BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig3828

Length=814
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009614756.1|  PREDICTED: probable protein phosphatase 2C 55      114   2e-25   Nicotiana tomentosiformis
ref|XP_009761616.1|  PREDICTED: probable protein phosphatase 2C 55      113   6e-25   Nicotiana sylvestris
ref|XP_004252785.1|  PREDICTED: probable protein phosphatase 2C 55      112   8e-25   Solanum lycopersicum
ref|XP_006342592.1|  PREDICTED: probable protein phosphatase 2C 5...    112   9e-25   Solanum tuberosum [potatoes]
ref|XP_011074517.1|  PREDICTED: probable protein phosphatase 2C 55      109   2e-23   Sesamum indicum [beniseed]
gb|EYU45128.1|  hypothetical protein MIMGU_mgv1a005010mg                102   2e-21   Erythranthe guttata [common monkey flower]
gb|EYU32793.1|  hypothetical protein MIMGU_mgv1a004775mg              99.8    3e-20   Erythranthe guttata [common monkey flower]
ref|XP_009805012.1|  PREDICTED: probable protein phosphatase 2C 55    96.7    4e-19   Nicotiana sylvestris
ref|XP_011083717.1|  PREDICTED: probable protein phosphatase 2C 5...  93.2    6e-18   Sesamum indicum [beniseed]
ref|XP_011083714.1|  PREDICTED: probable protein phosphatase 2C 5...  93.2    6e-18   Sesamum indicum [beniseed]
ref|XP_009612193.1|  PREDICTED: probable protein phosphatase 2C 55    92.8    7e-18   Nicotiana tomentosiformis
emb|CDP07546.1|  unnamed protein product                              87.0    8e-16   Coffea canephora [robusta coffee]
ref|XP_008220774.1|  PREDICTED: probable protein phosphatase 2C 55    85.5    2e-15   Prunus mume [ume]
ref|XP_010664663.1|  PREDICTED: probable protein phosphatase 2C 55    85.5    2e-15   Vitis vinifera
ref|XP_007223264.1|  hypothetical protein PRUPE_ppa004472mg           85.1    3e-15   Prunus persica
gb|KJB14506.1|  hypothetical protein B456_002G129300                  81.3    4e-14   Gossypium raimondii
gb|KJB14505.1|  hypothetical protein B456_002G129300                  81.3    5e-14   Gossypium raimondii
gb|KJB14503.1|  hypothetical protein B456_002G129300                  81.3    5e-14   Gossypium raimondii
gb|KHG04398.1|  hypothetical protein F383_28830                       81.3    6e-14   Gossypium arboreum [tree cotton]
ref|XP_002510354.1|  protein phosphatase 2c, putative                 81.3    6e-14   
ref|XP_012071803.1|  PREDICTED: probable protein phosphatase 2C 5...  76.6    2e-12   Jatropha curcas
ref|XP_012071802.1|  PREDICTED: probable protein phosphatase 2C 5...  76.6    2e-12   Jatropha curcas
ref|XP_006375084.1|  hypothetical protein POPTR_0014s04230g           75.1    7e-12   
ref|XP_006375083.1|  hypothetical protein POPTR_0014s04230g           75.1    7e-12   
ref|XP_011031594.1|  PREDICTED: probable protein phosphatase 2C 55    74.7    8e-12   Populus euphratica
ref|XP_011652404.1|  PREDICTED: probable protein phosphatase 2C 5...  73.6    2e-11   Cucumis sativus [cucumbers]
ref|XP_011652405.1|  PREDICTED: probable protein phosphatase 2C 5...  73.6    2e-11   Cucumis sativus [cucumbers]
ref|XP_010106023.1|  putative protein phosphatase 2C 55               73.2    2e-11   
ref|XP_008377320.1|  PREDICTED: probable protein phosphatase 2C 55    73.2    3e-11   Malus domestica [apple tree]
ref|XP_010028040.1|  PREDICTED: probable protein phosphatase 2C 55    72.0    6e-11   Eucalyptus grandis [rose gum]
ref|XP_008466602.1|  PREDICTED: probable protein phosphatase 2C 5...  72.0    6e-11   Cucumis melo [Oriental melon]
ref|XP_008466601.1|  PREDICTED: probable protein phosphatase 2C 5...  72.0    7e-11   Cucumis melo [Oriental melon]
ref|XP_007017479.1|  Phosphatase 2c, putative isoform 1               72.0    7e-11   
ref|XP_007017482.1|  Phosphatase 2c, putative isoform 4               71.6    8e-11   
ref|XP_007017484.1|  Phosphatase 2c, putative isoform 6               71.6    8e-11   
ref|XP_007017480.1|  Phosphatase 2c, putative isoform 2               71.6    8e-11   
ref|XP_007017483.1|  Phosphatase 2c, putative isoform 5               71.6    9e-11   
ref|XP_008377406.1|  PREDICTED: probable protein phosphatase 2C 55    70.5    2e-10   
ref|XP_009365583.1|  PREDICTED: probable protein phosphatase 2C 55    70.1    3e-10   Pyrus x bretschneideri [bai li]
ref|XP_006473470.1|  PREDICTED: probable protein phosphatase 2C 5...  68.9    6e-10   Citrus sinensis [apfelsine]
ref|XP_006473471.1|  PREDICTED: probable protein phosphatase 2C 5...  68.9    7e-10   Citrus sinensis [apfelsine]
ref|XP_009364699.1|  PREDICTED: probable protein phosphatase 2C 55    68.6    8e-10   Pyrus x bretschneideri [bai li]
gb|KDO84479.1|  hypothetical protein CISIN_1g010417mg                 67.8    1e-09   Citrus sinensis [apfelsine]
ref|XP_006434954.1|  hypothetical protein CICLE_v10000910mg           67.8    1e-09   Citrus clementina [clementine]
gb|KDO84478.1|  hypothetical protein CISIN_1g010417mg                 67.8    1e-09   Citrus sinensis [apfelsine]
gb|KDO84477.1|  hypothetical protein CISIN_1g010417mg                 67.8    1e-09   Citrus sinensis [apfelsine]
ref|XP_006434953.1|  hypothetical protein CICLE_v10000910mg           67.8    2e-09   Citrus clementina [clementine]
gb|KDO84475.1|  hypothetical protein CISIN_1g010417mg                 67.8    2e-09   Citrus sinensis [apfelsine]
ref|XP_010556299.1|  PREDICTED: probable protein phosphatase 2C 55    67.8    2e-09   Tarenaya hassleriana [spider flower]
ref|XP_006341911.1|  PREDICTED: probable protein phosphatase 2C 5...  66.2    4e-09   Solanum tuberosum [potatoes]
gb|KJB58309.1|  hypothetical protein B456_009G204100                  62.8    7e-08   Gossypium raimondii
gb|KJB58311.1|  hypothetical protein B456_009G204100                  62.8    7e-08   Gossypium raimondii
ref|XP_004238238.1|  PREDICTED: probable protein phosphatase 2C 55    61.2    3e-07   Solanum lycopersicum
gb|KHG28173.1|  hypothetical protein F383_08076                       60.8    3e-07   Gossypium arboreum [tree cotton]
gb|KEH40106.1|  protein phosphatase 2C family protein                 58.9    1e-06   Medicago truncatula
ref|XP_007160777.1|  hypothetical protein PHAVU_001G015900g           58.2    2e-06   Phaseolus vulgaris [French bean]
ref|XP_010244316.1|  PREDICTED: probable protein phosphatase 2C 5...  58.2    3e-06   Nelumbo nucifera [Indian lotus]
ref|XP_006595942.1|  PREDICTED: probable protein phosphatase 2C 5...  58.2    3e-06   Glycine max [soybeans]
ref|XP_003544423.1|  PREDICTED: probable protein phosphatase 2C 5...  57.8    3e-06   Glycine max [soybeans]
ref|XP_010244315.1|  PREDICTED: probable protein phosphatase 2C 5...  57.8    3e-06   Nelumbo nucifera [Indian lotus]
gb|KDP38477.1|  hypothetical protein JCGZ_04402                       53.9    7e-05   Jatropha curcas
ref|XP_006601312.1|  PREDICTED: probable protein phosphatase 2C 5...  53.1    1e-04   Glycine max [soybeans]
ref|XP_003550371.1|  PREDICTED: probable protein phosphatase 2C 5...  53.1    1e-04   Glycine max [soybeans]
gb|KHN12726.1|  Hypothetical protein glysoja_008689                   53.1    1e-04   Glycine soja [wild soybean]
ref|XP_004499136.1|  PREDICTED: probable protein phosphatase 2C 5...  50.8    7e-04   



>ref|XP_009614756.1| PREDICTED: probable protein phosphatase 2C 55 [Nicotiana tomentosiformis]
Length=518

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 76/103 (74%), Gaps = 1/103 (1%)
 Frame = +1

Query  505  MPFKNLLIVRSAKKHGFERLIFGCQSGCQESVEILVAQGRLLLSGHSKLFHSLPSASLAG  684
            MP   L  +  A + G ++ I G +SG Q+SVEILV QGRLLL G+SK F+S+P A    
Sbjct  1    MPSNYLFRLSRAARQGLQKSISGQESGLQDSVEILVGQGRLLL-GNSKSFYSIPFARSTD  59

