BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig3791

Length=828
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009616694.1|  PREDICTED: phosphoethanolamine N-methyltrans...    292   7e-92   Nicotiana tomentosiformis
ref|XP_009757363.1|  PREDICTED: phosphoethanolamine N-methyltrans...    291   1e-91   Nicotiana sylvestris
ref|XP_011084235.1|  PREDICTED: phosphoethanolamine N-methyltrans...    291   2e-91   Sesamum indicum [beniseed]
ref|XP_009614862.1|  PREDICTED: phosphoethanolamine N-methyltrans...    290   4e-91   Nicotiana tomentosiformis
ref|XP_007209941.1|  hypothetical protein PRUPE_ppa004742mg             287   3e-90   
ref|XP_002282182.1|  PREDICTED: phosphomethylethanolamine N-methy...    288   3e-90   Vitis vinifera
ref|XP_007209942.1|  hypothetical protein PRUPE_ppa004742mg             287   6e-90   Prunus persica
ref|XP_010097563.1|  hypothetical protein L484_017373                   287   7e-90   
ref|XP_007209943.1|  hypothetical protein PRUPE_ppa004742mg             287   8e-90   
ref|XP_011072995.1|  PREDICTED: phosphoethanolamine N-methyltrans...    286   1e-89   Sesamum indicum [beniseed]
ref|XP_002532097.1|  phosphoethanolamine n-methyltransferase, put...    286   2e-89   Ricinus communis
ref|NP_001234549.1|  phosphoethanolamine N-methyltransferase            285   3e-89   Solanum lycopersicum
ref|XP_010033717.1|  PREDICTED: phosphoethanolamine N-methyltrans...    285   4e-89   Eucalyptus grandis [rose gum]
ref|XP_006341528.1|  PREDICTED: phosphoethanolamine N-methyltrans...    285   4e-89   Solanum tuberosum [potatoes]
ref|XP_010533969.1|  PREDICTED: phosphomethylethanolamine N-methy...    285   4e-89   Tarenaya hassleriana [spider flower]
emb|CAN64744.1|  hypothetical protein VITISV_041321                     285   4e-89   Vitis vinifera
ref|XP_011084227.1|  PREDICTED: phosphoethanolamine N-methyltrans...    285   7e-89   Sesamum indicum [beniseed]
ref|XP_008240154.1|  PREDICTED: phosphoethanolamine N-methyltrans...    284   7e-89   
ref|XP_008240152.1|  PREDICTED: phosphoethanolamine N-methyltrans...    284   1e-88   Prunus mume [ume]
gb|KJB30121.1|  hypothetical protein B456_005G132000                    281   1e-88   Gossypium raimondii
ref|XP_012088547.1|  PREDICTED: phosphoethanolamine N-methyltrans...    284   2e-88   Jatropha curcas
ref|XP_010519218.1|  PREDICTED: phosphoethanolamine N-methyltrans...    284   2e-88   Tarenaya hassleriana [spider flower]
gb|KJB30119.1|  hypothetical protein B456_005G132000                    281   2e-88   Gossypium raimondii
ref|XP_010487710.1|  PREDICTED: phosphoethanolamine N-methyltrans...    283   2e-88   Camelina sativa [gold-of-pleasure]
ref|XP_010506242.1|  PREDICTED: phosphoethanolamine N-methyltrans...    283   3e-88   Camelina sativa [gold-of-pleasure]
ref|XP_007036803.1|  S-adenosyl-L-methionine-dependent methyltran...    283   4e-88   
ref|XP_007036802.1|  S-adenosyl-L-methionine-dependent methyltran...    283   4e-88   
gb|AAP83582.1|  phosphoethanolamine N-methyltransferase                 282   4e-88   Brassica napus [oilseed rape]
gb|ABX10444.1|  phosphoethanolamine N-methyltransferase                 282   4e-88   Gossypium hirsutum [American cotton]
ref|XP_009145948.1|  PREDICTED: phosphoethanolamine N-methyltrans...    282   6e-88   Brassica rapa
gb|KJB30123.1|  hypothetical protein B456_005G132000                    281   6e-88   Gossypium raimondii
gb|KHG16117.1|  Phosphoethanolamine N-methyltransferase 1 -like p...    282   6e-88   Gossypium arboreum [tree cotton]
ref|XP_004252273.1|  PREDICTED: phosphomethylethanolamine N-methy...    282   8e-88   Solanum lycopersicum
ref|XP_010519219.1|  PREDICTED: phosphoethanolamine N-methyltrans...    282   8e-88   Tarenaya hassleriana [spider flower]
ref|XP_002883100.1|  N-methyltransferase 1                              281   1e-87   
ref|XP_004299531.1|  PREDICTED: phosphomethylethanolamine N-methy...    281   1e-87   Fragaria vesca subsp. vesca
gb|AFK34653.1|  unknown                                                 271   1e-87   Lotus japonicus
ref|XP_008364653.1|  PREDICTED: phosphoethanolamine N-methyltrans...    281   2e-87   
gb|EYU33965.1|  hypothetical protein MIMGU_mgv1a005263mg                281   2e-87   Erythranthe guttata [common monkey flower]
gb|KJB30117.1|  hypothetical protein B456_005G132000                    281   2e-87   Gossypium raimondii
ref|NP_188427.2|  phosphoethanolamine N-methyltransferase 1             280   2e-87   Arabidopsis thaliana [mouse-ear cress]
gb|KJB30122.1|  hypothetical protein B456_005G132000                    280   2e-87   Gossypium raimondii
gb|AAM13092.1|  unknown protein                                         280   2e-87   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB02720.1|  methyl transferase-like protein                        280   3e-87   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010465872.1|  PREDICTED: phosphoethanolamine N-methyltrans...    280   3e-87   Camelina sativa [gold-of-pleasure]
gb|EPS65842.1|  hypothetical protein M569_08933                         280   3e-87   Genlisea aurea
ref|XP_010487709.1|  PREDICTED: phosphoethanolamine N-methyltrans...    280   3e-87   Camelina sativa [gold-of-pleasure]
ref|XP_008360927.1|  PREDICTED: phosphoethanolamine N-methyltrans...    280   4e-87   
ref|XP_009776424.1|  PREDICTED: phosphoethanolamine N-methyltrans...    280   4e-87   Nicotiana sylvestris
ref|XP_010506234.1|  PREDICTED: phosphoethanolamine N-methyltrans...    280   5e-87   Camelina sativa [gold-of-pleasure]
ref|XP_012088548.1|  PREDICTED: phosphoethanolamine N-methyltrans...    280   6e-87   Jatropha curcas
ref|XP_006346642.1|  PREDICTED: phosphoethanolamine N-methyltrans...    280   7e-87   Solanum tuberosum [potatoes]
gb|KDO63824.1|  hypothetical protein CISIN_1g043471mg                   279   7e-87   Citrus sinensis [apfelsine]
dbj|BAD93609.1|  hypothetical protein                                   270   7e-87   Cucumis melo [Oriental melon]
ref|XP_006406666.1|  hypothetical protein EUTSA_v10020595mg             279   9e-87   Eutrema salsugineum [saltwater cress]
ref|XP_012088546.1|  PREDICTED: phosphoethanolamine N-methyltrans...    280   9e-87   Jatropha curcas
ref|XP_006297517.1|  hypothetical protein CARUB_v10013541mg             279   1e-86   Capsella rubella
ref|XP_006490771.1|  PREDICTED: phosphoethanolamine N-methyltrans...    279   1e-86   
ref|XP_010263678.1|  PREDICTED: phosphoethanolamine N-methyltrans...    278   1e-86   Nelumbo nucifera [Indian lotus]
ref|XP_006451624.1|  hypothetical protein CICLE_v10010749mg             278   1e-86   Citrus clementina [clementine]
ref|XP_002891445.1|  hypothetical protein ARALYDRAFT_473996             278   1e-86   
ref|XP_008393424.1|  PREDICTED: phosphoethanolamine N-methyltrans...    278   2e-86   
ref|XP_009356042.1|  PREDICTED: phosphoethanolamine N-methyltrans...    278   2e-86   Pyrus x bretschneideri [bai li]
gb|KFK39125.1|  hypothetical protein AALP_AA3G204100                    278   2e-86   Arabis alpina [alpine rockcress]
ref|XP_009360079.1|  PREDICTED: phosphoethanolamine N-methyltrans...    278   2e-86   Pyrus x bretschneideri [bai li]
ref|NP_973993.1|  phosphoethanolamine N-methyltransferase 2             278   2e-86   Arabidopsis thaliana [mouse-ear cress]
gb|AFW83641.1|  hypothetical protein ZEAMMB73_560974                    269   4e-86   
emb|CDO98349.1|  unnamed protein product                                277   5e-86   Coffea canephora [robusta coffee]
ref|XP_010097561.1|  Phosphoethanolamine N-methyltransferase 1          277   8e-86   
gb|AGI56231.1|  phosphoethanolamine N-methyltransferase                 276   9e-86   Lycium barbarum [Duke of Argyll's teatree]
ref|XP_012088549.1|  PREDICTED: phosphoethanolamine N-methyltrans...    276   9e-86   Jatropha curcas
dbj|BAD80838.1|  phosphoethanolamine N-methyltransferase                276   1e-85   Atriplex nummularia
gb|AER10512.1|  phosphoethanolamine N-methyltransferase                 276   1e-85   Pyrus betulifolia
gb|KFK36082.1|  hypothetical protein AALP_AA4G075100                    276   1e-85   Arabis alpina [alpine rockcress]
gb|EYU24136.1|  hypothetical protein MIMGU_mgv1a005261mg                275   3e-85   Erythranthe guttata [common monkey flower]
ref|XP_008799221.1|  PREDICTED: phosphomethylethanolamine N-methy...    275   4e-85   Phoenix dactylifera
ref|XP_006303987.1|  hypothetical protein CARUB_v10008968mg             274   5e-85   Capsella rubella
ref|XP_009147956.1|  PREDICTED: phosphomethylethanolamine N-methy...    274   6e-85   Brassica rapa
ref|XP_010274723.1|  PREDICTED: phosphomethylethanolamine N-methy...    274   7e-85   Nelumbo nucifera [Indian lotus]
ref|XP_008799219.1|  PREDICTED: phosphomethylethanolamine N-methy...    274   7e-85   Phoenix dactylifera
ref|XP_003528975.2|  PREDICTED: phosphoethanolamine N-methyltrans...    275   7e-85   
gb|AEY75253.1|  phosphoethanolamine N-methyltransferase                 274   7e-85   Atriplex canescens [shadscale]
ref|XP_011039130.1|  PREDICTED: phosphomethylethanolamine N-methy...    273   1e-84   Populus euphratica
ref|XP_011014101.1|  PREDICTED: phosphomethylethanolamine N-methy...    273   2e-84   Populus euphratica
ref|XP_010461683.1|  PREDICTED: phosphomethylethanolamine N-methy...    273   2e-84   Camelina sativa [gold-of-pleasure]
ref|XP_009782224.1|  PREDICTED: phosphoethanolamine N-methyltrans...    273   2e-84   Nicotiana sylvestris
dbj|BAC57960.1|  phosphoethanolamine N-methyltransferase                273   2e-84   Tripolium pannonicum [sea starwort]
emb|CDX68222.1|  BnaA07g22620D                                          273   2e-84   
ref|XP_008799258.1|  PREDICTED: phosphomethylethanolamine N-methy...    271   3e-84   
sp|Q9M571.1|PEAMT_SPIOL  RecName: Full=Phosphoethanolamine N-meth...    272   4e-84   Spinacia oleracea
dbj|BAE07178.1|  phosphoethanolamine N-methyltransferase                272   5e-84   Beta vulgaris [beet]
ref|XP_010686587.1|  PREDICTED: phosphoethanolamine N-methyltrans...    271   6e-84   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010461752.1|  PREDICTED: phosphomethylethanolamine N-methy...    271   7e-84   Camelina sativa [gold-of-pleasure]
ref|XP_003569614.1|  PREDICTED: phosphoethanolamine N-methyltrans...    271   1e-83   Brachypodium distachyon [annual false brome]
pir||H96762  hypothetical protein F6D5.1 [imported] - Arabidopsis...    272   1e-83
emb|CDY11100.1|  BnaC06g23520D                                          271   1e-83   Brassica napus [oilseed rape]
gb|EMT21187.1|  Phosphoethanolamine N-methyltransferase 1               271   2e-83   
ref|XP_009104804.1|  PREDICTED: phosphoethanolamine N-methyltrans...    271   2e-83   Brassica rapa
ref|XP_006644536.1|  PREDICTED: phosphoethanolamine N-methyltrans...    271   2e-83   Oryza brachyantha
gb|EMS54147.1|  Phosphoethanolamine N-methyltransferase 1               271   2e-83   Triticum urartu
gb|ACV89824.1|  S-adenosyl-L-methionine:phosphoethanolamine N-met...    271   2e-83   Triticum aestivum [Canadian hard winter wheat]
emb|CDM83845.1|  unnamed protein product                                270   2e-83   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009595958.1|  PREDICTED: phosphoethanolamine N-methyltrans...    270   2e-83   Nicotiana tomentosiformis
ref|XP_010921161.1|  PREDICTED: phosphoethanolamine N-methyltrans...    270   2e-83   Elaeis guineensis
ref|XP_011623100.1|  PREDICTED: phosphomethylethanolamine N-methy...    270   3e-83   
ref|XP_010678114.1|  PREDICTED: phosphoethanolamine N-methyltrans...    270   5e-83   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001148925.1|  LOC100282545                                       270   6e-83   Zea mays [maize]
ref|XP_006365411.1|  PREDICTED: phosphoethanolamine N-methyltrans...    269   6e-83   Solanum tuberosum [potatoes]
ref|XP_008464197.1|  PREDICTED: phosphoethanolamine N-methyltrans...    269   7e-83   Cucumis melo [Oriental melon]
gb|ACJ83326.1|  unknown                                                 259   1e-82   Medicago truncatula
ref|XP_007152684.1|  hypothetical protein PHAVU_004G150500g             268   1e-82   Phaseolus vulgaris [French bean]
ref|XP_004137341.1|  PREDICTED: phosphoethanolamine N-methyltrans...    268   1e-82   Cucumis sativus [cucumbers]
ref|XP_004137500.1|  PREDICTED: phosphoethanolamine N-methyltrans...    268   1e-82   Cucumis sativus [cucumbers]
ref|XP_002456194.1|  hypothetical protein SORBIDRAFT_03g031950          268   2e-82   Sorghum bicolor [broomcorn]
gb|AAM97038.1|  phosphoethanolamine N-methyltransferase, putative       264   2e-82   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004969638.1|  PREDICTED: phosphoethanolamine N-methyltrans...    268   2e-82   Setaria italica
gb|AAF79704.1|AC020889_12  T1N15.22                                     257   2e-82   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ97525.1|  predicted protein                                      268   2e-82   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001043957.1|  Os01g0695100                                       268   3e-82   
gb|KEH21429.1|  phosphoethanolamine N-methyltransferase                 266   3e-82   Medicago truncatula
gb|AAS57723.1|  phosphoethanolamine N-methyltransferase                 268   3e-82   Oryza sativa [red rice]
gb|AFW83642.1|  phosphoethanolamine N-methyltransferase                 268   3e-82   
ref|XP_009385384.1|  PREDICTED: phosphoethanolamine N-methyltrans...    267   3e-82   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH21430.1|  phosphoethanolamine N-methyltransferase                 266   3e-82   Medicago truncatula
ref|XP_008453479.1|  PREDICTED: phosphoethanolamine N-methyltrans...    267   4e-82   Cucumis melo [Oriental melon]
gb|EEE55232.1|  hypothetical protein OsJ_03109                          267   4e-82   Oryza sativa Japonica Group [Japonica rice]
ref|NP_177501.2|  putative phosphoethanolamine N-methyltransferase 3    267   4e-82   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH01482.1|  unnamed protein product                                267   5e-82   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010921197.1|  PREDICTED: phosphoethanolamine N-methyltrans...    267   5e-82   Elaeis guineensis
ref|XP_011008809.1|  PREDICTED: phosphomethylethanolamine N-methy...    266   5e-82   Populus euphratica
ref|XP_006843796.1|  PREDICTED: phosphomethylethanolamine N-methy...    266   5e-82   Amborella trichopoda
ref|XP_011008808.1|  PREDICTED: phosphomethylethanolamine N-methy...    267   6e-82   Populus euphratica
ref|XP_004503268.1|  PREDICTED: phosphoethanolamine N-methyltrans...    266   6e-82   Cicer arietinum [garbanzo]
ref|XP_006390538.1|  hypothetical protein EUTSA_v10018431mg             267   7e-82   Eutrema salsugineum [saltwater cress]
gb|AET05600.2|  phosphoethanolamine N-methyltransferase                 266   7e-82   Medicago truncatula
ref|XP_002322102.2|  hypothetical protein POPTR_0015s04540g             267   7e-82   
ref|XP_003631124.1|  Phosphoethanolamine N-methyltransferase            266   7e-82   
ref|XP_003631125.1|  Phosphoethanolamine N-methyltransferase            266   1e-81   
ref|XP_009404071.1|  PREDICTED: phosphomethylethanolamine N-methy...    266   1e-81   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010416170.1|  PREDICTED: phosphoethanolamine N-methyltrans...    265   1e-81   Camelina sativa [gold-of-pleasure]
ref|XP_010428286.1|  PREDICTED: phosphoethanolamine N-methyltrans...    265   2e-81   Camelina sativa [gold-of-pleasure]
ref|XP_010921188.1|  PREDICTED: phosphoethanolamine N-methyltrans...    266   2e-81   
ref|XP_003534138.1|  PREDICTED: phosphoethanolamine N-methyltrans...    265   2e-81   
ref|XP_008799222.1|  PREDICTED: phosphomethylethanolamine N-methy...    265   3e-81   
ref|XP_004241642.1|  PREDICTED: phosphoethanolamine N-methyltrans...    265   3e-81   Solanum lycopersicum
dbj|BAG50404.1|  methyltransferase                                      253   4e-81   Cardamine sp. SIM-2007
ref|XP_004969637.1|  PREDICTED: phosphoethanolamine N-methyltrans...    264   5e-81   Setaria italica
gb|KFK41794.1|  hypothetical protein AALP_AA2G173000                    265   5e-81   Arabis alpina [alpine rockcress]
ref|XP_004512744.1|  PREDICTED: phosphoethanolamine N-methyltrans...    264   6e-81   Cicer arietinum [garbanzo]
ref|XP_002887491.1|  predicted protein                                  264   7e-81   
ref|NP_974139.2|  putative phosphoethanolamine N-methyltransferase 3    264   1e-80   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006302164.1|  hypothetical protein CARUB_v10020173mg             263   1e-80   Capsella rubella
dbj|BAC57432.1|  phosphoethanolamine N-methyltransferase                262   3e-80   Suaeda japonica
ref|XP_004961340.1|  PREDICTED: phosphoethanolamine N-methyltrans...    262   4e-80   Setaria italica
gb|AFW04224.1|  phosphoethanolamine N-methyl transferase                262   4e-80   Suaeda maritima
ref|XP_006655550.1|  PREDICTED: phosphoethanolamine N-methyltrans...    262   4e-80   Oryza brachyantha
dbj|BAE99185.1|  putative phosphoethanolamine N-methyltransferase       262   5e-80   Arabidopsis thaliana [mouse-ear cress]
gb|ABK42071.1|  phosphoethanolamine N-methyltransferase                 261   5e-80   Suaeda liaotungensis
ref|XP_010471422.1|  PREDICTED: phosphoethanolamine N-methyltrans...    261   6e-80   Camelina sativa [gold-of-pleasure]
ref|XP_004512745.1|  PREDICTED: phosphoethanolamine N-methyltrans...    261   7e-80   Cicer arietinum [garbanzo]
ref|XP_010428285.1|  PREDICTED: phosphoethanolamine N-methyltrans...    261   1e-79   Camelina sativa [gold-of-pleasure]
ref|XP_006393388.1|  hypothetical protein EUTSA_v10012068mg             253   2e-79   
ref|XP_010471421.1|  PREDICTED: phosphoethanolamine N-methyltrans...    260   2e-79   Camelina sativa [gold-of-pleasure]
ref|XP_003567962.1|  PREDICTED: phosphomethylethanolamine N-methy...    260   3e-79   Brachypodium distachyon [annual false brome]
ref|XP_002441466.1|  hypothetical protein SORBIDRAFT_09g027360          259   5e-79   Sorghum bicolor [broomcorn]
ref|NP_001169597.1|  uncharacterized LOC100383478                       259   8e-79   Zea mays [maize]
ref|XP_003619836.1|  Phosphoethanolamine N-methyltransferase            258   1e-78   Medicago truncatula
ref|NP_175293.1|  phosphoethanolamine N-methyltransferase 2             256   3e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002456193.1|  hypothetical protein SORBIDRAFT_03g031940          256   5e-78   Sorghum bicolor [broomcorn]
ref|XP_008675146.1|  PREDICTED: phosphoethanolamine N-methyltrans...    256   7e-78   Zea mays [maize]
ref|XP_007160542.1|  hypothetical protein PHAVU_002G330400g             256   7e-78   Phaseolus vulgaris [French bean]
emb|CDY40594.1|  BnaC06g02100D                                          255   9e-78   Brassica napus [oilseed rape]
emb|CDX93681.1|  BnaA06g03670D                                          255   9e-78   
ref|XP_010461685.1|  PREDICTED: phosphomethylethanolamine N-methy...    247   9e-78   Camelina sativa [gold-of-pleasure]
ref|XP_006393387.1|  hypothetical protein EUTSA_v10011451mg             255   9e-78   
ref|XP_008675144.1|  PREDICTED: phosphoethanolamine N-methyltrans...    256   1e-77   
ref|XP_007160543.1|  hypothetical protein PHAVU_002G330400g             256   1e-77   Phaseolus vulgaris [French bean]
ref|XP_003525185.1|  PREDICTED: phosphoethanolamine N-methyltrans...    255   1e-77   
gb|AAV67950.1|  putative phosphoethanolamine N-methyltransferase        255   1e-77   Zea mays [maize]
tpg|DAA57997.1|  TPA: putative phosphoethanolamine N-methyltransf...    255   1e-77   
gb|ABG57185.1|  phosphoethanolamine N-methyltransferase                 255   2e-77   Salicornia europaea [chicken-claws]
gb|AFZ78648.1|  methyl transferase                                      251   3e-76   Populus tomentosa [Chinese white poplar]
ref|XP_010500398.1|  PREDICTED: phosphomethylethanolamine N-methy...    249   2e-75   Camelina sativa [gold-of-pleasure]
ref|XP_010921205.1|  PREDICTED: phosphoethanolamine N-methyltrans...    249   2e-75   
ref|XP_002284594.1|  PREDICTED: phosphoethanolamine N-methyltrans...    245   8e-74   Vitis vinifera
emb|CDX92181.1|  BnaA05g22260D                                          243   2e-73   
gb|AAL40895.1|  phosphoethanolamine methyltransferase                   244   3e-73   Triticum aestivum [Canadian hard winter wheat]
gb|KJB30120.1|  hypothetical protein B456_005G132000                    242   6e-73   Gossypium raimondii
ref|XP_001763293.1|  predicted protein                                  240   7e-72   
gb|KJB53041.1|  hypothetical protein B456_008G289900                    239   8e-72   Gossypium raimondii
ref|XP_010655650.1|  PREDICTED: phosphomethylethanolamine N-methy...    240   1e-71   Vitis vinifera
gb|KJB53038.1|  hypothetical protein B456_008G289900                    239   2e-71   Gossypium raimondii
gb|KJB53040.1|  hypothetical protein B456_008G289900                    239   2e-71   Gossypium raimondii
gb|KJB53039.1|  hypothetical protein B456_008G289900                    239   3e-71   Gossypium raimondii
gb|EEC79642.1|  hypothetical protein OsI_20868                          237   2e-70   Oryza sativa Indica Group [Indian rice]
ref|XP_006306318.1|  hypothetical protein CARUB_v10012188mg             231   5e-70   
emb|CDX95799.1|  BnaC05g35500D                                          234   1e-69   
ref|XP_006376718.1|  hypothetical protein POPTR_0012s044902g            221   5e-69   
gb|ABK24808.1|  unknown                                                 231   2e-68   Picea sitchensis
ref|XP_001768934.1|  predicted protein                                  224   4e-66   
emb|CBI26879.3|  unnamed protein product                                224   9e-66   Vitis vinifera
gb|KHN10536.1|  Phosphoethanolamine N-methyltransferase                 223   1e-65   Glycine soja [wild soybean]
ref|XP_002969650.1|  hypothetical protein SELMODRAFT_146547             221   1e-64   Selaginella moellendorffii
ref|XP_002970912.1|  hypothetical protein SELMODRAFT_270875             221   2e-64   Selaginella moellendorffii
ref|XP_006303561.1|  hypothetical protein CARUB_v10011038mg             220   3e-64   
ref|XP_010540184.1|  PREDICTED: phosphoethanolamine N-methyltrans...    218   1e-63   Tarenaya hassleriana [spider flower]
ref|XP_002317875.2|  Phosphoethanolamine N-methyltransferase 1 fa...    203   6e-62   
gb|AGO59019.1|  heat responsive transcription factor protein            213   8e-62   Triticum aestivum [Canadian hard winter wheat]
gb|KDD75565.1|  hypothetical protein H632_c615p0                        204   2e-60   Helicosporidium sp. ATCC 50920
gb|EAY75471.1|  hypothetical protein OsI_03371                          206   5e-59   Oryza sativa Indica Group [Indian rice]
ref|XP_004137342.1|  PREDICTED: phosphomethylethanolamine N-methy...    204   3e-58   Cucumis sativus [cucumbers]
ref|XP_002730517.1|  PREDICTED: phosphoethanolamine N-methyltrans...    190   2e-56   Saccoglossus kowalevskii
ref|XP_011399976.1|  Phosphoethanolamine N-methyltransferase            200   2e-56   Auxenochlorella protothecoides
ref|XP_010231068.1|  PREDICTED: phosphomethylethanolamine N-methy...    199   2e-56   Brachypodium distachyon [annual false brome]
ref|XP_002454522.1|  hypothetical protein SORBIDRAFT_04g032625          187   1e-55   
gb|KIZ00652.1|  hypothetical protein MNEG_7307                          191   2e-55   Monoraphidium neglectum
ref|XP_002594091.1|  hypothetical protein BRAFLDRAFT_68467              188   1e-54   Branchiostoma floridae
ref|XP_009011308.1|  hypothetical protein HELRODRAFT_71964              185   9e-54   Helobdella robusta
ref|XP_002594077.1|  hypothetical protein BRAFLDRAFT_68483              187   9e-54   Branchiostoma floridae
ref|XP_008453688.1|  PREDICTED: phosphoethanolamine N-methyltrans...    180   4e-52   Cucumis melo [Oriental melon]
ref|XP_002594089.1|  hypothetical protein BRAFLDRAFT_118790             190   4e-52   Branchiostoma floridae
gb|AHY01341.1|  phosphoethanolamine methyltransferase                   179   6e-52   Carassius gibelio [gibel carp]
ref|XP_010864863.1|  PREDICTED: phosphoethanolamine N-methyltrans...    184   2e-50   Esox lucius
ref|NP_001070105.1|  phosphoethanolamine methyltransferase              183   3e-50   Danio rerio [leopard danio]
ref|XP_008324913.1|  PREDICTED: phosphoethanolamine N-methyltrans...    182   6e-50   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_008324912.1|  PREDICTED: phosphoethanolamine N-methyltrans...    182   6e-50   Cynoglossus semilaevis [half-smooth tongue sole]
gb|ETM43048.1|  hypothetical protein L914_11412                         176   6e-50   Phytophthora parasitica
ref|XP_008324914.1|  PREDICTED: phosphoethanolamine N-methyltrans...    182   9e-50   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_005643867.1|  S-adenosyl-L-methionine-dependent methyltran...    182   1e-49   Coccomyxa subellipsoidea C-169
gb|EMT23240.1|  Phosphoethanolamine N-methyltransferase 1               182   1e-49   
ref|XP_006003521.1|  PREDICTED: phosphoethanolamine N-methyltrans...    176   2e-49   
gb|ETK83171.1|  hypothetical protein L915_11577                         173   2e-49   Phytophthora parasitica
ref|NP_001096276.2|  phosphoethanolamine methyltransferase              181   2e-49   Xenopus tropicalis [western clawed frog]
ref|XP_005096334.1|  PREDICTED: phosphoethanolamine N-methyltrans...    181   2e-49   Aplysia californica
ref|NP_001167350.1|  phosphoethanolamine N-methyltransferase 3          181   2e-49   Salmo salar
ref|XP_008418600.1|  PREDICTED: phosphoethanolamine N-methyltrans...    181   3e-49   Poecilia reticulata
ref|XP_008418601.1|  PREDICTED: phosphoethanolamine N-methyltrans...    181   3e-49   Poecilia reticulata
gb|ETL36539.1|  hypothetical protein L916_11495                         173   7e-49   Phytophthora parasitica
ref|XP_005806845.1|  PREDICTED: phosphoethanolamine N-methyltrans...    179   9e-49   Xiphophorus maculatus
ref|XP_005723169.1|  PREDICTED: phosphoethanolamine N-methyltrans...    178   3e-48   Pundamilia nyererei
ref|XP_007550439.1|  PREDICTED: phosphoethanolamine N-methyltrans...    178   3e-48   Poecilia formosa
ref|XP_005723168.1|  PREDICTED: phosphoethanolamine N-methyltrans...    178   3e-48   
ref|XP_005723167.1|  PREDICTED: phosphoethanolamine N-methyltrans...    178   3e-48   Pundamilia nyererei
gb|KDO18851.1|  hypothetical protein SPRG_15850                         177   4e-48   Saprolegnia parasitica CBS 223.65
ref|XP_008620239.1|  hypothetical protein SDRG_15833                    177   5e-48   Saprolegnia diclina VS20
ref|XP_006781399.1|  PREDICTED: phosphoethanolamine N-methyltrans...    177   5e-48   Neolamprologus brichardi [lyretail cichlid]
gb|AAI35513.1|  LOC100124841 protein                                    177   6e-48   Xenopus tropicalis [western clawed frog]
ref|XP_008278560.1|  PREDICTED: phosphoethanolamine N-methyltrans...    177   6e-48   Stegastes partitus
ref|XP_008278559.1|  PREDICTED: phosphoethanolamine N-methyltrans...    177   7e-48   Stegastes partitus
ref|XP_005096335.1|  PREDICTED: phosphoethanolamine N-methyltrans...    177   8e-48   Aplysia californica
ref|XP_002898137.1|  phosphoethanolamine N-methyltransferase, put...    177   1e-47   Phytophthora infestans T30-4
ref|XP_004545581.1|  PREDICTED: phosphoethanolamine N-methyltrans...    176   1e-47   
ref|XP_004545582.1|  PREDICTED: phosphoethanolamine N-methyltrans...    176   1e-47   
ref|XP_005913451.1|  PREDICTED: phosphoethanolamine N-methyltrans...    176   1e-47   Haplochromis burtoni
ref|XP_005913450.1|  PREDICTED: phosphoethanolamine N-methyltrans...    176   1e-47   Haplochromis burtoni
ref|XP_003444639.1|  PREDICTED: phosphoethanolamine N-methyltrans...    176   1e-47   Oreochromis niloticus
ref|XP_005467629.1|  PREDICTED: phosphoethanolamine N-methyltrans...    176   1e-47   Oreochromis niloticus
ref|XP_005467627.1|  PREDICTED: phosphoethanolamine N-methyltrans...    176   1e-47   Oreochromis niloticus
ref|XP_010655490.1|  PREDICTED: phosphomethylethanolamine N-methy...    176   2e-47   Vitis vinifera
emb|CBI26877.3|  unnamed protein product                                176   2e-47   Vitis vinifera
ref|XP_008872791.1|  hypothetical protein H310_08714                    176   2e-47   Aphanomyces invadans
ref|NP_001087172.1|  phosphoethanolamine methyltransferase              175   3e-47   Xenopus laevis [clawed frog]
ref|XP_005855505.1|  phosphoethanolamine n-methyltransferase            176   4e-47   Nannochloropsis gaditana CCMP526
gb|EWM27854.1|  phosphoethanolamine n-methyltransferase                 176   8e-47   Nannochloropsis gaditana
emb|CAN75113.1|  hypothetical protein VITISV_043577                     173   8e-47   Vitis vinifera
gb|ETI43103.1|  hypothetical protein F443_11871                         167   9e-47   Phytophthora parasitica P1569
ref|XP_009832411.1|  hypothetical protein H257_08283                    174   9e-47   Aphanomyces astaci
gb|ETP40954.1|  hypothetical protein F442_11792                         167   2e-46   Phytophthora parasitica P10297
gb|ETP27600.1|  hypothetical protein F442_23122                         167   2e-46   Phytophthora parasitica P10297
ref|XP_011608846.1|  PREDICTED: phosphoethanolamine N-methyltrans...    167   3e-46   Takifugu rubripes [tiger puffer]
ref|XP_004073222.1|  PREDICTED: phosphoethanolamine N-methyltrans...    172   3e-46   
ref|XP_010730439.1|  PREDICTED: phosphomethylethanolamine N-methy...    172   4e-46   
ref|XP_010730440.1|  PREDICTED: phosphomethylethanolamine N-methy...    172   4e-46   
gb|EMT23241.1|  Phosphoethanolamine N-methyltransferase 1               172   7e-46   
gb|EMT23242.1|  Putative phosphoethanolamine N-methyltransferase 2      168   7e-46   
ref|XP_011608847.1|  PREDICTED: phosphoethanolamine N-methyltrans...    164   1e-45   
ref|XP_007440631.1|  PREDICTED: phosphomethylethanolamine N-methy...    171   2e-45   
gb|ETL89752.1|  hypothetical protein L917_11366                         167   2e-45   Phytophthora parasitica
gb|ELU13998.1|  hypothetical protein CAPTEDRAFT_140071                  161   4e-45   Capitella teleta
gb|ETK83144.1|  hypothetical protein L915_11579                         167   4e-45   
gb|EPS69227.1|  hypothetical protein M569_05544                         165   9e-45   
ref|XP_009525377.1|  hypothetical protein PHYSODRAFT_354467             165   1e-44   
ref|XP_009061459.1|  hypothetical protein LOTGIDRAFT_219756             168   1e-44   
ref|XP_011608845.1|  PREDICTED: phosphoethanolamine N-methyltrans...    168   1e-44   
ref|XP_011608844.1|  PREDICTED: phosphoethanolamine N-methyltrans...    169   1e-44   
gb|ELU02022.1|  hypothetical protein CAPTEDRAFT_91785                   160   3e-44   
emb|CAG09731.1|  unnamed protein product                                166   1e-43   
emb|CCI39434.1|  unnamed protein product                                164   3e-43   
ref|XP_002898136.1|  phosphoethanolamine N-methyltransferase            164   3e-43   
ref|XP_009525359.1|  hypothetical protein PHYSODRAFT_345888             164   6e-43   
emb|CCA16454.1|  phosphoethanolamine Nmethyltransferase putative        162   3e-42   
gb|ELT87122.1|  hypothetical protein CAPTEDRAFT_189076                  160   8e-42   
gb|KFM80232.1|  Phosphoethanolamine N-methyltransferase                 150   1e-40   
ref|XP_011453570.1|  PREDICTED: phosphoethanolamine N-methyltrans...    153   3e-39   
ref|XP_011453569.1|  PREDICTED: phosphoethanolamine N-methyltrans...    153   4e-39   
ref|XP_011453571.1|  PREDICTED: phosphoethanolamine N-methyltrans...    152   6e-39   
gb|EFX73213.1|  hypothetical protein DAPPUDRAFT_58148                   152   8e-39   
ref|XP_010677350.1|  PREDICTED: phosphoethanolamine N-methyltrans...    147   3e-37   
ref|XP_010481025.1|  PREDICTED: phosphomethylethanolamine N-methy...    145   8e-37   
emb|CDM83854.1|  unnamed protein product                                145   1e-36   
ref|XP_009862400.1|  PREDICTED: phosphoethanolamine N-methyltrans...    140   1e-36   
gb|EPB69307.1|  methyltransferase domain protein                        141   6e-36   
emb|CDJ81011.1|  Methyltransferase type 11 domain containing protein    142   3e-35   
gb|KJH50371.1|  methyltransferase domain protein                        142   4e-35   
gb|ETN83758.1|  methyltransferase domain protein                        140   7e-35   
gb|EYC44164.1|  hypothetical protein Y032_0470g2031                     140   8e-35   
ref|XP_006824126.1|  PREDICTED: phosphoethanolamine N-methyltrans...    133   3e-34   
ref|NP_494991.1|  Protein PMT-1, isoform b                              135   7e-33   
ref|XP_003108788.1|  CRE-PMT-1 protein                                  134   2e-32   
ref|NP_494990.2|  Protein PMT-1, isoform a                              134   2e-32   
ref|NP_871998.1|  Protein PMT-1, isoform d                              134   2e-32   
gb|KKA69568.1|  methyltransferase                                       128   3e-32   
gb|EKE08147.1|  Phosphoethanolamine N-methyltransferase                 128   4e-32   
gb|EGT50464.1|  hypothetical protein CAEBREN_10892                      133   5e-32   
gb|EGT32041.1|  hypothetical protein CAEBREN_18341                      133   5e-32   
ref|XP_002630685.1|  C. briggsae CBR-PMT-1 protein                      133   6e-32   
pdb|4KRG|A  Chain A, Semet Haemonchus Contortus Phosphoethanolami...    132   8e-32   
ref|XP_011660744.1|  PREDICTED: phosphoethanolamine N-methyltrans...    129   1e-30   
gb|ERG79882.1|  phosphoethanolamine n-methyltransferase                 127   4e-30   
emb|CDQ92053.1|  unnamed protein product                                112   8e-27   
ref|XP_008908105.1|  hypothetical protein PPTG_12690                    111   1e-26   
gb|ETO71745.1|  hypothetical protein F444_11961                         112   2e-26   
ref|XP_010314226.1|  PREDICTED: phosphoethanolamine N-methyltrans...    115   3e-26   
ref|XP_007228349.1|  PREDICTED: phosphoethanolamine N-methyltrans...    117   4e-26   
gb|ETO07474.1|  hypothetical protein RFI_29918                          110   7e-26   
gb|ETO01952.1|  hypothetical protein RFI_35487                          109   7e-26   
ref|WP_027370305.1|  hypothetical protein                               110   3e-25   
ref|XP_011403472.1|  PREDICTED: phosphoethanolamine N-methyltrans...    113   4e-25   
gb|ETO35874.1|  phosphoethanolamine N-methyltransferase 2 (NMT2)        108   3e-24   
ref|XP_010774827.1|  PREDICTED: phosphoethanolamine N-methyltrans...    110   3e-24   
emb|CEF71262.1|  Protein of unknown function DUF858, methyltransf...    107   4e-23   
emb|CDX74572.1|  BnaA04g08170D                                          106   6e-23   
ref|WP_020209191.1|  hypothetical protein                               105   3e-22   
ref|WP_013610264.1|  Putative SAM-dependent methyltransferase         99.8    2e-21   
emb|CDY35847.1|  BnaC09g37790D                                          100   6e-21   
emb|CDY07952.1|  BnaC03g35710D                                        96.7    1e-19   
gb|AFK44813.1|  unknown                                               92.0    2e-19   
emb|CEF71482.1|  Protein of unknown function DUF858, methyltransf...  96.7    4e-19   
gb|EPB65997.1|  hypothetical protein ANCCEY_14916                     93.6    6e-19   
gb|KHJ94304.1|  hypothetical protein OESDEN_05765                     92.8    3e-18   
gb|KFG31924.1|  methyltransferase domain-containing protein           90.1    6e-17   
ref|XP_002370184.1|  calpain, putative                                90.1    6e-17   
gb|KFG59470.1|  methyltransferase domain-containing protein           90.1    6e-17   
emb|CAJ20397.1|  hypothetical protein TgIa.1450                       90.1    7e-17   
gb|KFH03254.1|  methyltransferase domain-containing protein           90.1    7e-17   
ref|XP_008884763.1|  methyltransferase domain-containing protein      87.0    8e-16   
gb|KHG05875.1|  Phosphoethanolamine N-methyltransferase 1 -like p...  77.4    2e-13   
gb|KHN16511.1|  Phosphoethanolamine N-methyltransferase               75.5    5e-13   
gb|AFK40181.1|  unknown                                               71.6    8e-13   
gb|AFW78992.1|  hypothetical protein ZEAMMB73_932976                  71.6    2e-12   
gb|ETO71769.1|  hypothetical protein F444_11956                       69.3    1e-11   
gb|ETP40963.1|  hypothetical protein F442_11783                       68.9    1e-11   
gb|EMT23239.1|  hypothetical protein F775_30181                       67.8    3e-11   
gb|KJB30118.1|  hypothetical protein B456_005G132000                  68.9    6e-10   
ref|WP_017004055.1|  hypothetical protein                             64.3    1e-08   
ref|WP_016959600.1|  hypothetical protein                             64.3    1e-08   
ref|WP_038474864.1|  hypothetical protein                             62.8    2e-08   
ref|WP_042231279.1|  methyltransferase type 11                        62.8    3e-08   
ref|WP_009548140.1|  methylase involved in ubiquinone/menaquinone...  62.0    6e-08   
ref|WP_038589229.1|  methyltransferase type 11                        62.0    6e-08   
ref|WP_030923479.1|  hypothetical protein                             62.0    8e-08   
ref|WP_041268184.1|  hypothetical protein                             60.1    8e-08   
ref|WP_032758401.1|  MULTISPECIES: hypothetical protein               60.5    2e-07   
gb|ABZ87545.1|  methyltransferase type 11                             59.7    2e-07   
ref|WP_035015125.1|  hypothetical protein                             60.8    2e-07   
ref|WP_030320182.1|  ubiquinone biosynthesis methyltransferase UbiE   60.8    3e-07   
ref|WP_034729509.1|  SAM-dependent methyltransferase                  60.1    3e-07   
ref|WP_042175094.1|  methyltransferase type 11                        59.7    3e-07   
ref|WP_029535633.1|  methyltransferase type 11                        58.9    5e-07   
gb|ETL89780.1|  hypothetical protein L917_11359                       55.5    7e-07   
gb|ETB50522.1|  methyltransferase type 11                             57.4    7e-07   
ref|WP_028552340.1|  methyltransferase type 11                        58.5    7e-07   
ref|WP_006458970.1|  methyltransferase, UbiE/COQ5 family              58.9    8e-07   
gb|EYE96434.1|  type 11 methyltransferase                             58.9    1e-06   
gb|KFF75318.1|  SAM-dependent methyltransferase                       58.2    1e-06   
gb|ETB43218.1|  methyltransferase type 11                             57.0    1e-06   
ref|WP_025592905.1|  SAM-dependent methyltransferase                  58.2    1e-06   
ref|WP_044914324.1|  SAM-dependent methyltransferase                  58.2    1e-06   
ref|WP_043801196.1|  malonyl-CoA O-methyltransferase                  56.6    1e-06   
ref|WP_045412251.1|  SAM-dependent methyltransferase                  58.2    1e-06   
ref|WP_002137162.1|  methyltransferase                                58.2    1e-06   
ref|WP_009675881.1|  MULTISPECIES: methyltransferase type 11          57.8    1e-06   
ref|XP_002413140.1|  phosphoethanolamine N-methyltransferase, put...  56.2    2e-06   
ref|WP_013635800.1|  methyltransferase                                57.8    2e-06   
ref|WP_020674224.1|  hypothetical protein                             57.4    2e-06   
ref|WP_019565359.1|  methyltransferase                                57.8    2e-06   
gb|ERI71059.1|  methyltransferase domain protein                      56.6    2e-06   
ref|WP_015365730.1|  Methyltransferase type 11                        57.8    2e-06   
ref|WP_045359631.1|  SAM-dependent methyltransferase                  57.8    2e-06   
ref|WP_006613022.1|  SAM-dependent methlyltransferase                 57.0    2e-06   
ref|WP_028971893.1|  methyltransferase type 11                        57.4    2e-06   
ref|WP_027734845.1|  hypothetical protein                             57.0    2e-06   
ref|WP_043330844.1|  ubiquinone biosynthesis protein                  56.6    3e-06   
ref|WP_014381807.1|  methyltransferase type 11                        57.8    3e-06   
ref|WP_009954416.1|  MULTISPECIES: methyltransferase type 11          57.8    3e-06   
ref|WP_036343328.1|  ubiquinone biosynthesis protein                  56.6    3e-06   
gb|KCZ72303.1|  methyltransferase family protein                      57.4    3e-06   
ref|WP_014941284.1|  methyltransferase type 11                        57.4    3e-06   
gb|EQB28536.1|  methylase involved in ubiquinone/menaquinone bios...  57.0    3e-06   
ref|WP_022493475.1|  phosphoethanolamine Nmethyltransferase putative  56.6    3e-06   
ref|WP_039871819.1|  methyltransferase type 11                        57.0    3e-06   
ref|WP_026932721.1|  methyltransferase type 11                        56.2    3e-06   
ref|WP_017249948.1|  methyltransferase type 11                        56.6    3e-06   
ref|WP_014379131.1|  methyltransferase type 11                        57.4    3e-06   
gb|EWM66995.1|  methyltransferase                                     57.0    3e-06   
ref|WP_015850956.1|  SAM-dependent methyltransferase                  56.6    3e-06   
ref|WP_045022599.1|  SAM-dependent methyltransferase                  56.6    4e-06   
gb|KIH63696.1|  hypothetical protein ANCDUO_06001                     54.3    4e-06   
gb|AIF84066.1|  methylase involved in ubiquinone/menaquinone bios...  56.2    4e-06   
ref|WP_035218037.1|  SAM-dependent methyltransferase                  56.6    5e-06   
ref|WP_038256373.1|  SAM-dependent methyltransferase                  56.6    5e-06   
ref|WP_040903760.1|  SAM-dependent methyltransferase                  56.6    5e-06   
ref|WP_032680433.1|  SAM-dependent methyltransferase                  56.2    6e-06   
ref|WP_038205258.1|  biotin synthase                                  56.6    6e-06   
ref|WP_038490461.1|  SAM-dependent methyltransferase                  56.2    6e-06   
ref|WP_003512256.1|  methyltransferase                                56.2    6e-06   
ref|WP_031167243.1|  hypothetical protein                             56.6    6e-06   
ref|WP_044859262.1|  SAM-dependent methyltransferase                  56.2    7e-06   
ref|WP_032708748.1|  SAM-dependent methyltransferase                  56.2    7e-06   
gb|EHM45042.1|  methyltransferase domain protein                      56.2    7e-06   
ref|WP_008253539.1|  methyltransferase-UbiE family protein            56.2    7e-06   
ref|WP_032712033.1|  SAM-dependent methyltransferase                  55.8    8e-06   
ref|WP_045500447.1|  SAM-dependent methyltransferase                  55.8    8e-06   
ref|WP_038675258.1|  methyltransferase type 11                        55.8    9e-06   
ref|WP_018760746.1|  UbiE family methyltransferase                    56.2    9e-06   
ref|WP_028025295.1|  biotin synthase                                  56.2    9e-06   
ref|WP_040018944.1|  SAM-dependent methyltransferase                  55.8    9e-06   
ref|WP_020078296.1|  SAM-dependent methyltransferase                  55.8    9e-06   
ref|WP_030171158.1|  ubiquinone biosynthesis methyltransferase UbiE   55.8    9e-06   
ref|WP_014710950.1|  MULTISPECIES: methyltransferase type 11          55.8    9e-06   
gb|AIF52542.1|  Methyltransferase type 11                             55.8    9e-06   
ref|WP_043281533.1|  hypothetical protein                             53.5    9e-06   
dbj|GAF27217.1|  methylase                                            55.1    9e-06   
ref|WP_009589920.1|  methyltransferase type 11                        55.5    9e-06   
ref|WP_011710956.1|  methyltransferase type 11                        55.1    1e-05   
ref|WP_032714967.1|  SAM-dependent methyltransferase                  55.8    1e-05   
ref|WP_017813896.1|  hypothetical protein                             55.5    1e-05   
ref|WP_037742588.1|  hypothetical protein                             55.8    1e-05   
ref|WP_044458759.1|  SAM-dependent methyltransferase                  55.5    1e-05   
ref|WP_000608899.1|  malonyl-CoA O-methyltransferase                  55.8    1e-05   
ref|WP_016101074.1|  hypothetical protein                             55.5    1e-05   
gb|AKB43312.1|  Methyltransferase                                     55.5    1e-05   
ref|XP_001684676.1|  conserved hypothetical protein                   55.5    1e-05   
ref|WP_002033133.1|  MULTISPECIES: methyltransferase                  55.5    1e-05   
ref|WP_023866537.1|  methyltransferase type 11                        55.8    1e-05   
ref|WP_044446450.1|  hypothetical protein                             55.8    1e-05   
ref|WP_045391261.1|  SAM-dependent methyltransferase                  55.5    1e-05   
ref|WP_003501956.1|  methyltransferase                                55.5    1e-05   
ref|WP_023346141.1|  hypothetical protein                             55.5    1e-05   
ref|WP_002142407.1|  MULTISPECIES: methyltransferase                  55.5    1e-05   
ref|WP_025655865.1|  SAM-dependent methyltransferase                  55.5    1e-05   
ref|WP_033711115.1|  MULTISPECIES: methyltransferase type 11          55.8    1e-05   
ref|WP_035210160.1|  SAM-dependent methyltransferase                  55.5    1e-05   
ref|WP_024732549.1|  hypothetical protein                             55.5    1e-05   
ref|WP_006311543.1|  methyltransferase                                55.5    1e-05   
ref|WP_009792281.1|  MULTISPECIES: ubiquinone biosynthesis methyl...  55.1    1e-05   
ref|WP_044859259.1|  SAM-dependent methyltransferase                  55.5    1e-05   
ref|XP_006462433.1|  hypothetical protein AGABI2DRAFT_193584          55.1    1e-05   
ref|WP_045017016.1|  SAM-dependent methyltransferase                  55.1    1e-05   
ref|WP_023160493.1|  biotin synthesis protein BioC                    55.1    1e-05   
gb|KFM98367.1|  methyltransferase small domain protein                55.5    1e-05   
ref|XP_002317876.2|  hypothetical protein POPTR_0012s044901g          55.8    1e-05   
ref|WP_045746290.1|  methyltransferase                                54.3    1e-05   
ref|WP_020883881.1|  Methyltransferase type 11                        55.1    1e-05   
ref|XP_006376720.1|  hypothetical protein POPTR_0012s044901g          55.8    1e-05   
ref|XP_007329890.1|  hypothetical protein AGABI1DRAFT_113755          55.1    1e-05   
gb|AAS02988.1|  hypothetical protein MAP_0671                         55.8    1e-05   
ref|WP_009003423.1|  SAM-dependent methyltransferase                  55.1    1e-05   
emb|CDI07940.1|  Methyltransferase                                    55.1    2e-05   
gb|AIY02586.1|  hypothetical protein ART_2987                         55.5    2e-05   
ref|WP_007595292.1|  glycosyl transferase                             56.2    2e-05   
ref|WP_038892061.1|  biotin biosynthesis protein BioC                 55.5    2e-05   
ref|WP_036624290.1|  rRNA adenine methyltransferase                   55.5    2e-05   
ref|XP_001595257.1|  hypothetical protein SS1G_03346                  55.1    2e-05   
ref|WP_037088919.1|  SAM-dependent methyltransferase                  55.1    2e-05   
ref|WP_009255029.1|  MULTISPECIES: SAM-dependent methyltransferase    55.1    2e-05   
ref|WP_015037516.1|  Methyltransferase                                55.5    2e-05   
ref|WP_044964911.1|  SAM-dependent methyltransferase                  55.1    2e-05   
ref|WP_025203408.1|  SAM-dependent methyltransferase                  55.1    2e-05   
ref|WP_013278213.1|  methyltransferase type 11                        54.7    2e-05   
ref|WP_018769998.1|  UbiE family methyltransferase                    55.5    2e-05   
gb|KIH53398.1|  hypothetical protein ANCDUO_16477                     52.4    2e-05   
ref|WP_012917996.1|  type 11 methyltransferase                        54.7    2e-05   
ref|WP_010971351.1|  MULTISPECIES: methyltransferase                  55.1    2e-05   
ref|WP_015323802.1|  methylase involved in ubiquinone/menaquinone...  54.7    2e-05   
ref|WP_000655494.1|  ubiquinone biosynthesis methyltransferase UbiE   54.7    2e-05   
ref|WP_040217132.1|  hypothetical protein                             55.1    2e-05   
ref|WP_019733079.1|  methyltransferase type 11                        55.1    2e-05   
ref|WP_003873068.1|  methyltransferase type 11                        55.1    2e-05   
ref|WP_009974977.1|  methyltransferase type 11                        55.1    2e-05   
gb|KIH60772.1|  hypothetical protein ANCDUO_08965                     55.5    2e-05   
ref|WP_002787593.1|  type 11 methyltransferase                        55.1    2e-05   
gb|EEL81767.1|  Methyltransferase type 11                             54.7    2e-05   
ref|WP_028164399.1|  SAM-dependent methyltransferase                  54.7    2e-05   
ref|WP_041162829.1|  SAM-dependent methyltransferase                  54.7    2e-05   
gb|ELP47551.1|  hypothetical protein D522_03959                       55.1    2e-05   
ref|WP_045534161.1|  SAM-dependent methyltransferase                  54.7    2e-05   
ref|WP_011816796.1|  biotin biosynthesis protein BioC                 54.7    2e-05   
ref|WP_005168075.1|  biotin biosynthesis protein BioC                 55.1    2e-05   
gb|KGA74303.1|  ubiE/COQ5 methyltransferase family protein            54.7    2e-05   



