLKSLEKHLQEVHRSVQIIRDKQELAEAQKELA  169

Query  845   KLQLAQKESGSANNSQQNEERASQPASDTKRSDSPCELHGQQLALALPHQVAPPQTSHTT  1024
             KLQLAQK S S+ +SQ NE+RAS P SD +++D P E H QQLALALPHQVAP       
Sbjct  170   KLQLAQKGSASSTHSQSNEDRASPPTSDAQKADHPSETHNQQLALALPHQVAP-------  222

Query  1025  RHMEqpqqpsvppipsqviTQSQGYYL------SPTQMPLSQGQYMPSESQYRTPQMQEV  1186
                +Q         P Q +T  Q YYL       P Q    Q QY+P +SQYR PQ+QE+
Sbjct  223   ---QQQPVAPSTQPPPQNVTPQQSYYLPTQLQNPPPQAQHPQNQYLPPDSQYRNPQVQEM  279

Query  1187  AR  1192
              R
Sbjct  280   PR  281



>ref|XP_012088286.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15 [Jatropha curcas]
 gb|KDP24130.1| hypothetical protein JCGZ_25787 [Jatropha curcas]
Length=532

 Score =   253 bits (645),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 151/243 (62%), Positives = 180/243 (74%), Gaps = 17/243 (7%)
 Frame = +2

Query  485   QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
             ++FHK RM RSS+ P ++Y  PEDS F+QD+I   EKSMKK+ DN+MRFLEG+SSRLSQL
Sbjct  51    KDFHKGRMARSSVFPANSYSQPEDS-FSQDMISFFEKSMKKHTDNVMRFLEGVSSRLSQL  109

Query  665   ELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELA  844
             ELYCYNLDKSIGEMRSDLV DHGE D+KLKSL KH+QEVHRSVQILRDKQELA+ QKELA
Sbjct  110   ELYCYNLDKSIGEMRSDLVRDHGEADAKLKSLGKHIQEVHRSVQILRDKQELAETQKELA  169

Query  845   KLQLAQKESGSANNSQQNEERASQPASDTKRSDSPCELHGQQLALALPHQVAPPQTSHTT  1024
             KLQLAQKES S+N+S Q+EE+AS PASD K++D+  E+H QQLALALPHQ          
Sbjct  170   KLQLAQKESASSNHS-QSEEKASSPASDPKKADNSPEMHNQQLALALPHQ--------VV  220

Query  1025  RHMEqpqqpsvppipsqviTQSQGYYLSPTQMP-------LSQGQYMPSESQYRTPQMQE  1183
                +    P     P Q +TQ Q YYL  TQ+P         Q QY+ S+ QYRT QMQ+
Sbjct  221   PQQQPAPVPPPTQAPPQNVTQQQSYYLPSTQLPNPPAQTQHPQSQYLSSDPQYRTHQMQD  280

Query  1184  VAR  1192
             ++R
Sbjct  281   ISR  283



>gb|KEH17617.1| structural constituent of cell wall protein, putative [Medicago 
truncatula]
Length=527

 Score =   252 bits (643),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 149/240 (62%), Positives = 181/240 (75%), Gaps = 13/240 (5%)
 Frame = +2

Query  485   QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
             ++FHKSR+ R+S+ P  AY PPEDS  +QDVI  VEKSMKKYADNLMRFLEG+SSRLSQL
Sbjct  45    KDFHKSRVARTSVFPAPAYNPPEDS-LSQDVIATVEKSMKKYADNLMRFLEGISSRLSQL  103

Query  665   ELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELA  844
             ELYCYNLDKSIGE+RSDL  DHG+ DSKLKSLEKH+QEVHRSVQILRDKQELA+ QKELA
Sbjct  104   ELYCYNLDKSIGEIRSDLNRDHGDQDSKLKSLEKHVQEVHRSVQILRDKQELAETQKELA  163

Query  845   KLQLAQKESGSANNSQQNEERASQPASDTKRSDSPCELHGQQLALALPHQVAPPQTSHTT  1024
             KLQLAQKES S+++SQ NE+++S   +D K++D+  + + QQLALALPHQ+A        
Sbjct  164   KLQLAQKESSSSSHSQSNEDKSSPSTTDPKKADNASDTNNQQLALALPHQIA------PQ  217

Query  1025  RHMEqpqqpsvppipsqviTQSQGYYLSP----TQMPLSQGQYMPSESQYRTPQMQEVAR  1192
                  P     PP      TQ   YY+ P    +Q+P  Q QYMPS+ QYRTPQ+Q+++R
Sbjct  218   PQPAGPPPAQAPPPNVNQPTQQPSYYMPPAPAASQLP--QNQYMPSDQQYRTPQLQDMSR  275



>ref|XP_010110218.1| hypothetical protein L484_009824 [Morus notabilis]
 gb|EXC25515.1| hypothetical protein L484_009824 [Morus notabilis]
Length=527

 Score =   251 bits (640),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 141/226 (62%), Positives = 165/226 (73%), Gaps = 19/226 (8%)
 Frame = +2

Query  536   AYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSD  715
             AY  PEDS FNQDVI AVEKSMK+ ADNLMRFLEG+SSRLSQLELYCYNLDKSIGEMRSD
Sbjct  67    AYTQPEDS-FNQDVISAVEKSMKRNADNLMRFLEGISSRLSQLELYCYNLDKSIGEMRSD  125

Query  716   LVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQ  895
             L+ DHGE DSKLK+++KHLQEVHRS+QILRDKQELAD QKELAKLQL QKES S+++ Q 
Sbjct  126   LIRDHGEADSKLKAIDKHLQEVHRSIQILRDKQELADTQKELAKLQLVQKESSSSSH-QS  184

Query  896   NEERASQPASDTKRSDSPCELHGQQLALALPHQVAPPQTSHTTRHMEqpqqpsvppipsq  1075
              E+RAS P SD+K++D+  + H QQLALALPHQVAP           Q         P Q
Sbjct  185   TEDRASPPTSDSKKNDNTSDTHNQQLALALPHQVAP----------SQQPVAPPVQPPPQ  234

Query  1076  viTQSQGYYLSPTQMPLSQG-------QYMPSESQYRTPQMQEVAR  1192
              ++Q   YYL   Q+P           QY+ S+ QYRTPQ+Q++ R
Sbjct  235   NVSQQPPYYLPAPQLPNPPAPAQHPHRQYVASDPQYRTPQLQDIPR  280



>ref|XP_009341976.1| PREDICTED: ATP-dependent helicase brm-like isoform X1 [Pyrus 
x bretschneideri]
Length=522

 Score =   251 bits (640),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 150/243 (62%), Positives = 175/243 (72%), Gaps = 17/243 (7%)
 Frame = +2

Query  482   EQEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQ  661
             +Q+FH+SRM+R  M  + A+  PE+S  +QDV   VEKSMKKYADNLMRFLEG+SSRLSQ
Sbjct  51    KQDFHRSRMSRQPMFSSPAFSQPEES-LHQDVTATVEKSMKKYADNLMRFLEGISSRLSQ  109

Query  662   LELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKEL  841
             LELYCYN+DKSIGEMRSDL  DH E +SKLKSLEKHLQEVHRSVQI+RDKQELA+AQKEL
Sbjct  110   LELYCYNVDKSIGEMRSDLGRDHEEAESKLKSLEKHLQEVHRSVQIIRDKQELAEAQKEL  169

Query  842   AKLQLAQKESGSANNSQQNEERASQPASDTKRSDSPCELHGQQLALALPHQVAPPQTSHT  1021
             AKLQLAQK S S+ +SQ NE+RAS P SD +++D P E H QQLALALPHQVA       
Sbjct  170   AKLQLAQKGSASSTHSQSNEDRASPPTSDAQKADHPSETHNQQLALALPHQVA-------  222

Query  1022  TRHMEqpqqpsvppipsqviTQSQGYYL------SPTQMPLSQGQYMPSESQYRTPQMQE  1183
                 +Q         P Q +T  Q YYL       P Q    Q QY+P +SQYR PQ+QE
Sbjct  223   ---PQQQPVAPPTQPPPQNVTPQQSYYLPTQLQNPPPQAQHPQNQYLPPDSQYRNPQVQE  279

Query  1184  VAR  1192
             + R
Sbjct  280   MPR  282



>ref|XP_009341977.1| PREDICTED: ATP-dependent helicase brm-like isoform X2 [Pyrus 
x bretschneideri]
Length=521

 Score =   249 bits (635),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 149/242 (62%), Positives = 174/242 (72%), Gaps = 17/242 (7%)
 Frame = +2

Query  485   QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
             ++FH+SRM+R  M  + A+  PE+S  +QDV   VEKSMKKYADNLMRFLEG+SSRLSQL
Sbjct  51    KDFHRSRMSRQPMFSSPAFSQPEES-LHQDVTATVEKSMKKYADNLMRFLEGISSRLSQL  109

Query  665   ELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELA  844
             ELYCYN+DKSIGEMRSDL  DH E +SKLKSLEKHLQEVHRSVQI+RDKQELA+AQKELA
Sbjct  110   ELYCYNVDKSIGEMRSDLGRDHEEAESKLKSLEKHLQEVHRSVQIIRDKQELAEAQKELA  169

Query  845   KLQLAQKESGSANNSQQNEERASQPASDTKRSDSPCELHGQQLALALPHQVAPPQTSHTT  1024
             KLQLAQK S S+ +SQ NE+RAS P SD +++D P E H QQLALALPHQVA        
Sbjct  170   KLQLAQKGSASSTHSQSNEDRASPPTSDAQKADHPSETHNQQLALALPHQVA--------  221

Query  1025  RHMEqpqqpsvppipsqviTQSQGYYL------SPTQMPLSQGQYMPSESQYRTPQMQEV  1186
                +Q         P Q +T  Q YYL       P Q    Q QY+P +SQYR PQ+QE+
Sbjct  222   --PQQQPVAPPTQPPPQNVTPQQSYYLPTQLQNPPPQAQHPQNQYLPPDSQYRNPQVQEM  279

Query  1187  AR  1192
              R
Sbjct  280   PR  281



>ref|XP_002517918.1| structural constituent of cell wall, putative [Ricinus communis]
 gb|EEF44436.1| structural constituent of cell wall, putative [Ricinus communis]
Length=536

 Score =   247 bits (631),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 148/244 (61%), Positives = 179/244 (73%), Gaps = 19/244 (8%)
 Frame = +2

Query  485   QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
             +++HKSRM+RSS+   S+Y  PEDS F+QDVI  VE+SMKK+ D LMRFLEG+SSRLSQL
Sbjct  51    KDYHKSRMSRSSLFHASSYSQPEDS-FSQDVISVVERSMKKHTDGLMRFLEGVSSRLSQL  109

Query  665   ELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELA  844
             EL CYNLDKSIGEMRSDLV    + DSKLKSLEKHLQEVHRSVQILRDKQELAD QKELA
Sbjct  110   ELNCYNLDKSIGEMRSDLVRHRADGDSKLKSLEKHLQEVHRSVQILRDKQELADTQKELA  169

Query  845   KLQLAQKESGSANNSQQNEERASQPASDTKRSDSPCELHGQQLALALPHQVAP-PQTSHT  1021
             KLQL QKE  S+++SQ  EE+AS PA+D K++D+  E+H QQLALALPHQ+ P PQ++  
Sbjct  170   KLQLVQKEPSSSSHSQA-EEKASPPATDPKKTDNTPEIHSQQLALALPHQIVPQPQSAPV  228

Query  1022  TRHMEqpqqpsvppipsqviTQSQGYYLSPTQMP-------LSQGQYMPSESQYRTPQMQ  1180
                 +          P Q +TQ Q YYL P Q+P         QG YM ++ QY TPQ+Q
Sbjct  229   PPPSQ---------APPQNVTQQQSYYLPPAQLPNPPAQAQHPQGPYMSADPQYGTPQIQ  279

Query  1181  EVAR  1192
             ++ R
Sbjct  280   DMTR  283



>ref|XP_008342910.1| PREDICTED: extensin-like isoform X1 [Malus domestica]
Length=522

 Score =   246 bits (629),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 149/243 (61%), Positives = 173/243 (71%), Gaps = 17/243 (7%)
 Frame = +2

Query  482   EQEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQ  661
             +Q+F +SRM+R  M  + AY  PE+S  +QDV   VEKSMKKYADNLMRFLEG+SSRLSQ
Sbjct  51    KQDFQRSRMSRQPMFSSPAYSQPEES-LHQDVTATVEKSMKKYADNLMRFLEGISSRLSQ  109

Query  662   LELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKEL  841
             LELYCYN+DKSIGEMRSDL  DH E +SKLKSLEKHLQEVHRSVQI+RDKQELA+ QKEL
Sbjct  110   LELYCYNVDKSIGEMRSDLGRDHEEAESKLKSLEKHLQEVHRSVQIIRDKQELAETQKEL  169

Query  842   AKLQLAQKESGSANNSQQNEERASQPASDTKRSDSPCELHGQQLALALPHQVAPPQTSHT  1021
             AKLQLAQK S S+ +SQ NE+RAS P SD +++D P E H QQLALALPHQVA       
Sbjct  170   AKLQLAQKGSASSTHSQSNEDRASPPTSDAQKADHPSETHNQQLALALPHQVA-------  222

Query  1022  TRHMEqpqqpsvppipsqviTQSQGYYL------SPTQMPLSQGQYMPSESQYRTPQMQE  1183
                 +Q         P Q +T  Q YYL       P Q    Q QY+P +SQYR PQ+QE
Sbjct  223   ---PQQQPVAPPTQPPPQNVTPQQSYYLPTQLQNPPPQAQHPQNQYLPPDSQYRXPQVQE  279

Query  1184  VAR  1192
             + R
Sbjct  280   MPR  282



>ref|XP_008342911.1| PREDICTED: extensin-like isoform X2 [Malus domestica]
Length=521

 Score =   245 bits (626),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 142/225 (63%), Positives = 161/225 (72%), Gaps = 17/225 (8%)
 Frame = +2

Query  536   AYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSD  715
             AY  PE+S  +QDV   VEKSMKKYADNLMRFLEG+SSRLSQLELYCYN+DKSIGEMRSD
Sbjct  68    AYSQPEES-LHQDVTATVEKSMKKYADNLMRFLEGISSRLSQLELYCYNVDKSIGEMRSD  126

Query  716   LVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQ  895
             L  DH E +SKLKSLEKHLQEVHRSVQI+RDKQELA+ QKELAKLQLAQK S S+ +SQ 
Sbjct  127   LGRDHEEAESKLKSLEKHLQEVHRSVQIIRDKQELAETQKELAKLQLAQKGSASSTHSQS  186

Query  896   NEERASQPASDTKRSDSPCELHGQQLALALPHQVAPPQTSHTTRHMEqpqqpsvppipsq  1075
             NE+RAS P SD +++D P E H QQLALALPHQVA           +Q         P Q
Sbjct  187   NEDRASPPTSDAQKADHPSETHNQQLALALPHQVA----------PQQQPVAPPTQPPPQ  236

Query  1076  viTQSQGYYL------SPTQMPLSQGQYMPSESQYRTPQMQEVAR  1192
              +T  Q YYL       P Q    Q QY+P +SQYR PQ+QE+ R
Sbjct  237   NVTPQQSYYLPTQLQNPPPQAQHPQNQYLPPDSQYRXPQVQEMPR  281



>ref|XP_002325597.2| hydroxyproline-rich glycoprotein [Populus trichocarpa]
 gb|EEE99978.2| hydroxyproline-rich glycoprotein [Populus trichocarpa]
Length=537

 Score =   245 bits (625),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 147/244 (60%), Positives = 178/244 (73%), Gaps = 16/244 (7%)
 Frame = +2

Query  485   QEFHKsrmtrssmmptsAYIPPEDS-SFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQ  661
             ++FHKS+MTRSS+ P S+Y  PEDS  F+ DV+  VEK MKK+ DN+MRFLEG+SSRLSQ
Sbjct  53    KDFHKSKMTRSSVYPASSYSQPEDSFHFSPDVVSTVEKGMKKHTDNIMRFLEGISSRLSQ  112

Query  662   LELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKEL  841
             LEL CYNLDK+IG+MRSD + D+ E D KLKSLEKH+QEVHRSVQILRDKQELA+ QKEL
Sbjct  113   LELSCYNLDKAIGDMRSDSIRDNEEADLKLKSLEKHIQEVHRSVQILRDKQELAETQKEL  172

Query  842   AKLQLAQKESGSANNSQQNEERASQPASDTKRSDSPCELHGQQLALALPHQVAPPQTSHT  1021
             AKLQLAQKE  S++ SQ NEE+A   ASD K +D+  ++  QQLALALPHQVAP Q +  
Sbjct  173   AKLQLAQKEPSSSSQSQSNEEKAPPAASDPKATDNASDIRNQQLALALPHQVAPQQHAPP  232

Query  1022  TRHMEqpqqpsvppipsqviTQSQGYYLSPTQMPL-------SQGQYMPSESQYRTPQMQ  1180
                +           P Q +TQ Q YYL P Q+P         Q QY+PS+ QYRTPQMQ
Sbjct  233   VPPLS--------QAPPQNVTQQQSYYLPPAQLPTPAAPIQHPQNQYLPSDPQYRTPQMQ  284

Query  1181  EVAR  1192
             +V+R
Sbjct  285   DVSR  288



>ref|XP_007043595.1| Structural constituent of cell wall [Theobroma cacao]
 gb|EOX99426.1| Structural constituent of cell wall [Theobroma cacao]
Length=552

 Score =   244 bits (624),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 142/246 (58%), Positives = 166/246 (67%), Gaps = 39/246 (16%)
 Frame = +2

Query  536   AYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSD  715
             AY  PEDS F+ DV   VEK+MKKYADNLMRFLEG+SSRLSQLELYCYNLDK+IGEMRSD
Sbjct  69    AYSQPEDS-FSTDVTATVEKTMKKYADNLMRFLEGISSRLSQLELYCYNLDKTIGEMRSD  127

Query  716   LVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQ  895
             LV DH + D KLKS+EKHLQEVHRSVQILRDKQELA+ QKELAKLQL QKES S+++SQ 
Sbjct  128   LVRDHVDADLKLKSIEKHLQEVHRSVQILRDKQELAETQKELAKLQLVQKESSSSSHSQS  187

Query  896   NEERASQPASDTKRSDSPCELHGQQLALALPHQVAPPQTSHTTRHMEqpqqpsvppipsq  1075
              EERAS PASD+K++D   ++  QQLALALPHQVAPPQ      H +   Q         
Sbjct  188   TEERASPPASDSKKTDHTSDMQSQQLALALPHQVAPPQQP-VVPHSQASPQNLTQ-----  241

Query  1076  viTQSQGYYLSPTQMPLS---------------------------QGQYMPSESQYRTPQ  1174
                  Q YY+ P Q+  S                           Q QY+PS+SQYRTPQ
Sbjct  242   -----QSYYIPPNQLSNSQAQVQAPAPAPVPTPAPAPAPAPIQHPQSQYLPSDSQYRTPQ  296

Query  1175  MQEVAR  1192
             + +++R
Sbjct  297   IPDISR  302



>ref|XP_004506616.1| PREDICTED: transcription factor SPT20 homolog [Cicer arietinum]
Length=523

 Score =   243 bits (621),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 149/251 (59%), Positives = 176/251 (70%), Gaps = 36/251 (14%)
 Frame = +2

Query  485   QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
             ++FHK+R+ R+S+ PT+AY PPEDS  +QDVI  VEKSMKKYADNLMRFLEG+SSRLSQL
Sbjct  52    KDFHKTRVARTSVFPTTAYNPPEDS-LSQDVIATVEKSMKKYADNLMRFLEGISSRLSQL  110

Query  665   ELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELA  844
             ELYCYNLDKSIGEMRSDL  DHGE DSKLKSLEKHLQEVHRSVQILRDKQELA+ QKELA
Sbjct  111   ELYCYNLDKSIGEMRSDLNRDHGEQDSKLKSLEKHLQEVHRSVQILRDKQELAETQKELA  170

Query  845   KLQLAQKESGSANNSQQNEERASQPASDTKRSDSPCELHGQQLALALPH-----------  991
             KLQLAQKES S ++SQ NE+R++    D K++D+  +   QQLALALPH           
Sbjct  171   KLQLAQKESSSTSHSQPNEDRSAPSTGDPKKTDNASDASNQQLALALPHQIPPQPQPSLP  230

Query  992   --QVAPPQTSHTTRHMEqpqqpsvppipsqviTQSQGYYL--SPTQMPLSQGQYMPSESQ  1159
               Q  PP  + T                     Q   YY+  +P    L Q QYMPS+ Q
Sbjct  231   SAQAPPPNVTQT--------------------PQQSAYYMPPAPAAAQLPQNQYMPSDQQ  270

Query  1160  YRTPQMQEVAR  1192
             YRTPQ+Q+++R
Sbjct  271   YRTPQLQDMSR  281



>ref|XP_004303103.1| PREDICTED: transcriptional regulator DEF1 [Fragaria vesca subsp. 
vesca]
Length=540

 Score =   237 bits (604),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 151/240 (63%), Positives = 171/240 (71%), Gaps = 17/240 (7%)
 Frame = +2

Query  485   QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
             Q+FHKSRM RS M  ++AY  PEDS  NQ+VI  VEKSMKKYADNLMRFLEG+SSRLSQL
Sbjct  52    QDFHKSRMARSPMYSSAAYGQPEDS-LNQEVIATVEKSMKKYADNLMRFLEGISSRLSQL  110

Query  665   ELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELA  844
             ELYCYNLDKSIGEMRSDL  DHGE D+KLKSLEKHLQEVHRSVQILRDKQELA+ QKELA
Sbjct  111   ELYCYNLDKSIGEMRSDLNRDHGEADTKLKSLEKHLQEVHRSVQILRDKQELAETQKELA  170

Query  845   KLQLAQKESGSANNSQQNEERASQPASDTKRSDSPCELHGQQLALALPHQVAPPQTSHTT  1024
             KLQLAQK S S+ +SQ NEERAS P SD +++D+  E   QQLALALP         H  
Sbjct  171   KLQLAQKGSSSSIHSQSNEERASPPTSDGQKTDNTSETANQQLALALP---------HQV  221

Query  1025  RHMEqpqqpsvppipsqviTQSQGYYLSPTQM--PL-----SQGQYMPSESQYRTPQMQE  1183
                +QP  P           Q Q YYL  +Q+  P       Q QY+ S+ QYRTPQ+Q+
Sbjct  222   APQQQPVAPPQQAPTQSATQQQQTYYLPQSQLSNPAPAQQHPQSQYLASDPQYRTPQLQD  281



>ref|XP_010035753.1| PREDICTED: RNA polymerase II degradation factor 1-like [Eucalyptus 
grandis]
 gb|KCW47211.1| hypothetical protein EUGRSUZ_K01026 [Eucalyptus grandis]
Length=535

 Score =   234 bits (598),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 140/239 (59%), Positives = 171/239 (72%), Gaps = 19/239 (8%)
 Frame = +2

Query  485   QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
             ++FHKSR+ R  +    AY  PEDS FNQD+I +VEKSMKK+ D+LMRFLEG+SSRLS+L
Sbjct  53    KDFHKSRLVRPMVYSAPAYSQPEDS-FNQDLIASVEKSMKKHTDSLMRFLEGISSRLSEL  111

Query  665   ELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELA  844
             ELYCYNLDKSIGEMRS L  DHG+ D+KLKSL+KHLQEVHRSVQILRDKQELA+ QKELA
Sbjct  112   ELYCYNLDKSIGEMRSQLNRDHGDADTKLKSLDKHLQEVHRSVQILRDKQELAETQKELA  171

Query  845   KLQLAQKESGSANNSQQNEERASQPASDTKRSDSPCELHGQQLALALPHQVAPPQTSHTT  1024
             KLQLAQKES S ++ + NEE+ S P SD+K+SD+  ++  QQLALALPHQV+        
Sbjct  172   KLQLAQKESSSGHD-KSNEEKTSTPKSDSKKSDNASDVSDQQLALALPHQVS--------  222

Query  1025  RHMEqpqqpsvppipsqviTQSQGYYLSPTQMP-------LSQGQYMPSESQYRTPQMQ  1180
                 QP        P+Q ++Q Q YYL P Q+P       L Q QY+ S+   R  Q+Q
Sbjct  223   --PPQPPAAPPSQAPAQNVSQQQTYYLQPGQIPNTSVPAQLPQSQYVASDPHVRMSQLQ  279



>ref|XP_007132659.1| hypothetical protein PHAVU_011G113900g [Phaseolus vulgaris]
 gb|ESW04653.1| hypothetical protein PHAVU_011G113900g [Phaseolus vulgaris]
Length=541

 Score =   234 bits (596),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 151/233 (65%), Positives = 176/233 (76%), Gaps = 3/233 (1%)
 Frame = +2

Query  482   EQEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQ  661
             + +FHK+RM+R+SM PT+AY PPEDS  +QDVI  VEKSMKKYADNLMRFLEG+SSRLSQ
Sbjct  43    DPDFHKARMSRTSMFPTTAYNPPEDS-LSQDVIATVEKSMKKYADNLMRFLEGISSRLSQ  101

Query  662   LELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKEL  841
             LELYCYNLDKSIGEMRSDL  D+ E DS+LKSLEKHLQEVHRSVQILRDKQELA+ QKEL
Sbjct  102   LELYCYNLDKSIGEMRSDLTRDNVEQDSRLKSLEKHLQEVHRSVQILRDKQELAETQKEL  161

Query  842   AKLQLAQKESGSANNSQQNEERASQPASDTKRSDSPCELHGQQLALALPHQVAPPQTSHT  1021
             AKLQ AQKES S+++SQ NEER+S P +D K++D+  E + QQLALALPHQ+AP Q    
Sbjct  162   AKLQHAQKESSSSSHSQSNEERSS-PTTDPKKTDNASESNNQQLALALPHQIAPHQQPAA  220

Query  1022  TRHMEqpqqpsvppipsqviTQSQGYYLSPTQMP-LSQGQYMPSESQYRTPQM  1177
                  Q   P+    P Q         L  T +  L Q QY+PSE QYRTPQ+
Sbjct  221   PPAQAQAPAPAQTQAPQQPPYYMPPTPLQNTPVAQLPQNQYLPSEQQYRTPQL  273



>gb|KHN35253.1| hypothetical protein glysoja_042323 [Glycine soja]
Length=531

 Score =   232 bits (592),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 146/239 (61%), Positives = 172/239 (72%), Gaps = 15/239 (6%)
 Frame = +2

Query  479   IEQEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLS  658
              + +FHKSRM R+SM PT+AY PPEDS  +QDVI  VEKSMKKYADNLMRFLEG+SSRLS
Sbjct  42    TDPDFHKSRMARTSMFPTTAYNPPEDS-LSQDVIATVEKSMKKYADNLMRFLEGISSRLS  100

Query  659   QLELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKE  838
             QLELYCYNLDKSIGEM+SD+  DH E DS+LKSLEKH+QEVHRSVQILRDKQELA+ QKE
Sbjct  101   QLELYCYNLDKSIGEMKSDINRDHVEQDSRLKSLEKHVQEVHRSVQILRDKQELAETQKE  160

Query  839   LAKLQLAQKESGSANNSQQNEERASQPASDTKRSDSPCELHGQQLALALPHQVAPPQTSH  1018
             LAKLQLAQKES S+++SQ NEER+S P +D K++D+  + + QQLALALPHQ+AP     
Sbjct  161   LAKLQLAQKESSSSSHSQSNEERSS-PTTDPKKTDNASDANNQQLALALPHQIAPQPQPA  219

Query  1019  TTRHMEqpqqpsvppipsqviTQSQGYYLSPTQMPLS------QGQYMPSESQYRTPQM  1177
                        +  P                T MP S      Q QY+PS+ QYRTPQ+
Sbjct  220   APSAQAAASNVTQAPQQPPYYIPP-------TPMPNSALPQHPQNQYLPSDQQYRTPQL  271



>gb|KHG27956.1| S-adenosylmethionine synthase 1 [Gossypium arboreum]
Length=552

 Score =   233 bits (593),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 141/248 (57%), Positives = 169/248 (68%), Gaps = 41/248 (17%)
 Frame = +2

Query  536   AYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSD  715
             AY  P+DS ++ DV   VEK+MKKYADNLMRFLEG+SSRLSQLELYCYNLDKSIGEMRSD
Sbjct  71    AYSQPDDSLYS-DVTATVEKTMKKYADNLMRFLEGISSRLSQLELYCYNLDKSIGEMRSD  129

Query  716   LVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQ  895
             L+ D+ + DSKLKS+EKHLQEVHRSVQILRDKQELA+ QKELAKLQLAQKES S+++SQ 
Sbjct  130   LIRDNEDADSKLKSIEKHLQEVHRSVQILRDKQELAETQKELAKLQLAQKESSSSSHSQS  189

Query  896   NEERASQPASDTKRSDSPCELHGQQLALALPHQVAPPQTSHTTRHMEqpqqpsvppipsq  1075
              EERAS PASD+K++D   E+  QQLALALPHQVAPPQ      H + P Q         
Sbjct  190   TEERASPPASDSKKTDHTSEMQNQQLALALPHQVAPPQQP-VVPHSQAPPQNL-------  241

Query  1076  viTQSQGYYLSPTQM-------PL----------------------SQGQYMPSESQYRT  1168
               TQ Q YY+   Q+       P+                      +Q QY+P + QY+ 
Sbjct  242   --TQ-QSYYIPSNQLSNPHAPAPVHVPAPTPTPAPPSLPAPAPTPHTQSQYLPPDPQYQA  298

Query  1169  PQMQEVAR  1192
             P +Q+V+R
Sbjct  299   PHIQDVSR  306



>ref|XP_011002849.1| PREDICTED: calcium-binding protein P-like [Populus euphratica]
Length=549

 Score =   230 bits (586),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 145/256 (57%), Positives = 178/256 (70%), Gaps = 28/256 (11%)
 Frame = +2

Query  485   QEFHKsrmtrssmmptsAYIPPEDS-SFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQ  661
             ++FHKS+MTRSS+ P S+Y  PEDS  F+ DV+  VEK MKK+ D++MRFLEG+SSRLSQ
Sbjct  53    KDFHKSKMTRSSVYPASSYSQPEDSFHFSPDVVSTVEKGMKKHTDSIMRFLEGISSRLSQ  112

Query  662   LELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKEL  841
             LEL CYNLDK+IG+MRSD + D+ E D KLKSLEKH+QEVHRSVQILRDKQELA+ QKEL
Sbjct  113   LELSCYNLDKAIGDMRSDSIRDNEEADLKLKSLEKHIQEVHRSVQILRDKQELAETQKEL  172

Query  842   AKLQLAQKESGSANNSQQN------------EERASQPASDTKRSDSPCELHGQQLALAL  985
             AKLQLAQKE  S++ SQ N            EE+A+  ASD K +D+  ++  QQLALAL
Sbjct  173   AKLQLAQKEPSSSSQSQSNQKEPSSSSQSQSEEKATPAASDPKATDNTSDIRNQQLALAL  232

Query  986   PHQVAPPQTSHTTRHMEqpqqpsvppipsqviTQSQGYYLSPTQMPL-------SQGQYM  1144
             PHQVAP Q +     +           P Q +TQ Q YYL   Q+P         Q QY+
Sbjct  233   PHQVAPQQHAPPVPPLS--------QAPPQNVTQQQSYYLPHAQLPTPAVPIQHPQNQYL  284

Query  1145  PSESQYRTPQMQEVAR  1192
             PS+ QYRTPQMQ+V+R
Sbjct  285   PSDPQYRTPQMQDVSR  300



>ref|XP_008455322.1| PREDICTED: transcription factor SPT20 homolog [Cucumis melo]
Length=514

 Score =   229 bits (583),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 122/213 (57%), Positives = 155/213 (73%), Gaps = 2/213 (1%)
 Frame = +2