Query  685  VHDFVRPGTLAAAQANLHTVNRRKNLSVVGAFSRAISIPSXSG  813
            ++ FVRPGTLAA QANLH VN++KNLSVVG+ SRAISIPS SG
Sbjct  60   LNVFVRPGTLAATQANLHIVNQKKNLSVVGSISRAISIPSVSG  102



>ref|XP_009761616.1| PREDICTED: probable protein phosphatase 2C 55 [Nicotiana sylvestris]
 ref|XP_009761618.1| PREDICTED: probable protein phosphatase 2C 55 [Nicotiana sylvestris]
Length=518

 Score =   113 bits (282),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 75/103 (73%), Gaps = 1/103 (1%)
 Frame = +1

Query  505  MPFKNLLIVRSAKKHGFERLIFGCQSGCQESVEILVAQGRLLLSGHSKLFHSLPSASLAG  684
            MP   L  +  A + G ++ I G +SG Q+SVEILV QGRLLL G+SK F+S+P A    
Sbjct  1    MPSNYLFRLSRAARQGLQKSISGQESGLQDSVEILVGQGRLLL-GNSKSFYSIPFARSGD  59

Query  685  VHDFVRPGTLAAAQANLHTVNRRKNLSVVGAFSRAISIPSXSG  813
            ++ FVRPGTLAA QANLH VN++KNLS VG+ SRAISIPS SG
Sbjct  60   LNVFVRPGTLAATQANLHMVNQKKNLSAVGSISRAISIPSVSG  102



>ref|XP_004252785.1| PREDICTED: probable protein phosphatase 2C 55 [Solanum lycopersicum]
 ref|XP_010314634.1| PREDICTED: probable protein phosphatase 2C 55 [Solanum lycopersicum]
Length=519

 Score =   112 bits (281),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 75/103 (73%), Gaps = 1/103 (1%)
 Frame = +1

Query  505  MPFKNLLIVRSAKKHGFERLIFGCQSGCQESVEILVAQGRLLLSGHSKLFHSLPSASLAG  684
            MP   L  +  A + G ++ I G +SG Q+SVEILVAQGRLL  G+SK F+S+P A    
Sbjct  1    MPSNYLFRLSRAARQGLQKSISGKESGLQDSVEILVAQGRLLF-GNSKCFYSVPFARATD  59

Query  685  VHDFVRPGTLAAAQANLHTVNRRKNLSVVGAFSRAISIPSXSG  813
            ++  VRPGTLAAAQANLH  N++KN+SVVGA SRA+SIPS SG
Sbjct  60   LNVLVRPGTLAAAQANLHVANQKKNISVVGAISRAVSIPSVSG  102



>ref|XP_006342592.1| PREDICTED: probable protein phosphatase 2C 55-like isoform X1 
[Solanum tuberosum]
 ref|XP_006342593.1| PREDICTED: probable protein phosphatase 2C 55-like isoform X2 
[Solanum tuberosum]
 ref|XP_006342594.1| PREDICTED: probable protein phosphatase 2C 55-like isoform X3 
[Solanum tuberosum]
 ref|XP_006342595.1| PREDICTED: probable protein phosphatase 2C 55-like isoform X4 
[Solanum tuberosum]
Length=519

 Score =   112 bits (281),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 75/103 (73%), Gaps = 1/103 (1%)
 Frame = +1

Query  505  MPFKNLLIVRSAKKHGFERLIFGCQSGCQESVEILVAQGRLLLSGHSKLFHSLPSASLAG  684
            MP   L  +  A + G ++ I G +SG Q+SVEILVAQGRLL  G+SK F+S+P A    
Sbjct  1    MPSNYLFRLSRAARQGLQKSISGKESGLQDSVEILVAQGRLLF-GNSKCFYSVPFARPTD  59

Query  685  VHDFVRPGTLAAAQANLHTVNRRKNLSVVGAFSRAISIPSXSG  813
            ++  VRPGTLAAAQ NLH VN++KN+SVVGA SRA+SIPS SG
Sbjct  60   LNVLVRPGTLAAAQTNLHVVNQKKNISVVGAISRAVSIPSVSG  102



>ref|XP_011074517.1| PREDICTED: probable protein phosphatase 2C 55 [Sesamum indicum]
Length=518

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 71/103 (69%), Gaps = 1/103 (1%)
 Frame = +1

Query  505  MPFKNLLIVRSAKKHGFERLIFGCQSGCQESVEILVAQGRLLLSGHSKLFHSLPSASLAG  684
            MP      +R     G  RLI G ++G Q+    L+ QG+LLL G+S+L HSLPS +   
Sbjct  1    MPSNCFRRLRGGAWEGVWRLISGRETGIQDQFYGLIGQGKLLL-GNSRLLHSLPSGAFTD  59

Query  685  VHDFVRPGTLAAAQANLHTVNRRKNLSVVGAFSRAISIPSXSG  813
            +H FVRPGT+AAAQANL   NRRKN+SVVGAFSRAISIPS SG
Sbjct  60   LHVFVRPGTIAAAQANLCLANRRKNISVVGAFSRAISIPSVSG  102



>gb|EYU45128.1| hypothetical protein MIMGU_mgv1a005010mg [Erythranthe guttata]
Length=501

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 63/78 (81%), Gaps = 1/78 (1%)
 Frame = +1

Query  580  SGCQESVEILVAQGRLLLSGHSKLFHSLPSASLAGVHDFVRPGTLAAAQANLHTVNRRKN  759
            SG QE+ + L+ QG+ L+ G S+L HSLPS +L  +HDFVRPGT+A+AQANLH  NRR+N
Sbjct  26   SGIQENSDALIGQGKALV-GQSRLVHSLPSRTLTDLHDFVRPGTVASAQANLHIANRRRN  84

Query  760  LSVVGAFSRAISIPSXSG  813
            LSV GAFSRAIS+PS +G
Sbjct  85   LSVAGAFSRAISLPSVTG  102



>gb|EYU32793.1| hypothetical protein MIMGU_mgv1a004775mg [Erythranthe guttata]
Length=511

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 72/96 (75%), Gaps = 2/96 (2%)
 Frame = +1

Query  529  VRSAKKHGFERLIFGCQSGCQESV-EILVAQGRLLLSGHSKLFHSLPSASLAGVHDFVRP  705
            +R A   G  R + G +   Q+ V ++L+ QG+LLL G S+L HSLPS + A +H F+RP
Sbjct  8    LRGAIWQGAWRSVSGKEIRIQDQVVDVLIGQGKLLL-GQSRLLHSLPSGAFADLHVFIRP  66

Query  706  GTLAAAQANLHTVNRRKNLSVVGAFSRAISIPSXSG  813
            GT+AAAQANLH+ ++RK+LSVVGAFSR+IS+PS SG
Sbjct  67   GTIAAAQANLHSASQRKSLSVVGAFSRSISLPSVSG  102



>ref|XP_009805012.1| PREDICTED: probable protein phosphatase 2C 55 [Nicotiana sylvestris]
 ref|XP_009805013.1| PREDICTED: probable protein phosphatase 2C 55 [Nicotiana sylvestris]
Length=517

 Score = 96.7 bits (239),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 66/92 (72%), Gaps = 3/92 (3%)
 Frame = +1

Query  538  AKKHGFERLIFGCQSGCQESVEILVAQGRLLLSGHSKLFHSLPSASLAGVHDFVRPGTLA  717
            A + G ++ I G +S  Q+ VEILVA+ RLL     K F S+PSA L+ +H  VRPGTLA
Sbjct  12   AVRQGIKKSISGQESRLQDLVEILVAEERLLFG---KFFCSVPSARLSDLHVIVRPGTLA  68

Query  718  AAQANLHTVNRRKNLSVVGAFSRAISIPSXSG  813
            AAQANL+ VN+RKN SVVGA  RA+SIPS SG
Sbjct  69   AAQANLNIVNQRKNFSVVGAIPRALSIPSVSG  100



>ref|XP_011083717.1| PREDICTED: probable protein phosphatase 2C 55 isoform X2 [Sesamum 
indicum]
Length=516

 Score = 93.2 bits (230),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 66/103 (64%), Gaps = 2/103 (2%)
 Frame = +1

Query  505  MPFKNLLIVRSAKKHGFERLIFGCQSGCQESVEILVAQGRLLLSGHSKLFHSLPSASLAG  684
            MP   L  + SA + G  R + G   G ++ +++L+ QG++LL GH +  HSLPS     
Sbjct  1    MPSNYLSRLHSAIREGVWRSVSGKGGGIEDQIDVLIGQGKVLL-GHCRNIHSLPSGPFTD  59

Query  685  VHDFVRPGTLAAAQANLHTVNRRKNLSVVGAFSRAISIPSXSG  813
            +  FVRPGT+ AAQAN H  NR+K  SV GAFSRA+SIPS SG
Sbjct  60   LQVFVRPGTVVAAQAN-HIANRKKKFSVAGAFSRAMSIPSVSG  101



>ref|XP_011083714.1| PREDICTED: probable protein phosphatase 2C 55 isoform X1 [Sesamum 
indicum]
 ref|XP_011083715.1| PREDICTED: probable protein phosphatase 2C 55 isoform X1 [Sesamum 
indicum]
 ref|XP_011083716.1| PREDICTED: probable protein phosphatase 2C 55 isoform X1 [Sesamum 
indicum]
Length=517

 Score = 93.2 bits (230),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 66/103 (64%), Gaps = 2/103 (2%)
 Frame = +1