>ref|XP_009616694.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Nicotiana 
tomentosiformis]
Length=491

 Score =   292 bits (747),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = +2

Query  338  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  517
            MAA  G+EREVQKSYW+EH++ELTVEAMMLDSKAADLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAATSGQEREVQKSYWMEHTAELTVEAMMLDSKAADLDKEERPEVLSLLPPYEGKSVLEL  60

Query  518  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  697
            GAGIGRFTGELA+KAGQ+IA+DFIE  IKKNE+INGH  N+KFMCADVTS DLNFS ES+
Sbjct  61   GAGIGRFTGELAKKAGQLIALDFIEGAIKKNESINGHHKNVKFMCADVTSPDLNFSPESV  120

Query  698  DLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            DLIFSNWLLMYLSD EV+ L ERMVKWL VGGYIFFRESCFHQ
Sbjct  121  DLIFSNWLLMYLSDGEVQYLVERMVKWLKVGGYIFFRESCFHQ  163



>ref|XP_009757363.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Nicotiana 
sylvestris]
Length=491

 Score =   291 bits (746),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = +2

Query  338  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  517
            MAA  G+EREVQKSYW+EH++ELTVEAMMLDSKAADLDKEERPEV+S+LP YEGKSVLEL
Sbjct  1    MAATSGQEREVQKSYWMEHTAELTVEAMMLDSKAADLDKEERPEVVSLLPPYEGKSVLEL  60

Query  518  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  697
            GAGIGRFTGELA+KAGQ+IA+DFIE  IKKNE+INGH  N+KFMCADVTS DLNFS ES+
Sbjct  61   GAGIGRFTGELAKKAGQLIALDFIEGAIKKNESINGHHKNVKFMCADVTSPDLNFSPESV  120

Query  698  DLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            DLIFSNWLLMYLSD EV+ L ERMVKWL VGGYIFFRESCFHQ
Sbjct  121  DLIFSNWLLMYLSDGEVQDLVERMVKWLKVGGYIFFRESCFHQ  163



>ref|XP_011084235.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X2 [Sesamum indicum]
Length=491

 Score =   291 bits (744),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = +2

Query  338  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  517
            MAA Q +EREVQKSYWIEHS +LT+EAMMLDSKA+DLDKEERPEVLS+LP YEGKS+LEL
Sbjct  1    MAAIQEQEREVQKSYWIEHSVDLTLEAMMLDSKASDLDKEERPEVLSLLPPYEGKSILEL  60

Query  518  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  697
            GAGIGRFTGELA+K+GQ+IA+DFIE+VIKKNETINGH  N+KF+CADVTS+DLNFS+ S+
Sbjct  61   GAGIGRFTGELAKKSGQLIALDFIETVIKKNETINGHHKNVKFLCADVTSRDLNFSEGSL  120

Query  698  DLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            DLIFSNWLLMYLSD+EVE+L ERMV+WL VGGYIFFRESCFHQ
Sbjct  121  DLIFSNWLLMYLSDEEVENLVERMVRWLKVGGYIFFRESCFHQ  163



>ref|XP_009614862.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=499

 Score =   290 bits (743),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 136/170 (80%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +2

Query  317  TAIVQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYE  496
              ++ +A  A  G+ER+VQK+YWIEH+SELTVEAMMLDSKAADLDKEERPEVLS+LP+YE
Sbjct  2    APVISAATTASSGQERDVQKNYWIEHTSELTVEAMMLDSKAADLDKEERPEVLSLLPSYE  61

Query  497  GKSVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDL  676
            GKSVLELGAGIGRFTGELA+ AGQ+IA+DFIES IKKNE+IN H  N+KFMCADVTS DL
Sbjct  62   GKSVLELGAGIGRFTGELAKNAGQLIALDFIESAIKKNESINRHHKNVKFMCADVTSPDL  121

Query  677  NFSDESIDLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
             FS ES+DLIFSNWLLMYLSD+EV+SL ERMVKWL VGGYIFFRESCFHQ
Sbjct  122  KFSPESVDLIFSNWLLMYLSDEEVQSLVERMVKWLKVGGYIFFRESCFHQ  171



>ref|XP_007209941.1| hypothetical protein PRUPE_ppa004742mg [Prunus persica]
 gb|EMJ11140.1| hypothetical protein PRUPE_ppa004742mg [Prunus persica]
Length=463

 Score =   287 bits (735),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = +2

Query  338  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  517
            MAA  G+EREVQK+YW+EHS++LTVEAMMLDSKA+DLDKEERPEVLSMLP YEGKSVLEL
Sbjct  1    MAAPNGQEREVQKNYWVEHSADLTVEAMMLDSKASDLDKEERPEVLSMLPPYEGKSVLEL  60

Query  518  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  697
            GAGIGRFTGELAQKAGQ++A+DFI+SVIKKNE+ NGH  N+KFMCADVTS DL  S+ES+
Sbjct  61   GAGIGRFTGELAQKAGQLVALDFIDSVIKKNESTNGHHKNVKFMCADVTSPDLKISEESV  120

Query  698  DLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            D+IFSNWLLMYLSD+EVE+L ERM+ WL VGGYIFFRESCFHQ
Sbjct  121  DMIFSNWLLMYLSDKEVENLVERMMGWLKVGGYIFFRESCFHQ  163



>ref|XP_002282182.1| PREDICTED: phosphomethylethanolamine N-methyltransferase [Vitis 
vinifera]
 emb|CBI15568.3| unnamed protein product [Vitis vinifera]
Length=491

 Score =   288 bits (736),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = +2

Query  338  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  517
            MAA  G+ERE+QK+YW EHS++LTVEAMMLDSKAADLDKEERPEVLS+LP +EGKSVLEL
Sbjct  1    MAAQVGQEREIQKNYWAEHSADLTVEAMMLDSKAADLDKEERPEVLSLLPPFEGKSVLEL  60

Query  518  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  697
            GAGIGRFTGELAQKAGQVI++DFIESVIKKNE+INGH  N+KFMCADV S +LNFS ES+
Sbjct  61   GAGIGRFTGELAQKAGQVISLDFIESVIKKNESINGHYKNVKFMCADVASPELNFSAESV  120

Query  698  DLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            DLIFSNWLLMYLSD+EVE L ERMVKWL VGG+IFFRESCFHQ
Sbjct  121  DLIFSNWLLMYLSDKEVEELVERMVKWLKVGGFIFFRESCFHQ  163



>ref|XP_007209942.1| hypothetical protein PRUPE_ppa004742mg [Prunus persica]
 gb|EMJ11141.1| hypothetical protein PRUPE_ppa004742mg [Prunus persica]
Length=491

 Score =   287 bits (735),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = +2

Query  338  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  517
            MAA  G+EREVQK+YW+EHS++LTVEAMMLDSKA+DLDKEERPEVLSMLP YEGKSVLEL
Sbjct  1    MAAPNGQEREVQKNYWVEHSADLTVEAMMLDSKASDLDKEERPEVLSMLPPYEGKSVLEL  60

Query  518  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  697
            GAGIGRFTGELAQKAGQ++A+DFI+SVIKKNE+ NGH  N+KFMCADVTS DL  S+ES+
Sbjct  61   GAGIGRFTGELAQKAGQLVALDFIDSVIKKNESTNGHHKNVKFMCADVTSPDLKISEESV  120

Query  698  DLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            D+IFSNWLLMYLSD+EVE+L ERM+ WL VGGYIFFRESCFHQ
Sbjct  121  DMIFSNWLLMYLSDKEVENLVERMMGWLKVGGYIFFRESCFHQ  163



>ref|XP_010097563.1| hypothetical protein L484_017373 [Morus notabilis]
 gb|EXB69095.1| hypothetical protein L484_017373 [Morus notabilis]
Length=503

 Score =   287 bits (735),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = +2

Query  323  IVQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGK  502
            +  +A     G+ERE QK YW++HS++LTVEAMMLDSKA+DLDKEERPEVLS+LP YEGK
Sbjct  1    MADAATVNANGQEREKQKIYWMQHSADLTVEAMMLDSKASDLDKEERPEVLSLLPPYEGK  60

Query  503  SVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNF  682
            SVLELGAGIGRFT ELAQKAGQ++AMDFIESVIKKNE+INGH  N+KFMCADVTS DLN 
Sbjct  61   SVLELGAGIGRFTSELAQKAGQLVAMDFIESVIKKNESINGHYKNVKFMCADVTSPDLNI  120

Query  683  SDESIDLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            S++S+DLIFSNWLLMYLSD+EVE+LAERMVKWL VGGYIFFRESCFHQ
Sbjct  121  SEDSVDLIFSNWLLMYLSDKEVENLAERMVKWLKVGGYIFFRESCFHQ  168



>ref|XP_007209943.1| hypothetical protein PRUPE_ppa004742mg [Prunus persica]
 gb|EMJ11142.1| hypothetical protein PRUPE_ppa004742mg [Prunus persica]
Length=493

 Score =   287 bits (734),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = +2

Query  338  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  517
            MAA  G+EREVQK+YW+EHS++LTVEAMMLDSKA+DLDKEERPEVLSMLP YEGKSVLEL
Sbjct  1    MAAPNGQEREVQKNYWVEHSADLTVEAMMLDSKASDLDKEERPEVLSMLPPYEGKSVLEL  60

Query  518  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  697
            GAGIGRFTGELAQKAGQ++A+DFI+SVIKKNE+ NGH  N+KFMCADVTS DL  S+ES+
Sbjct  61   GAGIGRFTGELAQKAGQLVALDFIDSVIKKNESTNGHHKNVKFMCADVTSPDLKISEESV  120

Query  698  DLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            D+IFSNWLLMYLSD+EVE+L ERM+ WL VGGYIFFRESCFHQ
Sbjct  121  DMIFSNWLLMYLSDKEVENLVERMMGWLKVGGYIFFRESCFHQ  163



>ref|XP_011072995.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Sesamum 
indicum]
Length=491

 Score =   286 bits (732),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = +2

Query  338  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  517
            MAA Q +EREVQKSYW+EHS +LT+EAMMLDS A DLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAANQEQEREVQKSYWMEHSVDLTLEAMMLDSNACDLDKEERPEVLSLLPPYEGKSVLEL  60

Query  518  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  697
            GAGIGRFTGELA+KAG+++A+DFIESVIKKNETINGH  N+KFMCADVTS DLNF + S+
Sbjct  61   GAGIGRFTGELAKKAGELVALDFIESVIKKNETINGHNKNVKFMCADVTSPDLNFPEGSL  120

Query  698  DLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            DLIFSNWLLMYLSD+EVE LA+RMVKWL VGGYIFFRESCFHQ
Sbjct  121  DLIFSNWLLMYLSDKEVEDLAQRMVKWLKVGGYIFFRESCFHQ  163



>ref|XP_002532097.1| phosphoethanolamine n-methyltransferase, putative [Ricinus communis]
 gb|EEF30287.1| phosphoethanolamine n-methyltransferase, putative [Ricinus communis]
Length=492

 Score =   286 bits (732),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 138/164 (84%), Positives = 152/164 (93%), Gaps = 1/164 (1%)
 Frame = +2

Query  338  MAAFQG-EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  514
            MAA Q  EEREVQK+YWIEHS +LTVEAMMLDSKA+DLDKEERPEVLS+LP+YEGKSVLE
Sbjct  1    MAAAQNVEEREVQKNYWIEHSVDLTVEAMMLDSKASDLDKEERPEVLSLLPSYEGKSVLE  60

Query  515  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDES  694
             GAGIGRFTGELAQKAGQ++A+DFIESVIKKNE INGH  N+KFMCADVTS+ L FS+ES
Sbjct  61   FGAGIGRFTGELAQKAGQLVAVDFIESVIKKNENINGHHKNVKFMCADVTSQGLKFSEES  120

Query  695  IDLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            +DLIFSNWLLMYLSD+EV +LAERMVKWL VGGYIFFRESCFHQ
Sbjct  121  VDLIFSNWLLMYLSDEEVVNLAERMVKWLKVGGYIFFRESCFHQ  164



>ref|NP_001234549.1| phosphoethanolamine N-methyltransferase [Solanum lycopersicum]
 gb|AAG59894.1|AF328858_1 phosphoethanolamine N-methyltransferase [Solanum lycopersicum]
Length=491

 Score =   285 bits (730),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = +2

Query  338  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  517
            MAA  G+EREVQKSYWIEH++ELTVEAMMLDSKAADLDKEERPEVLS+LP YEGK+VLEL
Sbjct  1    MAAASGQEREVQKSYWIEHTAELTVEAMMLDSKAADLDKEERPEVLSLLPPYEGKTVLEL  60

Query  518  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  697
            GAGIGRFTGELAQKAGQ+IA+DFIE  IKKNE INGH  N+KFMCADVTS +L FS ES+
Sbjct  61   GAGIGRFTGELAQKAGQLIALDFIEGAIKKNENINGHYKNVKFMCADVTSPNLIFSPESV  120

Query  698  DLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            DLIFSNWLLMYLSD+EV++L ERMV WL VGG+IFFRESCFHQ
Sbjct  121  DLIFSNWLLMYLSDEEVKALVERMVIWLKVGGHIFFRESCFHQ  163



>ref|XP_010033717.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 [Eucalyptus 
grandis]
 gb|KCW84063.1| hypothetical protein EUGRSUZ_B00946 [Eucalyptus grandis]
Length=491

 Score =   285 bits (729),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = +2

Query  338  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  517
            MAA QG+ER VQKSYW EHS+ LTVEAMMLDSKA+DLDKEERPE+LS+LP YEGK+VLEL
Sbjct  1    MAAAQGDERHVQKSYWAEHSASLTVEAMMLDSKASDLDKEERPEILSLLPPYEGKTVLEL  60

Query  518  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  697
            GAGIGRFTGELAQKAGQ++A+DFI+  IKKNE+INGH  N+KF CADVTS DLN ++ES+
Sbjct  61   GAGIGRFTGELAQKAGQLLALDFIDGAIKKNESINGHHKNVKFQCADVTSPDLNIAEESV  120

Query  698  DLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            DLIFSNWLLMYLSD EVE+LAERM KWL VGGYIFFRESCFHQ
Sbjct  121  DLIFSNWLLMYLSDTEVENLAERMTKWLKVGGYIFFRESCFHQ  163



>ref|XP_006341528.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006341529.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X2 [Solanum tuberosum]
Length=491

 Score =   285 bits (729),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = +2

Query  338  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  517
            M A  G+EREVQKSYWIEH++ELTVEAMMLDSKAADLDKEERPEVLS+LP YEGK+VLEL
Sbjct  1    MDAASGQEREVQKSYWIEHTAELTVEAMMLDSKAADLDKEERPEVLSLLPPYEGKTVLEL  60

Query  518  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  697
            GAGIGRFTGELA KAGQ+IA+DFIE  IKKNE ING+  N+KFMCADVTS +LNFS ES+
Sbjct  61   GAGIGRFTGELANKAGQLIALDFIEGAIKKNENINGYHKNVKFMCADVTSPNLNFSPESV  120

Query  698  DLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            DLIFSNWLLMYLSD+EV++L ERMVKWL VGG+IFFRESCFHQ
Sbjct  121  DLIFSNWLLMYLSDEEVKALVERMVKWLKVGGHIFFRESCFHQ  163



>ref|XP_010533969.1| PREDICTED: phosphomethylethanolamine N-methyltransferase [Tarenaya 
hassleriana]
Length=491

 Score =   285 bits (729),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = +2

Query  338  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  517
            MA+  GEERE+QKSYW+EHS++LTVEAMMLDS+AADLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MASSYGEEREIQKSYWMEHSADLTVEAMMLDSRAADLDKEERPEVLSLLPPYEGKSVLEL  60

Query  518  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  697
            GAGIGRFTGELAQKAG+VIA+DFIES IKKNE++NGH  N+KFMC DVTS DL  +DESI
Sbjct  61   GAGIGRFTGELAQKAGEVIAIDFIESAIKKNESVNGHYKNVKFMCMDVTSPDLKITDESI  120

Query  698  DLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            DL+FSNWLLMYLSD+EVE LAERM++W+ VGGYI FRESCFHQ
Sbjct  121  DLLFSNWLLMYLSDKEVEHLAERMLRWVKVGGYIIFRESCFHQ  163



>emb|CAN64744.1| hypothetical protein VITISV_041321 [Vitis vinifera]
Length=490

 Score =   285 bits (729),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 151/163 (93%), Gaps = 1/163 (1%)
 Frame = +2

Query  338  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  517
            MAA QG+ERE+QK+YW EHS++LTVEAMMLDSKAADLDKEERPEVLS+LP +EGKSVLEL
Sbjct  1    MAA-QGQEREIQKNYWAEHSADLTVEAMMLDSKAADLDKEERPEVLSLLPPFEGKSVLEL  59

Query  518  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  697
            GAGIGRFT ELAQKAGQVI++DFIESVIKKNE+INGH  N+KFMCADV S +LNFS ES+
Sbjct  60   GAGIGRFTXELAQKAGQVISLDFIESVIKKNESINGHYKNVKFMCADVASPELNFSAESV  119

Query  698  DLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            DLIFSNWLLMYLSD+EVE L ERMVKWL VGG+IFFRESCFHQ
Sbjct  120  DLIFSNWLLMYLSDKEVEELVERMVKWLKVGGFIFFRESCFHQ  162



>ref|XP_011084227.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X1 [Sesamum indicum]
Length=494

 Score =   285 bits (728),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +2

Query  347  FQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAG  526
            F  +EREVQKSYWIEHS +LT+EAMMLDSKA+DLDKEERPEVLS+LP YEGKS+LELGAG
Sbjct  7    FVEQEREVQKSYWIEHSVDLTLEAMMLDSKASDLDKEERPEVLSLLPPYEGKSILELGAG  66

Query  527  IGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLI  706
            IGRFTGELA+K+GQ+IA+DFIE+VIKKNETINGH  N+KF+CADVTS+DLNFS+ S+DLI
Sbjct  67   IGRFTGELAKKSGQLIALDFIETVIKKNETINGHHKNVKFLCADVTSRDLNFSEGSLDLI  126

Query  707  FSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            FSNWLLMYLSD+EVE+L ERMV+WL VGGYIFFRESCFHQ
Sbjct  127  FSNWLLMYLSDEEVENLVERMVRWLKVGGYIFFRESCFHQ  166



>ref|XP_008240154.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 isoform 
X2 [Prunus mume]
Length=485

 Score =   284 bits (727),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 131/163 (80%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = +2

Query  338  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  517
            MAA  G+EREVQK+YW+EHS++LTVEAMMLDSKA+DLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAAANGQEREVQKNYWVEHSADLTVEAMMLDSKASDLDKEERPEVLSLLPPYEGKSVLEL  60

Query  518  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  697
            GAGIGRFT ELAQKAGQ++A+DFI+SVIKKNE+ NGH  N+KFMCADVTS DL  S+ES+
Sbjct  61   GAGIGRFTAELAQKAGQLVALDFIDSVIKKNESTNGHHKNVKFMCADVTSPDLKISEESV  120

Query  698  DLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            D+IFSNWLLMYLSD+EVE+L ERM+ WL VGGYIFFRESCFHQ
Sbjct  121  DMIFSNWLLMYLSDKEVENLVERMMGWLKVGGYIFFRESCFHQ  163



>ref|XP_008240152.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 isoform 
X1 [Prunus mume]
Length=491

 Score =   284 bits (726),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 131/163 (80%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = +2

Query  338  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  517
            MAA  G+EREVQK+YW+EHS++LTVEAMMLDSKA+DLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAAANGQEREVQKNYWVEHSADLTVEAMMLDSKASDLDKEERPEVLSLLPPYEGKSVLEL  60

Query  518  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  697
            GAGIGRFT ELAQKAGQ++A+DFI+SVIKKNE+ NGH  N+KFMCADVTS DL  S+ES+
Sbjct  61   GAGIGRFTAELAQKAGQLVALDFIDSVIKKNESTNGHHKNVKFMCADVTSPDLKISEESV  120

Query  698  DLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            D+IFSNWLLMYLSD+EVE+L ERM+ WL VGGYIFFRESCFHQ
Sbjct  121  DMIFSNWLLMYLSDKEVENLVERMMGWLKVGGYIFFRESCFHQ  163



>gb|KJB30121.1| hypothetical protein B456_005G132000 [Gossypium raimondii]
Length=422

 Score =   281 bits (720),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = +2

Query  335  AMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  514
            A   + G+ER+VQK+YWIEHS +LTVEAMMLDSKAAD+DKEERPEVLS+LP YEGK++LE
Sbjct  2    AANGYVGDERKVQKNYWIEHSVDLTVEAMMLDSKAADIDKEERPEVLSLLPPYEGKTILE  61

Query  515  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDES  694
            LGAGIGRFTG+LA+KAG VIA+DFIE+VIKKNETINGH  N+KF+CADVTS DL F++ S
Sbjct  62   LGAGIGRFTGDLAKKAGHVIALDFIENVIKKNETINGHYKNVKFLCADVTSPDLAFTEGS  121

Query  695  IDLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            +DLIFSNWLLMYLSD+EVE+LAERM+KWL VGG+IFFRESCFHQ
Sbjct  122  LDLIFSNWLLMYLSDKEVENLAERMLKWLKVGGHIFFRESCFHQ  165



>ref|XP_012088547.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X2 [Jatropha curcas]
Length=519

 Score =   284 bits (727),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/163 (80%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = +2

Query  338  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  517
            MAA   EERE+Q++YW+EHS +LTVEAMMLDSKA+DLDKEERPEVLSMLP+YEGKSVLE 
Sbjct  1    MAAHNVEEREIQRNYWMEHSVDLTVEAMMLDSKASDLDKEERPEVLSMLPSYEGKSVLEF  60

Query  518  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  697
            GAGIGRFTGE+AQ AGQ++A+DFI+SVIKKNE+INGH  N+KF+CADVTS+DL FS+ S+
Sbjct  61   GAGIGRFTGEIAQNAGQLVALDFIDSVIKKNESINGHYKNVKFICADVTSQDLKFSEGSV  120

Query  698  DLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            DLIFSNWLLMYLSD+EVE+L ERMVKWL VGGYIFFRESCFHQ
Sbjct  121  DLIFSNWLLMYLSDKEVENLVERMVKWLKVGGYIFFRESCFHQ  163



>ref|XP_010519218.1| PREDICTED: phosphoethanolamine N-methyltransferase 3 isoform 
X1 [Tarenaya hassleriana]
Length=510

 Score =   284 bits (726),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = +2

Query  326  VQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKS  505
            + S+++   GEERE+QKSYW EHS +L+VEAMMLDSKAADLDKEERPE+LS+LP YEGKS
Sbjct  7    ISSSLSKHNGEEREIQKSYWTEHSVDLSVEAMMLDSKAADLDKEERPEILSILPPYEGKS  66

Query  506  VLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFS  685
            VLE GAGIGRFTGE A KAGQVIA+DFI+SVIKKNE INGH  N+KFMCADVTS +L FS
Sbjct  67   VLEFGAGIGRFTGEFALKAGQVIAVDFIDSVIKKNENINGHHKNVKFMCADVTSPELKFS  126

Query  686  DESIDLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            DES+DLIFSNWLLMYLSD+EVE LA RM++WL VGGY+FFRESCFHQ
Sbjct  127  DESVDLIFSNWLLMYLSDKEVEDLARRMLQWLKVGGYVFFRESCFHQ  173



>gb|KJB30119.1| hypothetical protein B456_005G132000 [Gossypium raimondii]
Length=443

 Score =   281 bits (720),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = +2

Query  335  AMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  514
            A   + G+ER+VQK+YWIEHS +LTVEAMMLDSKAAD+DKEERPEVLS+LP YEGK++LE
Sbjct  2    AANGYVGDERKVQKNYWIEHSVDLTVEAMMLDSKAADIDKEERPEVLSLLPPYEGKTILE  61

Query  515  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDES  694
            LGAGIGRFTG+LA+KAG VIA+DFIE+VIKKNETINGH  N+KF+CADVTS DL F++ S
Sbjct  62   LGAGIGRFTGDLAKKAGHVIALDFIENVIKKNETINGHYKNVKFLCADVTSPDLAFTEGS  121

Query  695  IDLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            +DLIFSNWLLMYLSD+EVE+LAERM+KWL VGG+IFFRESCFHQ
Sbjct  122  LDLIFSNWLLMYLSDKEVENLAERMLKWLKVGGHIFFRESCFHQ  165



>ref|XP_010487710.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X2 [Camelina sativa]
Length=491

 Score =   283 bits (724),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = +2

Query  338  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  517
            MAA   EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP+YEGKSVLEL
Sbjct  1    MAATYEEERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPSYEGKSVLEL  60

Query  518  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  697
            GAGIGRFTGELAQKAG++IA+DFI+SVIKKNET+NGH  N+KFMCADVTS DL  +D S+
Sbjct  61   GAGIGRFTGELAQKAGELIALDFIDSVIKKNETVNGHYKNVKFMCADVTSPDLKITDGSL  120

Query  698  DLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            DLIFSNWLLMYLSD+EVE LAERMV W+ VGGYIFFRESCFHQ
Sbjct  121  DLIFSNWLLMYLSDKEVELLAERMVGWIKVGGYIFFRESCFHQ  163



>ref|XP_010506242.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 isoform 
X2 [Camelina sativa]
Length=491

 Score =   283 bits (723),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = +2

Query  338  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  517
            MAA   EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAATYEEERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPPYEGKSVLEL  60

Query  518  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  697
            GAGIGRFTGELAQKAG++IA+DFI+SVIKKNET+NGH  N+KFMCADVTS DL  +D S+
Sbjct  61   GAGIGRFTGELAQKAGELIALDFIDSVIKKNETVNGHYKNVKFMCADVTSPDLKITDGSL  120

Query  698  DLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            DLIFSNWLLMYLSD+EVE LAERMV W+ VGGYIFFRESCFHQ
Sbjct  121  DLIFSNWLLMYLSDKEVELLAERMVGWIKVGGYIFFRESCFHQ  163



>ref|XP_007036803.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 2 [Theobroma cacao]
 gb|EOY21304.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 2 [Theobroma cacao]
Length=494

 Score =   283 bits (723),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 133/157 (85%), Positives = 146/157 (93%), Gaps = 0/157 (0%)
 Frame = +2

Query  356  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  535
            +EREVQK YW+EHS +LTVEAMMLDSKAADLDKEERPEVLS+LP YEGKS+LELGAGIGR
Sbjct  9    DEREVQKDYWMEHSLDLTVEAMMLDSKAADLDKEERPEVLSLLPPYEGKSILELGAGIGR  68

Query  536  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  715
            FTGELAQKAG VIA+DFIESVIKKNE+INGH  N KF+CADVTS DL FS+ S+DLIFSN
Sbjct  69   FTGELAQKAGHVIALDFIESVIKKNESINGHYKNAKFLCADVTSPDLKFSEGSLDLIFSN  128

Query  716  WLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            WLLMYLSD+E+E+LAERMVKWL VGGYIFFRESCFHQ
Sbjct  129  WLLMYLSDKEIENLAERMVKWLKVGGYIFFRESCFHQ  165