Query  554   DSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHG  733
             D + +Q+VI  VE SMKK++DNL+RFLEG+SSRLSQLELYCYNLDKS+GEMRS+L  DH 
Sbjct  71    DDTISQNVISTVENSMKKHSDNLLRFLEGISSRLSQLELYCYNLDKSVGEMRSELARDHE  130

Query  734   ETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERAS  913
             E DSKLKSLEKH+QEVHRSVQI+RDKQELA+ QK+LAKLQ++QKE  S+N+SQ NEERAS
Sbjct  131   EADSKLKSLEKHVQEVHRSVQIIRDKQELAETQKDLAKLQVSQKEPSSSNHSQSNEERAS  190

Query  914   QPASDTKRSDSPCELHGQQLALALPHQVAPPQTSHTTRHMEqpqqpsvppipsqviTQSQ  1093
               ASD+K+ ++P E+H QQLALALPHQ+ P Q   T          ++P           
Sbjct  191   SVASDSKKKENPSEIHNQQLALALPHQIVPQQNPITPP--SAALPQNMPQQQQSYYISQS  248

Query  1094  GYYLSPTQMPLSQGQYMPSESQYRTPQMQEVAR  1192
                  P  +  +Q QY+ S+SQ+R  Q Q+V++
Sbjct  249   QLPGQPPHIQHAQSQYISSDSQHRASQPQDVSQ  281



>ref|XP_004136824.1| PREDICTED: trithorax group protein osa [Cucumis sativus]
 gb|KGN43616.1| hypothetical protein Csa_7G048000 [Cucumis sativus]
Length=515

 Score =   228 bits (581),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 122/213 (57%), Positives = 153/213 (72%), Gaps = 2/213 (1%)
 Frame = +2

Query  554   DSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHG  733
             D + +Q+VI  VE SMKK++DNL+RFLEG+SSRLSQLELYCYNLDKS+GEMRS+L  DH 
Sbjct  71    DDTISQNVISTVENSMKKHSDNLLRFLEGISSRLSQLELYCYNLDKSVGEMRSELARDHE  130

Query  734   ETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERAS  913
             E DSKLKSLEKH+QEVHRSVQI+RDKQELA+ QK+LAKLQ++QKE  S N+SQ NEERAS
Sbjct  131   EADSKLKSLEKHVQEVHRSVQIIRDKQELAETQKDLAKLQVSQKEPSSTNHSQSNEERAS  190

Query  914   QPASDTKRSDSPCELHGQQLALALPHQVAPPQTSHTTRHMEqpqqpsvppipsqviTQSQ  1093
               ASD K+ ++  E+H QQLALALPHQ+ P Q   T          ++P           
Sbjct  191   SVASDPKKKENSSEIHNQQLALALPHQIVPQQNPITPP--SAALPQNMPQQQQSYYISQS  248

Query  1094  GYYLSPTQMPLSQGQYMPSESQYRTPQMQEVAR  1192
                  P  +  +Q QY+PS+SQ+R  Q Q+V++
Sbjct  249   QLPGQPPHIQHAQSQYIPSDSQHRASQPQDVSQ  281



>gb|KFK35898.1| hypothetical protein AALP_AA4G050800 [Arabis alpina]
Length=484

 Score =   226 bits (576),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 118/172 (69%), Positives = 145/172 (84%), Gaps = 1/172 (1%)
 Frame = +2

Query  485  QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
            +EFHK+RM RSS+ PTS+Y PPEDS  +Q++   VE+SMKKYADN+MRFLEG+SSRLSQL
Sbjct  52   KEFHKTRMARSSVFPTSSYSPPEDS-LSQELTATVERSMKKYADNMMRFLEGISSRLSQL  110

Query  665  ELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELA  844
            ELYCYNLDK+IGEMRSDL  +H + D KL+SL+KHLQEVHRSVQILRDKQELAD QKELA
Sbjct  111  ELYCYNLDKTIGEMRSDLTREHDDADVKLRSLDKHLQEVHRSVQILRDKQELADTQKELA  170

Query  845  KLQLAQKESGSANNSQQNEERASQPASDTKRSDSPCELHGQQLALALPHQVA  1000
            +LQ+ QK+S S+ +SQ  EERA+ P  + K+SD+  + H QQLALALPHQ++
Sbjct  171  RLQIVQKDSSSSTHSQHAEERAATPVPEPKKSDTTSDPHNQQLALALPHQIS  222



>ref|XP_006582794.1| PREDICTED: vacuolar protein sorting-associated protein 27-like 
[Glycine max]
Length=486

 Score =   226 bits (576),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 138/233 (59%), Positives = 162/233 (70%), Gaps = 48/233 (21%)
 Frame = +2

Query  479   IEQEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLS  658
              + +FHKSRM R+SM PT+AY PPEDS  +QDVI  VEKSMKKYADNLMRFLEG+SSRLS
Sbjct  42    TDPDFHKSRMARTSMFPTTAYNPPEDS-LSQDVIATVEKSMKKYADNLMRFLEGISSRLS  100

Query  659   QLELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKE  838
             QLELYCYNLDKSIGEM+SD+  DH E DS+LKSLEKH+QEVHRSVQILRDKQELA+ QKE
Sbjct  101   QLELYCYNLDKSIGEMKSDINRDHVEQDSRLKSLEKHVQEVHRSVQILRDKQELAETQKE  160

Query  839   LAKLQLAQKESGSANNSQQNEERASQPASDTKRSDSPCELHGQQLALALPHQVAPPQTSH  1018
             LAKLQLAQKES S+++SQ NEER+S P +D K++D+  + + QQLALALPH         
Sbjct  161   LAKLQLAQKESSSSSHSQSNEERSS-PTTDPKKTDNASDANNQQLALALPH---------  210

Query  1019  TTRHMEqpqqpsvppipsqviTQSQGYYLSPTQMPLSQGQYMPSESQYRTPQM  1177
                                                  Q QY+PS+ QYRTPQ+
Sbjct  211   -------------------------------------QNQYLPSDQQYRTPQL  226



>ref|XP_011037329.1| PREDICTED: bromodomain-containing protein 4-like isoform X1 [Populus 
euphratica]
Length=527

 Score =   227 bits (578),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 152/260 (58%), Positives = 176/260 (68%), Gaps = 48/260 (18%)
 Frame = +2

Query  482   EQEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQ  661
             +Q+FHKSRMTRSSM P ++Y  PEDS F QDV+  VEKSMKK  DN+MRFLEG+SSRLSQ
Sbjct  53    KQDFHKSRMTRSSMFPATSYSQPEDS-FTQDVVSIVEKSMKKQTDNIMRFLEGISSRLSQ  111

Query  662   LELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKEL  841
             LEL CYNLDKSIGEMRSD VHD+ E D KLKSLEKH+QEVHRSVQILRDKQELA+ QKEL
Sbjct  112   LELCCYNLDKSIGEMRSDFVHDNEEADLKLKSLEKHIQEVHRSVQILRDKQELAETQKEL  171

Query  842   AKLQLAQKESGSANNSQQNEERASQPASDTKRSDSPCELHGQQLALALPHQV--------  997
              KLQLAQKE  S+++SQ +EE+ +  ASD K +D+  E+  QQLALALPHQV        
Sbjct  172   YKLQLAQKEPSSSSHSQSSEEKVAPAASDPKTTDNTSEIRNQQLALALPHQVAPQQQAPP  231

Query  998   ------APPQTSHTTRHMEqpqqpsvppipsqviTQSQGYYLS---------PTQMPLSQ  1132
                   APPQ                       + Q Q YYLS         PTQ P  Q
Sbjct  232   VPPLSQAPPQN----------------------VAQQQSYYLSPAPLPTPAAPTQHP--Q  267

Query  1133  GQYMPSESQYRTPQMQEVAR  1192
              QY+ S+ QYRTPQMQ+V+R
Sbjct  268   NQYLTSDPQYRTPQMQDVSR  287



>ref|XP_002869511.1| hypothetical protein ARALYDRAFT_491942 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45770.1| hypothetical protein ARALYDRAFT_491942 [Arabidopsis lyrata subsp. 
lyrata]
Length=494

 Score =   226 bits (575),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 121/172 (70%), Positives = 147/172 (85%), Gaps = 1/172 (1%)
 Frame = +2

Query  485  QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
            +EFHK+RM RSS+ PTS+Y PPEDS  +QD+ D VE++MKKYADN+MRFLEG+SSRLSQL
Sbjct  52   KEFHKTRMARSSVFPTSSYSPPEDS-LSQDLTDTVERTMKKYADNMMRFLEGISSRLSQL  110

Query  665  ELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELA  844
            ELYCYNLDK+IGEMRS+L H+H E D KL+SL+KHLQEVHRSVQILRDKQELAD QKELA
Sbjct  111  ELYCYNLDKTIGEMRSELTHEHEEADVKLRSLDKHLQEVHRSVQILRDKQELADTQKELA  170

Query  845  KLQLAQKESGSANNSQQNEERASQPASDTKRSDSPCELHGQQLALALPHQVA  1000
            KLQL QKES S+++SQ  E+R + P  + K+S++  + H QQLALALPHQ+A
Sbjct  171  KLQLVQKESSSSSHSQHGEDRVATPVPEPKKSENTSDAHNQQLALALPHQIA  222



>ref|XP_010448000.1| PREDICTED: vacuolar protein-sorting protein BRO1-like [Camelina 
sativa]
Length=495

 Score =   225 bits (573),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 146/171 (85%), Gaps = 1/171 (1%)
 Frame = +2

Query  488  EFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLE  667
            EFHK+RM RSS+ PTS+Y PPEDS  +QD+ D VE++MKKYADN+MRFLEG+SSRLSQLE
Sbjct  49   EFHKTRMARSSIFPTSSYSPPEDS-LSQDLTDTVERTMKKYADNMMRFLEGISSRLSQLE  107

Query  668  LYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAK  847
            LYCYNLDK+IGEMRS+L H+H E D KL+SL+KHLQEVHRSVQILRDKQELAD QKELAK
Sbjct  108  LYCYNLDKTIGEMRSELTHEHEEADVKLRSLDKHLQEVHRSVQILRDKQELADTQKELAK  167

Query  848  LQLAQKESGSANNSQQNEERASQPASDTKRSDSPCELHGQQLALALPHQVA  1000
            LQL QKES S+++SQ  E+R + P  + K+S++  + H QQLALALPHQ+A
Sbjct  168  LQLVQKESSSSSHSQHGEDRVATPVPEPKKSENTSDPHNQQLALALPHQIA  218



>ref|XP_011037330.1| PREDICTED: putative uncharacterized protein DDB_G0294196 isoform 
X2 [Populus euphratica]
Length=526

 Score =   225 bits (573),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 151/259 (58%), Positives = 175/259 (68%), Gaps = 48/259 (19%)
 Frame = +2

Query  485   QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
             ++FHKSRMTRSSM P ++Y  PEDS F QDV+  VEKSMKK  DN+MRFLEG+SSRLSQL
Sbjct  53    KDFHKSRMTRSSMFPATSYSQPEDS-FTQDVVSIVEKSMKKQTDNIMRFLEGISSRLSQL  111

Query  665   ELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELA  844
             EL CYNLDKSIGEMRSD VHD+ E D KLKSLEKH+QEVHRSVQILRDKQELA+ QKEL 
Sbjct  112   ELCCYNLDKSIGEMRSDFVHDNEEADLKLKSLEKHIQEVHRSVQILRDKQELAETQKELY  171

Query  845   KLQLAQKESGSANNSQQNEERASQPASDTKRSDSPCELHGQQLALALPHQV---------  997
             KLQLAQKE  S+++SQ +EE+ +  ASD K +D+  E+  QQLALALPHQV         
Sbjct  172   KLQLAQKEPSSSSHSQSSEEKVAPAASDPKTTDNTSEIRNQQLALALPHQVAPQQQAPPV  231

Query  998   -----APPQTSHTTRHMEqpqqpsvppipsqviTQSQGYYLS---------PTQMPLSQG  1135
                  APPQ                       + Q Q YYLS         PTQ P  Q 
Sbjct  232   PPLSQAPPQN----------------------VAQQQSYYLSPAPLPTPAAPTQHP--QN  267

Query  1136  QYMPSESQYRTPQMQEVAR  1192
             QY+ S+ QYRTPQMQ+V+R
Sbjct  268   QYLTSDPQYRTPQMQDVSR  286



>gb|KJB77268.1| hypothetical protein B456_012G128800 [Gossypium raimondii]
 gb|KJB77270.1| hypothetical protein B456_012G128800 [Gossypium raimondii]
 gb|KJB77272.1| hypothetical protein B456_012G128800 [Gossypium raimondii]
Length=551

 Score =   224 bits (572),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 138/250 (55%), Positives = 168/250 (67%), Gaps = 46/250 (18%)
 Frame = +2

Query  536   AYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSD  715
             AY  P+DS ++ DV   VEK+MKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEM+SD
Sbjct  71    AYSQPDDSLYS-DVTATVEKTMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMQSD  129

Query  716   LVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQ  895
             L+ D+ + DSKL S+EKHLQEVHRSVQILRDKQELA+ QKELAKLQLAQKES S+++SQ 
Sbjct  130   LIRDNEDADSKLNSIEKHLQEVHRSVQILRDKQELAETQKELAKLQLAQKESSSSSHSQS  189

Query  896   NEERASQPASDTKRSDSPCELHGQQLALALPHQVAP---PQTSHTTRHMEqpqqpsvppi  1066
              EERAS PASD+K++D   E+  QQLALALPHQVAP   P   H+               
Sbjct  190   TEERASPPASDSKKTDHTSEMQNQQLALALPHQVAPQQQPVVPHS-------------QS  236

Query  1067  psqviTQSQGYYLSPTQM-------PL---------------------SQGQYMPSESQY  1162
             P Q +TQ Q YY+   Q+       P+                     +Q QY+P + Q+
Sbjct  237   PPQNLTQ-QSYYIPSNQLSNPHAPAPVHVPAPTTPAPPPLPAPAPTPHTQSQYLPPDPQF  295

Query  1163  RTPQMQEVAR  1192
             + P +Q+V+R
Sbjct  296   QAPHIQDVSR  305



>ref|NP_194559.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAL36251.1| putative proline-rich protein [Arabidopsis thaliana]
 gb|AAM20028.1| putative proline-rich protein [Arabidopsis thaliana]
 gb|AEE85466.1| uncharacterized protein AT4G28300 [Arabidopsis thaliana]
Length=496

 Score =   223 bits (568),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 120/172 (70%), Positives = 145/172 (84%), Gaps = 1/172 (1%)
 Frame = +2

Query  485  QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
            +EFHK+RM RSS+ PTS+Y PPEDS  +QD+ D VE++MK YADN+MRFLEGLSSRLSQL
Sbjct  52   KEFHKTRMARSSVFPTSSYSPPEDS-LSQDITDTVERTMKMYADNMMRFLEGLSSRLSQL  110

Query  665  ELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELA  844
            ELYCYNLDK+IGEMRS+L H H + D KL+SL+KHLQEVHRSVQILRDKQELAD QKELA
Sbjct  111  ELYCYNLDKTIGEMRSELTHAHEDADVKLRSLDKHLQEVHRSVQILRDKQELADTQKELA  170

Query  845  KLQLAQKESGSANNSQQNEERASQPASDTKRSDSPCELHGQQLALALPHQVA  1000
            KLQL QKES S+++SQ  E+R + P  + K+S++  + H QQLALALPHQ+A
Sbjct  171  KLQLVQKESSSSSHSQHGEDRVATPVPEPKKSENTSDAHNQQLALALPHQIA  222



>ref|XP_006376495.1| hydroxyproline-rich glycoprotein [Populus trichocarpa]
 gb|ERP54292.1| hydroxyproline-rich glycoprotein [Populus trichocarpa]
Length=532

 Score =   224 bits (570),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 152/245 (62%), Positives = 178/245 (73%), Gaps = 20/245 (8%)
 Frame = +2

Query  485   QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
             ++FHKSRMTRSSM P ++Y  PEDS FNQDV+  VEKSMKK  DN+MRFLEG+SSRLSQL
Sbjct  53    KDFHKSRMTRSSMFPATSYSQPEDS-FNQDVVSIVEKSMKKQTDNIMRFLEGISSRLSQL  111

Query  665   ELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELA  844
             EL CYNLDKSIGEMRSD V D+ E D KLKSLEKH+QEVHRSVQILRDKQELA+ QKEL 
Sbjct  112   ELCCYNLDKSIGEMRSDFVRDNEEADLKLKSLEKHIQEVHRSVQILRDKQELAETQKELY  171

Query  845   KLQLAQKESGSANNSQQNEERASQPASDTKRSDSPCELHGQQLALALPHQVAPPQTSHTT  1024
             KLQLAQKE  S+++SQ +EE+ +  ASD K +D+  E+  QQLALALPHQVAP Q +   
Sbjct  172   KLQLAQKEPSSSSHSQSSEEKVAPAASDPKTTDNTSEIRNQQLALALPHQVAPQQQAPPV  231

Query  1025  RHMEqpqqpsvppipsqviTQSQGYYLS---------PTQMPLSQGQYMPSESQYRTPQM  1177
               +           P Q + Q Q YYLS         PTQ P  Q QY+ S+ QYRTPQM
Sbjct  232   PPLS--------QTPPQNVAQQQSYYLSPAPLPTPAAPTQHP--QNQYLTSDPQYRTPQM  281

Query  1178  QEVAR  1192
             Q+V+R
Sbjct  282   QDVSR  286



>gb|KHN31988.1| hypothetical protein glysoja_025822 [Glycine soja]
Length=505

 Score =   222 bits (565),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 139/234 (59%), Positives = 166/234 (71%), Gaps = 11/234 (5%)
 Frame = +2

Query  485   QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
             Q+FHKSR    +     AY PPEDS  +QDVI  VEKSMKKYADNLMRFLEG+SSRLSQL
Sbjct  45    QDFHKSRRMFPTT----AYNPPEDS-LSQDVIATVEKSMKKYADNLMRFLEGISSRLSQL  99

Query  665   ELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELA  844
             ELYCYNLDKSIGEM+ D+  DH E +S+LKSLEKH+QEVHRSVQILRDKQELA+ QKELA
Sbjct  100   ELYCYNLDKSIGEMKCDINRDHVEQESRLKSLEKHVQEVHRSVQILRDKQELAETQKELA  159

Query  845   KLQLAQKESGSANNSQQNEERASQPASDTKRSDSPCELHGQQLALALPHQVAPPQTSHTT  1024
             KLQLAQKES S+++SQ NEER+S P +D K++D+  + + QQLALALPHQ+A PQ     
Sbjct  160   KLQLAQKESSSSSHSQSNEERSS-PTTDPKKTDNASDANNQQLALALPHQIA-PQPQPPA  217

Query  1025  RHMEqpqqpsvppipsqviTQSQGYYLSPTQMPL----SQGQYMPSESQYRTPQ  1174
               ++   Q   P +             +P   P      Q QY+PS+ QYRTPQ
Sbjct  218   PQVQAQAQAPAPNVTQVPQQPPYYMPPTPLPNPAVPQHPQNQYLPSDQQYRTPQ  271



>ref|XP_006592435.1| PREDICTED: putative uncharacterized protein DDB_G0271606-like 
isoform X2 [Glycine max]
Length=534

 Score =   222 bits (566),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 139/234 (59%), Positives = 166/234 (71%), Gaps = 11/234 (5%)
 Frame = +2

Query  485   QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
             Q+FHKSR    +     AY PPEDS  +QDVI  VEKSMKKYADNLMRFLEG+SSRLSQL
Sbjct  45    QDFHKSRRMFPTT----AYNPPEDS-LSQDVIATVEKSMKKYADNLMRFLEGISSRLSQL  99

Query  665   ELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELA  844
             ELYCYNLDKSIGEM+ D+  DH E +S+LKSLEKH+QEVHRSVQILRDKQELA+ QKELA
Sbjct  100   ELYCYNLDKSIGEMKCDINRDHVEQESRLKSLEKHVQEVHRSVQILRDKQELAETQKELA  159

Query  845   KLQLAQKESGSANNSQQNEERASQPASDTKRSDSPCELHGQQLALALPHQVAPPQTSHTT  1024
             KLQLAQKES S+++SQ NEER+S P +D K++D+  + + QQLALALPHQ+A PQ     
Sbjct  160   KLQLAQKESSSSSHSQSNEERSS-PTTDPKKTDNASDANNQQLALALPHQIA-PQPQPPA  217

Query  1025  RHMEqpqqpsvppipsqviTQSQGYYLSPTQMPL----SQGQYMPSESQYRTPQ  1174
               ++   Q   P +             +P   P      Q QY+PS+ QYRTPQ
Sbjct  218   PQVQAQAQAPAPNVTQVPQQPPYYMPPTPLPNPAVPQHPQNQYLPSDQQYRTPQ  271



>ref|XP_003540363.1| PREDICTED: integrator complex subunit 3 homolog isoform 1 [Glycine 
max]
 gb|KHN27890.1| hypothetical protein glysoja_007622 [Glycine soja]
Length=532

 Score =   222 bits (565),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 131/219 (60%), Positives = 151/219 (69%), Gaps = 15/219 (7%)
 Frame = +2

Query  536   AYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSD  715
             AY   EDS  +QDVI  VEKSMK +ADNLMRFLEGLS+RLSQLELYCYNLDKSIG M+SD
Sbjct  63    AYSSSEDS-LSQDVIAIVEKSMKTHADNLMRFLEGLSTRLSQLELYCYNLDKSIGAMQSD  121

Query  716   LVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQ  895
             L  DH ETDSKLKSL+KHLQEVHRSV ILRDKQELA+ +KELAKL+  +KES S+++ Q 
Sbjct  122   LTCDHEETDSKLKSLDKHLQEVHRSVLILRDKQELAETRKELAKLKHVRKESSSSSHLQS  181

Query  896   NEERASQPASDTKRSDSPCELHGQQLALALPHQVAPPQTSHTTRHMEqpqqpsvppipsq  1075
             NEER+S  + D KR D+  +   Q+LALALPHQVAP       R         VP     
Sbjct  182   NEERSSPSSMDPKRIDNVSDTQNQELALALPHQVAP-------RQQPVASSYQVPAPNVS  234

Query  1076  viTQSQGYYLSPTQMP-------LSQGQYMPSESQYRTP  1171
               TQ   YYL PT +P       L Q QY+PS+ QYR P
Sbjct  235   QATQRPHYYLMPTHLPNPQAVTQLPQNQYLPSDPQYRIP  273



>ref|XP_003539922.1| PREDICTED: putative uncharacterized protein DDB_G0271606-like 
isoformX1 [Glycine max]
Length=533

 Score =   221 bits (562),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 138/235 (59%), Positives = 166/235 (71%), Gaps = 11/235 (5%)
 Frame = +2

Query  482   EQEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQ  661
             + +FHKSR    +     AY PPEDS  +QDVI  VEKSMKKYADNLMRFLEG+SSRLSQ
Sbjct  43    DPDFHKSRRMFPTT----AYNPPEDS-LSQDVIATVEKSMKKYADNLMRFLEGISSRLSQ  97

Query  662   LELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKEL  841
             LELYCYNLDKSIGEM+ D+  DH E +S+LKSLEKH+QEVHRSVQILRDKQELA+ QKEL
Sbjct  98    LELYCYNLDKSIGEMKCDINRDHVEQESRLKSLEKHVQEVHRSVQILRDKQELAETQKEL  157

Query  842   AKLQLAQKESGSANNSQQNEERASQPASDTKRSDSPCELHGQQLALALPHQVAPPQTSHT  1021
             AKLQLAQKES S+++SQ NEER+S P +D K++D+  + + QQLALALPHQ+A PQ    
Sbjct  158   AKLQLAQKESSSSSHSQSNEERSS-PTTDPKKTDNASDANNQQLALALPHQIA-PQPQPP  215

Query  1022  TRHMEqpqqpsvppipsqviTQSQGYYLSPTQMPL----SQGQYMPSESQYRTPQ  1174
                ++   Q   P +             +P   P      Q QY+PS+ QYRTPQ
Sbjct  216   APQVQAQAQAPAPNVTQVPQQPPYYMPPTPLPNPAVPQHPQNQYLPSDQQYRTPQ  270



>ref|NP_974630.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE85467.1| uncharacterized protein AT4G28300 [Arabidopsis thaliana]
Length=438

 Score =   218 bits (554),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 130/155 (84%), Gaps = 1/155 (1%)
 Frame = +2

Query  536  AYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSD  715
            +Y PPEDS  +QD+ D VE++MK YADN+MRFLEGLSSRLSQLELYCYNLDK+IGEMRS+
Sbjct  11   SYSPPEDS-LSQDITDTVERTMKMYADNMMRFLEGLSSRLSQLELYCYNLDKTIGEMRSE  69

Query  716  LVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQ  895
            L H H + D KL+SL+KHLQEVHRSVQILRDKQELAD QKELAKLQL QKES S+++SQ 
Sbjct  70   LTHAHEDADVKLRSLDKHLQEVHRSVQILRDKQELADTQKELAKLQLVQKESSSSSHSQH  129

Query  896  NEERASQPASDTKRSDSPCELHGQQLALALPHQVA  1000
             E+R + P  + K+S++  + H QQLALALPHQ+A
Sbjct  130  GEDRVATPVPEPKKSENTSDAHNQQLALALPHQIA  164



>ref|XP_010438481.1| PREDICTED: formin-like protein 5 [Camelina sativa]
Length=497

 Score =   219 bits (558),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 143/168 (85%), Gaps = 1/168 (1%)
 Frame = +2

Query  488  EFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLE  667
            EFHK+RM RSS+ PTS+Y PPEDS  +QD+ D VE++MKKYADN+MRFLEG+SSRLSQLE
Sbjct  49   EFHKTRMARSSIFPTSSYSPPEDS-LSQDLTDTVERTMKKYADNMMRFLEGISSRLSQLE  107

Query  668  LYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAK  847
            LYCYNLDK+IGEMRS+L H+H E D KL+SL+KHLQEVHRSVQILRDKQELAD QKELAK
Sbjct  108  LYCYNLDKTIGEMRSELTHEHEEADVKLRSLDKHLQEVHRSVQILRDKQELADTQKELAK  167

Query  848  LQLAQKESGSANNSQQNEERASQPASDTKRSDSPCELHGQQLALALPH  991
            LQL QKES S+++SQ  E+R + P  + K++++  + H QQLALALPH
Sbjct  168  LQLVQKESSSSSHSQHGEDRVATPVPEPKKTENTSDPHNQQLALALPH  215



>gb|KJB31694.1| hypothetical protein B456_005G201600 [Gossypium raimondii]
Length=546

 Score =   220 bits (561),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 143/172 (83%), Gaps = 3/172 (2%)
 Frame = +2

Query  485  QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
            +EFHK R+ RS   P+  Y  PEDS F+ DV   VEK+MK+Y DNLMRFLEG+SSRLSQL
Sbjct  49   KEFHKGRVARSMFPPS-GYSQPEDS-FSSDVAATVEKTMKRYTDNLMRFLEGISSRLSQL  106

Query  665  ELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELA  844
            ELYCYNLD+SIG+MR+DLVH +G+ DSKLKS+EKHLQEVHRSVQILRDKQELA+ QKELA
Sbjct  107  ELYCYNLDRSIGDMRADLVHGNGDADSKLKSIEKHLQEVHRSVQILRDKQELAETQKELA  166

Query  845  KLQLAQKESGSANNSQQNEERASQPASDTKRSDSPCELHGQQLALALPHQVA  1000
            KLQLAQKES S+++SQ  EER S PASD K++D   E+  QQLAL+LPHQVA
Sbjct  167  KLQLAQKES-SSSHSQSTEERVSPPASDPKKTDLTSEMQNQQLALSLPHQVA  217



>ref|XP_010433239.1| PREDICTED: bromodomain-containing protein 4-like [Camelina sativa]
Length=494

 Score =   219 bits (557),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 144/170 (85%), Gaps = 1/170 (1%)
 Frame = +2

Query  488  EFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLE  667
            EFHK+RM RSS+ PTS+Y PPEDS  +QD+ D VE++MKKYADN+MRFLEG+SSRLSQLE
Sbjct  49   EFHKTRMARSSIFPTSSYSPPEDS-LSQDLTDTVERTMKKYADNMMRFLEGISSRLSQLE  107

Query  668  LYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAK  847
            LYCYNLDK+IGEMRS+L H+H + D KL+SL+KHLQEVHRSVQILRDKQELAD QKELAK
Sbjct  108  LYCYNLDKTIGEMRSELTHEHEDADVKLRSLDKHLQEVHRSVQILRDKQELADTQKELAK  167

Query  848  LQLAQKESGSANNSQQNEERASQPASDTKRSDSPCELHGQQLALALPHQV  997
            LQL QKES S++ SQ  E+R + P  + K++++  + H QQLALALPHQ+
Sbjct  168  LQLVQKESSSSSQSQHGEDRVATPVPEPKKTENTSDPHNQQLALALPHQI  217



>ref|XP_006283593.1| hypothetical protein CARUB_v10004649mg [Capsella rubella]
 gb|EOA16491.1| hypothetical protein CARUB_v10004649mg [Capsella rubella]
Length=497

 Score =   217 bits (553),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 146/175 (83%), Gaps = 2/175 (1%)
 Frame = +2

Query  476  CIEQEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRL  655
               +EFHK+RM RSS+ PTS+Y PPEDS  +QD+ D VE++MKKYADN+MRFLEG+SSRL
Sbjct  50   ATNKEFHKTRMARSSVFPTSSYSPPEDS-LSQDLTDTVERTMKKYADNMMRFLEGISSRL  108

Query  656  SQLELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQK  835
            SQLELYCYNLDK+IGEMRS+L H++ E D KL+S++KHLQEVHRSVQILRDKQELAD QK
Sbjct  109  SQLELYCYNLDKTIGEMRSELTHENEEADVKLRSMDKHLQEVHRSVQILRDKQELADTQK  168

Query  836  ELAKLQLAQKESGSANNSQQNEERASQPASDTKRSDSPCELHGQQLALALPHQVA  1000
            ELAKLQL QKES S+++SQ  E+R + P  + K+S++  + H  QLALALPHQ+A
Sbjct  169  ELAKLQLVQKESSSSSHSQHGEDRVATPVQEPKKSENTSDAH-NQLALALPHQIA  222



>ref|XP_006412973.1| hypothetical protein EUTSA_v10024987mg [Eutrema salsugineum]
 gb|ESQ54426.1| hypothetical protein EUTSA_v10024987mg [Eutrema salsugineum]
Length=499

 Score =   216 bits (550),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 116/171 (68%), Positives = 144/171 (84%), Gaps = 1/171 (1%)
 Frame = +2

Query  485  QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
            +EFHK+RM RSS+ PTS+Y PPEDS  +QD+   VE++MKKYADN+MRFLEG+SSRLSQL
Sbjct  52   KEFHKTRMARSSVFPTSSYSPPEDS-LSQDLTATVERTMKKYADNMMRFLEGISSRLSQL  110

Query  665  ELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELA  844
            ELYCYNLDK+IGEMRSDL  +H E D KL+S++KHLQEVHRSVQILRDKQELAD QKELA
Sbjct  111  ELYCYNLDKTIGEMRSDLTREHEEADVKLRSMDKHLQEVHRSVQILRDKQELADTQKELA  170

Query  845  KLQLAQKESGSANNSQQNEERASQPASDTKRSDSPCELHGQQLALALPHQV  997
            +LQL +K+S S+++SQ  EER + P  + K+S++  + H QQLALALPHQ+
Sbjct  171  RLQLGKKDSSSSSHSQHGEERVATPVPEPKKSENTSDAHNQQLALALPHQM  221



>ref|XP_010689008.1| PREDICTED: RNA polymerase II degradation factor 1 [Beta vulgaris 
subsp. vulgaris]
Length=542

 Score =   216 bits (551),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 127/212 (60%), Positives = 151/212 (71%), Gaps = 12/212 (6%)
 Frame = +2

