BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig3777

Length=661
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009795542.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    288   7e-91   Nicotiana sylvestris
ref|XP_009588489.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    276   5e-90   Nicotiana tomentosiformis
ref|XP_006357659.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    278   4e-87   Solanum tuberosum [potatoes]
ref|XP_008342255.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    275   5e-86   
ref|XP_009361534.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    274   9e-86   Pyrus x bretschneideri [bai li]
gb|KDO50965.1|  hypothetical protein CISIN_1g010607mg                   268   4e-85   Citrus sinensis [apfelsine]
ref|XP_008245622.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    266   6e-85   Prunus mume [ume]
ref|XP_007215270.1|  hypothetical protein PRUPE_ppa004667mg             271   1e-84   Prunus persica
gb|KDO50964.1|  hypothetical protein CISIN_1g010607mg                   268   1e-84   Citrus sinensis [apfelsine]
ref|XP_004144553.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    271   2e-84   Cucumis sativus [cucumbers]
ref|XP_008462040.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    271   2e-84   Cucumis melo [Oriental melon]
ref|XP_012081511.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    271   3e-84   Jatropha curcas
gb|KDO50963.1|  hypothetical protein CISIN_1g010607mg                   269   3e-84   Citrus sinensis [apfelsine]
ref|XP_004305682.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    270   3e-84   Fragaria vesca subsp. vesca
ref|XP_006447826.1|  hypothetical protein CICLE_v10014974mg             270   6e-84   Citrus clementina [clementine]
gb|KDO50961.1|  hypothetical protein CISIN_1g010607mg                   270   8e-84   Citrus sinensis [apfelsine]
ref|XP_008229941.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    269   1e-83   Prunus mume [ume]
ref|XP_011100518.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    265   4e-83   
ref|XP_011100517.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    266   1e-82   Sesamum indicum [beniseed]
ref|XP_010252799.1|  PREDICTED: histone-lysine N-methyltransferas...    264   1e-81   Nelumbo nucifera [Indian lotus]
emb|CBI28466.3|  unnamed protein product                                264   1e-81   Vitis vinifera
ref|XP_002320530.2|  hypothetical protein POPTR_0014s16720g             265   1e-81   
gb|EYU42781.1|  hypothetical protein MIMGU_mgv1a004696mg                263   2e-81   Erythranthe guttata [common monkey flower]
ref|XP_002267469.2|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    265   4e-81   Vitis vinifera
ref|XP_002532210.1|  Ribulose-1,5 bisphosphate carboxylase/oxygen...    262   5e-81   Ricinus communis
ref|XP_011008074.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    261   1e-80   Populus euphratica
ref|XP_010088354.1|  Ribulose-1,5 bisphosphate carboxylase/oxygen...    262   1e-80   
ref|XP_003542190.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    259   6e-80   Glycine max [soybeans]
ref|XP_004243586.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    255   3e-78   Solanum lycopersicum
gb|KHG30782.1|  Ribulose-1,5 bisphosphate carboxylase/oxygenase l...    255   3e-78   Gossypium arboreum [tree cotton]
ref|XP_010689223.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    254   4e-78   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010048281.1|  PREDICTED: LOW QUALITY PROTEIN: ribulose-1,5...    254   6e-78   Eucalyptus grandis [rose gum]
gb|KJB10233.1|  hypothetical protein B456_001G190900                    253   1e-77   Gossypium raimondii
gb|KJB10232.1|  hypothetical protein B456_001G190900                    253   5e-77   Gossypium raimondii
ref|XP_007049391.1|  Rubisco methyltransferase family protein iso...    249   4e-76   Theobroma cacao [chocolate]
ref|XP_004502116.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    247   3e-75   Cicer arietinum [garbanzo]
ref|XP_006407809.1|  hypothetical protein EUTSA_v10020552mg             246   1e-74   Eutrema salsugineum [saltwater cress]
ref|XP_010486336.1|  PREDICTED: histone-lysine N-methyltransferas...    245   2e-74   Camelina sativa [gold-of-pleasure]
ref|XP_003601528.1|  SET domain-containing protein                      244   2e-74   Medicago truncatula
gb|KFK38228.1|  hypothetical protein AALP_AA3G085300                    245   2e-74   Arabis alpina [alpine rockcress]
ref|XP_006297498.1|  hypothetical protein CARUB_v10013517mg             244   3e-74   
ref|XP_003605258.1|  SET domain-containing protein                      244   4e-74   
ref|XP_010456598.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    244   6e-74   Camelina sativa [gold-of-pleasure]
ref|XP_002882542.1|  SET domain-containing protein                      243   1e-73   Arabidopsis lyrata subsp. lyrata
ref|XP_010464405.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    243   2e-73   Camelina sativa [gold-of-pleasure]
ref|NP_187424.1|  Rubisco methyltransferase family protein              242   3e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007146016.1|  hypothetical protein PHAVU_006G005700g             241   4e-73   Phaseolus vulgaris [French bean]
ref|XP_010524627.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    241   5e-73   Tarenaya hassleriana [spider flower]
gb|AAM61650.1|  putative ribulose-1,5-bisphosphate carboxylase/ox...    241   7e-73   Arabidopsis thaliana [mouse-ear cress]
gb|AAC14296.1|  putative methyltransferase                              238   9e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009124214.1|  PREDICTED: histone-lysine N-methyltransferas...    236   5e-71   Brassica rapa
ref|XP_008802702.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    235   6e-71   Phoenix dactylifera
gb|KJB22702.1|  hypothetical protein B456_004G061300                    231   1e-70   Gossypium raimondii
ref|XP_008802701.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    235   1e-70   Phoenix dactylifera
emb|CDY22127.1|  BnaC01g39740D                                          235   2e-70   Brassica napus [oilseed rape]
ref|XP_010942854.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    233   2e-70   Elaeis guineensis
ref|XP_010942853.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    233   2e-70   Elaeis guineensis
ref|XP_010942848.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    233   6e-70   
gb|KJB22703.1|  hypothetical protein B456_004G061300                    233   9e-70   Gossypium raimondii
ref|XP_009391784.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    231   5e-69   
ref|XP_006857756.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    228   1e-67   Amborella trichopoda
ref|XP_004953752.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    224   3e-66   
ref|XP_002454362.1|  hypothetical protein SORBIDRAFT_04g029430          223   5e-66   Sorghum bicolor [broomcorn]
gb|AFW63677.1|  hypothetical protein ZEAMMB73_839660                    218   6e-66   
ref|NP_001140387.1|  uncharacterized protein LOC100272441               219   1e-64   Zea mays [maize]
ref|XP_006649004.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    219   4e-64   
gb|ACG45124.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    218   6e-64   Zea mays [maize]
gb|KHG10408.1|  Ribulose-1,5 bisphosphate carboxylase/oxygenase l...    212   2e-62   Gossypium arboreum [tree cotton]
dbj|BAJ90575.1|  predicted protein                                      212   1e-61   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS68033.1|  Ribulose-1,5 bisphosphate carboxylase/oxygenase l...    212   1e-61   Triticum urartu
ref|XP_010236007.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    211   3e-61   Brachypodium distachyon [annual false brome]
gb|EEC73918.1|  hypothetical protein OsI_08761                          206   1e-59   Oryza sativa Indica Group [Indian rice]
ref|NP_001047982.1|  Os02g0725200                                       206   1e-59   
gb|EMT07134.1|  hypothetical protein F775_17280                         201   7e-57   
gb|KHN39942.1|  Ribulose-1,5 bisphosphate carboxylase/oxygenase l...    192   4e-55   Glycine soja [wild soybean]
ref|XP_008246184.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    184   6e-55   Prunus mume [ume]
gb|KCW89043.1|  hypothetical protein EUGRSUZ_A01370                     168   1e-45   Eucalyptus grandis [rose gum]
gb|KCW89045.1|  hypothetical protein EUGRSUZ_A01370                     168   1e-45   Eucalyptus grandis [rose gum]
ref|XP_001754252.1|  predicted protein                                  150   3e-39   
ref|XP_002963244.1|  hypothetical protein SELMODRAFT_80789              151   3e-39   
ref|XP_002974548.1|  hypothetical protein SELMODRAFT_101776             149   1e-38   
ref|XP_010689224.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    123   3e-29   
gb|KCW89046.1|  hypothetical protein EUGRSUZ_A01370                     121   8e-29   Eucalyptus grandis [rose gum]
emb|CDY71476.1|  BnaCnng73100D                                        87.4    4e-18   Brassica napus [oilseed rape]
ref|XP_005649983.1|  ResB-domain-containing protein                   86.3    1e-15   Coccomyxa subellipsoidea C-169
gb|KCW89047.1|  hypothetical protein EUGRSUZ_A01370                   72.4    1e-11   Eucalyptus grandis [rose gum]
ref|XP_001419603.1|  predicted protein                                72.4    3e-11   Ostreococcus lucimarinus CCE9901
emb|CDX78685.1|  BnaA03g05970D                                        62.8    2e-09   
ref|XP_003081307.1|  putative methyltransferase (ISS)                 65.9    3e-09   
emb|CEF99133.1|  Rubisco LS methyltransferase, substrate-binding ...  65.9    3e-09   Ostreococcus tauri
emb|CDY06579.1|  BnaC02g13030D                                        62.0    4e-09   
ref|XP_002505573.1|  set domain protein                               63.2    3e-08   Micromonas commoda
ref|XP_005850299.1|  hypothetical protein CHLNCDRAFT_142047           60.8    1e-07   Chlorella variabilis
ref|XP_007510589.1|  predicted protein                                60.8    1e-07   Bathycoccus prasinos
emb|CDY01223.1|  BnaC05g25090D                                        45.8    4e-07   
ref|XP_008617921.1|  hypothetical protein SDRG_13603                  59.3    5e-07   Saprolegnia diclina VS20
gb|AAC29137.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  58.2    1e-06   Spinacia oleracea
gb|AAC29136.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase N...  58.2    1e-06   Spinacia oleracea
ref|XP_002947838.1|  hypothetical protein VOLCADRAFT_88145            57.8    1e-06   Volvox carteri f. nagariensis
ref|XP_008607111.1|  hypothetical protein SDRG_03258                  57.8    2e-06   Saprolegnia diclina VS20
gb|KIW77858.1|  hypothetical protein Z517_07691                       57.4    2e-06   Fonsecaea pedrosoi CBS 271.37
gb|KDO26770.1|  hypothetical protein SPRG_20573                       55.8    6e-06   Saprolegnia parasitica CBS 223.65
ref|XP_002945653.1|  hypothetical protein VOLCADRAFT_120141           53.9    7e-06   Volvox carteri f. nagariensis
ref|XP_011075538.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  55.8    7e-06   Sesamum indicum [beniseed]
ref|XP_003556768.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  55.5    9e-06   Glycine max [soybeans]
ref|XP_008619088.1|  hypothetical protein SDRG_14714                  55.1    1e-05   Saprolegnia diclina VS20
emb|CCA68310.1|  related to SET7-Regulatory protein                   54.7    2e-05   Serendipita indica DSM 11827
ref|XP_003529470.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  54.3    2e-05   Glycine max [soybeans]
gb|EEC84567.1|  hypothetical protein OsI_31339                        54.3    2e-05   Oryza sativa Indica Group [Indian rice]
dbj|BAD28364.1|  putative ribulose-1,5 bisphosphate carboxylase/o...  54.3    2e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007158636.1|  hypothetical protein PHAVU_002G169400g           54.3    3e-05   Phaseolus vulgaris [French bean]
ref|XP_002508524.1|  set domain protein                               53.9    3e-05   Micromonas commoda
emb|CDR45671.1|  CYFA0S19e01640g1_1                                   53.5    4e-05   Cyberlindnera fabianii
ref|XP_001774765.1|  predicted protein                                53.1    6e-05   
ref|XP_002986460.1|  hypothetical protein SELMODRAFT_269129           53.1    6e-05   
ref|XP_008361779.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  53.1    6e-05   Malus domestica [apple tree]
ref|XP_002978944.1|  hypothetical protein SELMODRAFT_110000           53.1    6e-05   
ref|XP_004516567.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  53.1    7e-05   Cicer arietinum [garbanzo]
ref|XP_008221574.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  52.4    1e-04   Prunus mume [ume]
ref|XP_007339513.1|  SET domain-containing protein                    52.4    1e-04   
ref|XP_010683122.1|  PREDICTED: fructose-bisphosphate aldolase-ly...  52.4    1e-04   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002991767.1|  hypothetical protein SELMODRAFT_430007           52.4    1e-04   
ref|XP_002989713.1|  hypothetical protein SELMODRAFT_447801           52.0    1e-04   
ref|XP_001598126.1|  hypothetical protein SS1G_00212                  52.4    1e-04   Sclerotinia sclerotiorum 1980 UF-70
ref|XP_008179710.1|  PREDICTED: uncharacterized protein LOC103308320  52.0    1e-04   
ref|WP_043409385.1|  hypothetical protein                             52.0    1e-04   
ref|XP_008551338.1|  PREDICTED: SET domain-containing protein 4 i...  52.0    1e-04   
sp|Q43088.1|RBCMT_PEA  RecName: Full=Ribulose-1,5 bisphosphate ca...  52.0    2e-04   Pisum sativum [garden pea]
gb|KKA23272.1|  SET domain protein                                    52.0    2e-04   Rasamsonia emersonii CBS 393.64
ref|XP_005848872.1|  hypothetical protein CHLNCDRAFT_8187             51.6    2e-04   Chlorella variabilis
ref|XP_008551335.1|  PREDICTED: SET domain-containing protein 4 i...  51.6    2e-04   
gb|KEH30791.1|  rubisco large subunit N-methyltransferase             51.2    2e-04   Medicago truncatula
ref|XP_008551336.1|  PREDICTED: SET domain-containing protein 4 i...  51.6    2e-04   
ref|XP_011273526.1|  hypothetical protein BN7_4206                    51.6    2e-04   Wickerhamomyces ciferrii
ref|XP_002967739.1|  hypothetical protein SELMODRAFT_408995           51.2    2e-04   
ref|XP_006348752.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  51.2    2e-04   Solanum tuberosum [potatoes]
ref|XP_001694672.1|  predicted protein                                51.2    3e-04   Chlamydomonas reinhardtii
ref|XP_002992361.1|  hypothetical protein SELMODRAFT_430576           51.2    3e-04   
emb|CDK27492.1|  unnamed protein product                              50.8    3e-04   Kuraishia capsulata CBS 1993
pdb|2H21|A  Chain A, Structure Of Rubisco Lsmt Bound To Adomet        50.8    4e-04   Pisum sativum [garden pea]
pdb|1MLV|A  Chain A, Structure And Catalytic Mechanism Of A Set D...  50.8    4e-04   Pisum sativum [garden pea]
gb|ESZ99431.1|  hypothetical protein SBOR_0193                        50.8    4e-04   Sclerotinia borealis F-4128
ref|XP_002612559.1|  hypothetical protein BRAFLDRAFT_219602           50.4    4e-04   Branchiostoma floridae
ref|XP_008800499.1|  PREDICTED: [Fructose-bisphosphate aldolase]-...  50.4    5e-04   
ref|XP_002991099.1|  hypothetical protein SELMODRAFT_429412           50.4    5e-04   Selaginella moellendorffii
ref|XP_006662882.1|  PREDICTED: Fructose-bisphosphate aldolase-ly...  49.7    5e-04   
ref|XP_003057276.1|  set domain protein                               50.1    5e-04   Micromonas pusilla CCMP1545
ref|XP_002621905.1|  SET domain-containing protein                    50.4    5e-04   Blastomyces gilchristii SLH14081
gb|KEH30792.1|  rubisco large subunit N-methyltransferase             50.1    6e-04   Medicago truncatula
gb|KIW35468.1|  hypothetical protein PV07_02164                       50.1    6e-04   Cladophialophora immunda
ref|XP_011463675.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  50.1    7e-04   Fragaria vesca subsp. vesca
ref|XP_002153313.1|  SET domain protein                               50.1    8e-04   Talaromyces marneffei ATCC 18224
ref|XP_002563677.1|  Pc20g11910                                       49.7    8e-04   Penicillium rubens Wisconsin 54-1255
gb|KIM94980.1|  hypothetical protein OIDMADRAFT_171960                49.7    8e-04   Oidiodendron maius Zn
ref|XP_001783777.1|  predicted protein                                49.7    8e-04   
gb|KFX50163.1|  Ribosomal N-lysine methyltransferase 4                49.7    8e-04   Talaromyces marneffei PM1
ref|XP_006662881.1|  PREDICTED: Fructose-bisphosphate aldolase-ly...  49.3    9e-04   
ref|XP_006662880.1|  PREDICTED: Fructose-bisphosphate aldolase-ly...  48.9    0.001   



>ref|XP_009795542.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Nicotiana sylvestris]
Length=510

 Score =   288 bits (736),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 161/203 (79%), Gaps = 11/203 (5%)
 Frame = +1

Query  85   MPEASTIFQSTLLPPFSQS----RRALSSPICHTFFRRNPTSFTTI--RCSSV-----ST  231
            M EAS I QS  LPPFS +    R  L     +TF RRN T+  TI  RCSS      +T
Sbjct  1    MAEASRILQSGFLPPFSHNSPSHRTTLHFNSSYTFHRRNSTTPNTINIRCSSSVSAAETT  60

Query  232  EAAKIQTVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEK  411
            +  K + VPWGCD DSL+NAS LQKWLSDSG+P QKM IQRVD+GERGLVALKNIRKGEK
Sbjct  61   KPTKAENVPWGCDIDSLENASTLQKWLSDSGLPDQKMGIQRVDVGERGLVALKNIRKGEK  120

Query  412  LLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALP  591
            LLFVPPSLVITADS+WS P+AG VLK+Y VPDWP +ATYLISEASL+KSSRWSNYISALP
Sbjct  121  LLFVPPSLVITADSKWSNPEAGAVLKQYNVPDWPFLATYLISEASLMKSSRWSNYISALP  180

Query  592  TQPYSLLYWTRSELDRYLEASQI  660
             QPYSLLYWTRSELDRYLEASQI
Sbjct  181  RQPYSLLYWTRSELDRYLEASQI  203



>ref|XP_009588489.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=217

 Score =   276 bits (706),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 155/203 (76%), Gaps = 11/203 (5%)
 Frame = +1

Query  85   MPEASTIFQSTLLPPFSQS----RRALSSPICHTFFRRNPTS--FTTIRCSSV-----ST  231
            M EAS I QS  LP F  +    R  L     +TF RRN T+     IRCSS      +T
Sbjct  1    MAEASRILQSGFLPHFPHNSPSHRTTLHFNSSYTFHRRNNTTPNLINIRCSSSISAAETT  60

Query  232  EAAKIQTVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEK  411
            +  K +  PWGCD DSL+NAS LQKWLSDSG+P QKM IQRVD+GERGLVALKNIRKGEK
Sbjct  61   KPTKTENFPWGCDIDSLENASTLQKWLSDSGLPEQKMGIQRVDVGERGLVALKNIRKGEK  120

Query  412  LLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALP  591
            LLFVPPSLVITADS+WS P+ G VLK+Y VPDWP +ATYLISEASL+K SRWSNYISALP
Sbjct  121  LLFVPPSLVITADSKWSNPEVGAVLKQYNVPDWPFLATYLISEASLMKYSRWSNYISALP  180

Query  592  TQPYSLLYWTRSELDRYLEASQI  660
             QPYSLLYWTRSELDRYLEASQI
Sbjct  181  RQPYSLLYWTRSELDRYLEASQI  203



>ref|XP_006357659.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Solanum 
tuberosum]
Length=504

 Score =   278 bits (711),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 139/198 (70%), Positives = 159/198 (80%), Gaps = 7/198 (4%)
 Frame = +1

Query  85   MPEASTIFQSTLLPPFSQSRRALSSPICHTF--FRRNPTSFTTIRCSSVSTEAA----KI  246
            M E S I QS LLPPFS     +++    ++  +RRN  + + IRCSS+ST  A    K 
Sbjct  1    MAEVSRILQSVLLPPFSNKLDGITNSHFSSYKLYRRNKLNIS-IRCSSISTTEATKSTKT  59