>ref|XP_007036802.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY21303.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
Length=493

 Score =   283 bits (723),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 133/157 (85%), Positives = 146/157 (93%), Gaps = 0/157 (0%)
 Frame = +2

Query  356  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  535
            +EREVQK YW+EHS +LTVEAMMLDSKAADLDKEERPEVLS+LP YEGKS+LELGAGIGR
Sbjct  9    DEREVQKDYWMEHSLDLTVEAMMLDSKAADLDKEERPEVLSLLPPYEGKSILELGAGIGR  68

Query  536  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  715
            FTGELAQKAG VIA+DFIESVIKKNE+INGH  N KF+CADVTS DL FS+ S+DLIFSN
Sbjct  69   FTGELAQKAGHVIALDFIESVIKKNESINGHYKNAKFLCADVTSPDLKFSEGSLDLIFSN  128

Query  716  WLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            WLLMYLSD+E+E+LAERMVKWL VGGYIFFRESCFHQ
Sbjct  129  WLLMYLSDKEIENLAERMVKWLKVGGYIFFRESCFHQ  165



>gb|AAP83582.1| phosphoethanolamine N-methyltransferase [Brassica napus]
Length=491

 Score =   282 bits (722),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = +2

Query  338  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  517
            MAA    ER+VQK+YWIEHS++LTVEAMMLDS+AADLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAASYEAERDVQKNYWIEHSADLTVEAMMLDSRAADLDKEERPEVLSLLPPYEGKSVLEL  60

Query  518  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  697
            GAGIGRFTGELAQKAG++IA+DFI+SVIKKNE++NGH  N+KFMCADVTS DLN +D SI
Sbjct  61   GAGIGRFTGELAQKAGELIALDFIDSVIKKNESVNGHYKNVKFMCADVTSPDLNITDGSI  120

Query  698  DLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            DLIFSNWLLMYLSD+EVE L ERMV W+ VGGYIFFRESCFHQ
Sbjct  121  DLIFSNWLLMYLSDKEVELLVERMVGWIKVGGYIFFRESCFHQ  163



>gb|ABX10444.1| phosphoethanolamine N-methyltransferase [Gossypium hirsutum]
Length=475

 Score =   282 bits (721),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = +2

Query  335  AMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  514
            A   F G+ER+VQK+YWIEHS +LTVEAMMLDSKAAD+DKEERPEVLS+LP YEGK++LE
Sbjct  2    AANGFVGDERKVQKNYWIEHSVDLTVEAMMLDSKAADIDKEERPEVLSLLPPYEGKTILE  61

Query  515  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDES  694
            LGAGIGRFTG+LA+KAG VIA+DFIE+VIKKNETINGH  N+KF+CADVTS DL F++ S
Sbjct  62   LGAGIGRFTGDLAKKAGHVIALDFIENVIKKNETINGHYKNVKFLCADVTSPDLAFTEGS  121

Query  695  IDLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            +DLIFSNWLLMYLSD+EVE+LAERM+KWL VGG+IFFRESCFHQ
Sbjct  122  LDLIFSNWLLMYLSDKEVENLAERMLKWLKVGGHIFFRESCFHQ  165



>ref|XP_009145948.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 [Brassica 
rapa]
Length=492

 Score =   282 bits (721),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 133/164 (81%), Positives = 151/164 (92%), Gaps = 1/164 (1%)
 Frame = +2

Query  335  AMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  514
            A A+F+ E R+VQK+YWIEHS++LTVEAMMLDS+AADLDKEERPEVLS+LP YEGKSVLE
Sbjct  2    AAASFEAE-RDVQKNYWIEHSADLTVEAMMLDSRAADLDKEERPEVLSLLPPYEGKSVLE  60

Query  515  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDES  694
            LGAGIGRFTGELAQKAG++IA+DFI+SVIKKNE++NGH  N+KFMCADVTS DLN +D S
Sbjct  61   LGAGIGRFTGELAQKAGELIALDFIDSVIKKNESVNGHYKNVKFMCADVTSPDLNITDGS  120

Query  695  IDLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            IDLIFSNWLLMYLSD+EVE L ERMV W+ VGGYIFFRESCFHQ
Sbjct  121  IDLIFSNWLLMYLSDKEVELLVERMVGWIKVGGYIFFRESCFHQ  164



>gb|KJB30123.1| hypothetical protein B456_005G132000 [Gossypium raimondii]
Length=464

 Score =   281 bits (719),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = +2

Query  335  AMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  514
            A   + G+ER+VQK+YWIEHS +LTVEAMMLDSKAAD+DKEERPEVLS+LP YEGK++LE
Sbjct  2    AANGYVGDERKVQKNYWIEHSVDLTVEAMMLDSKAADIDKEERPEVLSLLPPYEGKTILE  61

Query  515  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDES  694
            LGAGIGRFTG+LA+KAG VIA+DFIE+VIKKNETINGH  N+KF+CADVTS DL F++ S
Sbjct  62   LGAGIGRFTGDLAKKAGHVIALDFIENVIKKNETINGHYKNVKFLCADVTSPDLAFTEGS  121

Query  695  IDLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            +DLIFSNWLLMYLSD+EVE+LAERM+KWL VGG+IFFRESCFHQ
Sbjct  122  LDLIFSNWLLMYLSDKEVENLAERMLKWLKVGGHIFFRESCFHQ  165



>gb|KHG16117.1| Phosphoethanolamine N-methyltransferase 1 -like protein [Gossypium 
arboreum]
Length=486

 Score =   282 bits (721),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = +2

Query  335  AMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  514
            A   F G+ER+VQK+YWIEHS +LTVEAMMLDSKAAD+DKEERPEVLS+LP YEGK++LE
Sbjct  2    AANGFVGDERKVQKNYWIEHSVDLTVEAMMLDSKAADIDKEERPEVLSLLPPYEGKTILE  61

Query  515  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDES  694
            LGAGIGRFTG+LA+KAG VIA+DFIE+VIKKNETINGH  N+KF+CADVTS DL F++ S
Sbjct  62   LGAGIGRFTGDLAKKAGHVIALDFIENVIKKNETINGHYKNVKFLCADVTSPDLAFTEGS  121

Query  695  IDLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            +DLIFSNWLLMYLSD+EVE+LAERM+KWL VGG+IFFRESCFHQ
Sbjct  122  LDLIFSNWLLMYLSDKEVENLAERMLKWLKVGGHIFFRESCFHQ  165



>ref|XP_004252273.1| PREDICTED: phosphomethylethanolamine N-methyltransferase isoform 
X1 [Solanum lycopersicum]
Length=500

 Score =   282 bits (721),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 148/165 (90%), Gaps = 0/165 (0%)
 Frame = +2

Query  332  SAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVL  511
            +   A  G+ER++QK+YW+EH+SELTVEAMMLDSKAADLDKEERPEVLS+LP YEGKSVL
Sbjct  8    AGAGAKSGQERDIQKNYWMEHTSELTVEAMMLDSKAADLDKEERPEVLSLLPPYEGKSVL  67

Query  512  ELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDE  691
            ELGAGIGRFT ELA+ AGQ+IA+DFIES IKKNE+IN H  N+KFMCADVTS DL FS E
Sbjct  68   ELGAGIGRFTSELAKNAGQLIALDFIESAIKKNESINKHHKNVKFMCADVTSPDLKFSPE  127

Query  692  SIDLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            S+DLIFSNWLLMYLSD+EV+SL ERMVKWL VGGYIFFRESCFHQ
Sbjct  128  SVDLIFSNWLLMYLSDEEVQSLVERMVKWLKVGGYIFFRESCFHQ  172



>ref|XP_010519219.1| PREDICTED: phosphoethanolamine N-methyltransferase 3 isoform 
X2 [Tarenaya hassleriana]
Length=499

 Score =   282 bits (721),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 148/163 (91%), Gaps = 1/163 (1%)
 Frame = +2

Query  338  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  517
            MAA+ GEERE+QKSYW EHS +L+VEAMMLDSKAADLDKEERPE+LS+LP YEGKSVLE 
Sbjct  1    MAAY-GEEREIQKSYWTEHSVDLSVEAMMLDSKAADLDKEERPEILSILPPYEGKSVLEF  59

Query  518  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  697
            GAGIGRFTGE A KAGQVIA+DFI+SVIKKNE INGH  N+KFMCADVTS +L FSDES+
Sbjct  60   GAGIGRFTGEFALKAGQVIAVDFIDSVIKKNENINGHHKNVKFMCADVTSPELKFSDESV  119

Query  698  DLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            DLIFSNWLLMYLSD+EVE LA RM++WL VGGY+FFRESCFHQ
Sbjct  120  DLIFSNWLLMYLSDKEVEDLARRMLQWLKVGGYVFFRESCFHQ  162



>ref|XP_002883100.1| N-methyltransferase 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59359.1| N-methyltransferase 1 [Arabidopsis lyrata subsp. lyrata]
Length=491

 Score =   281 bits (719),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 131/163 (80%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = +2

Query  338  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  517
            MAA   EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP+YEGKSVLEL
Sbjct  1    MAASYEEERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPSYEGKSVLEL  60

Query  518  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  697
            GAGIGRFTGELAQKAG++IA+DFI+SVIKKNE++NGH  N+KFMCADVTS DL  +D S+
Sbjct  61   GAGIGRFTGELAQKAGELIALDFIDSVIKKNESVNGHYKNVKFMCADVTSPDLKITDGSL  120

Query  698  DLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            DLIFSNWLLMYLSD+EVE LAERMV W+ VGGYIFFRESCFHQ
Sbjct  121  DLIFSNWLLMYLSDKEVELLAERMVGWIKVGGYIFFRESCFHQ  163



>ref|XP_004299531.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Fragaria vesca subsp. vesca]
Length=500

 Score =   281 bits (720),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = +2

Query  329  QSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSV  508
            ++A A   G+ERE+QKSYW E+S+ELTVE+MMLDSKA+DLDKEERPEVL+MLP YEGKSV
Sbjct  7    RTATANGSGKEREIQKSYWEENSTELTVESMMLDSKASDLDKEERPEVLAMLPPYEGKSV  66

Query  509  LELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSD  688
            LELGAGIGRFTGELAQKAGQ+IAMDFIE+VIKKNE+ING+  N+KFMCADVTS DL  S+
Sbjct  67   LELGAGIGRFTGELAQKAGQLIAMDFIENVIKKNESINGNHKNVKFMCADVTSPDLKISE  126

Query  689  ESIDLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            ES+DLIFSNWLLMYL D+EVE+LA RM+KWL VGGYIFFRESCFHQ
Sbjct  127  ESVDLIFSNWLLMYLCDKEVENLAARMMKWLKVGGYIFFRESCFHQ  172



>gb|AFK34653.1| unknown [Lotus japonicus]
Length=198

 Score =   271 bits (694),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 147/157 (94%), Gaps = 0/157 (0%)
 Frame = +2

Query  356  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  535
            EEREVQKSYWIEHSS+L++E+MMLDS A++LDKEERPEVLS+LPA E KSV+ELGAGIGR
Sbjct  15   EEREVQKSYWIEHSSDLSMESMMLDSNASNLDKEERPEVLSLLPAIESKSVIELGAGIGR  74

Query  536  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  715
            FTGELA+K+GQ++A+DFIES IKKNE+INGH  N+KFMCADVTS +L+ S+ S+DLIFSN
Sbjct  75   FTGELAKKSGQLLAVDFIESAIKKNESINGHHKNVKFMCADVTSPNLHVSEGSVDLIFSN  134

Query  716  WLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            WLLMYLSDQEVE+LAER++KWL VGGYIFFRESCFHQ
Sbjct  135  WLLMYLSDQEVENLAERVIKWLNVGGYIFFRESCFHQ  171



>ref|XP_008364653.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Malus 
domestica]
Length=492

 Score =   281 bits (718),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 150/164 (91%), Gaps = 1/164 (1%)
 Frame = +2

Query  338  MAAF-QGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  514
            MAAF  GEEREVQK+YW+EHS++LTVEAMMLDSKA+DLDKEERPEVLS+LP YEGKSV+E
Sbjct  1    MAAFANGEEREVQKNYWVEHSADLTVEAMMLDSKASDLDKEERPEVLSLLPPYEGKSVVE  60

Query  515  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDES  694
            LGAGIGRFTGELA+KAGQ+ A+DFI+SVIKKNE+INGH  N+KFMCADVTS DL  S+ S
Sbjct  61   LGAGIGRFTGELAEKAGQLFALDFIDSVIKKNESINGHHKNVKFMCADVTSPDLKISENS  120

Query  695  IDLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            +DL+FSNWLLMYLSD EVE+L ERM+ WL VGGYIFFRESCFHQ
Sbjct  121  VDLVFSNWLLMYLSDXEVENLVERMMGWLKVGGYIFFRESCFHQ  164



>gb|EYU33965.1| hypothetical protein MIMGU_mgv1a005263mg [Erythranthe guttata]
Length=491

 Score =   281 bits (718),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = +2

Query  338  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  517
            MAA Q EERE+QKSYW+EHS +LT+E+MMLDSKA+DLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAAVQDEEREMQKSYWVEHSVDLTLESMMLDSKASDLDKEERPEVLSLLPPYEGKSVLEL  60

Query  518  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  697
            GAGIGRFTGELA+KAGQ++A+DFIE  IKKNE INGH  N+KFMCADVTS  L+F D S 
Sbjct  61   GAGIGRFTGELAKKAGQLVALDFIEGSIKKNEIINGHHKNVKFMCADVTSPSLSFPDGSF  120

Query  698  DLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            DLIFSNWLLMYLSD+EVE+LA+RMVKWL VGGYIFFRESCFHQ
Sbjct  121  DLIFSNWLLMYLSDKEVENLAQRMVKWLKVGGYIFFRESCFHQ  163



>gb|KJB30117.1| hypothetical protein B456_005G132000 [Gossypium raimondii]
Length=494

 Score =   281 bits (718),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = +2

Query  335  AMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  514
            A   + G+ER+VQK+YWIEHS +LTVEAMMLDSKAAD+DKEERPEVLS+LP YEGK++LE
Sbjct  2    AANGYVGDERKVQKNYWIEHSVDLTVEAMMLDSKAADIDKEERPEVLSLLPPYEGKTILE  61

Query  515  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDES  694
            LGAGIGRFTG+LA+KAG VIA+DFIE+VIKKNETINGH  N+KF+CADVTS DL F++ S
Sbjct  62   LGAGIGRFTGDLAKKAGHVIALDFIENVIKKNETINGHYKNVKFLCADVTSPDLAFTEGS  121

Query  695  IDLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            +DLIFSNWLLMYLSD+EVE+LAERM+KWL VGG+IFFRESCFHQ
Sbjct  122  LDLIFSNWLLMYLSDKEVENLAERMLKWLKVGGHIFFRESCFHQ  165



>ref|NP_188427.2| phosphoethanolamine N-methyltransferase 1 [Arabidopsis thaliana]
 sp|Q9FR44.1|PEAM1_ARATH RecName: Full=Phosphoethanolamine N-methyltransferase 1; Short=AtNMT1; 
Short=PEAMT 1; AltName: Full=Protein XIPOTL 1 [Arabidopsis 
thaliana]
 gb|AAG41121.1|AF197940_1 SAM:phospho-ethanolamine N-methyltransferase [Arabidopsis thaliana]
 gb|AAK32886.1|AF367299_1 AT3g18000/MEB5_22 [Arabidopsis thaliana]
 gb|AAL25589.1| AT3g18000/MEB5_22 [Arabidopsis thaliana]
 gb|AAM10282.1| AT3g18000/MEB5_22 [Arabidopsis thaliana]
 gb|AEE76033.1| phosphoethanolamine N-methyltransferase 1 [Arabidopsis thaliana]
Length=491

 Score =   280 bits (717),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/163 (80%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = +2

Query  338  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  517
            MAA   EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAASYEEERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPPYEGKSVLEL  60

Query  518  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  697
            GAGIGRFTGELAQKAG++IA+DFI++VIKKNE+INGH  N+KFMCADVTS DL  +D S+
Sbjct  61   GAGIGRFTGELAQKAGELIALDFIDNVIKKNESINGHYKNVKFMCADVTSPDLKITDGSL  120

Query  698  DLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            DLIFSNWLLMYLSD+EVE LAERMV W+ VGGYIFFRESCFHQ
Sbjct  121  DLIFSNWLLMYLSDKEVELLAERMVGWIKVGGYIFFRESCFHQ  163



>gb|KJB30122.1| hypothetical protein B456_005G132000 [Gossypium raimondii]
Length=491

 Score =   280 bits (717),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/163 (80%), Positives = 152/163 (93%), Gaps = 1/163 (1%)
 Frame = +2

Query  338  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  517
            MAA  G+ER+VQK+YWIEHS +LTVEAMMLDSKAAD+DKEERPEVLS+LP YEGK++LEL
Sbjct  1    MAA-NGDERKVQKNYWIEHSVDLTVEAMMLDSKAADIDKEERPEVLSLLPPYEGKTILEL  59

Query  518  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  697
            GAGIGRFTG+LA+KAG VIA+DFIE+VIKKNETINGH  N+KF+CADVTS DL F++ S+
Sbjct  60   GAGIGRFTGDLAKKAGHVIALDFIENVIKKNETINGHYKNVKFLCADVTSPDLAFTEGSL  119

Query  698  DLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            DLIFSNWLLMYLSD+EVE+LAERM+KWL VGG+IFFRESCFHQ
Sbjct  120  DLIFSNWLLMYLSDKEVENLAERMLKWLKVGGHIFFRESCFHQ  162



>gb|AAM13092.1| unknown protein [Arabidopsis thaliana]
Length=491

 Score =   280 bits (717),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/163 (80%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = +2

Query  338  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  517
            MAA   EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAASYEEERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPPYEGKSVLEL  60

Query  518  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  697
            GAGIGRFTGELAQKAG++IA+DFI++VIKKNE+INGH  N+KFMCADVTS DL  +D S+
Sbjct  61   GAGIGRFTGELAQKAGELIALDFIDNVIKKNESINGHYKNVKFMCADVTSPDLKITDGSL  120

Query  698  DLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            DLIFSNWLLMYLSD+EVE LAERMV W+ VGGYIFFRESCFHQ
Sbjct  121  DLIFSNWLLMYLSDKEVELLAERMVGWIKVGGYIFFRESCFHQ  163



>dbj|BAB02720.1| methyl transferase-like protein [Arabidopsis thaliana]
Length=498

 Score =   280 bits (717),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 131/163 (80%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = +2

Query  338  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  517
            MAA   EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAASYEEERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPPYEGKSVLEL  60

Query  518  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  697
            GAGIGRFTGELAQKAG++IA+DFI++VIKKNE+INGH  N+KFMCADVTS DL  +D S+
Sbjct  61   GAGIGRFTGELAQKAGELIALDFIDNVIKKNESINGHYKNVKFMCADVTSPDLKITDGSL  120

Query  698  DLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            DLIFSNWLLMYLSD+EVE LAERMV W+ VGGYIFFRESCFHQ
Sbjct  121  DLIFSNWLLMYLSDKEVELLAERMVGWIKVGGYIFFRESCFHQ  163



>ref|XP_010465872.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Camelina 
sativa]
Length=491

 Score =   280 bits (716),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 130/163 (80%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = +2

Query  338  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  517
            MAA   EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP+YEGKSVLEL
Sbjct  1    MAATYEEERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPSYEGKSVLEL  60

Query  518  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  697
            GAGIGRFTGELAQKAG++IA+DFI+SVI+KNET+NGH  N+KFMCADVTS DL  +D S+
Sbjct  61   GAGIGRFTGELAQKAGELIALDFIDSVIEKNETVNGHYKNVKFMCADVTSPDLKITDGSL  120

Query  698  DLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            DLIFSNWLLMYLSD+EVE LAERM+ W+ VGGYIFFRESCFHQ
Sbjct  121  DLIFSNWLLMYLSDKEVELLAERMLGWIKVGGYIFFRESCFHQ  163



>gb|EPS65842.1| hypothetical protein M569_08933, partial [Genlisea aurea]
Length=487

 Score =   280 bits (716),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 148/157 (94%), Gaps = 0/157 (0%)
 Frame = +2

Query  356  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  535
            +EREVQKSYWIEHS +LTVEAMMLDSKA++LDKEERPEVLS+LP+YEGKSVLELGAGIGR
Sbjct  2    QEREVQKSYWIEHSGDLTVEAMMLDSKASELDKEERPEVLSLLPSYEGKSVLELGAGIGR  61

Query  536  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  715
            FTGE+A+KA QV+A+DFIESVIKKNE INGH  N+KFMCADVTS DL+F + S+DLIFSN
Sbjct  62   FTGEIAKKADQVVALDFIESVIKKNEIINGHHKNVKFMCADVTSSDLSFPEGSLDLIFSN  121

Query  716  WLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            WLLMYLSD+EVE+LAERM+KWL VGGYIFFRESCFHQ
Sbjct  122  WLLMYLSDEEVENLAERMIKWLAVGGYIFFRESCFHQ  158



>ref|XP_010487709.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X1 [Camelina sativa]
Length=494

 Score =   280 bits (716),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 148/157 (94%), Gaps = 0/157 (0%)
 Frame = +2

Query  356  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  535
            EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP+YEGKSVLELGAGIGR
Sbjct  10   EERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPSYEGKSVLELGAGIGR  69

Query  536  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  715
            FTGELAQKAG++IA+DFI+SVIKKNET+NGH  N+KFMCADVTS DL  +D S+DLIFSN
Sbjct  70   FTGELAQKAGELIALDFIDSVIKKNETVNGHYKNVKFMCADVTSPDLKITDGSLDLIFSN  129

Query  716  WLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            WLLMYLSD+EVE LAERMV W+ VGGYIFFRESCFHQ
Sbjct  130  WLLMYLSDKEVELLAERMVGWIKVGGYIFFRESCFHQ  166



>ref|XP_008360927.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 [Malus domestica]
Length=492

 Score =   280 bits (716),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 130/162 (80%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = +2

Query  341  AAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELG  520
            A+  GEEREVQK+YW+EHS++LTVEAMMLDSKA+DLDKEERPEVLSMLP YEG+SV+ELG
Sbjct  3    ASANGEEREVQKNYWVEHSADLTVEAMMLDSKASDLDKEERPEVLSMLPPYEGQSVVELG  62

Query  521  AGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESID  700
            AGIGRFTGELA+KAGQ++A+DFI+SVIKKNE+INGH  N+KFMCADVTS DL  S+ S+D
Sbjct  63   AGIGRFTGELAEKAGQLVALDFIDSVIKKNESINGHHKNVKFMCADVTSPDLKISEGSVD  122

Query  701  LIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            LIFSNWLLMYLSD+EVE L ERM+ WL VGGYIFFRESCFHQ
Sbjct  123  LIFSNWLLMYLSDKEVEKLVERMMGWLKVGGYIFFRESCFHQ  164



>ref|XP_009776424.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Nicotiana 
sylvestris]
Length=499

 Score =   280 bits (716),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 146/157 (93%), Gaps = 0/157 (0%)
 Frame = +2

Query  356  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  535
            +ER+VQK+YWIEH+SELTVEAMMLDSKAADLDKEERPEVLS+LP+YEGKSVLELGAGIGR
Sbjct  15   QERDVQKNYWIEHTSELTVEAMMLDSKAADLDKEERPEVLSLLPSYEGKSVLELGAGIGR  74

Query  536  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  715
            FT ELA+ AGQ++A+DFIES IKKNE+IN H  N+KFMCADVTS DL FS ES+DLIFSN
Sbjct  75   FTSELAKNAGQLLALDFIESAIKKNESINSHHKNVKFMCADVTSPDLKFSPESVDLIFSN  134

Query  716  WLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            WLLMYLSD+EV+SL ERMVKWL VGGYIFFRESCFHQ
Sbjct  135  WLLMYLSDEEVQSLVERMVKWLKVGGYIFFRESCFHQ  171



>ref|XP_010506234.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 isoform 
X1 [Camelina sativa]
Length=494

 Score =   280 bits (716),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 147/157 (94%), Gaps = 0/157 (0%)
 Frame = +2

Query  356  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  535
            EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP YEGKSVLELGAGIGR
Sbjct  10   EERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPPYEGKSVLELGAGIGR  69

Query  536  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  715
            FTGELAQKAG++IA+DFI+SVIKKNET+NGH  N+KFMCADVTS DL  +D S+DLIFSN
Sbjct  70   FTGELAQKAGELIALDFIDSVIKKNETVNGHYKNVKFMCADVTSPDLKITDGSLDLIFSN  129

Query  716  WLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            WLLMYLSD+EVE LAERMV W+ VGGYIFFRESCFHQ
Sbjct  130  WLLMYLSDKEVELLAERMVGWIKVGGYIFFRESCFHQ  166



>ref|XP_012088548.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X3 [Jatropha curcas]
 gb|KDP23922.1| hypothetical protein JCGZ_27082 [Jatropha curcas]
Length=510

 Score =   280 bits (716),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 148/157 (94%), Gaps = 0/157 (0%)
 Frame = +2

Query  356  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  535
            EERE+Q++YW+EHS +LTVEAMMLDSKA+DLDKEERPEVLSMLP+YEGKSVLE GAGIGR
Sbjct  26   EEREIQRNYWMEHSVDLTVEAMMLDSKASDLDKEERPEVLSMLPSYEGKSVLEFGAGIGR  85

Query  536  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  715
            FTGE+AQ AGQ++A+DFI+SVIKKNE+INGH  N+KF+CADVTS+DL FS+ S+DLIFSN
Sbjct  86   FTGEIAQNAGQLVALDFIDSVIKKNESINGHYKNVKFICADVTSQDLKFSEGSVDLIFSN  145

Query  716  WLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            WLLMYLSD+EVE+L ERMVKWL VGGYIFFRESCFHQ
Sbjct  146  WLLMYLSDKEVENLVERMVKWLKVGGYIFFRESCFHQ  182



>ref|XP_006346642.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Solanum 
tuberosum]
Length=500

 Score =   280 bits (715),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +2

Query  353  GEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIG  532
            GEER++QK+YW+EH+SELTVEAMMLDSKAADLDKEERPEVLS+LP YEGKSVLELGAGIG
Sbjct  15   GEERDIQKNYWMEHTSELTVEAMMLDSKAADLDKEERPEVLSLLPPYEGKSVLELGAGIG  74

Query  533  RFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFS  712
            RFT ELA+ AGQ+IA+DFI+S IKKN++IN H  N+KFMCADVTS DL FS ES+DLIFS
Sbjct  75   RFTSELAKNAGQLIALDFIDSAIKKNKSINKHHKNVKFMCADVTSPDLKFSPESVDLIFS  134

Query  713  NWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            NWLLMYLSD+EV+SL ERMVKWL VGGYIFFRESCFHQ
Sbjct  135  NWLLMYLSDEEVQSLVERMVKWLKVGGYIFFRESCFHQ  172



>gb|KDO63824.1| hypothetical protein CISIN_1g043471mg [Citrus sinensis]
Length=485

 Score =   279 bits (714),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 145/156 (93%), Gaps = 0/156 (0%)
 Frame = +2

Query  359  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  538
            ERE+QK+YW+EHS+ LTVEAMMLDSKA+DLDKEERPEVLS+LP YEGK+VLE GAGIGRF
Sbjct  9    EREIQKNYWMEHSANLTVEAMMLDSKASDLDKEERPEVLSLLPPYEGKTVLEFGAGIGRF  68

Query  539  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  718
            TGELA+KAG VIA+DFI+SVIKKNE +NGH  N+KFMCADVTS DL FS++S+D++FSNW
Sbjct  69   TGELAKKAGHVIALDFIDSVIKKNEEVNGHFENVKFMCADVTSPDLTFSEDSVDMMFSNW  128

Query  719  LLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            LLMYLSD+EVE LAERMVKWL VGGYIFFRESCFHQ
Sbjct  129  LLMYLSDKEVEKLAERMVKWLKVGGYIFFRESCFHQ  164



>dbj|BAD93609.1| hypothetical protein [Cucumis melo]
Length=211

 Score =   270 bits (690),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 144/167 (86%), Gaps = 0/167 (0%)
 Frame = +2

Query  326  VQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKS  505
              +   A   +ER +QK YWIEHS+ LTVEAM+LDS A+DLDKEERPEVLS+LP YEGKS
Sbjct  3    TPTPAPALNDDERLIQKKYWIEHSARLTVEAMLLDSNASDLDKEERPEVLSLLPPYEGKS  62

Query  506  VLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFS  685
            VLELGAGIGRFTG+LA KAGQV+A+DFIESVIKKNE+IN H  N+KFMCADVTS +L  S
Sbjct  63   VLELGAGIGRFTGDLAVKAGQVLALDFIESVIKKNESINRHHKNVKFMCADVTSPELKIS  122

Query  686  DESIDLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            + S+DLIFSNWLLMYLSD EV++LAERMVKWL VGG+IFFRESCFHQ
Sbjct  123  ENSVDLIFSNWLLMYLSDIEVKNLAERMVKWLRVGGHIFFRESCFHQ  169



>ref|XP_006406666.1| hypothetical protein EUTSA_v10020595mg [Eutrema salsugineum]
 gb|ESQ48119.1| hypothetical protein EUTSA_v10020595mg [Eutrema salsugineum]
Length=491

 Score =   279 bits (713),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 130/163 (80%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = +2

Query  338  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  517
            MAA   EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP +EGKSVLEL
Sbjct  1    MAASYEEERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPPFEGKSVLEL  60

Query  518  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  697
            GAGIGRFTGELAQKAG++IA+DFI+SVIKKNE++NGH  N+KFMCADVTS DL  +D SI
Sbjct  61   GAGIGRFTGELAQKAGELIALDFIDSVIKKNESVNGHYKNVKFMCADVTSPDLKITDGSI  120

Query  698  DLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            DLIFSNWLLMYLSD+EVE LAERMV W+  GGYIFFRESCFHQ
Sbjct  121  DLIFSNWLLMYLSDKEVELLAERMVGWIKTGGYIFFRESCFHQ  163



>ref|XP_012088546.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X1 [Jatropha curcas]
Length=538

 Score =   280 bits (717),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 148/157 (94%), Gaps = 0/157 (0%)
 Frame = +2

Query  356  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  535
            EERE+Q++YW+EHS +LTVEAMMLDSKA+DLDKEERPEVLSMLP+YEGKSVLE GAGIGR
Sbjct  26   EEREIQRNYWMEHSVDLTVEAMMLDSKASDLDKEERPEVLSMLPSYEGKSVLEFGAGIGR  85

Query  536  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  715
            FTGE+AQ AGQ++A+DFI+SVIKKNE+INGH  N+KF+CADVTS+DL FS+ S+DLIFSN
Sbjct  86   FTGEIAQNAGQLVALDFIDSVIKKNESINGHYKNVKFICADVTSQDLKFSEGSVDLIFSN  145

Query  716  WLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            WLLMYLSD+EVE+L ERMVKWL VGGYIFFRESCFHQ
Sbjct  146  WLLMYLSDKEVENLVERMVKWLKVGGYIFFRESCFHQ  182



>ref|XP_006297517.1| hypothetical protein CARUB_v10013541mg [Capsella rubella]
 gb|EOA30415.1| hypothetical protein CARUB_v10013541mg [Capsella rubella]
Length=491

 Score =   279 bits (713),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/163 (80%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = +2

Query  338  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  517
            MAA   EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAASYEEERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPPYEGKSVLEL  60

Query  518  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  697
            GAGIGRFTGELAQKAG++IA+DFI+SVIKKNE+INGH  N+KF+CADVTS DL  +D S+
Sbjct  61   GAGIGRFTGELAQKAGELIALDFIDSVIKKNESINGHYKNVKFLCADVTSPDLKITDGSL  120

Query  698  DLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            DLIFSNWLLMYLSD+EVE LAERM+ W+ VGGYIFFRESCFHQ
Sbjct  121  DLIFSNWLLMYLSDKEVELLAERMLGWIKVGGYIFFRESCFHQ  163



>ref|XP_006490771.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X2 [Citrus sinensis]
Length=489

 Score =   279 bits (713),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 148/161 (92%), Gaps = 1/161 (1%)
 Frame = +2

Query  344  AFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGA  523
            A QGE RE+QK+YW+EHS+ LTVEAMMLDSKA+DLDKEERPEVLS+LP YEGK+VLE GA
Sbjct  2    AGQGE-REIQKNYWMEHSANLTVEAMMLDSKASDLDKEERPEVLSLLPPYEGKTVLEFGA  60

Query  524  GIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDL  703
            GIGRFTGELA+KAG VIA+DFI+SVIKKNE +NGH  N+KFMCADVTS DL FS++S+D+
Sbjct  61   GIGRFTGELAKKAGHVIALDFIDSVIKKNEEVNGHFENVKFMCADVTSPDLTFSEDSVDM  120

Query  704  IFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            +FSNWLLMYLSD+EVE LAERMVKWL VGGYIFFRESCFHQ
Sbjct  121  MFSNWLLMYLSDKEVEKLAERMVKWLKVGGYIFFRESCFHQ  161



>ref|XP_010263678.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Nelumbo 
nucifera]
Length=489

 Score =   278 bits (712),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 151/163 (93%), Gaps = 1/163 (1%)
 Frame = +2

Query  338  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  517
            MAA QG ERE+QKSYWIEHS +LTVEAMMLDSKA+DLDKEERPEVLS+LP ++GKSVLEL
Sbjct  1    MAA-QGGEREIQKSYWIEHSVDLTVEAMMLDSKASDLDKEERPEVLSLLPPFKGKSVLEL  59

Query  518  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  697
            GAGIGRFTGELA++AGQV+A+DFIE+VIKKNE+INGH  N+KF+CADVTS DL  + ES+
Sbjct  60   GAGIGRFTGELAKEAGQVLALDFIENVIKKNESINGHHKNVKFLCADVTSPDLQIASESV  119

Query  698  DLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            DLIFSNWLLMYLSD+EVE+LAERM KWL VGG+IFFRESCFHQ
Sbjct  120  DLIFSNWLLMYLSDKEVENLAERMAKWLKVGGFIFFRESCFHQ  162



>ref|XP_006451624.1| hypothetical protein CICLE_v10010749mg [Citrus clementina]
 ref|XP_006490770.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X1 [Citrus sinensis]
 gb|ESR64864.1| hypothetical protein CICLE_v10010749mg [Citrus clementina]
Length=492

 Score =   278 bits (712),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 145/156 (93%), Gaps = 0/156 (0%)
 Frame = +2

Query  359  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  538
            ERE+QK+YW+EHS+ LTVEAMMLDSKA+DLDKEERPEVLS+LP YEGK+VLE GAGIGRF
Sbjct  9    EREIQKNYWMEHSANLTVEAMMLDSKASDLDKEERPEVLSLLPPYEGKTVLEFGAGIGRF  68

Query  539  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  718
            TGELA+KAG VIA+DFI+SVIKKNE +NGH  N+KFMCADVTS DL FS++S+D++FSNW
Sbjct  69   TGELAKKAGHVIALDFIDSVIKKNEEVNGHFENVKFMCADVTSPDLTFSEDSVDMMFSNW  128

Query  719  LLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            LLMYLSD+EVE LAERMVKWL VGGYIFFRESCFHQ
Sbjct  129  LLMYLSDKEVEKLAERMVKWLKVGGYIFFRESCFHQ  164



>ref|XP_002891445.1| hypothetical protein ARALYDRAFT_473996 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67704.1| hypothetical protein ARALYDRAFT_473996 [Arabidopsis lyrata subsp. 
lyrata]
Length=491

 Score =   278 bits (712),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/163 (80%), Positives = 147/163 (90%), Gaps = 0/163 (0%)
 Frame = +2

Query  338  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  517
            MA    +ER++QKSYW+EHSS+LTVEAMMLDSKA+DLDKEERPEVLS++P YEGKSVLEL
Sbjct  1    MATPYKKERDIQKSYWMEHSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKSVLEL  60

Query  518  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  697
            GAGIGRFTGELAQKAG+VIA+DFIES IKKNE++NGH  NIKFMCADVTS DL  +D SI
Sbjct  61   GAGIGRFTGELAQKAGEVIALDFIESAIKKNESVNGHYKNIKFMCADVTSPDLKIADGSI  120

Query  698  DLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            DLIFSNWLLMYLSD+EVE +AERM+ W+  GGYIFFRESCFHQ
Sbjct  121  DLIFSNWLLMYLSDKEVELMAERMIGWIKPGGYIFFRESCFHQ  163



>ref|XP_008393424.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Malus 
domestica]
Length=492

 Score =   278 bits (711),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = +2

Query  341  AAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELG  520
            A+  GEEREVQK+YW+EHS++LTVEAMMLDSKA+DLDKEERPEVLSMLP YEG+S +ELG
Sbjct  3    ASANGEEREVQKNYWVEHSADLTVEAMMLDSKASDLDKEERPEVLSMLPPYEGQSXVELG  62

Query  521  AGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESID  700
            AGIGRFTGELA+KAGQ++A+DFI+SVIKKNE+INGH  N+KFMCADVTS DL  S+ S+D
Sbjct  63   AGIGRFTGELAEKAGQLVALDFIDSVIKKNESINGHHKNVKFMCADVTSPDLKISEGSVD  122

Query  701  LIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            LIFSNWLLMYLSD+EVE L ERM+ WL VGGYIFFRESCFHQ
Sbjct  123  LIFSNWLLMYLSDKEVEKLVERMMGWLKVGGYIFFRESCFHQ  164



>ref|XP_009356042.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Pyrus 
x bretschneideri]
Length=492

 Score =   278 bits (711),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 150/164 (91%), Gaps = 1/164 (1%)
 Frame = +2

Query  338  MAAF-QGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  514
            MAAF  GEER VQK+YW+EHS++LTVEAMMLDSKA+DLDKEERPEVLS+LP YEGKSV+E
Sbjct  1    MAAFANGEERAVQKNYWVEHSADLTVEAMMLDSKASDLDKEERPEVLSLLPPYEGKSVVE  60

Query  515  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDES  694
            LGAGIGRFTGELA+KAGQ+ A+DFI+SVIKKNE+INGH  N+KF+CADVTS DL  S+ S
Sbjct  61   LGAGIGRFTGELAEKAGQLFALDFIDSVIKKNESINGHHKNVKFICADVTSPDLKISENS  120

Query  695  IDLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            +DL+FSNWLLMYLSD+EVE+L ERM+ WL VGGYIFFRESCFHQ
Sbjct  121  VDLVFSNWLLMYLSDKEVENLVERMMGWLKVGGYIFFRESCFHQ  164



>gb|KFK39125.1| hypothetical protein AALP_AA3G204100 [Arabis alpina]
Length=491

 Score =   278 bits (711),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/163 (80%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = +2

Query  338  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  517
            MAA   EER++QK+YWIEHS +LTVE+MMLDSKA+DLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAASYEEERDIQKNYWIEHSVDLTVESMMLDSKASDLDKEERPEVLSLLPPYEGKSVLEL  60

Query  518  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  697
            GAGIGRFTGELAQKAG++IA+DFI+SVI KNE++NGH  N+KFMCADVTS DL  +D S+
Sbjct  61   GAGIGRFTGELAQKAGELIALDFIDSVINKNESVNGHYKNVKFMCADVTSPDLKITDGSL  120

Query  698  DLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            DLIFSNWLLMYLSD+EVE LAERMV W+ VGGYIFFRESCFHQ
Sbjct  121  DLIFSNWLLMYLSDKEVELLAERMVGWIKVGGYIFFRESCFHQ  163



>ref|XP_009360079.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Pyrus 
x bretschneideri]
Length=492

 Score =   278 bits (711),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 147/162 (91%), Gaps = 0/162 (0%)
 Frame = +2

Query  341  AAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELG  520
            A+  GEEREVQK+YW+EHS++LTVEAMMLDSKA+DLDKEERPEVLSMLP YEG+SV+ELG
Sbjct  3    ASANGEEREVQKNYWVEHSADLTVEAMMLDSKASDLDKEERPEVLSMLPPYEGQSVVELG  62

Query  521  AGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESID  700
            AGIGRFTGELA+KAGQ++A+DFI+SVIKKNE+INGH  N+KFMCADV S DL  S+ S+D
Sbjct  63   AGIGRFTGELAEKAGQLVALDFIDSVIKKNESINGHHKNVKFMCADVASPDLKISEGSVD  122