Query  563   FNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETD  742
              +Q++I AVE++MKKYADNLMRFLEG+SSRLSQLELYCYNLDKSIGEMRSDL  DH E D
Sbjct  77    LSQELISAVERTMKKYADNLMRFLEGISSRLSQLELYCYNLDKSIGEMRSDLGRDHSEAD  136

Query  743   SKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERASQPA  922
             SKLK LEKHLQEVHRSVQILRDKQELA+ QKELAKLQLAQKES SA+     +ERA+  A
Sbjct  137   SKLKFLEKHLQEVHRSVQILRDKQELAETQKELAKLQLAQKESSSAS----PDERATVSA  192

Query  923   SDTKRSDSPCELHGQQLALALPHQVAPPQTSHTTRHMEqpqqpsvppipsqviTQSQGYY  1102
             S+ K++D   +    QLALALP Q+   Q SH T   +     + P   SQ  +Q Q YY
Sbjct  193   SEQKKNDDVSDTPNTQLALALPSQIT-QQPSHPTVQQQ---SVAPPQPSSQTHSQMQPYY  248

Query  1103  LSPTQMPLSQGQ----YMPSESQYRTPQMQEV  1186
             L   Q+P  Q Q    Y+ ++ QYR PQ+ + 
Sbjct  249   LPSNQLPNPQVQSHPSYLAADGQYRVPQIPQA  280



>ref|XP_006447362.1| hypothetical protein CICLE_v10014791mg [Citrus clementina]
 gb|ESR60602.1| hypothetical protein CICLE_v10014791mg [Citrus clementina]
Length=553

 Score =   216 bits (551),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 133/243 (55%), Positives = 163/243 (67%), Gaps = 25/243 (10%)
 Frame = +2

Query  536   AYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSD  715
             AY  P+D   N+DV+  VE +MKK+ D ++RFLEG+SSRLSQLELYCYNLDKS+ EMRSD
Sbjct  66    AYSQPDDC-LNEDVVSTVEITMKKHTDGVVRFLEGISSRLSQLELYCYNLDKSMVEMRSD  124

Query  716   LVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQ  895
             LV DHGE D+KLKSLEKHLQEVHRSVQILRDKQELA+ QKELAKLQL QK+S S+++SQ 
Sbjct  125   LVRDHGEADTKLKSLEKHLQEVHRSVQILRDKQELAETQKELAKLQLVQKDSSSSSHSQS  184

Query  896   NEERASQPASDTKRS-DSPCELHGQQLALALPHQVAP--------PQTSHTTRHMEqpqq  1048
             NEERAS  AS+ KR  ++  ++  QQLALALPHQVAP        PQT       +Q   
Sbjct  185   NEERASPAASEPKRGENTTADMQNQQLALALPHQVAPQQQPVAPLPQTLPHQVAPQQQPV  244

Query  1049  psvppipsqviTQSQGYYLSPTQMP---------------LSQGQYMPSESQYRTPQMQE  1183
                P  P Q ++  Q YY+  TQ+P                 Q QYM ++ QYR P + +
Sbjct  245   APTPQTPPQNVSHQQSYYMPATQLPNPPAPAPAPAPAPIQQPQSQYMSTDPQYRPPPLPD  304

Query  1184  VAR  1192
              +R
Sbjct  305   SSR  307



>ref|XP_006447363.1| hypothetical protein CICLE_v10014791mg [Citrus clementina]
 gb|ESR60603.1| hypothetical protein CICLE_v10014791mg [Citrus clementina]
Length=554

 Score =   216 bits (550),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 133/243 (55%), Positives = 163/243 (67%), Gaps = 25/243 (10%)
 Frame = +2

Query  536   AYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSD  715
             AY  P+D   N+DV+  VE +MKK+ D ++RFLEG+SSRLSQLELYCYNLDKS+ EMRSD
Sbjct  67    AYSQPDDC-LNEDVVSTVEITMKKHTDGVVRFLEGISSRLSQLELYCYNLDKSMVEMRSD  125

Query  716   LVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQ  895
             LV DHGE D+KLKSLEKHLQEVHRSVQILRDKQELA+ QKELAKLQL QK+S S+++SQ 
Sbjct  126   LVRDHGEADTKLKSLEKHLQEVHRSVQILRDKQELAETQKELAKLQLVQKDSSSSSHSQS  185

Query  896   NEERASQPASDTKRS-DSPCELHGQQLALALPHQVAP--------PQTSHTTRHMEqpqq  1048
             NEERAS  AS+ KR  ++  ++  QQLALALPHQVAP        PQT       +Q   
Sbjct  186   NEERASPAASEPKRGENTTADMQNQQLALALPHQVAPQQQPVAPLPQTLPHQVAPQQQPV  245

Query  1049  psvppipsqviTQSQGYYLSPTQMP---------------LSQGQYMPSESQYRTPQMQE  1183
                P  P Q ++  Q YY+  TQ+P                 Q QYM ++ QYR P + +
Sbjct  246   APTPQTPPQNVSHQQSYYMPATQLPNPPAPAPAPAPAPIQQPQSQYMSTDPQYRPPPLPD  305

Query  1184  VAR  1192
              +R
Sbjct  306   SSR  308



>emb|CAB79632.1| predicted proline-rich protein [Arabidopsis thaliana]
Length=508

 Score =   214 bits (544),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 120/184 (65%), Positives = 145/184 (79%), Gaps = 13/184 (7%)
 Frame = +2

Query  485  QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
            +EFHK+RM RSS+ PTS+Y PPEDS  +QD+ D VE++MK YADN+MRFLEGLSSRLSQL
Sbjct  52   KEFHKTRMARSSVFPTSSYSPPEDS-LSQDITDTVERTMKMYADNMMRFLEGLSSRLSQL  110

Query  665  ELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQE------------VHRSVQILRD  808
            ELYCYNLDK+IGEMRS+L H H + D KL+SL+KHLQE            VHRSVQILRD
Sbjct  111  ELYCYNLDKTIGEMRSELTHAHEDADVKLRSLDKHLQEVCYCYAMFLILFVHRSVQILRD  170

Query  809  KQELADAQKELAKLQLAQKESGSANNSQQNEERASQPASDTKRSDSPCELHGQQLALALP  988
            KQELAD QKELAKLQL QKES S+++SQ  E+R + P  + K+S++  + H QQLALALP
Sbjct  171  KQELADTQKELAKLQLVQKESSSSSHSQHGEDRVATPVPEPKKSENTSDAHNQQLALALP  230

Query  989  HQVA  1000
            HQ+A
Sbjct  231  HQIA  234



>gb|KDO51850.1| hypothetical protein CISIN_1g008878mg [Citrus sinensis]
Length=550

 Score =   214 bits (546),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 133/239 (56%), Positives = 162/239 (68%), Gaps = 21/239 (9%)
 Frame = +2

Query  536   AYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSD  715
             AY  P+D   N+DV+  VE +MKK+ D ++RFLEG+SSRLSQLELYCYNLDKS+ EMRSD
Sbjct  67    AYSQPDDC-LNEDVVSTVEITMKKHTDGVVRFLEGISSRLSQLELYCYNLDKSMVEMRSD  125

Query  716   LVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQ  895
             LV DHGE D+KLKSLEKHLQEVHRSVQILRDKQELA+ QKELAKLQL QK+S S+++SQ 
Sbjct  126   LVRDHGEADTKLKSLEKHLQEVHRSVQILRDKQELAETQKELAKLQLVQKDSSSSSHSQS  185

Query  896   NEERASQPASDTKRS-DSPCELHGQQLALALPHQVAP--------PQTSHTTRHMEqpqq  1048
             NEERAS  AS+ KR  ++  ++  QQLALALPHQVAP        PQT       +Q   
Sbjct  186   NEERASPAASEPKRGENTTADMQNQQLALALPHQVAPQQQPVAPLPQTLPHQVAPQQQPV  245

Query  1049  psvppipsqviTQSQGYYLSPTQM-----------PLSQGQYMPSESQYRTPQMQEVAR  1192
                P  P Q +T  Q YY+  TQ+              Q QYM ++ QYR P + + +R
Sbjct  246   APTPQTPPQNVTHQQSYYMPATQLPNPPAPAPAPIQQPQSQYMSTDPQYRPPPLPDSSR  304



>gb|KDO51849.1| hypothetical protein CISIN_1g008878mg [Citrus sinensis]
Length=549

 Score =   214 bits (545),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 133/239 (56%), Positives = 162/239 (68%), Gaps = 21/239 (9%)
 Frame = +2

Query  536   AYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSD  715
             AY  P+D   N+DV+  VE +MKK+ D ++RFLEG+SSRLSQLELYCYNLDKS+ EMRSD
Sbjct  66    AYSQPDDC-LNEDVVSTVEITMKKHTDGVVRFLEGISSRLSQLELYCYNLDKSMVEMRSD  124

Query  716   LVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQ  895
             LV DHGE D+KLKSLEKHLQEVHRSVQILRDKQELA+ QKELAKLQL QK+S S+++SQ 
Sbjct  125   LVRDHGEADTKLKSLEKHLQEVHRSVQILRDKQELAETQKELAKLQLVQKDSSSSSHSQS  184

Query  896   NEERASQPASDTKRS-DSPCELHGQQLALALPHQVAP--------PQTSHTTRHMEqpqq  1048
             NEERAS  AS+ KR  ++  ++  QQLALALPHQVAP        PQT       +Q   
Sbjct  185   NEERASPAASEPKRGENTTADMQNQQLALALPHQVAPQQQPVAPLPQTLPHQVAPQQQPV  244

Query  1049  psvppipsqviTQSQGYYLSPTQM-----------PLSQGQYMPSESQYRTPQMQEVAR  1192
                P  P Q +T  Q YY+  TQ+              Q QYM ++ QYR P + + +R
Sbjct  245   APTPQTPPQNVTHQQSYYMPATQLPNPPAPAPAPIQQPQSQYMSTDPQYRPPPLPDSSR  303



>gb|EPS62243.1| hypothetical protein M569_12549, partial [Genlisea aurea]
Length=512

 Score =   213 bits (542),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 121/185 (65%), Positives = 147/185 (79%), Gaps = 19/185 (10%)
 Frame = +2

Query  485  QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
            QEFHKSRM+RSS+ PT+ Y PPE+SSFNQ V+ AVE S+KKY DN++RFLEG+SSRLSQL
Sbjct  52   QEFHKSRMSRSSVFPTATYNPPEESSFNQTVVSAVENSVKKYTDNILRFLEGISSRLSQL  111

Query  665  ELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQE------------VHRSVQILRD  808
            ELYCYNLDKSIGEMRSDL+ DH E+DSKLKS+EKH+ E            VHRSVQILRD
Sbjct  112  ELYCYNLDKSIGEMRSDLIRDHSESDSKLKSIEKHMHEAINSLLPLLQMQVHRSVQILRD  171

Query  809  KQELADAQKELAKLQLAQKESGSANN-SQQNEERASQPASDTKRSDSPCELHGQQLALAL  985
            KQEL++AQ+ELAKLQLAQ ES S++  + QN++R S+     K++D   + H Q+LALAL
Sbjct  172  KQELSEAQRELAKLQLAQIESSSSSGKAPQNDDRTSE----AKKTD--VDSHDQKLALAL  225

Query  986  PHQVA  1000
            PHQVA
Sbjct  226  PHQVA  230



>gb|KJB77271.1| hypothetical protein B456_012G128800 [Gossypium raimondii]
 gb|KJB77273.1| hypothetical protein B456_012G128800 [Gossypium raimondii]
Length=566

 Score =   214 bits (545),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 138/265 (52%), Positives = 168/265 (63%), Gaps = 61/265 (23%)
 Frame = +2

Query  536   AYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSD  715
             AY  P+DS ++ DV   VEK+MKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEM+SD
Sbjct  71    AYSQPDDSLYS-DVTATVEKTMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMQSD  129

Query  716   LVHDHGETDSKLKSLEKHLQE---------------VHRSVQILRDKQELADAQKELAKL  850
             L+ D+ + DSKL S+EKHLQE               VHRSVQILRDKQELA+ QKELAKL
Sbjct  130   LIRDNEDADSKLNSIEKHLQEQHAREVHQIWIRKDLVHRSVQILRDKQELAETQKELAKL  189

Query  851   QLAQKESGSANNSQQNEERASQPASDTKRSDSPCELHGQQLALALPHQVAP---PQTSHT  1021
             QLAQKES S+++SQ  EERAS PASD+K++D   E+  QQLALALPHQVAP   P   H+
Sbjct  190   QLAQKESSSSSHSQSTEERASPPASDSKKTDHTSEMQNQQLALALPHQVAPQQQPVVPHS  249

Query  1022  TRHMEqpqqpsvppipsqviTQSQGYYLSPTQM-------PL------------------  1126
                            P Q +TQ Q YY+   Q+       P+                  
Sbjct  250   -------------QSPPQNLTQ-QSYYIPSNQLSNPHAPAPVHVPAPTTPAPPPLPAPAP  295

Query  1127  ---SQGQYMPSESQYRTPQMQEVAR  1192
                +Q QY+P + Q++ P +Q+V+R
Sbjct  296   TPHTQSQYLPPDPQFQAPHIQDVSR  320



>gb|KJB77274.1| hypothetical protein B456_012G128800 [Gossypium raimondii]
Length=461

 Score =   211 bits (536),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 126/226 (56%), Positives = 151/226 (67%), Gaps = 39/226 (17%)
 Frame = +2

Query  599   MKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQE  778
             MKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEM+SDL+ D+ + DSKL S+EKHLQE
Sbjct  1     MKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMQSDLIRDNEDADSKLNSIEKHLQE  60

Query  779   VHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERASQPASDTKRSDSPCEL  958
             VHRSVQILRDKQELA+ QKELAKLQLAQKES S+++SQ  EERAS PASD+K++D   E+
Sbjct  61    VHRSVQILRDKQELAETQKELAKLQLAQKESSSSSHSQSTEERASPPASDSKKTDHTSEM  120

Query  959   HGQQLALALPHQVAPPQTSHTTRHMEqpqqpsvppipsqviTQSQGYYLSPTQM------  1120
               QQLALALPHQVA PQ      H + P Q              Q YY+   Q+      
Sbjct  121   QNQQLALALPHQVA-PQQQPVVPHSQSPPQNLTQ----------QSYYIPSNQLSNPHAP  169

Query  1121  -PL---------------------SQGQYMPSESQYRTPQMQEVAR  1192
              P+                     +Q QY+P + Q++ P +Q+V+R
Sbjct  170   APVHVPAPTTPAPPPLPAPAPTPHTQSQYLPPDPQFQAPHIQDVSR  215



>ref|XP_003543336.1| PREDICTED: RNA polymerase II degradation factor 1-like [Glycine 
max]
Length=537

 Score =   212 bits (540),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 128/219 (58%), Positives = 149/219 (68%), Gaps = 15/219 (7%)
 Frame = +2

Query  536   AYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSD  715
             AY P EDS  +QDVI  VEKSMK +ADNLM+FLEGL +RLSQLELYCYNLDKSIG MRSD
Sbjct  64    AYSPSEDS-LSQDVIATVEKSMKTHADNLMQFLEGLGTRLSQLELYCYNLDKSIGAMRSD  122

Query  716   LVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQ  895
             L  DH ETDSKL SL+KHLQEVHRSV IL+D+QELA+ +KELA L+ AQKES S+++SQ 
Sbjct  123   LTCDHEETDSKLNSLDKHLQEVHRSVLILKDRQELAETRKELAMLKHAQKESSSSSHSQS  182

Query  896   NEERASQPASDTKRSDSPCELHGQQLALALPHQVAPPQTSHTTRHMEqpqqpsvppipsq  1075
             NEER+S  + D KR D+  +   Q+LALALPHQV P       R         VP    +
Sbjct  183   NEERSSPSSMDPKRIDNVSDTQNQELALALPHQVTP-------RQQPVASFYQVPAPNVR  235

Query  1076  viTQSQGYYLSPTQMP-------LSQGQYMPSESQYRTP  1171
               TQ   YYL PT +P       L Q QY PS+  YR P
Sbjct  236   QATQRPHYYLMPTPLPNPQAVNQLPQNQYWPSDLLYRIP  274



>ref|XP_010051997.1| PREDICTED: LOW QUALITY PROTEIN: bromodomain-containing protein 
4 [Eucalyptus grandis]
Length=513

 Score =   209 bits (531),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 129/251 (51%), Positives = 166/251 (66%), Gaps = 15/251 (6%)
 Frame = +2

Query  473   LCIEQEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSR  652
             L   Q+FHK+R+ R       +   PEDS  N D++  VEKSMK+  D++MRFLEG+SSR
Sbjct  2     LLFLQDFHKNRLVRPVTYAPPSSTQPEDSX-NSDLVSTVEKSMKRNTDSIMRFLEGISSR  60

Query  653   LSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQ  832
             LSQLELYCYNLDKSIGEMRS+L  DH E D KLKSLEKH+QEVHRSVQILRDKQELA+ Q
Sbjct  61    LSQLELYCYNLDKSIGEMRSELTRDHDEADVKLKSLEKHVQEVHRSVQILRDKQELAETQ  120

Query  833   KELAKLQLAQKESGSANNSQQNEERASQPASDTKRSDSPCELHGQQLALALPHQV--APP  1006
             KELAKL   +K+S S++ SQ NE ++  P SDTK+++   ++  QQLALALPHQ+     
Sbjct  121   KELAKLHFVRKDSSSSSQSQTNEGKS--PTSDTKKTECMSDVSNQQLALALPHQIMPQQQ  178

Query  1007  QTSHTTRHMEqpqqpsvppipsqviTQSQGYYLSPTQM-----P--LSQGQYMPSESQY-  1162
                      +          P Q ++Q Q YYL P QM     P  ++Q Q++PS+ QY 
Sbjct  179   LQPQPQPQPQPQPGALTSQAPPQNVSQPQSYYLPPVQMQTMAAPTQMTQTQFLPSDPQYC  238

Query  1163  --RTPQMQEVA  1189
               ++PQ+Q V+
Sbjct  239   ARQSPQLQNVS  249



>gb|KHN36637.1| hypothetical protein glysoja_001368 [Glycine soja]
Length=537

 Score =   208 bits (530),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 127/219 (58%), Positives = 148/219 (68%), Gaps = 15/219 (7%)
 Frame = +2

Query  536   AYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSD  715
             AY P EDS  +QDVI  VEKSMK +ADNLM+FLEGL +RLSQLELYCYNLDKSIG MRSD
Sbjct  64    AYSPSEDS-LSQDVIATVEKSMKTHADNLMQFLEGLGTRLSQLELYCYNLDKSIGAMRSD  122

Query  716   LVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQ  895
             L  DH ETDSKL SL+KHLQEVHRSV IL+D+QELA+ +KELA L+ AQKES S+++SQ 
Sbjct  123   LTCDHEETDSKLNSLDKHLQEVHRSVLILKDRQELAETRKELAMLKHAQKESSSSSHSQS  182

Query  896   NEERASQPASDTKRSDSPCELHGQQLALALPHQVAPPQTSHTTRHMEqpqqpsvppipsq  1075
              EER+S  + D KR D+  +   Q+LALALPHQV P       R         VP    +
Sbjct  183   IEERSSPSSMDPKRIDNVSDTQNQELALALPHQVTP-------RQQPVASFYQVPAPNVR  235

Query  1076  viTQSQGYYLSPTQMP-------LSQGQYMPSESQYRTP  1171
               TQ   YYL PT +P       L Q QY PS+  YR P
Sbjct  236   QATQRPHYYLMPTPLPNPQAVNQLPQNQYWPSDLLYRIP  274



>ref|XP_010242911.1| PREDICTED: RNA polymerase II degradation factor 1 [Nelumbo nucifera]
Length=560

 Score =   209 bits (531),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 126/224 (56%), Positives = 153/224 (68%), Gaps = 14/224 (6%)
 Frame = +2

Query  551   EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  730
             ++ SFNQ+VI  VE++MKKYADNL+RFLEG+S RL QLELYCYNL+KS+GEMRSDL  D+
Sbjct  70    QEESFNQEVIATVERTMKKYADNLLRFLEGISGRLQQLELYCYNLEKSVGEMRSDLERDN  129

Query  731   GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERA  910
              E +SKLKSLEKH+QEVHRSVQILRDKQELA+ QKELAKLQLA KES +  + Q  E+  
Sbjct  130   NEANSKLKSLEKHVQEVHRSVQILRDKQELAETQKELAKLQLAHKESSTNGHLQHKEDGG  189

Query  911   SQPASDTKRSDS-PCELHGQQLALALPHQVAPPQTSHTTRHMEqpqqpsvppipsqvi--  1081
             +  AS  K++D+ P      QLALALP QVA P  S  TR +E PQ  + P         
Sbjct  190   APSASGPKKTDNVPVPEVQNQLALALPQQVA-PSLSPPTRPVEPPQPMAPPSQAPPQNVH  248

Query  1082  --TQSQGYYLSPTQMPL--------SQGQYMPSESQYRTPQMQE  1183
               TQ   YY    Q+P         +Q QY+P +SQY+ PQMQE
Sbjct  249   VQTQPNAYYSPQNQLPNPPPQTQSHTQDQYLPVDSQYQRPQMQE  292



>ref|XP_008455323.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15-like [Cucumis melo]
Length=542

 Score =   206 bits (525),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 131/237 (55%), Positives = 166/237 (70%), Gaps = 15/237 (6%)
 Frame = +2

Query  485   QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
             ++FHKSRM+        AY   EDS   QDVI  VE SMKKY+DN++RFLEG+SSRLSQL
Sbjct  50    KDFHKSRMSTVYPAA--AYGQSEDS-IKQDVISTVENSMKKYSDNILRFLEGISSRLSQL  106

Query  665   ELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELA  844
             EL CYNLDKS+GEMRSD++ DH E D KLKSLEKHLQEVHRSVQI+RDKQELA+ QK+LA
Sbjct  107   ELNCYNLDKSVGEMRSDVLRDHEEEDLKLKSLEKHLQEVHRSVQIIRDKQELAETQKDLA  166

Query  845   KLQLAQKESGSANNSQQNEERASQPASDTKRSDSPCE-LHGQQLALALPHQVAPPQTSHT  1021
             KL L QKES S+++S  N+ERAS  ASD K++++P E L+ QQLALALPHQ+        
Sbjct  167   KLHLLQKESSSSSHSHSNDERASPVASDPKKNENPSENLNNQQLALALPHQIV-------  219

Query  1022  TRHMEqpqqpsvppipsqviTQSQGYYLSPTQMPLSQGQYMPSESQYRTPQMQEVAR  1192
                 + P  P  P    Q + Q Q YY++  Q+P        +++QY+  Q+Q+V+R
Sbjct  220   --PHQNPIPPPPPAALPQNVPQQQSYYMASNQLPSQPTHIQHAQTQYQ--QLQDVSR  272



>emb|CDX89188.1| BnaA01g17050D [Brassica napus]
Length=470

 Score =   203 bits (517),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 140/177 (79%), Gaps = 5/177 (3%)
 Frame = +2

Query  458  NLSSKLCIEQEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDA-VEKSMKKYADNLMRFL  634
            N    +   +EFHK+RM RSS+ PTS+Y PP+DS  +QD+I+A VE++MKKY+DN+MRFL
Sbjct  38   NSDPAIAANKEFHKTRMARSSVFPTSSYTPPDDS-LSQDIINATVERTMKKYSDNVMRFL  96

Query  635  EGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQ  814
            EG+SSRLSQLELYCYNLDK+IGEMRS+L  D+ E D+KL+S++KHLQEVHRSVQILRDKQ
Sbjct  97   EGISSRLSQLELYCYNLDKTIGEMRSELTRDNEEADAKLRSMDKHLQEVHRSVQILRDKQ  156

Query  815  ELADAQKELAKLQLAQKESGSANNSQQNEERASQPASDTKRSDSPCELHGQQLALAL  985
            EL D QKELA+LQL QK+S S   S   EER + P  + K+S++  + H  QLALAL
Sbjct  157  ELFDTQKELARLQLVQKDSSS---SSHGEERVATPVPEPKKSENTSDAHNNQLALAL  210



>emb|CDX97433.1| BnaC08g12980D [Brassica napus]
Length=492

 Score =   200 bits (509),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 139/172 (81%), Gaps = 0/172 (0%)
 Frame = +2

Query  485  QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
            +EFHK+RM RSS+ PT +Y PPEDS   +++   VE+SMKKY+DN+MRFLEGLSSRLSQL
Sbjct  52   KEFHKTRMARSSVFPTGSYAPPEDSLREEELTATVERSMKKYSDNMMRFLEGLSSRLSQL  111

Query  665  ELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELA  844
            ELYCYNLDK+IGEMRSDL   + E D KL+SL+KHLQEVHRSVQ+LRDKQELAD QKELA
Sbjct  112  ELYCYNLDKTIGEMRSDLTRHNEEADVKLRSLDKHLQEVHRSVQVLRDKQELADTQKELA  171

Query  845  KLQLAQKESGSANNSQQNEERASQPASDTKRSDSPCELHGQQLALALPHQVA  1000
            +LQL  K+S S+++SQ  EER + P  + K++++  +    QLALALPHQ++
Sbjct  172  RLQLVSKDSSSSSHSQHGEERVATPVPEHKKNENTSDAPNLQLALALPHQIS  223



>emb|CDY25250.1| BnaA02g22060D [Brassica napus]
Length=492

 Score =   200 bits (509),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 139/172 (81%), Gaps = 0/172 (0%)
 Frame = +2

Query  485  QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
            +EFHK+RM RSS+ PT +Y PPEDS   +++   VE+SMKKY+DN+MRFLEGLSSRLSQL
Sbjct  52   KEFHKTRMARSSVFPTGSYAPPEDSLREEELTATVERSMKKYSDNMMRFLEGLSSRLSQL  111

Query  665  ELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELA  844
            ELYCYNLDK+IGEMRSDL   + E D KL+SL+KHLQEVHRSVQ+LRDKQELAD QKELA
Sbjct  112  ELYCYNLDKTIGEMRSDLTRHNEEADVKLRSLDKHLQEVHRSVQVLRDKQELADTQKELA  171

Query  845  KLQLAQKESGSANNSQQNEERASQPASDTKRSDSPCELHGQQLALALPHQVA  1000
            +LQL  K+S S+++SQ  EER + P  + K++++  +    QLALALPHQ++
Sbjct  172  RLQLVSKDSSSSSHSQHGEERVATPVPEHKKNENTSDAPNLQLALALPHQIS  223



>ref|XP_009144355.1| PREDICTED: protein transport protein SEC31-like [Brassica rapa]
Length=476

 Score =   199 bits (507),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 139/177 (79%), Gaps = 5/177 (3%)
 Frame = +2

Query  458  NLSSKLCIEQEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDA-VEKSMKKYADNLMRFL  634
            N    +   +EFHK+RM RSS+ PTS+Y PP+DS  +QD+I+A VE++MKKY+DN+MRFL
Sbjct  38   NSDPAIAANKEFHKTRMARSSVFPTSSYTPPDDS-LSQDIINATVERTMKKYSDNVMRFL  96

Query  635  EGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQ  814
            EG+SSRLSQLELYCYNLDK+IGEMRS+L  D+ E D KL+S++KHLQEVHRSVQILRDKQ
Sbjct  97   EGISSRLSQLELYCYNLDKTIGEMRSELSRDNEEADVKLRSMDKHLQEVHRSVQILRDKQ  156

Query  815  ELADAQKELAKLQLAQKESGSANNSQQNEERASQPASDTKRSDSPCELHGQQLALAL  985
            EL D QKELA+LQL QK+S S   S   EER + P  + K+ ++  + H +QLALAL
Sbjct  157  ELFDTQKELARLQLVQKDSSS---SSHGEERVATPVPEPKKIENTSDAHNKQLALAL  210



>emb|CDY18985.1| BnaC01g20830D [Brassica napus]
Length=479

 Score =   198 bits (503),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 131/171 (77%), Gaps = 4/171 (2%)
 Frame = +2

Query  473  LCIEQEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSR  652
            +   +EFHK+RM RSS+ PTS+Y PPEDS  +QD+   VE +MKKY+DN+MRFLEG+SSR
Sbjct  42   IAANKEFHKTRMARSSVFPTSSYSPPEDS-LSQDINATVESTMKKYSDNMMRFLEGISSR  100

Query  653  LSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQ  832
            LSQLELYCYNLDK+IGEMRSDL  D+ E D KL+S++KHLQEVHRSVQILRDKQEL D Q
Sbjct  101  LSQLELYCYNLDKTIGEMRSDLTRDNDEADVKLRSMDKHLQEVHRSVQILRDKQELFDTQ  160

Query  833  KELAKLQLAQKESGSANNSQQNEERASQPASDTKRSDSPCELHGQQLALAL  985
            KELA+LQL  K+S S   S   EER + P  + K+ D+  + H   LALAL
Sbjct  161  KELARLQLVHKDSSS---SSHGEERVATPVPEPKKIDNTSDAHNNHLALAL  208



>ref|XP_009109102.1| PREDICTED: formin-like protein 3 [Brassica rapa]
Length=500

 Score =   198 bits (504),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 138/171 (81%), Gaps = 1/171 (1%)
 Frame = +2

Query  485  QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
            +EFHK+RM +SS+ PT +Y PPED    +++   VE+SMKKY+DN+MRFLEGLSSRLSQL
Sbjct  43   KEFHKTRMAKSSVFPTGSYGPPEDC-LREELTATVERSMKKYSDNMMRFLEGLSSRLSQL  101

Query  665  ELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELA  844
            ELYCYNLDK+IGEMRSDL  D+ E D KL+SL+KHLQEVHRSVQ+LRDKQELAD QKELA
Sbjct  102  ELYCYNLDKTIGEMRSDLTRDNEEADVKLRSLDKHLQEVHRSVQVLRDKQELADTQKELA  161

Query  845  KLQLAQKESGSANNSQQNEERASQPASDTKRSDSPCELHGQQLALALPHQV  997
            +LQL  K+S S+++SQ  EER + P  + K++++  +    QLALALPHQ+
Sbjct  162  RLQLVSKDSSSSSHSQHGEERVATPVPEHKKNENTSDAPNLQLALALPHQI  212



>ref|XP_009137778.1| PREDICTED: basic salivary proline-rich protein 1-like [Brassica 
rapa]
 emb|CDY29896.1| BnaA03g49170D [Brassica napus]
Length=487

 Score =   196 bits (497),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 137/169 (81%), Gaps = 4/169 (2%)
 Frame = +2

Query  479  IEQEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLS  658
              +EFHK+RM RSS+ PTS+Y PPEDS  +QDV   VE++MKKY DN+MRFLEG+SSRLS
Sbjct  46   FNKEFHKTRMARSSVFPTSSYSPPEDS-LSQDVTATVERTMKKYTDNVMRFLEGISSRLS  104

Query  659  QLELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKE  838
            QLELYCYNLDK+IGEMRSDL  D+ E D KL+S+EKHLQEV RSVQILRDKQELAD QK+
Sbjct  105  QLELYCYNLDKTIGEMRSDLTRDNEEADVKLRSMEKHLQEVRRSVQILRDKQELADTQKD  164

Query  839  LAKLQLAQKESGSANNSQQNEERASQPASDTKRSDSPCELHGQQLALAL  985
            LA+LQ+ QK+S S ++SQ++EE    P  + K+++S  + H QQLALAL
Sbjct  165  LARLQVVQKDSSSPSHSQKSEET---PVPEAKKTESSSDAHNQQLALAL  210



>gb|KEH39132.1| structural constituent of cell wall protein, putative [Medicago 
truncatula]
Length=480

 Score =   193 bits (491),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 130/247 (53%), Positives = 156/247 (63%), Gaps = 20/247 (8%)
 Frame = +2

Query  461   LSSKLCIEQEFHKsrmtrssmmptsAYIPPEDSSFNQDVI-DAVEKSMKKYADNLMRFLE  637
             +S+K    Q+FH SRM ++S  P +AY  PE  S +Q+VI   VEKSMK   D+LMRFLE
Sbjct  14    ISTKFTFLQDFHISRMVKTSTFPATAYNSPE-VSLSQEVIATTVEKSMKTCTDDLMRFLE  72