Query  247  QTVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVP  426
            Q +PWGC+TDSL+NAS LQKWLS+SG+P QKM +QRVD+GERGLVA  NIRKGEKLLFVP
Sbjct  60   QNIPWGCETDSLENASNLQKWLSESGLPSQKMDLQRVDVGERGLVANNNIRKGEKLLFVP  119

Query  427  PSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYS  606
            PSLVITADS+WS  DAG VLK+Y VPDWP IATYLISEASL+KSSRWSNYISALP QPYS
Sbjct  120  PSLVITADSKWSNSDAGDVLKQYNVPDWPFIATYLISEASLMKSSRWSNYISALPRQPYS  179

Query  607  LLYWTRSELDRYLEASQI  660
            LLYWT+SELDRYLEASQI
Sbjct  180  LLYWTQSELDRYLEASQI  197



>ref|XP_008342255.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Malus domestica]
 ref|XP_008353614.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Malus domestica]
 ref|XP_008362320.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Malus domestica]
Length=497

 Score =   275 bits (703),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 136/201 (68%), Positives = 158/201 (79%), Gaps = 20/201 (10%)
 Frame = +1

Query  85   MPEASTIFQSTLLPPFSQSRRALSSPICHTF------FRRNPTSFTTIRCSSVSTEAAKI  246
            M EAS + Q+TLLP F    +       HTF      FRRNP     ++CS  +T+ AK 
Sbjct  1    MAEASRVLQTTLLPTFHPQHK------IHTFHSLPLNFRRNP-----VQCSVSTTDGAKA  49

Query  247  ---QTVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLL  417
               Q +PWGCD DSL+NASALQKWL+DSG+PPQKMAI++V++GERGLVALKNIRKGEKLL
Sbjct  50   TVAQKIPWGCDIDSLENASALQKWLTDSGLPPQKMAIEKVEVGERGLVALKNIRKGEKLL  109

Query  418  FVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQ  597
            FVPPSL ITADSEW+  +AG+VLK+ GVPDWP +ATYLISEAS ++SSRWSNYISALP Q
Sbjct  110  FVPPSLFITADSEWTCGEAGEVLKKNGVPDWPFLATYLISEASYLQSSRWSNYISALPRQ  169

Query  598  PYSLLYWTRSELDRYLEASQI  660
            PYSLLYWTR ELDRYLEASQI
Sbjct  170  PYSLLYWTREELDRYLEASQI  190



>ref|XP_009361534.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Pyrus x bretschneideri]
Length=497

 Score =   274 bits (701),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 136/201 (68%), Positives = 158/201 (79%), Gaps = 20/201 (10%)
 Frame = +1

Query  85   MPEASTIFQSTLLPPFSQSRRALSSPICHTF------FRRNPTSFTTIRCSSVSTEAAKI  246
            M EAS + Q+TLLP F    +       HTF      FRR+P     ++CS  +T+ AK 
Sbjct  1    MAEASRVLQTTLLPTFHPQHK------IHTFHSLPLNFRRHP-----VQCSVSTTDGAKA  49

Query  247  ---QTVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLL  417
               Q +PWGCD DSL+NASALQKWL+DSG+PPQKMAIQ+V++GERGLVALKNIRKGEKLL
Sbjct  50   TVAQKIPWGCDIDSLENASALQKWLTDSGLPPQKMAIQKVEVGERGLVALKNIRKGEKLL  109

Query  418  FVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQ  597
            FVPPSL ITADSEW+  +AG+VLK+ GVPDWP +ATYLISEAS ++SSRWSNYISALP Q
Sbjct  110  FVPPSLFITADSEWTCGEAGEVLKKNGVPDWPFLATYLISEASYLQSSRWSNYISALPRQ  169

Query  598  PYSLLYWTRSELDRYLEASQI  660
            PYSLLYWTR ELDRYLEASQI
Sbjct  170  PYSLLYWTREELDRYLEASQI  190



>gb|KDO50965.1| hypothetical protein CISIN_1g010607mg [Citrus sinensis]
Length=359

 Score =   268 bits (686),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 135/199 (68%), Positives = 156/199 (78%), Gaps = 7/199 (4%)
 Frame = +1

Query  85   MPEASTIFQSTLLPPFSQSRRALSSPICHTFFRRNPTSFTTIRCS-SVSTEAAKIQT---  252
            M EAS  F + LLP FS   +A S      F R+       + CS S + +A++ +T   
Sbjct  1    MAEASRTFHTILLPSFSHLHKAQSPAGFTDFPRKRCGHRIVVHCSVSTTNDASRTKTTVT  60

Query  253  ---VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFV  423
               +PWGC+ DSL+NAS LQKWLSDSG+PPQKMAIQ+VD+GERGLVALKNIRKGEKLLFV
Sbjct  61   QNMIPWGCEIDSLENASTLQKWLSDSGLPPQKMAIQKVDVGERGLVALKNIRKGEKLLFV  120

Query  424  PPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPY  603
            PPSLVITADS+WS P+AG+VLK+  VPDWPL+ATYLISEAS  KSSRWSNYISALP QPY
Sbjct  121  PPSLVITADSKWSCPEAGEVLKQCSVPDWPLLATYLISEASFEKSSRWSNYISALPRQPY  180

Query  604  SLLYWTRSELDRYLEASQI  660
            SLLYWTR+ELDRYLEASQI
Sbjct  181  SLLYWTRAELDRYLEASQI  199



>ref|XP_008245622.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Prunus 
mume]
 ref|XP_008245623.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Prunus 
mume]
 ref|XP_008245624.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Prunus 
mume]
Length=308

 Score =   266 bits (680),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 133/195 (68%), Positives = 158/195 (81%), Gaps = 8/195 (4%)
 Frame = +1

Query  85   MPEASTIFQSTLLPPFSQSRRALSSPICHTF---FRRNPTSFTTIRCSSVSTEAAKIQTV  255
            M EAS + Q+TL+P F    +   SPI  +    FRRNP   T    +S ST+A   Q +
Sbjct  1    MAEASRVLQTTLIPSFHPQHK---SPIFQSLPLNFRRNPIQCTV--STSNSTKATVPQKI  55

Query  256  PWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPSL  435
            PWGC++DSL+NASALQKWL+DSG+PPQKMA+++V++GERGLVALKNIRKGEKLLFVPPSL
Sbjct  56   PWGCESDSLENASALQKWLTDSGLPPQKMALKKVEVGERGLVALKNIRKGEKLLFVPPSL  115

Query  436  VITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSLLY  615
             ITADSEW+  +AG+VLK+ GVPDWP +ATYLISEAS ++SSRWSNYISALP QPYSLLY
Sbjct  116  FITADSEWTCGEAGKVLKQNGVPDWPFLATYLISEASSLESSRWSNYISALPRQPYSLLY  175

Query  616  WTRSELDRYLEASQI  660
            WTR ELDRYLEASQI
Sbjct  176  WTREELDRYLEASQI  190



>ref|XP_007215270.1| hypothetical protein PRUPE_ppa004667mg [Prunus persica]
 gb|EMJ16469.1| hypothetical protein PRUPE_ppa004667mg [Prunus persica]
Length=497

 Score =   271 bits (694),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 135/195 (69%), Positives = 158/195 (81%), Gaps = 8/195 (4%)
 Frame = +1

Query  85   MPEASTIFQSTLLPPFSQSRRALSSPICHTF---FRRNPTSFTTIRCSSVSTEAAKIQTV  255
            M EAS + Q+TL+P F    R   SPI  +    FRRNP   T    +S ST+A   Q +
Sbjct  1    MAEASRVLQTTLIPSFHPQHR---SPIFQSLPLNFRRNPIQCTV--STSNSTKATVPQKI  55

Query  256  PWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPSL  435
            PWGC++DSL+NASALQKWL+DSG+PPQKMA+Q+V++GERGLVALKNIRKGEKLLFVPPSL
Sbjct  56   PWGCESDSLENASALQKWLTDSGLPPQKMALQKVEVGERGLVALKNIRKGEKLLFVPPSL  115

Query  436  VITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSLLY  615
             ITADSEW+  +AG+VLK+ GVPDWP +ATYLISEAS ++SSRWSNYISALP QPYSLLY
Sbjct  116  FITADSEWTCGEAGKVLKQNGVPDWPFLATYLISEASSLESSRWSNYISALPRQPYSLLY  175

Query  616  WTRSELDRYLEASQI  660
            WTR ELDRYLEASQI
Sbjct  176  WTREELDRYLEASQI  190



>gb|KDO50964.1| hypothetical protein CISIN_1g010607mg [Citrus sinensis]
Length=397

 Score =   268 bits (685),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 135/199 (68%), Positives = 156/199 (78%), Gaps = 7/199 (4%)
 Frame = +1

Query  85   MPEASTIFQSTLLPPFSQSRRALSSPICHTFFRRNPTSFTTIRCS-SVSTEAAKIQT---  252
            M EAS  F + LLP FS   +A S      F R+       + CS S + +A++ +T   
Sbjct  1    MAEASRTFHTILLPSFSHLHKAQSPAGFTDFPRKRCGHRIVVHCSVSTTNDASRTKTTVT  60

Query  253  ---VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFV  423
               +PWGC+ DSL+NAS LQKWLSDSG+PPQKMAIQ+VD+GERGLVALKNIRKGEKLLFV
Sbjct  61   QNMIPWGCEIDSLENASTLQKWLSDSGLPPQKMAIQKVDVGERGLVALKNIRKGEKLLFV  120

Query  424  PPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPY  603
            PPSLVITADS+WS P+AG+VLK+  VPDWPL+ATYLISEAS  KSSRWSNYISALP QPY
Sbjct  121  PPSLVITADSKWSCPEAGEVLKQCSVPDWPLLATYLISEASFEKSSRWSNYISALPRQPY  180

Query  604  SLLYWTRSELDRYLEASQI  660
            SLLYWTR+ELDRYLEASQI
Sbjct  181  SLLYWTRAELDRYLEASQI  199



>ref|XP_004144553.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Cucumis sativus]
 gb|KGN43400.1| hypothetical protein Csa_7G031610 [Cucumis sativus]
Length=497

 Score =   271 bits (693),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 133/195 (68%), Positives = 159/195 (82%), Gaps = 8/195 (4%)
 Frame = +1

Query  85   MPEASTIFQSTLLPPFSQSRRALSSPICHTFFRRNPTSFTTIRCSSVSTEAAKIQT---V  255
            M EAS +F S+LLP F   +  LS+      FRR+     +I CS  +T+ A++     +
Sbjct  1    MAEASRVFNSSLLPNFRPLQNTLSTKPHTATFRRH-----SINCSVSTTDGARVAATGPI  55

Query  256  PWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPSL  435
            PWGC+ DSL+NASALQKWLS+SG+P QKM+IQRV++GERGLVALKN+RKGEKLLFVPPSL
Sbjct  56   PWGCEIDSLENASALQKWLSESGLPDQKMSIQRVNVGERGLVALKNVRKGEKLLFVPPSL  115

Query  436  VITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSLLY  615
            VI+A+SEWS P+AG+VLKR  VPDWPLIATYLISEASL+KSSRW+NYISALP QPYSLLY
Sbjct  116  VISAESEWSCPEAGEVLKRNSVPDWPLIATYLISEASLMKSSRWNNYISALPRQPYSLLY  175

Query  616  WTRSELDRYLEASQI  660
            WTR ELDRYLEAS+I
Sbjct  176  WTREELDRYLEASEI  190



>ref|XP_008462040.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Cucumis melo]
Length=497

 Score =   271 bits (692),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 134/195 (69%), Positives = 158/195 (81%), Gaps = 8/195 (4%)
 Frame = +1

Query  85   MPEASTIFQSTLLPPFSQSRRALSSPICHTFFRRNPTSFTTIRCSSVSTEAAKIQT---V  255
            M EAS +F S+L+P F   +   S+      FRR+     +I CS  +T+ A++     +
Sbjct  1    MAEASRVFNSSLVPNFRPLQYTHSTKPHAATFRRH-----SINCSVSTTDTARVAATGPI  55

Query  256  PWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPSL  435
            PWGCD DSL+NASALQKWLS+SG+P QKM+IQRVD+GERGLVALKN+RKGEKLLFVPPSL
Sbjct  56   PWGCDIDSLENASALQKWLSESGLPDQKMSIQRVDVGERGLVALKNVRKGEKLLFVPPSL  115

Query  436  VITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSLLY  615
            VI+A+SEWS P+AG+VLKR  VPDWPLIATYLISEASL+KSSRWSNYISALP QPYSLLY
Sbjct  116  VISAESEWSCPEAGEVLKRNSVPDWPLIATYLISEASLMKSSRWSNYISALPRQPYSLLY  175

Query  616  WTRSELDRYLEASQI  660
            WTR ELDRYLEAS+I
Sbjct  176  WTREELDRYLEASEI  190



>ref|XP_012081511.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Jatropha curcas]
 gb|KDP29954.1| hypothetical protein JCGZ_18523 [Jatropha curcas]
Length=502

 Score =   271 bits (692),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 138/202 (68%), Positives = 159/202 (79%), Gaps = 17/202 (8%)
 Frame = +1

Query  85   MPEASTIFQSTLLPPFS--QSRRALSSP--ICHTFFRRNPTSFTTIRCSSVSTEAA----  240
            M +AS +FQ TL P FS     R LS+   I H         + TIRCS  ++++A    
Sbjct  1    MAKASRVFQPTLFPTFSTLHKPRTLSNAPTIIHK-------KYPTIRCSVSTSDSAIREA  53

Query  241  --KIQTVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKL  414
                Q VPWGCD DSL+NA+ALQKWLSDSG+PPQKMAI++V++GERGLVALKNIRKGEKL
Sbjct  54   TSATQKVPWGCDIDSLENAAALQKWLSDSGLPPQKMAIEKVEVGERGLVALKNIRKGEKL  113

Query  415  LFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPT  594
            LFVPP LVITADSEWS P+AG+VLK+Y VPDWP +ATYLISEASL +SSRWSNYISALP 
Sbjct  114  LFVPPPLVITADSEWSCPEAGEVLKQYSVPDWPFLATYLISEASLNQSSRWSNYISALPR  173

Query  595  QPYSLLYWTRSELDRYLEASQI  660
            QPYSLLYWTR+ELDRYLEASQI
Sbjct  174  QPYSLLYWTRAELDRYLEASQI  195



>gb|KDO50963.1| hypothetical protein CISIN_1g010607mg [Citrus sinensis]
Length=442

 Score =   269 bits (687),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 135/199 (68%), Positives = 156/199 (78%), Gaps = 7/199 (4%)
 Frame = +1

Query  85   MPEASTIFQSTLLPPFSQSRRALSSPICHTFFRRNPTSFTTIRCS-SVSTEAAKIQT---  252
            M EAS  F + LLP FS   +A S      F R+       + CS S + +A++ +T   
Sbjct  1    MAEASRTFHTILLPSFSHLHKAQSPAGFTDFPRKRCGHRIVVHCSVSTTNDASRTKTTVT  60

Query  253  ---VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFV  423
               +PWGC+ DSL+NAS LQKWLSDSG+PPQKMAIQ+VD+GERGLVALKNIRKGEKLLFV
Sbjct  61   QNMIPWGCEIDSLENASTLQKWLSDSGLPPQKMAIQKVDVGERGLVALKNIRKGEKLLFV  120

Query  424  PPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPY  603
            PPSLVITADS+WS P+AG+VLK+  VPDWPL+ATYLISEAS  KSSRWSNYISALP QPY
Sbjct  121  PPSLVITADSKWSCPEAGEVLKQCSVPDWPLLATYLISEASFEKSSRWSNYISALPRQPY  180

Query  604  SLLYWTRSELDRYLEASQI  660
            SLLYWTR+ELDRYLEASQI
Sbjct  181  SLLYWTRAELDRYLEASQI  199



>ref|XP_004305682.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Fragaria vesca 
subsp. vesca]
Length=498

 Score =   270 bits (691),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 134/198 (68%), Positives = 154/198 (78%), Gaps = 13/198 (7%)
 Frame = +1

Query  85   MPEASTIFQSTLLPPFSQSRRALSSPICHTF------FRRNPTSFTTIRCSSVSTEAAKI  246
            M E S I QSTL+P F       S P  HTF      F+R+P    +I  +  +T+A   
Sbjct  1    MAEVSRILQSTLIPSFH------SHPKTHTFQSHPPSFKRHPVQ-CSISTTESTTKATVS  53

Query  247  QTVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVP  426
            Q +PWGCD DSL+NASALQKWL+DSG+PPQKM IQ+VD+GERGLVALKNIRKGEKLLFVP
Sbjct  54   QNIPWGCDIDSLENASALQKWLTDSGLPPQKMGIQKVDVGERGLVALKNIRKGEKLLFVP  113

Query  427  PSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYS  606
            PSL ITADSEW+  +AG+V+K+  VPDWPL+ATYLISEAS +KSSRWSNYI ALP QPYS
Sbjct  114  PSLFITADSEWTCREAGKVMKKNSVPDWPLLATYLISEASYLKSSRWSNYIDALPRQPYS  173

Query  607  LLYWTRSELDRYLEASQI  660
            LLYWTR ELDRYLEASQI
Sbjct  174  LLYWTREELDRYLEASQI  191



>ref|XP_006447826.1| hypothetical protein CICLE_v10014974mg [Citrus clementina]
 ref|XP_006469428.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Citrus 
sinensis]
 gb|ESR61066.1| hypothetical protein CICLE_v10014974mg [Citrus clementina]
Length=506

 Score =   270 bits (690),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 135/199 (68%), Positives = 156/199 (78%), Gaps = 7/199 (4%)
 Frame = +1

Query  85   MPEASTIFQSTLLPPFSQSRRALSSPICHTFFRRNPTSFTTIRCS-SVSTEAAKIQT---  252
            M EAS  F + LLP FS   +A S      F R+       + CS S + +A++ +T   
Sbjct  1    MAEASRTFHTILLPSFSHLHKAQSPAGFTAFPRKRCGHRIVVHCSVSTTNDASRTKTTVT  60

Query  253  ---VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFV  423
               +PWGC+ DSL+NAS LQKWLSDSG+PPQKMAIQ+VD+GERGLVALKNIRKGEKLLFV
Sbjct  61   QNMIPWGCEIDSLENASTLQKWLSDSGLPPQKMAIQKVDVGERGLVALKNIRKGEKLLFV  120

Query  424  PPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPY  603
            PPSLVITADS+WS P+AG+VLK+  VPDWPL+ATYLISEAS  KSSRWSNYISALP QPY
Sbjct  121  PPSLVITADSKWSCPEAGEVLKQCSVPDWPLLATYLISEASFEKSSRWSNYISALPRQPY  180

Query  604  SLLYWTRSELDRYLEASQI  660
            SLLYWTR+ELDRYLEASQI
Sbjct  181  SLLYWTRAELDRYLEASQI  199



>gb|KDO50961.1| hypothetical protein CISIN_1g010607mg [Citrus sinensis]
Length=506

 Score =   270 bits (689),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 135/199 (68%), Positives = 156/199 (78%), Gaps = 7/199 (4%)
 Frame = +1

Query  85   MPEASTIFQSTLLPPFSQSRRALSSPICHTFFRRNPTSFTTIRCS-SVSTEAAKIQT---  252
            M EAS  F + LLP FS   +A S      F R+       + CS S + +A++ +T   
Sbjct  1    MAEASRTFHTILLPSFSHLHKAQSPAGFTDFPRKRCGHRIVVHCSVSTTNDASRTKTTVT  60

Query  253  ---VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFV  423
               +PWGC+ DSL+NAS LQKWLSDSG+PPQKMAIQ+VD+GERGLVALKNIRKGEKLLFV
Sbjct  61   QNMIPWGCEIDSLENASTLQKWLSDSGLPPQKMAIQKVDVGERGLVALKNIRKGEKLLFV  120

Query  424  PPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPY  603
            PPSLVITADS+WS P+AG+VLK+  VPDWPL+ATYLISEAS  KSSRWSNYISALP QPY
Sbjct  121  PPSLVITADSKWSCPEAGEVLKQCSVPDWPLLATYLISEASFEKSSRWSNYISALPRQPY  180