Query  505  MPFKNLLIVRSAKKHGFERLIFGCQSGCQESVEILVAQGRLLLSGHSKLFHSLPSASLAG  684
            MP   L  + SA + G  R + G   G ++ +++L+ QG++LL GH +  HSLPS     
Sbjct  1    MPSNYLSRLHSAIREGVWRSVSGKGGGIEDQIDVLIGQGKVLL-GHCRNIHSLPSGPFTD  59

Query  685  VHDFVRPGTLAAAQANLHTVNRRKNLSVVGAFSRAISIPSXSG  813
            +  FVRPGT+ AAQAN H  NR+K  SV GAFSRA+SIPS SG
Sbjct  60   LQVFVRPGTVVAAQAN-HIANRKKKFSVAGAFSRAMSIPSVSG  101



>ref|XP_009612193.1| PREDICTED: probable protein phosphatase 2C 55 [Nicotiana tomentosiformis]
 ref|XP_009612194.1| PREDICTED: probable protein phosphatase 2C 55 [Nicotiana tomentosiformis]
Length=517

 Score = 92.8 bits (229),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 64/92 (70%), Gaps = 3/92 (3%)
 Frame = +1

Query  538  AKKHGFERLIFGCQSGCQESVEILVAQGRLLLSGHSKLFHSLPSASLAGVHDFVRPGTLA  717
            A + G ++ I G +S  Q+ VEIL A+ RLL     K F S+PSA L+ +H  VRPGTLA
Sbjct  12   AVRQGIQKSISGQESRLQDLVEILAAEERLLFG---KFFCSVPSAGLSDLHVIVRPGTLA  68

Query  718  AAQANLHTVNRRKNLSVVGAFSRAISIPSXSG  813
            AAQANL+ VN+RKN SVV A  RA+SIPS SG
Sbjct  69   AAQANLNIVNQRKNFSVVSAIPRALSIPSVSG  100



>emb|CDP07546.1| unnamed protein product [Coffea canephora]
Length=513

 Score = 87.0 bits (214),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 60/100 (60%), Gaps = 19/100 (19%)
 Frame = +1

Query  547  HGFERLIFGCQSGCQES-----------VEILVAQGRLLLSGHSKLFHSLPSASLAGVHD  693
            + F RLI  C+ G Q S           VE+ ++Q +LL  G         S +++ +H 
Sbjct  4    NSFSRLIVACRQGVQRSISSQGGGLQDLVELPISQAKLLFGG--------ASGTISDLHG  55

Query  694  FVRPGTLAAAQANLHTVNRRKNLSVVGAFSRAISIPSXSG  813
             VRPGTLAAAQANLH  NRRKNLS  GAFSRAIS+PS SG
Sbjct  56   LVRPGTLAAAQANLHVANRRKNLSFAGAFSRAISLPSVSG  95



>ref|XP_008220774.1| PREDICTED: probable protein phosphatase 2C 55 [Prunus mume]
 ref|XP_008220775.1| PREDICTED: probable protein phosphatase 2C 55 [Prunus mume]
Length=508

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 70/103 (68%), Gaps = 5/103 (5%)
 Frame = +1

Query  505  MPFKNLLIVRSAKKHGFERLIFGCQSGCQESVEILVAQGRLLLSGHSKLFHSLPSASLAG  684
            MP  +L  +R+A     +R I G + G Q+S++ L+ QG+LL  G+SKLF S P ++++ 
Sbjct  1    MPSSHLSKLRTA----LQRSIVGQEGGLQDSLDGLIGQGKLLF-GNSKLFQSRPFSTISD  55

Query  685  VHDFVRPGTLAAAQANLHTVNRRKNLSVVGAFSRAISIPSXSG  813
            +H F+ PGT+ AA+++   VN+RKN+SVVG  SR IS PS SG
Sbjct  56   LHAFLSPGTVFAARSDSQLVNQRKNISVVGEISRIISTPSVSG  98



>ref|XP_010664663.1| PREDICTED: probable protein phosphatase 2C 55 [Vitis vinifera]
 ref|XP_010664664.1| PREDICTED: probable protein phosphatase 2C 55 [Vitis vinifera]
 ref|XP_010664665.1| PREDICTED: probable protein phosphatase 2C 55 [Vitis vinifera]
 ref|XP_010664666.1| PREDICTED: probable protein phosphatase 2C 55 [Vitis vinifera]
Length=519

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 64/95 (67%), Gaps = 1/95 (1%)
 Frame = +1

Query  529  VRSAKKHGFERLIFGCQSGCQESVEILVAQGRLLLSGHSKLFHSLPSASLAGVHDFVRPG  708
            +R A  HG +R   G   G Q+SVE+L+ +G+LL  G+S+LFHS P +SL+ +H  + PG
Sbjct  9    LRKAVHHGIQRSTIGQGGGLQDSVEVLLWRGKLLF-GNSRLFHSKPFSSLSDLHVLLHPG  67

Query  709  TLAAAQANLHTVNRRKNLSVVGAFSRAISIPSXSG  813
            T   A+++ H  N+R+ LSVVG  SRA SIPS SG
Sbjct  68   TDFVARSDSHLGNQRRTLSVVGTLSRAFSIPSVSG  102



>ref|XP_007223264.1| hypothetical protein PRUPE_ppa004472mg [Prunus persica]
 gb|EMJ24463.1| hypothetical protein PRUPE_ppa004472mg [Prunus persica]
Length=508

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 70/103 (68%), Gaps = 5/103 (5%)
 Frame = +1

Query  505  MPFKNLLIVRSAKKHGFERLIFGCQSGCQESVEILVAQGRLLLSGHSKLFHSLPSASLAG  684
            MP  +L  +R+A     +R I G + G Q+S++ L+ QG+LL  G+SKLF S P ++++ 
Sbjct  1    MPSSHLSKLRTA----LQRSIVGQEGGLQDSLDGLIGQGKLLF-GNSKLFQSRPFSTISD  55

Query  685  VHDFVRPGTLAAAQANLHTVNRRKNLSVVGAFSRAISIPSXSG  813
            +H F+ PGT+ AA+++   VN+RKN+SVVG  SR IS PS SG
Sbjct  56   LHAFLSPGTVFAARSDSQLVNQRKNISVVGEISRIISTPSVSG  98



>gb|KJB14506.1| hypothetical protein B456_002G129300 [Gossypium raimondii]
Length=456

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 66/103 (64%), Gaps = 5/103 (5%)
 Frame = +1

Query  505  MPFKNLLIVRSAKKHGFERLIFGCQSGCQESVEILVAQGRLLLSGHSKLFHSLPSASLAG  684
            MP      +RSA ++G +R     + G Q+S+E+L+  G+L   G+ + FHSL  + L  
Sbjct  1    MPSTYFWRLRSAVQNGIQRT----KCGSQDSIEVLIGTGKLGF-GNYRFFHSLRFSRLVD  55

Query  685  VHDFVRPGTLAAAQANLHTVNRRKNLSVVGAFSRAISIPSXSG  813
            +   ++PGT+ AA+++ H  NRR+N+SVVGA SR IS+PS SG
Sbjct  56   LRGLLQPGTVLAARSDSHVANRRRNISVVGAVSRTISVPSVSG  98



>gb|KJB14505.1| hypothetical protein B456_002G129300 [Gossypium raimondii]
 gb|KJB14507.1| hypothetical protein B456_002G129300 [Gossypium raimondii]
 gb|KJB14508.1| hypothetical protein B456_002G129300 [Gossypium raimondii]
Length=511

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 66/103 (64%), Gaps = 5/103 (5%)
 Frame = +1

Query  505  MPFKNLLIVRSAKKHGFERLIFGCQSGCQESVEILVAQGRLLLSGHSKLFHSLPSASLAG  684
            MP      +RSA ++G +R     + G Q+S+E+L+  G+L   G+ + FHSL  + L  
Sbjct  1    MPSTYFWRLRSAVQNGIQR----TKCGSQDSIEVLIGTGKLGF-GNYRFFHSLRFSRLVD  55

Query  685  VHDFVRPGTLAAAQANLHTVNRRKNLSVVGAFSRAISIPSXSG  813
            +   ++PGT+ AA+++ H  NRR+N+SVVGA SR IS+PS SG
Sbjct  56   LRGLLQPGTVLAARSDSHVANRRRNISVVGAVSRTISVPSVSG  98



>gb|KJB14503.1| hypothetical protein B456_002G129300 [Gossypium raimondii]
 gb|KJB14504.1| hypothetical protein B456_002G129300 [Gossypium raimondii]
Length=514

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 66/103 (64%), Gaps = 5/103 (5%)
 Frame = +1

Query  505  MPFKNLLIVRSAKKHGFERLIFGCQSGCQESVEILVAQGRLLLSGHSKLFHSLPSASLAG  684
            MP      +RSA ++G +R     + G Q+S+E+L+  G+L   G+ + FHSL  + L  
Sbjct  1    MPSTYFWRLRSAVQNGIQR----TKCGSQDSIEVLIGTGKLGF-GNYRFFHSLRFSRLVD  55

Query  685  VHDFVRPGTLAAAQANLHTVNRRKNLSVVGAFSRAISIPSXSG  813
            +   ++PGT+ AA+++ H  NRR+N+SVVGA SR IS+PS SG
Sbjct  56   LRGLLQPGTVLAARSDSHVANRRRNISVVGAVSRTISVPSVSG  98