Query  638   GLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQE  817
             G+SSRLSQLELYCYN+DKSIGE++S+L  DH E DSKLKSL+KHLQEVHRSVQILRDKQE
Sbjct  73    GISSRLSQLELYCYNIDKSIGELKSELTSDHEEADSKLKSLDKHLQEVHRSVQILRDKQE  132

Query  818   LADAQKELAKLQLAQKESGSANNSQQNEERASQPASDTKRSD----SPCELHGQQLALAL  985
             L + QKELAKLQLA+K S S+++SQ NEER S  A D K +D    +  + H QQLAL L
Sbjct  133   LVETQKELAKLQLARKGSPSSSHSQSNEERFSPSAIDQKGTDNAYVTSYDPHNQQLALTL  192

Query  986   PHQVAPPQTSHTTRHMEqpqqpsvppipsqviTQSQGYYLSPTQMP-------LSQGQYM  1144
              +QVA        +                  TQ   YY  PT  P       L Q QY 
Sbjct  193   SNQVA-------FQQQPIAPSSQASSPNVTETTQQPRYYTLPTSSPNPPAAAQLPQNQYF  245

Query  1145  PSESQYR  1165
              S  QY+
Sbjct  246   SSNPQYQ  252



>emb|CDY14248.1| BnaA08g13790D [Brassica napus]
Length=491

 Score =   193 bits (491),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 108/169 (64%), Positives = 136/169 (80%), Gaps = 1/169 (1%)
 Frame = +2

Query  485  QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
            +EFHK+RM +SS+ PT +Y PPEDS   +++   VE+SMKKY+DN+MRFLEGLSSRLSQL
Sbjct  52   KEFHKTRMAKSSVFPTGSYGPPEDS-LREELTATVERSMKKYSDNMMRFLEGLSSRLSQL  110

Query  665  ELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELA  844
            ELYCYNLDK+IGEMRSDL  D+ E   KL+SL+KHLQEVHRSVQ+LRDKQELAD QKELA
Sbjct  111  ELYCYNLDKTIGEMRSDLSRDNEEAHVKLRSLDKHLQEVHRSVQVLRDKQELADTQKELA  170

Query  845  KLQLAQKESGSANNSQQNEERASQPASDTKRSDSPCELHGQQLALALPH  991
            +LQL  K+S S+++SQ  EER + P  + K++++  +    QLALALPH
Sbjct  171  RLQLVSKDSSSSSHSQHGEERVATPVPEHKKNENTSDAPNLQLALALPH  219



>emb|CDY67879.1| BnaC07g50480D [Brassica napus]
Length=478

 Score =   193 bits (490),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 136/169 (80%), Gaps = 4/169 (2%)
 Frame = +2

Query  479  IEQEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLS  658
              +EFHK+RM RSS+ PTS+Y PPEDS  +QDV   VE++MKKY DN+MRFLEG+SSRLS
Sbjct  45   FNKEFHKTRMARSSVFPTSSYSPPEDS-LSQDVTATVERTMKKYTDNVMRFLEGISSRLS  103

Query  659  QLELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKE  838
            QLELYCYNLDK+IGEMRSDL  D+ E D KL+S+EKHLQEV RSVQILRDKQELAD QK+
Sbjct  104  QLELYCYNLDKTIGEMRSDLTRDNEEADVKLRSVEKHLQEVRRSVQILRDKQELADTQKD  163

Query  839  LAKLQLAQKESGSANNSQQNEERASQPASDTKRSDSPCELHGQQLALAL  985
            LA+LQ+ QK+S S ++SQQ+EE    P  + K+S+S  +   QQLALAL
Sbjct  164  LARLQVVQKDSSSPSHSQQSEET---PVPEAKKSESSSDAQNQQLALAL  209



>ref|XP_004136823.1| PREDICTED: trithorax group protein osa [Cucumis sativus]
 gb|KGN43615.1| Structural constituent of cell wall [Cucumis sativus]
Length=545

 Score =   192 bits (488),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 130/238 (55%), Positives = 164/238 (69%), Gaps = 16/238 (7%)
 Frame = +2

Query  485   QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
             ++FHKSRM+        AY   EDS   QDVI  VE SMKKY+DN++RFLEG+SSRLSQL
Sbjct  50    KDFHKSRMSTVYPAA--AYGQSEDS-IKQDVISTVENSMKKYSDNILRFLEGISSRLSQL  106

Query  665   ELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELA  844
             EL CYNLDKS+GEMRSD++ D  E D KLKSLEKHLQEVHRSVQI+RDKQELA+ QK+LA
Sbjct  107   ELNCYNLDKSVGEMRSDVLRDREEEDLKLKSLEKHLQEVHRSVQIIRDKQELAETQKDLA  166

Query  845   KLQLAQKESGSANNSQQNEERASQPASDTKR-SDSPCELHGQQLALALPHQVAPPQTSHT  1021
             KL L QKES S+N+S  N+ERAS  ASD+K+  +    L+ QQLALALPHQ+ P Q   T
Sbjct  167   KLHLLQKESSSSNHSHSNDERASPVASDSKKNENLSENLNNQQLALALPHQIVPHQNPIT  226

Query  1022  TRHMEqpqqpsvppipsqviTQSQGYYLSPTQMPLSQGQYMP-SESQYRTPQMQEVAR  1192
                         P    Q + Q Q YY++  Q+P     ++  +++QY+  Q+Q+V+R
Sbjct  227   P---------PPPAALPQNVPQQQSYYMASNQLPSQPPTHIQHAQTQYQ--QLQDVSR  273



>ref|XP_007149849.1| hypothetical protein PHAVU_005G103700g [Phaseolus vulgaris]
 gb|ESW21843.1| hypothetical protein PHAVU_005G103700g [Phaseolus vulgaris]
Length=513

 Score =   191 bits (486),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 124/231 (54%), Positives = 155/231 (67%), Gaps = 9/231 (4%)
 Frame = +2

Query  485   QEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  664
             ++FH SRMTR+S++P +A     + S  QDVI  VEKSMK + DNLM+FLEG+SSRLS+L
Sbjct  46    KDFHTSRMTRTSIVPAAAAYGSSEDSLGQDVIATVEKSMKTHTDNLMQFLEGISSRLSKL  105

Query  665   ELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELA  844
             ELYCYNLDKSIG MRSDL  DH E DSKL SL+KHLQEV RSVQILRDKQ+LA  QKELA
Sbjct  106   ELYCYNLDKSIGAMRSDLNSDHEEADSKLHSLDKHLQEVRRSVQILRDKQDLAKTQKELA  165

Query  845   KLQLAQKESGSANNSQQNEERASQPASDTKRSDSPCELHGQQLALALPHQVAPPQTSHTT  1024
             KLQL +KES S+++SQ NEER+S  + D +R D+  +    +LALA+P+Q+A        
Sbjct  166   KLQLIRKESSSSSHSQSNEERSSPSSIDPRRIDNASDTQNLELALAIPNQIA-------L  218

Query  1025  RHMEqpqqpsvppipsqviTQSQGYYLSP--TQMPLSQGQYMPSESQYRTP  1171
             R         VP       TQ   +YL P     P ++ QY+ S+  YR P
Sbjct  219   RQQPVSSSYQVPAPNVSPATQQPRHYLMPPTPSNPQARSQYLHSDPHYRIP  269



>gb|KCW89535.1| hypothetical protein EUGRSUZ_A01820 [Eucalyptus grandis]
Length=471

 Score =   188 bits (477),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 112/209 (54%), Positives = 143/209 (68%), Gaps = 14/209 (7%)
 Frame = +2

Query  599   MKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQE  778
             MK+  D++MRFLEG+SSRLSQLELYCYNLDKSIGEMRS+L  DH E D KLKSLEKH+QE
Sbjct  1     MKRNTDSIMRFLEGISSRLSQLELYCYNLDKSIGEMRSELTRDHDEADVKLKSLEKHVQE  60

Query  779   VHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERASQPASDTKRSDSPCEL  958
             VHRSVQILRDKQELA+ QKELAKL   +K+S S++ SQ NE ++  P SDTK+++   ++
Sbjct  61    VHRSVQILRDKQELAETQKELAKLHFVRKDSSSSSQSQTNEGKS--PTSDTKKTECMSDV  118

Query  959   HGQQLALALPHQV--APPQTSHTTRHMEqpqqpsvppipsqviTQSQGYYLSPTQM----  1120
               QQLALALPHQ+              +          P Q ++Q Q YYL P QM    
Sbjct  119   SNQQLALALPHQIMPQQQLQPQPQPQPQPQPGALTSQAPPQNVSQPQSYYLPPVQMQTMA  178

Query  1121  -P--LSQGQYMPSESQY---RTPQMQEVA  1189
              P  ++Q Q++PS+ QY   ++PQ+Q V+
Sbjct  179   APTQMTQTQFLPSDPQYCARQSPQLQNVS  207



>ref|XP_010540875.1| PREDICTED: extensin [Tarenaya hassleriana]
Length=492

 Score =   187 bits (474),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 114/141 (81%), Gaps = 0/141 (0%)
 Frame = +2

Query  563  FNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETD  742
             +QD+   VE++MKKYADN+MRFLEG+SSRLSQLELYCYNLDK+IGEMRSDL  ++ E D
Sbjct  77   LSQDITATVERTMKKYADNMMRFLEGISSRLSQLELYCYNLDKTIGEMRSDLTRENQEAD  136

Query  743  SKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERASQPA  922
             KL+SL+KHLQEVHRSVQILRDKQELA+ QKELAKLQ   KES S+++SQ  EER   P 
Sbjct  137  VKLRSLDKHLQEVHRSVQILRDKQELAETQKELAKLQHGHKESPSSSHSQSGEERTQAPV  196

Query  923  SDTKRSDSPCELHGQQLALAL  985
            +D+K  +   + H QQLALAL
Sbjct  197  ADSKPCERKSDTHNQQLALAL  217



>gb|KEH39131.1| structural constituent of cell wall protein, putative [Medicago 
truncatula]
Length=500

 Score =   187 bits (474),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 127/239 (53%), Positives = 152/239 (64%), Gaps = 20/239 (8%)
 Frame = +2

Query  485   QEFHKsrmtrssmmptsAYIPPEDSSFNQDVI-DAVEKSMKKYADNLMRFLEGLSSRLSQ  661
             ++FH SRM ++S  P +AY  PE  S +Q+VI   VEKSMK   D+LMRFLEG+SSRLSQ
Sbjct  42    KDFHISRMVKTSTFPATAYNSPE-VSLSQEVIATTVEKSMKTCTDDLMRFLEGISSRLSQ  100

Query  662   LELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKEL  841
             LELYCYN+DKSIGE++S+L  DH E DSKLKSL+KHLQEVHRSVQILRDKQEL + QKEL
Sbjct  101   LELYCYNIDKSIGELKSELTSDHEEADSKLKSLDKHLQEVHRSVQILRDKQELVETQKEL  160

Query  842   AKLQLAQKESGSANNSQQNEERASQPASDTKRSD----SPCELHGQQLALALPHQVAPPQ  1009
             AKLQLA+K S S+++SQ NEER S  A D K +D    +  + H QQLAL L +QVA   
Sbjct  161   AKLQLARKGSPSSSHSQSNEERFSPSAIDQKGTDNAYVTSYDPHNQQLALTLSNQVA---  217

Query  1010  TSHTTRHMEqpqqpsvppipsqviTQSQGYYLSPTQMP-------LSQGQYMPSESQYR  1165
                  +                  TQ   YY  PT  P       L Q QY  S  QY+
Sbjct  218   ----FQQQPIAPSSQASSPNVTETTQQPRYYTLPTSSPNPPAAAQLPQNQYFSSNPQYQ  272



>gb|ACU16150.1| unknown [Glycine max]
Length=193

 Score =   175 bits (444),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 109/131 (83%), Gaps = 1/131 (1%)
 Frame = +2

Query  536  AYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSD  715
            AY   EDS  +QDVI  VEKSMK +ADNLMRFLEGLS+RLSQLELYCYNLDKSIG M+SD
Sbjct  63   AYSSSEDS-LSQDVIAIVEKSMKTHADNLMRFLEGLSTRLSQLELYCYNLDKSIGAMQSD  121

Query  716  LVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQ  895
            L  DH ETDSKLKSL+KHLQEVHRSV ILRDKQELA+ +KELAKL+  +KES S+++ Q 
Sbjct  122  LTCDHEETDSKLKSLDKHLQEVHRSVLILRDKQELAETRKELAKLKHVRKESSSSSHLQS  181

Query  896  NEERASQPASD  928
            NEER+S  + D
Sbjct  182  NEERSSPSSMD  192



>ref|XP_008810226.1| PREDICTED: ataxin-2 homolog isoform X2 [Phoenix dactylifera]
 ref|XP_008810227.1| PREDICTED: ataxin-2 homolog isoform X2 [Phoenix dactylifera]
Length=493

 Score =   183 bits (465),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 113/150 (75%), Gaps = 6/150 (4%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  730
            ED S  + VI AVEK MKKYADNL+R+LEG+S RLSQLELYCY +++SIGE RSD++ D 
Sbjct  42   EDYS-KEKVICAVEKCMKKYADNLLRYLEGISGRLSQLELYCYKIERSIGEFRSDIIRDQ  100

Query  731  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERA  910
             E + K KS+EKHLQEVHRSVQILRDKQEL +AQKELAKLQL QKES     +Q+NEE  
Sbjct  101  SEGELKFKSIEKHLQEVHRSVQILRDKQELVEAQKELAKLQLVQKES-----TQKNEEAV  155

Query  911  SQPASDTKRSDSPCELHGQQLALALPHQVA  1000
               +S+TKR D    +   QLALALPHQ  
Sbjct  156  VPSSSETKRHDDKPNVASHQLALALPHQAV  185



>ref|XP_010919602.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 23-like 
isoform X2 [Elaeis guineensis]
Length=488

 Score =   183 bits (465),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 112/150 (75%), Gaps = 6/150 (4%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  730
            ED S  + VI AVEK MKKYADNL+R LEG+S RLSQLELYC+ +++SIGE RSD++ D 
Sbjct  38   EDYS-KEKVIPAVEKCMKKYADNLLRSLEGISGRLSQLELYCFKIERSIGEFRSDIIRDQ  96

Query  731  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERA  910
             ET+ K K+LEKHLQEVHRSVQILRDKQELA+ QKELAKLQL QKES      Q+NEE  
Sbjct  97   SETELKFKTLEKHLQEVHRSVQILRDKQELAETQKELAKLQLVQKES-----PQKNEEAV  151

Query  911  SQPASDTKRSDSPCELHGQQLALALPHQVA  1000
               +S+TKR D    +   QLALALPHQ  
Sbjct  152  VPSSSETKRHDDKPNVASHQLALALPHQAV  181



>ref|XP_008810225.1| PREDICTED: ataxin-2 homolog isoform X1 [Phoenix dactylifera]
Length=516

 Score =   183 bits (464),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 109/142 (77%), Gaps = 5/142 (4%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  754
            VI AVEK MKKYADNL+R+LEG+S RLSQLELYCY +++SIGE RSD++ D  E + K K
Sbjct  72   VICAVEKCMKKYADNLLRYLEGISGRLSQLELYCYKIERSIGEFRSDIIRDQSEGELKFK  131

Query  755  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERASQPASDTK  934
            S+EKHLQEVHRSVQILRDKQEL +AQKELAKLQL QKES     +Q+NEE     +S+TK
Sbjct  132  SIEKHLQEVHRSVQILRDKQELVEAQKELAKLQLVQKES-----TQKNEEAVVPSSSETK  186

Query  935  RSDSPCELHGQQLALALPHQVA  1000
            R D    +   QLALALPHQ  
Sbjct  187  RHDDKPNVASHQLALALPHQAV  208



>ref|XP_010919593.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 23-like 
isoform X1 [Elaeis guineensis]
Length=515

 Score =   182 bits (462),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 108/142 (76%), Gaps = 5/142 (4%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  754
            VI AVEK MKKYADNL+R LEG+S RLSQLELYC+ +++SIGE RSD++ D  ET+ K K
Sbjct  72   VIPAVEKCMKKYADNLLRSLEGISGRLSQLELYCFKIERSIGEFRSDIIRDQSETELKFK  131

Query  755  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERASQPASDTK  934
            +LEKHLQEVHRSVQILRDKQELA+ QKELAKLQL QKES      Q+NEE     +S+TK
Sbjct  132  TLEKHLQEVHRSVQILRDKQELAETQKELAKLQLVQKES-----PQKNEEAVVPSSSETK  186

Query  935  RSDSPCELHGQQLALALPHQVA  1000
            R D    +   QLALALPHQ  
Sbjct  187  RHDDKPNVASHQLALALPHQAV  208



>ref|XP_010924425.1| PREDICTED: hepatocyte growth factor-regulated tyrosine kinase 
substrate-like isoform X1 [Elaeis guineensis]
Length=517

 Score =   179 bits (454),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 111/144 (77%), Gaps = 5/144 (3%)
 Frame = +2

Query  569  QDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSK  748
            +++I AVEK MKKYADNL++FLEG+S RLSQLELYCY +++S+GE RSD++ D  E + K
Sbjct  70   EEMISAVEKCMKKYADNLLQFLEGISGRLSQLELYCYKIERSLGEFRSDVIRDQNEAEMK  129

Query  749  LKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERASQPASD  928
             KSLEKHLQEV RSVQILRDKQELA+AQKEL KLQL QKES     +Q+NEE      S+
Sbjct  130  FKSLEKHLQEVQRSVQILRDKQELAEAQKELTKLQLGQKES-----TQKNEEVVFPSPSE  184

Query  929  TKRSDSPCELHGQQLALALPHQVA  1000
            TK+ D   ++  QQLALALPHQ  
Sbjct  185  TKQHDDKPDVVNQQLALALPHQTV  208



>ref|XP_008798248.1| PREDICTED: putative cyclin-dependent serine/threonine-protein 
kinase DDB_G0272797/DDB_G0274007 [Phoenix dactylifera]
Length=514

 Score =   175 bits (444),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 112/144 (78%), Gaps = 5/144 (3%)
 Frame = +2

Query  569  QDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSK  748
            +++I AVEK MKKYADN++RFLEG+S RLSQL+L+CY +++SIGE RSD++ D  E + K
Sbjct  68   EEMIAAVEKCMKKYADNVLRFLEGISGRLSQLDLHCYKIERSIGEFRSDVIRDQNEAEMK  127

Query  749  LKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERASQPASD  928
             KSLEKHLQEV RSVQI+RDKQELA+AQKELAKLQL  KES     +Q+NEE     +S+
Sbjct  128  FKSLEKHLQEVQRSVQIMRDKQELAEAQKELAKLQLGHKES-----TQKNEEVVIPSSSE  182

Query  929  TKRSDSPCELHGQQLALALPHQVA  1000
            TK+ D   ++  +QLALALPHQ  
Sbjct  183  TKQHDDKPDVANRQLALALPHQTV  206



>ref|XP_009395702.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Musa acuminata subsp. malaccensis]
Length=581

 Score =   174 bits (442),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 88/146 (60%), Positives = 110/146 (75%), Gaps = 5/146 (3%)
 Frame = +2

Query  569   QDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSK  748
             +D+I AVEK MKKYADNL+R L+G+S RLSQLE++CY L++S+GE+R+D + D  E D K
Sbjct  71    EDIISAVEKCMKKYADNLLRSLDGISGRLSQLEIFCYKLERSLGELRADFLQDQSEKDLK  130

Query  749   LKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERASQPASD  928
              KSLEKHLQEVHRSVQILRDKQELA+ QKELAKLQL QKES      ++NE   ++   D
Sbjct  131   FKSLEKHLQEVHRSVQILRDKQELAETQKELAKLQLVQKES-----VEKNENAVARSVLD  185

Query  929   TKRSDSPCELHGQQLALALPHQVAPP  1006
             TK+ D   ++  QQLAL LP Q + P
Sbjct  186   TKKLDDKPDVANQQLALVLPRQTSAP  211



>ref|XP_004969990.1| PREDICTED: trithorax group protein osa-like [Setaria italica]
Length=590

 Score =   170 bits (431),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 93/162 (57%), Positives = 117/162 (72%), Gaps = 10/162 (6%)
 Frame = +2

Query  551   EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  730
             ++S   +DV+ AVEK MKKYADNL+R LEG++SRLSQLE+YCY L++SIGE+RSD++ D 
Sbjct  66    QESYSKEDVLSAVEKCMKKYADNLLRSLEGITSRLSQLEIYCYKLERSIGELRSDVLRD-  124

Query  731   GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERA  910
               TD +LKSLEKHL EVHRSVQILRDKQELA+AQKELAK QL Q      + S++ E+  
Sbjct  125   -VTDHRLKSLEKHLHEVHRSVQILRDKQELAEAQKELAKFQLTQ------DTSKKKEDAP  177

Query  911   SQPASDTKRSDSPCELHGQQLALALPHQVAPPQTSHTTRHME  1036
             +    + K+ +   +  GQQLAL LPHQV   QTS   R  E
Sbjct  178   TPSIPEPKKLEEKPDTSGQQLALVLPHQVN--QTSLAPRASE  217



>gb|EMS50510.1| hypothetical protein TRIUR3_23019 [Triticum urartu]
Length=606

 Score =   170 bits (430),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 109/149 (73%), Gaps = 9/149 (6%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  730
            +DS   +DV+ AVEK MKKYADNL+R LEG++SRLSQLE+YCY L++SIGE+R+D++ D 
Sbjct  64   QDSYAKEDVLSAVEKCMKKYADNLLRSLEGITSRLSQLEIYCYKLERSIGELRADVLRD-  122

Query  731  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERA  910
             ETD +LKSLEKHL EVHRS+QILRDKQELAD QKELAK QL   ES       + +E  
Sbjct  123  -ETDLRLKSLEKHLHEVHRSIQILRDKQELADTQKELAKFQLTHDES-------KKKEDV  174

Query  911  SQPASDTKRSDSPCELHGQQLALALPHQV  997
              P  + K  +   +   QQLALALPHQV
Sbjct  175  LTPFPEAKNPEEKRDAASQQLALALPHQV  203



>dbj|BAK01177.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=603

 Score =   168 bits (426),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 109/152 (72%), Gaps = 14/152 (9%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  730
            +DS   +DV+ AVEK MKKYADNL+R LEG++SRLSQLE+YCY L++SIGE+R+D++ D 
Sbjct  64   QDSYAKEDVLSAVEKCMKKYADNLLRSLEGITSRLSQLEIYCYKLERSIGELRADVLRD-  122

Query  731  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERA  910
             ETD +LKSLEKHL EVHRS+QILRDKQELAD QKELAK QL   ES         +++ 
Sbjct  123  -ETDLRLKSLEKHLHEVHRSIQILRDKQELADTQKELAKFQLTHDES---------KKKE  172

Query  911  SQPASDTKRSDSPCE---LHGQQLALALPHQV  997
              PA      + P E      QQLALALPHQV
Sbjct  173  DVPAPSFPEPNKPEEKRDAASQQLALALPHQV  204



>ref|XP_002458505.1| hypothetical protein SORBIDRAFT_03g034890 [Sorghum bicolor]
 gb|EES03625.1| hypothetical protein SORBIDRAFT_03g034890 [Sorghum bicolor]
Length=587

 Score =   168 bits (425),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 112/149 (75%), Gaps = 8/149 (5%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  730
            ++S   +DV+ AVEK MKKYADNL+R LEG++SRLSQLE+YCY L++SIGE+RSD++ D 
Sbjct  66   QESYGKEDVLSAVEKCMKKYADNLLRSLEGITSRLSQLEIYCYKLERSIGELRSDVLRD-  124

Query  731  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERA  910
             ETD +LKSLEKHL EVHRS+QILRDKQELA+AQKELAK QL Q      + S++ E+  
Sbjct  125  -ETDHRLKSLEKHLHEVHRSIQILRDKQELAEAQKELAKFQLTQ------DTSKKKEDVP  177

Query  911  SQPASDTKRSDSPCELHGQQLALALPHQV  997
            +    + K+ +   +   QQLAL LPHQV
Sbjct  178  TPSIPEQKKLEENPDTSNQQLALVLPHQV  206



>ref|XP_008655245.1| PREDICTED: uncharacterized protein LOC100383096 isoform X1 [Zea 
mays]
 gb|AFW85062.1| putative DUF1421 domain family protein [Zea mays]
Length=584

 Score =   166 bits (421),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 112/149 (75%), Gaps = 9/149 (6%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  730
            ++S   +DV+ AVEK MKKYADNL+R LEG++SRLSQLE+YCY L++SIGE+RSD++ D 
Sbjct  62   QESYGKEDVLSAVEKCMKKYADNLLRSLEGITSRLSQLEIYCYKLERSIGELRSDVLRD-  120

Query  731  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERA  910
             ETD +LKSLEKHL EVHRS+QILRDKQELA+AQKELAK QL Q      + S++ E+  
Sbjct  121  -ETDHRLKSLEKHLNEVHRSIQILRDKQELAEAQKELAKFQLTQ------DTSKKKEDVP  173

Query  911  SQPASDTKRSDSPCELHGQQLALALPHQV  997
            +      K  ++P +   QQLAL LPHQV
Sbjct  174  TSIPEQKKLEENP-DTSNQQLALVLPHQV  201



>gb|EMT05386.1| hypothetical protein F775_26441 [Aegilops tauschii]
Length=606

 Score =   166 bits (421),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 111/149 (74%), Gaps = 8/149 (5%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  730
            ++S   +DV+ AVEK MKKYADNL+R LEG++SRLSQLE+YCY L++SIGE+R+D++ D 
Sbjct  64   QESYAKEDVLSAVEKCMKKYADNLLRSLEGITSRLSQLEIYCYKLERSIGELRADVLRD-  122

Query  731  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERA  910
             ETD +LKSLEKHL EVHRS+QILRDKQELAD QKELAK QL   E      S++ E+  
Sbjct  123  -ETDLRLKSLEKHLHEVHRSIQILRDKQELADTQKELAKFQLTHDE------SKKKEDVL  175

Query  911  SQPASDTKRSDSPCELHGQQLALALPHQV  997
            +    + K+ +   +   QQLALALPHQV
Sbjct  176  TPSFPEPKKPEEKRDAASQQLALALPHQV  204



>ref|XP_006644725.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15-like isoform X2 [Oryza brachyantha]
Length=586

 Score =   164 bits (415),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 111/149 (74%), Gaps = 8/149 (5%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  730
            ++S   +DV+ AVEK MKKYADNL+R LEG++SRLSQLE+YCY L++S+GE+RSD++ D 
Sbjct  60   QESYGKEDVLFAVEKCMKKYADNLLRSLEGITSRLSQLEIYCYKLERSMGELRSDVLRD-  118

Query  731  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERA  910
             ETD +LKSLEKHL EVHRS+QILRDKQELA+ QKELAK QL        + S++ E+  
Sbjct  119  -ETDQRLKSLEKHLHEVHRSIQILRDKQELAETQKELAKFQLRH------DTSKKKEDVP  171

Query  911  SQPASDTKRSDSPCELHGQQLALALPHQV  997
            +Q   + K  +   +  GQQLA+ LPHQV
Sbjct  172  TQSFPEQKTLEEKADASGQQLAIVLPHQV  200



>emb|CDM84126.1| unnamed protein product [Triticum aestivum]
Length=603

 Score =   164 bits (415),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 110/149 (74%), Gaps = 9/149 (6%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  730
            ++S   +DV+ AVEK MKKYADNL+R LEG++SRLSQLE+YCY L++SIGE+R+D++ D 
Sbjct  64   QESYAKEDVLSAVEKCMKKYADNLLRSLEGITSRLSQLEIYCYKLERSIGELRADVLRD-  122

Query  731  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERA  910
             ETD +LKSLEKHL EVHRS+QILRDKQELAD QKELAK QL   ES       + ++  
Sbjct  123  -ETDLRLKSLEKHLHEVHRSIQILRDKQELADTQKELAKFQLTHDES-------KKKDVL  174

Query  911  SQPASDTKRSDSPCELHGQQLALALPHQV  997
            +    + K+ +   +   QQLALALPHQV
Sbjct  175  TPSFPEPKKPEEKRDAASQQLALALPHQV  203



>ref|XP_006644724.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15-like isoform X1 [Oryza brachyantha]
Length=587

 Score =   164 bits (414),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 111/149 (74%), Gaps = 8/149 (5%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  730
            ++S   +DV+ AVEK MKKYADNL+R LEG++SRLSQLE+YCY L++S+GE+RSD++ D 
Sbjct  61   QESYGKEDVLFAVEKCMKKYADNLLRSLEGITSRLSQLEIYCYKLERSMGELRSDVLRD-  119

Query  731  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERA  910
             ETD +LKSLEKHL EVHRS+QILRDKQELA+ QKELAK QL        + S++ E+  
Sbjct  120  -ETDQRLKSLEKHLHEVHRSIQILRDKQELAETQKELAKFQLRH------DTSKKKEDVP  172

Query  911  SQPASDTKRSDSPCELHGQQLALALPHQV  997
            +Q   + K  +   +  GQQLA+ LPHQV
Sbjct  173  TQSFPEQKTLEEKADASGQQLAIVLPHQV  201



>ref|NP_001044280.1| Os01g0754500 [Oryza sativa Japonica Group]
 dbj|BAD87289.1| putative calcium-binding protein [Oryza sativa Japonica Group]
 dbj|BAF06194.1| Os01g0754500 [Oryza sativa Japonica Group]
 dbj|BAG93651.1| unnamed protein product [Oryza sativa Japonica Group]
Length=594

 Score =   162 bits (411),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 110/149 (74%), Gaps = 8/149 (5%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  730
            ++S   +DV+ AVEK MKKYADNL+R LEG+++RLSQLE+YCY L++S+GE+RSD++ D 
Sbjct  60   QESYGKEDVLFAVEKCMKKYADNLLRSLEGITNRLSQLEIYCYKLERSMGELRSDVLRD-  118

Query  731  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERA  910
             ETD +LKSLEKHL EVHRS+QILRDKQELA+ QKELAK QL        + S++ E+  
Sbjct  119  -ETDQRLKSLEKHLHEVHRSIQILRDKQELAETQKELAKFQLTH------DTSKKKEDMP  171

Query  911  SQPASDTKRSDSPCELHGQQLALALPHQV  997
            +    + K  +   +  GQQLA+ LPHQV
Sbjct  172  TPSFPEQKTLEEKADAPGQQLAIVLPHQV  200



>gb|EEC71500.1| hypothetical protein OsI_03777 [Oryza sativa Indica Group]
Length=595

 Score =   162 bits (410),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 110/149 (74%), Gaps = 8/149 (5%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  730
            ++S   +DV+ AVEK MKKYADNL+R LEG+++RLSQLE+YCY L++S+GE+RSD++ D 
Sbjct  61   QESYGKEDVLFAVEKCMKKYADNLLRSLEGITNRLSQLEIYCYKLERSMGELRSDVLRD-  119

Query  731  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERA  910
             ETD +LKSLEKHL EVHRS+QILRDKQELA+ QKELAK QL        + S++ E+  
Sbjct  120  -ETDQRLKSLEKHLHEVHRSIQILRDKQELAETQKELAKFQLTH------DTSKKKEDMP  172

Query  911  SQPASDTKRSDSPCELHGQQLALALPHQV  997
            +    + K  +   +  GQQLA+ LPHQV
Sbjct  173  TPSFPEQKTLEEKADAPGQQLAIVLPHQV  201



>gb|ERN06562.1| hypothetical protein AMTR_s00058p00125550 [Amborella trichopoda]
Length=532

 Score =   157 bits (397),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 109/155 (70%), Gaps = 8/155 (5%)
 Frame = +2