Query  701  LIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            LIFSNWLLMYLSD+EVE L ERM  WL VGGYIFFRESCFHQ
Sbjct  123  LIFSNWLLMYLSDKEVEKLVERMTGWLKVGGYIFFRESCFHQ  164



>ref|NP_973993.1| phosphoethanolamine N-methyltransferase 2 [Arabidopsis thaliana]
 sp|Q944H0.2|PEAM2_ARATH RecName: Full=Phosphomethylethanolamine N-methyltransferase; 
Short=AtPMEAMT; AltName: Full=Phosphoethanolamine N-methyltransferase 
2 [Arabidopsis thaliana]
 gb|AEE32323.1| putative phosphoethanolamine N-methyltransferase 2 [Arabidopsis 
thaliana]
Length=491

 Score =   278 bits (710),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/163 (80%), Positives = 146/163 (90%), Gaps = 0/163 (0%)
 Frame = +2

Query  338  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  517
            MA    EER++QKSYW+EHSS+LTVEAMMLDSKA+DLDKEERPEVLS++P YEGKSVLEL
Sbjct  1    MATPYKEERDIQKSYWMEHSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKSVLEL  60

Query  518  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  697
            GAGIGRFTGELAQKAG+VIA+DFIES I+KNE++NGH  NIKFMCADVTS DL   D SI
Sbjct  61   GAGIGRFTGELAQKAGEVIALDFIESAIQKNESVNGHYKNIKFMCADVTSPDLKIKDGSI  120

Query  698  DLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            DLIFSNWLLMYLSD+EVE +AERM+ W+  GGYIFFRESCFHQ
Sbjct  121  DLIFSNWLLMYLSDKEVELMAERMIGWVKPGGYIFFRESCFHQ  163



>gb|AFW83641.1| hypothetical protein ZEAMMB73_560974 [Zea mays]
Length=244

 Score =   269 bits (688),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = +2

Query  353  GEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIG  532
             EER+ QKSYW EHS  LTVEAMMLDS+AADLDKEERPEVLS+LP+YEGKSVLELGAGIG
Sbjct  18   AEERKAQKSYWEEHSKNLTVEAMMLDSRAADLDKEERPEVLSLLPSYEGKSVLELGAGIG  77

Query  533  RFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFS  712
            RFTGELA+ AG V+A+DFIES IKKNE+INGH  N  FMCADVTS+DL     SIDLIFS
Sbjct  78   RFTGELAKTAGNVLALDFIESAIKKNESINGHYKNASFMCADVTSQDLVLQANSIDLIFS  137

Query  713  NWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            NWLLMYLSD+EVE L +RMVKWL VGGYIFFRESCFHQ
Sbjct  138  NWLLMYLSDEEVEQLVQRMVKWLKVGGYIFFRESCFHQ  175



>emb|CDO98349.1| unnamed protein product [Coffea canephora]
Length=491

 Score =   277 bits (708),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 130/163 (80%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = +2

Query  338  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  517
            MAA +G+EREVQKSYWIEH+++LTVEAMMLDS AADLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAAVEGQEREVQKSYWIEHTADLTVEAMMLDSMAADLDKEERPEVLSLLPPYEGKSVLEL  60

Query  518  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  697
            GAGIGRFTGELA+KAGQ++A+DFIE  IKKNE+ING+L N KF+CADVTS +L+FS ES+
Sbjct  61   GAGIGRFTGELAKKAGQIVALDFIEGAIKKNESINGNLKNTKFICADVTSPELHFSAESM  120

Query  698  DLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            DLIFSNWLLMYLSD+EV +LA++MV WL VGG+IFFRESCFHQ
Sbjct  121  DLIFSNWLLMYLSDEEVVTLAKKMVGWLKVGGHIFFRESCFHQ  163



>ref|XP_010097561.1| Phosphoethanolamine N-methyltransferase 1 [Morus notabilis]
 gb|EXB69093.1| Phosphoethanolamine N-methyltransferase 1 [Morus notabilis]
Length=519

 Score =   277 bits (709),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = +2

Query  350  QGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGI  529
             GEERE+QK+YW E+S++LT+E+MMLDSKA+DLDKEERPEVLS+LP +EGKSVLELGAGI
Sbjct  10   NGEEREIQKTYWTENSADLTIESMMLDSKASDLDKEERPEVLSVLPPFEGKSVLELGAGI  69

Query  530  GRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIF  709
            GRFTGELAQKAGQV+A+DFIESVIKKNE INGH  N+KFMCADVTS +L  S+ S+DLIF
Sbjct  70   GRFTGELAQKAGQVLALDFIESVIKKNEEINGHYENVKFMCADVTSPELKISEGSVDLIF  129

Query  710  SNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            SNWLLMYLSD+EVE+LAERMVKWL VGG+IFFRESCFHQ
Sbjct  130  SNWLLMYLSDKEVENLAERMVKWLKVGGFIFFRESCFHQ  168



>gb|AGI56231.1| phosphoethanolamine N-methyltransferase [Lycium barbarum]
Length=498

 Score =   276 bits (707),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = +2

Query  356  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  535
            +ER++QK+YWIEH+SELTVEAMMLDSKAADLDKEERPEVLS+LP YEGKSVLELGAGIGR
Sbjct  15   QERDIQKNYWIEHTSELTVEAMMLDSKAADLDKEERPEVLSLLPPYEGKSVLELGAGIGR  74

Query  536  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  715
            FT ELA+ AGQ+IA+DFIES IKKNE+IN H  N+KFMCADVTS DL  S ES+DLIFSN
Sbjct  75   FTSELAKNAGQLIALDFIESAIKKNESINKHHKNVKFMCADVTSPDLKISPESVDLIFSN  134

Query  716  WLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            WLLMYLSD+EV+SL +RMVKWL VGGYIFFRESCFHQ
Sbjct  135  WLLMYLSDEEVQSLVQRMVKWLKVGGYIFFRESCFHQ  171



>ref|XP_012088549.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Jatropha 
curcas]
 gb|KDP23923.1| hypothetical protein JCGZ_27083 [Jatropha curcas]
Length=491

 Score =   276 bits (707),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 130/163 (80%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = +2

Query  338  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  517
            MAA   EERE+QK+YWIE+S  LTVEAMMLDS A+ LDKEERPEVLSMLP YEGKSVLE 
Sbjct  1    MAAAHVEEREIQKNYWIENSDGLTVEAMMLDSNASLLDKEERPEVLSMLPPYEGKSVLEF  60

Query  518  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  697
            GAGIGRFTGE+AQ AGQ++A+DFI++VIKKNE INGH  N+KF+CADVTS+DL FS+ES+
Sbjct  61   GAGIGRFTGEIAQNAGQLVAVDFIDNVIKKNERINGHHKNVKFICADVTSEDLKFSEESV  120

Query  698  DLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            DLIFSNWLLMYLSD+E+E+LAERMVKWL VGGYIFFRESCFHQ
Sbjct  121  DLIFSNWLLMYLSDKEIENLAERMVKWLKVGGYIFFRESCFHQ  163



>dbj|BAD80838.1| phosphoethanolamine N-methyltransferase [Atriplex nummularia]
Length=503

 Score =   276 bits (707),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/165 (81%), Positives = 144/165 (87%), Gaps = 2/165 (1%)
 Frame = +2

Query  332  SAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVL  511
            SAM     EEREV K YW+EHS +LTVEAMMLDS+A+DLDKEERPEVLSMLP YEGKSVL
Sbjct  4    SAMGV--NEEREVFKKYWVEHSVDLTVEAMMLDSQASDLDKEERPEVLSMLPPYEGKSVL  61

Query  512  ELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDE  691
            ELGAGIGRFTGELA+KAGQVIA+DFIESVIKKNE INGH  N+KFMCADVTS  LN S  
Sbjct  62   ELGAGIGRFTGELAEKAGQVIALDFIESVIKKNECINGHYKNVKFMCADVTSPSLNISPN  121

Query  692  SIDLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            S+D+IFSNWLLMYLSD+EVE L ERM+KWL  GGYIFFRESCFHQ
Sbjct  122  SVDIIFSNWLLMYLSDEEVERLVERMLKWLKPGGYIFFRESCFHQ  166



>gb|AER10512.1| phosphoethanolamine N-methyltransferase [Pyrus betulifolia]
 gb|AER10513.1| phosphoethanolamine N-methyltransferase [Pyrus betulifolia]
Length=492

 Score =   276 bits (705),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/162 (79%), Positives = 147/162 (91%), Gaps = 0/162 (0%)
 Frame = +2

Query  341  AAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELG  520
            A+  GEEREVQK+YW+EHS++LTVEAMMLDS A+DLDKEERPEVLSMLP YEG+SV+ELG
Sbjct  3    ASANGEEREVQKNYWVEHSADLTVEAMMLDSNASDLDKEERPEVLSMLPPYEGQSVVELG  62

Query  521  AGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESID  700
            AGIGRFTGELA+KAGQ++A+DFI+SVIKKNE+INGH  N+KFMCADV S DL  S+ S+D
Sbjct  63   AGIGRFTGELAEKAGQLVALDFIDSVIKKNESINGHHKNVKFMCADVASPDLKISEGSVD  122

Query  701  LIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            LIFSNWLLMYLSD+EVE L ERM+ WL VGGYIFFRESCFHQ
Sbjct  123  LIFSNWLLMYLSDKEVEKLVERMMGWLKVGGYIFFRESCFHQ  164



>gb|KFK36082.1| hypothetical protein AALP_AA4G075100 [Arabis alpina]
Length=492

 Score =   276 bits (705),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = +2

Query  356  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  535
            EER++QKSYW+EHSS+LTVEAMMLDSKA+DLDKEERPEVLS++P YEGK+VLELGAGIGR
Sbjct  8    EERDIQKSYWMEHSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKTVLELGAGIGR  67

Query  536  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  715
            FTGELAQKAG+VIA+DFIES IKKNE+ NGH  N+KFMCADVTS DL  +D SIDLIFSN
Sbjct  68   FTGELAQKAGEVIALDFIESAIKKNESDNGHYKNVKFMCADVTSPDLKITDGSIDLIFSN  127

Query  716  WLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            WLLMYLSD+EVE LAERMV W+  GGYIFFRESCFHQ
Sbjct  128  WLLMYLSDKEVELLAERMVGWVKPGGYIFFRESCFHQ  164



>gb|EYU24136.1| hypothetical protein MIMGU_mgv1a005261mg [Erythranthe guttata]
Length=491

 Score =   275 bits (703),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 144/163 (88%), Gaps = 0/163 (0%)
 Frame = +2

Query  338  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  517
            MAA   +EREVQK+YW+EHS  LT+E MMLDSKA+DLDKEERPEVL+MLP YEGKS+LEL
Sbjct  1    MAAITEQEREVQKNYWVEHSVNLTLEDMMLDSKASDLDKEERPEVLAMLPPYEGKSILEL  60

Query  518  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  697
            GAGIGRFTGELA+KAG V A+DFIESVIKKNE IN H  N++FMCADVTS DLNF + S+
Sbjct  61   GAGIGRFTGELAKKAGHVTALDFIESVIKKNEAINKHHKNVEFMCADVTSPDLNFPEGSL  120

Query  698  DLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            D+IFSNWLLMYLSD EVE LA+RMVKWL VGGYIFFRESCFHQ
Sbjct  121  DMIFSNWLLMYLSDAEVEKLAQRMVKWLKVGGYIFFRESCFHQ  163



>ref|XP_008799221.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X2 [Phoenix dactylifera]
Length=492

 Score =   275 bits (702),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 131/164 (80%), Positives = 145/164 (88%), Gaps = 1/164 (1%)
 Frame = +2

Query  338  MAAFQGEE-REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  514
            MAAF GEE R VQKSYW+EHS +LTVEAMMLDS+A+DLDKEERPEVLS+LP Y+GKSVLE
Sbjct  1    MAAFSGEEERMVQKSYWMEHSKDLTVEAMMLDSRASDLDKEERPEVLSLLPPYKGKSVLE  60

Query  515  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDES  694
            LGAGIGRFTGELA++AG V+AMDFI++VIKKNE+INGH  N  FMC DVTS DL    ES
Sbjct  61   LGAGIGRFTGELAKEAGHVLAMDFIKNVIKKNESINGHFKNTSFMCTDVTSPDLMIEAES  120

Query  695  IDLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            +DLIFSNWLLMYLSD EVE LA+RMVKWL VGGYIFFRESCFHQ
Sbjct  121  VDLIFSNWLLMYLSDNEVEGLAQRMVKWLKVGGYIFFRESCFHQ  164



>ref|XP_006303987.1| hypothetical protein CARUB_v10008968mg [Capsella rubella]
 gb|EOA36885.1| hypothetical protein CARUB_v10008968mg [Capsella rubella]
Length=491

 Score =   274 bits (701),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 127/163 (78%), Positives = 145/163 (89%), Gaps = 0/163 (0%)
 Frame = +2

Query  338  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  517
            MA    EER +QKSYW+EHSS+LTVEAMMLDSKA DLDKEERPEVLS++P YEGK+VLEL
Sbjct  1    MATPYKEERHIQKSYWMEHSSDLTVEAMMLDSKATDLDKEERPEVLSLIPPYEGKTVLEL  60

Query  518  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  697
            GAGIGRFTGELAQKAG+VIA+DFIES I+KNE++NGH  N+KFMCADVTS DL  +D S+
Sbjct  61   GAGIGRFTGELAQKAGEVIALDFIESAIQKNESVNGHYKNVKFMCADVTSPDLKIADGSV  120

Query  698  DLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            DLIFSNWLLMYLSD+EVE +AERM+ W+  GGYIFFRESCFHQ
Sbjct  121  DLIFSNWLLMYLSDKEVELMAERMLGWVKPGGYIFFRESCFHQ  163



>ref|XP_009147956.1| PREDICTED: phosphomethylethanolamine N-methyltransferase [Brassica 
rapa]
Length=489

 Score =   274 bits (701),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 128/163 (79%), Positives = 144/163 (88%), Gaps = 0/163 (0%)
 Frame = +2

Query  338  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  517
            MA     ER++QKSYW+EHSS+LTVEAMMLDSKA+DLDKEERPEVLS++P YEGK VLEL
Sbjct  1    MATPYKAERDIQKSYWMEHSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKKVLEL  60

Query  518  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  697
            GAGIGRFTGELAQKAG+VIA+DFIES IKKNE++NGH  N+KFMCADVTS DL   D S+
Sbjct  61   GAGIGRFTGELAQKAGEVIALDFIESAIKKNESVNGHYKNVKFMCADVTSPDLKIEDGSV  120

Query  698  DLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            DLIFSNWLLMYLSD+EVE LAERM+ W+  GGYIFFRESCFHQ
Sbjct  121  DLIFSNWLLMYLSDKEVELLAERMLGWVKPGGYIFFRESCFHQ  163



>ref|XP_010274723.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Nelumbo nucifera]
Length=489

 Score =   274 bits (701),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 131/163 (80%), Positives = 146/163 (90%), Gaps = 1/163 (1%)
 Frame = +2

Query  338  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  517
            MAA Q EEREVQKSYWIEHSSELT+EAMMLDSKAADLDKEERPEVLS+LP ++GK VLEL
Sbjct  1    MAA-QVEEREVQKSYWIEHSSELTIEAMMLDSKAADLDKEERPEVLSLLPPFKGKDVLEL  59

Query  518  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  697
            GAGIGRFT E A++A QV+A+DFIESVIKKNE++NGH  N+KF+CADVTS DL  + ES+
Sbjct  60   GAGIGRFTSEFAKEANQVLALDFIESVIKKNESVNGHFKNVKFLCADVTSPDLKIAPESV  119

Query  698  DLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            DLIFSNWLLMYLSD+EVE LAERM  WL VGGYIFFRESCFHQ
Sbjct  120  DLIFSNWLLMYLSDKEVEKLAERMAIWLKVGGYIFFRESCFHQ  162



>ref|XP_008799219.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X1 [Phoenix dactylifera]
Length=494

 Score =   274 bits (701),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 145/166 (87%), Gaps = 3/166 (2%)
 Frame = +2

Query  338  MAAFQG---EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSV  508
            MAAF G   EER VQKSYW+EHS +LTVEAMMLDS+A+DLDKEERPEVLS+LP Y+GKSV
Sbjct  1    MAAFSGAGEEERMVQKSYWMEHSKDLTVEAMMLDSRASDLDKEERPEVLSLLPPYKGKSV  60

Query  509  LELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSD  688
            LELGAGIGRFTGELA++AG V+AMDFI++VIKKNE+INGH  N  FMC DVTS DL    
Sbjct  61   LELGAGIGRFTGELAKEAGHVLAMDFIKNVIKKNESINGHFKNTSFMCTDVTSPDLMIEA  120

Query  689  ESIDLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            ES+DLIFSNWLLMYLSD EVE LA+RMVKWL VGGYIFFRESCFHQ
Sbjct  121  ESVDLIFSNWLLMYLSDNEVEGLAQRMVKWLKVGGYIFFRESCFHQ  166



>ref|XP_003528975.2| PREDICTED: phosphoethanolamine N-methyltransferase-like [Glycine 
max]
 gb|KHN44632.1| Phosphoethanolamine N-methyltransferase [Glycine soja]
Length=531

 Score =   275 bits (703),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 127/176 (72%), Positives = 156/176 (89%), Gaps = 2/176 (1%)
 Frame = +2

Query  305  FYLFTAIVQSAMAAFQG--EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLS  478
             +LF++  Q  MA+     +ER VQ+SYWIEH+++L+VE+MMLDS A+DLDKEERPEVLS
Sbjct  29   LFLFSSFCQPYMASLATVQDERCVQRSYWIEHTTDLSVESMMLDSNASDLDKEERPEVLS  88

Query  479  MLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCAD  658
            +LPAYEGKSV+ELGAGIGRFTGELA+KAGQ++A+DFIES IKKNE+INGH  N+KFMCAD
Sbjct  89   LLPAYEGKSVVELGAGIGRFTGELAKKAGQLLAVDFIESAIKKNESINGHHKNVKFMCAD  148

Query  659  VTSKDLNFSDESIDLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            VTS +L+ S+ S+DL+FSNWLLMYLSD+EVE+LA RM+KWL VGGY+FFRESCFHQ
Sbjct  149  VTSPNLHISEGSVDLMFSNWLLMYLSDKEVENLAARMIKWLKVGGYVFFRESCFHQ  204



>gb|AEY75253.1| phosphoethanolamine N-methyltransferase [Atriplex canescens]
Length=494

 Score =   274 bits (701),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 129/156 (83%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  359  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  538
            EREV K YW+EHS +LTVEAMMLDS+A+DLDKEERPEVLSMLP YEGKSVLELGAGIGRF
Sbjct  11   EREVFKKYWVEHSVDLTVEAMMLDSQASDLDKEERPEVLSMLPPYEGKSVLELGAGIGRF  70

Query  539  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  718
            TGELA+KAGQVIA+DFIESVIKKNE INGH  N+KFMCADVTS  LN S  S+D+IFSNW
Sbjct  71   TGELAEKAGQVIALDFIESVIKKNECINGHYKNVKFMCADVTSPSLNISPNSVDIIFSNW  130

Query  719  LLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            LLMYLSD+EVE L ERM+KWL  GGYIFFRESCFHQ
Sbjct  131  LLMYLSDEEVERLVERMLKWLKPGGYIFFRESCFHQ  166



>ref|XP_011039130.1| PREDICTED: phosphomethylethanolamine N-methyltransferase [Populus 
euphratica]
Length=490

 Score =   273 bits (698),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 148/163 (91%), Gaps = 1/163 (1%)
 Frame = +2

Query  338  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  517
            MAA Q EERE+QK YW+++ S+L+V AMMLDSKA++LDKEERPE+LS+LP YEGK+VLEL
Sbjct  1    MAA-QVEEREIQKKYWMDNISDLSVNAMMLDSKASELDKEERPEILSLLPPYEGKTVLEL  59

Query  518  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  697
            GAGIGRFTGELAQKA QV+A+DFIES IKKNE INGH  N+KFMCADVTS DLNFS+ S+
Sbjct  60   GAGIGRFTGELAQKASQVVALDFIESAIKKNENINGHYKNVKFMCADVTSPDLNFSEGSV  119

Query  698  DLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            DLIFSNWLLMYLSD+EVE+L ERMVKWL VGG+IFFRESCFHQ
Sbjct  120  DLIFSNWLLMYLSDKEVENLVERMVKWLKVGGFIFFRESCFHQ  162



>ref|XP_011014101.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Populus euphratica]
Length=490

 Score =   273 bits (698),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 148/163 (91%), Gaps = 1/163 (1%)
 Frame = +2

Query  338  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  517
            MAA Q EERE+QK YW+++ S+L+V AMMLDSKA++LDKEERPE+LS+LP YEGK+VLEL
Sbjct  1    MAA-QVEEREIQKKYWMDNISDLSVNAMMLDSKASELDKEERPEILSLLPPYEGKTVLEL  59

Query  518  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  697
            GAGIGRFTGELAQKA QV+A+DFIES IKKNE INGH  N+KFMCADVTS DLNFS+ S+
Sbjct  60   GAGIGRFTGELAQKASQVVALDFIESAIKKNENINGHYKNVKFMCADVTSPDLNFSEGSV  119

Query  698  DLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            DLIFSNWLLMYLSD+EVE+L ERMVKWL VGG+IFFRESCFHQ
Sbjct  120  DLIFSNWLLMYLSDKEVENLVERMVKWLKVGGFIFFRESCFHQ  162



>ref|XP_010461683.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Camelina sativa]
Length=492

 Score =   273 bits (698),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/157 (80%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = +2

Query  356  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  535
            EER +QKSYW+EHSS+LTVEAMMLDSKA+DLD+EERPEVLS++P YEGKSVLELGAGIGR
Sbjct  8    EERHIQKSYWMEHSSDLTVEAMMLDSKASDLDREERPEVLSLIPPYEGKSVLELGAGIGR  67

Query  536  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  715
            FTGELAQKAG+VIA+DFIES I+KNE++NGH  N+KFMCADVTS DL  +  SIDLIFSN
Sbjct  68   FTGELAQKAGEVIALDFIESAIQKNESVNGHYKNVKFMCADVTSPDLKIAVGSIDLIFSN  127

Query  716  WLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            WLLMYLSD+EVE +AERM+KW+  GGYIFFRESCFHQ
Sbjct  128  WLLMYLSDKEVELMAERMLKWVKPGGYIFFRESCFHQ  164



>ref|XP_009782224.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Nicotiana 
sylvestris]
Length=496

 Score =   273 bits (698),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = +2

Query  338  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  517
            +AA   +ERE+QKSYW+E ++ELT+EAMMLDS+A+DLDKE+RPEVLS+LP+YEGKSVLEL
Sbjct  6    IAAAPEQEREIQKSYWMEQAAELTLEAMMLDSEASDLDKEDRPEVLSLLPSYEGKSVLEL  65

Query  518  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  697
            GAGIGRFTG+LA+KAGQ+ A+DF+E VIKKNE+INGH  N+KFMCADVTS DL FS ES+
Sbjct  66   GAGIGRFTGDLAEKAGQLTALDFVEGVIKKNESINGHHKNVKFMCADVTSPDLTFSPESV  125

Query  698  DLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            DLIFSNWLLMYLSD+EV+ LAERMVKWL VGGYIFFRE+CF Q
Sbjct  126  DLIFSNWLLMYLSDKEVQDLAERMVKWLKVGGYIFFRETCFSQ  168



>dbj|BAC57960.1| phosphoethanolamine N-methyltransferase [Aster tripolium]
Length=493

 Score =   273 bits (697),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 145/162 (90%), Gaps = 0/162 (0%)
 Frame = +2

Query  341  AAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELG  520
                G+ERE+QK+YW+EHS +LTVE+MMLDS A+DLDKEERPEVLS+LP+YEGK VLELG
Sbjct  3    GVINGDEREIQKNYWVEHSVDLTVESMMLDSMASDLDKEERPEVLSLLPSYEGKRVLELG  62

Query  521  AGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESID  700
            AGIGRFTGELA+ AG+VIA+DFIESV+KKNE+INGH  N+KFMCADVTS DL F  ESID
Sbjct  63   AGIGRFTGELAKTAGEVIALDFIESVVKKNESINGHCKNVKFMCADVTSPDLRFPAESID  122

Query  701  LIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            LIFSNWLLMYLSD+EVE +AER +KW+ VGG+IFFRESCFHQ
Sbjct  123  LIFSNWLLMYLSDKEVEDIAERFLKWVKVGGHIFFRESCFHQ  164



>emb|CDX68222.1| BnaA07g22620D [Brassica napus]
Length=506

 Score =   273 bits (698),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 147/168 (88%), Gaps = 0/168 (0%)
 Frame = +2

Query  323  IVQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGK  502
            I  S   ++ GEERE+QK+YW EHS  L+VEAMMLDSKAADLDKEERPE+LS+LP  EG+
Sbjct  10   ISPSFPNSYSGEEREIQKNYWKEHSVGLSVEAMMLDSKAADLDKEERPEILSLLPPIEGE  69

Query  503  SVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNF  682
            +VLE GAGIGRFT ELAQKAGQVIA+DFIESVIKKNE INGH  N+KFMCADVTS D+ F
Sbjct  70   TVLEFGAGIGRFTSELAQKAGQVIAVDFIESVIKKNENINGHYKNVKFMCADVTSPDMKF  129

Query  683  SDESIDLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            S+ES+DLIFSNWLLMYLSD+EVE LA++M++W  VGGYIFFRESCFHQ
Sbjct  130  SNESMDLIFSNWLLMYLSDKEVEDLAKKMLQWTKVGGYIFFRESCFHQ  177



>ref|XP_008799258.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Phoenix dactylifera]
Length=447

 Score =   271 bits (693),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 146/167 (87%), Gaps = 4/167 (2%)
 Frame = +2

Query  338  MAAFQG----EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKS  505
            MAA  G    EER VQKSYW+EHS +LTVEAMMLDS+A+DLDKEERPEVLS+LP Y+GKS
Sbjct  1    MAAINGGGGEEERMVQKSYWMEHSKDLTVEAMMLDSRASDLDKEERPEVLSLLPPYKGKS  60

Query  506  VLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFS  685
            VLELGAGIGRFTGELA++AG V+A+DFIE+VIKKNE+ NGHL NI F+CADVTS DL   
Sbjct  61   VLELGAGIGRFTGELAKEAGHVLALDFIENVIKKNESANGHLKNISFVCADVTSPDLMIE  120

Query  686  DESIDLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
             ES+DLIFSNWLLMYLSD EVE LAER+VKWL VGGYIFFRESCFH+
Sbjct  121  AESVDLIFSNWLLMYLSDNEVEKLAERLVKWLKVGGYIFFRESCFHR  167



>sp|Q9M571.1|PEAMT_SPIOL RecName: Full=Phosphoethanolamine N-methyltransferase [Spinacia 
oleracea]
 gb|AAF61950.1|AF237633_1 phosphoethanolamine N-methyltransferase [Spinacia oleracea]
Length=494

 Score =   272 bits (696),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 143/165 (87%), Gaps = 2/165 (1%)
 Frame = +2

Query  332  SAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVL  511
            SAM   Q  EREV K YWIEHS +LTVEAMMLDS+A+DLDK ERPEVLSMLP YEGKSVL
Sbjct  4    SAMGVLQ--EREVFKKYWIEHSVDLTVEAMMLDSQASDLDKVERPEVLSMLPPYEGKSVL  61

Query  512  ELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDE  691
            ELGAGIGRFTGELA+KA QVIA+DFIESVIKKNE+INGH  N+KFMCADVTS  LN S  
Sbjct  62   ELGAGIGRFTGELAEKASQVIALDFIESVIKKNESINGHYKNVKFMCADVTSPSLNISPN  121

Query  692  SIDLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            S+D+IFSNWLLMYLSD+EVE L ERM+KWL  GGYIFFRESCFHQ
Sbjct  122  SVDIIFSNWLLMYLSDEEVERLVERMLKWLKPGGYIFFRESCFHQ  166



>dbj|BAE07178.1| phosphoethanolamine N-methyltransferase [Beta vulgaris]
Length=494

 Score =   272 bits (695),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = +2

Query  356  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  535
            +EREV K YWIEHS +LTVEAMMLDSKA+DLDKEERPEVLSMLP YEGKSVLELGAGIGR
Sbjct  10   QEREVFKKYWIEHSVDLTVEAMMLDSKASDLDKEERPEVLSMLPPYEGKSVLELGAGIGR  69

Query  536  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  715
            FTG+LA+KAGQVIA+DFIES IKKNE +NGH  N+KFMCADVTS  LN S  S+D+IFSN
Sbjct  70   FTGDLAKKAGQVIALDFIESAIKKNECVNGHYKNVKFMCADVTSPSLNISPNSVDIIFSN  129

Query  716  WLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            WLLMYLSD+EV+ L ERM+KWL  GGYIFFRESCFHQ
Sbjct  130  WLLMYLSDEEVQRLVERMLKWLKPGGYIFFRESCFHQ  166



>ref|XP_010686587.1| PREDICTED: phosphoethanolamine N-methyltransferase [Beta vulgaris 
subsp. vulgaris]
Length=494

 Score =   271 bits (694),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = +2

Query  356  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  535
            +EREV K YWIEHS +LTVEAMMLDSKA+DLDKEERPEVLSMLP YEGKSVLELGAGIGR
Sbjct  10   QEREVFKKYWIEHSVDLTVEAMMLDSKASDLDKEERPEVLSMLPPYEGKSVLELGAGIGR  69

Query  536  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  715
            FTG+LA+KAGQVIA+DFIES IKKNE +NGH  N+KFMCADVTS  LN S  S+D+IFSN
Sbjct  70   FTGDLAKKAGQVIALDFIESAIKKNECVNGHYKNVKFMCADVTSPSLNISPNSVDIIFSN  129

Query  716  WLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            WLLMYLSD+EV+ L ERM+KWL  GGYIFFRESCFHQ
Sbjct  130  WLLMYLSDEEVQRLVERMLKWLKPGGYIFFRESCFHQ  166



>ref|XP_010461752.1| PREDICTED: phosphomethylethanolamine N-methyltransferase [Camelina 
sativa]
Length=492

 Score =   271 bits (694),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 126/157 (80%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = +2

Query  356  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  535
            EER +QKSYW+EHSS+LTVEAMMLDSKA+DLDKEERPEVLS++P YEGKSVLELGAGIGR
Sbjct  8    EERHIQKSYWMEHSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKSVLELGAGIGR  67

Query  536  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  715
            FTGELAQKAG+VIA+DFIES I+KNE++NGH  N+KFMCADVTS DL  +  SIDLIFSN
Sbjct  68   FTGELAQKAGEVIALDFIESAIQKNESVNGHYKNVKFMCADVTSPDLKIAVGSIDLIFSN  127

Query  716  WLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            WLLMYLSD+EVE +AERM+ W+  GGYIFFRESCFHQ
Sbjct  128  WLLMYLSDKEVELMAERMLGWVKPGGYIFFRESCFHQ  164



>ref|XP_003569614.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Brachypodium 
distachyon]
Length=502

 Score =   271 bits (693),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = +2

Query  356  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  535
            EERE QK YW EHS +LTVEAMMLDS AADLDKEERPE+LS+LP+YEGKSVLELGAGIGR
Sbjct  19   EEREAQKKYWEEHSRDLTVEAMMLDSHAADLDKEERPEILSLLPSYEGKSVLELGAGIGR  78

Query  536  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  715
            FTGELA+ AG V+AMDFIESVIKKNE+INGH  N  FMCADVTS DL   D SIDLIFSN
Sbjct  79   FTGELAKTAGHVLAMDFIESVIKKNESINGHYKNASFMCADVTSPDLVIEDNSIDLIFSN  138

Query  716  WLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            WLLMYLSD+EVE L +RMVKWL VGGYIFFRESCFHQ
Sbjct  139  WLLMYLSDEEVEKLVKRMVKWLKVGGYIFFRESCFHQ  175



>pir||H96762 hypothetical protein F6D5.1 [imported] - Arabidopsis thaliana
 gb|AAG51806.1|AC079676_1 phosphoethanolamine N-methyltransferase, putative; 6854-3993 
[Arabidopsis thaliana]
Length=555

 Score =   272 bits (696),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 131/188 (70%), Positives = 156/188 (83%), Gaps = 2/188 (1%)
 Frame = +2

Query  266  FSV-RIAFPGFLDFFYLFTAIVQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAA  442
            FS+ R  +P      +LF ++    MA++ GEERE+QK+YW EHS  L+VEAMMLDSKA+
Sbjct  41   FSIHRFHYPREKIVSFLFPSVFSRIMASY-GEEREIQKNYWKEHSVGLSVEAMMLDSKAS  99

Query  443  DLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETIN  622
            DLDKEERPE+L+ LP  EG +VLE GAGIGRFT ELAQKAGQVIA+DFIESVIKKNE IN
Sbjct  100  DLDKEERPEILAFLPPIEGTTVLEFGAGIGRFTTELAQKAGQVIAVDFIESVIKKNENIN  159

Query  623  GHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIF  802
            GH  N+KF+CADVTS ++NF +ES+DLIFSNWLLMYLSDQEVE LA++M++W  VGGYIF
Sbjct  160  GHYKNVKFLCADVTSPNMNFPNESMDLIFSNWLLMYLSDQEVEDLAKKMLQWTKVGGYIF  219

Query  803  FRESCFHQ  826
            FRESCFHQ
Sbjct  220  FRESCFHQ  227



>emb|CDY11100.1| BnaC06g23520D [Brassica napus]
Length=506

 Score =   271 bits (693),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 145/168 (86%), Gaps = 0/168 (0%)
 Frame = +2

Query  323  IVQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGK  502
            I  S   ++ GEERE+QK+YW EHS  L+VEAMMLDSKAADLDKEERPE+LS+LP  EG+
Sbjct  10   ISPSFPNSYSGEEREIQKNYWKEHSVGLSVEAMMLDSKAADLDKEERPEILSLLPPIEGE  69

Query  503  SVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNF  682
             VLE GAGIGRFT ELAQKAGQVIA+DFIESVIKKNE INGH  N+KFMCADVTS D+ F
Sbjct  70   KVLEFGAGIGRFTSELAQKAGQVIAVDFIESVIKKNENINGHYKNVKFMCADVTSPDMKF  129

Query  683  SDESIDLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            S ES+DL+FSNWLLMYLSD+EVE LA++M++W  VGGYIFFRESCFHQ
Sbjct  130  SSESMDLVFSNWLLMYLSDKEVEDLAKKMLQWTKVGGYIFFRESCFHQ  177



>gb|EMT21187.1| Phosphoethanolamine N-methyltransferase 1 [Aegilops tauschii]
Length=503

 Score =   271 bits (692),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = +2

Query  356  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  535
            EERE QK YW EHS +LTVEAMMLDS+AADLDKEERPE+LS+LP+YEGKSVLELGAGIGR
Sbjct  20   EEREAQKRYWEEHSRDLTVEAMMLDSRAADLDKEERPEILSLLPSYEGKSVLELGAGIGR  79

Query  536  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  715
            FTGELA+ AG V+AMDFIESVIKKNE+INGH  N  FMCADVTS DL   D SIDLIFSN
Sbjct  80   FTGELAKTAGHVLAMDFIESVIKKNESINGHYKNASFMCADVTSPDLVIEDNSIDLIFSN  139

Query  716  WLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            WLLMYLSD EVE L ERMVKWL VGG+IFFRESCFHQ
Sbjct  140  WLLMYLSDAEVEKLVERMVKWLKVGGHIFFRESCFHQ  176



>ref|XP_009104804.1| PREDICTED: phosphoethanolamine N-methyltransferase 3 [Brassica 
rapa]
Length=506

 Score =   271 bits (692),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 146/167 (87%), Gaps = 0/167 (0%)
 Frame = +2

Query  323  IVQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGK  502
            I  S   ++ GEERE+QK+YW EHS  L+VEAMMLDSKAADLDKEERPE+LS+LP  EG+
Sbjct  10   ISPSFPNSYSGEEREIQKNYWKEHSVGLSVEAMMLDSKAADLDKEERPEILSLLPPIEGE  69

Query  503  SVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNF  682
            +VLE GAGIGRFT ELAQKAGQVIA+DFIESVIKKNE INGH  N+KFMCADVTS D+ F
Sbjct  70   TVLEFGAGIGRFTSELAQKAGQVIAVDFIESVIKKNENINGHYKNVKFMCADVTSPDMKF  129

Query  683  SDESIDLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFH  823
            S+ES+DLIFSNWLLMYLSD+EVE LA++M++W  VGGYIFFRESCFH
Sbjct  130  SNESMDLIFSNWLLMYLSDKEVEDLAKKMLQWTKVGGYIFFRESCFH  176



>ref|XP_006644536.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Oryza 
brachyantha]
Length=499

 Score =   271 bits (692),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = +2

Query  356  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  535
            EER+ QKSYW EHS +LTVEAMMLDS+A DLDKEERPE+LS+LP+YEGKSVLELGAGIGR
Sbjct  16   EERKAQKSYWEEHSKDLTVEAMMLDSRATDLDKEERPEILSLLPSYEGKSVLELGAGIGR  75

Query  536  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  715
            FTGELA+ AG V+AMDFIESVIKKNE+INGH  N  FMCADVTS DL   D SIDLIFSN
Sbjct  76   FTGELAKTAGHVLAMDFIESVIKKNESINGHHKNASFMCADVTSPDLMIEDNSIDLIFSN  135

Query  716  WLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            WLLMYLSD+EVE L +RMVKWL VGGYIFFRESCFHQ
Sbjct  136  WLLMYLSDEEVEKLVKRMVKWLKVGGYIFFRESCFHQ  172



>gb|EMS54147.1| Phosphoethanolamine N-methyltransferase 1 [Triticum urartu]
Length=504

 Score =   271 bits (692),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = +2

Query  356  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  535
            EERE QK YW EHS +LTVEAMMLDS+AADLDKEERPE+LS+LP+YEGKSVLELGAGIGR
Sbjct  21   EEREAQKRYWEEHSRDLTVEAMMLDSRAADLDKEERPEILSLLPSYEGKSVLELGAGIGR  80

Query  536  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  715
            FTGELA+ AG V+AMDFIESVIKKNE+INGH  N  FMCADVTS DL   D SIDLIFSN
Sbjct  81   FTGELAKTAGHVLAMDFIESVIKKNESINGHYKNASFMCADVTSPDLVIEDNSIDLIFSN  140

Query  716  WLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            WLLMYLSD EVE L ERMVKWL VGG+IFFRESCFHQ
Sbjct  141  WLLMYLSDAEVEKLVERMVKWLKVGGHIFFRESCFHQ  177



>gb|ACV89824.1| S-adenosyl-L-methionine:phosphoethanolamine N-methyltransferase 
[Triticum aestivum]
Length=505

 Score =   271 bits (692),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = +2

Query  356  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  535
            EERE QK YW EHS +LTVEAMMLDS+AADLDKEERPE+LS+LP+YEGKSVLELGAGIGR
Sbjct  22   EEREAQKRYWEEHSRDLTVEAMMLDSRAADLDKEERPEILSLLPSYEGKSVLELGAGIGR  81

Query  536  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  715
            FTGELA+ AG V+AMDFIESVIKKNE+INGH  N  FMCADVTS DL   D SIDLIFSN
Sbjct  82   FTGELAKTAGHVLAMDFIESVIKKNESINGHYKNASFMCADVTSPDLVIEDNSIDLIFSN  141

Query  716  WLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            WLLMYLSD EVE L ERMVKWL VGG+IFFRESCFHQ
Sbjct  142  WLLMYLSDAEVEKLVERMVKWLKVGGHIFFRESCFHQ  178



>emb|CDM83845.1| unnamed protein product [Triticum aestivum]
Length=504

 Score =   270 bits (691),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = +2

Query  356  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  535
            EERE QK YW EHS +LTVEAMMLDS+AADLDKEERPE+LS+LP+YEGKSVLELGAGIGR
Sbjct  21   EEREAQKRYWEEHSRDLTVEAMMLDSRAADLDKEERPEILSLLPSYEGKSVLELGAGIGR  80