>gb|KHG04398.1| hypothetical protein F383_28830 [Gossypium arboreum]
Length=533

 Score = 81.3 bits (199),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 66/103 (64%), Gaps = 5/103 (5%)
 Frame = +1

Query  505  MPFKNLLIVRSAKKHGFERLIFGCQSGCQESVEILVAQGRLLLSGHSKLFHSLPSASLAG  684
            MP      +RSA ++G +R     + G Q+S+E+L+  G+L   G+ + FHSL  + L  
Sbjct  1    MPSTYFWRLRSAVQNGIQR----TECGSQDSIEVLIGTGKLGF-GNYRFFHSLRFSRLVD  55

Query  685  VHDFVRPGTLAAAQANLHTVNRRKNLSVVGAFSRAISIPSXSG  813
            +   ++PGT+ AA+++ H  NRR+N+SVVGA SR IS+PS SG
Sbjct  56   LRGLLQPGTVLAARSDSHLANRRRNISVVGAVSRTISVPSVSG  98



>ref|XP_002510354.1| protein phosphatase 2c, putative [Ricinus communis]
 gb|EEF52541.1| protein phosphatase 2c, putative [Ricinus communis]
Length=512

 Score = 81.3 bits (199),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 44/103 (43%), Positives = 65/103 (63%), Gaps = 1/103 (1%)
 Frame = +1

Query  505  MPFKNLLIVRSAKKHGFERLIFGCQSGCQESVEILVAQGRLLLSGHSKLFHSLPSASLAG  684
            MP      +R+A ++   R + G + G Q+S EIL+ Q +     + +LFHS+  ASLA 
Sbjct  1    MPSTYFSRLRTAAQNEIRRSVVGQERGFQDSAEILIGQLKSRFCNY-RLFHSVRIASLAE  59

Query  685  VHDFVRPGTLAAAQANLHTVNRRKNLSVVGAFSRAISIPSXSG  813
            +   + PGT+ AAQ++L  VNR++N+SVVGA SR  S+PS SG
Sbjct  60   IQALLGPGTVFAAQSDLQLVNRKRNISVVGALSRTFSVPSVSG  102



>ref|XP_012071803.1| PREDICTED: probable protein phosphatase 2C 55 isoform X2 [Jatropha 
curcas]
Length=511

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 67/103 (65%), Gaps = 2/103 (2%)
 Frame = +1

Query  505  MPFKNLLIVRSAKKHGFERLIFGCQSGCQESVEILVAQGRLLLSGHSKLFHSLPSASLAG  684
            MP      +R A ++  + ++ G + G ++S EIL+ Q +   S + +LFHS+  ASLA 
Sbjct  1    MPSTYFSRIRGAVQNEIQSIV-GQEGGLRDSAEILIGQAKSRFSNY-RLFHSVRMASLAD  58

Query  685  VHDFVRPGTLAAAQANLHTVNRRKNLSVVGAFSRAISIPSXSG  813
            +   +RPGT+ AAQ++   ++RR+N+SV+GA SR +S+PS SG
Sbjct  59   IQALLRPGTVFAAQSDSILLHRRRNISVIGALSRTVSVPSVSG  101



>ref|XP_012071802.1| PREDICTED: probable protein phosphatase 2C 55 isoform X1 [Jatropha 
curcas]
Length=516

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 67/103 (65%), Gaps = 2/103 (2%)
 Frame = +1

Query  505  MPFKNLLIVRSAKKHGFERLIFGCQSGCQESVEILVAQGRLLLSGHSKLFHSLPSASLAG  684
            MP      +R A ++  + ++ G + G ++S EIL+ Q +   S + +LFHS+  ASLA 
Sbjct  1    MPSTYFSRIRGAVQNEIQSIV-GQEGGLRDSAEILIGQAKSRFSNY-RLFHSVRMASLAD  58

Query  685  VHDFVRPGTLAAAQANLHTVNRRKNLSVVGAFSRAISIPSXSG  813
            +   +RPGT+ AAQ++   ++RR+N+SV+GA SR +S+PS SG
Sbjct  59   IQALLRPGTVFAAQSDSILLHRRRNISVIGALSRTVSVPSVSG  101



>ref|XP_006375084.1| hypothetical protein POPTR_0014s04230g [Populus trichocarpa]
 gb|ERP52881.1| hypothetical protein POPTR_0014s04230g [Populus trichocarpa]
Length=521

 Score = 75.1 bits (183),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 64/103 (62%), Gaps = 2/103 (2%)
 Frame = +1

Query  505  MPFKNLLIVRSAKKHGFERLIFGCQSGCQESVEILVAQGRLLLSGHSKLFHSLPSASLAG  684
            MP      +RSA ++G +R   G Q G  ++ E L+ QG+     + +LFHS+  ASL  
Sbjct  1    MPSTYFSRLRSAVQNGIQRSGIG-QEGVLQNFESLIGQGKFRFCNY-RLFHSVCVASLTD  58

Query  685  VHDFVRPGTLAAAQANLHTVNRRKNLSVVGAFSRAISIPSXSG  813
            +   +RPGT+ AA ++   VNR++N+SVVGA SR +S+PS SG
Sbjct  59   LQLLLRPGTVVAASSDSLVVNRKRNISVVGAVSRTLSVPSVSG  101



>ref|XP_006375083.1| hypothetical protein POPTR_0014s04230g [Populus trichocarpa]
 ref|XP_006375085.1| hypothetical protein POPTR_0014s04230g [Populus trichocarpa]
 gb|ERP52880.1| hypothetical protein POPTR_0014s04230g [Populus trichocarpa]
 gb|ERP52882.1| hypothetical protein POPTR_0014s04230g [Populus trichocarpa]
Length=510

 Score = 75.1 bits (183),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 64/103 (62%), Gaps = 2/103 (2%)
 Frame = +1

Query  505  MPFKNLLIVRSAKKHGFERLIFGCQSGCQESVEILVAQGRLLLSGHSKLFHSLPSASLAG  684
            MP      +RSA ++G +R   G Q G  ++ E L+ QG+     + +LFHS+  ASL  
Sbjct  1    MPSTYFSRLRSAVQNGIQRSGIG-QEGVLQNFESLIGQGKFRFCNY-RLFHSVCVASLTD  58

Query  685  VHDFVRPGTLAAAQANLHTVNRRKNLSVVGAFSRAISIPSXSG  813
            +   +RPGT+ AA ++   VNR++N+SVVGA SR +S+PS SG
Sbjct  59   LQLLLRPGTVVAASSDSLVVNRKRNISVVGAVSRTLSVPSVSG  101



>ref|XP_011031594.1| PREDICTED: probable protein phosphatase 2C 55 [Populus euphratica]
Length=521

 Score = 74.7 bits (182),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 62/103 (60%), Gaps = 2/103 (2%)
 Frame = +1

Query  505  MPFKNLLIVRSAKKHGFERLIFGCQSGCQESVEILVAQGRLLLSGHSKLFHSLPSASLAG  684
            MP      +RSA + G +R   G Q G  +  E L+ QG+     + +LFHS+  ASL  
Sbjct  1    MPSTYFSRLRSAVQKGIQRSGIG-QEGVLQDFESLIGQGKFRFCNY-RLFHSVCVASLTD  58

Query  685  VHDFVRPGTLAAAQANLHTVNRRKNLSVVGAFSRAISIPSXSG  813
            +   +RPGT+ AA ++   VNR++N+SVVGA SR +S+PS SG
Sbjct  59   LQLLLRPGTIVAASSDSLVVNRKRNISVVGAVSRTLSVPSVSG  101



>ref|XP_011652404.1| PREDICTED: probable protein phosphatase 2C 55 isoform X1 [Cucumis 
sativus]
Length=507

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 56/83 (67%), Gaps = 3/83 (4%)
 Frame = +1

Query  565  IFGCQSGCQESVEILVAQGRLLLSGHSKLFHSLPSASLAGVHDFVRPGTLAAAQANLHTV  744
              G + G + S+E+L+   +LL  G+S LFHS+P +SL  +H  +RPG ++ A + L  V
Sbjct  14   FLGWEGGLKSSLELLLGHQKLLC-GNSSLFHSVPCSSLTELHALLRPGAISGASSEL--V  70

Query  745  NRRKNLSVVGAFSRAISIPSXSG  813
            NRR+N+SV+GA SR  SIPS SG
Sbjct  71   NRRRNISVLGAISRTFSIPSVSG  93



>ref|XP_011652405.1| PREDICTED: probable protein phosphatase 2C 55 isoform X2 [Cucumis 
sativus]
 gb|KGN59939.1| hypothetical protein Csa_3G855330 [Cucumis sativus]
Length=503

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 56/83 (67%), Gaps = 3/83 (4%)
 Frame = +1

Query  565  IFGCQSGCQESVEILVAQGRLLLSGHSKLFHSLPSASLAGVHDFVRPGTLAAAQANLHTV  744
              G + G + S+E+L+   +LL  G+S LFHS+P +SL  +H  +RPG ++ A + L  V
Sbjct  14   FLGWEGGLKSSLELLLGHQKLLC-GNSSLFHSVPCSSLTELHALLRPGAISGASSEL--V  70

Query  745  NRRKNLSVVGAFSRAISIPSXSG  813
            NRR+N+SV+GA SR  SIPS SG
Sbjct  71   NRRRNISVLGAISRTFSIPSVSG  93



>ref|XP_010106023.1| putative protein phosphatase 2C 55 [Morus notabilis]
 gb|EXC07293.1| putative protein phosphatase 2C 55 [Morus notabilis]
Length=460