Query  551   EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  730
             ++  FN +VI  VEK+MKK  D L+ F+EG+S R+SQ+E YC N+++SIGE+RSD VHDH
Sbjct  24    QNEDFNVEVITTVEKTMKKCMDTLLCFIEGISGRMSQMESYCCNIERSIGELRSDFVHDH  83

Query  731   GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKES---GSANNSQQNE  901
             GE++SKL SLEKHLQEVHRS+QI+RDKQELA+ Q+EL KLQ+  KE    G   +S +  
Sbjct  84    GESNSKLTSLEKHLQEVHRSIQIIRDKQELAETQRELVKLQIVPKEPNREGVRPSSPEPP  143

Query  902   ERASQPASDTKRSDSPCELH-GQQLALALPHQVAP  1003
             ++   P+S  ++     ++H   + A  +PH+  P
Sbjct  144   KQQDNPSSGIEKP----QMHQAHESARPVPHRSTP  174



>ref|XP_011623594.1| PREDICTED: transcriptional regulator DEF1 [Amborella trichopoda]
Length=587

 Score =   156 bits (394),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 109/155 (70%), Gaps = 8/155 (5%)
 Frame = +2

Query  551   EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  730
             ++  FN +VI  VEK+MKK  D L+ F+EG+S R+SQ+E YC N+++SIGE+RSD VHDH
Sbjct  79    QNEDFNVEVITTVEKTMKKCMDTLLCFIEGISGRMSQMESYCCNIERSIGELRSDFVHDH  138

Query  731   GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKES---GSANNSQQNE  901
             GE++SKL SLEKHLQEVHRS+QI+RDKQELA+ Q+EL KLQ+  KE    G   +S +  
Sbjct  139   GESNSKLTSLEKHLQEVHRSIQIIRDKQELAETQRELVKLQIVPKEPNREGVRPSSPEPP  198

Query  902   ERASQPASDTKRSDSPCELH-GQQLALALPHQVAP  1003
             ++   P+S  ++     ++H   + A  +PH+  P
Sbjct  199   KQQDNPSSGIEKP----QMHQAHESARPVPHRSTP  229



>ref|NP_001169238.1| uncharacterized protein LOC100383096 [Zea mays]
 gb|ACN32051.1| unknown [Zea mays]
Length=507

 Score =   154 bits (389),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 101/133 (76%), Gaps = 9/133 (7%)
 Frame = +2

Query  599  MKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQE  778
            MKKYADNL+R LEG++SRLSQLE+YCY L++SIGE+RSD++ D  ETD +LKSLEKHL E
Sbjct  1    MKKYADNLLRSLEGITSRLSQLEIYCYKLERSIGELRSDVLRD--ETDHRLKSLEKHLNE  58

Query  779  VHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERASQPASDTKRSDSPCEL  958
            VHRS+QILRDKQELA+AQKELAK QL Q      + S++ E+  +      K  ++P + 
Sbjct  59   VHRSIQILRDKQELAEAQKELAKFQLTQ------DTSKKKEDVPTSIPEQKKLEENP-DT  111

Query  959  HGQQLALALPHQV  997
              QQLAL LPHQV
Sbjct  112  SNQQLALVLPHQV  124



>gb|EEE55398.1| hypothetical protein OsJ_03493 [Oryza sativa Japonica Group]
Length=371

 Score =   150 bits (380),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 100/133 (75%), Gaps = 8/133 (6%)
 Frame = +2

Query  599  MKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQE  778
            MKKYADNL+R LEG+++RLSQLE+YCY L++S+GE+RSD++ D  ETD +LKSLEKHL E
Sbjct  1    MKKYADNLLRSLEGITNRLSQLEIYCYKLERSMGELRSDVLRD--ETDQRLKSLEKHLHE  58

Query  779  VHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERASQPASDTKRSDSPCEL  958
            VHRS+QILRDKQELA+ QKELAK QL      + + S++ E+  +    + K  +   + 
Sbjct  59   VHRSIQILRDKQELAETQKELAKFQL------THDTSKKKEDMPTPSFPEQKTLEEKADA  112

Query  959  HGQQLALALPHQV  997
             GQQLA+ LPHQV
Sbjct  113  PGQQLAIVLPHQV  125



>emb|CBI21851.3| unnamed protein product [Vitis vinifera]
Length=151

 Score =   137 bits (346),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +2

Query  536  AYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSD  715
             Y   E+SS NQ++I  VEK++KKYADNLMRFLEG+SSRLSQLELYCYNLDKSIGEMRSD
Sbjct  65   VYGQQEESSLNQEMISTVEKTVKKYADNLMRFLEGISSRLSQLELYCYNLDKSIGEMRSD  124

Query  716  LVHDHGETDSKLKSLEKHLQEV  781
            LV DHGE DSKLKSL+KH+QEV
Sbjct  125  LVRDHGEADSKLKSLDKHIQEV  146



>emb|CAN71577.1| hypothetical protein VITISV_043279 [Vitis vinifera]
Length=292

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +2

Query  536  AYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSD  715
             Y   E+SS NQ++I  VEK++KKYADNLMRFLEG+SSRLSQLELYCYNLDKSIGEMRSD
Sbjct  65   VYGQQEESSLNQEMISTVEKTVKKYADNLMRFLEGISSRLSQLELYCYNLDKSIGEMRSD  124

Query  716  LVHDHGETDSKLKSLEKHLQEV  781
            LV DHGE DSKLKSL+KH+QEV
Sbjct  125  LVRDHGEADSKLKSLDKHIQEV  146



>ref|XP_009396506.1| PREDICTED: pinin-like [Musa acuminata subsp. malaccensis]
Length=512

 Score =   140 bits (352),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 99/144 (69%), Gaps = 5/144 (3%)
 Frame = +2

Query  575   VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  754
             V  +VEK MKKYAD L++ LE +S RLSQ+E++ + L++S+ E+R D + D  + D   K
Sbjct  73    VTSSVEKCMKKYADTLLQSLEAISGRLSQMEIHFHKLEQSLCELRGDFIQDQSDKDLNFK  132

Query  755   SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERASQPASDTK  934
             SLEKHLQEVHRSVQI+RDKQELA+  KELAKLQ+ QKES      ++ EE  ++  S+ K
Sbjct  133   SLEKHLQEVHRSVQIMRDKQELAETHKELAKLQMVQKES-----VEKKEEVVARSVSEPK  187

Query  935   RSDSPCELHGQQLALALPHQVAPP  1006
             + D   ++  QQLALALP     P
Sbjct  188   KLDDKPDVANQQLALALPRPATSP  211



>gb|EAY99014.1| hypothetical protein OsI_20972 [Oryza sativa Indica Group]
Length=518

 Score =   129 bits (323),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 70/150 (47%), Positives = 98/150 (65%), Gaps = 7/150 (5%)
 Frame = +2

Query  551  EDSSFNQDVI-DAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHD  727
            E  ++++++I +A+E  MKK ADNL+  L+ +S RLSQLELYCY L++SIGE+RSD++  
Sbjct  50   EQETYSREIITEAIESCMKKQADNLVNTLDVISGRLSQLELYCYKLERSIGELRSDVMDY  109

Query  728  HGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEER  907
            HGE +   + LEKH++EV  SVQ+L+DKQELA+ QKEL KLQ+  +ES       Q  E 
Sbjct  110  HGEANINFRCLEKHVKEVQNSVQVLQDKQELAETQKELTKLQILHEESA------QKSEG  163

Query  908  ASQPASDTKRSDSPCELHGQQLALALPHQV  997
             +     TK  D    +   +LAL   HQV
Sbjct  164  TAPSVLMTKEIDGSMPVAKHELALVPLHQV  193



>gb|AAU10648.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAH00945.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64682.1| hypothetical protein OsJ_19537 [Oryza sativa Japonica Group]
Length=518

 Score =   129 bits (323),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 70/150 (47%), Positives = 98/150 (65%), Gaps = 7/150 (5%)
 Frame = +2

Query  551  EDSSFNQDVI-DAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHD  727
            E  ++++++I +A+E  MKK ADNL+  L+ +S RLSQLELYCY L++SIGE+RSD++  
Sbjct  50   EQETYSREIITEAIESCMKKQADNLVNTLDVISGRLSQLELYCYKLERSIGELRSDVMDY  109

Query  728  HGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEER  907
            HGE +   + LEKH++EV  SVQ+L+DKQELA+ QKEL KLQ+  +ES       Q  E 
Sbjct  110  HGEANINFRCLEKHVKEVQNSVQVLQDKQELAETQKELTKLQILHEESA------QKSEG  163

Query  908  ASQPASDTKRSDSPCELHGQQLALALPHQV  997
             +     TK  D    +   +LAL   HQV
Sbjct  164  TAPSVLMTKEIDGSMPVAKHELALVPLHQV  193



>ref|XP_006655586.1| PREDICTED: adenylate cyclase, terminal-differentiation specific-like, 
partial [Oryza brachyantha]
Length=512

 Score =   126 bits (316),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/139 (47%), Positives = 97/139 (70%), Gaps = 6/139 (4%)
 Frame = +2

Query  551  EDSSFNQDVI-DAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHD  727
            E  ++++++I +A+E  MKK A+NL+  L+ +S RLSQLELYCY L++SIGE+RSD++  
Sbjct  45   EQETYSREIITEAIENCMKKQAENLVNTLDVISGRLSQLELYCYKLERSIGELRSDVMDY  104

Query  728  HGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQL-----AQKESGSANNSQ  892
            HGE +   + LEKH++EV +SVQ+L+DKQ+LA+ QKEL KLQ+     AQK  G+A +  
Sbjct  105  HGEANVNFRCLEKHVKEVQKSVQVLQDKQDLAETQKELNKLQILHEESAQKSEGTAPSVF  164

Query  893  QNEERASQPASDTKRSDSP  949
              E   S PA+  + +  P
Sbjct  165  MKEIEGSMPAAKPELALVP  183



>ref|XP_002440244.1| hypothetical protein SORBIDRAFT_09g028390 [Sorghum bicolor]
 gb|EES18674.1| hypothetical protein SORBIDRAFT_09g028390 [Sorghum bicolor]
Length=519

 Score =   118 bits (296),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 80/107 (75%), Gaps = 5/107 (5%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  754
            V DA+E  MKK ADNL+  LE +S RLSQLELYCY L++SIGE+RSD++  H E +   +
Sbjct  59   VTDAIESCMKKQADNLLNSLEVISGRLSQLELYCYKLERSIGELRSDVMDYHNEANLNFQ  118

Query  755  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQL-----AQKESGSA  880
             LEK ++EV +SVQ++++KQELA+ QKE++KLQ+     AQK  G+A
Sbjct  119  CLEKQVKEVQKSVQVVQEKQELAETQKEMSKLQVVHEDSAQKSEGTA  165



>ref|XP_004961233.1| PREDICTED: adenylate cyclase, terminal-differentiation specific-like 
isoform X2 [Setaria italica]
 ref|XP_004961234.1| PREDICTED: adenylate cyclase, terminal-differentiation specific-like 
isoform X3 [Setaria italica]
Length=484

 Score =   117 bits (294),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 79/107 (74%), Gaps = 5/107 (5%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  754
            V +A+E  MKK ADNL+  LE +S RLSQLELYCY L++SIGE+RSD++  H E     +
Sbjct  17   VTEAIENCMKKQADNLLNSLEVISGRLSQLELYCYKLERSIGELRSDVMDYHSEASLNYR  76

Query  755  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQL-----AQKESGSA  880
             LEKH++EV +SVQ+L++KQELA+  KE++KLQ+     AQK  G+A
Sbjct  77   CLEKHVKEVQQSVQVLQEKQELAETPKEMSKLQIVHEDSAQKSEGTA  123



>ref|XP_004961232.1| PREDICTED: adenylate cyclase, terminal-differentiation specific-like 
isoform X1 [Setaria italica]
Length=526

 Score =   117 bits (293),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 79/107 (74%), Gaps = 5/107 (5%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  754
            V +A+E  MKK ADNL+  LE +S RLSQLELYCY L++SIGE+RSD++  H E     +
Sbjct  59   VTEAIENCMKKQADNLLNSLEVISGRLSQLELYCYKLERSIGELRSDVMDYHSEASLNYR  118

Query  755  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQL-----AQKESGSA  880
             LEKH++EV +SVQ+L++KQELA+  KE++KLQ+     AQK  G+A
Sbjct  119  CLEKHVKEVQQSVQVLQEKQELAETPKEMSKLQIVHEDSAQKSEGTA  165



>tpg|DAA58178.1| TPA: putative DUF1421 domain family protein [Zea mays]
Length=495

 Score =   115 bits (289),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/153 (41%), Positives = 96/153 (63%), Gaps = 7/153 (5%)
 Frame = +2

Query  545  PPEDSSF--NQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDL  718
            PP    F   + V+ AVE+ M+K AD L+  L+G+  RLSQLELYCY L++SIGE+RSD+
Sbjct  13   PPHQDGFYPKEAVMAAVEECMRKQADALLHSLDGIGGRLSQLELYCYKLERSIGELRSDV  72

Query  719  VHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQN  898
            +  H E+ +  + ++K+L +VH+S+Q+L+D+Q+LA+  KEL+KLQ+A +       S Q 
Sbjct  73   MDYHSESTTNFRCIDKNLGQVHKSLQVLQDRQDLAETPKELSKLQIAHEAP-----SHQK  127

Query  899  EERASQPASDTKRSDSPCELHGQQLALALPHQV  997
             E    P    + +D   +    ++AL   HQV
Sbjct  128  GEATGFPMLAPRENDHITQAPKHEVALLRLHQV  160



>gb|AFW79145.1| putative DUF1421 domain family protein [Zea mays]
Length=521

 Score =   115 bits (289),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  754
            V DA+E  MKK ADNL+  LE +S RLSQLELYCY L++SIGE+RSD++  H E +   +
Sbjct  56   VTDAIESCMKKQADNLLNSLEVISGRLSQLELYCYKLERSIGELRSDVMDYHNEANLNFQ  115

Query  755  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESG  874
             L+K L+EV +SVQ+++++QELA+ QKE+ KLQ+  ++S 
Sbjct  116  CLDKQLKEVQKSVQVVQERQELAETQKEMTKLQIVHEDSA  155



>ref|NP_001143126.1| uncharacterized protein LOC100275604 [Zea mays]
 gb|ACG29188.1| hypothetical protein [Zea mays]
Length=521

 Score =   115 bits (288),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/141 (45%), Positives = 92/141 (65%), Gaps = 15/141 (11%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  754
            V DA+E  MKK ADNL+  LE +S RLSQLELYCY L++SIGE+RSD++  H E +   +
Sbjct  56   VTDAIESCMKKQADNLLNSLEVISGRLSQLELYCYKLERSIGELRSDVMDYHNEANLNFQ  115

Query  755  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERASQPASDTK  934
             L+K ++EV +SVQ+++++QELA+ QKE+ KLQ+  ++S       Q  ER+S P+    
Sbjct  116  CLDKQVKEVQKSVQVVQERQELAETQKEMTKLQIVHEDSA------QKSERSS-PSVFIN  168

Query  935  RSDSPCELHGQQLALALPHQV  997
            R +        ++AL   HQV
Sbjct  169  REN--------EIALVPLHQV  181



>gb|ACN33301.1| unknown [Zea mays]
 tpg|DAA58175.1| TPA: putative DUF1421 domain family protein [Zea mays]
Length=534

 Score =   115 bits (289),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/153 (41%), Positives = 96/153 (63%), Gaps = 7/153 (5%)
 Frame = +2

Query  545  PPEDSSF--NQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDL  718
            PP    F   + V+ AVE+ M+K AD L+  L+G+  RLSQLELYCY L++SIGE+RSD+
Sbjct  52   PPHQDGFYPKEAVMAAVEECMRKQADALLHSLDGIGGRLSQLELYCYKLERSIGELRSDV  111

Query  719  VHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQN  898
            +  H E+ +  + ++K+L +VH+S+Q+L+D+Q+LA+  KEL+KLQ+A +       S Q 
Sbjct  112  MDYHSESTTNFRCIDKNLGQVHKSLQVLQDRQDLAETPKELSKLQIAHEAP-----SHQK  166

Query  899  EERASQPASDTKRSDSPCELHGQQLALALPHQV  997
             E    P    + +D   +    ++AL   HQV
Sbjct  167  GEATGFPMLAPRENDHITQAPKHEVALLRLHQV  199



>ref|XP_006644504.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15-like [Oryza brachyantha]
Length=477

 Score =   114 bits (285),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 74/102 (73%), Gaps = 0/102 (0%)
 Frame = +2

Query  578  IDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLKS  757
            + AVE+ MKK A+ L+  LEG+  RLSQLELYCY L++SIGE+RSD++  H E     + 
Sbjct  1    MAAVEECMKKQAEGLLHLLEGIGGRLSQLELYCYKLERSIGELRSDVMDYHSEGTVNFRC  60

Query  758  LEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSAN  883
            LEK+L++V +SVQ+L+DK ELA+  KEL+KLQ+A +     N
Sbjct  61   LEKNLRQVQKSVQVLQDKHELAETPKELSKLQIAHEFPARVN  102



>ref|NP_001266367.1| uncharacterized protein LOC101202710 [Zea mays]
 gb|ACN35148.1| unknown [Zea mays]
Length=531

 Score =   114 bits (286),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 80/107 (75%), Gaps = 2/107 (2%)
 Frame = +2

Query  545  PPEDSSF--NQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDL  718
            PP    F   + V+ AVE+ M+K AD L+  L+G+  RLSQLELYCY L++SIGE+RSD+
Sbjct  49   PPHQDGFYPKEAVMAAVEECMRKQADALLHSLDGIGGRLSQLELYCYKLERSIGELRSDV  108

Query  719  VHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLA  859
            +  H E+ +  + ++K+L +VH+S+Q+L+D+Q+LA+  KEL+KLQ+A
Sbjct  109  MDYHSESTTNFRCIDKNLGQVHKSLQVLQDRQDLAETPKELSKLQIA  155



>ref|XP_002458299.1| hypothetical protein SORBIDRAFT_03g030820 [Sorghum bicolor]
 gb|EES03419.1| hypothetical protein SORBIDRAFT_03g030820 [Sorghum bicolor]
Length=538

 Score =   113 bits (283),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  754
            V+ AVE+ M+K AD L+  L+G+  RLSQLELYCY L++SIGE+RSD++  HG++ +  +
Sbjct  67   VMAAVEECMRKQADALLHSLDGIGGRLSQLELYCYKLERSIGELRSDVMDYHGDSTANFR  126

Query  755  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKES  871
             ++K+L++VH+S+Q+L+D+Q+LA+  +EL+KLQ+A + +
Sbjct  127  CIDKNLRQVHKSLQVLQDRQDLAETPRELSKLQIAHEAA  165



>ref|XP_008654665.1| PREDICTED: putative DUF1421 domain family protein isoform X2 
[Zea mays]
Length=495

 Score =   112 bits (280),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 80/115 (70%), Gaps = 5/115 (4%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  754
            V  A+E  MKK ADNL+  L+ +S RLSQLELYCY L++SIGE+RSD++  H E +   +
Sbjct  36   VTHAIESCMKKQADNLLNSLDVISGRLSQLELYCYRLERSIGELRSDVMDYHNEANLNFR  95

Query  755  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQL-----AQKESGSANNSQQNEE  904
             +EK ++EV +SVQ +++KQELA+ QKE+ KLQ+     AQK  G+A +   N E
Sbjct  96   CVEKQVKEVQKSVQAVQEKQELAETQKEMTKLQIVHEDSAQKSEGTAPSVFMNRE  150



>ref|XP_003567907.1| PREDICTED: transcriptional regulator DEF1-like [Brachypodium 
distachyon]
Length=536

 Score =   112 bits (281),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 88/141 (62%), Gaps = 6/141 (4%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  754
            + +A+E  MKK A+NL+  L+ +S RLSQLELYCY L++SIGE+RSD++  H E +    
Sbjct  57   ITEAIEDCMKKQAENLVNSLDVISGRLSQLELYCYKLERSIGELRSDVMDYHSEANLNFN  116

Query  755  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERASQPASDTK  934
             LEK+++EV  SVQ+L+DKQELA+ Q +LA+LQ+  +E        Q  E  +       
Sbjct  117  CLEKNMKEVQTSVQVLQDKQELAETQNKLARLQMVYEEPA------QKSEGTAPSVFMAN  170

Query  935  RSDSPCELHGQQLALALPHQV  997
             +DS   +   +LAL   HQV
Sbjct  171  ENDSSFPVAKHELALVPVHQV  191



>ref|NP_001142422.1| putative DUF1421 domain family protein [Zea mays]
 gb|ACF88458.1| unknown [Zea mays]
 gb|ACN25356.1| unknown [Zea mays]
 gb|AFW81113.1| putative DUF1421 domain family protein [Zea mays]
Length=518

 Score =   112 bits (281),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 80/115 (70%), Gaps = 5/115 (4%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  754
            V  A+E  MKK ADNL+  L+ +S RLSQLELYCY L++SIGE+RSD++  H E +   +
Sbjct  59   VTHAIESCMKKQADNLLNSLDVISGRLSQLELYCYRLERSIGELRSDVMDYHNEANLNFR  118

Query  755  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQL-----AQKESGSANNSQQNEE  904
             +EK ++EV +SVQ +++KQELA+ QKE+ KLQ+     AQK  G+A +   N E
Sbjct  119  CVEKQVKEVQKSVQAVQEKQELAETQKEMTKLQIVHEDSAQKSEGTAPSVFMNRE  173



>ref|XP_008654664.1| PREDICTED: putative DUF1421 domain family protein isoform X1 
[Zea mays]
Length=539

 Score =   112 bits (280),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 80/115 (70%), Gaps = 5/115 (4%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  754
            V  A+E  MKK ADNL+  L+ +S RLSQLELYCY L++SIGE+RSD++  H E +   +
Sbjct  80   VTHAIESCMKKQADNLLNSLDVISGRLSQLELYCYRLERSIGELRSDVMDYHNEANLNFR  139

Query  755  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQL-----AQKESGSANNSQQNEE  904
             +EK ++EV +SVQ +++KQELA+ QKE+ KLQ+     AQK  G+A +   N E
Sbjct  140  CVEKQVKEVQKSVQAVQEKQELAETQKEMTKLQIVHEDSAQKSEGTAPSVFMNRE  194



>ref|XP_010232129.1| PREDICTED: uncharacterized protein LOC100831431 [Brachypodium 
distachyon]
Length=538

 Score =   112 bits (280),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 75/105 (71%), Gaps = 0/105 (0%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  754
            V+ AVE+ MKK AD L+  LEG+  RLSQLELYCY L++SIGE+RSD++  H E     +
Sbjct  61   VMAAVEECMKKQADGLLHSLEGIGGRLSQLELYCYKLERSIGELRSDVMDYHSEATVNFR  120

Query  755  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNS  889
             L+K++++V ++VQ+L+DK E AD  ++LAKLQ+A +     N +
Sbjct  121  CLDKNIRQVQKAVQMLQDKHEFADTAQQLAKLQMAHEFPARTNGA  165



>ref|XP_008666394.1| PREDICTED: putative mediator of RNA polymerase II transcription 
subunit 26 [Zea mays]
Length=340

 Score =   109 bits (273),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 80/115 (70%), Gaps = 5/115 (4%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  754
            V  A+E  MKK ADNL+  L+ ++ RLSQLELYCY L++SIGE+RSD++  H E +   +
Sbjct  45   VTHAIESCMKKQADNLLNSLDVINGRLSQLELYCYILERSIGELRSDVMDYHNEANLNFR  104

Query  755  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQL-----AQKESGSANNSQQNEE  904
             +EK ++EV +SVQ +++KQELA+ QKEL KLQ+     AQK  G+A +   N E
Sbjct  105  CVEKQVKEVQKSVQAVQEKQELAETQKELTKLQIVHEDSAQKSEGTAPSVFMNRE  159



>gb|EMS64546.1| hypothetical protein TRIUR3_27252 [Triticum urartu]
Length=656

 Score =   112 bits (281),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 82/115 (71%), Gaps = 5/115 (4%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  730
            +D+   + + +A+E  M K A+NL+  L+ +S RLSQLELYCY L++SIGE+RSD++  H
Sbjct  176  QDNHSKEIITEAIESCMNKQAENLVNSLDVISGRLSQLELYCYKLERSIGELRSDVMDYH  235

Query  731  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQL-----AQKESGSA  880
             E +    SL+K+++EV + VQ+L+DKQELA+ Q ELAKLQ+     AQK  G+A
Sbjct  236  SEANLNFHSLDKNVKEVQKCVQVLQDKQELAETQNELAKLQIVYEDPAQKSEGTA  290



>gb|EAY75332.1| hypothetical protein OsI_03225 [Oryza sativa Indica Group]
Length=540

 Score =   111 bits (278),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 78/111 (70%), Gaps = 0/111 (0%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  730
            ++S   + V+ AVE+ MKK A+ L+  LEG+  RLSQLELYCY L++SIGE+RSD++  H
Sbjct  56   QESYTKEAVMAAVEECMKKQAEGLLHSLEGIGGRLSQLELYCYKLERSIGELRSDVMDYH  115

Query  731  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSAN  883
             E     + LEK+L++V +SVQIL+DK E+++   E +KLQ+A +    AN
Sbjct  116  SEGTVNFRCLEKNLRQVQKSVQILQDKHEISETPNEFSKLQIAHEFPARAN  166



>ref|XP_004960805.1| PREDICTED: protein diaphanous homolog 1-like [Setaria italica]
Length=568

 Score =   111 bits (278),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 77/106 (73%), Gaps = 0/106 (0%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  730
            E S+F+   I  ++++MKKYADNL+  LEG+SSRLSQLE   Y+L+ S+GE++  + +++
Sbjct  118  ERSNFSAVTIVDIDRTMKKYADNLLHALEGVSSRLSQLEDRTYHLENSVGELKLTIGNNN  177

Query  731  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKE  868
            G TD KL+  E  L+EV   VQILRDKQE+ + Q +LAKLQ+ + E
Sbjct  178  GSTDGKLRQFENTLREVQAGVQILRDKQEIVETQIQLAKLQVPKAE  223



>gb|EAZ13051.1| hypothetical protein OsJ_02970 [Oryza sativa Japonica Group]
Length=540

 Score =   111 bits (278),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 74/103 (72%), Gaps = 0/103 (0%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  754
            V+ AVE+ MKK A+ L+  LEG+  RLSQLELYCY L++SIGE+RSD++  H E     +
Sbjct  64   VMAAVEECMKKQAEGLLHSLEGIGGRLSQLELYCYKLERSIGELRSDVMDYHSEGTVNFR  123

Query  755  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSAN  883
             LEK+L++V +SVQIL+DK E+++   E +KLQ+A +    AN
Sbjct  124  CLEKNLRQVQKSVQILQDKHEISETPNEFSKLQIAHEFPARAN  166



>dbj|BAJ85240.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=575

 Score =   111 bits (278),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 78/107 (73%), Gaps = 5/107 (5%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  754
            + +A+E  M K A+NL+  L+ +S RLSQLELYCY L++SIGE+RSD++  H E +   +
Sbjct  102  ITEAIESCMNKQAENLVNSLDVISGRLSQLELYCYKLERSIGELRSDVMDYHSEANLNFR  161

Query  755  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQL-----AQKESGSA  880
             L+K+++EV + VQ+L+DKQELA+ Q +LAKLQ+     AQK  G+A
Sbjct  162  GLDKNVKEVQKCVQVLQDKQELAETQNDLAKLQIAYEDPAQKSEGTA  208



>ref|XP_003568842.1| PREDICTED: zyxin-like [Brachypodium distachyon]
Length=573

 Score =   110 bits (275),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 78/107 (73%), Gaps = 0/107 (0%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  730
            E S+FN   I  ++++MKKYADNL+  LEG+SSRLSQLE   ++L+ S+GE++  + + +
Sbjct  132  ERSNFNAVTIADIDRTMKKYADNLLNALEGVSSRLSQLEGRTHHLEDSVGELKLTIGNSN  191

Query  731  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKES  871
            G TD KL+  E  L+EV   VQILRDKQE+ + Q +L+KLQ+ ++E+
Sbjct  192  GSTDGKLRQFENTLREVQAGVQILRDKQEIVETQIQLSKLQVFKEEN  238



>gb|EMT01630.1| hypothetical protein F775_09697 [Aegilops tauschii]
Length=574

 Score =   110 bits (274),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 80/113 (71%), Gaps = 0/113 (0%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  730
            E S+FN   I  ++++MKKYADNL+  +EG+SSRL+QLE   ++L+ S+GE++  + + +
Sbjct  125  ERSNFNAVTIADIDRTMKKYADNLLHAMEGVSSRLAQLEGRTHHLEDSVGELKLTVGNYN  184

Query  731  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNS  889
            G TD KL+  E  L+EV   VQILRDKQE+ +AQ +L KLQ+++ E   + N+
Sbjct  185  GSTDGKLRQFENTLREVQAGVQILRDKQEIVEAQVQLTKLQVSKAEDVESENA  237



>ref|XP_002440684.1| hypothetical protein SORBIDRAFT_09g005090 [Sorghum bicolor]
 gb|EES19114.1| hypothetical protein SORBIDRAFT_09g005090 [Sorghum bicolor]
Length=582

 Score =   110 bits (274),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 81/120 (68%), Gaps = 5/120 (4%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  730
            E S+F+   I  ++++MKKYADNL+  LE +SSRLSQLE   Y+L+ S+GE++  + +++
Sbjct  133  ERSNFSAVTIADIDRTMKKYADNLLHALESVSSRLSQLEDRTYHLENSVGELKLTIGNNN  192

Query  731  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQL-----AQKESGSANNSQQ  895
            G TD KL+  E  L+EV   VQILRDKQE+ + Q +LAKLQ+      Q E+G  +  QQ
Sbjct  193  GSTDGKLRQFENTLREVQAGVQILRDKQEIVETQIQLAKLQMPKAEDVQSEAGQVDTMQQ  252



>dbj|BAK01901.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=571

 Score =   109 bits (273),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 80/113 (71%), Gaps = 0/113 (0%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  730
            E S+FN   I  ++++MKKYADNL+  LEG+SSRL+QLE   ++L+ S+GE++  + + +
Sbjct  123  ERSNFNAVTIADIDRTMKKYADNLLHALEGVSSRLAQLEGRTHHLEDSVGELKLTVGNYN  182

Query  731  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNS  889
            G TD KL+  E  L+EV   VQILRDKQE+ +AQ +L KLQ+++ E   + N+
Sbjct  183  GSTDGKLRQFENTLREVQAGVQILRDKQEIVEAQVQLTKLQVSKAEDVESENA  235



>tpg|DAA47389.1| TPA: hypothetical protein ZEAMMB73_495059 [Zea mays]
Length=274

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 78/111 (70%), Gaps = 9/111 (8%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  754
            V  A+E  MKK ADNL+  L+ ++ RLSQLELYCY L++SIGE+RSD++  H E +   +
Sbjct  127  VTHAIESCMKKQADNLLNSLDVINGRLSQLELYCYILERSIGELRSDVMDYHNEANLNFR  186

Query  755  SLEKHLQEVH----RSVQILRDKQELADAQKELAKLQL-----AQKESGSA  880
             +EK ++E+H    +SVQ +++KQELA+ QKEL KLQ+     AQK  G+A
Sbjct  187  CVEKQVKEIHGQVQKSVQAVQEKQELAETQKELTKLQIVHEDSAQKSEGTA  237



>dbj|BAJ94416.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=536

 Score =   107 bits (267),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 74/103 (72%), Gaps = 0/103 (0%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  754
            V+ AVE+ M+K A+ L+  LEG+  RLSQLELYCY L++SIGE+RSD++  H E     +
Sbjct  61   VMAAVEECMRKQAEGLLHSLEGIGGRLSQLELYCYKLERSIGELRSDVMDYHSEGTVNFR  120

Query  755  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSAN  883
             L+K+L++V ++VQ+L+DK E AD  ++LAKLQ+A +     N
Sbjct  121  CLDKNLRQVQKAVQMLQDKHEPADTAQQLAKLQIAHEFPARTN  163