Query  604  SLLYWTRSELDRYLEASQI  660
            SLLYWTR+ELDRYLEASQI
Sbjct  181  SLLYWTRAELDRYLEASQI  199



>ref|XP_008229941.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Prunus mume]
Length=497

 Score =   269 bits (687),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 133/195 (68%), Positives = 158/195 (81%), Gaps = 8/195 (4%)
 Frame = +1

Query  85   MPEASTIFQSTLLPPFSQSRRALSSPICHTF---FRRNPTSFTTIRCSSVSTEAAKIQTV  255
            M EAS + Q+TL+P F    +   SPI  +    FRRNP   T    +S ST+A   Q +
Sbjct  1    MAEASRVLQTTLIPSFHPQHK---SPIFQSLPLNFRRNPIQCTV--STSNSTKATVPQKI  55

Query  256  PWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPSL  435
            PWGC++DSL+NASALQKWL+DSG+PPQKMA+++V++GERGLVALKNIRKGEKLLFVPPSL
Sbjct  56   PWGCESDSLENASALQKWLTDSGLPPQKMALKKVEVGERGLVALKNIRKGEKLLFVPPSL  115

Query  436  VITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSLLY  615
             ITADSEW+  +AG+VLK+ GVPDWP +ATYLISEAS ++SSRWSNYISALP QPYSLLY
Sbjct  116  FITADSEWTCGEAGKVLKQNGVPDWPFLATYLISEASSLESSRWSNYISALPRQPYSLLY  175

Query  616  WTRSELDRYLEASQI  660
            WTR ELDRYLEASQI
Sbjct  176  WTREELDRYLEASQI  190



>ref|XP_011100518.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X2 [Sesamum 
indicum]
Length=403

 Score =   265 bits (676),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 136/201 (68%), Positives = 155/201 (77%), Gaps = 9/201 (4%)
 Frame = +1

Query  85   MPEASTIFQSTLLPPFSQ--SRRALSSPICHTF---FRRNPTSFTTIRCS----SVSTEA  237
            M EAS I Q+TL+  FSQ  S+  L +   H       +    F  IRCS    S   E+
Sbjct  1    MAEASRILQTTLISTFSQNPSQYTLKAHSHHYIPPSTSKRSNLFHRIRCSVSTASTGGES  60

Query  238  AKIQTVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLL  417
            A   T+PWGCD +SL+NASALQ+WLS  G+PPQKMAIQRVD+GERGLVALKNIRKGEKLL
Sbjct  61   ATGTTIPWGCDVESLENASALQEWLSKCGLPPQKMAIQRVDVGERGLVALKNIRKGEKLL  120

Query  418  FVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQ  597
            FVPPSL ITADSEWS  +AG+VLK+Y VPDWPL+ATYLISEA L+ SSRWSNYISALP Q
Sbjct  121  FVPPSLFITADSEWSCREAGEVLKQYNVPDWPLLATYLISEAGLMNSSRWSNYISALPRQ  180

Query  598  PYSLLYWTRSELDRYLEASQI  660
            PYSLLYWTR+ELDRYLEAS+I
Sbjct  181  PYSLLYWTRAELDRYLEASEI  201



>ref|XP_011100517.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X1 [Sesamum 
indicum]
Length=508

 Score =   266 bits (681),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 136/201 (68%), Positives = 155/201 (77%), Gaps = 9/201 (4%)
 Frame = +1

Query  85   MPEASTIFQSTLLPPFSQ--SRRALSSPICHTF---FRRNPTSFTTIRCS----SVSTEA  237
            M EAS I Q+TL+  FSQ  S+  L +   H       +    F  IRCS    S   E+
Sbjct  1    MAEASRILQTTLISTFSQNPSQYTLKAHSHHYIPPSTSKRSNLFHRIRCSVSTASTGGES  60

Query  238  AKIQTVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLL  417
            A   T+PWGCD +SL+NASALQ+WLS  G+PPQKMAIQRVD+GERGLVALKNIRKGEKLL
Sbjct  61   ATGTTIPWGCDVESLENASALQEWLSKCGLPPQKMAIQRVDVGERGLVALKNIRKGEKLL  120

Query  418  FVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQ  597
            FVPPSL ITADSEWS  +AG+VLK+Y VPDWPL+ATYLISEA L+ SSRWSNYISALP Q
Sbjct  121  FVPPSLFITADSEWSCREAGEVLKQYNVPDWPLLATYLISEAGLMNSSRWSNYISALPRQ  180

Query  598  PYSLLYWTRSELDRYLEASQI  660
            PYSLLYWTR+ELDRYLEAS+I
Sbjct  181  PYSLLYWTRAELDRYLEASEI  201



>ref|XP_010252799.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Nelumbo 
nucifera]
Length=502

 Score =   264 bits (674),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 139/203 (68%), Positives = 159/203 (78%), Gaps = 19/203 (9%)
 Frame = +1

Query  85   MPEASTIFQSTLLPPFSQ----SRRALSSPICHTFFRRNPTSFTTIRCS--SVSTEAAKI  246
            M EAST   +TL+P FSQ    SRR  + P       RN     +IRCS  + S ++ + 
Sbjct  1    MAEASTSLYTTLIPHFSQNPSPSRRTSALPTARD---RN-----SIRCSISATSNDSTRA  52

Query  247  -----QTVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEK  411
                 Q +PWGCD DSL+NASALQKWLS+SG+PPQKMAI++VDIGERGLVALKNIRKGEK
Sbjct  53   LVSVSQKIPWGCDVDSLENASALQKWLSESGLPPQKMAIEKVDIGERGLVALKNIRKGEK  112

Query  412  LLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALP  591
            LLF+PPSLVITADSEWS P+ G+VLKR  VPDWPL+ATYLISEAS++KSSRWSNYISALP
Sbjct  113  LLFIPPSLVITADSEWSCPEVGEVLKRNFVPDWPLLATYLISEASIMKSSRWSNYISALP  172

Query  592  TQPYSLLYWTRSELDRYLEASQI  660
             QPYSLLYWTRSELD YL ASQI
Sbjct  173  RQPYSLLYWTRSELDTYLVASQI  195



>emb|CBI28466.3| unnamed protein product [Vitis vinifera]
Length=497

 Score =   264 bits (674),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 136/199 (68%), Positives = 157/199 (79%), Gaps = 16/199 (8%)
 Frame = +1

Query  85   MPEASTIFQSTL---LPP-FSQSRRALSSPICHTFFRRNPTSFTTIRCSSVSTEAAKI--  246
            M EA  +F + L   LPP FSQ+    S PI     RR+P     IRCS  +T+ AK   
Sbjct  1    MAEACRMFHTALTLTLPPSFSQTPSRHSQPIP----RRHP-----IRCSISTTDTAKTSV  51

Query  247  -QTVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFV  423
             Q +PWGC+ DSL+NA+ LQKWLSDSG+PPQKM I+RV++GERGLVALKNIRKGEKLLFV
Sbjct  52   TQKIPWGCEVDSLENAALLQKWLSDSGLPPQKMGIERVEVGERGLVALKNIRKGEKLLFV  111

Query  424  PPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPY  603
            PPSLVITADSEWS  +AG+VLKR  VPDWPL+ATYLI EAS ++SSRWSNYISALP QPY
Sbjct  112  PPSLVITADSEWSCTEAGEVLKRNSVPDWPLLATYLIGEASFMQSSRWSNYISALPRQPY  171

Query  604  SLLYWTRSELDRYLEASQI  660
            SLLYWTR+ELD+YLEASQI
Sbjct  172  SLLYWTRAELDKYLEASQI  190



>ref|XP_002320530.2| hypothetical protein POPTR_0014s16720g [Populus trichocarpa]
 gb|EEE98845.2| hypothetical protein POPTR_0014s16720g [Populus trichocarpa]
Length=561

 Score =   265 bits (678),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 135/199 (68%), Positives = 155/199 (78%), Gaps = 10/199 (5%)
 Frame = +1

Query  85   MPEAS-TIFQSTLLPPF-----SQSRRALSSPICHTFFRRNPTSFTTIRCSSVSTEAAKI  246
            M EA   I  +T LP       +  + + S P  H   +R+P    +I  SS +  AAK+
Sbjct  59   MAEACRIILNTTFLPSLHSLHKTHKKVSYSQPFLH---KRHPAIQCSISTSSDTKAAAKV  115

Query  247  -QTVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFV  423
             +TVPWGCD DSL+NA ALQKWLSDSG+PPQKMAIQ+V++GERGLVALKNIRKGE LLFV
Sbjct  116  SETVPWGCDIDSLENAEALQKWLSDSGLPPQKMAIQKVEVGERGLVALKNIRKGEMLLFV  175

Query  424  PPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPY  603
            PPSLVI ADSEWS P+AG+VLK+Y VPDWPL+ATYLISEAS  KSSRWSNYISALP QPY
Sbjct  176  PPSLVIAADSEWSCPEAGEVLKKYSVPDWPLLATYLISEASFEKSSRWSNYISALPRQPY  235

Query  604  SLLYWTRSELDRYLEASQI  660
            SLLYWTR+ELD YLEASQI
Sbjct  236  SLLYWTRAELDTYLEASQI  254



>gb|EYU42781.1| hypothetical protein MIMGU_mgv1a004696mg [Erythranthe guttata]
Length=514

 Score =   263 bits (673),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 136/203 (67%), Positives = 157/203 (77%), Gaps = 11/203 (5%)
 Frame = +1

Query  85   MPEASTIFQSTLLPPFSQSRRALSSPICHTFFRRNP------TSFTTIRCS--SVSTEAA  240
            M EAS I Q+TL+  FSQ+ ++  +   H+  R  P      + F  IRCS  + S    
Sbjct  1    MAEASRILQTTLVHTFSQNPKSQITLRAHSNRRSFPPISKSSSLFRPIRCSVTTASGGGG  60

Query  241  KIQT---VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEK  411
            +I T   VPWGC+TDS +NASALQKWLS+SG+PPQKMAIQRV++GERGLVALKNIRKGE 
Sbjct  61   EIATQIGVPWGCETDSAENASALQKWLSESGLPPQKMAIQRVEVGERGLVALKNIRKGEN  120

Query  412  LLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALP  591
            LLFVPPSL ITADSEWS  +AG+V+KRY VPDWP +ATYLISEA L  SSRWSNYISALP
Sbjct  121  LLFVPPSLFITADSEWSNREAGEVMKRYNVPDWPFLATYLISEAGLKSSSRWSNYISALP  180

Query  592  TQPYSLLYWTRSELDRYLEASQI  660
             QPYSLLYWTRSELDRYLEAS+I
Sbjct  181  RQPYSLLYWTRSELDRYLEASEI  203



>ref|XP_002267469.2| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Vitis vinifera]
Length=577

 Score =   265 bits (676),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 136/201 (68%), Positives = 159/201 (79%), Gaps = 16/201 (8%)
 Frame = +1

Query  79   SAMPEASTIFQSTL---LPP-FSQSRRALSSPICHTFFRRNPTSFTTIRCSSVSTEAAKI  246
            ++M EA  +F + L   LPP FSQ+    S PI     RR+P     IRCS  +T+ AK 
Sbjct  79   ASMAEACRMFHTALTLTLPPSFSQTPSRHSQPIP----RRHP-----IRCSISTTDTAKT  129

Query  247  ---QTVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLL  417
               Q +PWGC+ DSL+NA+ LQKWLSDSG+PPQKM I+RV++GERGLVALKNIRKGEKLL
Sbjct  130  SVTQKIPWGCEVDSLENAALLQKWLSDSGLPPQKMGIERVEVGERGLVALKNIRKGEKLL  189

Query  418  FVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQ  597
            FVPPSLVITADSEWS  +AG+VLKR  VPDWPL+ATYLI EAS ++SSRWSNYISALP Q
Sbjct  190  FVPPSLVITADSEWSCTEAGEVLKRNSVPDWPLLATYLIGEASFMQSSRWSNYISALPRQ  249

Query  598  PYSLLYWTRSELDRYLEASQI  660
            PYSLLYWTR+ELD+YLEASQI
Sbjct  250  PYSLLYWTRAELDKYLEASQI  270



>ref|XP_002532210.1| Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit 
N-methyltransferase, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF30179.1| Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit 
N-methyltransferase, chloroplast precursor, putative [Ricinus 
communis]
Length=508

 Score =   262 bits (670),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 137/205 (67%), Positives = 156/205 (76%), Gaps = 17/205 (8%)
 Frame = +1

Query  85   MPEASTIFQSTLLPPFSQSRRALSSP--ICHTFFRRNPTSFTTIRC--SSVSTE------  234
            M EAS IFQ+TLLP FS    +L  P  + H         + TI C  SSVST       
Sbjct  1    MAEASRIFQTTLLPTFS----SLQKPRLVSHHPPNLAHKKYQTIHCLSSSVSTSDDITTA  56

Query  235  ---AAKIQTVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKG  405
                   Q VPWGCD DS DNA+ALQ+WLS++G+P QKMAI +V++GERGLVALKNIRKG
Sbjct  57   KAATTVTQMVPWGCDIDSSDNAAALQRWLSNNGLPDQKMAIDKVEVGERGLVALKNIRKG  116

Query  406  EKLLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISA  585
            EKLLFVPPSLVITADSEWS P+AG+VLK+Y VPDWPL+A YLISEA+L KSS+WSNYISA
Sbjct  117  EKLLFVPPSLVITADSEWSCPEAGEVLKQYSVPDWPLLAIYLISEANLQKSSKWSNYISA  176

Query  586  LPTQPYSLLYWTRSELDRYLEASQI  660
            LP QPYSLLYWTR+ELDRYLEASQI
Sbjct  177  LPRQPYSLLYWTRAELDRYLEASQI  201



>ref|XP_011008074.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Populus euphratica]
Length=503

 Score =   261 bits (668),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 134/196 (68%), Positives = 153/196 (78%), Gaps = 4/196 (2%)
 Frame = +1

Query  85   MPEASTIFQSTLLPPFSQSRRALSSPI-CHTFF--RRNPTSFTTIRCSSVSTEAAKI-QT  252
            M EA  I  +T   P   S       + C   F  +R+P    +I  SS +  AAK+ +T
Sbjct  1    MAEACRIILNTTFRPSLHSLHKTQKKVSCSQPFLPKRHPAIQCSISTSSDTKAAAKVSET  60

Query  253  VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPS  432
            VPWGCD DSL+NA ALQKWLSDSG+PPQKMAIQ+V++GERGLVALKNIRKGE LLFVPPS
Sbjct  61   VPWGCDIDSLENAEALQKWLSDSGLPPQKMAIQKVEVGERGLVALKNIRKGEMLLFVPPS  120

Query  433  LVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSLL  612
            LVI+ADSEWS P+AG+VLK+Y VPDWPL+ATYLISEAS  KSSRWSNYISALP QPYSLL
Sbjct  121  LVISADSEWSCPEAGEVLKQYSVPDWPLLATYLISEASFEKSSRWSNYISALPRQPYSLL  180

Query  613  YWTRSELDRYLEASQI  660
            YWTR+ELD YLEASQI
Sbjct  181  YWTRAELDTYLEASQI  196



>ref|XP_010088354.1| Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit 
N-methyltransferase [Morus notabilis]
 gb|EXB34472.1| Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit 
N-methyltransferase [Morus notabilis]
Length=527

 Score =   262 bits (669),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 136/199 (68%), Positives = 158/199 (79%), Gaps = 11/199 (6%)
 Frame = +1

Query  85   MPEASTIFQSTLL---PPFSQSRRALSSPICHTFFRRNPTSFTTIRCSSVSTEAAKI---  246
            M EAS I Q++L+    PF ++      P+    FRRNPT    I+CS  ++E  K    
Sbjct  1    MAEASGILQTSLISNFHPFHKTHLPQLHPVLS--FRRNPT--IPIQCSVSTSETTKTTTT  56

Query  247  -QTVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFV  423
               +PWGCD DSL+NASALQKWLS SG+PPQKMAI+RVD+GERGLVALKNIRKGEKLLFV
Sbjct  57   QNAIPWGCDIDSLENASALQKWLSQSGLPPQKMAIERVDVGERGLVALKNIRKGEKLLFV  116

Query  424  PPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPY  603
            PPSLVI+ADSEWS  +AG+V+K+  VPDWPL+ATYLISEASL++SSRWSNYISALP QPY
Sbjct  117  PPSLVISADSEWSCEEAGEVMKKNSVPDWPLLATYLISEASLMESSRWSNYISALPRQPY  176

Query  604  SLLYWTRSELDRYLEASQI  660
            SLLYWTR ELDRYLEASQI
Sbjct  177  SLLYWTRDELDRYLEASQI  195



>ref|XP_003542190.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Glycine max]
Length=499

 Score =   259 bits (662),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 129/194 (66%), Positives = 154/194 (79%), Gaps = 6/194 (3%)
 Frame = +1

Query  82   AMPEASTI-FQSTLLPPFSQSRRALSSPICHTFFRRNPTSFTTIRCSSVSTEAAKIQTVP  258
            AM EAS I   STLLP F+       + + H     + +    ++CS  +  AA+   V 
Sbjct  4    AMAEASRITLHSTLLPFFTPK-----THVGHRHLSLSSSRKHQVQCSVSAGAAAQTNPVA  58

Query  259  WGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPSLV  438
            WGC+ DSL+N+SALQ+WLS+SG+PPQKM I+RV++GERGLVALKNIRKGEKLLFVPPSLV
Sbjct  59   WGCEIDSLENSSALQRWLSESGLPPQKMGIERVEVGERGLVALKNIRKGEKLLFVPPSLV  118

Query  439  ITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSLLYW  618
            IT DSEWS P+AG+VLKR  VPDWPL+ATYLISEASL++SSRWSNYISALP QPYSLLYW
Sbjct  119  ITPDSEWSCPEAGEVLKRNSVPDWPLLATYLISEASLMESSRWSNYISALPRQPYSLLYW  178

Query  619  TRSELDRYLEASQI  660
            T++ELDRYLEASQI
Sbjct  179  TQAELDRYLEASQI  192



>ref|XP_004243586.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Solanum lycopersicum]
Length=501

 Score =   255 bits (651),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 129/196 (66%), Positives = 152/196 (78%), Gaps = 6/196 (3%)
 Frame = +1

Query  85   MPEASTIFQSTLLPPFSQSRRALSSPICHTFFRRNPTSFTTIRCSSVST----EAAKIQT  252
            M E + I Q  LLPPF       ++   H    R      +IRCSS+ST    ++ K Q 
Sbjct  1    MAEVTKILQPVLLPPFFHKLDGTTN--SHFRLCRRNRRNISIRCSSISTTETNKSTKTQN  58

Query  253  VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPS  432
            +PWGC+TDS++NAS LQKWL++SG+P QK+ +QRV++GERGLVA  NIRKGE+LLFVPPS
Sbjct  59   IPWGCETDSIENASNLQKWLTESGLPAQKLDLQRVNVGERGLVANNNIRKGERLLFVPPS  118

Query  433  LVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSLL  612
            LVITADS+WS  DAG VLK+Y VPDWP IATYLISEASL+KSSRWSNYISALP QPYSLL
Sbjct  119  LVITADSKWSNSDAGDVLKQYNVPDWPFIATYLISEASLMKSSRWSNYISALPRQPYSLL  178

Query  613  YWTRSELDRYLEASQI  660
            YWT+SELDRYLEASQI
Sbjct  179  YWTQSELDRYLEASQI  194



>gb|KHG30782.1| Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit 
N-methyltransferase, chloroplastic [Gossypium arboreum]
Length=504

 Score =   255 bits (651),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 136/203 (67%), Positives = 152/203 (75%), Gaps = 17/203 (8%)
 Frame = +1

Query  85   MPEASTIFQSTLLPPFSQSRRALSSPI--CHTF----FRRNPTSFTTIRCSSVSTEAAK-  243
            M EAS IF STL P  S     LS P    H +     ++ P     ++CS  ++E    
Sbjct  1    MAEASRIFHSTLFPTLSLQ---LSKPCYNSHVYPSLSLKKAPR---PVQCSVSTSETKST  54

Query  244  ----IQTVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEK  411
                 Q VPWGCD DSL+NA ALQKWLSDSG+PPQKMAI +V +GERGLVALKN+RKGEK
Sbjct  55   SSNATQEVPWGCDIDSLENAEALQKWLSDSGLPPQKMAIDKVAVGERGLVALKNVRKGEK  114