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 54/86 (63%), Gaps = 1/86 (1%)
 Frame = +1

Query  556  ERLIFGCQSGCQESVEILVAQGRLLLSGHSKLFHSLPSASLAGVHDFVRPGTLAAAQANL  735
            +R I G     Q+SV + + + +LL  G+S +FHS   +SL+ +   +RPGT+  A  + 
Sbjct  14   QRSIVGDDGAVQDSVRVFIGKEKLLF-GNSWMFHSRSFSSLSELQALLRPGTVVPASLDS  72

Query  736  HTVNRRKNLSVVGAFSRAISIPSXSG  813
              VN+RKNLSVVGA SR  SIPS SG
Sbjct  73   QVVNQRKNLSVVGAISRTFSIPSVSG  98



>ref|XP_008377320.1| PREDICTED: probable protein phosphatase 2C 55 [Malus domestica]
 ref|XP_008377321.1| PREDICTED: probable protein phosphatase 2C 55 [Malus domestica]
Length=507

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 63/103 (61%), Gaps = 5/103 (5%)
 Frame = +1

Query  505  MPFKNLLIVRSAKKHGFERLIFGCQSGCQESVEILVAQGRLLLSGHSKLFHSLPSASLAG  684
            MP   L  +R+A     +R I G +   QESV+ L+ QG+LL  G+SKLF S   ++++ 
Sbjct  1    MPSSYLSKIRTA----LQRSIVGQEGALQESVDGLIGQGKLLF-GNSKLFQSRSFSTISD  55

Query  685  VHDFVRPGTLAAAQANLHTVNRRKNLSVVGAFSRAISIPSXSG  813
            +     PG + AA+++   VN+R+N+SVVG  SR IS PS SG
Sbjct  56   LQALFSPGIVFAARSDSQLVNQRRNISVVGEISRIISTPSVSG  98



>ref|XP_010028040.1| PREDICTED: probable protein phosphatase 2C 55 [Eucalyptus grandis]
 ref|XP_010028118.1| PREDICTED: probable protein phosphatase 2C 55 [Eucalyptus grandis]
 gb|KCW88093.1| hypothetical protein EUGRSUZ_A00501 [Eucalyptus grandis]
Length=515

 Score = 72.0 bits (175),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 61/103 (59%), Gaps = 1/103 (1%)
 Frame = +1

Query  505  MPFKNLLIVRSAKKHGFERLIFGCQSGCQESVEILVAQGRLLLSGHSKLFHSLPSASLAG  684
            MP    L +R+A ++G  +   G  +  Q  VE LV QG+    G+S+LFHS+P + +  
Sbjct  2    MPSSYTLKLRTAVQNGVSKSSIGKDAKVQGPVEALVEQGKSWF-GNSRLFHSVPFSRVPD  60

Query  685  VHDFVRPGTLAAAQANLHTVNRRKNLSVVGAFSRAISIPSXSG  813
            +   + P T+ AA+++    N+R+N+SVVGA SR  S PS SG
Sbjct  61   LQLLLPPSTVVAARSDSQLANQRRNISVVGALSRTFSTPSVSG  103



>ref|XP_008466602.1| PREDICTED: probable protein phosphatase 2C 55 isoform X2 [Cucumis 
melo]
Length=503

 Score = 72.0 bits (175),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 54/83 (65%), Gaps = 3/83 (4%)
 Frame = +1

Query  565  IFGCQSGCQESVEILVAQGRLLLSGHSKLFHSLPSASLAGVHDFVRPGTLAAAQANLHTV  744
              G + G + S+E+L+   +LL  G S LFHS P +SL  +H  +RPG ++ A + L  V
Sbjct  14   FLGWEGGLKSSLELLLGHQKLLC-GSSSLFHSAPYSSLTELHALLRPGAISGASSEL--V  70

Query  745  NRRKNLSVVGAFSRAISIPSXSG  813
            NRR+N+SV+GA SR  SIPS SG
Sbjct  71   NRRRNISVLGAISRTFSIPSVSG  93



>ref|XP_008466601.1| PREDICTED: probable protein phosphatase 2C 55 isoform X1 [Cucumis 
melo]
Length=507

 Score = 72.0 bits (175),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 54/83 (65%), Gaps = 3/83 (4%)
 Frame = +1

Query  565  IFGCQSGCQESVEILVAQGRLLLSGHSKLFHSLPSASLAGVHDFVRPGTLAAAQANLHTV  744
              G + G + S+E+L+   +LL  G S LFHS P +SL  +H  +RPG ++ A + L  V
Sbjct  14   FLGWEGGLKSSLELLLGHQKLLC-GSSSLFHSAPYSSLTELHALLRPGAISGASSEL--V  70

Query  745  NRRKNLSVVGAFSRAISIPSXSG  813
            NRR+N+SV+GA SR  SIPS SG
Sbjct  71   NRRRNISVLGAISRTFSIPSVSG  93



>ref|XP_007017479.1| Phosphatase 2c, putative isoform 1 [Theobroma cacao]
 gb|EOY14704.1| Phosphatase 2c, putative isoform 1 [Theobroma cacao]
Length=552

 Score = 72.0 bits (175),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 64/103 (62%), Gaps = 5/103 (5%)
 Frame = +1

Query  505  MPFKNLLIVRSAKKHGFERLIFGCQSGCQESVEILVAQGRLLLSGHSKLFHSLPSASLAG  684
            MP    + +RSA ++G +R     + G  +S+ +L+  G+L    + +LFHSL  + LA 
Sbjct  1    MPSTFFVRLRSAVQNGIQRT----ECGLHDSIGVLIGTGKLGFD-NCRLFHSLRFSGLAD  55

Query  685  VHDFVRPGTLAAAQANLHTVNRRKNLSVVGAFSRAISIPSXSG  813
            +   ++ GT  AA+++    NRR+N+SVVGAFSR IS+PS SG
Sbjct  56   LQGLLQTGTFLAARSDSLLANRRRNISVVGAFSRTISVPSVSG  98



>ref|XP_007017482.1| Phosphatase 2c, putative isoform 4 [Theobroma cacao]
 gb|EOY14707.1| Phosphatase 2c, putative isoform 4 [Theobroma cacao]
Length=522

 Score = 71.6 bits (174),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 64/103 (62%), Gaps = 5/103 (5%)
 Frame = +1

Query  505  MPFKNLLIVRSAKKHGFERLIFGCQSGCQESVEILVAQGRLLLSGHSKLFHSLPSASLAG  684
            MP    + +RSA ++G +R     + G  +S+ +L+  G+L    + +LFHSL  + LA 
Sbjct  1    MPSTFFVRLRSAVQNGIQRT----ECGLHDSIGVLIGTGKLGFD-NCRLFHSLRFSGLAD  55

Query  685  VHDFVRPGTLAAAQANLHTVNRRKNLSVVGAFSRAISIPSXSG  813
            +   ++ GT  AA+++    NRR+N+SVVGAFSR IS+PS SG
Sbjct  56   LQGLLQTGTFLAARSDSLLANRRRNISVVGAFSRTISVPSVSG  98



>ref|XP_007017484.1| Phosphatase 2c, putative isoform 6 [Theobroma cacao]
 gb|EOY14709.1| Phosphatase 2c, putative isoform 6 [Theobroma cacao]
Length=513

 Score = 71.6 bits (174),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 64/103 (62%), Gaps = 5/103 (5%)
 Frame = +1

Query  505  MPFKNLLIVRSAKKHGFERLIFGCQSGCQESVEILVAQGRLLLSGHSKLFHSLPSASLAG  684
            MP    + +RSA ++G +R     + G  +S+ +L+  G+L    + +LFHSL  + LA 
Sbjct  1    MPSTFFVRLRSAVQNGIQRT----ECGLHDSIGVLIGTGKLGFD-NCRLFHSLRFSGLAD  55

Query  685  VHDFVRPGTLAAAQANLHTVNRRKNLSVVGAFSRAISIPSXSG  813
            +   ++ GT  AA+++    NRR+N+SVVGAFSR IS+PS SG
Sbjct  56   LQGLLQTGTFLAARSDSLLANRRRNISVVGAFSRTISVPSVSG  98



>ref|XP_007017480.1| Phosphatase 2c, putative isoform 2 [Theobroma cacao]
 ref|XP_007017481.1| Phosphatase 2c, putative isoform 2 [Theobroma cacao]
 gb|EOY14705.1| Phosphatase 2c, putative isoform 2 [Theobroma cacao]
 gb|EOY14706.1| Phosphatase 2c, putative isoform 2 [Theobroma cacao]
Length=514

 Score = 71.6 bits (174),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 64/103 (62%), Gaps = 5/103 (5%)
 Frame = +1

Query  505  MPFKNLLIVRSAKKHGFERLIFGCQSGCQESVEILVAQGRLLLSGHSKLFHSLPSASLAG  684
            MP    + +RSA ++G +R     + G  +S+ +L+  G+L    + +LFHSL  + LA 
Sbjct  1    MPSTFFVRLRSAVQNGIQRT----ECGLHDSIGVLIGTGKLGFD-NCRLFHSLRFSGLAD  55

Query  685  VHDFVRPGTLAAAQANLHTVNRRKNLSVVGAFSRAISIPSXSG  813
            +   ++ GT  AA+++    NRR+N+SVVGAFSR IS+PS SG
Sbjct  56   LQGLLQTGTFLAARSDSLLANRRRNISVVGAFSRTISVPSVSG  98