>gb|EMS54596.1| Tryptophan aminotransferase 1 [Triticum urartu]
Length=891

 Score =   108 bits (269),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 85/126 (67%), Gaps = 2/126 (2%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  730
            E S+FN   I  ++++MKKYADNL+  +EG+SSRL+QLE   ++L+ S+GE++  + + +
Sbjct  89   ERSNFNAVTIADIDRTMKKYADNLLHAMEGVSSRLAQLEGRTHHLEDSVGELKLTVGNYN  148

Query  731  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQ--QNEE  904
            G TD KL+  E  L+EV   VQILRDKQE+ +AQ +L KLQ+++ E   + N+   Q + 
Sbjct  149  GSTDGKLRQFENTLREVQAGVQILRDKQEIVEAQVQLTKLQVSKAEDVVSENASAGQVDS  208

Query  905  RASQPA  922
            R   PA
Sbjct  209  RQQPPA  214



>emb|CDM83294.1| unnamed protein product [Triticum aestivum]
Length=475

 Score =   106 bits (264),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 73/102 (72%), Gaps = 0/102 (0%)
 Frame = +2

Query  578  IDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLKS  757
            + AVE+ M+K A+ L+  LEG+  RLSQLELYCY L++SIGE+RSD++  H E     + 
Sbjct  1    MAAVEECMRKQAEGLLHSLEGIGGRLSQLELYCYKLERSIGELRSDVMDYHSEGTVNFRC  60

Query  758  LEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSAN  883
            L+K+L++V ++VQ+L+DK E AD  ++LAKLQ+A +     N
Sbjct  61   LDKNLRQVQKAVQMLQDKHEPADTAQQLAKLQIAHEFPARTN  102



>ref|XP_008656735.1| PREDICTED: chromatin modification-related protein eaf-1-like 
isoform X2 [Zea mays]
Length=682

 Score =   107 bits (267),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  754
            V+ AVE+  +K AD L+  L  +  RLSQLELYCY L++SIGE+RSD++  H ++++  K
Sbjct  184  VVAAVEECTRKQADALLHSLGAIGGRLSQLELYCYKLERSIGELRSDVMDYHSDSNANFK  243

Query  755  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQK  865
             ++++L++VH+S+Q+L+D+Q+LA+  KEL+KLQ+A +
Sbjct  244  CIDRNLRQVHKSLQLLQDRQDLAETAKELSKLQIAHE  280



>gb|KJB77267.1| hypothetical protein B456_012G128800 [Gossypium raimondii]
Length=419

 Score =   105 bits (262),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 76/170 (45%), Positives = 98/170 (58%), Gaps = 39/170 (23%)
 Frame = +2

Query  767   HLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERASQPASDTKRSDS  946
             ++Q VHRSVQILRDKQELA+ QKELAKLQLAQKES S+++SQ  EERAS PASD+K++D 
Sbjct  15    YIQGVHRSVQILRDKQELAETQKELAKLQLAQKESSSSSHSQSTEERASPPASDSKKTDH  74

Query  947   PCELHGQQLALALPHQVAPPQTSHTTRHMEqpqqpsvppipsqviTQSQGYYLSPTQM--  1120
               E+  QQLALALPHQVA PQ      H + P Q              Q YY+   Q+  
Sbjct  75    TSEMQNQQLALALPHQVA-PQQQPVVPHSQSPPQNLTQ----------QSYYIPSNQLSN  123

Query  1121  -----PL---------------------SQGQYMPSESQYRTPQMQEVAR  1192
                  P+                     +Q QY+P + Q++ P +Q+V+R
Sbjct  124   PHAPAPVHVPAPTTPAPPPLPAPAPTPHTQSQYLPPDPQFQAPHIQDVSR  173



>gb|ADE75761.1| unknown [Picea sitchensis]
Length=534

 Score =   105 bits (263),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 71/99 (72%), Gaps = 0/99 (0%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  754
             ++AVE+ MK+Y DNL+  LEG+S RLS LE    +L+ S+GE++  + ++HG TD KL+
Sbjct  101  TVEAVERIMKQYIDNLLHALEGISRRLSHLESTTRHLETSLGELKMTVDNNHGATDGKLR  160

Query  755  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKES  871
             LE H +EV   VQILRDKQE+A+A  +L KLQL++  S
Sbjct  161  LLENHTREVQTGVQILRDKQEIAEAHSQLMKLQLSKSNS  199



>emb|CBI34879.3| unnamed protein product [Vitis vinifera]
Length=465

 Score =   104 bits (259),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 87/134 (65%), Gaps = 0/134 (0%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  730
            +D + +  ++  ++++MKK+ADNL+  LEGLS+RL+QLE    NL+ S+ +++  + ++H
Sbjct  112  KDRNIDAAIVSEIDRTMKKHADNLLHVLEGLSARLTQLESRTRNLENSVDDLKVSVGNNH  171

Query  731  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERA  910
            G  D K++ LE  L+EV   VQ+LRDKQE+ +A  +LAKLQ+++ +  S   +    + A
Sbjct  172  GSADGKMRQLENILREVQTGVQVLRDKQEIVEAHLQLAKLQVSKADQQSETQNTVTLDSA  231

Query  911  SQPASDTKRSDSPC  952
             Q AS  ++S  P 
Sbjct  232  KQAASPPQQSHQPL  245



>ref|XP_002275607.1| PREDICTED: protein enabled [Vitis vinifera]
Length=563

 Score =   104 bits (260),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 87/134 (65%), Gaps = 0/134 (0%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  730
            +D + +  ++  ++++MKK+ADNL+  LEGLS+RL+QLE    NL+ S+ +++  + ++H
Sbjct  112  KDRNIDAAIVSEIDRTMKKHADNLLHVLEGLSARLTQLESRTRNLENSVDDLKVSVGNNH  171

Query  731  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERA  910
            G  D K++ LE  L+EV   VQ+LRDKQE+ +A  +LAKLQ+++ +  S   +    + A
Sbjct  172  GSADGKMRQLENILREVQTGVQVLRDKQEIVEAHLQLAKLQVSKADQQSETQNTVTLDSA  231

Query  911  SQPASDTKRSDSPC  952
             Q AS  ++S  P 
Sbjct  232  KQAASPPQQSHQPL  245



>ref|XP_006655038.1| PREDICTED: vegetative cell wall protein gp1-like, partial [Oryza 
brachyantha]
Length=495

 Score =   104 bits (259),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 79/113 (70%), Gaps = 0/113 (0%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  730
            E S+ +   I  ++++MKKYADNL+  LEG+SSRLSQLE   ++L+ S+GE++  + + +
Sbjct  47   ERSNLSAVSIADIDRTMKKYADNLLHALEGVSSRLSQLEGRTHHLENSVGELKLTIGNYN  106

Query  731  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNS  889
            G TD KL+  E  L+EV   VQILRDKQE+ + Q +L+KLQ+++ E   + N+
Sbjct  107  GSTDGKLRQFENTLREVQAGVQILRDKQEIMETQVQLSKLQVSKAEDAQSENA  159



>ref|XP_008801947.1| PREDICTED: arginine-glutamic acid dipeptide repeats protein [Phoenix 
dactylifera]
Length=539

 Score =   104 bits (259),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 77/108 (71%), Gaps = 0/108 (0%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  730
            E  +++   +  +++++KKYADNL+  LEG+SSRLSQLE     L+ S+ E++  + ++H
Sbjct  99   ERDAYDVAAVAEIDRTVKKYADNLLHALEGVSSRLSQLESRTRYLESSVDELKVSVGNNH  158

Query  731  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESG  874
            G TD KL+ LE  L+EV   VQ+LRDKQ++A+AQ +LAKLQ ++ E G
Sbjct  159  GSTDGKLRQLENILREVQTGVQVLRDKQDIAEAQLQLAKLQASKSEQG  206



>dbj|BAK07367.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=595

 Score =   103 bits (258),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 77/111 (69%), Gaps = 0/111 (0%)
 Frame = +2

Query  557  SSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGE  736
            S+F    I  ++++MKKY+DNL+  LEG+SSRLSQLE   ++L+ S+ E +  + + +G 
Sbjct  123  SNFGLVTIADIDRTMKKYSDNLLYALEGVSSRLSQLEGRTHHLESSVDEFKLTIGNYNGS  182

Query  737  TDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNS  889
            TD KL+ LE  L+EV   VQI+RDKQE+ + Q  LAKLQ+ + E+ S+ NS
Sbjct  183  TDGKLRQLENMLREVQAGVQIMRDKQEIVETQLHLAKLQIPKNETQSSENS  233



>ref|NP_001140648.1| uncharacterized protein LOC100272723 [Zea mays]
 gb|ACF84264.1| unknown [Zea mays]
 tpg|DAA53270.1| TPA: putative DUF1421 domain family protein [Zea mays]
Length=568

 Score =   103 bits (258),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 77/111 (69%), Gaps = 0/111 (0%)
 Frame = +2

Query  557  SSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGE  736
            S+F    I  ++++MKKY+DNL+  LEG+SSRLSQ+E   + L+ S+ E++  + + +G 
Sbjct  133  SNFPTVTIADIDRTMKKYSDNLLHALEGVSSRLSQMEGRTHQLENSVDELKLTIGNYNGS  192

Query  737  TDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNS  889
            TD KL+ LE  L+EV   VQILRDKQE+ +AQ  LAKLQ  + ++ S+ NS
Sbjct  193  TDGKLRHLENMLREVQAGVQILRDKQEIVEAQLHLAKLQTTKTDAHSSENS  243



>emb|CDM81418.1| unnamed protein product [Triticum aestivum]
Length=603

 Score =   103 bits (256),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 77/111 (69%), Gaps = 0/111 (0%)
 Frame = +2

Query  557  SSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGE  736
            S+F    I  ++++MKKY+DNL+  LEG+SSRLSQLE   ++L+ S+ E +  + + +G 
Sbjct  131  SNFGLVTIADIDRTMKKYSDNLLYALEGVSSRLSQLEGRTHHLESSVDEFKLTIGNYNGS  190

Query  737  TDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNS  889
            TD KL+ LE  L+E+   VQI+RDKQE+ + Q  LAKLQ+ + E+ S+ NS
Sbjct  191  TDGKLRQLENMLREIQAGVQIMRDKQEIVEMQLHLAKLQIPKTETQSSENS  241



>gb|EMS67668.1| hypothetical protein TRIUR3_30524 [Triticum urartu]
Length=566

 Score =   102 bits (255),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 77/111 (69%), Gaps = 0/111 (0%)
 Frame = +2

Query  557  SSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGE  736
            S+F    I  ++++MKKY+DNL+  LEG+SSRLSQLE   ++L+ S+ + +  + + +G 
Sbjct  94   SNFGLVTIADIDRTMKKYSDNLLYALEGVSSRLSQLEGRTHHLESSVDDFKLTIGNFNGS  153

Query  737  TDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNS  889
            TD KL+ LE  L+EV   VQI+RDKQE+ + Q  LAKLQ+ + E+ S+ NS
Sbjct  154  TDGKLRQLENMLREVQAGVQIMRDKQEIVETQLHLAKLQIPKTETQSSENS  204



>gb|AFW80147.1| putative DUF1421 domain family protein [Zea mays]
Length=563

 Score =   102 bits (254),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 77/113 (68%), Gaps = 0/113 (0%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  730
            + S+F    I  ++++MKKY+DNL+  LEG+SSRLSQ+E   + L+ S+ E++  + + +
Sbjct  123  DKSNFPTVTIADIDRTMKKYSDNLLHALEGVSSRLSQMEGRTHQLENSVDELKLTIGNYN  182

Query  731  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNS  889
            G TD KL++LE  L+EV   VQILRDKQE+ + Q  LAKLQ  + +  S+ NS
Sbjct  183  GSTDGKLRNLENMLREVQAGVQILRDKQEIVETQLHLAKLQTNKTDGQSSENS  235



>ref|NP_001054762.2| Os05g0169400 [Oryza sativa Japonica Group]
 dbj|BAF16676.2| Os05g0169400, partial [Oryza sativa Japonica Group]
Length=536

 Score =   102 bits (254),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 75/106 (71%), Gaps = 0/106 (0%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  730
            E  +F+   I  ++++MKKYADNL+  LE +SSRLSQLE   ++L+ S+GE++  + + +
Sbjct  90   ERGNFSAVSIADIDRTMKKYADNLLHALESVSSRLSQLEGRTHHLENSVGELKLIIGNYN  149

Query  731  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKE  868
            G TD KL+  E  L+EV   VQILRDKQE+ + Q +L+KLQL++ E
Sbjct  150  GSTDGKLRQFENTLREVQAGVQILRDKQEIVETQVQLSKLQLSKAE  195



>ref|XP_008784980.1| PREDICTED: uncharacterized protein LOC103703781 [Phoenix dactylifera]
Length=875

 Score =   103 bits (256),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 52/127 (41%), Positives = 84/127 (66%), Gaps = 0/127 (0%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  730
            E S+++   +  +++++KKYADNL+R LEG+SSRL QLE   ++L+ S+ E++  + +  
Sbjct  104  EKSAYDAATVAEIDRTVKKYADNLLRTLEGVSSRLMQLESRTHHLESSVDELKVTIGNSS  163

Query  731  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERA  910
            G TD KL+ LE  L EV   VQ+LRDKQE+ +AQ +LA LQ ++ +S    + +Q+ + A
Sbjct  164  GTTDGKLRQLENILTEVQTGVQVLRDKQEIVEAQLQLANLQASKGDSQPQQSVEQSHQHA  223

Query  911  SQPASDT  931
              P+  T
Sbjct  224  VPPSQPT  230



>emb|CAN60421.1| hypothetical protein VITISV_021069 [Vitis vinifera]
Length=604

 Score =   102 bits (254),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 85/134 (63%), Gaps = 0/134 (0%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  730
            +D + +  ++  ++++MKK ADNL+  LEGLS+RL+QLE    NL+ S+ +++  + ++H
Sbjct  101  KDRNIDAAIVSEIDRTMKKXADNLLHXLEGLSARLTQLESRTRNLENSVDDLKVSVGNNH  160

Query  731  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERA  910
            G  D K++ LE  L+EV   VQ+LRDKQE+ +A  +LAKLQ+++ +  S        + A
Sbjct  161  GSADGKMRQLENILREVQTGVQVLRDKQEIVEAHLQLAKLQVSKADQQSETQKTVTLDSA  220

Query  911  SQPASDTKRSDSPC  952
             Q AS  ++S  P 
Sbjct  221  KQAASPPQQSHQPL  234



>gb|EAY96697.1| hypothetical protein OsI_18619 [Oryza sativa Indica Group]
 gb|EEE62479.1| hypothetical protein OsJ_17276 [Oryza sativa Japonica Group]
Length=574

 Score =   101 bits (252),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 75/106 (71%), Gaps = 0/106 (0%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  730
            E  +F+   I  ++++MKKYADNL+  LE +SSRLSQLE   ++L+ S+GE++  + + +
Sbjct  128  ERGNFSAVSIADIDRTMKKYADNLLHALESVSSRLSQLEGRTHHLENSVGELKLIIGNYN  187

Query  731  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKE  868
            G TD KL+  E  L+EV   VQILRDKQE+ + Q +L+KLQL++ E
Sbjct  188  GSTDGKLRQFENTLREVQAGVQILRDKQEIVETQVQLSKLQLSKAE  233



>ref|XP_010108811.1| hypothetical protein L484_020546 [Morus notabilis]
 gb|EXC20326.1| hypothetical protein L484_020546 [Morus notabilis]
Length=591

 Score =   101 bits (251),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 76/102 (75%), Gaps = 1/102 (1%)
 Frame = +2

Query  557  SSFNQDVIDA-VEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHG  733
            SSF+   I A ++K+MKK+ADNL+  L+G+S+RL+QLE    NL+ S+ +++  + ++HG
Sbjct  127  SSFDSSTIMAEIDKTMKKHADNLLHVLDGVSARLTQLESRTRNLENSVDDLKVSVGNNHG  186

Query  734  ETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLA  859
             TD K++ LE  L+EV   VQ+L+DKQE+ +AQ +LAK+QL+
Sbjct  187  STDGKMRQLENILREVQSGVQVLKDKQEIVEAQLQLAKVQLS  228



>ref|XP_011097415.1| PREDICTED: protein enabled-like [Sesamum indicum]
Length=543

 Score =   100 bits (250),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 75/107 (70%), Gaps = 0/107 (0%)
 Frame = +2

Query  548  PEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHD  727
            P ++S +  ++  ++++MKKYADNLM  L+G+S+RLSQLE    NL+ S+ +++  + ++
Sbjct  120  PVNASLDVSLVSEIDRTMKKYADNLMHTLDGVSARLSQLETRSRNLENSMDDLKESIDNN  179

Query  728  HGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKE  868
             G TD K++ LE  L+EV   VQ++RDKQE+ +AQ  +AKL + + E
Sbjct  180  QGSTDGKIRQLEDILREVQAGVQVIRDKQEVVEAQLHIAKLPIPKVE  226



>ref|NP_001147786.1| LOC100281396 [Zea mays]
 gb|ACG28711.1| proline-rich protein [Zea mays]
Length=563

 Score =   100 bits (249),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 76/113 (67%), Gaps = 0/113 (0%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  730
            + S+F    I  ++++MKKY+DNL+  LEG+SSRLSQ+E   + L+  + E++  + + +
Sbjct  123  DKSNFPTVTIADIDRTMKKYSDNLLHALEGVSSRLSQMEGRTHQLENCVDELKLTIGNYN  182

Query  731  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNS  889
            G TD KL++LE  L+EV   VQILRDKQE+ + Q  LAKLQ  + +  S+ NS
Sbjct  183  GSTDGKLRNLENMLREVQAGVQILRDKQEIVETQLHLAKLQTNKTDGQSSENS  235



>ref|XP_008656734.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15-like isoform X1 [Zea mays]
Length=689

 Score =   100 bits (249),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 56/148 (38%), Positives = 90/148 (61%), Gaps = 12/148 (8%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  754
            V+ AVE+  +K AD L+  L  +  RLSQLELYCY L++SIGE+RSD++  H ++++  K
Sbjct  184  VVAAVEECTRKQADALLHSLGAIGGRLSQLELYCYKLERSIGELRSDVMDYHSDSNANFK  243

Query  755  SLEKHLQ-------EVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERAS  913
             ++++L+       +VH+S+Q+L+D+Q+LA+  KEL+KLQ+A +       SQ   E A 
Sbjct  244  CIDRNLRQIYILGCQVHKSLQLLQDRQDLAETAKELSKLQIAHEAP-----SQTKGEAAG  298

Query  914  QPASDTKRSDSPCELHGQQLALALPHQV  997
             P    + +         ++AL   HQV
Sbjct  299  FPMLAARENGHSTRAPKHEVALLPLHQV  326



>gb|AFW83522.1| putative DUF1421 domain family protein [Zea mays]
Length=578

 Score =   100 bits (248),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 58/161 (36%), Positives = 96/161 (60%), Gaps = 17/161 (11%)
 Frame = +2

Query  536  AYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSD  715
             ++ P+D+     V+ AVE+  +K AD L+  L  +  RLSQLELYCY L++SIGE+RSD
Sbjct  65   GFLYPKDA-----VVAAVEECTRKQADALLHSLGAIGGRLSQLELYCYKLERSIGELRSD  119

Query  716  LVHDHGETDSKLKSLEKHLQ-------EVHRSVQILRDKQELADAQKELAKLQLAQKESG  874
            ++  H ++++  K ++++L+       +VH+S+Q+L+D+Q+LA+  KEL+KLQ+A +   
Sbjct  120  VMDYHSDSNANFKCIDRNLRQIYILGCQVHKSLQLLQDRQDLAETAKELSKLQIAHEAP-  178

Query  875  SANNSQQNEERASQPASDTKRSDSPCELHGQQLALALPHQV  997
                SQ   E A  P    + +         ++AL   HQV
Sbjct  179  ----SQTKGEAAGFPMLAARENGHSTRAPKHEVALLPLHQV  215



>ref|XP_006643803.1| PREDICTED: vegetative cell wall protein gp1-like [Oryza brachyantha]
Length=573

 Score =   100 bits (248),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 75/110 (68%), Gaps = 0/110 (0%)
 Frame = +2

Query  557  SSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGE  736
            S+F    +  ++++MKKY+DNL+  LEG+SSRLSQLE   ++L+ S+ E++  + + +G 
Sbjct  125  SNFGAVTMADIDRTMKKYSDNLLHALEGVSSRLSQLEGQTHHLENSVDELKLTIGNYNGS  184

Query  737  TDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANN  886
            TD KL+ LE  L+EV   VQILRDKQE+ + Q  LAKLQ  + ++ S  N
Sbjct  185  TDGKLRQLENMLREVQAGVQILRDKQEIVETQLHLAKLQPPKSDTPSLEN  234



>ref|XP_011620611.1| PREDICTED: altered inheritance of mitochondria protein 3 [Amborella 
trichopoda]
Length=555

 Score = 99.8 bits (247),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 71/98 (72%), Gaps = 0/98 (0%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  754
            ++  +++++KK+ DNL+  LEG+S+RLSQLE     L+ S+ E++  + + HG TD KL+
Sbjct  94   IVSEIDRTVKKHVDNLLHSLEGVSARLSQLESRTRRLENSVDELKVSVGNSHGSTDGKLR  153

Query  755  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKE  868
             LE  L+EV  SVQ+LRDKQE+A+A  +L KLQL++ E
Sbjct  154  QLENILREVQASVQVLRDKQEIAEAHSQLMKLQLSKSE  191



>ref|XP_002455112.1| hypothetical protein SORBIDRAFT_03g004550 [Sorghum bicolor]
 gb|EES00232.1| hypothetical protein SORBIDRAFT_03g004550 [Sorghum bicolor]
Length=571

 Score = 99.4 bits (246),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 75/111 (68%), Gaps = 0/111 (0%)
 Frame = +2

Query  557  SSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGE  736
            S+F    I  ++++MKKY+DNL+  LEG+SSRLSQ+E   + L+ S+ E++  + + +G 
Sbjct  132  SNFPTVTIADIDRTMKKYSDNLLHALEGVSSRLSQMEGRTHQLENSVDELKLTIGNYNGS  191

Query  737  TDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNS  889
            TD KL+ LE  L+EV   VQI+RDKQE+ + Q  LAKLQ  + ++  + NS
Sbjct  192  TDGKLRHLENMLREVQAGVQIMRDKQEIVETQLHLAKLQTTKADAQLSENS  242



>ref|XP_010248593.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Nelumbo nucifera]
Length=554

 Score = 99.0 bits (245),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 87/134 (65%), Gaps = 5/134 (4%)
 Frame = +2

Query  560  SFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGET  739
            +++   +  +++++KKYADNL+  LEG+S+RL+QLE    +L+ S+ +++  + ++HG T
Sbjct  104  AYDAATVSEIDRTVKKYADNLLHALEGVSARLTQLESRTRHLESSVDDLKLSVGNNHGST  163

Query  740  DSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLA---QKESGSANNSQQNEERA  910
            D KL+ LE  L+EV   VQ+LR+KQE+ + Q + AK Q++   Q+  G  N SQQ+    
Sbjct  164  DGKLRQLENSLREVQTGVQVLREKQEIVETQLQFAKFQVSKGDQQSEGQNNASQQDS--M  221

Query  911  SQPASDTKRSDSPC  952
             Q AS T++S  P 
Sbjct  222  PQTASTTQQSYQPL  235



>ref|XP_002985569.1| hypothetical protein SELMODRAFT_446314 [Selaginella moellendorffii]
 gb|EFJ13443.1| hypothetical protein SELMODRAFT_446314 [Selaginella moellendorffii]
Length=538

 Score = 99.0 bits (245),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 74/108 (69%), Gaps = 6/108 (6%)
 Frame = +2

Query  563  FNQDVID-----AVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHD  727
            F++D  D     AVE++MKKYADNL+R LEG+  RLSQLE     L+ +  + +S   ++
Sbjct  113  FDKDAYDSATAAAVERTMKKYADNLLRVLEGMGGRLSQLEAATQRLEVAFEKSKSANANN  172

Query  728  HGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKES  871
            HGETD +L+ LE  L+EV R VQ++RDKQE+ +AQ +L KLQ  + E+
Sbjct  173  HGETDGRLRMLENMLREVQRGVQVVRDKQEINEAQFQL-KLQQDKTEA  219



>ref|XP_004968338.1| PREDICTED: class E vacuolar protein-sorting machinery protein 
HSE1-like [Setaria italica]
Length=570

 Score = 99.0 bits (245),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 79/120 (66%), Gaps = 0/120 (0%)
 Frame = +2

Query  557  SSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGE  736
            S+F    +  ++++MKKY+DN++  LEG+SSRLSQ+E   + L+ S+ E++  + + +G 
Sbjct  129  SNFTAVTMADIDRTMKKYSDNILHALEGVSSRLSQMESRTHQLENSVDELKLTIGNYNGG  188

Query  737  TDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERASQ  916
            TD KL+ LE  L+EV   VQILRDKQ++ + Q  LAKLQ  + ++ S+ NS   +  + Q
Sbjct  189  TDGKLRHLENMLREVQAGVQILRDKQDIVETQLHLAKLQTPKTDTQSSENSGSGQAASQQ  248



>ref|XP_010033310.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1 [Eucalyptus grandis]
 gb|KCW52919.1| hypothetical protein EUGRSUZ_J02234 [Eucalyptus grandis]
Length=576

 Score = 99.0 bits (245),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 84/118 (71%), Gaps = 6/118 (5%)
 Frame = +2

Query  560  SFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGET  739
            +F+  ++  ++++MKK+AD+L+  LEG+S+RL+QLE    NL+ S+ +++  + +++G T
Sbjct  143  AFDASMVSEIDRTMKKHADSLLHVLEGVSARLTQLESRTRNLENSVDDLKVSVDNNYGTT  202

Query  740  DSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERAS  913
            D K++ LE  L++V   VQ+L+DKQE+ +AQ +LAKLQL++ E       QQ+ ++AS
Sbjct  203  DGKMRQLENILRDVQGGVQVLKDKQEIMEAQYQLAKLQLSKAE------QQQDNQKAS  254



>ref|XP_002987005.1| hypothetical protein SELMODRAFT_425866 [Selaginella moellendorffii]
 gb|EFJ11848.1| hypothetical protein SELMODRAFT_425866 [Selaginella moellendorffii]
Length=548

 Score = 98.6 bits (244),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 74/108 (69%), Gaps = 6/108 (6%)
 Frame = +2

Query  563  FNQDVID-----AVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHD  727
            F++D  D     AVE++MKKYADNL+R LEG+  RLSQLE     L+ +  + +S   ++
Sbjct  113  FDKDAYDSATAAAVERTMKKYADNLLRVLEGMGGRLSQLEAATQRLEVAFEKSKSANANN  172

Query  728  HGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKES  871
            HGETD +L+ LE  L+EV R VQ++RDKQE+ +AQ +L KLQ  + E+
Sbjct  173  HGETDGRLRMLENMLREVQRGVQVVRDKQEINEAQFQL-KLQQDKTEA  219



>ref|XP_010940140.1| PREDICTED: protein diaphanous homolog 1-like [Elaeis guineensis]
Length=549

 Score = 98.6 bits (244),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 77/107 (72%), Gaps = 0/107 (0%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  730
            E S+++   +  V++++KKYADNL+  LEG+SSRL++LE   + L+ S+  ++  + +++
Sbjct  103  EKSAYDAATVAEVDRTVKKYADNLLHALEGVSSRLTELESRAHQLESSVDGLKMMIGNNN  162

Query  731  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKES  871
            G TD KL+ LE  L+EV   VQ+LRDKQE+ +AQ +LAKLQ ++ ++
Sbjct  163  GTTDGKLRQLENVLREVQTGVQVLRDKQEIVEAQLQLAKLQASKGDN  209



>gb|ERM98731.1| hypothetical protein AMTR_s00082p00053170 [Amborella trichopoda]
Length=695

 Score = 99.0 bits (245),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 71/98 (72%), Gaps = 0/98 (0%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  754
            ++  +++++KK+ DNL+  LEG+S+RLSQLE     L+ S+ E++  + + HG TD KL+
Sbjct  94   IVSEIDRTVKKHVDNLLHSLEGVSARLSQLESRTRRLENSVDELKVSVGNSHGSTDGKLR  153

Query  755  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKE  868
             LE  L+EV  SVQ+LRDKQE+A+A  +L KLQL++ E
Sbjct  154  QLENILREVQASVQVLRDKQEIAEAHSQLMKLQLSKSE  191



>ref|XP_004232320.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 2 [Solanum lycopersicum]
Length=545

 Score = 98.2 bits (243),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 86/143 (60%), Gaps = 10/143 (7%)
 Frame = +2

Query  587   VEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEK  766
             ++ ++KKYADNL+  +EG+S+RLSQLE     +D SI E++  + ++HG TD KL+ LE 
Sbjct  124   IDHTVKKYADNLLHAVEGVSARLSQLETRNRQIDNSIDELKLSVGNNHGVTDGKLRQLEN  183

Query  767   HLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERASQPASDTKRSDS  946
              L+EV   VQ++RDKQE+ DAQ +L K Q  + E       QQ E  ++     ++ + +
Sbjct  184   ILREVQDGVQVIRDKQEIMDAQLQLMKSQAPKIE-------QQAETHSTTHTDSSQPTTA  236

Query  947   PCELHGQQLALAL---PHQVAPP  1006
             P   H Q   +AL   P  +APP
Sbjct  237   PLHSHQQFPPVALTQQPSTLAPP  259



>ref|NP_001042136.2| Os01g0169900 [Oryza sativa Japonica Group]
 dbj|BAD68319.1| vegetative cell wall protein gp1 -like [Oryza sativa Japonica 
Group]
 gb|EAY72703.1| hypothetical protein OsI_00570 [Oryza sativa Indica Group]
 gb|EAZ10703.1| hypothetical protein OsJ_00537 [Oryza sativa Japonica Group]
 dbj|BAH00414.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF04050.2| Os01g0169900 [Oryza sativa Japonica Group]
Length=580

 Score = 98.2 bits (243),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 77/110 (70%), Gaps = 0/110 (0%)
 Frame = +2

Query  557  SSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGE  736
            S+F    +  ++++MKKY+DNL+  LEG+SSRLSQLE   ++L+ S+ +++  + + +G 
Sbjct  127  SNFGTVTMADIDRTMKKYSDNLLHALEGVSSRLSQLEGRTHHLENSVDDLKITIGNYNGS  186

Query  737  TDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANN  886
            TD KL+ LE  L+EV   VQILRDKQE+ + Q  LAKLQ  + ++ +++N
Sbjct  187  TDGKLRQLENMLREVQAGVQILRDKQEIVETQLHLAKLQPPKSDALASDN  236



>ref|XP_008795992.1| PREDICTED: protein transport protein SEC31-like [Phoenix dactylifera]
Length=553

 Score = 97.4 bits (241),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 72/101 (71%), Gaps = 0/101 (0%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  730
            E S+++   +  V++++KKYADNL+  LEG+SSRL++LE   + L+ S+  ++  + +++
Sbjct  104  EKSAYDAATVAEVDRTVKKYADNLLHALEGVSSRLTELENRTHQLESSVDGLKVMIGNNN  163

Query  731  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQ  853
            G TD KLK LE  L+EV   VQ+LRDKQE+  AQ +LAKLQ
Sbjct  164  GTTDGKLKQLENILREVQTGVQVLRDKQEIVQAQLQLAKLQ  204



>ref|XP_010230500.1| PREDICTED: uncharacterized protein LOC100838076 [Brachypodium 
distachyon]
Length=961

 Score = 98.2 bits (243),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 88/150 (59%), Gaps = 11/150 (7%)
 Frame = +2

Query  557   SSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGE  736
             S+F Q  +  ++++MKKY+DNL   LEG+SSRL QLE   ++L+ S+ E    + + +G 
Sbjct  122   SNFGQVTVADIDRTMKKYSDNLFHALEGVSSRLLQLERRTHHLENSVDEFNLTIGNYNGS  181