Query  412  LLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALP  591
            LLFVPPSL ITADSEWS P+AGQVLK+Y VPDWPL+ATYLISEAS  KSSRW NYISALP
Sbjct  115  LLFVPPSLFITADSEWSSPEAGQVLKQYSVPDWPLLATYLISEASAQKSSRWCNYISALP  174

Query  592  TQPYSLLYWTRSELDRYLEASQI  660
             QPYSLLYWTR+ELDRYLEASQI
Sbjct  175  RQPYSLLYWTRAELDRYLEASQI  197



>ref|XP_010689223.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=500

 Score =   254 bits (650),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 133/196 (68%), Positives = 152/196 (78%), Gaps = 7/196 (4%)
 Frame = +1

Query  85   MPEAST-IFQSTLLPP-FSQSRRALSSPICHTFFRRNPTSFTTIRCS--SVSTEAAKIQT  252
            M EAST IF+STLLP  FSQ+      P    F  +   S + IRCS  +  T    +  
Sbjct  1    MAEASTVIFRSTLLPSMFSQNHHL---PYSKHFRTKTLNSPSQIRCSISTSDTPFTAVGR  57

Query  253  VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPS  432
            +PWGC+ DS++NA ALQKWLS SG+PPQKM I++VD+GERGLVA  NIRKGEKLLFVPPS
Sbjct  58   IPWGCEVDSVENAEALQKWLSGSGLPPQKMRIEKVDVGERGLVANNNIRKGEKLLFVPPS  117

Query  433  LVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSLL  612
            LVI+ADS WS P+AG+VLKR  VPDWPL+ATYLISEAS + SSRWSNYISALP QPYSLL
Sbjct  118  LVISADSVWSCPEAGKVLKRNSVPDWPLLATYLISEASQMSSSRWSNYISALPRQPYSLL  177

Query  613  YWTRSELDRYLEASQI  660
            YWTRSELDRYLEASQI
Sbjct  178  YWTRSELDRYLEASQI  193



>ref|XP_010048281.1| PREDICTED: LOW QUALITY PROTEIN: ribulose-1,5 bisphosphate carboxylase/oxygenase 
large subunit N-methyltransferase, chloroplastic 
[Eucalyptus grandis]
Length=506

 Score =   254 bits (649),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 130/197 (66%), Positives = 151/197 (77%), Gaps = 10/197 (5%)
 Frame = +1

Query  94   ASTIFQSTLLPPFSQSRRALSSPICHTFFRRNPT-----SFTTIRCS---SVSTEAAKIQ  249
            AS IF ++LLPPFS  RR    P     F   P+     + + + CS   + +  +   +
Sbjct  5    ASRIFHASLLPPFSPLRRGPHKP--RPRFPPGPSLLPPATASKVVCSVPAAAARASEARR  62

Query  250  TVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPP  429
             +PWGCD DSL+NASALQ WLSDSG+PPQKMAIQRVD+GERG VALKN+RKGEKLLFVPP
Sbjct  63   MIPWGCDVDSLENASALQGWLSDSGLPPQKMAIQRVDVGERGXVALKNVRKGEKLLFVPP  122

Query  430  SLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSL  609
             LVITADSEW   +AG+VLK+  VPDWPL+A YLISEASL+ SSRWSNYISALP QPYSL
Sbjct  123  PLVITADSEWGCAEAGEVLKKNSVPDWPLLAIYLISEASLMGSSRWSNYISALPRQPYSL  182

Query  610  LYWTRSELDRYLEASQI  660
            LYWTR+ELDRYLEASQI
Sbjct  183  LYWTRAELDRYLEASQI  199



>gb|KJB10233.1| hypothetical protein B456_001G190900 [Gossypium raimondii]
Length=483

 Score =   253 bits (645),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 153/204 (75%), Gaps = 17/204 (8%)
 Frame = +1

Query  82   AMPEASTIFQSTLLPPFSQSRRALSSPI--CHTF----FRRNPTSFTTIRCSSVSTEAAK  243
            AM EAS IF STL+P  S     LS P    H +     ++ P     ++CS  ++E   
Sbjct  54   AMAEASRIFHSTLIPTLSLQ---LSKPCYNSHVYPSLSLKKAPR---PVQCSVSTSETKS  107

Query  244  -----IQTVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGE  408
                  Q VPWGCD DSL+NA ALQKWLS+SG+PPQKMAI +V +GERGLVALKNIRKGE
Sbjct  108  TSSNATQEVPWGCDIDSLENAEALQKWLSNSGLPPQKMAIDKVAVGERGLVALKNIRKGE  167

Query  409  KLLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISAL  588
            KLLFVPPSL ITADSEWS P+AG VLK+Y VPDWPL+ATYLISEAS  KSSRW NYISAL
Sbjct  168  KLLFVPPSLFITADSEWSSPEAGLVLKQYSVPDWPLLATYLISEASAQKSSRWCNYISAL  227

Query  589  PTQPYSLLYWTRSELDRYLEASQI  660
            P QPYSLLYWTR+ELDRYLEASQI
Sbjct  228  PRQPYSLLYWTRAELDRYLEASQI  251



>gb|KJB10232.1| hypothetical protein B456_001G190900 [Gossypium raimondii]
Length=558

 Score =   253 bits (647),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 153/204 (75%), Gaps = 17/204 (8%)
 Frame = +1

Query  82   AMPEASTIFQSTLLPPFSQSRRALSSPI--CHTF----FRRNPTSFTTIRCSSVSTEAAK  243
            AM EAS IF STL+P  S     LS P    H +     ++ P     ++CS  ++E   
Sbjct  54   AMAEASRIFHSTLIPTLSLQ---LSKPCYNSHVYPSLSLKKAPR---PVQCSVSTSETKS  107

Query  244  -----IQTVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGE  408
                  Q VPWGCD DSL+NA ALQKWLS+SG+PPQKMAI +V +GERGLVALKNIRKGE
Sbjct  108  TSSNATQEVPWGCDIDSLENAEALQKWLSNSGLPPQKMAIDKVAVGERGLVALKNIRKGE  167

Query  409  KLLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISAL  588
            KLLFVPPSL ITADSEWS P+AG VLK+Y VPDWPL+ATYLISEAS  KSSRW NYISAL
Sbjct  168  KLLFVPPSLFITADSEWSSPEAGLVLKQYSVPDWPLLATYLISEASAQKSSRWCNYISAL  227

Query  589  PTQPYSLLYWTRSELDRYLEASQI  660
            P QPYSLLYWTR+ELDRYLEASQI
Sbjct  228  PRQPYSLLYWTRAELDRYLEASQI  251



>ref|XP_007049391.1| Rubisco methyltransferase family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007049392.1| Rubisco methyltransferase family protein isoform 1 [Theobroma 
cacao]
 gb|EOX93548.1| Rubisco methyltransferase family protein isoform 1 [Theobroma 
cacao]
 gb|EOX93549.1| Rubisco methyltransferase family protein isoform 1 [Theobroma 
cacao]
Length=506

 Score =   249 bits (637),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 142/202 (70%), Positives = 156/202 (77%), Gaps = 13/202 (6%)
 Frame = +1

Query  85   MPEASTIFQSTLLPPFS-QSRRALSSPICHTF----FRRNPTSFTTIRCSSVSTEAAKI-  246
            M EAS IF +TLLP FS Q    L     HTF    F++  +    ++CS  ++E     
Sbjct  1    MAEASRIFHATLLPTFSPQLHHKLRHSHSHTFPSLSFKKERS---VVQCSVSTSETRTTS  57

Query  247  ----QTVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKL  414
                Q VPWGCD DSL+NA  LQKWLSDSG+PPQKMAI +VDIGERGLVALKNIRKGEKL
Sbjct  58   SNTTQEVPWGCDIDSLENAEDLQKWLSDSGLPPQKMAIDKVDIGERGLVALKNIRKGEKL  117

Query  415  LFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPT  594
            LFVPPSL ITADSEWS P+AGQVLK+Y VPDWPLIATYLISEAS  KSSRWSNYISALP 
Sbjct  118  LFVPPSLFITADSEWSSPEAGQVLKQYSVPDWPLIATYLISEASSSKSSRWSNYISALPR  177

Query  595  QPYSLLYWTRSELDRYLEASQI  660
            QPYSLLYWTR+ELDRYLEASQI
Sbjct  178  QPYSLLYWTRAELDRYLEASQI  199



>ref|XP_004502116.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Cicer arietinum]
Length=503

 Score =   247 bits (631),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 129/200 (65%), Positives = 157/200 (79%), Gaps = 12/200 (6%)
 Frame = +1

Query  85   MPEAS-TIFQST--LLPPFS-----QSRRALSSPICHTFFRRNPTSFTTIRCSSVSTEAA  240
            M EAS  +F +T  L+P F+     ++   LS P   T  RR+   F+ +  +   T AA
Sbjct  1    MVEASGMMFTNTTNLIPAFTPTTFHRTYLGLSQP---TLSRRHHIHFS-VSATQSQTSAA  56

Query  241  KIQTVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLF  420
             ++T+PWGC+ DSL+N+S+LQ WLSDSG+P QKMAI +VD+GERGLVALKNIRKGEKLLF
Sbjct  57   LVETIPWGCENDSLENSSSLQTWLSDSGLPFQKMAIDKVDVGERGLVALKNIRKGEKLLF  116

Query  421  VPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQP  600
            VPPSLVIT DSEWS P+AG+VLKR  VPDWPL+ATYLISEASL+KSSRW +YISALP QP
Sbjct  117  VPPSLVITPDSEWSCPEAGEVLKRNSVPDWPLLATYLISEASLMKSSRWCSYISALPRQP  176

Query  601  YSLLYWTRSELDRYLEASQI  660
            YSLLYW+++ELDRYLEAS I
Sbjct  177  YSLLYWSQAELDRYLEASLI  196



>ref|XP_006407809.1| hypothetical protein EUTSA_v10020552mg [Eutrema salsugineum]
 gb|ESQ49262.1| hypothetical protein EUTSA_v10020552mg [Eutrema salsugineum]
Length=506

 Score =   246 bits (627),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 125/200 (63%), Positives = 153/200 (77%), Gaps = 10/200 (5%)
 Frame = +1

Query  85   MPEASTIFQSTLLPPFSQSRRALSSPICHTF-----FRRNPTSFTTIRCSSVSTEAAKIQ  249
            M ++S++ QSTLLP FS   +  +     +       R  P  + ++  S+  T    ++
Sbjct  1    MAKSSSVLQSTLLPAFSPLHKLRNQNFTLSLPPLPVSRCRPGIYCSV--SAGETTRRSVE  58

Query  250  TVP---WGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLF  420
              P   WGC+ DS++NA++LQKWLSDSG+PPQKMAI RVDIGERGLVA +N+RKGEKLLF
Sbjct  59   EAPDISWGCEIDSVENATSLQKWLSDSGLPPQKMAIDRVDIGERGLVASQNLRKGEKLLF  118

Query  421  VPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQP  600
            VPPSLVI+ADSEW+ P+AG+V+KRY VPDWPL+ATYLISEASL KSSRW NYISALP QP
Sbjct  119  VPPSLVISADSEWTNPEAGEVMKRYDVPDWPLLATYLISEASLQKSSRWFNYISALPRQP  178

Query  601  YSLLYWTRSELDRYLEASQI  660
            YSLLYWTR+ELD YLEASQI
Sbjct  179  YSLLYWTRTELDMYLEASQI  198



>ref|XP_010486336.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Camelina 
sativa]
Length=507

 Score =   245 bits (626),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 153/202 (76%), Gaps = 14/202 (7%)
 Frame = +1

Query  85   MPEASTIFQSTLLPPFSQSRRALSSPICHTF-----FRRNPTSFTTIRCSSVSTEAAK--  243
            M +AS++ QSTLLP +S   +  +     +F      R  P     I CS  + E  +  
Sbjct  1    MAKASSVLQSTLLPAYSPLHKLRNQSFILSFPPLPVSRCRPG----IHCSVSAGETTRRS  56

Query  244  IQTVP---WGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKL  414
            ++  P   WGC+ DSL+NA++LQ WLS+SG+PPQKMAI RVDIGERGLVA +N+RKGEKL
Sbjct  57   VEEAPDISWGCEIDSLENATSLQNWLSESGLPPQKMAIDRVDIGERGLVASQNLRKGEKL  116

Query  415  LFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPT  594
            LFVPPSLVI+ADSEW+ P+AG+V+KRY VPDWPL+ATYLISEASL K+SRW NYISALP 
Sbjct  117  LFVPPSLVISADSEWTNPEAGEVMKRYDVPDWPLLATYLISEASLQKNSRWFNYISALPR  176

Query  595  QPYSLLYWTRSELDRYLEASQI  660
            QPYSLLYWTR+ELD YLEASQI
Sbjct  177  QPYSLLYWTRTELDMYLEASQI  198



>ref|XP_003601528.1| SET domain-containing protein [Medicago truncatula]
 gb|AES71779.1| rubisco methyltransferase family protein [Medicago truncatula]
 gb|AFK38105.1| unknown [Medicago truncatula]
Length=497

 Score =   244 bits (624),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 122/198 (62%), Positives = 152/198 (77%), Gaps = 13/198 (7%)
 Frame = +1

Query  79   SAMPEASTIFQ----STLLPPFSQSRRALSSPICHTFFRRNPTSFTTIRCSSVSTEAAKI  246
            + M EA  +F     +TL+P F+Q+   +         RRN   FT      +S  ++ I
Sbjct  2    TTMVEALGMFMFTNTTTLIPAFNQT---IHKTTHLGLSRRNHAHFT------LSATSSLI  52

Query  247  QTVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVP  426
            +T+PWGC+ DS++N+S+LQKWLS SG+P QKM+I +VD+GERGLVAL NIRKGEKLLFVP
Sbjct  53   ETIPWGCENDSIENSSSLQKWLSQSGLPSQKMSIDKVDVGERGLVALNNIRKGEKLLFVP  112

Query  427  PSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYS  606
            P LVIT DSEWS P+AG+VLK+  VPDWPL+ATYLISEASL+KSSRW +YISALP QPYS
Sbjct  113  PQLVITPDSEWSCPEAGEVLKKNSVPDWPLLATYLISEASLMKSSRWFSYISALPRQPYS  172

Query  607  LLYWTRSELDRYLEASQI  660
            LLYW+++ELDRYLEASQI
Sbjct  173  LLYWSQAELDRYLEASQI  190



>gb|KFK38228.1| hypothetical protein AALP_AA3G085300 [Arabis alpina]
Length=506

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 126/206 (61%), Positives = 152/206 (74%), Gaps = 22/206 (11%)
 Frame = +1

Query  85   MPEASTIFQSTLLPPFSQSRRALSSPICHTFFRRNPTSF---------TTIRCSSVSTEA  237
            M +AS++ QSTLLPPFS        P+    F+ +  S            I CS  + E 
Sbjct  1    MAKASSVLQSTLLPPFS--------PLPKLRFQTSTVSLPPSPPFRCRQGIHCSVSAGET  52

Query  238  AK--IQTVP---WGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRK  402
             +  ++  P   WGC+ DSL+NA++LQ WLSDSG+PPQKM+I +VDIGERGLVA +N+RK
Sbjct  53   TRRSVEEAPDISWGCEIDSLENATSLQNWLSDSGLPPQKMSIDKVDIGERGLVASQNLRK  112

Query  403  GEKLLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYIS  582
            GEKLLFVPPSLVI+ADS W+ P+AG+V+KRY VPDWPL+ATYLISEAS  KSSRW NYIS
Sbjct  113  GEKLLFVPPSLVISADSGWTNPEAGEVMKRYDVPDWPLLATYLISEASFQKSSRWYNYIS  172

Query  583  ALPTQPYSLLYWTRSELDRYLEASQI  660
            ALP QPYSLLYWTR+ELD YLEASQI
Sbjct  173  ALPRQPYSLLYWTRTELDMYLEASQI  198



>ref|XP_006297498.1| hypothetical protein CARUB_v10013517mg [Capsella rubella]
 gb|EOA30396.1| hypothetical protein CARUB_v10013517mg [Capsella rubella]
Length=498

 Score =   244 bits (623),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 153/202 (76%), Gaps = 14/202 (7%)
 Frame = +1

Query  85   MPEASTIFQSTLLPPFSQSRRALSSPICHTF-----FRRNPTSFTTIRCSSVSTEAAK--  243
            M +AS++ QSTLLP +S   +  +     +F      R  P     I CS  + E  +  
Sbjct  1    MAKASSVLQSTLLPAYSPLYKLRNQSFTLSFPPLPVSRCRPG----IHCSVSAGETTRRS  56

Query  244  IQTVP---WGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKL  414
            ++  P   WGC+ DSL+NA++LQ WLSDSG+PPQKM+I RVDIGERGLVA +N+RKGEKL
Sbjct  57   VEEAPDISWGCEIDSLENATSLQNWLSDSGLPPQKMSIDRVDIGERGLVASQNLRKGEKL  116

Query  415  LFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPT  594
            LFVPPSLVI+ADSEW+ P+AG+V+KRY VPDWPL+ATYLISEASL K+SRW NYISALP 
Sbjct  117  LFVPPSLVISADSEWTNPEAGEVMKRYDVPDWPLLATYLISEASLQKNSRWFNYISALPR  176

Query  595  QPYSLLYWTRSELDRYLEASQI  660
            QPYSLLYWTR+ELD YLEASQI
Sbjct  177  QPYSLLYWTRTELDMYLEASQI  198



>ref|XP_003605258.1| SET domain-containing protein [Medicago truncatula]
Length=494

 Score =   244 bits (623),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 122/196 (62%), Positives = 151/196 (77%), Gaps = 13/196 (7%)
 Frame = +1

Query  85   MPEASTIFQ----STLLPPFSQSRRALSSPICHTFFRRNPTSFTTIRCSSVSTEAAKIQT  252
            M EA  +F     +TL+P F+Q+   +         RRN   FT      +S  ++ I+T
Sbjct  1    MVEALGMFMFTNTTTLIPAFNQT---IHKTTHLGLSRRNHAHFT------LSATSSLIET  51

Query  253  VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPS  432
            +PWGC+ DS++N+S+LQKWLS SG+P QKM+I +VD+GERGLVAL NIRKGEKLLFVPP 
Sbjct  52   IPWGCENDSIENSSSLQKWLSQSGLPSQKMSIDKVDVGERGLVALNNIRKGEKLLFVPPQ  111

Query  433  LVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSLL  612
            LVIT DSEWS P+AG+VLK+  VPDWPL+ATYLISEASL+KSSRW +YISALP QPYSLL
Sbjct  112  LVITPDSEWSCPEAGEVLKKNSVPDWPLLATYLISEASLMKSSRWFSYISALPRQPYSLL  171

Query  613  YWTRSELDRYLEASQI  660
            YW+++ELDRYLEASQI
Sbjct  172  YWSQAELDRYLEASQI  187



>ref|XP_010456598.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Camelina 
sativa]
Length=507

 Score =   244 bits (622),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 153/202 (76%), Gaps = 14/202 (7%)
 Frame = +1

Query  85   MPEASTIFQSTLLPPFSQSRRALSSPICHTF-----FRRNPTSFTTIRCSSVSTEAAK--  243
            M +AS++ QSTLLP +S   +  +     +F      R  P     I CS  + E  +  
Sbjct  1    MAKASSVLQSTLLPAYSPLLKLRNQSFILSFPPLPVSRCRPG----IHCSVSAGETTRRS  56

Query  244  IQTVP---WGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKL  414
            ++  P   WGC+ DSL+NA++LQ WLS+SG+PPQKMAI RVDIGERGLVA +N+RKGEKL
Sbjct  57   VEDAPDISWGCEIDSLENATSLQNWLSESGLPPQKMAIDRVDIGERGLVASQNLRKGEKL  116

Query  415  LFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPT  594
            LFVPPSLVI+ADSEW+ P+AG+V+KRY VPDWPL+ATYLISEASL K+SRW NYISALP 
Sbjct  117  LFVPPSLVISADSEWTNPEAGEVMKRYDVPDWPLLATYLISEASLQKNSRWFNYISALPR  176