>ref|XP_007017483.1| Phosphatase 2c, putative isoform 5, partial [Theobroma cacao]
 gb|EOY14708.1| Phosphatase 2c, putative isoform 5, partial [Theobroma cacao]
Length=520

 Score = 71.6 bits (174),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 64/103 (62%), Gaps = 5/103 (5%)
 Frame = +1

Query  505  MPFKNLLIVRSAKKHGFERLIFGCQSGCQESVEILVAQGRLLLSGHSKLFHSLPSASLAG  684
            MP    + +RSA ++G +R     + G  +S+ +L+  G+L    + +LFHSL  + LA 
Sbjct  1    MPSTFFVRLRSAVQNGIQRT----ECGLHDSIGVLIGTGKLGFD-NCRLFHSLRFSGLAD  55

Query  685  VHDFVRPGTLAAAQANLHTVNRRKNLSVVGAFSRAISIPSXSG  813
            +   ++ GT  AA+++    NRR+N+SVVGAFSR IS+PS SG
Sbjct  56   LQGLLQTGTFLAARSDSLLANRRRNISVVGAFSRTISVPSVSG  98



>ref|XP_008377406.1| PREDICTED: probable protein phosphatase 2C 55 [Malus domestica]
Length=506

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 62/103 (60%), Gaps = 6/103 (6%)
 Frame = +1

Query  505  MPFKNLLIVRSAKKHGFERLIFGCQSGCQESVEILVAQGRLLLSGHSKLFHSLPSASLAG  684
            MP   L  +R+      +R I G +   QESV+ L+ QG+LL  G+SKLF S P ++++G
Sbjct  1    MPSSYLSKIRTX----LQRXIVGQEGALQESVDGLIGQGKLLF-GNSKLFQS-PFSTISG  54

Query  685  VHDFVRPGTLAAAQANLHTVNRRKNLSVVGAFSRAISIPSXSG  813
            +     PG + AA+ +   VN+R+N+SVV   SR IS PS SG
Sbjct  55   LQALFSPGIVFAARLDSQLVNKRRNISVVEEISRIISTPSVSG  97



>ref|XP_009365583.1| PREDICTED: probable protein phosphatase 2C 55 [Pyrus x bretschneideri]
Length=516

 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 56/90 (62%), Gaps = 1/90 (1%)
 Frame = +1

Query  544  KHGFERLIFGCQSGCQESVEILVAQGRLLLSGHSKLFHSLPSASLAGVHDFVRPGTLAAA  723
            +   +R I G +   QESV+ L+ QG+LL  G+SKLF S P ++++ +     PG + AA
Sbjct  10   RTALQRSIVGQEGALQESVDGLIGQGKLLF-GNSKLFQSRPFSTISDLQALFSPGIVFAA  68

Query  724  QANLHTVNRRKNLSVVGAFSRAISIPSXSG  813
            + +   VN+R+N+SVV   SR IS PS SG
Sbjct  69   RLDSQLVNKRRNISVVEEISRIISTPSVSG  98



>ref|XP_006473470.1| PREDICTED: probable protein phosphatase 2C 55-like isoform X1 
[Citrus sinensis]
Length=511

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 63/103 (61%), Gaps = 6/103 (6%)
 Frame = +1

Query  505  MPFKNLLIVRSAKKHGFERLIFGCQSGCQESVEILVAQGRLLLSGHSKLFHSLPSASLAG  684
            MP      +R+  ++G +R + G +   ++SVE++   G        + FHSL  ++L+ 
Sbjct  1    MPSNYFSRLRTVLQNGTQRPLLGQEGVIRDSVELVFGLGNY------RFFHSLRFSTLSD  54

Query  685  VHDFVRPGTLAAAQANLHTVNRRKNLSVVGAFSRAISIPSXSG  813
            +H  +RPGT+ AA+++L   N+++NLSVVGA SR  S+PS SG
Sbjct  55   LHVLLRPGTIFAARSDLLLANQKRNLSVVGAISRPFSVPSVSG  97



>ref|XP_006473471.1| PREDICTED: probable protein phosphatase 2C 55-like isoform X2 
[Citrus sinensis]
Length=507

 Score = 68.9 bits (167),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 63/103 (61%), Gaps = 6/103 (6%)
 Frame = +1

Query  505  MPFKNLLIVRSAKKHGFERLIFGCQSGCQESVEILVAQGRLLLSGHSKLFHSLPSASLAG  684
            MP      +R+  ++G +R + G +   ++SVE++   G        + FHSL  ++L+ 
Sbjct  1    MPSNYFSRLRTVLQNGTQRPLLGQEGVIRDSVELVFGLGNY------RFFHSLRFSTLSD  54

Query  685  VHDFVRPGTLAAAQANLHTVNRRKNLSVVGAFSRAISIPSXSG  813
            +H  +RPGT+ AA+++L   N+++NLSVVGA SR  S+PS SG
Sbjct  55   LHVLLRPGTIFAARSDLLLANQKRNLSVVGAISRPFSVPSVSG  97



>ref|XP_009364699.1| PREDICTED: probable protein phosphatase 2C 55 [Pyrus x bretschneideri]
 ref|XP_009364704.1| PREDICTED: probable protein phosphatase 2C 55 [Pyrus x bretschneideri]
Length=507

 Score = 68.6 bits (166),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 61/103 (59%), Gaps = 5/103 (5%)
 Frame = +1

Query  505  MPFKNLLIVRSAKKHGFERLIFGCQSGCQESVEILVAQGRLLLSGHSKLFHSLPSASLAG  684
            MP   L  +R+A     +R I G +   QESV+ L+ QG+LL  G+SKLF S   ++++ 
Sbjct  1    MPSSYLSKIRTA----LQRSIVGQEGALQESVDGLIGQGKLLF-GNSKLFQSKSLSTISD  55

Query  685  VHDFVRPGTLAAAQANLHTVNRRKNLSVVGAFSRAISIPSXSG  813
            +     PG + AA+++   VN+R  +SVVG  SR IS PS SG
Sbjct  56   LQALFSPGIVFAARSDSQLVNQRGKISVVGEISRIISTPSVSG  98



>gb|KDO84479.1| hypothetical protein CISIN_1g010417mg [Citrus sinensis]
Length=360

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 62/103 (60%), Gaps = 6/103 (6%)
 Frame = +1

Query  505  MPFKNLLIVRSAKKHGFERLIFGCQSGCQESVEILVAQGRLLLSGHSKLFHSLPSASLAG  684
            MP      +R+  ++G +R + G +   ++SVE+L   G        +  HSL  ++L+ 
Sbjct  1    MPSNYFSRLRTVLQNGTQRPLLGQEGVIRDSVELLFGLGNY------RFLHSLRFSTLSD  54

Query  685  VHDFVRPGTLAAAQANLHTVNRRKNLSVVGAFSRAISIPSXSG  813
            +H  +RPGT+ AA+++L   N+++NLSVVGA SR  S+PS SG
Sbjct  55   LHVLLRPGTIFAARSDLLLANQKRNLSVVGAISRPFSVPSVSG  97



>ref|XP_006434954.1| hypothetical protein CICLE_v10000910mg [Citrus clementina]
 gb|ESR48194.1| hypothetical protein CICLE_v10000910mg [Citrus clementina]
Length=511

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 62/103 (60%), Gaps = 6/103 (6%)
 Frame = +1

Query  505  MPFKNLLIVRSAKKHGFERLIFGCQSGCQESVEILVAQGRLLLSGHSKLFHSLPSASLAG  684
            MP      +R+  ++G +R + G +   ++SVE+L   G        +  HSL  ++L+ 
Sbjct  1    MPSNYFSRLRTVLQNGTQRPLLGQEGVIRDSVELLFGLGNY------RFLHSLRFSTLSD  54

Query  685  VHDFVRPGTLAAAQANLHTVNRRKNLSVVGAFSRAISIPSXSG  813
            +H  +RPGT+ AA+++L   N+++NLSVVGA SR  S+PS SG
Sbjct  55   LHVLLRPGTIFAARSDLLLANQKRNLSVVGAISRPFSVPSVSG  97



>gb|KDO84478.1| hypothetical protein CISIN_1g010417mg [Citrus sinensis]
Length=431

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 62/103 (60%), Gaps = 6/103 (6%)
 Frame = +1

Query  505  MPFKNLLIVRSAKKHGFERLIFGCQSGCQESVEILVAQGRLLLSGHSKLFHSLPSASLAG  684
            MP      +R+  ++G +R + G +   ++SVE+L   G        +  HSL  ++L+ 
Sbjct  1    MPSNYFSRLRTVLQNGTQRPLLGQEGVIRDSVELLFGLGNY------RFLHSLRFSTLSD  54

Query  685  VHDFVRPGTLAAAQANLHTVNRRKNLSVVGAFSRAISIPSXSG  813
            +H  +RPGT+ AA+++L   N+++NLSVVGA SR  S+PS SG
Sbjct  55   LHVLLRPGTIFAARSDLLLANQKRNLSVVGAISRPFSVPSVSG  97



>gb|KDO84477.1| hypothetical protein CISIN_1g010417mg [Citrus sinensis]
Length=511

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 62/103 (60%), Gaps = 6/103 (6%)
 Frame = +1