Query  737   TDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERASQ  916
             TD KL+ LE  L+EV   VQI+RDKQE+ +    LAKLQ  + E+ S+ NS   +     
Sbjct  182   TDGKLRQLENMLREVQVGVQIMRDKQEIVETLVNLAKLQAPKTETHSSENSGVGQ-----  236

Query  917   PASDTKRSDSPCELHGQQLALALPHQVAPP  1006
              A   ++S +P     QQ A+   HQV  P
Sbjct  237   -ADSRQQSVAP-----QQAAVQPQHQVTTP  260



>gb|KFK25694.1| hypothetical protein AALP_AA8G147000 [Arabis alpina]
Length=530

 Score = 97.1 bits (240),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 68/93 (73%), Gaps = 0/93 (0%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  754
            +I A++++MKK+ADNL+  +EG+S+RL+QLE    NL+  + +++  + + HG TD KL+
Sbjct  107  IISAIDRTMKKHADNLLHVMEGVSARLTQLETRTRNLENLVDDVKVSVGNSHGNTDGKLR  166

Query  755  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQ  853
             LE  L EV   VQ+L+DKQE+ +AQ +L+KLQ
Sbjct  167  QLENILLEVQSGVQLLKDKQEIVEAQLQLSKLQ  199



>ref|XP_002873675.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49934.1| predicted protein, partial [Arabidopsis lyrata subsp. lyrata]
Length=444

 Score = 96.3 bits (238),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 78/117 (67%), Gaps = 0/117 (0%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  754
            +I A++++MK +AD+L+  +EG+S+RL+QLE    NL+  + +++  + + HG+TD KL+
Sbjct  120  IISAIDRTMKAHADSLLHVMEGVSARLTQLETRTRNLENLVDDVKVSVGNSHGKTDGKLR  179

Query  755  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERASQPAS  925
             LE  + EV   VQ+L+DKQE+ +AQ +L+KLQL++       +S   E  A  PAS
Sbjct  180  QLENIMLEVQSGVQLLKDKQEIVEAQLQLSKLQLSKVNQQPETHSTHVEPTAQPPAS  236



>ref|XP_006338590.1| PREDICTED: AT-rich interactive domain-containing protein 1A-like 
[Solanum tuberosum]
Length=549

 Score = 96.7 bits (239),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 79/132 (60%), Gaps = 8/132 (6%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  754
            ++  ++ ++KKYADNL+  +EG+S+RLSQLE     +D S+ E++  + + HG TD KL+
Sbjct  120  LLSEIDHTVKKYADNLLHAVEGVSARLSQLETRNRQIDNSVDELKLSVGNSHGVTDGKLR  179

Query  755  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERASQPASDTK  934
             LE  L+EV   VQ++RDKQE+ DAQ +L K Q  + E        Q  E  S   +D+ 
Sbjct  180  QLENILREVQDGVQVIRDKQEIMDAQLQLMKSQAPKIE--------QQAETHSTTHTDSS  231

Query  935  RSDSPCELHGQQ  970
            +  +P  LH  Q
Sbjct  232  QPTTPTPLHSHQ  243



>ref|XP_010906083.1| PREDICTED: protein transport protein SEC31 [Elaeis guineensis]
Length=541

 Score = 96.3 bits (238),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 72/103 (70%), Gaps = 0/103 (0%)
 Frame = +2

Query  560  SFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGET  739
            +++   +  ++  +KKYADNL+  LEG+ SRLSQLE     L+  + E++  + ++HG T
Sbjct  102  AYDVATVAEIDCIVKKYADNLLHALEGVGSRLSQLESRTRYLEGCVDELKVSVGNNHGST  161

Query  740  DSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKE  868
            D KL+ LE  L+EV   VQ+LRDKQ++A+AQ +LAKLQ +++E
Sbjct  162  DGKLRQLENILREVQTGVQVLRDKQDIAEAQLQLAKLQASKRE  204



>ref|XP_010551915.1| PREDICTED: actin cytoskeleton-regulatory complex protein PAN1 
[Tarenaya hassleriana]
Length=550

 Score = 95.9 bits (237),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 85/135 (63%), Gaps = 1/135 (1%)
 Frame = +2

Query  557  SSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGE  736
            S+ N  ++  ++++MKK+ADNL+  +EGLS+RL+QLE    NL+  + +++  + + HG 
Sbjct  126  SAPNTSILSEIDRTMKKHADNLLHAMEGLSARLTQLETRTRNLENLVDDLKVSVGNSHGS  185

Query  737  TDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERASQ  916
            TD K++ LE  L EV   VQ+L+DKQE+ +AQ +L+K Q+++ +      +  + +  +Q
Sbjct  186  TDGKMRQLENILLEVQSGVQLLKDKQEIVEAQLQLSKFQISKVDQQPETQTTAHTDPVAQ  245

Query  917  PASDTKRSDSPCELH  961
            P +   +   P +LH
Sbjct  246  PPASAPQPHMP-QLH  259



>gb|KJB75894.1| hypothetical protein B456_012G063600 [Gossypium raimondii]
Length=622

 Score = 95.9 bits (237),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 60/170 (35%), Positives = 95/170 (56%), Gaps = 21/170 (12%)
 Frame = +2

Query  551   EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  730
             + S+F+  ++  ++++MKK+ DNLM  +E +S RL+QLE    +L+ S+ +++  +V++H
Sbjct  193   DQSAFDTSILAEIDQTMKKHTDNLMHMMEKVSDRLTQLESRTRHLENSLDDLKVSVVNNH  252

Query  731   GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERA  910
             G TD K+K LE  L EV   V  L++KQE+ +AQ +LAKLQ+++ +  S   +    E  
Sbjct  253   GSTDRKMKQLENILTEVQTGVHDLKEKQEIMEAQLQLAKLQVSKVDQPSETQNTVRTESV  312

Query  911   SQPASDTKRSDSPCELHGQQLAL--------------ALPHQVAPPQTSH  1018
              Q AS      +P + H QQL L              ALP    PPQ  H
Sbjct  313   QQVAS------APFQSH-QQLPLAASFPQSLPSVPPPALPQPSLPPQVQH  355



>ref|XP_003525675.1| PREDICTED: arginine-glutamic acid dipeptide repeats protein-like 
[Glycine max]
Length=573

 Score = 95.5 bits (236),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 76/104 (73%), Gaps = 0/104 (0%)
 Frame = +2

Query  557  SSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGE  736
            S+F+  ++  ++++MKK+ +N++  LEG+S+RL+QLE   ++L+ S+ +++  + ++HG 
Sbjct  131  SAFDATMLSEIDRTMKKHMENMLHVLEGVSARLTQLETRTHHLENSVDDLKVSVGNNHGS  190

Query  737  TDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKE  868
            TD KL+ LE  L+EV   VQ ++DKQ++  AQ +LAKLQ+++ +
Sbjct  191  TDGKLRQLENILREVQSGVQTIKDKQDIVQAQLQLAKLQVSKTD  234



>ref|XP_010492262.1| PREDICTED: basic salivary proline-rich protein 2-like [Camelina 
sativa]
Length=547

 Score = 95.5 bits (236),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 77/117 (66%), Gaps = 0/117 (0%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  754
            ++ A++++MK +ADNL+  +EG+S+RL+QLE    NL+  + +++  + + HG TD KL+
Sbjct  127  ILSAIDRTMKAHADNLIHVIEGVSARLTQLETRTRNLENLVDDVKVSVGNSHGTTDGKLR  186

Query  755  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERASQPAS  925
             LE  + EV   VQ+L+DKQ++ +AQ +L+KLQL++       +S   E  A  PAS
Sbjct  187  QLENIMLEVQSGVQMLKDKQDIVEAQLQLSKLQLSKVNQQPETHSTHVEPTAQPPAS  243



>gb|KHN27460.1| hypothetical protein glysoja_022169 [Glycine soja]
Length=573

 Score = 95.5 bits (236),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 76/104 (73%), Gaps = 0/104 (0%)
 Frame = +2

Query  557  SSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGE  736
            S+F+  ++  ++++MKK+ +N++  LEG+S+RL+QLE   ++L+ S+ +++  + ++HG 
Sbjct  131  SAFDATMLSEIDRTMKKHMENMLHVLEGVSARLTQLETRTHHLENSVDDLKVSVGNNHGS  190

Query  737  TDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKE  868
            TD KL+ LE  L+EV   VQ ++DKQ++  AQ +LAKLQ+++ +
Sbjct  191  TDGKLRQLENILREVQSGVQTIKDKQDIVQAQLQLAKLQVSKTD  234



>ref|XP_010908580.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 2 [Elaeis guineensis]
Length=523

 Score = 95.1 bits (235),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 81/127 (64%), Gaps = 0/127 (0%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  730
            E S+++   +  ++ ++KKYADNL+  LEG+SSRL+QLE   ++L+ S+ E++    +  
Sbjct  104  EKSAYDAATVAEIDHTVKKYADNLLHTLEGVSSRLTQLESRTHHLESSVDELKVTTGNSS  163

Query  731  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERA  910
            G TD KL+ LE  L+ V   VQ+LRDKQE+ +AQ +LA LQ ++ ++    + +Q+ + A
Sbjct  164  GTTDGKLRQLENILRGVQTCVQVLRDKQEIVEAQLQLANLQASKGDNKPRQSVEQSHQLA  223

Query  911  SQPASDT  931
              P   T
Sbjct  224  VPPLQPT  230



>ref|XP_009334114.1| PREDICTED: arginine-glutamic acid dipeptide repeats protein [Pyrus 
x bretschneideri]
Length=583

 Score = 95.1 bits (235),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/166 (33%), Positives = 94/166 (57%), Gaps = 13/166 (8%)
 Frame = +2

Query  566   NQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDS  745
             N  ++  ++++MKK+ DNL+  LEG+S+RL+QLE    NL+ S+ +++  + ++HG  D 
Sbjct  142   NAAIVSEIDQTMKKHTDNLLHVLEGVSARLTQLESRTRNLENSVDDLKISVGNNHGNADG  201

Query  746   KLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLA------QKESGSANNSQQNEER  907
             K++ LE  L++V   V+ ++DKQE+ +AQ  LA++QL+      Q E  +A +    +  
Sbjct  202   KMRQLEGILRDVQTGVKDMKDKQEIVEAQLNLARIQLSNAKVDPQPEPQNAGHVDSGQTA  261

Query  908   ASQPASDTKRSDSPCELHGQQLALALPHQVAPPQ-----TSHTTRH  1030
             AS P    ++   P  L     A++  H  APPQ       HT +H
Sbjct  262   ASTPQHSHQQIHPPVNLPPSLPAVS--HPNAPPQPMPQSVPHTVQH  305



>ref|XP_012081352.1| PREDICTED: WW domain-binding protein 11 isoform X1 [Jatropha 
curcas]
Length=596

 Score = 95.1 bits (235),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 75/98 (77%), Gaps = 0/98 (0%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  754
            ++  ++K+MKK+AD+L+  +EG+S+RL+QLE    NL+ S+ +++  + +++G TD K++
Sbjct  153  IVMEIDKTMKKHADSLLHIMEGVSARLTQLESRTRNLENSVDDLKLSVGNNNGSTDGKMR  212

Query  755  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKE  868
             LE  L+EVH  VQ+L++KQE+ +A+ +LAKLQ+++ +
Sbjct  213  QLENILREVHSGVQVLKEKQEVVEAELQLAKLQVSKAD  250



>ref|XP_012081360.1| PREDICTED: WW domain-binding protein 11 isoform X2 [Jatropha 
curcas]
 gb|KDP45326.1| hypothetical protein JCGZ_09575 [Jatropha curcas]
Length=579

 Score = 95.1 bits (235),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 75/98 (77%), Gaps = 0/98 (0%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  754
            ++  ++K+MKK+AD+L+  +EG+S+RL+QLE    NL+ S+ +++  + +++G TD K++
Sbjct  136  IVMEIDKTMKKHADSLLHIMEGVSARLTQLESRTRNLENSVDDLKLSVGNNNGSTDGKMR  195

Query  755  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKE  868
             LE  L+EVH  VQ+L++KQE+ +A+ +LAKLQ+++ +
Sbjct  196  QLENILREVHSGVQVLKEKQEVVEAELQLAKLQVSKAD  233



>emb|CDP02078.1| unnamed protein product [Coffea canephora]
Length=551

 Score = 95.1 bits (235),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 74/106 (70%), Gaps = 5/106 (5%)
 Frame = +2

Query  566  NQDVIDA-----VEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  730
            +Q+V+D      ++++MKKYADNLM  L+ +S+RL+QLE    +L+ S+ E++  +  +H
Sbjct  106  DQNVVDPKLVSEIDRTMKKYADNLMHGLDSVSARLTQLESRTRHLENSLDELKVSVGTNH  165

Query  731  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKE  868
            G +D +++ LE  L+EV   VQ +RDKQE+ DAQ  LAKL++++ E
Sbjct  166  GSSDGRMRQLENILREVQNGVQFIRDKQEILDAQLHLAKLEVSKAE  211



>emb|CAB87621.1| putative protein [Arabidopsis thaliana]
Length=530

 Score = 94.4 bits (233),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 77/117 (66%), Gaps = 0/117 (0%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  754
            +I A++++MK +AD L+  +EG+S+RL+QLE    +L+  + +++  + + HG+TD KL+
Sbjct  109  IISAIDRTMKAHADKLLHVMEGVSARLTQLETRTRDLENLVDDVKVSVGNSHGKTDGKLR  168

Query  755  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERASQPAS  925
             LE  + EV   VQ+L+DKQE+ +AQ +L+KLQL++       +S   E  A  PAS
Sbjct  169  QLENIMLEVQNGVQLLKDKQEIVEAQLQLSKLQLSKVNQQPETHSTHVEPTAQPPAS  225



>ref|NP_196958.2| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAH20220.1| AT5G14540 [Arabidopsis thaliana]
 gb|AED92045.1| uncharacterized protein AT5G14540 [Arabidopsis thaliana]
Length=547

 Score = 94.0 bits (232),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 77/117 (66%), Gaps = 0/117 (0%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  754
            +I A++++MK +AD L+  +EG+S+RL+QLE    +L+  + +++  + + HG+TD KL+
Sbjct  126  IISAIDRTMKAHADKLLHVMEGVSARLTQLETRTRDLENLVDDVKVSVGNSHGKTDGKLR  185

Query  755  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERASQPAS  925
             LE  + EV   VQ+L+DKQE+ +AQ +L+KLQL++       +S   E  A  PAS
Sbjct  186  QLENIMLEVQNGVQLLKDKQEIVEAQLQLSKLQLSKVNQQPETHSTHVEPTAQPPAS  242



>ref|XP_008379205.1| PREDICTED: protein enabled [Malus domestica]
Length=583

 Score = 94.0 bits (232),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 53/164 (32%), Positives = 94/164 (57%), Gaps = 9/164 (5%)
 Frame = +2

Query  566   NQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDS  745
             N  ++  ++++MKK+ADNL+  LEG+S+RL+QLE    NL+ S+ +++  + ++HG TD 
Sbjct  142   NAAIVSEIDQTMKKHADNLLHMLEGVSARLTQLESRTRNLENSVDDLKISVGNNHGNTDG  201

Query  746   KLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLA------QKESGSANNSQQNEER  907
              ++ LE  L++V   V+ ++DKQE+ +AQ  LA++Q++      Q E  +A +    +  
Sbjct  202   TMRQLEGILRDVQTGVKDMKDKQEIVEAQLNLARIQMSNPKIDPQPEPQNAGHVDSGQTP  261

Query  908   ASQPASDTKRSDSPCELHGQQLALALPH---QVAPPQTSHTTRH  1030
             AS P    ++   P  L     A++ P+   Q  P    HT +H
Sbjct  262   ASAPQHSHQQIHPPVNLPPSIPAVSHPNAPSQPMPQSVPHTVQH  305



>ref|XP_008365379.1| PREDICTED: protein enabled-like [Malus domestica]
Length=583

 Score = 94.0 bits (232),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 53/164 (32%), Positives = 94/164 (57%), Gaps = 9/164 (5%)
 Frame = +2

Query  566   NQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDS  745
             N  ++  ++++MKK+ADNL+  LEG+S+RL+QLE    NL+ S+ +++  + ++HG TD 
Sbjct  142   NAAIVSEIDQTMKKHADNLLHMLEGVSARLTQLESRTRNLENSVDDLKISVGNNHGNTDG  201

Query  746   KLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLA------QKESGSANNSQQNEER  907
              ++ LE  L++V   V+ ++DKQE+ +AQ  LA++Q++      Q E  +A +    +  
Sbjct  202   TMRQLEGILRDVQTGVKDMKDKQEIVEAQLNLARIQMSXPKIDPQPEPQNAGHVDSGQTP  261

Query  908   ASQPASDTKRSDSPCELHGQQLALALPH---QVAPPQTSHTTRH  1030
             AS P    ++   P  L     A++ P+   Q  P    HT +H
Sbjct  262   ASAPQHSHQQIHPPVNLPPSIPAVSHPNAPSQPMPQSVPHTVQH  305



>ref|XP_009388841.1| PREDICTED: bromodomain-containing protein 4 [Musa acuminata subsp. 
malaccensis]
Length=538

 Score = 94.0 bits (232),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 83/124 (67%), Gaps = 7/124 (6%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  730
            E S+ +   +  ++ ++K+YADNLM  LEGLSSRLS++E   ++++ S+ E++  + +++
Sbjct  122  EKSAHDIAFVAEIDHTVKRYADNLMNALEGLSSRLSKIESRTHHMENSVDELKVAIENNN  181

Query  731  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKL-------QLAQKESGSANNS  889
            G T+ KLK +E  L+EVH SVQIL+DKQ++ +AQ  LA+L       QL +      ++S
Sbjct  182  GSTNGKLKQIENVLKEVHSSVQILQDKQQVTEAQLHLAQLITSEGDQQLPENSKTGDSDS  241

Query  890  QQNE  901
            QQ+E
Sbjct  242  QQHE  245



>ref|XP_006289230.1| hypothetical protein CARUB_v10002686mg [Capsella rubella]
 gb|EOA22128.1| hypothetical protein CARUB_v10002686mg [Capsella rubella]
Length=541

 Score = 93.2 bits (230),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 76/117 (65%), Gaps = 0/117 (0%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  754
            ++ A++++MK +ADNL+  +E +S+RL+QLE    NL+  + +++  + + HG TD KL+
Sbjct  123  ILSAIDRTMKAHADNLIHVIECVSARLTQLETRTRNLENLVDDVKVSVGNSHGTTDGKLR  182

Query  755  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERASQPAS  925
             LE  + EV   VQ+L+DKQE+ +AQ +L+KLQL++       +S   E  A  PAS
Sbjct  183  QLENIMLEVQSGVQLLKDKQEIVEAQLQLSKLQLSKVNQQPETHSSHVEPSAQPPAS  239



>ref|XP_009782100.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 2 [Nicotiana sylvestris]
Length=545

 Score = 93.2 bits (230),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 66/94 (70%), Gaps = 0/94 (0%)
 Frame = +2

Query  587  VEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEK  766
            ++ ++KKYADNL+  +EG+S+RLSQLE     +D S+ E++  + ++HG TD KL+ LE 
Sbjct  116  IDHTVKKYADNLLHAMEGVSARLSQLETRSRQIDNSVDELKLSVGNNHGVTDGKLRQLEN  175

Query  767  HLQEVHRSVQILRDKQELADAQKELAKLQLAQKE  868
             L++V   VQ++RDKQE+ DAQ +L K Q  + E
Sbjct  176  ILRQVQDGVQVIRDKQEIMDAQLQLMKSQAPKVE  209



>ref|XP_009403230.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 2 [Musa acuminata subsp. malaccensis]
Length=550

 Score = 92.8 bits (229),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 86/134 (64%), Gaps = 7/134 (5%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  730
            E S+++  ++  ++ ++K+YADNLM  LEG++SRL QLE   ++L+ S+ E++  + +++
Sbjct  122  EKSTYDVAMVAEIDTTVKRYADNLMNALEGVNSRLLQLENRTHHLENSVDELKVAIGNNN  181

Query  731  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERA  910
            G TD +L+  +  L+EV   VQILRDKQ++ +AQ  LA+L+ ++ E       QQ   + 
Sbjct  182  GSTDGRLRQFDNILREVQSGVQILRDKQDIVEAQLHLAQLKASKGE-----QQQQQNSKT  236

Query  911  SQPASDTKRSDSPC  952
             QP  D+++ + P 
Sbjct  237  VQP--DSRQHEVPA  248



>gb|EYU44780.1| hypothetical protein MIMGU_mgv1a004985mg [Erythranthe guttata]
Length=501

 Score = 92.8 bits (229),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 70/101 (69%), Gaps = 0/101 (0%)
 Frame = +2

Query  548  PEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHD  727
            P ++S +  ++  ++K+MKKY DNL   ++ +S+RLSQLE    NL+ SI +++  + ++
Sbjct  66   PSNASLDASLVSEIDKTMKKYMDNLTHAVDNMSARLSQLETRTRNLEHSIDDLKVSVGNN  125

Query  728  HGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKL  850
            HG TD K++ LE  L EV   V+++RDKQE+ +AQ ++AK+
Sbjct  126  HGITDGKMRLLENILNEVQAGVELIRDKQEVVEAQVQIAKM  166



>ref|XP_006603779.1| PREDICTED: vacuolar protein sorting-associated protein 27-like 
isoform X2 [Glycine max]
Length=466

 Score = 92.4 bits (228),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 77/109 (71%), Gaps = 0/109 (0%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  730
            + S+F+  ++  +++++KK+ +N++  LEG+S+RL+QLE   ++L+ S+ +++  + + H
Sbjct  22   DQSAFDATMLSEIDRTVKKHMENMLHVLEGVSARLTQLETRTHHLENSVDDLKVSVGNSH  81

Query  731  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGS  877
            G TD KL+ +E  L+EV   VQ ++DKQ++  AQ +LAKL++++ +  S
Sbjct  82   GSTDGKLRQMENSLREVQSGVQTIKDKQDIVQAQLQLAKLEVSKTDPQS  130



>ref|XP_006446566.1| hypothetical protein CICLE_v10014743mg [Citrus clementina]
 gb|ESR59806.1| hypothetical protein CICLE_v10014743mg [Citrus clementina]
Length=574

 Score = 92.4 bits (228),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 89/148 (60%), Gaps = 5/148 (3%)
 Frame = +2

Query  575   VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  754
             ++  ++++MKKYADNL+  LEG+S+RL+QL+    NL+ S+ +++  +  +H  TD K++
Sbjct  127   IVSDIDQTMKKYADNLLHVLEGVSARLTQLDARTRNLESSVDDLKVSVGSNHASTDGKMR  186

Query  755   SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERASQPASDTK  934
              +E  L+EV   + +L+DKQE+ +AQ +  KLQ ++ +  S + S  + E   Q AS + 
Sbjct  187   QVENILREVQSGILVLKDKQEMLEAQMQHGKLQGSKVDRPSESRSTVHTEAVHQSASASL  246

Query  935   RS----DSPCELHGQQLALALPHQVAPP  1006
             +S     SP     Q +   LP  +APP
Sbjct  247   QSHIQHPSPPVTFPQSVP-PLPSTIAPP  273



>ref|XP_004299014.1| PREDICTED: formin-like protein 3 isoform X1 [Fragaria vesca subsp. 
vesca]
Length=561

 Score = 92.4 bits (228),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 79/121 (65%), Gaps = 6/121 (5%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  754
            VI  ++++MKKYADNL++ +EG+S+RL+QLE    +L+ S+ +++  + ++HG  D K++
Sbjct  123  VISEIDQTMKKYADNLLQVMEGISARLTQLESRTCHLENSVDDLKVSVGNNHGNADGKMR  182

Query  755  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLA------QKESGSANNSQQNEERASQ  916
             LE  L++V   VQ L+DKQ + +AQ +L K+Q++      Q ES +A N    +  A+ 
Sbjct  183  QLENILRDVQTGVQDLKDKQSIVEAQLQLGKIQISNPKVDPQLESRNALNVDSGQTVATA  242

Query  917  P  919
            P
Sbjct  243  P  243



>ref|XP_010037529.1| PREDICTED: vegetative cell wall protein gp1-like [Eucalyptus 
grandis]
 gb|KCW49241.1| hypothetical protein EUGRSUZ_K02812 [Eucalyptus grandis]
Length=553

 Score = 92.4 bits (228),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/152 (33%), Positives = 91/152 (60%), Gaps = 5/152 (3%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  730
            E  SFN+ +I  +E+ M ++ D ++  +EG+S+RLSQLE     L+ ++ +M+  L ++H
Sbjct  62   ERVSFNETLISLIERKMTEHNDTVLHAVEGVSARLSQLETRTRRLENAVDDMKESLEYNH  121

Query  731  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKES-----GSANNSQQ  895
            G+TD KL+ LE  L+EV    + LRDK+++A AQ ++ KLQ+ + E+     G++  +  
Sbjct  122  GKTDGKLRELENLLREVQSCTRDLRDKEDIAQAQLQILKLQIRKNEAREEKKGNSTRTNS  181

Query  896  NEERASQPASDTKRSDSPCELHGQQLALALPH  991
             +++A+     +  S     +  QQ A +LP+
Sbjct  182  GQQKAAPKTQQSAESLPVPVVRSQQFASSLPY  213



>ref|XP_011464066.1| PREDICTED: formin-like protein 3 isoform X2 [Fragaria vesca subsp. 
vesca]
Length=550

 Score = 92.4 bits (228),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 70/98 (71%), Gaps = 0/98 (0%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  754
            VI  ++++MKKYADNL++ +EG+S+RL+QLE    +L+ S+ +++  + ++HG  D K++
Sbjct  112  VISEIDQTMKKYADNLLQVMEGISARLTQLESRTCHLENSVDDLKVSVGNNHGNADGKMR  171

Query  755  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKE  868
             LE  L++V   VQ L+DKQ + +AQ +L K+Q++  +
Sbjct  172  QLENILRDVQTGVQDLKDKQSIVEAQLQLGKIQISNPK  209



>gb|KDO55180.1| hypothetical protein CISIN_1g0084162mg, partial [Citrus sinensis]
Length=462

 Score = 92.0 bits (227),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 89/148 (60%), Gaps = 5/148 (3%)
 Frame = +2

Query  575   VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  754
             ++  ++++MKKYADNL+  LEG+S+RL+QL+    NL+ S+ +++  +  +H  TD K++
Sbjct  23    IVSDIDQTMKKYADNLLHVLEGVSARLTQLDARTRNLESSVDDLKVSVGSNHASTDGKMR  82

Query  755   SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERASQPASDTK  934
              +E  L+EV   V +L+DKQE+ +AQ +  KLQ ++ +  S + S  + E   Q AS + 
Sbjct  83    QVENILREVQSGVLVLKDKQEMLEAQMQHGKLQGSKVDQPSESRSTVHTEAVHQSASASL  142

Query  935   RS----DSPCELHGQQLALALPHQVAPP  1006
             +S     SP     + +   LP  +APP
Sbjct  143   QSHIQHPSPPVTFPRSVP-PLPSTIAPP  169



>ref|XP_003554822.1| PREDICTED: vacuolar protein sorting-associated protein 27-like 
isoform X1 [Glycine max]
 gb|KHN19672.1| hypothetical protein glysoja_037174 [Glycine soja]
Length=578

 Score = 92.0 bits (227),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 77/109 (71%), Gaps = 0/109 (0%)
 Frame = +2

Query  551  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  730
            + S+F+  ++  +++++KK+ +N++  LEG+S+RL+QLE   ++L+ S+ +++  + + H
Sbjct  134  DQSAFDATMLSEIDRTVKKHMENMLHVLEGVSARLTQLETRTHHLENSVDDLKVSVGNSH  193

Query  731  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGS  877
            G TD KL+ +E  L+EV   VQ ++DKQ++  AQ +LAKL++++ +  S
Sbjct  194  GSTDGKLRQMENSLREVQSGVQTIKDKQDIVQAQLQLAKLEVSKTDPQS  242



>ref|XP_010910341.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 2 isoform X1 [Elaeis guineensis]
Length=535

 Score = 91.7 bits (226),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 71/101 (70%), Gaps = 2/101 (2%)
 Frame = +2

Query  572  DVIDAVE--KSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDS  745
            DV   VE  +++KKYADNL+  LEG+SSRLSQLE     L  S+ E++  + ++H  T+ 
Sbjct  105  DVARVVEIDRAVKKYADNLLHALEGVSSRLSQLESRTCYLGSSVDELKVSVGNNHRSTNG  164

Query  746  KLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKE  868
            +L+ +E  L+EV   VQ+LRD+Q++A+AQ +LAKLQ ++ E
Sbjct  165  RLRQIENILREVQTGVQVLRDEQDIAEAQLQLAKLQASKGE  205



>ref|XP_006470271.1| PREDICTED: COPII coat assembly protein sec16-like [Citrus sinensis]
Length=574

 Score = 91.7 bits (226),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 89/148 (60%), Gaps = 5/148 (3%)
 Frame = +2

Query  575   VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  754
             ++  ++++MKKYADNL+  LEG+S+RL+QL+    NL+ S+ +++  +  +H  TD K++
Sbjct  127   IVSDIDQTMKKYADNLLHVLEGVSARLTQLDARTRNLESSVDDLKVSVGSNHASTDGKMR  186

Query  755   SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERASQPASDTK  934
              +E  L+EV   V +L+DKQE+ +AQ +  KLQ ++ +  S + S  + E   Q AS + 
Sbjct  187   QVENILREVQSGVLVLKDKQEMLEAQMQHGKLQGSKVDQPSESRSTVHTEAVHQSASASL  246

Query  935   RS----DSPCELHGQQLALALPHQVAPP  1006
             +S     SP     + +   LP  +APP
Sbjct  247   QSHIQHPSPPVTFPRSVP-PLPSTIAPP  273



>ref|XP_010910342.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 2 isoform X2 [Elaeis guineensis]
Length=533

 Score = 91.3 bits (225),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 71/101 (70%), Gaps = 2/101 (2%)
 Frame = +2

Query  572  DVIDAVE--KSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDS  745
            DV   VE  +++KKYADNL+  LEG+SSRLSQLE     L  S+ E++  + ++H  T+ 
Sbjct  103  DVARVVEIDRAVKKYADNLLHALEGVSSRLSQLESRTCYLGSSVDELKVSVGNNHRSTNG  162

Query  746  KLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKE  868
            +L+ +E  L+EV   VQ+LRD+Q++A+AQ +LAKLQ ++ E
Sbjct  163  RLRQIENILREVQTGVQVLRDEQDIAEAQLQLAKLQASKGE  203



>ref|XP_009611188.1| PREDICTED: transcriptional regulator DEF1 isoform X2 [Nicotiana 
tomentosiformis]
Length=545

 Score = 91.3 bits (225),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 65/94 (69%), Gaps = 0/94 (0%)
 Frame = +2

Query  587  VEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEK  766
            ++ ++KKYADNL+  +EG+S+RLSQLE     +D S+ E++  + ++HG TD KL+ LE 
Sbjct  116  IDHTVKKYADNLLHAMEGVSARLSQLETRSRQIDNSVDELKLSVGNNHGVTDGKLRQLEN  175

Query  767  HLQEVHRSVQILRDKQELADAQKELAKLQLAQKE  868
             L++V   VQ++RDKQE+ D Q +L K Q  + E
Sbjct  176  ILRQVQDGVQVIRDKQEIMDVQLQLMKSQAPKVE  209



>gb|KDO55179.1| hypothetical protein CISIN_1g0084162mg [Citrus sinensis]
Length=566

 Score = 91.7 bits (226),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 89/148 (60%), Gaps = 5/148 (3%)
 Frame = +2

Query  575   VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  754
             ++  ++++MKKYADNL+  LEG+S+RL+QL+    NL+ S+ +++  +  +H  TD K++
Sbjct  127   IVSDIDQTMKKYADNLLHVLEGVSARLTQLDARTRNLESSVDDLKVSVGSNHASTDGKMR  186