Query  595  QPYSLLYWTRSELDRYLEASQI  660
            QPYSLLYWTR+ELD YLEASQI
Sbjct  177  QPYSLLYWTRTELDMYLEASQI  198



>ref|XP_002882542.1| SET domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58801.1| SET domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=504

 Score =   243 bits (620),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/194 (62%), Positives = 147/194 (76%), Gaps = 6/194 (3%)
 Frame = +1

Query  97   STIFQSTLLPPFSQSRRALSSPICHTF-----FRRNPTSFTTIRCSSVSTEAAK-IQTVP  258
            + + QSTLLP +S   +  +     +F      R  P    ++     +T + +    + 
Sbjct  4    ACVLQSTLLPAYSPLHKLRNQNFTLSFPPLPVSRCRPGIHCSVSAGETTTRSVEEAPEIS  63

Query  259  WGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPSLV  438
            WGC+ DSL+NA++LQ WLSDSG+PPQKMAI RVDIGERGLVA +N+RKGEKLLFVPPSLV
Sbjct  64   WGCEIDSLENATSLQNWLSDSGLPPQKMAIDRVDIGERGLVASQNLRKGEKLLFVPPSLV  123

Query  439  ITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSLLYW  618
            I+ADSEW+ P+AG+V+KRY VPDWPL+ATYLISEASL KSSRW NYISALP QPYSLLYW
Sbjct  124  ISADSEWTNPEAGEVMKRYDVPDWPLLATYLISEASLQKSSRWYNYISALPRQPYSLLYW  183

Query  619  TRSELDRYLEASQI  660
            TR+ELD YLEASQI
Sbjct  184  TRTELDMYLEASQI  197



>ref|XP_010464405.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Camelina 
sativa]
Length=507

 Score =   243 bits (619),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 153/201 (76%), Gaps = 12/201 (6%)
 Frame = +1

Query  85   MPEASTIFQSTLLPPFS--QSRRALSSPICHTFFRRNPTSFT--TIRCSSVSTEAAK--I  246
            M +AS++ QSTLLP +S     R  SS +    F   P S     I CS  + E  +  +
Sbjct  1    MAKASSVLQSTLLPAYSPLHKLRNQSSILS---FPPLPVSRCRPGIHCSVSAGETTRRSV  57

Query  247  QTVP---WGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLL  417
            +  P   WGC+ DSL+NA++LQ WLS+SG+PPQKMAI RVDIGERGLVA +N+RKGEKLL
Sbjct  58   EEAPDISWGCEIDSLENATSLQNWLSESGLPPQKMAIDRVDIGERGLVASQNLRKGEKLL  117

Query  418  FVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQ  597
            FVPPSLVI+ADSEW+ P+AG+V+KRY VPDWPL+ATYLISEAS  K+SRW NYISALP Q
Sbjct  118  FVPPSLVISADSEWTNPEAGEVMKRYDVPDWPLLATYLISEASFQKNSRWFNYISALPRQ  177

Query  598  PYSLLYWTRSELDRYLEASQI  660
            PYSLLYWTR+ELD YLEASQI
Sbjct  178  PYSLLYWTRTELDMYLEASQI  198



>ref|NP_187424.1| Rubisco methyltransferase family protein [Arabidopsis thaliana]
 gb|AAF13085.1|AC009176_12 putative ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit N-methyltransferase I [Arabidopsis thaliana]
 gb|AAF21177.1|AC013483_1 putative ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit N-methyltransferase I [Arabidopsis thaliana]
 gb|AAK76599.1| putative ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit N-methyltransferase I [Arabidopsis thaliana]
 gb|AAL85066.1| putative ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit N-methyltransferase I [Arabidopsis thaliana]
 gb|AEE74585.1| Rubisco methyltransferase family protein [Arabidopsis thaliana]
Length=504

 Score =   242 bits (618),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 149/197 (76%), Gaps = 12/197 (6%)
 Frame = +1

Query  97   STIFQSTLLPPFSQSRRALSSPICHTFFRRNPTSFTTIR---CSSVSTEAAKIQT-----  252
            + + QSTLLP +S   +  +  I  +F   +P   +  R     SVS     IQ+     
Sbjct  4    ACLLQSTLLPAYSPLHKLRNQNITLSF---SPLPLSRCRPGIHCSVSAGETTIQSMEEAP  60

Query  253  -VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPP  429
             + WGC+ DSL+NA++LQ WLSDSG+PPQKMAI RVDIGERGLVA +N+RKGEKLLFVPP
Sbjct  61   KISWGCEIDSLENATSLQNWLSDSGLPPQKMAIDRVDIGERGLVASQNLRKGEKLLFVPP  120

Query  430  SLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSL  609
            SLVI+ADSEW+  +AG+V+KRY VPDWPL+ATYLISEASL KSSRW NYISALP QPYSL
Sbjct  121  SLVISADSEWTNAEAGEVMKRYDVPDWPLLATYLISEASLQKSSRWFNYISALPRQPYSL  180

Query  610  LYWTRSELDRYLEASQI  660
            LYWTR+ELD YLEASQI
Sbjct  181  LYWTRTELDMYLEASQI  197



>ref|XP_007146016.1| hypothetical protein PHAVU_006G005700g [Phaseolus vulgaris]
 gb|ESW18010.1| hypothetical protein PHAVU_006G005700g [Phaseolus vulgaris]
Length=492

 Score =   241 bits (616),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 127/193 (66%), Positives = 149/193 (77%), Gaps = 9/193 (5%)
 Frame = +1

Query  85   MPEASTI-FQSTLLPPFSQSRRALSSPICHTFFRRNPTSFTTIRCSSVSTEAAKIQTVPW  261
            M EAST+ F STLLP F         P+  T  R+       +RCS VS  A     V W
Sbjct  1    MAEASTVTFFSTLLPSFRPHAHVSHRPL--TLPRK-----LQVRCS-VSAGATPQNAVAW  52

Query  262  GCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPSLVI  441
            GC+ +SL++ASALQ+WLS SG+PPQKM I RV++GERGLVALK+IRKGEKLLFVPPSLVI
Sbjct  53   GCEIESLESASALQRWLSKSGLPPQKMGIDRVEVGERGLVALKSIRKGEKLLFVPPSLVI  112

Query  442  TADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSLLYWT  621
            T +SEWS P+ G+VLKR  VPDWPL+ATYLISEASL++SSRWSNYISALP QPYSLLYW+
Sbjct  113  TPNSEWSHPETGEVLKRNSVPDWPLLATYLISEASLMESSRWSNYISALPRQPYSLLYWS  172

Query  622  RSELDRYLEASQI  660
            ++ELD YLEASQI
Sbjct  173  QAELDLYLEASQI  185



>ref|XP_010524627.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Tarenaya hassleriana]
Length=508

 Score =   241 bits (616),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 127/206 (62%), Positives = 149/206 (72%), Gaps = 19/206 (9%)
 Frame = +1

Query  85   MPEASTIFQSTLLP---PFSQSRR----ALSSPICHTFFRRNPTSFTTIRCSSVSTEAAK  243
            M EAS + QS L P   PF +  R     LS P      RR       + CS  + EA +
Sbjct  1    MAEASIVLQSALFPTLSPFHKLHRDQHSTLSFPSPAVARRRQ-----VVHCSVSAGEAMR  55

Query  244  IQTVP-------WGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRK  402
              +V        WGC+ DS++NA++LQ+WLSDSG+PPQKMAI +V IGERGLVA KNIRK
Sbjct  56   RASVEEDSPEISWGCEVDSVENATSLQRWLSDSGLPPQKMAIDKVSIGERGLVASKNIRK  115

Query  403  GEKLLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYIS  582
            GEKLLFVPPSLVIT+DS+WS P+AG+++KRY VPDWPL+ATYLISEASL   S W NYIS
Sbjct  116  GEKLLFVPPSLVITSDSKWSKPEAGELMKRYDVPDWPLLATYLISEASLGNDSVWYNYIS  175

Query  583  ALPTQPYSLLYWTRSELDRYLEASQI  660
            ALP QPYSLLYWTR+ELDRYLEASQI
Sbjct  176  ALPRQPYSLLYWTRAELDRYLEASQI  201



>gb|AAM61650.1| putative ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit N-methyltransferase I [Arabidopsis thaliana]
Length=504

 Score =   241 bits (615),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 124/197 (63%), Positives = 149/197 (76%), Gaps = 12/197 (6%)
 Frame = +1

Query  97   STIFQSTLLPPFSQSRRALSSPICHTFFRRNPTSFTTIR---CSSVSTEAAKIQT-----  252
            + + QSTLLP +S   +  +  I  +F   +P   +  R     SVS     IQ+     
Sbjct  4    ACLLQSTLLPAYSPLHKLRNQNITLSF---SPLPLSRCRPGIHCSVSAGETTIQSMEEAP  60

Query  253  -VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPP  429
             + WGC+ DSL+NA++LQ WLSDSG+PPQKMAI RVDIGERGLVA +N+RKGEKLLFVPP
Sbjct  61   KISWGCEIDSLENATSLQNWLSDSGLPPQKMAIDRVDIGERGLVASQNLRKGEKLLFVPP  120

Query  430  SLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSL  609
            SLVI+ADSEW+  +AG+V+KRY VPDWPL+ATYLISEA+L KSSRW NYISALP QPYSL
Sbjct  121  SLVISADSEWTNAEAGEVMKRYDVPDWPLLATYLISEANLQKSSRWFNYISALPRQPYSL  180

Query  610  LYWTRSELDRYLEASQI  660
            LYWTR+ELD YLEASQI
Sbjct  181  LYWTRTELDMYLEASQI  197



>gb|AAC14296.1| putative methyltransferase [Arabidopsis thaliana]
Length=504

 Score =   238 bits (608),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 124/197 (63%), Positives = 147/197 (75%), Gaps = 12/197 (6%)
 Frame = +1

Query  97   STIFQSTLLPPFSQSRRALSSPICHTFFRRNPTSFTTIR---CSSVSTEAAKIQT-----  252
            + + QSTLLP +S   +  +  I  +F   +P   +  R     SVS     IQ+     
Sbjct  4    ACLLQSTLLPAYSPLHKLRNQNITLSF---SPLPLSRCRPGIHCSVSAGETTIQSMEEAP  60

Query  253  -VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPP  429
             + WGC+ DSL+NA++LQ WLSDSG+PPQKMAI RVDIGERGLVA +N+RKGEKLLFV P
Sbjct  61   KISWGCEIDSLENATSLQNWLSDSGLPPQKMAIDRVDIGERGLVASQNLRKGEKLLFVSP  120

Query  430  SLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSL  609
            SLVI ADSEW+  +AG+V+KRY VPDWPL+ATYLISEASL KSSRW NYISALP QPYSL
Sbjct  121  SLVICADSEWTNAEAGEVMKRYDVPDWPLLATYLISEASLQKSSRWFNYISALPRQPYSL  180

Query  610  LYWTRSELDRYLEASQI  660
            LYWTR+ELD YLEASQI
Sbjct  181  LYWTRTELDMYLEASQI  197



>ref|XP_009124214.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Brassica 
rapa]
Length=507

 Score =   236 bits (603),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 125/202 (62%), Positives = 149/202 (74%), Gaps = 13/202 (6%)
 Frame = +1

Query  85   MPEASTIFQSTLLPPFS-----QSRRALSSPICHTFFRRNPTSFTTIRCSSVSTEAAK--  243
            M +AS   QSTLLP  S     +S+    S       R  P    TI CS  + E  K  
Sbjct  1    MAKASNFLQSTLLPSSSPLRNLRSQPLPLSFPPLPSSRHRPI---TIHCSVSAGETTKRS  57

Query  244  IQTVP---WGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKL  414
            ++  P   WGC+ DS++NA++LQ+WLSDSG+PPQKMAI +VDIGERGLVA +++RKGEKL
Sbjct  58   LEEAPDISWGCEIDSVENATSLQRWLSDSGLPPQKMAIDKVDIGERGLVASQSLRKGEKL  117

Query  415  LFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPT  594
            LFVPPSLVI+ADS W+  +AG+V+KRY VPDWPL+ATYLISEASL K SRW NYISALP 
Sbjct  118  LFVPPSLVISADSVWTNGEAGEVMKRYDVPDWPLLATYLISEASLQKGSRWFNYISALPR  177

Query  595  QPYSLLYWTRSELDRYLEASQI  660
            QPYSLLYWTR+ELD YLEASQI
Sbjct  178  QPYSLLYWTRTELDMYLEASQI  199



>ref|XP_008802702.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X2 [Phoenix 
dactylifera]
Length=483

 Score =   235 bits (600),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 109/136 (80%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = +1

Query  253  VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPS  432
            +PWGC+ +SL++ASALQ+WLS+SG+PPQKMAIQRVD+GERGLVALKNIRKGEKLLFVPPS
Sbjct  59   IPWGCEIESLESASALQQWLSESGLPPQKMAIQRVDVGERGLVALKNIRKGEKLLFVPPS  118

Query  433  LVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSLL  612
            LVITADS+WS P+ G V++R  VPDWPL+ATYLISEASL+ SSRW +YISALP QPYSLL
Sbjct  119  LVITADSDWSCPEVGNVMRRNSVPDWPLLATYLISEASLLNSSRWCSYISALPRQPYSLL  178

Query  613  YWTRSELDRYLEASQI  660
            YWTRSELD YL ASQI
Sbjct  179  YWTRSELDTYLVASQI  194



>gb|KJB22702.1| hypothetical protein B456_004G061300 [Gossypium raimondii]
Length=344

 Score =   231 bits (589),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 122/203 (60%), Positives = 148/203 (73%), Gaps = 20/203 (10%)
 Frame = +1

Query  85   MPEASTIFQSTL--LPPFSQSRRALSSPICH---TFFRRNPTSFTTIRCSSVSTEAAKIQ  249
            M EAS  F +TL  LP FS        P  H   ++   +P S    R  SV    ++ +
Sbjct  1    MAEASRTFHATLFSLPTFS--------PRLHFKLSYSHSHP-SLHLKRARSVQRSISETK  51

Query  250  T------VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEK  411
            T      +PWGCD DSL+NA ALQKWLSDSG+PPQK+ I +V++G+RGLVALK I +GEK
Sbjct  52   TMSSDTTLPWGCDIDSLENAEALQKWLSDSGLPPQKVGINKVEMGKRGLVALKKINRGEK  111

Query  412  LLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALP  591
            LLFVPPSL+IT+DS+WS P+ G VLK++ V D PL+ATYLISEA+L KSSRWSNYIS+LP
Sbjct  112  LLFVPPSLLITSDSDWSSPEVGHVLKQHNVADLPLLATYLISEANLQKSSRWSNYISSLP  171

Query  592  TQPYSLLYWTRSELDRYLEASQI  660
             QPYSLLYWTRSELDRYL+ASQI
Sbjct  172  RQPYSLLYWTRSELDRYLKASQI  194



>ref|XP_008802701.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X1 [Phoenix 
dactylifera]
Length=501

 Score =   235 bits (600),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/136 (80%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = +1

Query  253  VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPS  432
            +PWGC+ +SL++ASALQ+WLS+SG+PPQKMAIQRVD+GERGLVALKNIRKGEKLLFVPPS
Sbjct  59   IPWGCEIESLESASALQQWLSESGLPPQKMAIQRVDVGERGLVALKNIRKGEKLLFVPPS  118

Query  433  LVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSLL  612
            LVITADS+WS P+ G V++R  VPDWPL+ATYLISEASL+ SSRW +YISALP QPYSLL
Sbjct  119  LVITADSDWSCPEVGNVMRRNSVPDWPLLATYLISEASLLNSSRWCSYISALPRQPYSLL  178

Query  613  YWTRSELDRYLEASQI  660
            YWTRSELD YL ASQI
Sbjct  179  YWTRSELDTYLVASQI  194



>emb|CDY22127.1| BnaC01g39740D [Brassica napus]
Length=507

 Score =   235 bits (599),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 124/202 (61%), Positives = 148/202 (73%), Gaps = 13/202 (6%)
 Frame = +1

Query  85   MPEASTIFQSTLLPPFS-----QSRRALSSPICHTFFRRNPTSFTTIRCSSVSTEAAK--  243
            M +AS   QSTLLP  S     +S+    S       R  P    TI CS  + E  K  
Sbjct  1    MAKASNFLQSTLLPSSSPLRNLRSQPLPLSFPPLPSSRHRPI---TIHCSVSAGETTKRS  57

Query  244  IQTVP---WGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKL  414
            ++  P   WGC+ DS++NA++LQ+WLSDSG+PPQKMAI +VDIGERGLVA +++RKGEKL
Sbjct  58   LEEAPDISWGCEIDSVENATSLQRWLSDSGLPPQKMAIDKVDIGERGLVASQSLRKGEKL  117

Query  415  LFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPT  594
            LFVPPSLVI+ADS W+  +AG+V+KRY VPDWPL+ATYLISEAS  K SRW NYISALP 
Sbjct  118  LFVPPSLVISADSVWTNGEAGEVMKRYDVPDWPLLATYLISEASFQKGSRWFNYISALPR  177

Query  595  QPYSLLYWTRSELDRYLEASQI  660
            QPYSLLYWTR+ELD YLEASQI
Sbjct  178  QPYSLLYWTRTELDMYLEASQI  199



>ref|XP_010942854.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X3 [Elaeis 
guineensis]
Length=434

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 122/197 (62%), Positives = 151/197 (77%), Gaps = 8/197 (4%)
 Frame = +1

Query  85   MPEASTIFQSTLLPPFSQS-----RRALSSPICHTFFRRNPTSFTTIRCSSVSTEAAKIQ  249
            M + S +  ++ LP F QS         +SP     +R   +  ++   +S ++EA   +
Sbjct  1    MAQISRVLHTSFLPHFPQSPLPPSSHNGASPAVPFRYRTRSSISSSPSTTSRASEA---R  57

Query  250  TVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPP  429
             +PWGC+ +SL++ASALQ+WLS+SG+PPQKMAIQRVD+GERGLVALKNIRKGEKLLFVPP
Sbjct  58   PIPWGCEIESLESASALQQWLSESGLPPQKMAIQRVDVGERGLVALKNIRKGEKLLFVPP  117

Query  430  SLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSL  609
            SLVITADS+WS  +AG V++R  VPDWPL+ATYLISEASL+ SSRW +YISALP QPYSL
Sbjct  118  SLVITADSDWSCLEAGNVMRRNSVPDWPLLATYLISEASLMNSSRWCSYISALPRQPYSL  177

Query  610  LYWTRSELDRYLEASQI  660
            LYWTRSELD YL ASQI
Sbjct  178  LYWTRSELDTYLVASQI  194



>ref|XP_010942853.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X2 [Elaeis 
guineensis]
Length=434

 Score =   233 bits (593),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 122/197 (62%), Positives = 151/197 (77%), Gaps = 8/197 (4%)
 Frame = +1

Query  85   MPEASTIFQSTLLPPFSQS-----RRALSSPICHTFFRRNPTSFTTIRCSSVSTEAAKIQ  249
            M + S +  ++ LP F QS         +SP     +R   +  ++   +S ++EA   +
Sbjct  1    MAQISRVLHTSFLPHFPQSPLPPSSHNGASPAVPFRYRTRSSISSSPSTTSRASEA---R  57

Query  250  TVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPP  429
             +PWGC+ +SL++ASALQ+WLS+SG+PPQKMAIQRVD+GERGLVALKNIRKGEKLLFVPP
Sbjct  58   PIPWGCEIESLESASALQQWLSESGLPPQKMAIQRVDVGERGLVALKNIRKGEKLLFVPP  117

Query  430  SLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSL  609
            SLVITADS+WS  +AG V++R  VPDWPL+ATYLISEASL+ SSRW +YISALP QPYSL
Sbjct  118  SLVITADSDWSCLEAGNVMRRNSVPDWPLLATYLISEASLMNSSRWCSYISALPRQPYSL  177