Query  505  MPFKNLLIVRSAKKHGFERLIFGCQSGCQESVEILVAQGRLLLSGHSKLFHSLPSASLAG  684
            MP      +R+  ++G +R + G +   ++SVE+L   G        +  HSL  ++L+ 
Sbjct  1    MPSNYFSRLRTVLQNGTQRPLLGQEGVIRDSVELLFGLGNY------RFLHSLRFSTLSD  54

Query  685  VHDFVRPGTLAAAQANLHTVNRRKNLSVVGAFSRAISIPSXSG  813
            +H  +RPGT+ AA+++L   N+++NLSVVGA SR  S+PS SG
Sbjct  55   LHVLLRPGTIFAARSDLLLANQKRNLSVVGAISRPFSVPSVSG  97



>ref|XP_006434953.1| hypothetical protein CICLE_v10000910mg [Citrus clementina]
 gb|ESR48193.1| hypothetical protein CICLE_v10000910mg [Citrus clementina]
Length=507

 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 62/103 (60%), Gaps = 6/103 (6%)
 Frame = +1

Query  505  MPFKNLLIVRSAKKHGFERLIFGCQSGCQESVEILVAQGRLLLSGHSKLFHSLPSASLAG  684
            MP      +R+  ++G +R + G +   ++SVE+L   G        +  HSL  ++L+ 
Sbjct  1    MPSNYFSRLRTVLQNGTQRPLLGQEGVIRDSVELLFGLGNY------RFLHSLRFSTLSD  54

Query  685  VHDFVRPGTLAAAQANLHTVNRRKNLSVVGAFSRAISIPSXSG  813
            +H  +RPGT+ AA+++L   N+++NLSVVGA SR  S+PS SG
Sbjct  55   LHVLLRPGTIFAARSDLLLANQKRNLSVVGAISRPFSVPSVSG  97



>gb|KDO84475.1| hypothetical protein CISIN_1g010417mg [Citrus sinensis]
 gb|KDO84476.1| hypothetical protein CISIN_1g010417mg [Citrus sinensis]
Length=507

 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 62/103 (60%), Gaps = 6/103 (6%)
 Frame = +1

Query  505  MPFKNLLIVRSAKKHGFERLIFGCQSGCQESVEILVAQGRLLLSGHSKLFHSLPSASLAG  684
            MP      +R+  ++G +R + G +   ++SVE+L   G        +  HSL  ++L+ 
Sbjct  1    MPSNYFSRLRTVLQNGTQRPLLGQEGVIRDSVELLFGLGNY------RFLHSLRFSTLSD  54

Query  685  VHDFVRPGTLAAAQANLHTVNRRKNLSVVGAFSRAISIPSXSG  813
            +H  +RPGT+ AA+++L   N+++NLSVVGA SR  S+PS SG
Sbjct  55   LHVLLRPGTIFAARSDLLLANQKRNLSVVGAISRPFSVPSVSG  97



>ref|XP_010556299.1| PREDICTED: probable protein phosphatase 2C 55 [Tarenaya hassleriana]
Length=514

 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/103 (43%), Positives = 60/103 (58%), Gaps = 6/103 (6%)
 Frame = +1

Query  505  MPFKNLLIVRSAKKHGFERLIFGCQSGCQESVEILVAQGRLLLSGHSKLFHSLPSASLAG  684
            MP   L  +R A + G +R + G Q G  + +E+L+ QG+    G SK FHS     L  
Sbjct  1    MPPGYLSRLRHAVQDGVQRQVTG-QGGLVDGLEVLIGQGKFGF-GSSKSFHS----RLTD  54

Query  685  VHDFVRPGTLAAAQANLHTVNRRKNLSVVGAFSRAISIPSXSG  813
               F+ P T+ AA ++L  VN+R+NLSVVGA SR  S+PS SG
Sbjct  55   PKGFLGPATVFAASSDLLLVNQRRNLSVVGAVSRTFSVPSVSG  97



>ref|XP_006341911.1| PREDICTED: probable protein phosphatase 2C 55-like isoform X1 
[Solanum tuberosum]
 ref|XP_006341912.1| PREDICTED: probable protein phosphatase 2C 55-like isoform X2 
[Solanum tuberosum]
Length=393

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 56/95 (59%), Gaps = 5/95 (5%)
 Frame = +1

Query  505  MPFKNLLIVRSAKKHGFERLIFGCQSGCQESVEILVAQGRLLLSGHSKLFHSLPSASLAG  684
            MP   L  V  A + G  + I G + G Q  VEI  ++ RLL     K F S+ SA L+ 
Sbjct  1    MPSNYLFRVGGALRQGIRKSISGQERGIQ-LVEIF-SEERLLFG---KSFCSVSSARLSD  55

Query  685  VHDFVRPGTLAAAQANLHTVNRRKNLSVVGAFSRA  789
            +H FVRPG  AAAQ NL+ VN+RKN+SV+ A  RA
Sbjct  56   LHVFVRPGAFAAAQTNLNIVNQRKNISVISAIPRA  90



>gb|KJB58309.1| hypothetical protein B456_009G204100 [Gossypium raimondii]
 gb|KJB58310.1| hypothetical protein B456_009G204100 [Gossypium raimondii]
 gb|KJB58312.1| hypothetical protein B456_009G204100 [Gossypium raimondii]
Length=505

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 61/103 (59%), Gaps = 5/103 (5%)
 Frame = +1

Query  505  MPFKNLLIVRSAKKHGFERLIFGCQSGCQESVEILVAQGRLLLSGHSKLFHSLPSASLAG  684
            MP    L +RSA ++G +R     +   Q+S+EIL+ +G+L    + + FHS   + LA 
Sbjct  1    MPSALFLKMRSAVRNGIQRT----ECELQDSLEILIGKGKLGFRNY-RFFHSSSLSGLAD  55

Query  685  VHDFVRPGTLAAAQANLHTVNRRKNLSVVGAFSRAISIPSXSG  813
            +  F   GT+ AA ++  +VN  +N+S VGAFSR + +PS SG
Sbjct  56   LQGFFPSGTVLAACSDSLSVNCGRNISAVGAFSRTVFVPSVSG  98



>gb|KJB58311.1| hypothetical protein B456_009G204100 [Gossypium raimondii]
Length=506

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 61/103 (59%), Gaps = 5/103 (5%)
 Frame = +1

Query  505  MPFKNLLIVRSAKKHGFERLIFGCQSGCQESVEILVAQGRLLLSGHSKLFHSLPSASLAG  684
            MP    L +RSA ++G +R     +   Q+S+EIL+ +G+L    + + FHS   + LA 
Sbjct  1    MPSALFLKMRSAVRNGIQRT----ECELQDSLEILIGKGKLGFRNY-RFFHSSSLSGLAD  55

Query  685  VHDFVRPGTLAAAQANLHTVNRRKNLSVVGAFSRAISIPSXSG  813
            +  F   GT+ AA ++  +VN  +N+S VGAFSR + +PS SG
Sbjct  56   LQGFFPSGTVLAACSDSLSVNCGRNISAVGAFSRTVFVPSVSG  98



>ref|XP_004238238.1| PREDICTED: probable protein phosphatase 2C 55 [Solanum lycopersicum]
 ref|XP_010320377.1| PREDICTED: probable protein phosphatase 2C 55 [Solanum lycopersicum]
 ref|XP_010320378.1| PREDICTED: probable protein phosphatase 2C 55 [Solanum lycopersicum]
Length=393

 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 54/98 (55%), Gaps = 5/98 (5%)
 Frame = +1

Query  505  MPFKNLLIVRSAKKHGFERLIFGCQSGCQESVEILVAQGRLLLSGHSKLFHSLPSASLAG  684
            MP   L  V  A   G  + I G + G Q  VEI  ++ RLL     K F S+PSA L+ 
Sbjct  1    MPSNYLFRVGGALCQGIRKSISGQERGLQ-LVEIF-SEERLLFG---KSFCSVPSAGLSD  55

Query  685  VHDFVRPGTLAAAQANLHTVNRRKNLSVVGAFSRAISI  798
            +H FVRPG  AAA  NL+ VN+RKN+S + A  R   +
Sbjct  56   LHVFVRPGAFAAAPTNLNIVNQRKNISGISAIPRTFGL  93



>gb|KHG28173.1| hypothetical protein F383_08076 [Gossypium arboreum]
Length=524

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 59/98 (60%), Gaps = 5/98 (5%)
 Frame = +1

Query  520  LLIVRSAKKHGFERLIFGCQSGCQESVEILVAQGRLLLSGHSKLFHSLPSASLAGVHDFV  699
            L +  S  ++G +R     +   Q+S+EIL+ +G+L    + + FHS   + LA    F+
Sbjct  5    LFLKLSTVRNGIQRT----ECKLQDSLEILMGKGKLGFRNY-RFFHSSRLSGLADFQGFL  59

Query  700  RPGTLAAAQANLHTVNRRKNLSVVGAFSRAISIPSXSG  813
              GT+ AA ++  +VNR +N+S VGAFSR +S+PS SG
Sbjct  60   PSGTVLAACSDSLSVNRGRNISAVGAFSRTVSVPSVSG  97



>gb|KEH40106.1| protein phosphatase 2C family protein [Medicago truncatula]
Length=508

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 50/91 (55%), Gaps = 6/91 (7%)
 Frame = +1