Query  755   SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERASQPASDTK  934
              +E  L+EV   V +L+DKQE+ +AQ +  KLQ ++ +  S + S  + E   Q AS + 
Sbjct  187   QVENILREVQSGVLVLKDKQEMLEAQMQHGKLQGSKVDQPSESRSTVHTEAVHQSASASL  246

Query  935   RS----DSPCELHGQQLALALPHQVAPP  1006
             +S     SP     + +   LP  +APP
Sbjct  247   QSHIQHPSPPVTFPRSVP-PLPSTIAPP  273



>ref|XP_009611187.1| PREDICTED: transcriptional regulator DEF1 isoform X1 [Nicotiana 
tomentosiformis]
Length=551

 Score = 91.3 bits (225),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 65/94 (69%), Gaps = 0/94 (0%)
 Frame = +2

Query  587  VEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEK  766
            ++ ++KKYADNL+  +EG+S+RLSQLE     +D S+ E++  + ++HG TD KL+ LE 
Sbjct  122  IDHTVKKYADNLLHAMEGVSARLSQLETRSRQIDNSVDELKLSVGNNHGVTDGKLRQLEN  181

Query  767  HLQEVHRSVQILRDKQELADAQKELAKLQLAQKE  868
             L++V   VQ++RDKQE+ D Q +L K Q  + E
Sbjct  182  ILRQVQDGVQVIRDKQEIMDVQLQLMKSQAPKVE  215



>gb|KDO55178.1| hypothetical protein CISIN_1g0084162mg [Citrus sinensis]
Length=564

 Score = 91.3 bits (225),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 89/148 (60%), Gaps = 5/148 (3%)
 Frame = +2

Query  575   VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  754
             ++  ++++MKKYADNL+  LEG+S+RL+QL+    NL+ S+ +++  +  +H  TD K++
Sbjct  125   IVSDIDQTMKKYADNLLHVLEGVSARLTQLDARTRNLESSVDDLKVSVGSNHASTDGKMR  184

Query  755   SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERASQPASDTK  934
              +E  L+EV   V +L+DKQE+ +AQ +  KLQ ++ +  S + S  + E   Q AS + 
Sbjct  185   QVENILREVQSGVLVLKDKQEMLEAQMQHGKLQGSKVDQPSESRSTVHTEAVHQSASASL  244

Query  935   RS----DSPCELHGQQLALALPHQVAPP  1006
             +S     SP     + +   LP  +APP
Sbjct  245   QSHIQHPSPPVTFPRSVP-PLPSTIAPP  271



>gb|KHG02060.1| Myosin-2 [Gossypium arboreum]
Length=542

 Score = 91.3 bits (225),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 87/142 (61%), Gaps = 7/142 (5%)
 Frame = +2

Query  557  SSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGE  736
            S+F+  ++  ++++MKK+ DNLM  +E +S RL+QLE    +L+ S+ +++  + ++HG 
Sbjct  116  SAFDTSILAEIDRTMKKHTDNLMHMMEKVSDRLTQLESRTRHLENSLDDLKVSVGNNHGS  175

Query  737  TDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERASQ  916
            TD K+K LE  L EV   V  L++KQE+ +AQ +LAKL++++ E  S   +    E   Q
Sbjct  176  TDRKMKQLENILTEVQTGVHDLKEKQEIMEAQLQLAKLEVSKVEQPSETQNTVRTESVQQ  235

Query  917  PASDTKRSDSPCELHGQQLALA  982
             AS      +P + H QQL LA
Sbjct  236  VAS------APFQSH-QQLPLA  250



>ref|XP_002524656.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF37675.1| DNA binding protein, putative [Ricinus communis]
Length=568

 Score = 90.9 bits (224),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 71/100 (71%), Gaps = 0/100 (0%)
 Frame = +2

Query  557  SSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGE  736
            S+F+  ++  ++K+MKK+ DNL+  LEG+S+RL+QLE+    L+ S+ E++  + ++HG 
Sbjct  144  SAFDAAIVSEIDKTMKKHTDNLLHLLEGVSARLTQLEIRSRCLENSVDELKVSIGNNHGN  203

Query  737  TDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQL  856
            TD K++ +EK L ++    ++L+DK E+ +AQ +LA LQ+
Sbjct  204  TDGKIEQVEKVLLKLQAGFEVLKDKHEIFEAQLKLAGLQV  243



>ref|XP_007031556.1| Uncharacterized protein TCM_016944 [Theobroma cacao]
 gb|EOY02482.1| Uncharacterized protein TCM_016944 [Theobroma cacao]
Length=541

 Score = 90.9 bits (224),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 72/104 (69%), Gaps = 0/104 (0%)
 Frame = +2

Query  557  SSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGE  736
            ++F+  ++  ++++MKK+ DNL+  LE +S+RL+QLE    NL+ S+ +++  + ++HG 
Sbjct  110  NAFDTSIVAEIDRTMKKHTDNLIHMLEVVSARLTQLESRTRNLENSVDDLKVSVGNNHGS  169

Query  737  TDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKE  868
            T+ K++ LE  L EV   V +L++KQE+ +AQ  LAKLQ+ + +
Sbjct  170  TEGKMRQLENILNEVQTGVHVLKEKQEIMEAQLHLAKLQVTKGD  213



>ref|XP_010420094.1| PREDICTED: protein transport protein sec31-like [Camelina sativa]
Length=545

 Score = 90.5 bits (223),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 75/117 (64%), Gaps = 0/117 (0%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  754
            ++ A++ +MK +ADNL+  +EG+S+RL+QLE    NL+  + +++  + + HG TD KL+
Sbjct  126  ILSAIDLTMKAHADNLIHVIEGVSARLTQLETRTRNLENLVDDVKVSVGNSHGITDGKLR  185

Query  755  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERASQPAS  925
             LE  + EV   VQ+L+DKQ++ +AQ +L+KLQL++       +S   E     PAS
Sbjct  186  QLENIMLEVQSGVQMLKDKQDIVEAQLQLSKLQLSKVNQQPEKHSTHVEPTPQPPAS  242



>ref|XP_010453577.1| PREDICTED: basic salivary proline-rich protein 2-like [Camelina 
sativa]
Length=547

 Score = 90.1 bits (222),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 74/117 (63%), Gaps = 0/117 (0%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  754
            ++ A++++MK +ADNL+  +EG+S+RL+QLE    NL+  + +++  + + HG TD KL+
Sbjct  127  ILSAIDRTMKAHADNLIHVIEGVSARLTQLETRTRNLENLVDDVKVSVGNSHGTTDGKLR  186

Query  755  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERASQPAS  925
             LE  + EV   VQ+L+DKQ++ +AQ +L+KL  ++       +S   E     PAS
Sbjct  187  QLENIMLEVESGVQMLKDKQDIVEAQLQLSKLHFSKVNQQPETHSTHVEPTPQPPAS  243



>ref|XP_009362961.1| PREDICTED: histone acetyltransferase KAT6A-like isoform X2 [Pyrus 
x bretschneideri]
Length=356

 Score = 88.2 bits (217),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 59/164 (36%), Positives = 88/164 (54%), Gaps = 17/164 (10%)
 Frame = +2

Query  551   EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  730
             EDS+    +I  +E+ M  +  NL+  +EGLS+R+SQLE     L  S+ + +     +H
Sbjct  76    EDSA----LISVIERKMDDHFGNLLHAVEGLSARISQLETRLCRLQNSVDDFKDSTEINH  131

Query  731   GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERA  910
             G+ D KL+ LE  L+EV   +Q LRDKQE+ +A+ ELAKLQ+ +    S N +  N +  
Sbjct  132   GKADGKLRQLENMLREVDGGMQDLRDKQEITEARLELAKLQMLKGHQQSENQT-NNVQTV  190

Query  911   SQPA---SDTKRSDSPCELHGQQLALA---------LPHQVAPP  1006
             S P    S  ++SD P  +    L ++         LPHQ  PP
Sbjct  191   SAPGVLSSSPQQSDQPHAVQAPTLQVSTLPTDDPRTLPHQNFPP  234



>ref|XP_009125983.1| PREDICTED: WW domain-binding protein 11 isoform X1 [Brassica 
rapa]
Length=537

 Score = 89.4 bits (220),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 69/96 (72%), Gaps = 0/96 (0%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  754
            ++  +++ MKK+AD+LM  +EG+S+RL+QLE    NL+  + +++  + + HG TD K++
Sbjct  120  ILSEIDRVMKKHADDLMNVMEGVSARLTQLESRTRNLENLVDDVKVSVGNSHGNTDGKMR  179

Query  755  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQ  862
             LE  + EV   VQ+L+DKQE+ +AQ +L+KLQ+++
Sbjct  180  QLENIMLEVQSGVQLLKDKQEILEAQLQLSKLQVSK  215



>ref|XP_009125985.1| PREDICTED: WW domain-binding protein 11 isoform X2 [Brassica 
rapa]
Length=536

 Score = 89.4 bits (220),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 69/96 (72%), Gaps = 0/96 (0%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  754
            ++  +++ MKK+AD+LM  +EG+S+RL+QLE    NL+  + +++  + + HG TD K++
Sbjct  119  ILSEIDRVMKKHADDLMNVMEGVSARLTQLESRTRNLENLVDDVKVSVGNSHGNTDGKMR  178

Query  755  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQ  862
             LE  + EV   VQ+L+DKQE+ +AQ +L+KLQ+++
Sbjct  179  QLENIMLEVQSGVQLLKDKQEILEAQLQLSKLQVSK  214



>ref|XP_004489226.1| PREDICTED: vacuolar protein sorting-associated protein 27-like 
[Cicer arietinum]
Length=550

 Score = 89.4 bits (220),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 75/106 (71%), Gaps = 5/106 (5%)
 Frame = +2

Query  566  NQDVIDA-----VEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  730
            +++ +DA     ++++MK++ DNL   LEG+S+RL+QLE   ++L+ S+ +++  + ++H
Sbjct  105  DRNTVDAAILLEIDRTMKRHMDNLHHVLEGVSARLTQLETRTHHLESSMDDLKVSVGNNH  164

Query  731  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKE  868
            G TD KL+ LE  LQEV   VQ ++DKQ++  AQ +LAKLQ+++ +
Sbjct  165  GITDGKLRLLENILQEVQTGVQDIKDKQDIVQAQLQLAKLQVSKTD  210



>ref|XP_011098435.1| PREDICTED: protein diaphanous homolog 1-like [Sesamum indicum]
Length=564

 Score = 89.4 bits (220),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 74/114 (65%), Gaps = 0/114 (0%)
 Frame = +2

Query  548  PEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHD  727
            P +   +  ++  ++K+MKKY +NLM  ++ +S+RLSQLE    +L+ SI +++  +  +
Sbjct  123  PSNVPLDVSLVSEIDKTMKKYMENLMHEVDKMSARLSQLETRTRSLENSIDDLKVSVGSN  182

Query  728  HGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNS  889
             G TD K++ LE  L+EV   VQ++RDKQE+ +AQ  +AKLQ+ + E   + N+
Sbjct  183  CGSTDGKMRLLENILREVQTGVQVIRDKQEIVEAQLHIAKLQVPKVEQVDSKNT  236



>emb|CDX85594.1| BnaA02g02190D [Brassica napus]
Length=487

 Score = 89.0 bits (219),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 69/96 (72%), Gaps = 0/96 (0%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  754
            ++  +++ MKK+AD+LM  +EG+S+RL+QLE    NL+  + +++  + + HG TD K++
Sbjct  119  ILSEIDRVMKKHADDLMNVMEGVSARLTQLESRTRNLENLVDDVKVSVGNSHGNTDGKMR  178

Query  755  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQ  862
             LE  + EV   VQ+L+DKQE+ +AQ +L+KLQ+++
Sbjct  179  QLENIMLEVQSGVQLLKDKQEILEAQLQLSKLQVSK  214



>ref|XP_008393001.1| PREDICTED: putative uncharacterized protein DDB_G0291608 [Malus 
domestica]
Length=525

 Score = 89.0 bits (219),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 72/116 (62%), Gaps = 1/116 (1%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  754
            +I  +E+ M ++  NL+  +EGLS+R+SQLE     L+ S+G+++     +HG+ D KL+
Sbjct  91   LISVIERKMDEHFGNLLHGVEGLSARISQLETRLRRLENSVGDLKDSTEINHGKADGKLR  150

Query  755  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERASQPA  922
             LE  L+EV   +Q LRDKQE+ +AQ ELAKLQ+ +    S N +  N +  S P 
Sbjct  151  QLENMLREVDXGMQDLRDKQEITEAQLELAKLQMLKGYQQSENQT-NNVQTVSAPG  205



>ref|XP_007217219.1| hypothetical protein PRUPE_ppa003425mg [Prunus persica]
 gb|EMJ18418.1| hypothetical protein PRUPE_ppa003425mg [Prunus persica]
Length=575

 Score = 89.0 bits (219),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/151 (34%), Positives = 89/151 (59%), Gaps = 8/151 (5%)
 Frame = +2

Query  575   VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  754
             V+  ++++MKK+ADNL+  LEG+S+RL+QLE    +L+ S+ +++  + ++HG  D K+ 
Sbjct  137   VVSEIDQAMKKHADNLLHVLEGVSARLTQLESRTRHLENSVDDLKVSVGNNHGNADGKMI  196

Query  755   SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLA------QKESGSANNSQQNEERASQ  916
              LE  L++V   V+ L+DKQ++ +AQ  LA++Q++      Q E  +A +    +  AS 
Sbjct  197   RLEDILRDVQTGVKDLKDKQDIVEAQLHLARIQVSNPKVDPQPEPQNAMHGDSGQAAASA  256

Query  917   PASDTKRSDSPCELHGQQLALALPHQVAPPQ  1009
             P    ++   P  L     A++  H  APPQ
Sbjct  257   PRHSHQQLPPPVNLPPSLPAVS--HPNAPPQ  285



>emb|CBI14977.3| unnamed protein product [Vitis vinifera]
Length=400

 Score = 87.4 bits (215),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 68/102 (67%), Gaps = 0/102 (0%)
 Frame = +2

Query  557  SSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGE  736
            +S++  +I  V+K MK++ D  +  ++ L +RLSQLE    N++  + E+++   ++HG 
Sbjct  16   TSYDGALISVVDKKMKEHTDTFLHVVDALITRLSQLESRTRNIESYVDELKASTEYNHGR  75

Query  737  TDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQ  862
            T+ KLK LE  L+EV   +  LRDKQE+ +AQ +LAKLQ+++
Sbjct  76   TNGKLKQLENTLREVQGGIHDLRDKQEIVEAQLQLAKLQVSK  117



>emb|CDX91045.1| BnaC02g05520D [Brassica napus]
Length=486

 Score = 87.8 bits (216),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 68/96 (71%), Gaps = 0/96 (0%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  754
            ++  +++ MKK+AD+LM  +EG+S+RL+QLE    NL+  + +++  + + HG TD K++
Sbjct  118  ILSEIDRVMKKHADDLMNVMEGVSARLTQLESRTRNLENLVDDVKVSVGNSHGNTDGKMR  177

Query  755  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQ  862
             LE  + EV   VQ+L+DKQE+ +AQ +L+KLQ+ +
Sbjct  178  QLENIMLEVQSGVQLLKDKQEILEAQLQLSKLQVPK  213



>ref|XP_009362960.1| PREDICTED: uncharacterized protein LOC103952977 isoform X1 [Pyrus 
x bretschneideri]
Length=440

 Score = 87.4 bits (215),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 59/164 (36%), Positives = 87/164 (53%), Gaps = 17/164 (10%)
 Frame = +2

Query  551   EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  730
             EDS+     I  +E+ M  +  NL+  +EGLS+R+SQLE     L  S+ + +     +H
Sbjct  160   EDSAL----ISVIERKMDDHFGNLLHAVEGLSARISQLETRLCRLQNSVDDFKDSTEINH  215

Query  731   GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERA  910
             G+ D KL+ LE  L+EV   +Q LRDKQE+ +A+ ELAKLQ+ +    S N +  N +  
Sbjct  216   GKADGKLRQLENMLREVDGGMQDLRDKQEITEARLELAKLQMLKGHQQSENQT-NNVQTV  274

Query  911   SQPA---SDTKRSDSPCELHGQQLALA---------LPHQVAPP  1006
             S P    S  ++SD P  +    L ++         LPHQ  PP
Sbjct  275   SAPGVLSSSPQQSDQPHAVQAPTLQVSTLPTDDPRTLPHQNFPP  318



>ref|XP_008230557.1| PREDICTED: protein transport protein SEC31 [Prunus mume]
Length=581

 Score = 87.8 bits (216),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 69/95 (73%), Gaps = 0/95 (0%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  754
            V+  ++++MKK+ADNL+  LEG+S+RL+QLE    +L+ S+ +++  + ++HG  D K++
Sbjct  137  VVSEIDQAMKKHADNLLHVLEGVSARLTQLESRTRHLENSVDDLKVSVGNNHGNADGKMR  196

Query  755  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLA  859
             LE  L++V   V+ L+DKQ++ +AQ  LA++Q++
Sbjct  197  RLEDILRDVQTGVKDLKDKQDIVEAQLHLARIQVS  231



>gb|KFK37621.1| hypothetical protein AALP_AA3G007100 [Arabis alpina]
Length=508

 Score = 87.4 bits (215),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 69/96 (72%), Gaps = 0/96 (0%)
 Frame = +2

Query  575  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  754
            +I  +++++KK+ D L+  +EG+S+RL+QLE   +NL+  + +++  + + HG +D K++
Sbjct  117  IISEIDRTVKKHVDTLLHVMEGVSARLTQLETRTHNLENLVDDLKVSVENSHGSSDGKMR  176

Query  755  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQ  862
             L+  L EV   VQ+L+DKQE+ +AQ +L+KLQ+++
Sbjct  177  RLQNILVEVQSGVQVLKDKQEIIEAQIQLSKLQVSK  212



>ref|XP_010663116.1| PREDICTED: vegetative cell wall protein gp1-like isoform X2 [Vitis 
vinifera]
 ref|XP_010663117.1| PREDICTED: vegetative cell wall protein gp1-like isoform X2 [Vitis 
vinifera]
 ref|XP_010663118.1| PREDICTED: vegetative cell wall protein gp1-like isoform X2 [Vitis 
vinifera]
 ref|XP_010663119.1| PREDICTED: vegetative cell wall protein gp1-like isoform X2 [Vitis 
vinifera]
Length=469

 Score = 87.4 bits (215),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 68/102 (67%), Gaps = 0/102 (0%)
 Frame = +2

Query  557  SSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGE  736
            +S++  +I  V+K MK++ D  +  ++ L +RLSQLE    N++  + E+++   ++HG 
Sbjct  16   TSYDGALISVVDKKMKEHTDTFLHVVDALITRLSQLESRTRNIESYVDELKASTEYNHGR  75

Query  737  TDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQ  862
            T+ KLK LE  L+EV   +  LRDKQE+ +AQ +LAKLQ+++
Sbjct  76   TNGKLKQLENTLREVQGGIHDLRDKQEIVEAQLQLAKLQVSK  117



>ref|XP_010663115.1| PREDICTED: proline-rich receptor-like protein kinase PERK10 isoform 
X1 [Vitis vinifera]
Length=524

 Score = 87.4 bits (215),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 68/102 (67%), Gaps = 0/102 (0%)
 Frame = +2

Query  557  SSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGE  736
            +S++  +I  V+K MK++ D  +  ++ L +RLSQLE    N++  + E+++   ++HG 
Sbjct  71   TSYDGALISVVDKKMKEHTDTFLHVVDALITRLSQLESRTRNIESYVDELKASTEYNHGR  130

Query  737  TDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQ  862
            T+ KLK LE  L+EV   +  LRDKQE+ +AQ +LAKLQ+++
Sbjct  131  TNGKLKQLENTLREVQGGIHDLRDKQEIVEAQLQLAKLQVSK  172



>gb|KEH24794.1| DNA-binding protein, putative [Medicago truncatula]
Length=565

 Score = 87.0 bits (214),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 71/104 (68%), Gaps = 5/104 (5%)
 Frame = +2

Query  566  NQDVIDA-----VEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  730
            NQ  +DA     ++++MKK+ DNL   LEG+S+RL+Q+E   ++L+ S+ +++  + ++H
Sbjct  118  NQSAVDASILLEIDRTMKKHMDNLHHVLEGVSARLTQVETRTHHLESSMDDLKVSVGNNH  177

Query  731  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQ  862
            G TD KL+ LE  L EV   V  ++DKQ++  AQ +LAKLQ+++
Sbjct  178  GITDGKLRLLENILSEVQTGVHDIKDKQDIMQAQLQLAKLQVSK  221



>gb|KJB40752.1| hypothetical protein B456_007G076000 [Gossypium raimondii]
Length=519

 Score = 85.9 bits (211),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/141 (35%), Positives = 83/141 (59%), Gaps = 7/141 (5%)
 Frame = +2

Query  560  SFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGET  739
             F+  ++ A++++MKK+ DNLM  LEG+  RL+QLE    NL+ S+ +++  + ++HG  
Sbjct  60   GFDTSLVAAIDRTMKKHTDNLMHMLEGVGDRLTQLESRTSNLETSVDDLKMSVGNNHGSI  119

Query  740  DSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERASQP  919
            D K++ LE  L+EV   V ++++KQE  +A  + AKLQ  + +  S  ++  +     Q 
Sbjct  120  DGKMRQLENILKEVQTEVHVVKEKQESVEALLQHAKLQETKMDQPSETHNTAHIGSMQQA  179

Query  920  ASDTKRSDSPCELHGQQLALA  982
            AS      +P + H QQL LA
Sbjct  180  AS------APFQSH-QQLPLA  193



>ref|XP_006341319.1| PREDICTED: trithorax group protein osa-like [Solanum tuberosum]
Length=526

 Score = 85.5 bits (210),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 71/104 (68%), Gaps = 0/104 (0%)
 Frame = +2

Query  557  SSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGE  736
            S+ +  ++  ++ ++KKYADNL+  +E +S+RLSQLE   + ++  + E++  + ++HG 
Sbjct  95   STIDASLLSEIDHTVKKYADNLLHAIESVSARLSQLETRSHQIEAFVVELKLSVDNNHGN  154

Query  737  TDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKE  868
            TD KL+ +E  L+EV   VQ++++KQ++ D Q +L KLQ+ + E
Sbjct  155  TDGKLRLVENILREVQDGVQVIKNKQDIMDTQLQLTKLQVPKFE  198



>gb|KJB40753.1| hypothetical protein B456_007G076000 [Gossypium raimondii]
Length=565

 Score = 85.1 bits (209),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 65/98 (66%), Gaps = 0/98 (0%)
 Frame = +2

Query  560  SFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGET  739
             F+  ++ A++++MKK+ DNLM  LEG+  RL+QLE    NL+ S+ +++  + ++HG  
Sbjct  106  GFDTSLVAAIDRTMKKHTDNLMHMLEGVGDRLTQLESRTSNLETSVDDLKMSVGNNHGSI  165

Query  740  DSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQ  853
            D K++ LE  L+EV   V ++++KQE  +A  + AKLQ
Sbjct  166  DGKMRQLENILKEVQTEVHVVKEKQESVEALLQHAKLQ  203



>gb|KJB40754.1| hypothetical protein B456_007G076000 [Gossypium raimondii]
Length=566

 Score = 85.1 bits (209),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 65/98 (66%), Gaps = 0/98 (0%)
 Frame = +2

Query  560  SFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGET  739
             F+  ++ A++++MKK+ DNLM  LEG+  RL+QLE    NL+ S+ +++  + ++HG  
Sbjct  107  GFDTSLVAAIDRTMKKHTDNLMHMLEGVGDRLTQLESRTSNLETSVDDLKMSVGNNHGSI  166

Query  740  DSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQ  853
            D K++ LE  L+EV   V ++++KQE  +A  + AKLQ
Sbjct  167  DGKMRQLENILKEVQTEVHVVKEKQESVEALLQHAKLQ  204



>tpg|DAA58177.1| TPA: putative DUF1421 domain family protein [Zea mays]
Length=154

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 57/85 (67%), Gaps = 2/85 (2%)
 Frame = +2

Query  545  PPEDSSF--NQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDL  718
            PP    F   + V+ AVE+ M+K AD L+  L+G+  RLSQLELYCY L++SIGE+RSD+
Sbjct  49   PPHQDGFYPKEAVMAAVEECMRKQADALLHSLDGIGGRLSQLELYCYKLERSIGELRSDV  108

Query  719  VHDHGETDSKLKSLEKHLQEVHRSV  793
            +  H E+ +  + ++K+L +V   V
Sbjct  109  MDYHSESTTNFRCIDKNLGQVRPRV  133



>gb|ACN28687.1| unknown [Zea mays]
 tpg|DAA58179.1| TPA: putative DUF1421 domain family protein [Zea mays]
Length=118

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 57/85 (67%), Gaps = 2/85 (2%)
 Frame = +2

Query  545  PPEDSSF--NQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDL  718
            PP    F   + V+ AVE+ M+K AD L+  L+G+  RLSQLELYCY L++SIGE+RSD+
Sbjct  13   PPHQDGFYPKEAVMAAVEECMRKQADALLHSLDGIGGRLSQLELYCYKLERSIGELRSDV  72

Query  719  VHDHGETDSKLKSLEKHLQEVHRSV  793
            +  H E+ +  + ++K+L +V   V
Sbjct  73   MDYHSESTTNFRCIDKNLGQVRPRV  97



>tpg|DAA58176.1| TPA: putative DUF1421 domain family protein [Zea mays]
Length=157

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 57/85 (67%), Gaps = 2/85 (2%)
 Frame = +2

Query  545  PPEDSSF--NQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDL  718
            PP    F   + V+ AVE+ M+K AD L+  L+G+  RLSQLELYCY L++SIGE+RSD+
Sbjct  52   PPHQDGFYPKEAVMAAVEECMRKQADALLHSLDGIGGRLSQLELYCYKLERSIGELRSDV  111

Query  719  VHDHGETDSKLKSLEKHLQEVHRSV  793
            +  H E+ +  + ++K+L +V   V
Sbjct  112  MDYHSESTTNFRCIDKNLGQVRPRV  136



>ref|XP_007150938.1| hypothetical protein PHAVU_004G007500g [Phaseolus vulgaris]
 gb|ESW22932.1| hypothetical protein PHAVU_004G007500g [Phaseolus vulgaris]
Length=575

 Score = 84.0 bits (206),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 71/101 (70%), Gaps = 0/101 (0%)
 Frame = +2

Query  557  SSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGE  736
            S+ +  ++  ++++M+K+ +N++  LEG+S+RL+QLE   ++L+ S+ +++  + ++HG 
Sbjct  127  SASDASMLAEIDRTMQKHMENMLNVLEGVSARLTQLETRTHHLENSVDDLKVSVGNNHGI  186

Query  737  TDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLA  859
            TD KL+ LE  L+EV   V  ++DKQ++  AQ + AKLQ++
Sbjct  187  TDGKLRQLENILREVQSGVLTIKDKQDIMQAQLQFAKLQMS  227



>ref|XP_008374404.1| PREDICTED: TSC22 domain family protein 1-like [Malus domestica]
Length=529

 Score = 84.0 bits (206),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 55/164 (34%), Positives = 84/164 (51%), Gaps = 17/164 (10%)
 Frame = +2

Query  551   EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  730
             EDS+    +I  +E+ M ++  NL+  +EGLS+ +SQLE     L  S+ + +     +H
Sbjct  88    EDSA----LISXIERKMNQHFGNLLHAVEGLSAXISQLETRLRRLXNSVDDFKDSTEINH  143

Query  731   GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERA  910
             G+ D KL+ LE  L+EV   +Q LRDKQE+ +A+  LAKLQ+ + +  S N +  N ++ 
Sbjct  144   GKADGKLRQLENMLREVDSGMQNLRDKQEITEARLXLAKLQMLKGQQQSENQA-XNVQKV  202

Query  911   SQPASDTKRSDSPCELHGQQLAL------------ALPHQVAPP  1006
             S P   +       +LH  Q                LPHQ  PP
Sbjct  203   SSPGVQSSAPQQSYQLHSVQAPTLQVPSLPTNDPGTLPHQNFPP  246



>gb|ACZ74657.1| hypothetical protein [Phaseolus vulgaris]
Length=574

 Score = 84.0 bits (206),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 71/101 (70%), Gaps = 0/101 (0%)
 Frame = +2

Query  557  SSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGE  736
            S+ +  ++  ++++M+K+ +N++  LEG+S+RL+QLE   ++L+ S+ +++  + ++HG 
Sbjct  126  SASDASMLAEIDRTMQKHMENMLNVLEGVSARLTQLETRTHHLENSVDDLKVSVGNNHGI  185

Query  737  TDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLA  859
            TD KL+ LE  L+EV   V  ++DKQ++  AQ + AKLQ++
Sbjct  186  TDGKLRQLENILREVQSGVLTIKDKQDIMQAQLQFAKLQMS  226



>ref|XP_008219121.1| PREDICTED: uncharacterized protein LOC103319367 [Prunus mume]
Length=1861

 Score = 84.3 bits (207),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 88/145 (61%), Gaps = 3/145 (2%)
 Frame = +2

Query  575   VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  754
             ++  ++++MKK+ D+L+  LEG+S +L+QLE    +L+ S+ +++  + ++HG TD K++
Sbjct  128   IVSEIDRTMKKHVDSLLHVLEGVSEKLTQLESRTRHLENSVDDLKISVGNNHGNTDGKMR  187

Query  755   SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERASQPASDTK  934
              LE  L++V   +Q+L+DKQ + +AQ +L K Q++  +  + +     +  AS+     +
Sbjct  188   QLENVLRDVQTGIQVLKDKQAIVEAQLQLGKTQVSNSKVDTQSQV-SGQTVASESTQAHQ  246

Query  935   RSDSPCELHGQQLALALPHQVAPPQ  1009
             +S  P  L     A++ P+  APPQ
Sbjct  247   QSPHPVNLPSSLPAVSPPN--APPQ  269



>gb|KHG20812.1| Actin cytoskeleton-regulatory complex PAN1 [Gossypium arboreum]
Length=566

 Score = 82.4 bits (202),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 82/141 (58%), Gaps = 7/141 (5%)
 Frame = +2

Query  560  SFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGET  739
             F+  ++ A++++MKK+ DNLM  LEG+  RL+QLE     L+ S+ +++  + ++HG  
Sbjct  107  GFDTSLVAAIDRTMKKHTDNLMHMLEGVGDRLTQLESRTSKLETSVDDLKMSVGNNHGSI  166

Query  740  DSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKESGSANNSQQNEERASQP  919
            D K++ LE  L+EV   V ++++KQE  +A  + AKLQ  + +  S  ++  +     Q 
Sbjct  167  DGKMRQLENILKEVQTEVHVVKEKQESVEALLQHAKLQETKMDQPSETHNTAHIGSMQQA  226

Query  920  ASDTKRSDSPCELHGQQLALA  982
            AS      +P + H QQL LA
Sbjct  227  AS------APFQSH-QQLPLA  240



>ref|NP_186805.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE73688.1| uncharacterized protein AT3G01560 [Arabidopsis thaliana]
Length=511

 Score = 81.6 bits (200),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 71/104 (68%), Gaps = 3/104 (3%)
 Frame = +2

Query  563  FNQDVI-DAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGET  739
            FN  ++ + ++++MKK+ D L+  +EG+S+RLSQLE   +NL+  + +++  + + HG T
Sbjct  125  FNTTIMSEIIDRTMKKHTDTLLHVMEGVSARLSQLETRTHNLENLVDDLKVSVDNSHGST  184

Query  740  DSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQKES  871
            D K++ L+  L EV   VQ+L+DKQE+ +AQ  L+K Q++ + +
Sbjct  185  DGKMRQLKNILVEVQSGVQLLKDKQEILEAQ--LSKHQVSNQHA  226



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4008105817222