Query  536  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  715
            FTGELA+ AG V+AMDFIESVIKKNE+INGH  N  FMCADVTS DL   D SIDLIFSN
Sbjct  81   FTGELAKTAGHVLAMDFIESVIKKNESINGHYKNASFMCADVTSPDLVIEDNSIDLIFSN  140

Query  716  WLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            WLLMYLSD EVE L ERMVKWL VGG+IFFRESCFHQ
Sbjct  141  WLLMYLSDAEVEKLVERMVKWLKVGGHIFFRESCFHQ  177



>ref|XP_009595958.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=496

 Score =   270 bits (691),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 147/163 (90%), Gaps = 0/163 (0%)
 Frame = +2

Query  338  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  517
            +AA   +ERE+QKSYWIE ++ELT++AMMLDS+A+DLDKE+RPEVLS+LP YEGKSVLEL
Sbjct  6    IAAAPEQEREIQKSYWIEQAAELTLKAMMLDSEASDLDKEDRPEVLSLLPPYEGKSVLEL  65

Query  518  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  697
            GAGIGRFTG LA+KAGQ+  +DF+E VIKKNE+INGH  N+KFMCADVTS DL FS ES+
Sbjct  66   GAGIGRFTGGLAEKAGQLTTLDFVEDVIKKNESINGHHKNVKFMCADVTSPDLTFSPESV  125

Query  698  DLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            DLIFSNWLLMYLSD+EV+ LAERMVKWL VGGYIFFRE+CF+Q
Sbjct  126  DLIFSNWLLMYLSDKEVQDLAERMVKWLKVGGYIFFRETCFNQ  168



>ref|XP_010921161.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Elaeis 
guineensis]
Length=494

 Score =   270 bits (691),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/166 (78%), Positives = 144/166 (87%), Gaps = 3/166 (2%)
 Frame = +2

Query  338  MAAFQG---EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSV  508
            MAA  G   EER VQKSYW+EHS +LTV AMMLDS+A +LDKEERPEVLS+LP Y+GKSV
Sbjct  1    MAAVSGAGEEERMVQKSYWMEHSKDLTVAAMMLDSRATNLDKEERPEVLSLLPPYKGKSV  60

Query  509  LELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSD  688
            LELGAGIGRFTGELA++AG V+A+DFIE+VIKKNE+INGH  N  FMCADVTS DL   +
Sbjct  61   LELGAGIGRFTGELAKEAGHVLALDFIENVIKKNESINGHFTNTSFMCADVTSPDLLIEE  120

Query  689  ESIDLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            ES+DLIFSNWLLMYLSD EVE LAERMVKWL VGGYIFFRESCFHQ
Sbjct  121  ESVDLIFSNWLLMYLSDNEVERLAERMVKWLKVGGYIFFRESCFHQ  166



>ref|XP_011623100.1| PREDICTED: phosphomethylethanolamine N-methyltransferase isoform 
X2 [Amborella trichopoda]
Length=491

 Score =   270 bits (690),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = +2

Query  338  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  517
            MA   G+ERE+QKSYWIEHSS+LTVEAMMLDSKAA+LDKEERPEVLS+LP ++GK+VLEL
Sbjct  1    MALHIGKEREIQKSYWIEHSSDLTVEAMMLDSKAAELDKEERPEVLSLLPPFKGKNVLEL  60

Query  518  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  697
            GAGIGRFTGELA++AG V A+DFI+SVIKKNE INGH  NIKF+CADVTS +L F+ ES+
Sbjct  61   GAGIGRFTGELAKEAGHVTALDFIKSVIKKNEKINGHYKNIKFVCADVTSPELQFAPESV  120

Query  698  DLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            DL+FSNWLLMYLSD EVE LA+R+++W+ VGGYIFFRESCFHQ
Sbjct  121  DLLFSNWLLMYLSDAEVEDLAKRILQWVKVGGYIFFRESCFHQ  163



>ref|XP_010678114.1| PREDICTED: phosphoethanolamine N-methyltransferase [Beta vulgaris 
subsp. vulgaris]
Length=494

 Score =   270 bits (689),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = +2

Query  356  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  535
            EEREV K YWIEHS +LTVEAMMLDSKA+DLDKEERPEVLSMLP YEGKSVLELGAGIGR
Sbjct  10   EEREVFKKYWIEHSVDLTVEAMMLDSKASDLDKEERPEVLSMLPPYEGKSVLELGAGIGR  69

Query  536  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  715
            FTG+LA KA QVIA+DFIES IKKNE +NGH  N+KFMCADVTS  LN S  S+D+IFSN
Sbjct  70   FTGDLANKADQVIALDFIESAIKKNECVNGHYKNVKFMCADVTSPSLNISPNSVDIIFSN  129

Query  716  WLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            WLLMYLSD+EV+ L ERM+KWL  GGYIFFRESCFHQ
Sbjct  130  WLLMYLSDEEVQHLVERMLKWLKPGGYIFFRESCFHQ  166



>ref|NP_001148925.1| LOC100282545 [Zea mays]
 gb|ACG33501.1| phosphoethanolamine N-methyltransferase [Zea mays]
Length=502

 Score =   270 bits (689),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 141/169 (83%), Gaps = 0/169 (0%)
 Frame = +2

Query  320  AIVQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEG  499
            A V S       EER+ QKSYW EHS  LTVEAMMLDS+AADLDKEERPEVLS+LP+YEG
Sbjct  7    ATVVSLNGKMGAEERKAQKSYWEEHSKNLTVEAMMLDSRAADLDKEERPEVLSLLPSYEG  66

Query  500  KSVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLN  679
            KSVLELGAGIGRFTGELA+ AG V+A+DFIES IKKNE+INGH  N  FMCADVTS+DL 
Sbjct  67   KSVLELGAGIGRFTGELAKTAGNVLALDFIESAIKKNESINGHYKNASFMCADVTSQDLV  126

Query  680  FSDESIDLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
                SIDLIFSNWLLMYLSD+EVE L +RMVKWL VGGYIFFRESCFHQ
Sbjct  127  LQANSIDLIFSNWLLMYLSDEEVEQLVQRMVKWLKVGGYIFFRESCFHQ  175



>ref|XP_006365411.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Solanum 
tuberosum]
Length=494

 Score =   269 bits (688),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 149/165 (90%), Gaps = 0/165 (0%)
 Frame = +2

Query  332  SAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVL  511
            +A+A   G+ERE+QKSYW+E ++EL +EAMMLDS A+DLDKE+RPEVLS+LP+YEGKSVL
Sbjct  2    AAIAPGVGQEREIQKSYWMEQTTELNLEAMMLDSAASDLDKEDRPEVLSLLPSYEGKSVL  61

Query  512  ELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDE  691
            ELGAGIGRFTG++A+KAG+++ +DFIE VIKKNE+INGH  N+KF+CADVTS DL F  E
Sbjct  62   ELGAGIGRFTGDIAEKAGELVTVDFIEEVIKKNESINGHHKNVKFVCADVTSPDLTFLPE  121

Query  692  SIDLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            S+DLIFSNWLLMYLSD+EV+ LAERM+KWL VGGYIFFRE+CFHQ
Sbjct  122  SVDLIFSNWLLMYLSDEEVQDLAERMIKWLKVGGYIFFRETCFHQ  166



>ref|XP_008464197.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Cucumis 
melo]
Length=493

 Score =   269 bits (687),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  353  GEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIG  532
            G+EREVQK+YWIEH+++LTVEAMMLDS+A+ LDKEERPE+LS+LP Y+GK+VLELGAGIG
Sbjct  8    GQEREVQKNYWIEHTADLTVEAMMLDSQASYLDKEERPEILSLLPPYDGKTVLELGAGIG  67

Query  533  RFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFS  712
            RFTGELAQKAG VIA+DFIE+ IKKNE IN H  N+KF+CADVTS +L  SDES+DLIFS
Sbjct  68   RFTGELAQKAGNVIALDFIENAIKKNERINSHHKNVKFVCADVTSSELKISDESVDLIFS  127

Query  713  NWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            NWLLMYLSD+EVE+ A R++KWL VGGYIFFRESCFHQ
Sbjct  128  NWLLMYLSDKEVENFAARIIKWLKVGGYIFFRESCFHQ  165



>gb|ACJ83326.1| unknown [Medicago truncatula]
Length=221

 Score =   259 bits (663),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 141/164 (86%), Gaps = 0/164 (0%)
 Frame = +2

Query  335  AMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  514
            AM     +EREVQ+SYW EH   L+VE+MMLDS A+ LDKEERPEVLS+LP+YEGKSVLE
Sbjct  6    AMKQGGEDEREVQRSYWKEHCVNLSVESMMLDSNASHLDKEERPEVLSLLPSYEGKSVLE  65

Query  515  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDES  694
            LGAGIGRFT ELAQKAGQ++A+DFIES IKKNE  NGH  N+KFMCADVTS +L+ S+ S
Sbjct  66   LGAGIGRFTAELAQKAGQLLAVDFIESAIKKNENTNGHHKNVKFMCADVTSPNLHISEGS  125

Query  695  IDLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            +DLIFSNWLLMYLSD+EV++LAERMVKWL V G IFFRESCFHQ
Sbjct  126  VDLIFSNWLLMYLSDEEVKNLAERMVKWLNVNGCIFFRESCFHQ  169



>ref|XP_007152684.1| hypothetical protein PHAVU_004G150500g [Phaseolus vulgaris]
 gb|ESW24678.1| hypothetical protein PHAVU_004G150500g [Phaseolus vulgaris]
Length=497

 Score =   268 bits (686),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 150/168 (89%), Gaps = 3/168 (2%)
 Frame = +2

Query  332  SAMAAFQG---EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGK  502
            +++A  QG   +ER VQKSYWIEH++EL+VE+MMLDS A+ LDKEERPEVLS+LPAYEGK
Sbjct  2    ASLAMVQGGGVDERCVQKSYWIEHTTELSVESMMLDSNASHLDKEERPEVLSLLPAYEGK  61

Query  503  SVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNF  682
            SVLELGAGIGRFTGELA+KAGQ++A+DFIES IKKNE INGH  N+KFMCADVTS +L  
Sbjct  62   SVLELGAGIGRFTGELAKKAGQLLAVDFIESAIKKNENINGHHKNVKFMCADVTSPNLQI  121

Query  683  SDESIDLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            S+ S+DLIFSNWLLMYLSD+EVE+LA +M+KWL VGGY+FFRESCFHQ
Sbjct  122  SEGSVDLIFSNWLLMYLSDKEVENLAGKMMKWLKVGGYVFFRESCFHQ  169



>ref|XP_004137341.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Cucumis 
sativus]
Length=500

 Score =   268 bits (686),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 144/165 (87%), Gaps = 0/165 (0%)
 Frame = +2

Query  332  SAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVL  511
            +   A   EER +QK YWIEHS+ LTVEAM+LDS A+DLDKEERPEVLS+LP YEGKSVL
Sbjct  5    TPAPALNDEERLIQKKYWIEHSARLTVEAMLLDSNASDLDKEERPEVLSLLPPYEGKSVL  64

Query  512  ELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDE  691
            ELGAGIGRFTG+LA KAGQV+A+DFIESVIKKNE+IN H  N+KFMCADVTS +L  S+ 
Sbjct  65   ELGAGIGRFTGDLAVKAGQVLALDFIESVIKKNESINRHHKNVKFMCADVTSPELKISEN  124

Query  692  SIDLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            S+DLIFSNWLLMYLSD EV++LAERMVKWL VGG+IFFRESCFHQ
Sbjct  125  SVDLIFSNWLLMYLSDIEVKNLAERMVKWLKVGGHIFFRESCFHQ  169



>ref|XP_004137500.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Cucumis 
sativus]
 gb|KGN64173.1| hypothetical protein Csa_1G042800 [Cucumis sativus]
Length=493

 Score =   268 bits (685),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  353  GEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIG  532
            G+EREVQK+YWIEH+++LTVEAMMLDS+A+ LDKEERPEVLS+LP  +GK+VLELGAGIG
Sbjct  8    GQEREVQKNYWIEHTADLTVEAMMLDSQASYLDKEERPEVLSLLPPCDGKTVLELGAGIG  67

Query  533  RFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFS  712
            RFTGELAQKAG VIA+DFIE+ IKKNE+ N H  N+KF+CADVTS +L  SDESIDLIFS
Sbjct  68   RFTGELAQKAGNVIALDFIENAIKKNESTNSHHKNVKFVCADVTSSELKISDESIDLIFS  127

Query  713  NWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            NWLLMYLSD+EVESLA R++KWL VGGYIFFRESCFHQ
Sbjct  128  NWLLMYLSDKEVESLAARIIKWLKVGGYIFFRESCFHQ  165



>ref|XP_002456194.1| hypothetical protein SORBIDRAFT_03g031950 [Sorghum bicolor]
 gb|EES01314.1| hypothetical protein SORBIDRAFT_03g031950 [Sorghum bicolor]
Length=501

 Score =   268 bits (685),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/170 (76%), Positives = 142/170 (84%), Gaps = 0/170 (0%)
 Frame = +2

Query  317  TAIVQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYE  496
            TA V S       EER+ QKSYW EHS  LTVEAMMLDS+AADLDKEERPEVLS+LP++E
Sbjct  5    TAAVVSVNGKMGVEERQAQKSYWEEHSRNLTVEAMMLDSRAADLDKEERPEVLSLLPSFE  64

Query  497  GKSVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDL  676
            GKSVLELGAGIGRFTGELA+ AG V+A+DFIES IKKNE+INGH  N  FMCADVTS+DL
Sbjct  65   GKSVLELGAGIGRFTGELAKTAGNVLALDFIESAIKKNESINGHYKNASFMCADVTSEDL  124

Query  677  NFSDESIDLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
                 SIDLIFSNWLLMYLSD+EVE L +RMVKWL +GGYIFFRESCFHQ
Sbjct  125  VLPASSIDLIFSNWLLMYLSDEEVEQLVQRMVKWLKIGGYIFFRESCFHQ  174



>gb|AAM97038.1| phosphoethanolamine N-methyltransferase, putative [Arabidopsis 
thaliana]
Length=376

 Score =   264 bits (675),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/157 (78%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = +2

Query  356  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  535
            EERE+QK+YW EHS  L+VEAMMLDSKA+DLDKEERPE+L+ LP  EG +VLE GAGIGR
Sbjct  20   EEREIQKNYWKEHSVGLSVEAMMLDSKASDLDKEERPEILAFLPPIEGTTVLEFGAGIGR  79

Query  536  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  715
            FT ELAQKAGQVIA+DFIESVIKKNE INGH  N+KF+CADVTS ++NF +ES+DLIFSN
Sbjct  80   FTTELAQKAGQVIAVDFIESVIKKNENINGHYKNVKFLCADVTSPNMNFPNESMDLIFSN  139

Query  716  WLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            WLLMYLSDQEVE LA++M++W  VGGYIFFRESCFHQ
Sbjct  140  WLLMYLSDQEVEDLAKKMLQWTKVGGYIFFRESCFHQ  176



>ref|XP_004969638.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Setaria 
italica]
Length=499

 Score =   268 bits (685),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 141/169 (83%), Gaps = 0/169 (0%)
 Frame = +2

Query  320  AIVQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEG  499
            A   S     + EER+ QKSYW EHS +LTVEAMMLDS+AADLDKEERPEVLS+LP YEG
Sbjct  4    ATAVSVNGKMEVEERQAQKSYWEEHSRDLTVEAMMLDSRAADLDKEERPEVLSLLPPYEG  63

Query  500  KSVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLN  679
            KSVLELGAGIGRFTGELA+ AG V+A+DFIES IKKNE+INGH  N  FMCADVTS+DL 
Sbjct  64   KSVLELGAGIGRFTGELAKTAGNVLALDFIESAIKKNESINGHFKNASFMCADVTSQDLV  123

Query  680  FSDESIDLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
                SID+IFSNWLLMYLSD+EVE L +RMVKWL VGGYIFFRESCFHQ
Sbjct  124  IQANSIDMIFSNWLLMYLSDEEVEQLVQRMVKWLKVGGYIFFRESCFHQ  172



>gb|AAF79704.1|AC020889_12 T1N15.22 [Arabidopsis thaliana]
Length=180

 Score =   257 bits (657),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = +2

Query  386  IEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAG  565
            +EHSS+LTVEAMMLDSKA+DLDKEERPEVLS++P YEGKSVLELGAGIGRFTGELAQKAG
Sbjct  1    MEHSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKSVLELGAGIGRFTGELAQKAG  60

Query  566  QVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQE  745
            +VIA+DFIES I+KNE++NGH  NIKFMCADVTS DL   D SIDLIFSNWLLMYLSD+E
Sbjct  61   EVIALDFIESAIQKNESVNGHYKNIKFMCADVTSPDLKIKDGSIDLIFSNWLLMYLSDKE  120

Query  746  VESLAERMVKWLXVGGYIFFRESCFHQ  826
            VE +AERM+ W+  GGYIFFRESCFHQ
Sbjct  121  VELMAERMIGWVKPGGYIFFRESCFHQ  147



>dbj|BAJ97525.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=508

 Score =   268 bits (685),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = +2

Query  356  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  535
            EERE QK YW EHS +LTVEAMMLDS+AADLDKEERPE+LS+LP+YEGKSVLELGAGIGR
Sbjct  25   EEREAQKRYWEEHSRDLTVEAMMLDSRAADLDKEERPEILSLLPSYEGKSVLELGAGIGR  84

Query  536  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  715
            FTGELA+ AG V+AMDFI SVIKKNE+INGH  N  FMCADVTS DL   D SIDLIFSN
Sbjct  85   FTGELAKTAGHVLAMDFIGSVIKKNESINGHYENASFMCADVTSPDLVIEDNSIDLIFSN  144

Query  716  WLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            WLLMYLSD+EVE L ERMVKWL VGG+IFFRESCFHQ
Sbjct  145  WLLMYLSDEEVEKLVERMVKWLKVGGHIFFRESCFHQ  181



>ref|NP_001043957.1| Os01g0695100 [Oryza sativa Japonica Group]
 dbj|BAF05871.1| Os01g0695100 [Oryza sativa Japonica Group]
Length=499

 Score =   268 bits (684),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 126/157 (80%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = +2

Query  356  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  535
            EER+ QKSYW EHS +LTVEAMMLDS+AADLDKEERPE+LS+LP YEGKSVLELGAGIGR
Sbjct  16   EERKAQKSYWEEHSKDLTVEAMMLDSRAADLDKEERPEILSLLPPYEGKSVLELGAGIGR  75

Query  536  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  715
            FTGEL + AG V+AMDFIESVIKKNE+INGH  N  FMCADVT  DL   D SIDLIFSN
Sbjct  76   FTGELVKTAGHVLAMDFIESVIKKNESINGHHKNASFMCADVTCPDLMIEDNSIDLIFSN  135

Query  716  WLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            WLLMYLSD+EVE L +RMV+WL VGGYIFFRESCFHQ
Sbjct  136  WLLMYLSDEEVEKLVKRMVRWLKVGGYIFFRESCFHQ  172



>gb|KEH21429.1| phosphoethanolamine N-methyltransferase [Medicago truncatula]
Length=469

 Score =   266 bits (681),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 122/157 (78%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = +2

Query  356  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  535
            +ERE+QKSYWI+H ++L+VEAMMLDSKA+DLDKEERPEVLS+LP YEGKSV+ELGAGIGR
Sbjct  11   DEREIQKSYWIQHCADLSVEAMMLDSKASDLDKEERPEVLSLLPEYEGKSVIELGAGIGR  70

Query  536  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  715
            FTGELAQKAGQ++A+DFIES IKKNE+INGH  N KF+CADVTS  ++ S+ S+D+IFSN
Sbjct  71   FTGELAQKAGQLLAVDFIESAIKKNESINGHYKNAKFLCADVTSPKMDVSEGSVDVIFSN  130

Query  716  WLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            WLLMYLSD EVE+LA+RM+KWL  GGYIFFRESCFHQ
Sbjct  131  WLLMYLSDNEVENLAKRMMKWLKDGGYIFFRESCFHQ  167



>gb|AAS57723.1| phosphoethanolamine N-methyltransferase [Oryza sativa]
Length=499

 Score =   268 bits (684),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 126/157 (80%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = +2

Query  356  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  535
            EER+ QKSYW EHS +LTVEAMMLDS+AADLDKEERPE+LS+LP YEGKSVLELGAGIGR
Sbjct  16   EERKAQKSYWEEHSKDLTVEAMMLDSRAADLDKEERPEILSLLPPYEGKSVLELGAGIGR  75

Query  536  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  715
            FTGEL + AG V+AMDFIESVIKKNE+INGH  N  FMCADVT  DL   D SIDLIFSN
Sbjct  76   FTGELVKTAGHVLAMDFIESVIKKNESINGHHKNASFMCADVTCPDLMIEDNSIDLIFSN  135

Query  716  WLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            WLLMYLSD+EVE L +RMV+WL VGGYIFFRESCFHQ
Sbjct  136  WLLMYLSDEEVEKLVKRMVRWLKVGGYIFFRESCFHQ  172



>gb|AFW83642.1| phosphoethanolamine N-methyltransferase [Zea mays]
Length=502

 Score =   268 bits (684),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = +2

Query  356  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  535
            EER+ QKSYW EHS  LTVEAMMLDS+AADLDKEERPEVLS+LP+YEGKSVLELGAGIGR
Sbjct  19   EERKAQKSYWEEHSKNLTVEAMMLDSRAADLDKEERPEVLSLLPSYEGKSVLELGAGIGR  78

Query  536  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  715
            FTGELA+ AG V+A+DFIES IKKNE+INGH  N  FMCADVTS+DL     SIDLIFSN
Sbjct  79   FTGELAKTAGNVLALDFIESAIKKNESINGHYKNASFMCADVTSQDLVLQANSIDLIFSN  138

Query  716  WLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            WLLMYLSD+EVE L +RMVKWL VGGYIFFRESCFHQ
Sbjct  139  WLLMYLSDEEVEQLVQRMVKWLKVGGYIFFRESCFHQ  175



>ref|XP_009385384.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Musa 
acuminata subsp. malaccensis]
Length=497

 Score =   267 bits (683),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = +2

Query  353  GEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIG  532
            GEEREVQK YWIEHS ELTVEAMMLDS A++LDKEERPEVLS+LP Y+GKSVLELGAGIG
Sbjct  12   GEEREVQKIYWIEHSKELTVEAMMLDSHASELDKEERPEVLSLLPPYKGKSVLELGAGIG  71

Query  533  RFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFS  712
            RFTGELA++AG V+A+DFIESVI+KNE++NGH  N  FMCADV+S DL+   +S DLIFS
Sbjct  72   RFTGELAKEAGHVLALDFIESVIEKNESLNGHYKNTSFMCADVSSPDLSIEADSFDLIFS  131

Query  713  NWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            NWLLMYLSD+EVE L ERMVKWL VGGYIFFRESCFHQ
Sbjct  132  NWLLMYLSDKEVEKLVERMVKWLKVGGYIFFRESCFHQ  169



>gb|KEH21430.1| phosphoethanolamine N-methyltransferase [Medicago truncatula]
Length=456

 Score =   266 bits (680),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 122/157 (78%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = +2

Query  356  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  535
            +ERE+QKSYWI+H ++L+VEAMMLDSKA+DLDKEERPEVLS+LP YEGKSV+ELGAGIGR
Sbjct  11   DEREIQKSYWIQHCADLSVEAMMLDSKASDLDKEERPEVLSLLPEYEGKSVIELGAGIGR  70

Query  536  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  715
            FTGELAQKAGQ++A+DFIES IKKNE+INGH  N KF+CADVTS  ++ S+ S+D+IFSN
Sbjct  71   FTGELAQKAGQLLAVDFIESAIKKNESINGHYKNAKFLCADVTSPKMDVSEGSVDVIFSN  130

Query  716  WLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            WLLMYLSD EVE+LA+RM+KWL  GGYIFFRESCFHQ
Sbjct  131  WLLMYLSDNEVENLAKRMMKWLKDGGYIFFRESCFHQ  167



>ref|XP_008453479.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Cucumis 
melo]
Length=500

 Score =   267 bits (683),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 144/167 (86%), Gaps = 0/167 (0%)
 Frame = +2

Query  326  VQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKS  505
              +   A   +ER +QK YWIEHS+ LTVEAM+LDS A+DLDKEERPEVLS+LP YEGKS
Sbjct  3    TPTPAPALNDDERLIQKKYWIEHSARLTVEAMLLDSNASDLDKEERPEVLSLLPPYEGKS  62

Query  506  VLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFS  685
            VLELGAGIGRFTG+LA KAGQV+A+DFIESVIKKNE+IN H  N+KFMCADVTS +L  S
Sbjct  63   VLELGAGIGRFTGDLAVKAGQVLALDFIESVIKKNESINRHHKNVKFMCADVTSPELKIS  122

Query  686  DESIDLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            + S+DLIFSNWLLMYLSD EV++LAERMVKWL VGG+IFFRESCFHQ
Sbjct  123  ENSVDLIFSNWLLMYLSDIEVKNLAERMVKWLRVGGHIFFRESCFHQ  169



>gb|EEE55232.1| hypothetical protein OsJ_03109 [Oryza sativa Japonica Group]
Length=509

 Score =   267 bits (683),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 126/157 (80%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = +2

Query  356  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  535
            EER+ QKSYW EHS +LTVEAMMLDS+AADLDKEERPE+LS+LP YEGKSVLELGAGIGR
Sbjct  16   EERKAQKSYWEEHSKDLTVEAMMLDSRAADLDKEERPEILSLLPPYEGKSVLELGAGIGR  75

Query  536  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  715
            FTGEL + AG V+AMDFIESVIKKNE+INGH  N  FMCADVT  DL   D SIDLIFSN
Sbjct  76   FTGELVKTAGHVLAMDFIESVIKKNESINGHHKNASFMCADVTCPDLMIEDNSIDLIFSN  135

Query  716  WLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            WLLMYLSD+EVE L +RMV+WL VGGYIFFRESCFHQ
Sbjct  136  WLLMYLSDEEVEKLVKRMVRWLKVGGYIFFRESCFHQ  172



>ref|NP_177501.2| putative phosphoethanolamine N-methyltransferase 3 [Arabidopsis 
thaliana]
 sp|Q9C6B9.2|PEAM3_ARATH RecName: Full=Phosphoethanolamine N-methyltransferase 3 [Arabidopsis 
thaliana]
 gb|AEE35481.1| putative phosphoethanolamine N-methyltransferase 3 [Arabidopsis 
thaliana]
Length=490

 Score =   267 bits (682),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 145/163 (89%), Gaps = 1/163 (1%)
 Frame = +2

Query  338  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  517
            MA++ GEERE+QK+YW EHS  L+VEAMMLDSKA+DLDKEERPE+L+ LP  EG +VLE 
Sbjct  1    MASY-GEEREIQKNYWKEHSVGLSVEAMMLDSKASDLDKEERPEILAFLPPIEGTTVLEF  59

Query  518  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  697
            GAGIGRFT ELAQKAGQVIA+DFIESVIKKNE INGH  N+KF+CADVTS ++NF +ES+
Sbjct  60   GAGIGRFTTELAQKAGQVIAVDFIESVIKKNENINGHYKNVKFLCADVTSPNMNFPNESM  119

Query  698  DLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            DLIFSNWLLMYLSDQEVE LA++M++W  VGGYIFFRESCFHQ
Sbjct  120  DLIFSNWLLMYLSDQEVEDLAKKMLQWTKVGGYIFFRESCFHQ  162



>dbj|BAH01482.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64589.1| hypothetical protein OsJ_19441 [Oryza sativa Japonica Group]
Length=495

 Score =   267 bits (682),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 126/156 (81%), Positives = 139/156 (89%), Gaps = 0/156 (0%)
 Frame = +2

Query  359  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  538
            ER+ Q+SYW EHS +LTVEAMMLDS+AADLDKEERPEVLS+LP+Y+GKSVLELGAGIGRF
Sbjct  13   ERKAQRSYWEEHSKDLTVEAMMLDSRAADLDKEERPEVLSVLPSYKGKSVLELGAGIGRF  72

Query  539  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  718
            TGELA++AG V+A+DFIESVIKKNE INGH  NI FMCADVTS DL   D SIDLIFSNW
Sbjct  73   TGELAKEAGHVLALDFIESVIKKNENINGHHKNITFMCADVTSPDLTIEDNSIDLIFSNW  132

Query  719  LLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            LLMYLSD+EVE L  RMVKWL VGG+IFFRESCFHQ
Sbjct  133  LLMYLSDEEVEKLVGRMVKWLKVGGHIFFRESCFHQ  168



>ref|XP_010921197.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X2 [Elaeis guineensis]
Length=499

 Score =   267 bits (682),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = +2

Query  356  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  535
            EER VQKS+W+EHS +L VEAMMLDS+A+DLDKEERPEVLS+LP Y+GKS+LELGAGIGR
Sbjct  10   EERTVQKSFWMEHSKDLNVEAMMLDSRASDLDKEERPEVLSLLPPYKGKSILELGAGIGR  69

Query  536  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  715
            FTGELA++AG V+A+DFIE VIKKNE++NGH  NI FMCADVTS DL    ES+DLIFSN
Sbjct  70   FTGELAKEAGHVLALDFIEDVIKKNESVNGHFKNISFMCADVTSPDLMIEAESVDLIFSN  129

Query  716  WLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            WLLMYLSD EVE LAERMVKW  VGGYIFFRESCFHQ
Sbjct  130  WLLMYLSDNEVEKLAERMVKWSKVGGYIFFRESCFHQ  166



>ref|XP_011008809.1| PREDICTED: phosphomethylethanolamine N-methyltransferase isoform 
X2 [Populus euphratica]
Length=490

 Score =   266 bits (681),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 122/157 (78%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = +2

Query  356  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  535
            EER++QK YW+++ S+L+V AMMLDSKA++LDKEERPE+LS+LP YEGK+VLELGAGIGR
Sbjct  6    EERDIQKKYWMDNISDLSVNAMMLDSKASELDKEERPEILSLLPPYEGKTVLELGAGIGR  65

Query  536  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  715
            FTGELAQKAGQV+A+DFIES IKKNE INGH  N+KFMCADVTS DLN S+ S+DLIFSN
Sbjct  66   FTGELAQKAGQVVALDFIESAIKKNENINGHYKNVKFMCADVTSPDLNISEGSVDLIFSN  125

Query  716  WLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            WLLMYLSD+EVE+L ERMVKW+ V G+IFFRESCFHQ
Sbjct  126  WLLMYLSDKEVENLVERMVKWVKVDGFIFFRESCFHQ  162



>ref|XP_006843796.1| PREDICTED: phosphomethylethanolamine N-methyltransferase isoform 
X1 [Amborella trichopoda]
 gb|ERN05471.1| hypothetical protein AMTR_s00007p00250490 [Amborella trichopoda]
Length=489

 Score =   266 bits (681),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 128/163 (79%), Positives = 149/163 (91%), Gaps = 2/163 (1%)
 Frame = +2

Query  338  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  517
            MAA QGE RE+QKSYWIEHSS+LTVEAMMLDSKAA+LDKEERPEVLS+LP ++GK+VLEL
Sbjct  1    MAA-QGE-REIQKSYWIEHSSDLTVEAMMLDSKAAELDKEERPEVLSLLPPFKGKNVLEL  58

Query  518  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  697
            GAGIGRFTGELA++AG V A+DFI+SVIKKNE INGH  NIKF+CADVTS +L F+ ES+
Sbjct  59   GAGIGRFTGELAKEAGHVTALDFIKSVIKKNEKINGHYKNIKFVCADVTSPELQFAPESV  118

Query  698  DLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            DL+FSNWLLMYLSD EVE LA+R+++W+ VGGYIFFRESCFHQ
Sbjct  119  DLLFSNWLLMYLSDAEVEDLAKRILQWVKVGGYIFFRESCFHQ  161



>ref|XP_011008808.1| PREDICTED: phosphomethylethanolamine N-methyltransferase isoform 
X1 [Populus euphratica]
Length=506

 Score =   267 bits (682),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = +2

Query  332  SAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVL  511
            +   A + EER++QK YW+++ S+L+V AMMLDSKA++LDKEERPE+LS+LP YEGK+VL
Sbjct  14   TPPPASRVEERDIQKKYWMDNISDLSVNAMMLDSKASELDKEERPEILSLLPPYEGKTVL  73

Query  512  ELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDE  691
            ELGAGIGRFTGELAQKAGQV+A+DFIES IKKNE INGH  N+KFMCADVTS DLN S+ 
Sbjct  74   ELGAGIGRFTGELAQKAGQVVALDFIESAIKKNENINGHYKNVKFMCADVTSPDLNISEG  133

Query  692  SIDLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            S+DLIFSNWLLMYLSD+EVE+L ERMVKW+ V G+IFFRESCFHQ
Sbjct  134  SVDLIFSNWLLMYLSDKEVENLVERMVKWVKVDGFIFFRESCFHQ  178



>ref|XP_004503268.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Cicer 
arietinum]
Length=490

 Score =   266 bits (681),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 122/157 (78%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = +2

Query  356  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  535
            +ERE+QKSYW++H ++L+VEAMMLDSKA+DLDKEERPEVLS+LPAYEGKSV+ELGAGIGR
Sbjct  6    DEREIQKSYWVQHCADLSVEAMMLDSKASDLDKEERPEVLSLLPAYEGKSVIELGAGIGR  65

Query  536  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  715
            FTGELAQKAGQ++A+DFIES IKKNE+INGH  N KF+CADVTS ++  S+ S+D+IFSN
Sbjct  66   FTGELAQKAGQLLAVDFIESAIKKNESINGHYKNAKFLCADVTSPNMKVSEGSVDVIFSN  125

Query  716  WLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            WLLMYLSD EVE+LAERM+KWL   GYIFFRESCFHQ
Sbjct  126  WLLMYLSDNEVENLAERMMKWLKDDGYIFFRESCFHQ  162



>ref|XP_006390538.1| hypothetical protein EUTSA_v10018431mg [Eutrema salsugineum]
 gb|ESQ27824.1| hypothetical protein EUTSA_v10018431mg [Eutrema salsugineum]
Length=504

 Score =   267 bits (682),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 147/167 (88%), Gaps = 0/167 (0%)
 Frame = +2

Query  326  VQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKS  505
            + S+ +    EERE+QK+YW EHS  L+VEAMMLDSKAADLDKEERPE+L++LP  +G++
Sbjct  10   IASSFSKNSWEEREIQKNYWKEHSVGLSVEAMMLDSKAADLDKEERPEILALLPPIDGRT  69

Query  506  VLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFS  685
            VLE GAGIGRFT ELAQKAG+VIA+DFI+SVIKKNE INGH  N++FMCADVTS D+NFS
Sbjct  70   VLEFGAGIGRFTSELAQKAGKVIAVDFIDSVIKKNENINGHYKNVEFMCADVTSPDMNFS  129

Query  686  DESIDLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            DES+DLIFSNWLLMYLSD+EVE LA++M++W  VGGYIFFRESCFHQ
Sbjct  130  DESMDLIFSNWLLMYLSDKEVEDLAKKMLQWTKVGGYIFFRESCFHQ  176



>gb|AET05600.2| phosphoethanolamine N-methyltransferase [Medicago truncatula]
Length=494

 Score =   266 bits (681),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 122/157 (78%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = +2

Query  356  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  535
            +ERE+QKSYWI+H ++L+VEAMMLDSKA+DLDKEERPEVLS+LP YEGKSV+ELGAGIGR
Sbjct  11   DEREIQKSYWIQHCADLSVEAMMLDSKASDLDKEERPEVLSLLPEYEGKSVIELGAGIGR  70

Query  536  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  715
            FTGELAQKAGQ++A+DFIES IKKNE+INGH  N KF+CADVTS  ++ S+ S+D+IFSN
Sbjct  71   FTGELAQKAGQLLAVDFIESAIKKNESINGHYKNAKFLCADVTSPKMDVSEGSVDVIFSN  130

Query  716  WLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            WLLMYLSD EVE+LA+RM+KWL  GGYIFFRESCFHQ
Sbjct  131  WLLMYLSDNEVENLAKRMMKWLKDGGYIFFRESCFHQ  167



>ref|XP_002322102.2| hypothetical protein POPTR_0015s04540g [Populus trichocarpa]
 gb|EEF06229.2| hypothetical protein POPTR_0015s04540g [Populus trichocarpa]
Length=516

 Score =   267 bits (682),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = +2

Query  332  SAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVL  511
            +   A + EER++QK YW+++ S+L+V AMMLDSKA++LDKEERPE+LS+LP YEGK+VL
Sbjct  14   TPPPASRVEERDIQKKYWMDNISDLSVNAMMLDSKASELDKEERPEILSLLPPYEGKTVL  73

Query  512  ELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDE  691
            ELGAGIGRFTGELAQKAGQV+A+DFIES IKKNE INGH  N+KFMCADVTS DLN S+ 
Sbjct  74   ELGAGIGRFTGELAQKAGQVVALDFIESAIKKNENINGHYKNVKFMCADVTSPDLNISEG  133

Query  692  SIDLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            S+DLIFSNWLLMYLSD+EVE+L ERMVKW+ V G+IFFRESCFHQ
Sbjct  134  SVDLIFSNWLLMYLSDKEVENLVERMVKWVKVDGFIFFRESCFHQ  178



>ref|XP_003631124.1| Phosphoethanolamine N-methyltransferase [Medicago truncatula]
Length=495

 Score =   266 bits (681),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 122/157 (78%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = +2

Query  356  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  535
            +ERE+QKSYWI+H ++L+VEAMMLDSKA+DLDKEERPEVLS+LP YEGKSV+ELGAGIGR
Sbjct  11   DEREIQKSYWIQHCADLSVEAMMLDSKASDLDKEERPEVLSLLPEYEGKSVIELGAGIGR  70

Query  536  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  715
            FTGELAQKAGQ++A+DFIES IKKNE+INGH  N KF+CADVTS  ++ S+ S+D+IFSN
Sbjct  71   FTGELAQKAGQLLAVDFIESAIKKNESINGHYKNAKFLCADVTSPKMDVSEGSVDVIFSN  130

Query  716  WLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            WLLMYLSD EVE+LA+RM+KWL  GGYIFFRESCFHQ
Sbjct  131  WLLMYLSDNEVENLAKRMMKWLKDGGYIFFRESCFHQ  167



>ref|XP_003631125.1| Phosphoethanolamine N-methyltransferase [Medicago truncatula]
 gb|AET05601.1| phosphoethanolamine N-methyltransferase [Medicago truncatula]
Length=488

 Score =   266 bits (679),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/157 (78%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = +2

Query  356  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  535
            +ERE+QKSYWI+H ++L+VEAMMLDSKA+DLDKEERPEVLS+LP YEGKSV+ELGAGIGR
Sbjct  5    DEREIQKSYWIQHCADLSVEAMMLDSKASDLDKEERPEVLSLLPEYEGKSVIELGAGIGR  64

Query  536  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  715
            FTGELAQKAGQ++A+DFIES IKKNE+INGH  N KF+CADVTS  ++ S+ S+D+IFSN
Sbjct  65   FTGELAQKAGQLLAVDFIESAIKKNESINGHYKNAKFLCADVTSPKMDVSEGSVDVIFSN  124

Query  716  WLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            WLLMYLSD EVE+LA+RM+KWL  GGYIFFRESCFHQ
Sbjct  125  WLLMYLSDNEVENLAKRMMKWLKDGGYIFFRESCFHQ  161



>ref|XP_009404071.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Musa acuminata subsp. malaccensis]
Length=497

 Score =   266 bits (680),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = +2

Query  356  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  535
            EEREVQKSYW+EHS +LT+EAMMLDS+A++LDKEERPEVLS+LP Y+GKSVLELGAGIGR
Sbjct  13   EEREVQKSYWMEHSRDLTLEAMMLDSRASELDKEERPEVLSLLPPYKGKSVLELGAGIGR  72

Query  536  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  715
            FT ELA++AG V+A+DFIESVIKKNE++NGH  N  FMCADVTS DL    +S+DLIFSN
Sbjct  73   FTSELAKEAGHVLALDFIESVIKKNESLNGHYKNTSFMCADVTSPDLTIEADSVDLIFSN  132

Query  716  WLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            WLLMYLSD+EVE L ERMVKW+ VGGYIFFRESCFHQ
Sbjct  133  WLLMYLSDKEVEKLVERMVKWVKVGGYIFFRESCFHQ  169



>ref|XP_010416170.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like [Camelina 
sativa]
Length=490