Query  610  LYWTRSELDRYLEASQI  660
            LYWTRSELD YL ASQI
Sbjct  178  LYWTRSELDTYLVASQI  194



>ref|XP_010942848.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X1 [Elaeis 
guineensis]
 ref|XP_010942849.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X1 [Elaeis 
guineensis]
 ref|XP_010942850.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X1 [Elaeis 
guineensis]
 ref|XP_010942851.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X1 [Elaeis 
guineensis]
 ref|XP_010942852.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X1 [Elaeis 
guineensis]
Length=501

 Score =   233 bits (595),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 109/136 (80%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = +1

Query  253  VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPS  432
            +PWGC+ +SL++ASALQ+WLS+SG+PPQKMAIQRVD+GERGLVALKNIRKGEKLLFVPPS
Sbjct  59   IPWGCEIESLESASALQQWLSESGLPPQKMAIQRVDVGERGLVALKNIRKGEKLLFVPPS  118

Query  433  LVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSLL  612
            LVITADS+WS  +AG V++R  VPDWPL+ATYLISEASL+ SSRW +YISALP QPYSLL
Sbjct  119  LVITADSDWSCLEAGNVMRRNSVPDWPLLATYLISEASLMNSSRWCSYISALPRQPYSLL  178

Query  613  YWTRSELDRYLEASQI  660
            YWTRSELD YL ASQI
Sbjct  179  YWTRSELDTYLVASQI  194



>gb|KJB22703.1| hypothetical protein B456_004G061300 [Gossypium raimondii]
Length=489

 Score =   233 bits (593),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 122/203 (60%), Positives = 148/203 (73%), Gaps = 20/203 (10%)
 Frame = +1

Query  85   MPEASTIFQSTL--LPPFSQSRRALSSPICH---TFFRRNPTSFTTIRCSSVSTEAAKIQ  249
            M EAS  F +TL  LP FS        P  H   ++   +P S    R  SV    ++ +
Sbjct  1    MAEASRTFHATLFSLPTFS--------PRLHFKLSYSHSHP-SLHLKRARSVQRSISETK  51

Query  250  T------VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEK  411
            T      +PWGCD DSL+NA ALQKWLSDSG+PPQK+ I +V++G+RGLVALK I +GEK
Sbjct  52   TMSSDTTLPWGCDIDSLENAEALQKWLSDSGLPPQKVGINKVEMGKRGLVALKKINRGEK  111

Query  412  LLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALP  591
            LLFVPPSL+IT+DS+WS P+ G VLK++ V D PL+ATYLISEA+L KSSRWSNYIS+LP
Sbjct  112  LLFVPPSLLITSDSDWSSPEVGHVLKQHNVADLPLLATYLISEANLQKSSRWSNYISSLP  171

Query  592  TQPYSLLYWTRSELDRYLEASQI  660
             QPYSLLYWTRSELDRYL+ASQI
Sbjct  172  RQPYSLLYWTRSELDRYLKASQI  194



>ref|XP_009391784.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=502

 Score =   231 bits (589),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 130/156 (83%), Gaps = 5/156 (3%)
 Frame = +1

Query  208  IRCSSVSTE-----AAKIQTVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGER  372
            IRCS  +T       ++ + +PWGC+ +SL++ASALQ+WLS SG+PPQK+ IQRVD+GER
Sbjct  39   IRCSVSATSSNALTGSEARVIPWGCEIESLESASALQRWLSASGLPPQKLEIQRVDVGER  98

Query  373  GLVALKNIRKGEKLLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLI  552
            GLVAL NIRKGEKLLFVPPSLVITADSEWS P+ G VLK+  VPDWPL+ATYL+SEASL+
Sbjct  99   GLVALNNIRKGEKLLFVPPSLVITADSEWSCPEVGNVLKKNSVPDWPLLATYLLSEASLM  158

Query  553  KSSRWSNYISALPTQPYSLLYWTRSELDRYLEASQI  660
             SSRW+ YISALP QPYSLLYWT SELD YL ASQI
Sbjct  159  SSSRWNRYISALPRQPYSLLYWTPSELDTYLVASQI  194



>ref|XP_006857756.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Amborella trichopoda]
 gb|ERN19223.1| hypothetical protein AMTR_s00061p00196800 [Amborella trichopoda]
Length=541

 Score =   228 bits (581),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +1

Query  232  EAAKIQTVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEK  411
            E  ++  V WGCD DS +NAS L++WLS++G+PPQKMAI+RV++GERGLVALKNIRKGEK
Sbjct  90   EREEVGAVRWGCDIDSSENASYLKRWLSENGLPPQKMAIERVEVGERGLVALKNIRKGEK  149

Query  412  LLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALP  591
            LLFVPPSLVI A+SEWS P+ G VLKR  VPDWPL+ATYLISEASL++SSRW+ YISALP
Sbjct  150  LLFVPPSLVIDANSEWSCPEVGNVLKRNSVPDWPLLATYLISEASLMESSRWNEYISALP  209

Query  592  TQPYSLLYWTRSELDRYLEASQI  660
             QPYSLL+WTRSELD YL AS+I
Sbjct  210  RQPYSLLHWTRSELDMYLVASEI  232



>ref|XP_004953752.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like isoform 
X1 [Setaria italica]
 ref|XP_004953753.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like isoform 
X2 [Setaria italica]
 ref|XP_004953754.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like isoform 
X3 [Setaria italica]
Length=503

 Score =   224 bits (570),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = +1

Query  244  IQTVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFV  423
            +  VPWGC+ +SL++A++L++WL DSG+P Q++AIQRVD+GERGLVALKNIRKGEKLLFV
Sbjct  58   VAGVPWGCEIESLESAASLERWLIDSGLPEQRLAIQRVDVGERGLVALKNIRKGEKLLFV  117

Query  424  PPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPY  603
            PPSLVITADSEWS P+ G V+K+  VPDWPLIATYLISEASL  SS+WSNYI+ALP QPY
Sbjct  118  PPSLVITADSEWSRPEVGDVMKKNAVPDWPLIATYLISEASLEGSSKWSNYIAALPRQPY  177

Query  604  SLLYWTRSELDRYLEASQI  660
            SLLYWTR+ELD YL AS I
Sbjct  178  SLLYWTRAELDAYLVASPI  196



>ref|XP_002454362.1| hypothetical protein SORBIDRAFT_04g029430 [Sorghum bicolor]
 gb|EES07338.1| hypothetical protein SORBIDRAFT_04g029430 [Sorghum bicolor]
Length=499

 Score =   223 bits (568),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 105/136 (77%), Positives = 122/136 (90%), Gaps = 0/136 (0%)
 Frame = +1

Query  253  VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPS  432
            VPWGC+ +SL++A++L++WL DSG+P Q++AIQRVDIGERGLVALKNIRKGEKLLFVPPS
Sbjct  57   VPWGCEIESLESAASLERWLIDSGLPEQRLAIQRVDIGERGLVALKNIRKGEKLLFVPPS  116

Query  433  LVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSLL  612
            LVITADSEW  P+ G+V+KR  VPDWPLIATYLISEASL  SSRWS+YI+ALP QPYSLL
Sbjct  117  LVITADSEWGRPEVGEVMKRNSVPDWPLIATYLISEASLEGSSRWSSYIAALPRQPYSLL  176

Query  613  YWTRSELDRYLEASQI  660
            YWTR+ELD YL AS I
Sbjct  177  YWTRAELDAYLVASPI  192



>gb|AFW63677.1| hypothetical protein ZEAMMB73_839660 [Zea mays]
 gb|AFW63678.1| hypothetical protein ZEAMMB73_839660 [Zea mays]
Length=306

 Score =   218 bits (554),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 104/136 (76%), Positives = 120/136 (88%), Gaps = 0/136 (0%)
 Frame = +1

Query  253  VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPS  432
            VPWGC+ +SL++A++L++WL DSG+P Q++AIQRVDIGERGLVALKNIRKGEKLLFVPPS
Sbjct  61   VPWGCEIESLESAASLERWLIDSGLPEQRLAIQRVDIGERGLVALKNIRKGEKLLFVPPS  120

Query  433  LVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSLL  612
            LVITADSEW  P+ G V+KR  VPDWPLIATYLISEASL  SSRW +YI+ALP QPYSLL
Sbjct  121  LVITADSEWGRPEVGDVMKRNSVPDWPLIATYLISEASLEGSSRWISYIAALPRQPYSLL  180

Query  613  YWTRSELDRYLEASQI  660
            YWTR+ELD YL AS I
Sbjct  181  YWTRAELDAYLVASPI  196



>ref|NP_001140387.1| uncharacterized protein LOC100272441 [Zea mays]
 gb|ACF83720.1| unknown [Zea mays]
 gb|AFW63676.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
N-methyltransferase I [Zea mays]
Length=503

 Score =   219 bits (559),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/136 (76%), Positives = 120/136 (88%), Gaps = 0/136 (0%)
 Frame = +1

Query  253  VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPS  432
            VPWGC+ +SL++A++L++WL DSG+P Q++AIQRVDIGERGLVALKNIRKGEKLLFVPPS
Sbjct  61   VPWGCEIESLESAASLERWLIDSGLPEQRLAIQRVDIGERGLVALKNIRKGEKLLFVPPS  120

Query  433  LVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSLL  612
            LVITADSEW  P+ G V+KR  VPDWPLIATYLISEASL  SSRW +YI+ALP QPYSLL
Sbjct  121  LVITADSEWGRPEVGDVMKRNSVPDWPLIATYLISEASLEGSSRWISYIAALPRQPYSLL  180

Query  613  YWTRSELDRYLEASQI  660
            YWTR+ELD YL AS I
Sbjct  181  YWTRAELDAYLVASPI  196



>ref|XP_006649004.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Oryza brachyantha]
Length=551

 Score =   219 bits (558),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 101/136 (74%), Positives = 120/136 (88%), Gaps = 0/136 (0%)
 Frame = +1

Query  253  VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPS  432
            VPWGC+ +SL++A++L++WL+ SG+P Q++AIQRVD+GERGLVALKNIRKGEKLLFVPP 
Sbjct  109  VPWGCEIESLESAASLERWLTASGLPEQRLAIQRVDVGERGLVALKNIRKGEKLLFVPPP  168

Query  433  LVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSLL  612
            LVI+ADSEW  P+ G V+KR  VPDWPL+ATYLISEASL  SSRWSNYI+ALP QPYSLL
Sbjct  169  LVISADSEWGCPEVGNVMKRNSVPDWPLLATYLISEASLESSSRWSNYIAALPRQPYSLL  228

Query  613  YWTRSELDRYLEASQI  660
            YWTR+ELD YL AS I
Sbjct  229  YWTRAELDAYLVASPI  244



>gb|ACG45124.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
N-methyltransferase I [Zea mays]
Length=503

 Score =   218 bits (554),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 119/136 (88%), Gaps = 0/136 (0%)
 Frame = +1

Query  253  VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPS  432
            VPWGC+ +SL++A++L++WL DSG+P Q++AIQRVDIGERGLVALKNIRKGE LLFVPPS
Sbjct  61   VPWGCEIESLESAASLERWLIDSGLPEQRLAIQRVDIGERGLVALKNIRKGENLLFVPPS  120

Query  433  LVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSLL  612
            LVITADSEW  P+ G V+KR  VPDWPLIATYLISEASL  SSRW +YI+ALP QPYSLL
Sbjct  121  LVITADSEWGRPEVGDVMKRNSVPDWPLIATYLISEASLEGSSRWISYIAALPRQPYSLL  180

Query  613  YWTRSELDRYLEASQI  660
            YWTR+ELD YL AS I
Sbjct  181  YWTRAELDAYLVASPI  196



>gb|KHG10408.1| Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit 
N-methyltransferase, chloroplastic [Gossypium arboreum]
Length=451

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 112/194 (58%), Positives = 140/194 (72%), Gaps = 14/194 (7%)
 Frame = +1

Query  85   MPEASTIFQSTL--LPPFS-----QSRRALSSPICHTFFRRN-PTSFTTIRCSSVSTEAA  240
            M EAS  F +TL  LP FS     +   + S P  H    R+   S +  +  S++T   
Sbjct  1    MAEASRTFHATLFSLPTFSPRFHFKLSYSHSHPSLHLKRARSVQRSISETKTMSLNT---  57

Query  241  KIQTVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLF  420
               T+PWGCD DSL+NA ALQ WLSDSG+PPQK+ I +V++G+RGLVALK I +GEK+LF
Sbjct  58   ---TLPWGCDIDSLENAEALQNWLSDSGLPPQKVGINKVEMGKRGLVALKKINRGEKILF  114

Query  421  VPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQP  600
            VPPSL+IT+DS+WS P AG VLK+  V D PL+ATYLISEA+L KSSRWSNYIS+LP +P
Sbjct  115  VPPSLLITSDSDWSSPVAGHVLKQQNVADLPLLATYLISEANLQKSSRWSNYISSLPREP  174

Query  601  YSLLYWTRSELDRY  642
            YSLL+W RSELDR+
Sbjct  175  YSLLHWRRSELDRF  188



>dbj|BAJ90575.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=507

 Score =   212 bits (539),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = +1

Query  244  IQTVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFV  423
            +  VPWGC+ +SL++A++L++WL+ SG+P Q++A+++VDIGERGLVALKN+R GEKLLFV
Sbjct  61   VSGVPWGCEIESLESAASLERWLTASGLPEQRLALEKVDIGERGLVALKNVRNGEKLLFV  120

Query  424  PPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPY  603
            PP+LVITADSEW+  + G V+KRY VPDWPL+ATYLISEASL  SSRWS+YI ALP QPY
Sbjct  121  PPTLVITADSEWTNREVGDVMKRYSVPDWPLLATYLISEASLEGSSRWSSYIDALPRQPY  180

Query  604  SLLYWTRSELDRYLEASQI  660
            SLLYWTR+E+D YL AS I
Sbjct  181  SLLYWTRTEIDAYLVASPI  199



>gb|EMS68033.1| Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit 
N-methyltransferase, chloroplastic [Triticum urartu]
Length=509

 Score =   212 bits (539),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = +1

Query  244  IQTVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFV  423
            +  VPWGC+ +SL++A++L++WL+ SG+P Q++A+++VDIGERGLVALKN+R GEKLLFV
Sbjct  60   VAGVPWGCEIESLESAASLERWLTASGLPEQRLALEKVDIGERGLVALKNVRNGEKLLFV  119

Query  424  PPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPY  603
            PP+LVITADSEWS  + G V+KRY VPDWPL+ATYLISEASL  SS+WS+YI ALP QPY
Sbjct  120  PPTLVITADSEWSNREVGDVMKRYSVPDWPLLATYLISEASLEGSSKWSSYIDALPRQPY  179

Query  604  SLLYWTRSELDRYLEASQI  660
            SLLYWTR+E+D YL AS I
Sbjct  180  SLLYWTRTEIDAYLVASPI  198



>ref|XP_010236007.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Brachypodium 
distachyon]
Length=506

 Score =   211 bits (536),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 97/137 (71%), Positives = 119/137 (87%), Gaps = 0/137 (0%)
 Frame = +1

Query  250  TVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPP  429
            +VPWGC+ +SL++A++L++WL+ SG+P Q+MA+QRVD+GERGLVAL N+R GEKLLFVPP
Sbjct  62   SVPWGCEIESLESAASLERWLTASGLPEQRMALQRVDVGERGLVALTNVRNGEKLLFVPP  121

Query  430  SLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSL  609
            SLVI+ADSEWS  + G V+K Y VPDWPL+ATYLISEASL  SSRWS+YI ALP QPYSL
Sbjct  122  SLVISADSEWSNREVGDVMKSYSVPDWPLLATYLISEASLEGSSRWSSYIDALPRQPYSL  181

Query  610  LYWTRSELDRYLEASQI  660
            LYWTR+E+D YL AS I
Sbjct  182  LYWTRTEIDAYLVASPI  198



>gb|EEC73918.1| hypothetical protein OsI_08761 [Oryza sativa Indica Group]
Length=502

 Score =   206 bits (525),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 104/136 (76%), Positives = 119/136 (88%), Gaps = 0/136 (0%)
 Frame = +1

Query  253  VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPS  432
            VPWGC+ +SL++A +L++WL+DSG+P Q++ IQRVD+GERGLVALKNIRKGEKLLFVPPS
Sbjct  60   VPWGCEIESLESAVSLERWLTDSGLPEQRLGIQRVDVGERGLVALKNIRKGEKLLFVPPS  119

Query  433  LVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSLL  612
            LVITADSEW  P+ G VLKR  VPDWPLIATYLISEASL  SSRWS+YI+ALP QPYSLL
Sbjct  120  LVITADSEWGCPEVGNVLKRNSVPDWPLIATYLISEASLESSSRWSSYIAALPRQPYSLL  179

Query  613  YWTRSELDRYLEASQI  660
            YWTR ELD YL AS I
Sbjct  180  YWTRPELDAYLVASPI  195



>ref|NP_001047982.1| Os02g0725200 [Oryza sativa Japonica Group]
 dbj|BAD12920.1| putative ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit N-methyltransferase [Oryza sativa Japonica Group]
 dbj|BAD13045.1| putative ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit N-methyltransferase [Oryza sativa Japonica Group]
 dbj|BAF09896.1| Os02g0725200 [Oryza sativa Japonica Group]
 dbj|BAG96165.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57721.1| hypothetical protein OsJ_08208 [Oryza sativa Japonica Group]
Length=502

 Score =   206 bits (524),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 104/136 (76%), Positives = 119/136 (88%), Gaps = 0/136 (0%)
 Frame = +1

Query  253  VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPS  432
            VPWGC+ +SL++A +L++WL+DSG+P Q++ IQRVD+GERGLVALKNIRKGEKLLFVPPS
Sbjct  60   VPWGCEIESLESAVSLERWLTDSGLPEQRLGIQRVDVGERGLVALKNIRKGEKLLFVPPS  119

Query  433  LVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSLL  612
            LVITADSEW  P+ G VLKR  VPDWPLIATYLISEASL  SSRWS+YI+ALP QPYSLL
Sbjct  120  LVITADSEWGCPEVGNVLKRNSVPDWPLIATYLISEASLESSSRWSSYIAALPRQPYSLL  179

Query  613  YWTRSELDRYLEASQI  660
            YWTR ELD YL AS I
Sbjct  180  YWTRPELDAYLVASPI  195



>gb|EMT07134.1| hypothetical protein F775_17280 [Aegilops tauschii]
Length=579

 Score =   201 bits (510),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 96/155 (62%), Positives = 120/155 (77%), Gaps = 16/155 (10%)
 Frame = +1

Query  244  IQTVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFV  423
            +  VPWGC+ +SL++A++L++WL+ SG+P Q++A+++VDIGERGLVALKN+R GEKLLFV
Sbjct  62   VAGVPWGCEIESLESAASLERWLTASGLPEQRLALEKVDIGERGLVALKNVRNGEKLLFV  121

Query  424  PPSLVITADS----------------EWSVPDAGQVLKRYGVPDWPLIATYLISEASLIK  555
            PP+LVITADS                EWS  + G V+KRY VP WPL+ATYLISEASL  
Sbjct  122  PPTLVITADSVEMIIQSVSPVTTPLMEWSNREVGDVMKRYSVPAWPLLATYLISEASLEG  181

Query  556  SSRWSNYISALPTQPYSLLYWTRSELDRYLEASQI  660
            SSRWS+YI ALP QPYSLLYWTR+E+D YL AS I
Sbjct  182  SSRWSSYIDALPRQPYSLLYWTRTEIDAYLAASPI  216



>gb|KHN39942.1| Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit 
N-methyltransferase, chloroplastic [Glycine soja]
Length=409

 Score =   192 bits (489),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +1

Query  340  MAIQRVDIGERGLVALKNIRKGEKLLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLI  519
            M I+RV++GERGLVALKNIRKGEKLLFVPPSLVIT DSEWS P+AG+VLKR  VPDWPL+
Sbjct  1    MGIERVEVGERGLVALKNIRKGEKLLFVPPSLVITPDSEWSCPEAGEVLKRNSVPDWPLL  60

Query  520  ATYLISEASLIKSSRWSNYISALPTQPYSLLYWTRSELDRYLEASQI  660
            ATYLISEASL++SSRWSNYISALP QPYSLLYWT++ELDRYLEASQI
Sbjct  61   ATYLISEASLMESSRWSNYISALPRQPYSLLYWTQAELDRYLEASQI  107