Query  553  FERL--IFGCQSGCQESVEILVAQGRLLLSGHSKLFHSLPSASLAGVHD--FVRPGTLAA  720
            F RL  I G + G Q+S EIL+ QG+L     SK FHS+  +S   V    F RPG   A
Sbjct  16   FSRLGSILGKKIGIQDSAEILIGQGKLWFGSGSKFFHSVNKSSSFFVEATLFARPG--VA  73

Query  721  AQANLHTVNRRKNLSVVGAFSRAISIPSXSG  813
              ++   V +R+ L+VV   SR  S+PS SG
Sbjct  74   LDSSPEFVGKRRTLTVVDTLSRTFSVPSVSG  104



>ref|XP_007160777.1| hypothetical protein PHAVU_001G015900g [Phaseolus vulgaris]
 gb|ESW32771.1| hypothetical protein PHAVU_001G015900g [Phaseolus vulgaris]
Length=507

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 49/86 (57%), Gaps = 3/86 (3%)
 Frame = +1

Query  556  ERLIFGCQSGCQESVEILVAQGRLLLSGHSKLFHSLPSASLAGVHDFVRPGTLAAAQANL  735
            +R + G + G  +S EIL+ QG+L   G SK FHS+ S+    +   VRPG   A+ + L
Sbjct  14   QRSVLGKERGILDSAEILIGQGKLWF-GSSKFFHSVHSSYCVELSLLVRPGFALASSSEL  72

Query  736  HTVNRRKNLSVVGAFSRAISIPSXSG  813
                +R+ LSVV   SR  S+PS SG
Sbjct  73   --PGKRRTLSVVDTLSRTFSVPSVSG  96



>ref|XP_010244316.1| PREDICTED: probable protein phosphatase 2C 55 isoform X2 [Nelumbo 
nucifera]
Length=512

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 61/111 (55%), Gaps = 12/111 (11%)
 Frame = +1

Query  481  TYIF*RANMPFKNLLIVRSAKKHGFERLIFGCQSGCQESVEILVAQGRLLLSGHSKLFHS  660
            TY F R N+ F++          GF RLI G Q G  ++V  L AQG  LL G S L   
Sbjct  4    TY-FSRLNLDFRS----------GFRRLIIGKQGGLDKTVGFLFAQGNFLL-GDSGLSTL  51

Query  661  LPSASLAGVHDFVRPGTLAAAQANLHTVNRRKNLSVVGAFSRAISIPSXSG  813
             P +SL G++  +RPGT+ AA+++L    ++     VGA SR  SIPS SG
Sbjct  52   RPFSSLGGLNLLLRPGTIFAARSDLRIAEQKSLAVFVGALSRTFSIPSVSG  102



>ref|XP_006595942.1| PREDICTED: probable protein phosphatase 2C 55-like isoform X2 
[Glycine max]
Length=496

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 48/85 (56%), Gaps = 3/85 (4%)
 Frame = +1

Query  559  RLIFGCQSGCQESVEILVAQGRLLLSGHSKLFHSLPSASLAGVHDFVRPGTLAAAQANLH  738
            R + G +   ++S E+L+ QG+L   G SK FHS+ S+    +   VRPG   A+ + L 
Sbjct  15   RSVVGKEGRIRDSAEVLIGQGKLWF-GSSKFFHSVQSSYFVELQLLVRPGIALASSSEL-  72

Query  739  TVNRRKNLSVVGAFSRAISIPSXSG  813
               +R+ LSVV   SR  S+PS SG
Sbjct  73   -AGKRRTLSVVDTLSRTFSVPSVSG  96



>ref|XP_003544423.1| PREDICTED: probable protein phosphatase 2C 55-like isoform X1 
[Glycine max]
 gb|KHN20995.1| Hypothetical protein glysoja_009303 [Glycine soja]
Length=506

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 48/85 (56%), Gaps = 3/85 (4%)
 Frame = +1

Query  559  RLIFGCQSGCQESVEILVAQGRLLLSGHSKLFHSLPSASLAGVHDFVRPGTLAAAQANLH  738
            R + G +   ++S E+L+ QG+L   G SK FHS+ S+    +   VRPG   A+ + L 
Sbjct  15   RSVVGKEGRIRDSAEVLIGQGKLWF-GSSKFFHSVQSSYFVELQLLVRPGIALASSSEL-  72

Query  739  TVNRRKNLSVVGAFSRAISIPSXSG  813
               +R+ LSVV   SR  S+PS SG
Sbjct  73   -AGKRRTLSVVDTLSRTFSVPSVSG  96



>ref|XP_010244315.1| PREDICTED: probable protein phosphatase 2C 55 isoform X1 [Nelumbo 
nucifera]
Length=532

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 61/111 (55%), Gaps = 12/111 (11%)
 Frame = +1

Query  481  TYIF*RANMPFKNLLIVRSAKKHGFERLIFGCQSGCQESVEILVAQGRLLLSGHSKLFHS  660
            TY F R N+ F++          GF RLI G Q G  ++V  L AQG  LL G S L   
Sbjct  4    TY-FSRLNLDFRS----------GFRRLIIGKQGGLDKTVGFLFAQGNFLL-GDSGLSTL  51

Query  661  LPSASLAGVHDFVRPGTLAAAQANLHTVNRRKNLSVVGAFSRAISIPSXSG  813
             P +SL G++  +RPGT+ AA+++L    ++     VGA SR  SIPS SG
Sbjct  52   RPFSSLGGLNLLLRPGTIFAARSDLRIAEQKSLAVFVGALSRTFSIPSVSG  102



>gb|KDP38477.1| hypothetical protein JCGZ_04402 [Jatropha curcas]
Length=464

 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  670  ASLAGVHDFVRPGTLAAAQANLHTVNRRKNLSVVGAFSRAISIPSXSG  813
            ASLA +   +RPGT+ AAQ++   ++RR+N+SV+GA SR +S+PS SG
Sbjct  2    ASLADIQALLRPGTVFAAQSDSILLHRRRNISVIGALSRTVSVPSVSG  49



>ref|XP_006601312.1| PREDICTED: probable protein phosphatase 2C 55-like isoform X2 
[Glycine max]
Length=496

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 47/86 (55%), Gaps = 3/86 (3%)
 Frame = +1

Query  556  ERLIFGCQSGCQESVEILVAQGRLLLSGHSKLFHSLPSASLAGVHDFVRPGTLAAAQANL  735
            +R I G +   ++S E+L+ QG+L   G SK FHS+ S+    V   V P    A+ + L
Sbjct  14   QRSIAGKEGRIRDSAEVLIGQGKLWF-GSSKFFHSVHSSYCVEVQLLVWPDVALASSSEL  72

Query  736  HTVNRRKNLSVVGAFSRAISIPSXSG  813
                +R+ LSVV   SR  S+PS SG
Sbjct  73   G--GKRRTLSVVDTLSRTFSVPSVSG  96



>ref|XP_003550371.1| PREDICTED: probable protein phosphatase 2C 55-like isoform X1 
[Glycine max]
Length=506

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 47/86 (55%), Gaps = 3/86 (3%)
 Frame = +1

Query  556  ERLIFGCQSGCQESVEILVAQGRLLLSGHSKLFHSLPSASLAGVHDFVRPGTLAAAQANL  735
            +R I G +   ++S E+L+ QG+L   G SK FHS+ S+    V   V P    A+ + L
Sbjct  14   QRSIAGKEGRIRDSAEVLIGQGKLWF-GSSKFFHSVHSSYCVEVQLLVWPDVALASSSEL  72

Query  736  HTVNRRKNLSVVGAFSRAISIPSXSG  813
                +R+ LSVV   SR  S+PS SG
Sbjct  73   G--GKRRTLSVVDTLSRTFSVPSVSG  96



>gb|KHN12726.1| Hypothetical protein glysoja_008689 [Glycine soja]
Length=506

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 47/86 (55%), Gaps = 3/86 (3%)
 Frame = +1

Query  556  ERLIFGCQSGCQESVEILVAQGRLLLSGHSKLFHSLPSASLAGVHDFVRPGTLAAAQANL  735
            +R I G +   ++S E+L+ QG+L   G SK FHS+ S+    V   V P    A+ + L
Sbjct  14   QRSIAGKEGRIRDSAEVLIGQGKLWF-GSSKFFHSVHSSYCVEVQLLVWPDVALASSSEL  72

Query  736  HTVNRRKNLSVVGAFSRAISIPSXSG  813
                +R+ LSVV   SR  S+PS SG
Sbjct  73   G--GKRRTLSVVDTLSRTFSVPSVSG  96



>ref|XP_004499136.1| PREDICTED: probable protein phosphatase 2C 55-like isoform X1 
[Cicer arietinum]
 ref|XP_004499137.1| PREDICTED: probable protein phosphatase 2C 55-like isoform X2 
[Cicer arietinum]
Length=505

 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 47/85 (55%), Gaps = 5/85 (6%)
 Frame = +1

Query  565  IFGCQSGCQESVEILVAQGRLLLSGHSKLFHSLPSASLAGVHD--FVRPGTLAAAQANLH  738
            + G ++G Q+S E+L   G+L   G SK FHS+  ++ + +     VRPG    +     
Sbjct  17   VLGKETGIQDSAEVLFGLGKLWFGG-SKFFHSVNKSTSSCLEATLLVRPGVDLVSSP--E  73

Query  739  TVNRRKNLSVVGAFSRAISIPSXSG  813
            ++ +RK LSVV   SR  S+PS SG
Sbjct  74   SIGKRKTLSVVDTVSRTFSVPSVSG  98



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1710808110896