 Score =   265 bits (678),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 145/163 (89%), Gaps = 1/163 (1%)
 Frame = +2

Query  338  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  517
            MAA+ GEERE+QK+YW  HS  L+VEAMMLDSKAADLDKEERPE+LS+LP  EGK+VLE 
Sbjct  1    MAAY-GEEREIQKNYWKVHSVGLSVEAMMLDSKAADLDKEERPEILSLLPPIEGKTVLEF  59

Query  518  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  697
            GAGIGRFT ELAQKAGQ+IA+DFIESVIKKN+ INGH  N+KFMCADVTS D+ F ++S+
Sbjct  60   GAGIGRFTTELAQKAGQLIAVDFIESVIKKNKNINGHYRNVKFMCADVTSPDMKFPNDSM  119

Query  698  DLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            DLIFSNWLLMYLSD+EVE LA++M++W  VGGYIFFRESCFHQ
Sbjct  120  DLIFSNWLLMYLSDKEVEDLAKKMLQWTKVGGYIFFRESCFHQ  162



>ref|XP_010428286.1| PREDICTED: phosphoethanolamine N-methyltransferase 3 isoform 
X2 [Camelina sativa]
Length=492

 Score =   265 bits (678),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 145/163 (89%), Gaps = 1/163 (1%)
 Frame = +2

Query  338  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  517
            MAA+ GEERE+QK+YW  HS  L+VEAMMLDSKAADLDKEERPE+LS+LP  EGK+VLE 
Sbjct  3    MAAY-GEEREIQKNYWKVHSVGLSVEAMMLDSKAADLDKEERPEILSLLPPIEGKTVLEF  61

Query  518  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  697
            GAGIGRFT ELAQKAGQ+IA+DFIESVIKKN+ INGH  N+KFMCADVTS D+ F ++S+
Sbjct  62   GAGIGRFTTELAQKAGQLIAVDFIESVIKKNKYINGHYKNVKFMCADVTSPDMKFPNDSM  121

Query  698  DLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            DLIFSNWLLMYLSD+EVE LA++M++W  VGGYIFFRESCFHQ
Sbjct  122  DLIFSNWLLMYLSDKEVEDLAKKMLQWTKVGGYIFFRESCFHQ  164



>ref|XP_010921188.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X1 [Elaeis guineensis]
Length=537

 Score =   266 bits (680),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = +2

Query  356  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  535
            EER VQKS+W+EHS +L VEAMMLDS+A+DLDKEERPEVLS+LP Y+GKS+LELGAGIGR
Sbjct  48   EERTVQKSFWMEHSKDLNVEAMMLDSRASDLDKEERPEVLSLLPPYKGKSILELGAGIGR  107

Query  536  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  715
            FTGELA++AG V+A+DFIE VIKKNE++NGH  NI FMCADVTS DL    ES+DLIFSN
Sbjct  108  FTGELAKEAGHVLALDFIEDVIKKNESVNGHFKNISFMCADVTSPDLMIEAESVDLIFSN  167

Query  716  WLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            WLLMYLSD EVE LAERMVKW  VGGYIFFRESCFHQ
Sbjct  168  WLLMYLSDNEVEKLAERMVKWSKVGGYIFFRESCFHQ  204



>ref|XP_003534138.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Glycine 
max]
 gb|KHN43631.1| Phosphoethanolamine N-methyltransferase [Glycine soja]
Length=490

 Score =   265 bits (677),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 147/163 (90%), Gaps = 1/163 (1%)
 Frame = +2

Query  338  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  517
            MA  Q +ER VQKSYWIEH+++L+VE+MMLDS A+DLDKEERPEVLS+LP YEGKSV+EL
Sbjct  1    MAMVQ-DERCVQKSYWIEHTTDLSVESMMLDSNASDLDKEERPEVLSLLPPYEGKSVVEL  59

Query  518  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  697
            GAGIGRFT ELA+KAGQ++A+DFIES IKKNE+INGH  N+KFMCADVTS +L  S+ S+
Sbjct  60   GAGIGRFTVELAKKAGQLLAVDFIESAIKKNESINGHHKNVKFMCADVTSPNLYISEGSV  119

Query  698  DLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            DLIFSNWLLMYLSD+EVE+LA RM+KWL VGGY+FFRESCFHQ
Sbjct  120  DLIFSNWLLMYLSDKEVENLAARMIKWLKVGGYVFFRESCFHQ  162



>ref|XP_008799222.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X3 [Phoenix dactylifera]
Length=482

 Score =   265 bits (676),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 137/153 (90%), Gaps = 0/153 (0%)
 Frame = +2

Query  368  VQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGE  547
            VQKSYW+EHS +LTVEAMMLDS+A+DLDKEERPEVLS+LP Y+GKSVLELGAGIGRFTGE
Sbjct  2    VQKSYWMEHSKDLTVEAMMLDSRASDLDKEERPEVLSLLPPYKGKSVLELGAGIGRFTGE  61

Query  548  LAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLM  727
            LA++AG V+AMDFI++VIKKNE+INGH  N  FMC DVTS DL    ES+DLIFSNWLLM
Sbjct  62   LAKEAGHVLAMDFIKNVIKKNESINGHFKNTSFMCTDVTSPDLMIEAESVDLIFSNWLLM  121

Query  728  YLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            YLSD EVE LA+RMVKWL VGGYIFFRESCFHQ
Sbjct  122  YLSDNEVEGLAQRMVKWLKVGGYIFFRESCFHQ  154



>ref|XP_004241642.1| PREDICTED: phosphoethanolamine N-methyltransferase [Solanum lycopersicum]
Length=494

 Score =   265 bits (676),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 147/165 (89%), Gaps = 0/165 (0%)
 Frame = +2

Query  332  SAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVL  511
            +A+A   GEERE+QKSYW+E +SEL +EAMM DS A+DLDKE+RPEVLS+LP+YEGKSVL
Sbjct  2    AAIAPEVGEEREIQKSYWMEQTSELNLEAMMRDSAASDLDKEDRPEVLSLLPSYEGKSVL  61

Query  512  ELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDE  691
            ELGAGIGRFTG+LA+KAG+++A+DFIE V KKNE+INGH  N+KF+CADVTS DL    E
Sbjct  62   ELGAGIGRFTGDLAEKAGELVAVDFIEEVTKKNESINGHHKNVKFVCADVTSPDLTVLPE  121

Query  692  SIDLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            S+DLIFSNWLLMYLS++EV+ LAERM+KWL VGGYIFFRE+CFHQ
Sbjct  122  SVDLIFSNWLLMYLSNEEVQDLAERMIKWLKVGGYIFFRETCFHQ  166



>dbj|BAG50404.1| methyltransferase [Cardamine sp. SIM-2007]
Length=148

 Score =   253 bits (645),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +2

Query  392  HSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQV  571
            HS++LTVEAMMLDS+A+DLDKEERP VLS+LP+YEGKSVLELGAGIGRFT ELAQKAG++
Sbjct  1    HSADLTVEAMMLDSRASDLDKEERPGVLSLLPSYEGKSVLELGAGIGRFTSELAQKAGEL  60

Query  572  IAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQEVE  751
            IA+DFI+SVIKKNE+INGH  N+KFMCADVTS DL  +D S+DLIFSNWLLMYLSD+EVE
Sbjct  61   IALDFIDSVIKKNESINGHYKNVKFMCADVTSPDLKITDGSLDLIFSNWLLMYLSDKEVE  120

Query  752  SLAERMVKWLXVGGYIFFRESCFHQ  826
             LAERMV W+ VGGYIFFRESCFHQ
Sbjct  121  LLAERMVGWIKVGGYIFFRESCFHQ  145



>ref|XP_004969637.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Setaria 
italica]
Length=499

 Score =   264 bits (675),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = +2

Query  356  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  535
            EER+ Q+SYW EHS +LTVEAMMLDS+AA+LDKE+RPEVLS+LP+YEGKSVLELGAGIGR
Sbjct  16   EERKAQRSYWEEHSRDLTVEAMMLDSRAAELDKEDRPEVLSLLPSYEGKSVLELGAGIGR  75

Query  536  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  715
            FTGELA+ AG V A+DFIESVIKKNE+ NGH  N  FMCADVTS DL   + S+DLIFSN
Sbjct  76   FTGELAKTAGHVFALDFIESVIKKNESTNGHYKNTSFMCADVTSPDLIIEENSVDLIFSN  135

Query  716  WLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            WLLMYLSD+E++ LAERMVKWL VGGYIFFRESCFHQ
Sbjct  136  WLLMYLSDEEIDKLAERMVKWLKVGGYIFFRESCFHQ  172



>gb|KFK41794.1| hypothetical protein AALP_AA2G173000 [Arabis alpina]
Length=505

 Score =   265 bits (676),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 147/168 (88%), Gaps = 0/168 (0%)
 Frame = +2

Query  323  IVQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGK  502
            ++ S+     GEERE+QK+YW EHS++L+VE+MMLDS+AADLDKEERPE++++LP  EGK
Sbjct  10   MISSSFPKNLGEEREIQKNYWKEHSADLSVESMMLDSQAADLDKEERPEIVALLPPIEGK  69

Query  503  SVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNF  682
            +VLE GAGIGRFT ELA+KAG VIA+DFI++ IKKN+ INGH  N+KFMCADVTS D+ F
Sbjct  70   TVLEFGAGIGRFTTELARKAGHVIAVDFIDNAIKKNQNINGHYKNVKFMCADVTSPDMKF  129

Query  683  SDESIDLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            SDES+DLIFSNWLLMYLSD+EVE LA++M++W  VGGYIFFRESCFHQ
Sbjct  130  SDESMDLIFSNWLLMYLSDKEVEDLAKKMLQWTKVGGYIFFRESCFHQ  177



>ref|XP_004512744.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X1 [Cicer arietinum]
Length=497

 Score =   264 bits (675),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 145/164 (88%), Gaps = 0/164 (0%)
 Frame = +2

Query  335  AMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  514
            AM   + +EREVQ++YW EH + L+VE+MMLDS A+ LDKEERPEVLS+LPAYEGKS+LE
Sbjct  6    AMTQVEEDEREVQRNYWREHCANLSVESMMLDSNASHLDKEERPEVLSLLPAYEGKSILE  65

Query  515  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDES  694
            LGAGIGRFT ELA+KAGQ++A+DFIES IKKNE INGH  N+KFMCADVTS +L+ S+ S
Sbjct  66   LGAGIGRFTSELAKKAGQLLAVDFIESAIKKNENINGHHKNVKFMCADVTSPNLHISEGS  125

Query  695  IDLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            +DLIFSNWLLMYLSD+EVE+LAE+MVKWL V GYIFFRESCFHQ
Sbjct  126  VDLIFSNWLLMYLSDEEVENLAEKMVKWLKVDGYIFFRESCFHQ  169



>ref|XP_002887491.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63750.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=490

 Score =   264 bits (674),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  344  AFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGA  523
            A  GEERE+QK+YW EHS  L+VEAMMLDSKA+DLDKEERPE+L++LP  EGK+VLE GA
Sbjct  2    AVYGEEREIQKNYWKEHSVGLSVEAMMLDSKASDLDKEERPEILALLPPIEGKTVLEFGA  61

Query  524  GIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDL  703
            GIGRFT  LA KAGQ+IA+DFIESVIKKN+ INGH  N+KF+CADVTS D+NF +ES+DL
Sbjct  62   GIGRFTTNLAHKAGQLIAVDFIESVIKKNQNINGHYKNVKFLCADVTSPDMNFPNESMDL  121

Query  704  IFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            IFSNWLLMYLSD+EVE LA++M++W  VGGYIFFRESCFHQ
Sbjct  122  IFSNWLLMYLSDREVEDLAKKMLQWTKVGGYIFFRESCFHQ  162



>ref|NP_974139.2| putative phosphoethanolamine N-methyltransferase 3 [Arabidopsis 
thaliana]
 gb|AEE35480.1| putative phosphoethanolamine N-methyltransferase 3 [Arabidopsis 
thaliana]
Length=504

 Score =   264 bits (674),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/157 (78%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = +2

Query  356  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  535
            EERE+QK+YW EHS  L+VEAMMLDSKA+DLDKEERPE+L+ LP  EG +VLE GAGIGR
Sbjct  20   EEREIQKNYWKEHSVGLSVEAMMLDSKASDLDKEERPEILAFLPPIEGTTVLEFGAGIGR  79

Query  536  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  715
            FT ELAQKAGQVIA+DFIESVIKKNE INGH  N+KF+CADVTS ++NF +ES+DLIFSN
Sbjct  80   FTTELAQKAGQVIAVDFIESVIKKNENINGHYKNVKFLCADVTSPNMNFPNESMDLIFSN  139

Query  716  WLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            WLLMYLSDQEVE LA++M++W  VGGYIFFRESCFHQ
Sbjct  140  WLLMYLSDQEVEDLAKKMLQWTKVGGYIFFRESCFHQ  176



>ref|XP_006302164.1| hypothetical protein CARUB_v10020173mg [Capsella rubella]
 gb|EOA35062.1| hypothetical protein CARUB_v10020173mg [Capsella rubella]
Length=503

 Score =   263 bits (673),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/157 (77%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = +2

Query  356  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  535
            EERE+QK+YW EHS  L+VEAMMLDSKAADLDKEERPE+L++LP  EGK+VLE GAGIGR
Sbjct  19   EEREIQKNYWKEHSVGLSVEAMMLDSKAADLDKEERPEILALLPPIEGKTVLEFGAGIGR  78

Query  536  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  715
            FT ELAQKAGQ+IA+DFIESVIKKN+ INGH  N+KFMCADVTS D+ F ++S+DLIFSN
Sbjct  79   FTTELAQKAGQLIAVDFIESVIKKNKKINGHYKNVKFMCADVTSPDMKFPNDSVDLIFSN  138

Query  716  WLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            WLLMYLSD+EVE LA++M++W  VGGYIFFRESCFHQ
Sbjct  139  WLLMYLSDKEVEDLAKKMLQWTKVGGYIFFRESCFHQ  175



>dbj|BAC57432.1| phosphoethanolamine N-methyltransferase [Suaeda japonica]
Length=494

 Score =   262 bits (669),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = +2

Query  356  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  535
            +ER+V K YW+EH+ +LT+EAMMLDS+A+DLDKEERPE+LSMLP  EGK +LELGAGIGR
Sbjct  10   QERDVFKKYWVEHTVDLTIEAMMLDSQASDLDKEERPEILSMLPPLEGKCLLELGAGIGR  69

Query  536  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  715
            FTGELA+KAGQVIA+DFIES IKKNE INGH  N+KFMCADVTS  L+F   S+D+IFSN
Sbjct  70   FTGELAEKAGQVIALDFIESAIKKNEVINGHYKNVKFMCADVTSPTLSFPPHSLDVIFSN  129

Query  716  WLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            WLLMYLSD+EVE+L ERM+KWL  GGYIFFRESCFHQ
Sbjct  130  WLLMYLSDEEVENLVERMLKWLKPGGYIFFRESCFHQ  166



>ref|XP_004961340.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Setaria 
italica]
Length=498

 Score =   262 bits (669),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 144/165 (87%), Gaps = 1/165 (1%)
 Frame = +2

Query  335  AMAAFQGE-EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVL  511
            A+A   GE ER+VQKSYW EHS  LTVE+MMLDS+AADLDKEERPE+LS+LP+Y+GKSVL
Sbjct  7    AVANGIGEVERKVQKSYWEEHSKSLTVESMMLDSRAADLDKEERPEILSLLPSYKGKSVL  66

Query  512  ELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDE  691
            ELGAGIGRFTG+LA++AG V+A+DFIESVIKKNE+INGH  NI FMCADVTS +L   D 
Sbjct  67   ELGAGIGRFTGDLAKEAGHVLALDFIESVIKKNESINGHHKNITFMCADVTSPNLKIEDN  126

Query  692  SIDLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            S DLIFSNWLLMYLSD+EVE L  +MVKWL VGG+IFFRESCFHQ
Sbjct  127  SFDLIFSNWLLMYLSDEEVEKLVGKMVKWLKVGGHIFFRESCFHQ  171



>gb|AFW04224.1| phosphoethanolamine N-methyl transferase [Suaeda maritima]
Length=494

 Score =   262 bits (669),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = +2

Query  356  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  535
            +ER+V K YW+EH+ +LT+EAMMLDS+A+DLDKEERPE+LSMLP  EGK +LELGAGIGR
Sbjct  10   QERDVFKKYWVEHTVDLTIEAMMLDSQASDLDKEERPEILSMLPPLEGKCLLELGAGIGR  69

Query  536  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  715
            FTGELA+KAGQVIA+DFIES IKKNE INGH  N+KFMCADVTS  L+F   S+D+IFSN
Sbjct  70   FTGELAEKAGQVIALDFIESAIKKNEVINGHYKNVKFMCADVTSPTLSFPPHSLDVIFSN  129

Query  716  WLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            WLLMYLSD+EVE L ERM+KWL  GGYIFFRESCFHQ
Sbjct  130  WLLMYLSDEEVEDLVERMLKWLKPGGYIFFRESCFHQ  166



>ref|XP_006655550.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Oryza 
brachyantha]
Length=495

 Score =   262 bits (669),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 123/156 (79%), Positives = 137/156 (88%), Gaps = 0/156 (0%)
 Frame = +2

Query  359  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  538
            ER+ Q+SYW EHS  LTVEAMMLDS+AADLDKEERPE+LS+LP+Y+GKSVLELGAGIGRF
Sbjct  13   ERKAQRSYWEEHSKALTVEAMMLDSRAADLDKEERPEILSVLPSYKGKSVLELGAGIGRF  72

Query  539  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  718
            TGELA++AG V+A+DFIESVIKKNE  NGH  NI FMCADVTS DL   D SIDLIFSNW
Sbjct  73   TGELAKEAGHVLALDFIESVIKKNENTNGHHKNITFMCADVTSADLKIEDNSIDLIFSNW  132

Query  719  LLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            LLMYLSD+EV+ L  RMVKWL VGG+IFFRESCFHQ
Sbjct  133  LLMYLSDEEVKKLVGRMVKWLKVGGHIFFRESCFHQ  168



>dbj|BAE99185.1| putative phosphoethanolamine N-methyltransferase [Arabidopsis 
thaliana]
Length=504

 Score =   262 bits (669),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 121/157 (77%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = +2

Query  356  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  535
            EERE+QK+YW EHS  L+VEAMMLDSKA+DLDKEERPE+L+ LP  EG + LE GAGIGR
Sbjct  20   EEREIQKNYWKEHSVGLSVEAMMLDSKASDLDKEERPEILAFLPPIEGTTALEFGAGIGR  79

Query  536  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  715
            FT ELAQKAGQVIA+DFIESVIKKNE INGH  N+KF+CADVTS ++NF +ES+DLIFSN
Sbjct  80   FTTELAQKAGQVIAVDFIESVIKKNENINGHYKNVKFLCADVTSPNMNFPNESMDLIFSN  139

Query  716  WLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            WLLMYLSDQEVE LA++M++W  VGGYIFFRESCFHQ
Sbjct  140  WLLMYLSDQEVEDLAKKMLQWAKVGGYIFFRESCFHQ  176



>gb|ABK42071.1| phosphoethanolamine N-methyltransferase [Suaeda liaotungensis]
Length=494

 Score =   261 bits (668),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = +2

Query  356  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  535
            +ER+V K YW+EH+ +LT+EAMMLDS+A+DLDKEERPE+LSMLP  EGK +LELGAGIGR
Sbjct  10   QERDVFKKYWVEHTVDLTIEAMMLDSQASDLDKEERPEILSMLPPLEGKCLLELGAGIGR  69

Query  536  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  715
            FTGELA+KAGQVIA+DFIES IKKNE INGH  N+KFMCADVTS  L+F   S+D+IFSN
Sbjct  70   FTGELAEKAGQVIALDFIESAIKKNEVINGHYKNVKFMCADVTSPTLSFPPHSLDVIFSN  129

Query  716  WLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            WLLMYLSD+EVE L ERM+KWL  GGYIFFRESCFHQ
Sbjct  130  WLLMYLSDEEVEDLVERMLKWLKPGGYIFFRESCFHQ  166



>ref|XP_010471422.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Camelina sativa]
Length=490

 Score =   261 bits (668),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 144/163 (88%), Gaps = 1/163 (1%)
 Frame = +2

Query  338  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  517
            MAA+  EERE+QK+YW  HS  L+VEAMMLDSKAADLDKEERPE+LS+LP  EGK+VLE 
Sbjct  1    MAAYV-EEREIQKNYWKVHSVGLSVEAMMLDSKAADLDKEERPEILSLLPPIEGKTVLEF  59

Query  518  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  697
            GAGIGRFT ELAQKAGQ+IA+DFIESVIKKN+ INGH  N+KFMCADVTS D+ F ++S+
Sbjct  60   GAGIGRFTTELAQKAGQLIAVDFIESVIKKNKNINGHYKNVKFMCADVTSPDMKFPNDSM  119

Query  698  DLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            DLIFSNWLLMYLSD+EVE L+++M++W  VGGYIFFRESCFHQ
Sbjct  120  DLIFSNWLLMYLSDKEVEDLSKKMLQWTKVGGYIFFRESCFHQ  162



>ref|XP_004512745.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X2 [Cicer arietinum]
Length=496

 Score =   261 bits (668),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 121/157 (77%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = +2

Query  356  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  535
            +EREVQ++YW EH + L+VE+MMLDS A+ LDKEERPEVLS+LPAYEGKS+LELGAGIGR
Sbjct  12   DEREVQRNYWREHCANLSVESMMLDSNASHLDKEERPEVLSLLPAYEGKSILELGAGIGR  71

Query  536  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  715
            FT ELA+KAGQ++A+DFIES IKKNE INGH  N+KFMCADVTS +L+ S+ S+DLIFSN
Sbjct  72   FTSELAKKAGQLLAVDFIESAIKKNENINGHHKNVKFMCADVTSPNLHISEGSVDLIFSN  131

Query  716  WLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            WLLMYLSD+EVE+LAE+MVKWL V GYIFFRESCFHQ
Sbjct  132  WLLMYLSDEEVENLAEKMVKWLKVDGYIFFRESCFHQ  168



>ref|XP_010428285.1| PREDICTED: phosphoethanolamine N-methyltransferase 3 isoform 
X1 [Camelina sativa]
Length=504

 Score =   261 bits (666),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/157 (77%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = +2

Query  356  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  535
            EERE+QK+YW  HS  L+VEAMMLDSKAADLDKEERPE+LS+LP  EGK+VLE GAGIGR
Sbjct  20   EEREIQKNYWKVHSVGLSVEAMMLDSKAADLDKEERPEILSLLPPIEGKTVLEFGAGIGR  79

Query  536  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  715
            FT ELAQKAGQ+IA+DFIESVIKKN+ INGH  N+KFMCADVTS D+ F ++S+DLIFSN
Sbjct  80   FTTELAQKAGQLIAVDFIESVIKKNKYINGHYKNVKFMCADVTSPDMKFPNDSMDLIFSN  139

Query  716  WLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            WLLMYLSD+EVE LA++M++W  VGGYIFFRESCFHQ
Sbjct  140  WLLMYLSDKEVEDLAKKMLQWTKVGGYIFFRESCFHQ  176



>ref|XP_006393388.1| hypothetical protein EUTSA_v10012068mg, partial [Eutrema salsugineum]
 gb|ESQ30674.1| hypothetical protein EUTSA_v10012068mg, partial [Eutrema salsugineum]
Length=258

 Score =   253 bits (645),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/163 (73%), Positives = 138/163 (85%), Gaps = 0/163 (0%)
 Frame = +2

Query  338  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  517
            MA    EER +QKSY  E+SS+LTVEA+MLDSK +D DKEERPEVLS++P YEGK+VLEL
Sbjct  1    MATPYKEERVIQKSYLKENSSDLTVEAIMLDSKDSDPDKEERPEVLSLIPPYEGKTVLEL  60

Query  518  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  697
            GAGIG FTGELAQKAG+VIA+DFIES IKKN ++NGH  N+KFMCADV S DL  +D SI
Sbjct  61   GAGIGHFTGELAQKAGEVIALDFIESAIKKNASVNGHYKNVKFMCADVRSPDLKITDASI  120

Query  698  DLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            DLIFSNWLLMYLSD+EVE  ++RM+ W+  GGYIFFRESCFHQ
Sbjct  121  DLIFSNWLLMYLSDKEVELFSKRMLGWIKPGGYIFFRESCFHQ  163



>ref|XP_010471421.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Camelina sativa]
Length=504

 Score =   260 bits (665),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = +2

Query  356  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  535
            EERE+QK+YW  HS  L+VEAMMLDSKAADLDKEERPE+LS+LP  EGK+VLE GAGIGR
Sbjct  20   EEREIQKNYWKVHSVGLSVEAMMLDSKAADLDKEERPEILSLLPPIEGKTVLEFGAGIGR  79

Query  536  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  715
            FT ELAQKAGQ+IA+DFIESVIKKN+ INGH  N+KFMCADVTS D+ F ++S+DLIFSN
Sbjct  80   FTTELAQKAGQLIAVDFIESVIKKNKNINGHYKNVKFMCADVTSPDMKFPNDSMDLIFSN  139

Query  716  WLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            WLLMYLSD+EVE L+++M++W  VGGYIFFRESCFHQ
Sbjct  140  WLLMYLSDKEVEDLSKKMLQWTKVGGYIFFRESCFHQ  176



>ref|XP_003567962.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X1 [Brachypodium distachyon]
Length=501

 Score =   260 bits (664),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 144/170 (85%), Gaps = 1/170 (1%)
 Frame = +2

Query  320  AIVQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEG  499
            A++      F G ER+VQKSYW EHS +LTVE+MMLDS+A DLDKEERPEVLS+LP+YEG
Sbjct  5    AVIAVVENGFVGVERKVQKSYWEEHSRDLTVESMMLDSRAKDLDKEERPEVLSILPSYEG  64

Query  500  KSVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHL-GNIKFMCADVTSKDL  676
            K+VLELGAGIGRFTGELA++AG V+A+DFI+SVIKKNE INGH+  NI FMCADVTS +L
Sbjct  65   KTVLELGAGIGRFTGELAKEAGHVLALDFIDSVIKKNEEINGHIHNNITFMCADVTSPEL  124

Query  677  NFSDESIDLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
               D SIDL+FSNWLLMYLSD+EVE L  R+VKWL VGG+IF RESCFHQ
Sbjct  125  KIEDNSIDLVFSNWLLMYLSDEEVEKLIGRIVKWLKVGGHIFIRESCFHQ  174



>ref|XP_002441466.1| hypothetical protein SORBIDRAFT_09g027360 [Sorghum bicolor]
 gb|EES19896.1| hypothetical protein SORBIDRAFT_09g027360 [Sorghum bicolor]
Length=510

 Score =   259 bits (663),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  359  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  538
            ER+VQKSYW EHS +LTVE+MMLDS+AADLDKEERPE+LS+LP+Y+GKSVLELGAGIGRF
Sbjct  28   ERKVQKSYWEEHSKDLTVESMMLDSRAADLDKEERPEILSLLPSYKGKSVLELGAGIGRF  87

Query  539  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  718
            TG+LA++AG V+A+DFIESVIKKN++INGH  NI F CADVTS +L   D S+DLIFSNW
Sbjct  88   TGDLAKEAGHVLALDFIESVIKKNQSINGHHKNITFKCADVTSPELKIEDNSVDLIFSNW  147

Query  719  LLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            LLMYLSD+EVE L  +MVKWL VGG+IFFRESCFHQ
Sbjct  148  LLMYLSDEEVEKLVGKMVKWLKVGGHIFFRESCFHQ  183



>ref|NP_001169597.1| uncharacterized LOC100383478 [Zea mays]
 gb|ABF83429.1| S-adenosyl-L-methionine: phosphoethanolamine N-methyltransferase 
[Zea mays]
 gb|ACN34220.1| unknown [Zea mays]
 gb|AFW78993.1| S-adenosyl-L-methionine: phosphoethanolamine N-methyltransferase 
[Zea mays]
Length=501

 Score =   259 bits (661),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 144/165 (87%), Gaps = 1/165 (1%)
 Frame = +2

Query  335  AMAAFQGE-EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVL  511
            A+A   GE ER+VQKSYW EHS  LTVE+MMLDS+AADLDKEERPE+LS+LP+Y+GKSVL
Sbjct  10   AVANGIGEVERKVQKSYWEEHSKCLTVESMMLDSRAADLDKEERPEILSLLPSYKGKSVL  69

Query  512  ELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDE  691
            ELGAGIGRFTG+LA++AG V+A+DFIESVIKKN++INGH  NI F CADVTS DL   D 
Sbjct  70   ELGAGIGRFTGDLAKEAGHVLALDFIESVIKKNQSINGHHKNITFRCADVTSNDLKIEDN  129

Query  692  SIDLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            S+DLIFSNWLLMYLSD+EV+ L  +MVKWL VGG+IFFRESCFHQ
Sbjct  130  SVDLIFSNWLLMYLSDEEVQKLVGKMVKWLKVGGHIFFRESCFHQ  174



>ref|XP_003619836.1| Phosphoethanolamine N-methyltransferase [Medicago truncatula]
 gb|AES76054.1| phosphoethanolamine N-methyltransferase [Medicago truncatula]
Length=497

 Score =   258 bits (659),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 141/164 (86%), Gaps = 0/164 (0%)
 Frame = +2

Query  335  AMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  514
            AM     +EREVQ+SYW EH   L+VE+MMLDS A+ LDKEERPEVLS+LP+YEGKSVLE
Sbjct  6    AMKQGGEDEREVQRSYWKEHCVNLSVESMMLDSNASHLDKEERPEVLSLLPSYEGKSVLE  65

Query  515  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDES  694
            LGAGIGRFT ELAQKAGQ++A+DFIES IKKNE  NGH  N+KFMCADVTS +L+ S+ S
Sbjct  66   LGAGIGRFTAELAQKAGQLLAVDFIESAIKKNENTNGHHKNVKFMCADVTSPNLHISEGS  125

Query  695  IDLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            +DLIFSNWLLMYLSD+EV++LAERMVKWL V G IFFRESCFHQ
Sbjct  126  VDLIFSNWLLMYLSDEEVKNLAERMVKWLNVNGCIFFRESCFHQ  169



>ref|NP_175293.1| phosphoethanolamine N-methyltransferase 2 [Arabidopsis thaliana]
 gb|AAL16223.1|AF428454_1 At1g48600/T1N15_20 [Arabidopsis thaliana]
 gb|AAL36222.1| putative phosphoethanolamine N-methyltransferase [Arabidopsis 
thaliana]
 gb|AAM91745.1| putative phosphoethanolamine N-methyltransferase [Arabidopsis 
thaliana]
 gb|AEE32324.1| putative phosphoethanolamine N-methyltransferase 2 [Arabidopsis 
thaliana]
Length=475

 Score =   256 bits (655),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = +2

Query  386  IEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAG  565
            +EHSS+LTVEAMMLDSKA+DLDKEERPEVLS++P YEGKSVLELGAGIGRFTGELAQKAG
Sbjct  1    MEHSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKSVLELGAGIGRFTGELAQKAG  60

Query  566  QVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQE  745
            +VIA+DFIES I+KNE++NGH  NIKFMCADVTS DL   D SIDLIFSNWLLMYLSD+E
Sbjct  61   EVIALDFIESAIQKNESVNGHYKNIKFMCADVTSPDLKIKDGSIDLIFSNWLLMYLSDKE  120

Query  746  VESLAERMVKWLXVGGYIFFRESCFHQ  826
            VE +AERM+ W+  GGYIFFRESCFHQ
Sbjct  121  VELMAERMIGWVKPGGYIFFRESCFHQ  147



>ref|XP_002456193.1| hypothetical protein SORBIDRAFT_03g031940 [Sorghum bicolor]
 gb|EES01313.1| hypothetical protein SORBIDRAFT_03g031940 [Sorghum bicolor]
Length=499

 Score =   256 bits (655),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 135/156 (87%), Gaps = 0/156 (0%)
 Frame = +2

Query  359  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  538
            ER+ Q+SYW EHS ELT+EAMMLDS+AA+LDKEERPEVLS+LP+YEGKSVLELGAGIGRF
Sbjct  17   ERKAQRSYWEEHSGELTLEAMMLDSRAAELDKEERPEVLSLLPSYEGKSVLELGAGIGRF  76

Query  539  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  718
            TGELA+ +G V A+DFIES IKKNE+ NGH  N  FMCADVTS +L     SIDLIFSNW
Sbjct  77   TGELAKTSGHVFAVDFIESAIKKNESTNGHYDNTSFMCADVTSPNLMIEANSIDLIFSNW  136

Query  719  LLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            LLMYLSD+E++ L ERMVKWL VGGYIFFRESCFHQ
Sbjct  137  LLMYLSDEEIDKLVERMVKWLKVGGYIFFRESCFHQ  172



>ref|XP_008675146.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X3 [Zea mays]
Length=483

 Score =   256 bits (653),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 138/167 (83%), Gaps = 0/167 (0%)
 Frame = +2

Query  326  VQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKS  505
            V  ++      ER+ QKSYW EHS EL +EA+MLDS+AA+LDKEERPEVLS+LP+YEGKS
Sbjct  8    VNGSLDRLDVHERKAQKSYWEEHSGELNLEAIMLDSRAAELDKEERPEVLSLLPSYEGKS  67

Query  506  VLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFS  685
            +LELGAGIGRFTGELA+ +G V A+DF+ESVIKKN +IN H GN  FMCADVTS DL   
Sbjct  68   ILELGAGIGRFTGELAKTSGHVFAVDFVESVIKKNGSINDHYGNTSFMCADVTSTDLMIE  127

Query  686  DESIDLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
              SIDLIFSNWLLMYLSD+E++ L ERMVKWL VGGYIFFRESCFHQ
Sbjct  128  ANSIDLIFSNWLLMYLSDEEIDKLVERMVKWLKVGGYIFFRESCFHQ  174



>ref|XP_007160542.1| hypothetical protein PHAVU_002G330400g [Phaseolus vulgaris]
 gb|ESW32536.1| hypothetical protein PHAVU_002G330400g [Phaseolus vulgaris]
Length=496

 Score =   256 bits (654),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 142/158 (90%), Gaps = 2/158 (1%)
 Frame = +2

Query  359  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  538
            ER++QK YW++HS++L+VEAMMLDSKAA LDKEERPEVLS+LP  EGKSV+ELGAGIGRF
Sbjct  11   ERDMQKLYWVQHSADLSVEAMMLDSKAAHLDKEERPEVLSLLPPCEGKSVIELGAGIGRF  70

Query  539  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDL--NFSDESIDLIFS  712
            TGELAQKAGQ++A+DFIES IKKNE+INGH  N+KF+CADVTS ++  + S+ S+D+IFS
Sbjct  71   TGELAQKAGQLLAVDFIESAIKKNESINGHHKNVKFLCADVTSPNMSSSVSEGSVDVIFS  130

Query  713  NWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            NWLLMYLSD EVE LAERM+KWL  GGYIFFRESCFHQ
Sbjct  131  NWLLMYLSDNEVEKLAERMIKWLKDGGYIFFRESCFHQ  168



>emb|CDY40594.1| BnaC06g02100D [Brassica napus]
Length=473

 Score =   255 bits (652),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = +2

Query  386  IEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAG  565
            +EHSS+LTVEAMMLDSKA+DLDKEERPEVLS++P YEGK VLELGAGIGRFTGELAQKAG
Sbjct  1    MEHSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKKVLELGAGIGRFTGELAQKAG  60

Query  566  QVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQE  745
            +VIA+DFIES IKKNE++NGH  N+KFMCADVTS DL   D S+DLIFSNWLLMYLSD+E
Sbjct  61   EVIALDFIESAIKKNESVNGHYKNVKFMCADVTSPDLKIEDGSVDLIFSNWLLMYLSDKE  120

Query  746  VESLAERMVKWLXVGGYIFFRESCFHQ  826
            VE LAERM+ W+  GGYIFFRESCFHQ
Sbjct  121  VELLAERMLGWVKPGGYIFFRESCFHQ  147



>emb|CDX93681.1| BnaA06g03670D [Brassica napus]
Length=473

 Score =   255 bits (651),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = +2

Query  386  IEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAG  565
            +EHSS+LTVEAMMLDSKA+DLDKEERPEVLS++P YEGK VLELGAGIGRFTGELAQKAG
Sbjct  1    MEHSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKKVLELGAGIGRFTGELAQKAG  60

Query  566  QVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQE  745
            +VIA+DFIES IKKNE++NGH  N+KFMCADVTS DL   D S+DLIFSNWLLMYLSD+E
Sbjct  61   EVIALDFIESAIKKNESVNGHYKNVKFMCADVTSPDLKIEDGSVDLIFSNWLLMYLSDKE  120

Query  746  VESLAERMVKWLXVGGYIFFRESCFHQ  826
            VE LAERM+ W+  GGYIFFRESCFHQ
Sbjct  121  VELLAERMLGWVKPGGYIFFRESCFHQ  147



>ref|XP_010461685.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Camelina sativa]
 ref|XP_010461686.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Camelina sativa]
Length=234

 Score =   247 bits (631),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 134/148 (91%), Gaps = 1/148 (1%)
 Frame = +2

Query  386  IEHSSELTVEAMMLDSKAADLDKEERPE-VLSMLPAYEGKSVLELGAGIGRFTGELAQKA  562
            +EHSS+LTVEAMMLDSKA+DLDKEERPE VLS++P YEGKSVLELGAGIGRFT ELAQKA
Sbjct  1    MEHSSDLTVEAMMLDSKASDLDKEERPEEVLSLVPPYEGKSVLELGAGIGRFTVELAQKA  60

Query  563  GQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQ  742
            G+VIA+DFIES I+KNE+INGH   +KFMCADVTS DL  +D SIDLIFSNWLLMYLSD+
Sbjct  61   GEVIAVDFIESDIQKNESINGHYKKVKFMCADVTSPDLKIADGSIDLIFSNWLLMYLSDK  120

Query  743  EVESLAERMVKWLXVGGYIFFRESCFHQ  826
            EVE +AERM+KW+  GGYIFFRESCFHQ
Sbjct  121  EVELMAERMLKWVKPGGYIFFRESCFHQ  148



>ref|XP_006393387.1| hypothetical protein EUTSA_v10011451mg [Eutrema salsugineum]
 gb|ESQ30673.1| hypothetical protein EUTSA_v10011451mg [Eutrema salsugineum]
Length=475

 Score =   255 bits (652),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = +2

Query  386  IEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAG  565
            +E+SS+LTVEAMMLDSKA+DLDKEERPEVLS++P YEGK+VLELGAGIGRFTGELAQKAG
Sbjct  1    MENSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKTVLELGAGIGRFTGELAQKAG  60

Query  566  QVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQE  745
            +VIA+DFIES IKKNE++NGH  N+KFMCADVTS+DL  +D SIDLIFSNWLLMYLSD+E
Sbjct  61   EVIALDFIESAIKKNESVNGHYKNVKFMCADVTSQDLKITDGSIDLIFSNWLLMYLSDKE  120

Query  746  VESLAERMVKWLXVGGYIFFRESCFHQ  826
            VE LAERM+ W+  GGYIFFRESCFHQ
Sbjct  121  VELLAERMLGWIKPGGYIFFRESCFHQ  147



>ref|XP_008675144.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X1 [Zea mays]
 ref|XP_008675145.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X2 [Zea mays]
Length=501

 Score =   256 bits (653),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 138/167 (83%), Gaps = 0/167 (0%)
 Frame = +2

Query  326  VQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKS  505
            V  ++      ER+ QKSYW EHS EL +EA+MLDS+AA+LDKEERPEVLS+LP+YEGKS
Sbjct  8    VNGSLDRLDVHERKAQKSYWEEHSGELNLEAIMLDSRAAELDKEERPEVLSLLPSYEGKS  67

Query  506  VLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFS  685
            +LELGAGIGRFTGELA+ +G V A+DF+ESVIKKN +IN H GN  FMCADVTS DL   
Sbjct  68   ILELGAGIGRFTGELAKTSGHVFAVDFVESVIKKNGSINDHYGNTSFMCADVTSTDLMIE  127

Query  686  DESIDLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
              SIDLIFSNWLLMYLSD+E++ L ERMVKWL VGGYIFFRESCFHQ
Sbjct  128  ANSIDLIFSNWLLMYLSDEEIDKLVERMVKWLKVGGYIFFRESCFHQ  174