>ref|XP_008246184.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like, partial 
[Prunus mume]
Length=147

 Score =   184 bits (466),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  340  MAIQRVDIGERGLVALKNIRKGEKLLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLI  519
            MA+++V++GERGLVALKNIRKGEKLLFVPPSL ITADSEW+  +AG+VLK+ GVPDWP +
Sbjct  1    MALKKVEVGERGLVALKNIRKGEKLLFVPPSLFITADSEWTCGEAGKVLKQNGVPDWPFL  60

Query  520  ATYLISEASLIKSSRWSNYISALPTQPYSLLYWTRSELDRYLEASQI  660
            ATYLISEAS ++SSRWSNYISALP QPYSLLYWTR ELDRYLEASQI
Sbjct  61   ATYLISEASSLESSRWSNYISALPRQPYSLLYWTREELDRYLEASQI  107



>gb|KCW89043.1| hypothetical protein EUGRSUZ_A01370 [Eucalyptus grandis]
 gb|KCW89044.1| hypothetical protein EUGRSUZ_A01370 [Eucalyptus grandis]
Length=439

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = +1

Query  373  GLVALKNIRKGEKLLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLI  552
            GLVALKN+RKGEKLLFVPP LVITADSEW   +AG+VLK+  VPDWPL+A YLISEASL+
Sbjct  37   GLVALKNVRKGEKLLFVPPPLVITADSEWGCAEAGEVLKKNSVPDWPLLAIYLISEASLM  96

Query  553  KSSRWSNYISALPTQPYSLLYWTRSELDRYLEASQI  660
             SSRWSNYISALP QPYSLLYWTR+ELDRYLEASQI
Sbjct  97   GSSRWSNYISALPRQPYSLLYWTRAELDRYLEASQI  132



>gb|KCW89045.1| hypothetical protein EUGRSUZ_A01370 [Eucalyptus grandis]
Length=464

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = +1

Query  373  GLVALKNIRKGEKLLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLI  552
            GLVALKN+RKGEKLLFVPP LVITADSEW   +AG+VLK+  VPDWPL+A YLISEASL+
Sbjct  37   GLVALKNVRKGEKLLFVPPPLVITADSEWGCAEAGEVLKKNSVPDWPLLAIYLISEASLM  96

Query  553  KSSRWSNYISALPTQPYSLLYWTRSELDRYLEASQI  660
             SSRWSNYISALP QPYSLLYWTR+ELDRYLEASQI
Sbjct  97   GSSRWSNYISALPRQPYSLLYWTRAELDRYLEASQI  132



>ref|XP_001754252.1| predicted protein [Physcomitrella patens]
 gb|EDQ80702.1| predicted protein, partial [Physcomitrella patens]
Length=431

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/136 (50%), Positives = 95/136 (70%), Gaps = 0/136 (0%)
 Frame = +1

Query  253  VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPS  432
            V WGCD  S++  S LQ WL   G+  QK+ + RVD G RGLVA +++R+GE+LLFVP  
Sbjct  1    VNWGCDPQSIEKGSLLQDWLMKEGLAKQKLVLDRVDSGGRGLVATQSLRQGERLLFVPSG  60

Query  433  LVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSLL  612
            L+ITADSEW   + G+++K  G+P+WP++A +LISEAS  +SSRW  Y + LP  P S+L
Sbjct  61   LLITADSEWGCAETGRIIKEAGLPEWPMLAIFLISEASREESSRWFPYFATLPKTPSSIL  120

Query  613  YWTRSELDRYLEASQI  660
             WT  E++ +L AS +
Sbjct  121  QWTEEEVNTWLTASPV  136



>ref|XP_002963244.1| hypothetical protein SELMODRAFT_80789 [Selaginella moellendorffii]
 gb|EFJ35115.1| hypothetical protein SELMODRAFT_80789 [Selaginella moellendorffii]
Length=467

 Score =   151 bits (381),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 105/144 (73%), Gaps = 2/144 (1%)
 Frame = +1

Query  235  AAKIQTVPWGCDTDS--LDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGE  408
            A +  +VPWGCDTDS  LD+  ALQ+WLS +G+P QK+ ++ V  G RGLV+ + + KG+
Sbjct  18   ACRASSVPWGCDTDSSALDSGIALQQWLSQAGLPIQKVELKNVGAGGRGLVSKRMLYKGD  77

Query  409  KLLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISAL  588
            +LLF+P +L IT +SEW+  +AG+V++   +P+WP +A YLISEASL KSS W  YI+AL
Sbjct  78   RLLFLPATLAITTESEWACAEAGKVIRAKDLPEWPFLACYLISEASLGKSSPWYPYIAAL  137

Query  589  PTQPYSLLYWTRSELDRYLEASQI  660
            P +P S+L WT  +++ +L A+ I
Sbjct  138  PRRPGSILLWTALDVETHLSATSI  161



>ref|XP_002974548.1| hypothetical protein SELMODRAFT_101776 [Selaginella moellendorffii]
 gb|EFJ24068.1| hypothetical protein SELMODRAFT_101776 [Selaginella moellendorffii]
Length=467

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 105/144 (73%), Gaps = 2/144 (1%)
 Frame = +1

Query  235  AAKIQTVPWGCDTDS--LDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGE  408
            A +  +VPWGCDTDS  L++  ALQ+WLS +G+P QK+ ++ V  G RGLV+ + + KG+
Sbjct  18   ACRASSVPWGCDTDSSALNSGIALQQWLSQAGLPIQKVELKNVGAGGRGLVSKRMLYKGD  77

Query  409  KLLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISAL  588
            +LLF+P +L IT +SEW+  +AG+V++   +P+WP +A YLISEASL KSS W  YI+AL
Sbjct  78   RLLFLPATLAITTESEWACAEAGKVIRAKDLPEWPFLACYLISEASLGKSSPWYPYIAAL  137

Query  589  PTQPYSLLYWTRSELDRYLEASQI  660
            P +P S+L WT  +++ +L A+ I
Sbjct  138  PRRPGSILLWTALDVEAHLSATSI  161



>ref|XP_010689224.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=413

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +1

Query  457  WSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSLLYWTRSELD  636
            WS P+AG+VLKR  VPDWPL+ATYLISEAS + SSRWSNYISALP QPYSLLYWTRSELD
Sbjct  39   WSCPEAGKVLKRNSVPDWPLLATYLISEASQMSSSRWSNYISALPRQPYSLLYWTRSELD  98

Query  637  RYLEASQI  660
            RYLEASQI
Sbjct  99   RYLEASQI  106



>gb|KCW89046.1| hypothetical protein EUGRSUZ_A01370 [Eucalyptus grandis]
Length=381

 Score =   121 bits (304),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = +1

Query  448  DSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSLLYWTRS  627
            D EW   +AG+VLK+  VPDWPL+A YLISEASL+ SSRWSNYISALP QPYSLLYWTR+
Sbjct  4    DQEWGCAEAGEVLKKNSVPDWPLLAIYLISEASLMGSSRWSNYISALPRQPYSLLYWTRA  63

Query  628  ELDRYLEASQI  660
            ELDRYLEASQI
Sbjct  64   ELDRYLEASQI  74



>emb|CDY71476.1| BnaCnng73100D [Brassica napus]
Length=124

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 67/130 (52%), Gaps = 45/130 (35%)
 Frame = +1

Query  286  NASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPSLVITADSEWSV  465
             AS  +KWLS                 ERGLVA +N+RKGEKLLFVPPSLVI ADS  S 
Sbjct  21   QASHRRKWLSTE------------STSERGLVASQNLRKGEKLLFVPPSLVIRADSVSSK  68

Query  466  P-----DAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSLLYWTRSE  630
                  +A +V+KRY VPDWPL+ATYLISE                             +
Sbjct  69   ACGPNGEAREVMKRYDVPDWPLLATYLISEG----------------------------K  100

Query  631  LDRYLEASQI  660
            LD YLEASQI
Sbjct  101  LDMYLEASQI  110



>ref|XP_005649983.1| ResB-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE25439.1| ResB-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=889

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 66/117 (56%), Gaps = 2/117 (2%)
 Frame = +1

Query  292  SALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPSLVITADSEWSVPD  471
             +L+ WL+  G+PPQK+AI       RGLVA + +RK EKLL VP  L++TAD       
Sbjct  32   GSLEDWLTHRGLPPQKVAISHEIPEGRGLVATRRVRKHEKLLNVPAQLLLTADVALQHSA  91

Query  472  AGQVLKRYGVPDWPLIATYLISEASLIKSSR--WSNYISALPTQPYSLLYWTRSELD  636
             G +L+  GVP W ++AT+L       +  +  W  Y+ ALP+Q   +L W   E+D
Sbjct  92   YGGLLESCGVPAWSVLATFLAETRRQPEGDKNVWGQYVDALPSQTGCVLEWASEEVD  148



>gb|KCW89047.1| hypothetical protein EUGRSUZ_A01370 [Eucalyptus grandis]
Length=344

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  550  IKSSRWSNYISALPTQPYSLLYWTRSELDRYLEASQI  660
            + SSRWSNYISALP QPYSLLYWTR+ELDRYLEASQI
Sbjct  1    MGSSRWSNYISALPRQPYSLLYWTRAELDRYLEASQI  37



>ref|XP_001419603.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97896.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=524

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 53/158 (34%), Positives = 87/158 (55%), Gaps = 13/158 (8%)
 Frame = +1

Query  193  TSFTTIRCSSVSTEAAKIQTVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGE-  369
            T+ T  R  S   + A+I   P G  + +    + L +WL    +P QKMA++ V++ E 
Sbjct  55   TTSTRGRAESARYDDAEI---PRGVGSAT---KAELARWLEGRRLPGQKMALE-VNLAEG  107

Query  370  RGLVALKNIRKGEKLLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASL  549
            RGLVA + I++GE LL VP + +IT   E ++ +A    K   + +W ++AT+L  +A  
Sbjct  108  RGLVATEEIKRGEALLGVPRTTLITV--ERAIAEAKLGPKHAELQEWSVLATFLAQQALA  165

Query  550  IKS---SRWSNYISALPTQPYSLLYWTRSELDRYLEAS  654
            ++S     +  YI ALP +  S+L W   E+D+ L+ S
Sbjct  166  LESGTAGTFGEYIRALPRRTGSVLDWPEDEVDKLLKGS  203



>emb|CDX78685.1| BnaA03g05970D [Brassica napus]
Length=133

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  253  VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGL  378
            + WGC+ DS++NA++LQ+WL++SG PP+KMA+  VDI ER L
Sbjct  7    ISWGCNIDSVENATSLQRWLTNSGFPPKKMAVDSVDIREREL  48



>ref|XP_003081307.1| putative methyltransferase (ISS) [Ostreococcus tauri]
Length=505

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/137 (31%), Positives = 75/137 (55%), Gaps = 8/137 (6%)
 Frame = +1

Query  253  VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPS  432
            +P G  + + ++   L +WL+ +G+  QKM ++      RGLVA + I++GE LL V  S
Sbjct  55   IPRGVGSATRED---LTRWLASNGLRAQKMTLESNLAEGRGLVATEEIKRGEALLGVDAS  111

Query  433  LVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSR---WSNYISALPTQPY  603
             +IT   E ++ +A    +   + +W ++AT+L  +A  ++S     +  YI ALP +  
Sbjct  112  CLITV--ERAIAEAKLGPRHAELQEWSVLATFLAQQAMALESGNAGTFGEYIRALPRRTG  169

Query  604  SLLYWTRSELDRYLEAS  654
            S+L W   E++  L+ S
Sbjct  170  SVLDWPEDEVETLLKGS  186



>emb|CEF99133.1| Rubisco LS methyltransferase, substrate-binding domain [Ostreococcus 
tauri]
Length=531

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/137 (31%), Positives = 75/137 (55%), Gaps = 8/137 (6%)
 Frame = +1

Query  253  VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPS  432
            +P G  + + ++   L +WL+ +G+  QKM ++      RGLVA + I++GE LL V  S
Sbjct  81   IPRGVGSATRED---LTRWLASNGLRAQKMTLESNLAEGRGLVATEEIKRGEALLGVDAS  137

Query  433  LVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSR---WSNYISALPTQPY  603
             +IT   E ++ +A    +   + +W ++AT+L  +A  ++S     +  YI ALP +  
Sbjct  138  CLITV--ERAIAEAKLGPRHAELQEWSVLATFLAQQAMALESGNAGTFGEYIRALPRRTG  195

Query  604  SLLYWTRSELDRYLEAS  654
            S+L W   E++  L+ S
Sbjct  196  SVLDWPEDEVETLLKGS  212



>emb|CDY06579.1| BnaC02g13030D [Brassica napus]
Length=129

 Score = 62.0 bits (149),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  253  VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGER  372
            + WGC+ DS++NA++LQ+WL++SG PP+KMA+  VDI ER
Sbjct  7    ISWGCNIDSVENATSLQRWLTNSGFPPKKMAVDSVDIRER  46



>ref|XP_002505573.1| set domain protein [Micromonas sp. RCC299]
 gb|ACO66831.1| set domain protein [Micromonas sp. RCC299]
Length=509

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 47/155 (30%), Positives = 77/155 (50%), Gaps = 15/155 (10%)
 Frame = +1

Query  181  RRNPTSFTTIRCSSVSTEAAKIQTVPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVD  360
            RR P   +  R  +V+ +A+         D+ +  +  AL  WL   G+   K++   VD
Sbjct  30   RRAPPPLSQRRPRAVAVDAS--------VDSRTQADFDALWAWLGSEGVDVSKVSPALVD  81

Query  361  I--GERG--LVALKNIRKGEKLLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATY  528
               G RG  LVA ++I  G+ +L +P SL +T D+  + P         G   W  +A  
Sbjct  82   AAPGGRGWGLVAAEDIGGGDAVLAIPRSLWMTVDTALASPIGAHCGDEAG---WIAVALQ  138

Query  529  LISEASLIKSSRWSNYISALPTQPYSLLYWTRSEL  633
            L+ E S+ + SRW+ Y++ALP Q  + L+W+  E+
Sbjct  139  LLHERSIGEKSRWAAYVNALPAQLDAPLFWSAEEV  173



>ref|XP_005850299.1| hypothetical protein CHLNCDRAFT_142047 [Chlorella variabilis]
 gb|EFN58197.1| hypothetical protein CHLNCDRAFT_142047 [Chlorella variabilis]
Length=485

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 63/121 (52%), Gaps = 1/121 (1%)
 Frame = +1

Query  298  LQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPSLVITADSEWSVPDAG  477
            L+ WL + G+PP K+A        RGLVA + I KGE LL +P  LV+T  +        
Sbjct  61   LKAWLIERGLPPPKLAAAATPGSGRGLVAAQPIGKGESLLSIPQQLVLTPAAALEQSCLR  120

Query  478  QVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSLLYWTRSELDRYLEASQ  657
             +L+   +P W ++A +L  + +   +  W  Y+  LP +   +L W+  E++ +L  SQ
Sbjct  121  PLLEEQPLPAWSVLALWLAEQRAAGSAGGWWPYVRLLPERTGCVLEWSEEEVE-WLCGSQ  179

Query  658  I  660
            +
Sbjct  180  L  180



>ref|XP_007510589.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18122.1| predicted protein [Bathycoccus prasinos]
Length=543

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/138 (30%), Positives = 67/138 (49%), Gaps = 14/138 (10%)
 Frame = +1

Query  265  CDTDSLDNASALQKWLSD-SGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPSLVI  441
            C  D LD       WL+D   +P QKM ++      RGLVA ++I++GEK+L +P   +I
Sbjct  86   CSKDELD------AWLADIMKLPEQKMKLEYFKEEGRGLVATESIKRGEKVLEIPQEAII  139

Query  442  TADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSS-------RWSNYISALPTQP  600
            T +         +  K   + +W ++AT+L   A  + +        R++ Y+ ALP   
Sbjct  140  TVEVALKESLLREKKKLAELQEWSILATFLAETAQNLSTEDNSSNKYRFATYVKALPRST  199

Query  601  YSLLYWTRSELDRYLEAS  654
             S+L W  S++   L  S
Sbjct  200  GSVLEWPESDVRTLLAGS  217



>emb|CDY01223.1| BnaC05g25090D [Brassica napus]
Length=238

 Score = 45.8 bits (107),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 40/81 (49%), Gaps = 29/81 (36%)
 Frame = +1

Query  253  VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPS  432
            + WGC+  S                   KMAI RVDIGER L+A +N+RKGE L      
Sbjct  7    ISWGCEIYS-------------------KMAIHRVDIGERELLASQNLRKGELL------  41

Query  433  LVITADSEWSVPDAGQVLKRY  495
                + S W+  +AG+++K +
Sbjct  42   ----SSSVWTNGEAGEMMKLF  58


 Score = 35.0 bits (79),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (64%), Gaps = 0/33 (0%)
 Frame = +2

Query  563  DGVTISLPCLHSLTRFYIGLDQSSTGIWKHHKY  661
            DG+TISL    + TRFY GL Q+    WK H++
Sbjct  63   DGLTISLLFRENRTRFYTGLRQNLICTWKLHRF  95



>ref|XP_008617921.1| hypothetical protein SDRG_13603 [Saprolegnia diclina VS20]
 gb|EQC28729.1| hypothetical protein SDRG_13603 [Saprolegnia diclina VS20]
Length=400

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 61/120 (51%), Gaps = 4/120 (3%)
 Frame = +1

Query  283  DNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPSLVITADSEWS  462
            D+ +   +WL++ G     +AI R   G RG+VA +++   E  + +P +L+I+  S   
Sbjct  4    DDEARFLRWLTEHGAKIDALAITRDLDGGRGVVATRDLAPNEIAMSIPEALMISEASVKL  63

Query  463  VPDAGQVLKRYG---VPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSLLYWTRSEL  633
             PD G +  R+      D PL+AT++     L   S +  Y+S LP  P S+  WT  EL
Sbjct  64   DPDLGPIFARHSDLFARDDPLLATFVAHHMHLGHHSFYYPYLSTLPA-PESIQNWTIDEL  122



>gb|AAC29137.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
N-methyltransferase I [Spinacia oleracea]
Length=491

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 60/188 (32%), Positives = 83/188 (44%), Gaps = 27/188 (14%)
 Frame = +1

Query  109  QSTLLPPFS---QSRRALSSPICHTFFRRNPTSFTTIRCSSVSTEAAKIQTVPWGCDTDS  279
             ST L PF     S+   ++P   TF  +NP S    R     T   +IQ   WG     
Sbjct  12   NSTFLNPFKTTQHSKLHFATP-SPTF--KNPLSIRCFRPPETDT-PPEIQKF-WG-----  61

Query  280  LDNASALQKWLSDSGMPPQKMAIQRVDIGER-GLVALKNIRKGEKLLFVPPSLVITADSE  456
                     WLSD G+   K  ++   + E  GLVA K+I + E +L VP    I  D+ 
Sbjct  62   ---------WLSDKGIISPKCPVKPGIVPEGLGLVAQKDISRNEVVLEVPQKFWINPDT-  111

Query  457  WSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSLLYWTRSELD  636
             +  + G V    G+  W  +A +L+ E  L  SS W  YI  LP    S +YW+  EL 
Sbjct  112  VAASEIGSVCN--GLKPWVSVALFLMREKKLGNSSSWKPYIDILPDSTNSTIYWSEEELS  169

Query  637  RYLEASQI  660
              L+ SQ+
Sbjct  170  E-LQGSQL  176



>gb|AAC29136.1| ribulose-1,5-bisphosphate carboxylase/oxygenase N-methyltransferase 
[Spinacia oleracea]
 gb|AAC29138.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
N-methyltransferase II [Spinacia oleracea]
Length=495

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 60/188 (32%), Positives = 83/188 (44%), Gaps = 27/188 (14%)
 Frame = +1

Query  109  QSTLLPPFS---QSRRALSSPICHTFFRRNPTSFTTIRCSSVSTEAAKIQTVPWGCDTDS  279
             ST L PF     S+   ++P   TF  +NP S    R     T   +IQ   WG     
Sbjct  12   NSTFLNPFKTTQHSKLHFATP-SPTF--KNPLSIRCFRPPETDT-PPEIQKF-WG-----  61