>ref|XP_007160543.1| hypothetical protein PHAVU_002G330400g [Phaseolus vulgaris]
 gb|ESW32537.1| hypothetical protein PHAVU_002G330400g [Phaseolus vulgaris]
Length=517

 Score =   256 bits (654),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 142/158 (90%), Gaps = 2/158 (1%)
 Frame = +2

Query  359  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  538
            ER++QK YW++HS++L+VEAMMLDSKAA LDKEERPEVLS+LP  EGKSV+ELGAGIGRF
Sbjct  11   ERDMQKLYWVQHSADLSVEAMMLDSKAAHLDKEERPEVLSLLPPCEGKSVIELGAGIGRF  70

Query  539  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDL--NFSDESIDLIFS  712
            TGELAQKAGQ++A+DFIES IKKNE+INGH  N+KF+CADVTS ++  + S+ S+D+IFS
Sbjct  71   TGELAQKAGQLLAVDFIESAIKKNESINGHHKNVKFLCADVTSPNMSSSVSEGSVDVIFS  130

Query  713  NWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            NWLLMYLSD EVE LAERM+KWL  GGYIFFRESCFHQ
Sbjct  131  NWLLMYLSDNEVEKLAERMIKWLKDGGYIFFRESCFHQ  168



>ref|XP_003525185.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Glycine 
max]
Length=488

 Score =   255 bits (652),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 143/159 (90%), Gaps = 2/159 (1%)
 Frame = +2

Query  356  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  535
            +ER +QKSYW++HS++L+VEAMMLDSKAA LDKEERPEVLS+LP +EGKSV+ELGAGIGR
Sbjct  2    DERHIQKSYWLQHSADLSVEAMMLDSKAAHLDKEERPEVLSLLPPFEGKSVIELGAGIGR  61

Query  536  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDL--NFSDESIDLIF  709
            FTGELA KAGQ++A+DFI++ IKKNETINGH  ++KF+CADVTS ++  N S+ S+D++F
Sbjct  62   FTGELALKAGQLLAVDFIDTAIKKNETINGHHNHVKFLCADVTSPNMSNNVSEGSVDVVF  121

Query  710  SNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            SNWLLMYLSD EVE LAERMV+WL  GGYIFFRESCFHQ
Sbjct  122  SNWLLMYLSDIEVEKLAERMVRWLKDGGYIFFRESCFHQ  160



>gb|AAV67950.1| putative phosphoethanolamine N-methyltransferase [Zea mays]
Length=495

 Score =   255 bits (652),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 135/156 (87%), Gaps = 0/156 (0%)
 Frame = +2

Query  359  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  538
            ER+ QKSYW EHS EL +EA+MLDS+AA+LDKEERPEVLS+LP+YEGKS+LELGAGIGRF
Sbjct  13   ERKAQKSYWEEHSGELNLEAIMLDSRAAELDKEERPEVLSLLPSYEGKSILELGAGIGRF  72

Query  539  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  718
            TGELA+ +G V A+DF+ESVIKKN +IN H GN  FMCADVTS DL     SIDLIFSNW
Sbjct  73   TGELAKTSGHVFAVDFVESVIKKNGSINDHYGNTSFMCADVTSPDLMIEANSIDLIFSNW  132

Query  719  LLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            LLMYLSD+E++ L ERMVKWL VGGYIFFRESCFHQ
Sbjct  133  LLMYLSDEEIDKLVERMVKWLKVGGYIFFRESCFHQ  168



>tpg|DAA57997.1| TPA: putative phosphoethanolamine N-methyltransferase [Zea mays]
Length=498

 Score =   255 bits (652),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 135/156 (87%), Gaps = 0/156 (0%)
 Frame = +2

Query  359  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  538
            ER+ QKSYW EHS EL +EA+MLDS+AA+LDKEERPEVLS+LP+YEGKS+LELGAGIGRF
Sbjct  16   ERKAQKSYWEEHSGELNLEAIMLDSRAAELDKEERPEVLSLLPSYEGKSILELGAGIGRF  75

Query  539  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  718
            TGELA+ +G V A+DF+ESVIKKN +IN H GN  FMCADVTS DL     SIDLIFSNW
Sbjct  76   TGELAKTSGHVFAVDFVESVIKKNGSINDHYGNTSFMCADVTSTDLMIEANSIDLIFSNW  135

Query  719  LLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            LLMYLSD+E++ L ERMVKWL VGGYIFFRESCFHQ
Sbjct  136  LLMYLSDEEIDKLVERMVKWLKVGGYIFFRESCFHQ  171



>gb|ABG57185.1| phosphoethanolamine N-methyltransferase [Salicornia europaea]
Length=494

 Score =   255 bits (651),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = +2

Query  356  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  535
            EER V K YW+EH+++LTVE+MMLDS+A+DLDKEERPE+LS+LP  EGK VLELGAGIGR
Sbjct  10   EERNVFKKYWVEHTTDLTVESMMLDSQASDLDKEERPEILSLLPNLEGKCVLELGAGIGR  69

Query  536  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  715
            FTGELA+KAGQVIA+DFI+  IKKNE I+GH  N+KFMCADVTS  LNF   S+D+IFSN
Sbjct  70   FTGELAEKAGQVIALDFIDKAIKKNEYIDGHYKNVKFMCADVTSPTLNFPPNSLDVIFSN  129

Query  716  WLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            WLLMYLSD+EVE L ERM+KWL  GG IFFRESCFHQ
Sbjct  130  WLLMYLSDEEVEHLVERMLKWLKPGGNIFFRESCFHQ  166



>gb|AFZ78648.1| methyl transferase [Populus tomentosa]
Length=485

 Score =   251 bits (642),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = +2

Query  386  IEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAG  565
            ++++S+L+V AMMLDSKA++LDKEERPE+LS+LP YEGK+VLELGAGIGRFTGELAQKAG
Sbjct  1    MDNTSDLSVNAMMLDSKASELDKEERPEILSLLPPYEGKTVLELGAGIGRFTGELAQKAG  60

Query  566  QVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQE  745
            QV+A+DFIES IKKNE INGH  N+KFMCADVTS DLN S+ S+DLIFSNWLLMYLSD+E
Sbjct  61   QVVALDFIESAIKKNENINGHYKNVKFMCADVTSPDLNISEGSVDLIFSNWLLMYLSDKE  120

Query  746  VESLAERMVKWLXVGGYIFFRESCFHQ  826
            VE+L ERMVKW+ V GYIFFRESCFHQ
Sbjct  121  VENLVERMVKWVKVDGYIFFRESCFHQ  147



>ref|XP_010500398.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Camelina sativa]
Length=474

 Score =   249 bits (636),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 135/148 (91%), Gaps = 1/148 (1%)
 Frame = +2

Query  386  IEHSSELTVEAMMLDSKAADLDKEERPE-VLSMLPAYEGKSVLELGAGIGRFTGELAQKA  562
            +EHSS+LTVEAMMLDSKA+DLDKEERPE VLS++P YEGKSVLELGAGIGRFTGELAQKA
Sbjct  1    MEHSSDLTVEAMMLDSKASDLDKEERPEEVLSLIPPYEGKSVLELGAGIGRFTGELAQKA  60

Query  563  GQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQ  742
            G+VIA+DFIES I+KNE++NG   N+KF+CADVTS DL  +D SIDLIFSNWLLMYLSD+
Sbjct  61   GEVIALDFIESAIQKNESVNGQYKNVKFICADVTSPDLKIADGSIDLIFSNWLLMYLSDK  120

Query  743  EVESLAERMVKWLXVGGYIFFRESCFHQ  826
            EVE +AERM+KW+  GGYIFFRESCFHQ
Sbjct  121  EVELMAERMLKWVKPGGYIFFRESCFHQ  148



>ref|XP_010921205.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X3 [Elaeis guineensis]
 ref|XP_010921212.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X3 [Elaeis guineensis]
 ref|XP_010921222.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X3 [Elaeis guineensis]
 ref|XP_010921230.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X3 [Elaeis guineensis]
 ref|XP_010921238.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X3 [Elaeis guineensis]
Length=480

 Score =   249 bits (636),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = +2

Query  386  IEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAG  565
            +EHS +L VEAMMLDS+A+DLDKEERPEVLS+LP Y+GKS+LELGAGIGRFTGELA++AG
Sbjct  1    MEHSKDLNVEAMMLDSRASDLDKEERPEVLSLLPPYKGKSILELGAGIGRFTGELAKEAG  60

Query  566  QVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQE  745
             V+A+DFIE VIKKNE++NGH  NI FMCADVTS DL    ES+DLIFSNWLLMYLSD E
Sbjct  61   HVLALDFIEDVIKKNESVNGHFKNISFMCADVTSPDLMIEAESVDLIFSNWLLMYLSDNE  120

Query  746  VESLAERMVKWLXVGGYIFFRESCFHQ  826
            VE LAERMVKW  VGGYIFFRESCFHQ
Sbjct  121  VEKLAERMVKWSKVGGYIFFRESCFHQ  147



>ref|XP_002284594.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Vitis vinifera]
Length=490

 Score =   245 bits (626),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  353  GEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIG  532
            GEER+VQKSYW+EHS+ELTVEAMMLDS+A+DLDKEERPE+LS+LP  EGK V+ELGAGIG
Sbjct  5    GEERDVQKSYWMEHSAELTVEAMMLDSQASDLDKEERPELLSLLPPLEGKYVVELGAGIG  64

Query  533  RFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFS  712
            RFTGELA++AGQV+A+DFIESVI++NE ING   N KF+CADVTS DL+ S  S+DLIFS
Sbjct  65   RFTGELAKQAGQVLAIDFIESVIRENEVINGRFKNTKFVCADVTSPDLDISPGSVDLIFS  124

Query  713  NWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            NWLLMYLSD+EVE LAERMVKWL VGG++FFRESCFHQ
Sbjct  125  NWLLMYLSDKEVEDLAERMVKWLKVGGFLFFRESCFHQ  162



>emb|CDX92181.1| BnaA05g22260D [Brassica napus]
Length=464

 Score =   243 bits (621),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 126/136 (93%), Gaps = 0/136 (0%)
 Frame = +2

Query  419  MMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFIESV  598
            MMLDS+AADLDKEERPEVLS+LP YEGKSVLELGAGIGRFTGELAQKAG++IA+DFI+SV
Sbjct  1    MMLDSRAADLDKEERPEVLSLLPPYEGKSVLELGAGIGRFTGELAQKAGELIALDFIDSV  60

Query  599  IKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQEVESLAERMVKW  778
            IKKN+++NGH  N+KFMCADVTS DLN +D SIDLIFSNWLLMYLSD+EVE L ERMV W
Sbjct  61   IKKNKSVNGHYKNVKFMCADVTSPDLNITDGSIDLIFSNWLLMYLSDKEVELLVERMVGW  120

Query  779  LXVGGYIFFRESCFHQ  826
            + VGGYIFFRESCFHQ
Sbjct  121  IKVGGYIFFRESCFHQ  136



>gb|AAL40895.1| phosphoethanolamine methyltransferase [Triticum aestivum]
Length=498

 Score =   244 bits (622),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 136/157 (87%), Gaps = 1/157 (1%)
 Frame = +2

Query  359  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  538
            ER+VQKSYW EHS +LTVE+MMLDS+A DLDKEERPEVL++LP+Y GK+VLELGAGIGRF
Sbjct  15   ERKVQKSYWEEHSKDLTVESMMLDSRAKDLDKEERPEVLAILPSYAGKTVLELGAGIGRF  74

Query  539  TGELAQKAGQVIAMDFIESVIKKNETINGHL-GNIKFMCADVTSKDLNFSDESIDLIFSN  715
            TGELA++AG VIA+DFI+SVIKKNE ING +  NI FMCADVTS +L   D S+D++FSN
Sbjct  75   TGELAKEAGHVIALDFIDSVIKKNEEINGDIYKNITFMCADVTSPELKIEDNSVDIVFSN  134

Query  716  WLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            WLLMYL+D+EVE L  R+VKWL  GG+IF RESCFHQ
Sbjct  135  WLLMYLNDEEVEKLIGRIVKWLKPGGHIFIRESCFHQ  171



>gb|KJB30120.1| hypothetical protein B456_005G132000 [Gossypium raimondii]
Length=465

 Score =   242 bits (618),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 111/136 (82%), Positives = 128/136 (94%), Gaps = 0/136 (0%)
 Frame = +2

Query  419  MMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFIESV  598
            MMLDSKAAD+DKEERPEVLS+LP YEGK++LELGAGIGRFTG+LA+KAG VIA+DFIE+V
Sbjct  1    MMLDSKAADIDKEERPEVLSLLPPYEGKTILELGAGIGRFTGDLAKKAGHVIALDFIENV  60

Query  599  IKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQEVESLAERMVKW  778
            IKKNETINGH  N+KF+CADVTS DL F++ S+DLIFSNWLLMYLSD+EVE+LAERM+KW
Sbjct  61   IKKNETINGHYKNVKFLCADVTSPDLAFTEGSLDLIFSNWLLMYLSDKEVENLAERMLKW  120

Query  779  LXVGGYIFFRESCFHQ  826
            L VGG+IFFRESCFHQ
Sbjct  121  LKVGGHIFFRESCFHQ  136



>ref|XP_001763293.1| predicted protein [Physcomitrella patens]
 gb|EDQ71823.1| predicted protein [Physcomitrella patens]
Length=491

 Score =   240 bits (613),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 131/156 (84%), Gaps = 0/156 (0%)
 Frame = +2

Query  359  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  538
            ER +Q +YW EHS E +VEAMMLDS+A+ LDKEERPE+LS+LP YE K V+ELGAGIGRF
Sbjct  6    ERSLQSTYWKEHSVEPSVEAMMLDSQASKLDKEERPEILSLLPPYENKDVMELGAGIGRF  65

Query  539  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  718
            TGELA+ AG V+AMDF+E++IKKNE +NGH  NI F CADVTS DLN +  S DL+FSNW
Sbjct  66   TGELAKHAGHVLAMDFMENLIKKNEDVNGHYNNIDFKCADVTSPDLNIAAGSADLVFSNW  125

Query  719  LLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            LLMYLSD+EV+ LA R+++WL  GGYIFFRESCFHQ
Sbjct  126  LLMYLSDEEVKGLASRVMEWLRPGGYIFFRESCFHQ  161



>gb|KJB53041.1| hypothetical protein B456_008G289900 [Gossypium raimondii]
Length=448

 Score =   239 bits (609),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 135/156 (87%), Gaps = 0/156 (0%)
 Frame = +2

Query  359  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  538
            EREVQK+YW+EHS +LT +  +LDSK ADLDKE+R EVLS+LP YEGK +LELGAGIGRF
Sbjct  6    EREVQKNYWMEHSIDLTEDGTILDSKDADLDKEDRLEVLSLLPPYEGKCILELGAGIGRF  65

Query  539  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  718
            TGELAQKA  VIA+DFIE VIKKNE+INGH  NIKF+CAD TS DL+ S+ S+DLIFSN 
Sbjct  66   TGELAQKADSVIALDFIEDVIKKNESINGHYKNIKFLCADATSPDLDISEGSMDLIFSNL  125

Query  719  LLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            LLMYLS++EVE+LA+ M+KWL VGG+IFFRE+CF Q
Sbjct  126  LLMYLSNEEVENLAQGMMKWLKVGGHIFFREACFDQ  161



>ref|XP_010655650.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X1 [Vitis vinifera]
Length=494

 Score =   240 bits (612),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 124/162 (77%), Positives = 144/162 (89%), Gaps = 4/162 (2%)
 Frame = +2

Query  353  GEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIG  532
            GEER+VQKSYW+EHS+ELTVEAMMLDS+A+DLDKEERPE+LS+LP  EGK V+ELGAGIG
Sbjct  5    GEERDVQKSYWMEHSAELTVEAMMLDSQASDLDKEERPELLSLLPPLEGKYVVELGAGIG  64

Query  533  RFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFS  712
            RFTGELA++AGQV+A+DFIESVI++NE ING   N KF+CADVTS DL+ S  S+DLIFS
Sbjct  65   RFTGELAKQAGQVLAIDFIESVIRENEVINGRFKNTKFVCADVTSPDLDISPGSVDLIFS  124

Query  713  NWLLMYLSDQE----VESLAERMVKWLXVGGYIFFRESCFHQ  826
            NWLLMYLSD+E    VE LAERMVKWL VGG++FFRESCFHQ
Sbjct  125  NWLLMYLSDKEVVTMVEDLAERMVKWLKVGGFLFFRESCFHQ  166



>gb|KJB53038.1| hypothetical protein B456_008G289900 [Gossypium raimondii]
Length=480

 Score =   239 bits (609),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 135/156 (87%), Gaps = 0/156 (0%)
 Frame = +2

Query  359  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  538
            EREVQK+YW+EHS +LT +  +LDSK ADLDKE+R EVLS+LP YEGK +LELGAGIGRF
Sbjct  6    EREVQKNYWMEHSIDLTEDGTILDSKDADLDKEDRLEVLSLLPPYEGKCILELGAGIGRF  65

Query  539  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  718
            TGELAQKA  VIA+DFIE VIKKNE+INGH  NIKF+CAD TS DL+ S+ S+DLIFSN 
Sbjct  66   TGELAQKADSVIALDFIEDVIKKNESINGHYKNIKFLCADATSPDLDISEGSMDLIFSNL  125

Query  719  LLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            LLMYLS++EVE+LA+ M+KWL VGG+IFFRE+CF Q
Sbjct  126  LLMYLSNEEVENLAQGMMKWLKVGGHIFFREACFDQ  161



>gb|KJB53040.1| hypothetical protein B456_008G289900 [Gossypium raimondii]
Length=489

 Score =   239 bits (609),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 135/156 (87%), Gaps = 0/156 (0%)
 Frame = +2

Query  359  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  538
            EREVQK+YW+EHS +LT +  +LDSK ADLDKE+R EVLS+LP YEGK +LELGAGIGRF
Sbjct  6    EREVQKNYWMEHSIDLTEDGTILDSKDADLDKEDRLEVLSLLPPYEGKCILELGAGIGRF  65

Query  539  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  718
            TGELAQKA  VIA+DFIE VIKKNE+INGH  NIKF+CAD TS DL+ S+ S+DLIFSN 
Sbjct  66   TGELAQKADSVIALDFIEDVIKKNESINGHYKNIKFLCADATSPDLDISEGSMDLIFSNL  125

Query  719  LLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            LLMYLS++EVE+LA+ M+KWL VGG+IFFRE+CF Q
Sbjct  126  LLMYLSNEEVENLAQGMMKWLKVGGHIFFREACFDQ  161



>gb|KJB53039.1| hypothetical protein B456_008G289900 [Gossypium raimondii]
Length=488

 Score =   239 bits (609),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 135/156 (87%), Gaps = 0/156 (0%)
 Frame = +2

Query  359  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  538
            EREVQK+YW+EHS +LT +  +LDSK ADLDKE+R EVLS+LP YEGK +LELGAGIGRF
Sbjct  5    EREVQKNYWMEHSIDLTEDGTILDSKDADLDKEDRLEVLSLLPPYEGKCILELGAGIGRF  64

Query  539  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  718
            TGELAQKA  VIA+DFIE VIKKNE+INGH  NIKF+CAD TS DL+ S+ S+DLIFSN 
Sbjct  65   TGELAQKADSVIALDFIEDVIKKNESINGHYKNIKFLCADATSPDLDISEGSMDLIFSNL  124

Query  719  LLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            LLMYLS++EVE+LA+ M+KWL VGG+IFFRE+CF Q
Sbjct  125  LLMYLSNEEVENLAQGMMKWLKVGGHIFFREACFDQ  160



>gb|EEC79642.1| hypothetical protein OsI_20868 [Oryza sativa Indica Group]
Length=504

 Score =   237 bits (604),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 131/165 (79%), Gaps = 9/165 (5%)
 Frame = +2

Query  359  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERP---------EVLSMLPAYEGKSVL  511
            ER+ Q+SYW EHS +LTVEAMMLDS+     +   P         +VLS+LP+Y+GKSVL
Sbjct  13   ERKAQRSYWEEHSKDLTVEAMMLDSRPRRPRQGGAPRGLIGTVDAQVLSVLPSYKGKSVL  72

Query  512  ELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDE  691
            ELGAGIGRFTGELA++AG V+A+DFIESVIKKNE INGH  NI FMCADVTS DL   D 
Sbjct  73   ELGAGIGRFTGELAKEAGHVLALDFIESVIKKNENINGHHKNITFMCADVTSPDLTIEDN  132

Query  692  SIDLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            SIDLIFSNWLLMYLSD+EVE L  RMVKWL VGG+IFFRESCFHQ
Sbjct  133  SIDLIFSNWLLMYLSDEEVEKLVGRMVKWLKVGGHIFFRESCFHQ  177



>ref|XP_006306318.1| hypothetical protein CARUB_v10012188mg, partial [Capsella rubella]
 gb|EOA39216.1| hypothetical protein CARUB_v10012188mg, partial [Capsella rubella]
Length=354

 Score =   231 bits (590),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 111/150 (74%), Positives = 132/150 (88%), Gaps = 3/150 (2%)
 Frame = +2

Query  386  IEHSSELTVEAMMLDS-KAADLDKEE--RPEVLSMLPAYEGKSVLELGAGIGRFTGELAQ  556
            +EHSS+LT EAMMLDS +A+DLD+EE  RPEVLS++P YEGKSVLELGAGI RF GE+AQ
Sbjct  1    MEHSSDLTAEAMMLDSTEASDLDEEEERRPEVLSLIPPYEGKSVLELGAGIDRFIGEVAQ  60

Query  557  KAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLS  736
            KAG+VIA+DFIES I+KNE++NGH  N+KFMCADVTS DL  +D S++LIFSNWLLMYLS
Sbjct  61   KAGEVIALDFIESAIQKNESVNGHYKNVKFMCADVTSPDLKIADGSVELIFSNWLLMYLS  120

Query  737  DQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            D+EVE +AERM+ W+  GGYIFFRESCFHQ
Sbjct  121  DKEVELMAERMLGWVKPGGYIFFRESCFHQ  150



>emb|CDX95799.1| BnaC05g35500D [Brassica napus]
Length=481

 Score =   234 bits (597),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 126/153 (82%), Gaps = 17/153 (11%)
 Frame = +2

Query  419  MMLDSKAADLDKEERPE-----------------VLSMLPAYEGKSVLELGAGIGRFTGE  547
            MMLDS+AADLDKEERPE                 VLS+LP YEGKSVLELGAGIGRFTGE
Sbjct  1    MMLDSRAADLDKEERPEEMFSLSLSLLRFRESDGVLSLLPPYEGKSVLELGAGIGRFTGE  60

Query  548  LAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLM  727
            LAQKAG++IA+DFI+SVIKKNE++NGH  N+KFMCADVTS DLN +D SIDLIFSNWLLM
Sbjct  61   LAQKAGELIALDFIDSVIKKNESVNGHYKNVKFMCADVTSPDLNITDGSIDLIFSNWLLM  120

Query  728  YLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            YLSD+EVE L ERMV W+ VGGYIFFRESCFHQ
Sbjct  121  YLSDKEVELLVERMVGWIKVGGYIFFRESCFHQ  153



>ref|XP_006376718.1| hypothetical protein POPTR_0012s044902g, partial [Populus trichocarpa]
 ref|XP_006376719.1| hypothetical protein POPTR_0012s044902g, partial [Populus trichocarpa]
 gb|ERP54515.1| hypothetical protein POPTR_0012s044902g, partial [Populus trichocarpa]
 gb|ERP54516.1| hypothetical protein POPTR_0012s044902g, partial [Populus trichocarpa]
Length=135

 Score =   221 bits (564),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 102/130 (78%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = +2

Query  356  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  535
            EERE+QK YW+++ S+L+V AMMLDSKA++LDKEERPE+LS+LP YEGK+VLELGAGIGR
Sbjct  6    EEREIQKKYWMDNISDLSVNAMMLDSKASELDKEERPEILSLLPPYEGKTVLELGAGIGR  65

Query  536  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  715
            FTGELAQKA QV+A+DFIES IKKNE INGH  N+KFMCADVTS DLNFS+ S+DLIFSN
Sbjct  66   FTGELAQKASQVVALDFIESAIKKNENINGHYKNVKFMCADVTSPDLNFSEGSVDLIFSN  125

Query  716  WLLMYLSDQE  745
            WLLMYLSD+E
Sbjct  126  WLLMYLSDKE  135



>gb|ABK24808.1| unknown [Picea sitchensis]
Length=472

 Score =   231 bits (588),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/156 (68%), Positives = 130/156 (83%), Gaps = 0/156 (0%)
 Frame = +2

Query  359  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  538
            ER +Q +YW EHS  L++EAMMLDS+A+ LD+EERPE++S+LP  EGKSV+ELGAGIGR+
Sbjct  6    ERALQLNYWKEHSVVLSLEAMMLDSQASKLDQEERPEIISLLPPLEGKSVIELGAGIGRY  65

Query  539  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  718
            T ELAQKA  ++AMDFIES IKKNE  NGH  N++FMCADVTS DL     S DL+FSNW
Sbjct  66   TVELAQKADHILAMDFIESAIKKNEETNGHFKNVEFMCADVTSADLKIEPGSADLVFSNW  125

Query  719  LLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            LLMYLSD+EV  LA++MV+W+ +GGY+FFRESCFHQ
Sbjct  126  LLMYLSDEEVVELAKKMVQWVKMGGYVFFRESCFHQ  161



>ref|XP_001768934.1| predicted protein [Physcomitrella patens]
 gb|EDQ66288.1| predicted protein [Physcomitrella patens]
Length=431

 Score =   224 bits (570),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 101/156 (65%), Positives = 125/156 (80%), Gaps = 0/156 (0%)
 Frame = +2

Query  359  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  538
            ER +Q +YW EHS   +VE MMLDS+A  LD EERPE+LS+LP Y+GK V+ELGAGIGRF
Sbjct  17   ERTLQSNYWKEHSVNPSVETMMLDSQAPKLDLEERPEILSLLPPYKGKDVIELGAGIGRF  76

Query  539  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  718
            TG+LA+ AG V+AMDF+E++IKKNE ++GH+ NI F CADVTS  L+ S  S DL+FSNW
Sbjct  77   TGDLAKSAGHVLAMDFMENLIKKNEDVHGHMNNIDFKCADVTSPQLDISSASADLVFSNW  136

Query  719  LLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            LLM LSD+EVE L  R+++WL  GG+IFFRESCFH 
Sbjct  137  LLMSLSDEEVEGLTSRIIEWLRPGGFIFFRESCFHH  172



>emb|CBI26879.3| unnamed protein product [Vitis vinifera]
Length=475

 Score =   224 bits (571),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = +2

Query  386  IEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAG  565
            +EHS+ELTVEAMMLDS+A+DLDKEERPE+LS+LP  EGK V+ELGAGIGRFTGELA++AG
Sbjct  1    MEHSAELTVEAMMLDSQASDLDKEERPELLSLLPPLEGKYVVELGAGIGRFTGELAKQAG  60

Query  566  QVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQE  745
            QV+A+DFIESVI++NE ING   N KF+CADVTS DL+ S  S+DLIFSNWLLMYLSD+E
Sbjct  61   QVLAIDFIESVIRENEVINGRFKNTKFVCADVTSPDLDISPGSVDLIFSNWLLMYLSDKE  120

Query  746  VESLAERMVKWLXVGGYIFFRESCFHQ  826
            VE LAERMVKWL VGG++FFRESCFHQ
Sbjct  121  VEDLAERMVKWLKVGGFLFFRESCFHQ  147



>gb|KHN10536.1| Phosphoethanolamine N-methyltransferase [Glycine soja]
Length=466

 Score =   223 bits (569),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 123/138 (89%), Gaps = 2/138 (1%)
 Frame = +2

Query  419  MMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFIESV  598
            MMLDSKAA LDKEERPEVLS+LP +EGKSV+ELGAGIGRFTGELA KAGQ++A+DFI++ 
Sbjct  1    MMLDSKAAHLDKEERPEVLSLLPPFEGKSVIELGAGIGRFTGELALKAGQLLAVDFIDTA  60

Query  599  IKKNETINGHLGNIKFMCADVTSKDL--NFSDESIDLIFSNWLLMYLSDQEVESLAERMV  772
            IKKNETINGH  ++KF+CADVTS ++  N S+ S+D++FSNWLLMYLSD EVE LAERMV
Sbjct  61   IKKNETINGHHNHVKFLCADVTSPNMSNNVSEGSVDVVFSNWLLMYLSDIEVEKLAERMV  120

Query  773  KWLXVGGYIFFRESCFHQ  826
            +WL  GGYIFFRESCFHQ
Sbjct  121  RWLKDGGYIFFRESCFHQ  138



>ref|XP_002969650.1| hypothetical protein SELMODRAFT_146547 [Selaginella moellendorffii]
 gb|EFJ29738.1| hypothetical protein SELMODRAFT_146547 [Selaginella moellendorffii]
Length=495

 Score =   221 bits (564),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 126/162 (78%), Gaps = 0/162 (0%)
 Frame = +2

Query  341  AAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELG  520
            A     ER+ Q SYW EHS+ LTVE M+LDS+AA LD+EERPE+LSMLP  EG SV+ELG
Sbjct  3    APILSTERDAQLSYWKEHSTALTVEEMLLDSQAAKLDQEERPEILSMLPPLEGISVVELG  62

Query  521  AGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESID  700
            AGIGRFTG+LA+ A  V+AMDF++SVI KN+ +NG   N++F+CADVTS  L F   S D
Sbjct  63   AGIGRFTGDLAKSAKHVVAMDFVQSVIDKNKEVNGCHKNVEFLCADVTSPSLTFPRSSKD  122

Query  701  LIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            LIFSNWLLMYLSD EV +L ++M+ WL  GG IFFRESCFHQ
Sbjct  123  LIFSNWLLMYLSDDEVTALTKKMIFWLKRGGSIFFRESCFHQ  164



>ref|XP_002970912.1| hypothetical protein SELMODRAFT_270875 [Selaginella moellendorffii]
 gb|EFJ28238.1| hypothetical protein SELMODRAFT_270875 [Selaginella moellendorffii]
Length=495

 Score =   221 bits (563),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 126/162 (78%), Gaps = 0/162 (0%)
 Frame = +2

Query  341  AAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELG  520
            A     ER+ Q SYW EHS+ LTVE M+LDS+AA LD+EERPE+LSMLP  EG SV+ELG
Sbjct  3    APILSTERDAQLSYWKEHSTALTVEEMLLDSQAAKLDQEERPEILSMLPPLEGISVVELG  62

Query  521  AGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESID  700
            AGIGRFTG+LA+ A  V+AMDF++SVI KN+ +NG   N++F+CADVTS  L F   S D
Sbjct  63   AGIGRFTGDLAKSAKHVVAMDFVQSVIDKNKEVNGCHRNVEFLCADVTSPSLTFPRSSKD  122

Query  701  LIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            LIFSNWLLMYLSD EV +L ++M+ WL  GG IFFRESCFHQ
Sbjct  123  LIFSNWLLMYLSDDEVTALTKKMIFWLKRGGSIFFRESCFHQ  164



>ref|XP_006303561.1| hypothetical protein CARUB_v10011038mg [Capsella rubella]
 gb|EOA36459.1| hypothetical protein CARUB_v10011038mg [Capsella rubella]
Length=475

 Score =   220 bits (560),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 127/148 (86%), Gaps = 5/148 (3%)
 Frame = +2

Query  386  IEHSSELTVEAMMLDSKAADLDKEERP-EVLSMLPAYEGKSVLELGAGIGRFTGELAQKA  562
            +EHSS++ V++    ++A+DLDKEE P E+L ++P YEGK+VLELGAGIGRFTGELAQKA
Sbjct  1    MEHSSDVMVDS----TEASDLDKEELPHELLCLIPPYEGKTVLELGAGIGRFTGELAQKA  56

Query  563  GQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQ  742
            G+VIA+DFIES I KNE++NGH  N+KFMCADVTS DL  +D SIDLIFSNWLLMYLSD+
Sbjct  57   GEVIALDFIESAIHKNESVNGHYKNVKFMCADVTSPDLKIADGSIDLIFSNWLLMYLSDK  116

Query  743  EVESLAERMVKWLXVGGYIFFRESCFHQ  826
            EVE +AERM+ W+  GGYIFFRESCFHQ
Sbjct  117  EVELIAERMLGWVKPGGYIFFRESCFHQ  144



>ref|XP_010540184.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like, partial 
[Tarenaya hassleriana]
Length=457

 Score =   218 bits (555),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = +2

Query  458  ERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGN  637
            ERPE+LS+LP +EGKSVLE GAGIGRFTGE AQ+A QVIA+DFIESVIKKNE INGH  N
Sbjct  6    ERPEILSVLPPFEGKSVLEFGAGIGRFTGEFAQRASQVIAVDFIESVIKKNEDINGHHKN  65

Query  638  IKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESC  817
            +KFMCADVTS DL FSDES+DLIFSNWLLMYLSD+EVE LA RM++WL  GGYIFFRESC
Sbjct  66   VKFMCADVTSPDLKFSDESVDLIFSNWLLMYLSDKEVEGLARRMLQWLKAGGYIFFRESC  125

Query  818  FHQ  826
            FHQ
Sbjct  126  FHQ  128



>ref|XP_002317875.2| Phosphoethanolamine N-methyltransferase 1 family protein, partial 
[Populus trichocarpa]
 gb|EEE96095.2| Phosphoethanolamine N-methyltransferase 1 family protein, partial 
[Populus trichocarpa]
Length=129

 Score =   203 bits (516),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +2

Query  386  IEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAG  565
            +++ S+L+V AMMLDSKA++LDKEERPE+LS+LP YEGK+VLELGAGIGRFTGELAQKA 
Sbjct  1    MDNISDLSVNAMMLDSKASELDKEERPEILSLLPPYEGKTVLELGAGIGRFTGELAQKAS  60

Query  566  QVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQE  745
            QV+A+DFIES IKKNE INGH  N+KFMCADV S DLNFS+ S+DLIFSNWLLMYLSD+E
Sbjct  61   QVVALDFIESAIKKNENINGHYKNVKFMCADVKSPDLNFSEGSVDLIFSNWLLMYLSDKE  120

Query  746  VESL  757
            V  L
Sbjct  121  VNRL  124



>gb|AGO59019.1| heat responsive transcription factor protein, partial [Triticum 
aestivum]
Length=460

 Score =   213 bits (543),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 118/137 (86%), Gaps = 1/137 (1%)
 Frame = +2

Query  419  MMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFIESV  598
            MMLDS+A DLDKEERPEVL++LP+Y GK+VLELGAGIGRFTGELA++AG VIA+DFI+SV
Sbjct  1    MMLDSRAKDLDKEERPEVLAILPSYAGKTVLELGAGIGRFTGELAKEAGHVIALDFIDSV  60

Query  599  IKKNETINGHL-GNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQEVESLAERMVK  775
            IKKNE ING +  NI FMCADVTS +L   D SID++FSNWLLMYL+D+EVE L  R+VK
Sbjct  61   IKKNEEINGDIYKNITFMCADVTSPELKIEDNSIDIVFSNWLLMYLNDEEVEKLIGRIVK  120

Query  776  WLXVGGYIFFRESCFHQ  826
            WL  GG+IF RESCFHQ
Sbjct  121  WLKPGGHIFIRESCFHQ  137



>gb|KDD75565.1| hypothetical protein H632_c615p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=278

 Score =   204 bits (519),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/156 (63%), Positives = 115/156 (74%), Gaps = 2/156 (1%)
 Frame = +2

Query  359  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  538
            ER VQK YWIEHS+  TVE MMLDSKAAD+DK ERPEVL +L + EGK V+ELGAGIGRF
Sbjct  10   ERAVQKQYWIEHSANATVETMMLDSKAADIDKMERPEVLELLGSVEGKDVVELGAGIGRF  69

Query  539  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  718
            T  LA  A  V+A+DF+E++I++N   N H GNI F C D T  +L     S DL+FSNW
Sbjct  70   TAPLASTAKSVVALDFMENLIEENRRTNSHYGNIDFRCGDAT--ELELPASSQDLVFSNW  127

Query  719  LLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            LLMYL+D EV  LA+RM+ WL  GG IFFRESCF Q
Sbjct  128  LLMYLNDDEVRRLAQRMLGWLRPGGCIFFRESCFRQ  163



>gb|EAY75471.1| hypothetical protein OsI_03371 [Oryza sativa Indica Group]
Length=456

 Score =   206 bits (524),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 106/130 (82%), Gaps = 0/130 (0%)
 Frame = +2

Query  437  AADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNET  616
             ADLD      +LS+LP YEGKSVLELGAGIGRFTGEL + AG V+AMDFIESVIKKNE+
Sbjct  8    TADLDIVASHRILSLLPPYEGKSVLELGAGIGRFTGELVKTAGHVLAMDFIESVIKKNES  67

Query  617  INGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQEVESLAERMVKWLXVGGY  796
            INGH  N  FMCADVT  DL   D SIDLIFSNWLLMYLSD+EVE L +RMV+WL VGGY
Sbjct  68   INGHHKNASFMCADVTCPDLMIEDNSIDLIFSNWLLMYLSDEEVEKLVKRMVRWLKVGGY  127

Query  797  IFFRESCFHQ  826
            IFFRESCFHQ
Sbjct  128  IFFRESCFHQ  137



>ref|XP_004137342.1| PREDICTED: phosphomethylethanolamine N-methyltransferase [Cucumis 
sativus]
 gb|KGN63873.1| hypothetical protein Csa_1G025050 [Cucumis sativus]
Length=468

 Score =   204 bits (519),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = +2

Query  410  VEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFI  589
            +E+MM+DS + +LD EE  EV+S+LP YEGK+V+ELGAGIGRFT ELAQ+A QVIA+DF+
Sbjct  1    MESMMVDSDSHELDSEETAEVISLLPPYEGKTVVELGAGIGRFTSELAQRAAQVIAVDFV  60

Query  590  ESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQEVESLAERM  769
            E VI+KNE+INGH  N+KF CADVT  +L+  ++S+D IFSN LLMYLSD+EV+ LAERM
Sbjct  61   EDVIRKNESINGHHKNVKFQCADVTFSELDIHEDSVDFIFSNLLLMYLSDEEVKLLAERM  120

Query  770  VKWLXVGGYIFFRESCFHQ  826
            +KWL VGGYIFFRESCF  
Sbjct  121  IKWLKVGGYIFFRESCFQH  139



>ref|XP_002730517.1| PREDICTED: phosphoethanolamine N-methyltransferase-like, partial 
[Saccoglossus kowalevskii]
Length=160

 Score =   190 bits (483),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 117/158 (74%), Gaps = 2/158 (1%)
 Frame = +2

Query  353  GEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIG  532
             E R+V  SYW++HS + ++E MMLD++A  L + E PE+LS+LP YEGK ++ELGAGIG
Sbjct  4    NEVRQVMSSYWMDHSKDASLEEMMLDTQAESLAQSEHPEILSLLPPYEGKRIIELGAGIG  63

Query  533  RFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFS  712
            RFTG LA+KA  V A+DF+ES IKKN+  N H  N+ F  ADVT   L   ++S DL+FS
Sbjct  64   RFTGVLAKKASHVTAVDFMESFIKKNKDANSHHKNVDFKQADVTV--LKCPEKSFDLVFS  121

Query  713  NWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            NWL+MYL+++EV +LA  M+ WL   G++FFRESCFHQ
Sbjct  122  NWLMMYLTNEEVLALARNMLSWLKEDGFVFFRESCFHQ  159



>ref|XP_011399976.1| Phosphoethanolamine N-methyltransferase [Auxenochlorella protothecoides]
 gb|KFM27020.1| Phosphoethanolamine N-methyltransferase [Auxenochlorella protothecoides]
Length=503

 Score =   200 bits (508),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 117/157 (75%), Gaps = 2/157 (1%)
 Frame = +2

Query  356  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  535
            +ERE QKSYW EHSS  TVE+MMLDS+AAD+DK ERPEVL +L + +G  V+ELGAGIGR
Sbjct  5    QEREAQKSYWAEHSSNATVESMMLDSQAADIDKLERPEVLKLLGSVDGLDVVELGAGIGR  64

Query  536  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  715
            FT  LA++A  V+A+DF+ ++I++N   NGHLGNI F C D T  DL       DL+FSN
Sbjct  65   FTRPLAEEARSVVALDFMPNLIEQNRVDNGHLGNIDFRCGDATELDLPAG--CADLVFSN  122

Query  716  WLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            WLLMYL+D EV  LA  M+ W+ VGG +FFRESCF Q
Sbjct  123  WLLMYLADDEVAKLAHNMLTWVKVGGTVFFRESCFRQ  159



>ref|XP_010231068.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X2 [Brachypodium distachyon]
Length=472

 Score =   199 bits (506),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 111/131 (85%), Gaps = 1/131 (1%)
 Frame = +2

Query  437  AADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNET  616
            AA+LD E    VLS+LP+YEGK+VLELGAGIGRFTGELA++AG V+A+DFI+SVIKKNE 
Sbjct  15   AAELDPESDQWVLSILPSYEGKTVLELGAGIGRFTGELAKEAGHVLALDFIDSVIKKNEE  74

Query  617  INGHL-GNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQEVESLAERMVKWLXVGG  793
            INGH+  NI FMCADVTS +L   D SIDL+FSNWLLMYLSD+EVE L  R+VKWL VGG
Sbjct  75   INGHIHNNITFMCADVTSPELKIEDNSIDLVFSNWLLMYLSDEEVEKLIGRIVKWLKVGG  134

Query  794  YIFFRESCFHQ  826
            +IF RESCFHQ
Sbjct  135  HIFIRESCFHQ  145



>ref|XP_002454522.1| hypothetical protein SORBIDRAFT_04g032625 [Sorghum bicolor]
 gb|EES07498.1| hypothetical protein SORBIDRAFT_04g032625, partial [Sorghum bicolor]
Length=136

 Score =   187 bits (475),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = +2

Query  404  LTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMD  583
            LTVEAMMLDS+AADL++EERPEVLS+LP+YEGKSVLELGAGIG FTGELA+ AG V+A+D
Sbjct  19   LTVEAMMLDSRAADLNREERPEVLSLLPSYEGKSVLELGAGIGHFTGELAKIAGNVLALD  78

Query  584  FIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQEV  748
            FIES IKKNE+INGH  N  FMCA VTS+DL     SIDLIFSNWLLMYLSD+EV
Sbjct  79   FIESAIKKNESINGHYNNASFMCAYVTSEDLVLPASSIDLIFSNWLLMYLSDEEV  133



>gb|KIZ00652.1| hypothetical protein MNEG_7307 [Monoraphidium neglectum]
Length=252

 Score =   191 bits (484),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 117/165 (71%), Gaps = 2/165 (1%)
 Frame = +2

Query  332  SAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVL  511
            +A A    +EREVQ +YW+EHS E TVEAMMLDSKA+++D+ ERPEVLS L + +GK VL
Sbjct  2    AAAAEVGVQEREVQLNYWLEHSKEPTVEAMMLDSKASEIDQMERPEVLSTLGSIKGKRVL  61

Query  512  ELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDE  691
            ELGAGIGRFTGE+A+ A  V+A DF+E  I +N   NGHL N+ F  ADVT   L     
Sbjct  62   ELGAGIGRFTGEIAKTASSVLACDFMEVSIDENRRRNGHLPNVDFRVADVTQ--LRCEPR  119

Query  692  SIDLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
              D++FSNWLLMYLSD+EV  L +  + WL   G +FFRESCF Q
Sbjct  120  QFDVVFSNWLLMYLSDEEVSQLVKNALTWLPESGVLFFRESCFRQ  164



>ref|XP_002594091.1| hypothetical protein BRAFLDRAFT_68467 [Branchiostoma floridae]
 gb|EEN50102.1| hypothetical protein BRAFLDRAFT_68467 [Branchiostoma floridae]
Length=242

 Score =   188 bits (478),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 114/154 (74%), Gaps = 2/154 (1%)
 Frame = +2

Query  362  REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  541
            R+    +W EHSS+ ++E MMLD  A +L K+E PE+LS+LP  EGK++LELGAGIGR+T
Sbjct  10   RDKMSQFWREHSSQASIEEMMLDDAAKELSKDELPEILSLLPGIEGKTILELGAGIGRYT  69

Query  542  GELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWL  721
              LAQ+A  V A+DF+E  I+KNE +NGH  N++FM ADVT   L    +S D++FSNWL
Sbjct  70   APLAQQAKHVTAVDFMEPFIRKNEEVNGHHKNVRFMQADVTK--LEMPPKSFDIVFSNWL  127

Query  722  LMYLSDQEVESLAERMVKWLXVGGYIFFRESCFH  823
            +MYLSD EV++LAE+++ WL   G  FFRESCFH
Sbjct  128  MMYLSDAEVQALAEKVLTWLKDDGIFFFRESCFH  161



>ref|XP_009011308.1| hypothetical protein HELRODRAFT_71964 [Helobdella robusta]
 gb|ESO11039.1| hypothetical protein HELRODRAFT_71964 [Helobdella robusta]
Length=215

 Score =   185 bits (470),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 113/151 (75%), Gaps = 2/151 (1%)
 Frame = +2

Query  374  KSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELA  553
            +++W EHS++   E MMLDS A  L +EE PE+LS+LP  EGKSVLELGAGIGRF+G +A
Sbjct  2    QNFWKEHSTKANEEEMMLDSDADTLGREEVPEILSLLPGLEGKSVLELGAGIGRFSGRIA  61

Query  554  QKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYL  733
             KA  V+A+DF+E+ IK NE+ NGH GNI+F+ ADV    L F + S DL+FSNWLLMYL
Sbjct  62   AKAKSVVAVDFMENFIKCNESTNGHHGNIQFVQADVML--LKFPENSFDLVFSNWLLMYL  119

Query  734  SDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
             + EV +L E++  WL  GG+ FFRESCFHQ
Sbjct  120  EEDEVCTLFEKIFNWLKPGGHFFFRESCFHQ  150



>ref|XP_002594077.1| hypothetical protein BRAFLDRAFT_68483 [Branchiostoma floridae]
 gb|EEN50088.1| hypothetical protein BRAFLDRAFT_68483 [Branchiostoma floridae]
Length=274

 Score =   187 bits (474),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 114/149 (77%), Gaps = 2/149 (1%)
 Frame = +2

Query  380  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  559
            +W E S + +++ MMLD  A +LD+EERPE+L+MLP  +GK VLELGAGIGRFT  LA++
Sbjct  56   FWREQSHDGSLQEMMLDENADELDQEERPEILAMLPDLKGKRVLELGAGIGRFTPSLARQ  115

Query  560  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSD  739
            A  V A+DF+ES IKKNE  N HLGNI F+ ADVT  DL    ES+D++FSNWL+MYL+D
Sbjct  116  ADHVTAVDFMESFIKKNEEANRHLGNINFLQADVTRLDL--PQESVDVVFSNWLMMYLAD  173

Query  740  QEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            +EV +LA +++ WL  GGY FFRESCF +
Sbjct  174  EEVSALAAKVLSWLTEGGYFFFRESCFQK  202



>ref|XP_008453688.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Cucumis 
melo]
Length=184

 Score =   180 bits (456),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = +2

Query  467  EVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKF  646
            +V+S+LP YEGK+V+ELGAG+GRFT ELAQ+A QVIA+DF+E VI+KNE+INGH  N+KF
Sbjct  12   KVISLLPPYEGKTVVELGAGVGRFTAELAQRAAQVIAVDFVEDVIRKNESINGHHKNVKF  71

Query  647  MCADVTSKDLNFSDESIDLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFH  823
            + ADVTS +L+  ++S+D IFSN LLMYLSD+EV+ LAE M+KWL VGGYIF+RESCF 
Sbjct  72   LWADVTSPELDIHEDSVDFIFSNLLLMYLSDEEVKLLAEMMIKWLKVGGYIFYRESCFQ  130



>ref|XP_002594089.1| hypothetical protein BRAFLDRAFT_118790 [Branchiostoma floridae]
 gb|EEN50100.1| hypothetical protein BRAFLDRAFT_118790 [Branchiostoma floridae]
Length=577

 Score =   190 bits (482),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 123/169 (73%), Gaps = 8/169 (5%)
 Frame = +2

Query  338  MAAFQGEEREVQKS------YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEG  499
            M++ QGE  E + +      +W EHSS+ ++E MMLD  A +L K+E PE+LS+LP  EG
Sbjct  1    MSSDQGESAEYEATRDKMSQFWREHSSKASLEEMMLDDNAKELSKDELPEILSLLPGIEG  60

Query  500  KSVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLN  679
            K++LELGAGIGR+T  LAQ+A  V A+DF+ES I+KNE +NGH  N++FM ADVT   L 
Sbjct  61   KTILELGAGIGRYTAPLAQQAKHVTAVDFMESFIRKNEEVNGHHKNVRFMQADVTK--LE  118

Query  680  FSDESIDLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
               +S D++FSNWL+MYLSD EV++LAE+++ WL   G  FFRESCFH+
Sbjct  119  MPPKSFDIVFSNWLMMYLSDAEVQALAEKVLTWLKDDGIFFFRESCFHR  167



>gb|AHY01341.1| phosphoethanolamine methyltransferase, partial [Carassius gibelio]
Length=172

 Score =   179 bits (453),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 110/149 (74%), Gaps = 2/149 (1%)
 Frame = +2

Query  380  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  559
            +W EHS   TVE MMLD+ A +L + E PE+LS+LP+     VLELGAGIGRFT  L  K
Sbjct  4    FWKEHSKFATVEEMMLDTNAQELTQHELPEILSLLPSLAASDVLELGAGIGRFTRHLIGK  63

Query  560  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSD  739
            A  V A+DF+E  ++KN+  N HLG+++F+ ADVT   L+F     D++FSNWLLMYLSD
Sbjct  64   ARHVTAVDFMEKFVEKNKKDNSHLGSVEFIQADVTK--LDFPKHGFDVVFSNWLLMYLSD  121

Query  740  QEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            QE++SLAE+++ WL  GG++FFRESCFHQ
Sbjct  122  QELKSLAEKLLLWLRPGGFLFFRESCFHQ  150



>ref|XP_010864863.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like [Esox 
lucius]
Length=495

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/157 (56%), Positives = 111/157 (71%), Gaps = 2/157 (1%)
 Frame = +2

Query  356  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  535
            +ER     +W EHS + TVE MMLDS A +L + E PE+LS+LP+   + +LELGAGIGR
Sbjct  4    KERSSMTEFWKEHSRQATVEEMMLDSHAKELTQHELPEILSLLPSLHDQRILELGAGIGR  63

Query  536  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  715
            FT  L  +A  V A+DF+ES +KKN+  NGH  N  F+ ADVT   L+F   S D+IFSN
Sbjct  64   FTSHLLAQASHVTAVDFMESFVKKNQQENGHHSNAAFIQADVTK--LDFPKNSYDIIFSN  121

Query  716  WLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            WL+MYLSD+E+ SL ERM+ WL  GGY+FFRESC HQ
Sbjct  122  WLMMYLSDEELRSLTERMLGWLRPGGYLFFRESCNHQ  158



>ref|NP_001070105.1| phosphoethanolamine methyltransferase [Danio rerio]
 gb|AAI24222.1| Zgc:153034 [Danio rerio]
Length=489

 Score =   183 bits (465),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 111/149 (74%), Gaps = 2/149 (1%)
 Frame = +2

Query  380  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  559
            +W EHS + TVE MMLDS A +L + E PE+L +LPA     VLELGAGIGR+T  L  +
Sbjct  4    FWKEHSKQATVEEMMLDSHAQELTQHELPEILDLLPALSESCVLELGAGIGRYTKHLIGR  63

Query  560  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSD  739
            A  V A+DF+E  ++KN   NGHLG+++F+ ADVT   L+F + S DL+FSNWLLMYLSD
Sbjct  64   ARHVTAVDFMEKFVEKNRQDNGHLGSVEFIQADVTK--LDFPEHSFDLVFSNWLLMYLSD  121

Query  740  QEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            QE++ LAE+ ++WL  GG++FFRESCFHQ
Sbjct  122  QELQLLAEKFLRWLRPGGFLFFRESCFHQ  150



>ref|XP_008324913.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Cynoglossus semilaevis]
Length=491

 Score =   182 bits (463),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 111/155 (72%), Gaps = 2/155 (1%)
 Frame = +2

Query  362  REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  541
            R    ++W EHS+E TVE MMLD++A DL ++E PE+LS+LP   G  VLELGAGIGR+T
Sbjct  5    RNNMAAFWKEHSTEATVEEMMLDTQARDLTQQEMPEILSLLPRLTGYKVLELGAGIGRYT  64

Query  542  GELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWL  721
             +L  KA  V A+DF+ES I+KN  +NGH  N+ F+ ADVT   L     S+D IFSNWL
Sbjct  65   SQLLTKAAHVTAVDFMESFIEKNREVNGHHKNVTFLHADVTK--LEIPKTSLDFIFSNWL  122

Query  722  LMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            LMYLSD E++ L ++M+ WL  GG++FFRESC H+
Sbjct  123  LMYLSDDEIQPLMKKMLSWLRPGGFLFFRESCNHR  157



>ref|XP_008324912.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Cynoglossus semilaevis]
Length=495

 Score =   182 bits (463),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 111/155 (72%), Gaps = 2/155 (1%)
 Frame = +2

Query  362  REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  541
            R    ++W EHS+E TVE MMLD++A DL ++E PE+LS+LP   G  VLELGAGIGR+T
Sbjct  5    RNNMAAFWKEHSTEATVEEMMLDTQARDLTQQEMPEILSLLPRLTGYKVLELGAGIGRYT  64

Query  542  GELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWL  721
             +L  KA  V A+DF+ES I+KN  +NGH  N+ F+ ADVT   L     S+D IFSNWL
Sbjct  65   SQLLTKAAHVTAVDFMESFIEKNREVNGHHKNVTFLHADVTK--LEIPKTSLDFIFSNWL  122

Query  722  LMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            LMYLSD E++ L ++M+ WL  GG++FFRESC H+
Sbjct  123  LMYLSDDEIQPLMKKMLSWLRPGGFLFFRESCNHR  157



>gb|ETM43048.1| hypothetical protein L914_11412, partial [Phytophthora parasitica]
Length=244

 Score =   176 bits (446),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 106/155 (68%), Gaps = 2/155 (1%)
 Frame = +2

Query  362  REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  541
            R++ K+YW  HSS  TVE MMLDS A  L + E PE+L   P+ E K VLEL AGIGR+T
Sbjct  5    RDLMKAYWEGHSSSATVETMMLDSHAKTLTELEVPEILDKAPSMEHKDVLELAAGIGRYT  64

Query  542  GELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWL  721
              +A KA  V A++FIE  IK NE  NGHLGNIKF+C DV    L     S D+IFSNW+
Sbjct  65   SVIATKAKSVTAVEFIEDFIKVNEDKNGHLGNIKFLCKDVVH--LEAEPNSFDVIFSNWI  122

Query  722  LMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            LMY+ D+EV+  A++ VKWL  GG +FFRESCF Q
Sbjct  123  LMYMEDEEVKEFAKKAVKWLRPGGKLFFRESCFKQ  157



>ref|XP_008324914.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X3 [Cynoglossus semilaevis]
 ref|XP_008324916.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X3 [Cynoglossus semilaevis]
 ref|XP_008324917.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X3 [Cynoglossus semilaevis]
Length=488

 Score =   182 bits (461),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 110/150 (73%), Gaps = 2/150 (1%)
 Frame = +2

Query  377  SYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQ  556
            ++W EHS+E TVE MMLD++A DL ++E PE+LS+LP   G  VLELGAGIGR+T +L  
Sbjct  3    AFWKEHSTEATVEEMMLDTQARDLTQQEMPEILSLLPRLTGYKVLELGAGIGRYTSQLLT  62

Query  557  KAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLS  736
            KA  V A+DF+ES I+KN  +NGH  N+ F+ ADVT   L     S+D IFSNWLLMYLS
Sbjct  63   KAAHVTAVDFMESFIEKNREVNGHHKNVTFLHADVTK--LEIPKTSLDFIFSNWLLMYLS  120

Query  737  DQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            D E++ L ++M+ WL  GG++FFRESC H+
Sbjct  121  DDEIQPLMKKMLSWLRPGGFLFFRESCNHR  150



>ref|XP_005643867.1| S-adenosyl-L-methionine-dependent methyltransferase [Coccomyxa 
subellipsoidea C-169]
 gb|EIE19323.1| S-adenosyl-L-methionine-dependent methyltransferase [Coccomyxa 
subellipsoidea C-169]
Length=498

 Score =   182 bits (461),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/157 (56%), Positives = 113/157 (72%), Gaps = 2/157 (1%)
 Frame = +2

Query  356  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  535
            EER  QKSYW +HS+  +VEAMMLDS+A+ +DKEERPEVL+ML   EG  ++ELGAGIGR
Sbjct  16   EERAAQKSYWADHSATASVEAMMLDSQASVIDKEERPEVLTMLGCVEGARIVELGAGIGR  75

Query  536  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  715
            FTGELA  A  V+A+DF+E++I +N   N H  N+++   D T  +L     S D++FSN
Sbjct  76   FTGELAVAARSVLAVDFMENLIAENRRANSHRRNVRWQVGDAT--ELELPAGSADVVFSN  133

Query  716  WLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            WLLMYLSD+EV  LA   + W+  GG +FFRESCF Q
Sbjct  134  WLLMYLSDKEVAKLAGDALTWVVEGGTVFFRESCFRQ  170



>gb|EMT23240.1| Phosphoethanolamine N-methyltransferase 1 [Aegilops tauschii]
Length=497

 Score =   182 bits (461),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 102/120 (85%), Gaps = 1/120 (1%)
 Frame = +2

Query  470  VLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHL-GNIKF  646
            VL++LP+Y GK+VLELGAGIGRFTGELA++AG VIA+DFI+SVIKKNE ING +  NI F
Sbjct  51   VLAILPSYAGKTVLELGAGIGRFTGELAKEAGHVIALDFIDSVIKKNEEINGDIYKNITF  110

Query  647  MCADVTSKDLNFSDESIDLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            MCADVTS +L   D S+D++FSNWLLMYL+D+EVE L  R+VKWL  GG+IF RESCFHQ
Sbjct  111  MCADVTSPELKIEDNSVDIVFSNWLLMYLNDEEVEKLIGRIVKWLKPGGHIFIRESCFHQ  170



>ref|XP_006003521.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like, partial 
[Latimeria chalumnae]
Length=264

 Score =   176 bits (445),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 112/151 (74%), Gaps = 2/151 (1%)
 Frame = +2

Query  374  KSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELA  553
            K +W EHS E +VE MMLDS A  + +E+R E+++MLP  EGK VLELGAGIGRF+G+LA
Sbjct  2    KQFWEEHSKEASVEEMMLDSNAQAIAEEDRSEIIAMLPCVEGKDVLELGAGIGRFSGQLA  61

Query  554  QKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYL  733
            +KA +V A+DF+++ ++KN  +N   GN+ F+ ADVT+ DL     S DLIFSNWL MYL
Sbjct  62   KKARRVTAVDFMKTFMEKNREVNKVYGNVTFLQADVTNLDL--PPNSFDLIFSNWLFMYL  119

Query  734  SDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            +D+E+     ++++WL  GGY+FFRESCF +
Sbjct  120  TDKELVHFTNKLLQWLRPGGYLFFRESCFFK  150



>gb|ETK83171.1| hypothetical protein L915_11577 [Phytophthora parasitica]
Length=185

 Score =   173 bits (438),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 105/155 (68%), Gaps = 2/155 (1%)
 Frame = +2

Query  362  REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  541
            R++ K+YW  HSS  TVE MMLDS A  L + E PE+L   P+ E K VLEL AGIGR+T
Sbjct  5    RDLMKAYWEGHSSSATVETMMLDSHAKTLTELEVPEILDKAPSMEHKDVLELAAGIGRYT  64

Query  542  GELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWL  721
              +A  A  V A++FIE  IK NE  NGHLGNIKF+C DV    L     S D+IFSNW+
Sbjct  65   SVIATMAKSVTAVEFIEDFIKVNEDKNGHLGNIKFLCKDVVH--LEAEPNSFDVIFSNWI  122

Query  722  LMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            LMY+ D+EV+  A++ VKWL  GG +FFRESCF Q
Sbjct  123  LMYMEDEEVKEFAKKAVKWLRPGGKLFFRESCFKQ  157



>ref|NP_001096276.2| phosphoethanolamine methyltransferase [Xenopus (Silurana) tropicalis]
Length=494

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/157 (55%), Positives = 114/157 (73%), Gaps = 2/157 (1%)
 Frame = +2

Query  356  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  535
            + R+V   +W EHS + TVE MMLDS A  L  EE+PE++ +LP  +G SVLELGAGIGR
Sbjct  4    DTRQVMTQFWEEHSRDATVEEMMLDSSAKLLSLEEKPEIILLLPCLDGHSVLELGAGIGR  63

Query  536  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  715
            +TG LA+ A  V A+DF+++ I+KN+  NG  GNI F+ ADVT+ DL   +ES D IFSN
Sbjct  64   YTGHLAKLASHVTAVDFMQNFIEKNQKDNGFRGNITFLQADVTNLDL--PNESFDFIFSN  121

Query  716  WLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            WL MYL+D E+ +L ++M+ WL  GGY+FFRESCF Q
Sbjct  122  WLFMYLTDAELLALIQKMLGWLKPGGYLFFRESCFFQ  158


 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 64/124 (52%), Gaps = 7/124 (6%)
 Frame = +2

Query  455  EERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAG-QVIAMDFIESV--IKKNETING  625
            E   E +SML    G+ V+++G GIG     +A+  G +V+ MD   ++  I     I  
Sbjct  266  ETTKEFISMLNLRPGQRVVDVGCGIGGGDFYMAKTYGVEVLGMDLSSNMVEIAMERAIIE  325

Query  626  HLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFF  805
             +  ++F   D T +  +FS+ S D+++S   +++++D+  E+L  R   WL  GG +  
Sbjct  326  KIPLVQFEIGDATKR--SFSEASFDVVYSRDTILHINDK--EALFRRFYTWLKPGGKLLI  381

Query  806  RESC  817
             + C
Sbjct  382  TDYC  385



>ref|XP_005096334.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Aplysia californica]
Length=494

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/157 (56%), Positives = 111/157 (71%), Gaps = 2/157 (1%)
 Frame = +2

Query  356  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  535
            E R+V  +YW EHS + +VE MMLD+ A +L KEE PE+LS LP Y GK V+ELGAGIGR
Sbjct  4    EVRQVMAAYWKEHSKQGSVEEMMLDNTAEELSKEELPEILSYLPEYAGKDVIELGAGIGR  63

Query  536  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  715
            FT E+A+KA  V A+DF+E  I KN+  N +  NI+++ ADVT   L+   ES DLIFSN
Sbjct  64   FTTEIAKKAKSVAAVDFMEEFINKNKKTNQNFNNIEYVVADVTK--LDRPKESADLIFSN  121

Query  716  WLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            WLLMYL+D EV+    + + WL  GGY+F RESC HQ
Sbjct  122  WLLMYLNDNEVQEFFRKQLSWLRPGGYLFIRESCRHQ  158



>ref|NP_001167350.1| phosphoethanolamine N-methyltransferase 3 [Salmo salar]
 gb|ACN11445.1| phosphoethanolamine N-methyltransferase 3 [Salmo salar]
Length=495

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/157 (55%), Positives = 109/157 (69%), Gaps = 2/157 (1%)
 Frame = +2

Query  356  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  535
            +ER     +W EHS + TVE MMLDS A +L + E PE+LS+LP+  G+ VLELGAGIGR
Sbjct  4    KERSTMTEFWKEHSRQATVEEMMLDSHAQELTQHELPEILSLLPSLSGQRVLELGAGIGR  63

Query  536  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  715
            +T  L   A  V A+DF+ES ++KN   N H  N  F+ ADVT   L+F   S D+IFSN
Sbjct  64   YTSHLLTLASHVTAVDFMESFVEKNRQDNSHYSNASFLQADVTK--LDFPKNSFDIIFSN  121

Query  716  WLLMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            WLLMYLSD+E+ SL ERM+ WL  GGY+FFRESC +Q
Sbjct  122  WLLMYLSDEELTSLTERMLGWLSPGGYLFFRESCNYQ  158



>ref|XP_008418600.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Poecilia reticulata]
Length=492

 Score =   181 bits (458),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 108/149 (72%), Gaps = 2/149 (1%)
 Frame = +2

Query  380  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  559
            +W EHS   TVE MMLDS+A +L + E PE+LSMLP+ EG+ VLELGAGIGRFT  L  K
Sbjct  11   FWKEHSKAATVEEMMLDSRAKELTEHELPEILSMLPSLEGRRVLELGAGIGRFTSHLLTK  70

Query  560  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSD  739
            A  V A+DF++S + KN   NGH  N+ F+ ADVT   L+    SID IFSNWLLMYLSD
Sbjct  71   AAHVTAVDFMQSFVDKNRQNNGHHSNVSFVQADVTK--LDIPQHSIDFIFSNWLLMYLSD  128

Query  740  QEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            +E++S  ++M+ WL  GG++FFRESC H+
Sbjct  129  EELKSFMKKMLNWLQPGGFLFFRESCNHR  157



>ref|XP_008418601.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Poecilia reticulata]
Length=491

 Score =   181 bits (458),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 108/149 (72%), Gaps = 2/149 (1%)
 Frame = +2

Query  380  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  559
            +W EHS   TVE MMLDS+A +L + E PE+LSMLP+ EG+ VLELGAGIGRFT  L  K
Sbjct  10   FWKEHSKAATVEEMMLDSRAKELTEHELPEILSMLPSLEGRRVLELGAGIGRFTSHLLTK  69

Query  560  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSD  739
            A  V A+DF++S + KN   NGH  N+ F+ ADVT  D+     SID IFSNWLLMYLSD
Sbjct  70   AAHVTAVDFMQSFVDKNRQNNGHHSNVSFVQADVTKLDI--PQHSIDFIFSNWLLMYLSD  127

Query  740  QEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            +E++S  ++M+ WL  GG++FFRESC H+
Sbjct  128  EELKSFMKKMLNWLQPGGFLFFRESCNHR  156



>gb|ETL36539.1| hypothetical protein L916_11495, partial [Phytophthora parasitica]
Length=244

 Score =   173 bits (439),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 105/155 (68%), Gaps = 2/155 (1%)
 Frame = +2

Query  362  REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  541
            R++ K+YW  HSS  TVE MMLDS A  L + E PE+L   P+ E K VLEL AGIGR+T
Sbjct  5    RDLMKAYWEGHSSSATVETMMLDSHAKTLTELEVPEILDKAPSMEHKDVLELAAGIGRYT  64

Query  542  GELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWL  721
              +A  A  V A++FIE  IK NE  NGHLGNIKF+C DV    L     S D+IFSNW+
Sbjct  65   SVIATMAKSVTAVEFIEDFIKVNEDKNGHLGNIKFLCKDVVH--LEAEPNSFDVIFSNWI  122

Query  722  LMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            LMY+ D+EV+  A++ VKWL  GG +FFRESCF Q
Sbjct  123  LMYMEDEEVKEFAKKAVKWLRPGGKLFFRESCFKQ  157



>ref|XP_005806845.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like [Xiphophorus 
maculatus]
Length=492

 Score =   179 bits (455),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 106/149 (71%), Gaps = 2/149 (1%)
 Frame = +2

Query  380  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  559
            +W EHS   TVE MMLDS+A  L + E PE+LSMLP  EG+ VLELGAGIGRFT  L  K
Sbjct  11   FWKEHSKAATVEEMMLDSQAKKLTEHELPEILSMLPPLEGRRVLELGAGIGRFTSHLLTK  70

Query  560  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSD  739
            A  V A+DF++S + KN   NGH  N+ F+ ADVT   L+    SID IFSNWLLMYLSD
Sbjct  71   AAHVTAVDFMQSFVDKNRQNNGHHSNVSFVQADVTK--LDIPQHSIDFIFSNWLLMYLSD  128

Query  740  QEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            +E++S  ++M+ WL  GG++FFRESC H+
Sbjct  129  EELKSFMKKMLNWLQPGGFLFFRESCNHR  157



>ref|XP_005723169.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X3 [Pundamilia nyererei]
Length=485

 Score =   178 bits (451),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 107/149 (72%), Gaps = 2/149 (1%)
 Frame = +2

Query  380  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  559
            +W EHS   TVE MMLDS+A +L + E PE+LSMLP+ EG  VLELGAGIGR+T  L  K
Sbjct  4    FWKEHSKAATVEEMMLDSRAKELTQHELPEILSMLPSLEGCKVLELGAGIGRYTKHLLTK  63

Query  560  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSD  739
            A  V A+DF+ES I+KN   NGH  N  F+ ADVT   L+    SID IFSNWLLMYLSD
Sbjct  64   AAHVTAVDFMESFIEKNRQKNGHHSNGTFLQADVTK--LDVPQNSIDFIFSNWLLMYLSD  121

Query  740  QEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            +E+ S+ ++M+ WL  GG++FFRESC H+
Sbjct  122  EELNSVMQKMLTWLKPGGFLFFRESCNHR  150



>ref|XP_007550439.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like [Poecilia 
formosa]
Length=492

 Score =   178 bits (451),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 107/149 (72%), Gaps = 2/149 (1%)
 Frame = +2

Query  380  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  559
            +W EHS   TVE MMLDS+A +L + E PE+LSMLP+ EG+ VLELGAGIGRFT  L  K
Sbjct  11   FWKEHSKGATVEEMMLDSRAKELTEHELPEILSMLPSLEGRRVLELGAGIGRFTSHLLTK  70

Query  560  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSD  739
            A  V A+DF++S + KN   NGH  N+ F+ ADVT  D+     SID IFSNWLLMYLSD
Sbjct  71   AAHVTAVDFMQSFVDKNRQNNGHHSNVSFVQADVTKLDI--PQHSIDFIFSNWLLMYLSD  128

Query  740  QEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            +E++S  ++M+ WL  G ++FFRESC H+
Sbjct  129  EELKSFMKKMLNWLQPGAFLFFRESCNHR  157



>ref|XP_005723168.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Pundamilia nyererei]
Length=491

 Score =   178 bits (451),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 108/155 (70%), Gaps = 2/155 (1%)
 Frame = +2

Query  362  REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  541
            R     +W EHS   TVE MMLDS+A +L + E PE+LSMLP+ EG  VLELGAGIGR+T
Sbjct  4    RSNMTEFWKEHSKAATVEEMMLDSRAKELTQHELPEILSMLPSLEGCKVLELGAGIGRYT  63

Query  542  GELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWL  721
              L  KA  V A+DF+ES I+KN   NGH  N  F+ ADVT   L+    SID IFSNWL
Sbjct  64   KHLLTKAAHVTAVDFMESFIEKNRQKNGHHSNGTFLQADVTK--LDVPQNSIDFIFSNWL  121

Query  722  LMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            LMYLSD+E+ S+ ++M+ WL  GG++FFRESC H+
Sbjct  122  LMYLSDEELNSVMQKMLTWLKPGGFLFFRESCNHR  156



>ref|XP_005723167.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Pundamilia nyererei]
Length=492

 Score =   178 bits (451),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 108/155 (70%), Gaps = 2/155 (1%)
 Frame = +2

Query  362  REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  541
            R     +W EHS   TVE MMLDS+A +L + E PE+LSMLP+ EG  VLELGAGIGR+T
Sbjct  5    RSNMTEFWKEHSKAATVEEMMLDSRAKELTQHELPEILSMLPSLEGCKVLELGAGIGRYT  64

Query  542  GELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWL  721
              L  KA  V A+DF+ES I+KN   NGH  N  F+ ADVT   L+    SID IFSNWL
Sbjct  65   KHLLTKAAHVTAVDFMESFIEKNRQKNGHHSNGTFLQADVTK--LDVPQNSIDFIFSNWL  122

Query  722  LMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            LMYLSD+E+ S+ ++M+ WL  GG++FFRESC H+
Sbjct  123  LMYLSDEELNSVMQKMLTWLKPGGFLFFRESCNHR  157



>gb|KDO18851.1| hypothetical protein SPRG_15850 [Saprolegnia parasitica CBS 223.65]
Length=498

 Score =   177 bits (450),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 104/155 (67%), Gaps = 2/155 (1%)
 Frame = +2

Query  362  REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  541
            R   KSYW EHS E T+E MMLDS A  L + E PE+L+ LP  + K VLE+ AGIGR+T
Sbjct  12   RNDMKSYWSEHSQETTIETMMLDSNAKVLHELEIPEILAKLPDVKDKDVLEMAAGIGRYT  71

Query  542  GELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWL  721
            G +A  A  V A++FIE   K NE  NGH GN+ F+CADV   DL     S D+IFSNWL
Sbjct  72   GRIADAAASVTAVEFIEDFHKANEKSNGHRGNVSFLCADVC--DLERQPSSFDVIFSNWL  129

Query  722  LMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            LMYL D EV  LA++ +KWL  GG +FFRESCF Q
Sbjct  130  LMYLDDDEVARLAQKTLKWLRPGGEVFFRESCFRQ  164



>ref|XP_008620239.1| hypothetical protein SDRG_15833 [Saprolegnia diclina VS20]
 gb|EQC26346.1| hypothetical protein SDRG_15833 [Saprolegnia diclina VS20]
Length=498

 Score =   177 bits (450),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 105/155 (68%), Gaps = 2/155 (1%)
 Frame = +2

Query  362  REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  541
            R   KSYW EHS E T+E MMLDS A  L + E PE+L+ LP  + K VLE+ AGIGR+T
Sbjct  12   RNDMKSYWSEHSQETTIETMMLDSNAKVLHELEIPEILAKLPDVKDKDVLEMAAGIGRYT  71

Query  542  GELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWL  721
            G +A +A  + A++FIE   K NE  NGH GN+ F+CADV   DL     S D++FSNWL
Sbjct  72   GRIADEAASITAVEFIEDFHKANEKANGHRGNVSFLCADVC--DLERQPSSFDVVFSNWL  129

Query  722  LMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            LMYL D EV  LA++ +KWL  GG +FFRESCF Q
Sbjct  130  LMYLDDDEVSRLAQKTLKWLRPGGEVFFRESCFRQ  164



>ref|XP_006781399.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like [Neolamprologus 
brichardi]
Length=492

 Score =   177 bits (449),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 107/155 (69%), Gaps = 2/155 (1%)
 Frame = +2

Query  362  REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  541
            R     +W EHS   TVE MMLDS+A +L + E PE+LSMLP  EG  VLELGAGIGR+T
Sbjct  5    RSNMTEFWKEHSKAATVEEMMLDSRAKELTQHELPEILSMLPRLEGCKVLELGAGIGRYT  64

Query  542  GELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWL  721
              L  KA  V A+DF+ES I+KN   NGH  N  F+ ADVT   L+    SID IFSNWL
Sbjct  65   KHLLTKAAHVTAVDFMESFIEKNRQKNGHHSNGTFLQADVTK--LDVPQNSIDFIFSNWL  122

Query  722  LMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            LMYLSD+E+ S+ ++M+ WL  GG++FFRESC H+
Sbjct  123  LMYLSDEELNSVMQKMLTWLKPGGFLFFRESCNHR  157



>gb|AAI35513.1| LOC100124841 protein [Xenopus (Silurana) tropicalis]
Length=486

 Score =   177 bits (449),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 110/149 (74%), Gaps = 2/149 (1%)
 Frame = +2

Query  380  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  559
            +W EHS + TVE MMLDS A  L  EE+PE++ +LP  +G SVLELGAGIGR+TG LA+ 
Sbjct  4    FWEEHSRDATVEEMMLDSSAKLLSLEEKPEIILLLPCLDGHSVLELGAGIGRYTGHLAKL  63

Query  560  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSD  739
            A  V A+DF+++ I+KN+  NG  GNI F+ ADVT+ DL   +ES D IFSNWL MYL+D
Sbjct  64   ASHVTAVDFMQNFIEKNQKDNGFRGNITFLQADVTNLDL--PNESFDFIFSNWLFMYLTD  121

Query  740  QEVESLAERMVKWLXVGGYIFFRESCFHQ  826
             E+ +L ++M+ WL  GGY+FFRESCF Q
Sbjct  122  AELLALIQKMLGWLKPGGYLFFRESCFFQ  150


 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 64/124 (52%), Gaps = 7/124 (6%)
 Frame = +2

Query  455  EERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAG-QVIAMDFIESV--IKKNETING  625
            E   E +SML    G+ V+++G GIG     +A+  G +V+ MD   ++  I     I  
Sbjct  258  ETTKEFISMLNLRPGQRVVDVGCGIGGGDFYMAKTYGVEVLGMDLSSNMVEIAMERAIIE  317

Query  626  HLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQEVESLAERMVKWLXVGGYIFF  805
             +  ++F   D T +  +FS+ S D+++S   +++++D+  E+L  R   WL  GG +  
Sbjct  318  KIPLVQFEIGDATKR--SFSEASFDVVYSRDTILHINDK--EALFRRFYTWLKPGGKLLI  373

Query  806  RESC  817
             + C
Sbjct  374  TDYC  377



>ref|XP_008278560.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Stegastes partitus]
 ref|XP_008278561.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Stegastes partitus]
Length=492

 Score =   177 bits (449),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 108/155 (70%), Gaps = 2/155 (1%)
 Frame = +2

Query  362  REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  541
            R     +W EHSSE TVE MMLDS+A +L  +E PE+LSMLP+ +G  VLELGAGIGR+T
Sbjct  5    RSNMTEFWKEHSSEATVEKMMLDSQARELTTQELPEILSMLPSLDGCRVLELGAGIGRYT  64

Query  542  GELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWL  721
              L  KAG V A+DF+ES +++N   NGH  N+  + ADVT  D      S D+IFSNWL
Sbjct  65   SHLLTKAGHVTAVDFMESFVERNRKENGHHSNVSIIQADVTKMDN--PQNSFDIIFSNWL  122

Query  722  LMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            LMYLSD EV++  E+ + WL  GG++FFRESC H+
Sbjct  123  LMYLSDDEVKTFMEKTLTWLQTGGFLFFRESCNHR  157



>ref|XP_008278559.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Stegastes partitus]
Length=510

 Score =   177 bits (449),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 108/155 (70%), Gaps = 2/155 (1%)
 Frame = +2

Query  362  REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  541
            R     +W EHSSE TVE MMLDS+A +L  +E PE+LSMLP+ +G  VLELGAGIGR+T
Sbjct  23   RSNMTEFWKEHSSEATVEKMMLDSQARELTTQELPEILSMLPSLDGCRVLELGAGIGRYT  82

Query  542  GELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWL  721
              L  KAG V A+DF+ES +++N   NGH  N+  + ADVT  D      S D+IFSNWL
Sbjct  83   SHLLTKAGHVTAVDFMESFVERNRKENGHHSNVSIIQADVTKMDN--PQNSFDIIFSNWL  140

Query  722  LMYLSDQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            LMYLSD EV++  E+ + WL  GG++FFRESC H+
Sbjct  141  LMYLSDDEVKTFMEKTLTWLQTGGFLFFRESCNHR  175



>ref|XP_005096335.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Aplysia californica]
 ref|XP_005096336.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X3 [Aplysia californica]
Length=486

 Score =   177 bits (448),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 107/150 (71%), Gaps = 2/150 (1%)
 Frame = +2

Query  377  SYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQ  556
            +YW EHS + +VE MMLD+ A +L KEE PE+LS LP Y GK V+ELGAGIGRFT E+A+
Sbjct  3    AYWKEHSKQGSVEEMMLDNTAEELSKEELPEILSYLPEYAGKDVIELGAGIGRFTTEIAK  62

Query  557  KAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLS  736
            KA  V A+DF+E  I KN+  N +  NI+++ ADVT   L+   ES DLIFSNWLLMYL+
Sbjct  63   KAKSVAAVDFMEEFINKNKKTNQNFNNIEYVVADVTK--LDRPKESADLIFSNWLLMYLN  120

Query  737  DQEVESLAERMVKWLXVGGYIFFRESCFHQ  826
            D EV+    + + WL  GGY+F RESC HQ
Sbjct  121  DNEVQEFFRKQLSWLRPGGYLFIRESCRHQ  150



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1779792308916