Query  280  LDNASALQKWLSDSGMPPQKMAIQRVDIGER-GLVALKNIRKGEKLLFVPPSLVITADSE  456
                     WLSD G+   K  ++   + E  GLVA K+I + E +L VP    I  D+ 
Sbjct  62   ---------WLSDKGIISPKCPVKPGIVPEGLGLVAQKDISRNEVVLEVPQKFWINPDTV  112

Query  457  WSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSLLYWTRSELD  636
             +  + G V    G+  W  +A +L+ E  L  SS W  YI  LP    S +YW+  EL 
Sbjct  113  -AASEIGSVCN--GLKPWVSVALFLMREKKLGNSSSWKPYIDILPDSTNSTIYWSEEELS  169

Query  637  RYLEASQI  660
              L+ SQ+
Sbjct  170  E-LQGSQL  176



>ref|XP_002947838.1| hypothetical protein VOLCADRAFT_88145 [Volvox carteri f. nagariensis]
 gb|EFJ50826.1| hypothetical protein VOLCADRAFT_88145 [Volvox carteri f. nagariensis]
Length=508

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 64/139 (46%), Gaps = 22/139 (16%)
 Frame = +1

Query  268  DTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPSLVITA  447
            D D  D     Q WL   G+  Q + ++      RGLVA +++ +GE L+ +P  LVITA
Sbjct  15   DVDGPDLEPEFQSWLRSEGLSTQPLLLRHCGREGRGLVASRSLSRGEVLVKLPDHLVITA  74

Query  448  DSEWSVPDAGQVLKRYGVPDWPLIATYL--------ISEASLIKSSRWSNYISALPTQPY  603
            +       AG+         W L+A  L          + S   ++RW  Y++ LP +P 
Sbjct  75   ERA-----AGE---------WSLLALLLAEVKGRLAAGDRSSPAAARWGPYVAVLPQRPG  120

Query  604  SLLYWTRSELDRYLEASQI  660
            +LL W   E+ + L  S +
Sbjct  121  TLLDWPAKEVQQLLRGSPL  139



>ref|XP_008607111.1| hypothetical protein SDRG_03258 [Saprolegnia diclina VS20]
 gb|EQC39050.1| hypothetical protein SDRG_03258 [Saprolegnia diclina VS20]
Length=401

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 58/113 (51%), Gaps = 4/113 (4%)
 Frame = +1

Query  304  KWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPSLVITADSEWSVPDAGQV  483
            +WL++ G     +AI R   G RG+VA +++   E  + +P +L+I+  S    PD G +
Sbjct  12   RWLTERGAKIDALAITRDLDGGRGVVATRDLAPNEVAMSIPEALMISEASVKLDPDLGPI  71

Query  484  LKRYG---VPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSLLYWTRSEL  633
              R+      D PL+AT++     L   S +  Y+S LP  P S+  WT  EL
Sbjct  72   FARHSDLFARDDPLLATFVAHHMHLGHHSFYYPYLSTLPA-PESIQNWTIDEL  123



>gb|KIW77858.1| hypothetical protein Z517_07691 [Fonsecaea pedrosoi CBS 271.37]
Length=501

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 60/111 (54%), Gaps = 3/111 (3%)
 Frame = +1

Query  328  PPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPSLVITADSEWSVPDAGQVLKRYGVPD  507
            P  ++   R +   RG VA+K+I + E+L  +P SLV+TA +    P   + L+  G   
Sbjct  34   PKVQLKDLRSENAGRGAVAVKDIEEDEELFAIPRSLVLTATTSSIPPAVLEPLRESG--Q  91

Query  508  WPLIATYLISEASLIKSSRWSNYISALPTQPYSLLYWTRSELDRYLEASQI  660
            W L+   LI E    + S W  Y   LPT+  SL++WT +EL + L+AS +
Sbjct  92   WVLLIVTLIYEYLRDEKSPWHAYFQVLPTKFDSLMFWTDAEL-KTLQASAV  141



>gb|KDO26770.1| hypothetical protein SPRG_20573 [Saprolegnia parasitica CBS 223.65]
Length=403

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 59/113 (52%), Gaps = 4/113 (4%)
 Frame = +1

Query  304  KWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPSLVITADSEWSVPDAGQV  483
            +WL+++G     +AI     G RG+VA +++   E  + +P +L+I+  S    PD G +
Sbjct  11   RWLTENGAKIDALAITHDLDGGRGVVATRDLAPNEVAMSIPEALMISEASVKLDPDLGPI  70

Query  484  LKRYG---VPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSLLYWTRSEL  633
              R+      D PL+AT++     L   S +  Y+S LPT P S+  WT  EL
Sbjct  71   FARHSDLFARDDPLLATFVAHHMDLGPHSFYYPYLSMLPT-PESIQNWTIDEL  122



>ref|XP_002945653.1| hypothetical protein VOLCADRAFT_120141 [Volvox carteri f. nagariensis]
 gb|EFJ52648.1| hypothetical protein VOLCADRAFT_120141, partial [Volvox carteri 
f. nagariensis]
Length=163

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 70/142 (49%), Gaps = 16/142 (11%)
 Frame = +1

Query  211  RCSSVST---EAAKIQTVPWGCDTDSLDNASA----------LQKWLSDSG--MPPQKMA  345
            +C  V     +  +++ +  GC  ++L  AS           L+ W+ +    +P Q   
Sbjct  10   QCGCVGCWALDVKRVRALDGGCQEEALAEASGSGAADPRAARLKAWVLEHSKTLPTQLTP  69

Query  346  IQRVDIGERGLVALKNIRKGEKLLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIAT  525
            +QR D G   LVA + +R+G+ L+ VP  L+++ D+  +    G+ ++  G+ +W  +  
Sbjct  70   VQRSD-GSYSLVADEPVRRGQILVRVPRRLLMSQDTARASEACGRTVREAGLNEWQSLIL  128

Query  526  YLISEASLIKSSRWSNYISALP  591
            +L+ E +L   S W+ Y+  LP
Sbjct  129  HLLCERALGSRSFWAPYLDTLP  150



>ref|XP_011075538.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Sesamum indicum]
Length=492

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 74/169 (44%), Gaps = 23/169 (14%)
 Frame = +1

Query  151  LSSPICHTFFRRNPT-------SFTTIRCSSVSTEAAKIQTVPWGCDTDSLDNASALQKW  309
            L +P  + F + NPT       SF+     S  T+    QTV                +W
Sbjct  16   LKTPGTNNFLKTNPTLHHFKKRSFSLNSVLSTETDPNIPQTV------------QRFWQW  63

Query  310  LSDSGMPPQKMAIQRVDIGER-GLVALKNIRKGEKLLFVPPSLVITADSEWSVPDAGQVL  486
            L D G+   K  ++   + E  GLVA +NI + E +L VP    I  D+  +  + G + 
Sbjct  64   LKDEGVVSSKTPVKPGIVTEGLGLVATRNIGRNEVVLEVPKRFWINQDAA-AASEIGSIC  122

Query  487  KRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSLLYWTRSEL  633
               G+  +  +A +L+SE    + S+W  YI  LP    S +YW+  EL
Sbjct  123  S--GLKPFIAVALFLLSEKFKGEESKWKYYIDVLPESTNSTIYWSEEEL  169



>ref|XP_003556768.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Glycine 
max]
 gb|KHN25053.1| Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit 
N-methyltransferase, chloroplastic [Glycine soja]
Length=487

 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 65/120 (54%), Gaps = 6/120 (5%)
 Frame = +1

Query  304  KWLSDSGMPPQKMAIQRVDIGER-GLVALKNIRKGEKLLFVPPSLVITADSEWSVPDAGQ  480
            +WL + G+   K  ++   + E  GLVALK+I + E +L VP  L I  D+  +  + G+
Sbjct  57   QWLKEEGVVSAKTPVKPSVVPEGLGLVALKDISRNEVVLQVPKRLWINPDA-VAASEIGK  115

Query  481  VLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSLLYWTRSELDRYLEASQI  660
            V    G+  W  +A +LI E S   +S W +Y S LP +  S +YW+  EL   L+ +Q+
Sbjct  116  VC--IGLKPWLAVALFLIRERSR-SNSLWKHYFSVLPKETDSTIYWSEEELSE-LQGTQL  171



>ref|XP_008619088.1| hypothetical protein SDRG_14714 [Saprolegnia diclina VS20]
 gb|EQC27514.1| hypothetical protein SDRG_14714 [Saprolegnia diclina VS20]
Length=496

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/134 (28%), Positives = 70/134 (52%), Gaps = 5/134 (4%)
 Frame = +1

Query  268  DTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPSLVITA  447
            D+D+ D  + L KWL+ +G   +K+ I+      RG+ A +    G++++ +P + +IT 
Sbjct  49   DSDTWDVPTRLCKWLAANGADLEKLRIETYAPEVRGVHAKRPFSAGDRVMLIPLNCLITV  108

Query  448  DSEWSVPDAGQVLKR--YGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSL-LYW  618
            +      D G  ++   +G P    +  YL+++  L   S +  Y  +LP   ++L ++W
Sbjct  109  EM-GKATDIGIKIQHLEFGAPKHIFLMMYLLTDMELGNDSFFKPYYDSLPPTLHNLPVFW  167

Query  619  TRSELDRYLEASQI  660
            T  EL R+L+ S I
Sbjct  168  TDDEL-RWLQGSHI  180



>emb|CCA68310.1| related to SET7-Regulatory protein [Piriformospora indica DSM 
11827]
Length=493

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/130 (31%), Positives = 62/130 (48%), Gaps = 23/130 (18%)
 Frame = +1

Query  304  KWLSDSGMPPQ-KMAIQRVDIGERGLVALKNIRKGEKLLFVPPSLV----------ITAD  450
            KW  DSG      + I+  +   RG VAL +I+K   L  VP S++          I  D
Sbjct  11   KWFRDSGATLHPAVGIKDFEGVGRGAVALHDIQKDTVLFTVPRSILLSTRTAPLRDILGD  70

Query  451  SEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSLLYWTRSE  630
             +WS            +  W  +   ++ E S +K S WS Y+  LPT+  +L++WT  E
Sbjct  71   EDWST-----------LKGWEGLILSMMYEDSRVKDSPWSGYLQDLPTKFDTLMFWTDEE  119

Query  631  LDRYLEASQI  660
            L++ L+AS +
Sbjct  120  LEQ-LQASTV  128



>ref|XP_003529470.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Glycine 
max]
 gb|KHN42922.1| Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit 
N-methyltransferase, chloroplastic [Glycine soja]
Length=487

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 64/120 (53%), Gaps = 6/120 (5%)
 Frame = +1

Query  304  KWLSDSGMPPQKMAIQRVDIGER-GLVALKNIRKGEKLLFVPPSLVITADSEWSVPDAGQ  480
            +WL + G+   K  ++   + E  GLVALK+I + E +L VP  L I  D+  +  + G+
Sbjct  57   QWLKEEGVVSGKTPVKPGVVPEGLGLVALKDISRNEVVLQVPKRLWINPDA-VAASEIGK  115

Query  481  VLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSLLYWTRSELDRYLEASQI  660
            V    G+  W  +A +LI E S    S W +Y S LP +  S +YW+  EL   L+ +Q+
Sbjct  116  VCS--GLKPWLAVALFLIRERSR-SDSLWKHYFSILPKETDSTIYWSEEELSE-LQGTQL  171



>gb|EEC84567.1| hypothetical protein OsI_31339 [Oryza sativa Indica Group]
Length=649

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 49/87 (56%), Gaps = 1/87 (1%)
 Frame = +1

Query  373  GLVALKNIRKGEKLLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLI  552
            GLVA +++ +GE L  VP  L + AD+  +  D G  + R G+  W  +A  L+ EA+  
Sbjct  243  GLVAARDLPRGEVLAEVPKKLWLDADA-VAASDLGGAVGRGGLRPWVAVALLLLREAARG  301

Query  553  KSSRWSNYISALPTQPYSLLYWTRSEL  633
              S W+ Y++ LP Q  S ++W+  EL
Sbjct  302  AGSPWAPYLAILPRQTDSTIFWSEEEL  328



>dbj|BAD28364.1| putative ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplast precursor [Oryza 
sativa Japonica Group]
 dbj|BAH01674.1| unnamed protein product [Oryza sativa Japonica Group]
Length=495

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 50/90 (56%), Gaps = 1/90 (1%)
 Frame = +1

Query  364  GERGLVALKNIRKGEKLLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEA  543
            G  GLVA +++ +GE L  VP  L + AD+  +  D G  + R G+  W  +A  L+ EA
Sbjct  86   GGLGLVAARDLPRGEVLAEVPKKLWLDADA-VAASDLGGAVGRGGLRPWVAVALLLLREA  144

Query  544  SLIKSSRWSNYISALPTQPYSLLYWTRSEL  633
            +    S W+ Y++ LP Q  S ++W+  EL
Sbjct  145  ARGAGSPWAPYLAILPRQTDSTIFWSEEEL  174



>ref|XP_007158636.1| hypothetical protein PHAVU_002G169400g [Phaseolus vulgaris]
 gb|ESW30630.1| hypothetical protein PHAVU_002G169400g [Phaseolus vulgaris]
Length=489

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 94/195 (48%), Gaps = 30/195 (15%)
 Frame = +1

Query  82   AMPEASTIFQSTLLPPFSQSRRALSSPICHTFFRRNPTSFTTIRCSSVSTEAAKIQTVPW  261
            A   ++++FQ T   PF+    A  SP+ H    + P S   +  +S+ TE     +VP 
Sbjct  7    ACSGSASLFQGTNFFPFA----AKGSPL-HL---KTPLSAKCV--ASLGTEI----SVPP  52

Query  262  GCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGL--VALKNIRKGEKLLFVPPSL  435
              DT          +WL + G+  +K  + +  +G  GL  VALK+I + E +L VP  L
Sbjct  53   AVDT--------FWQWLKEEGVVSRKTPV-KPGMGPEGLGLVALKDISRNEVVLQVPKRL  103

Query  436  VITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSLLY  615
             I  D+  +  + G+V    G+  W  +  +LI E S    S W +Y S LP +  S +Y
Sbjct  104  WINPDAV-AASEIGKVCS--GLKPWLAVVLFLIRERSK-DDSLWKHYFSILPKETGSTIY  159

Query  616  WTRSELDRYLEASQI  660
            W+  EL   L+ +Q+
Sbjct  160  WSEEELSE-LQGTQL  173



>ref|XP_002508524.1| set domain protein [Micromonas sp. RCC299]
 gb|ACO69782.1| set domain protein [Micromonas sp. RCC299]
Length=425

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 62/115 (54%), Gaps = 8/115 (7%)
 Frame = +1

Query  325  MPPQKMAIQRVDIGE-RGLVALKNIRKGEKLLFVPPSLVITADSEWSVPDAGQVLKRYGV  501
            +P QK+ +  VD+ E RGLVA + +R+GE LL +P S +IT +   +  + G       +
Sbjct  7    LPAQKLELV-VDLPEGRGLVATEEVRRGESLLDIPESTLITVERAIAESNLGPA--HANL  63

Query  502  PDWPLIATYLISEASLIKS----SRWSNYISALPTQPYSLLYWTRSELDRYLEAS  654
             +W ++A +L  +A  I +    SR++ Y+ ALP +   +L W   ++   L  S
Sbjct  64   QEWSVLAAFLAEQALAIDAGADGSRFATYVRALPRRTGGVLDWPEEDVKELLAGS  118



>emb|CDR45671.1| CYFA0S19e01640g1_1 [Cyberlindnera fabianii]
Length=477

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 64/120 (53%), Gaps = 9/120 (8%)
 Frame = +1

Query  298  LQKWLSDSGM---PPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPSLVITADS----E  456
             ++WL  SG    P  K+A  R     RG++AL++I   E L  +P ++++  ++     
Sbjct  10   FEQWLLASGYQVSPKIKIADLRAQAQGRGIIALEDIPADEVLFSIPRNVLLNIETGTLAS  69

Query  457  WSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSLLYWTRSELD  636
                +  +++ +Y    W  +   ++ E SL + SRW+ Y+S LP + +SL++W  SEL+
Sbjct  70   LHPQNREKLMTKYD--HWEGLILTILFELSLGQESRWAPYLSVLPHEFHSLMFWNDSELE  127



>ref|XP_001774765.1| predicted protein [Physcomitrella patens]
 gb|EDQ60436.1| predicted protein [Physcomitrella patens]
Length=523

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 55/211 (26%), Positives = 91/211 (43%), Gaps = 25/211 (12%)
 Frame = +1

Query  73   RSSAMPEASTIFQSTLLPP-FSQSRRALSSPICHTFFRRNPTSFTTIRCSSVSTEAAKIQ  249
            RSSA+   +  F   L PP F   + A+SS    +  R N  +    +        +K Q
Sbjct  27   RSSAVRYTTLGFVGNLCPPRFGTQKVAVSSEKRGSRCR-NTLTTDVYKQDENDLAQSKKQ  85

Query  250  TVPWGCDTDSLDNASALQKWLSDSGMPPQKMAI--QRVDIGERG-----LVALKNIRKGE  408
                G D         L++W+ + G+P  K+++   +   G++G     +VA ++++ GE
Sbjct  86   EHESGID---------LKQWMEEQGLPECKVSLAEHQPSEGDKGKPIHYVVASEDLQPGE  136

Query  409  KLLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISAL  588
              L +P SLV+T +         ++L    + +   +A YL+ E    K S W  YI  L
Sbjct  137  LALTIPKSLVVTLERVLGDETIAELLTTNKLSELACLALYLMYEKKQGKESYWYPYIREL  196

Query  589  PTQ-------PYSLLYWTRSELDRYLEASQI  660
              Q         S L W+R EL+ Y   S +
Sbjct  197  DRQRGRGQLSVASPLLWSREELNEYFTGSTM  227



>ref|XP_002986460.1| hypothetical protein SELMODRAFT_269129 [Selaginella moellendorffii]
 gb|EFJ12317.1| hypothetical protein SELMODRAFT_269129 [Selaginella moellendorffii]
Length=432

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 62/128 (48%), Gaps = 10/128 (8%)
 Frame = +1

Query  307  WLSDSGMPPQKMAIQRVDIGE---RGLVALKNIRKGEKLLFVPPSLVITADSEWSVPDAG  477
            W+ + G+PP K++++  D+     R +VA ++++ G+  L VP SLV+T +         
Sbjct  3    WMLEQGLPPCKVSLKERDLNGKTIRYVVASEDLKPGDLALSVPMSLVVTLERVLGNETIA  62

Query  478  QVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQ-------PYSLLYWTRSELD  636
            ++L    + +   +A YL+ E    K S W  +I  L  Q         S L WT  ELD
Sbjct  63   ELLTTNKLSELACLALYLMYEKKRGKESFWYPFIRELDRQRGRGQVAVESPLLWTSEELD  122

Query  637  RYLEASQI  660
             Y   S++
Sbjct  123  EYFTGSRM  130



>ref|XP_008361779.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Malus domestica]
Length=491

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 55/183 (30%), Positives = 81/183 (44%), Gaps = 27/183 (15%)
 Frame = +1

Query  127  PFSQSRRALSSPICHTFFRRNPTSFTTIRCSSVSTEAAKIQTVPWGCDTDSLDNASALQK  306
            P  +++ +L+ P  H    +NP        SS           P  CD           +
Sbjct  17   PTPRTKLSLAKPPTHP---KNPVRLAVTALSS-----------PLQCDPSLPPPVQTFWQ  62

Query  307  WLSDSGM-----PPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPSLVITADSEWSVPD  471
            WL D G+     P  K A+  V  G  GLVA ++I K E +L VP  L I  D+  S  +
Sbjct  63   WLRDEGVVSAKSPAAKPAL--VPEG-MGLVAHRDISKNEVVLEVPKRLWINPDT-VSASE  118

Query  472  AGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSLLYWTRSELDRYLEA  651
             G V    G+  W  +A +LI E S    S+W  Y+  LP    S ++W+  ELD+ L+ 
Sbjct  119  IGGVCS--GLKPWVSVALFLIREKSR-ADSKWRTYLDILPESTNSTVFWSEEELDQ-LQG  174

Query  652  SQI  660
            +Q+
Sbjct  175  TQL  177



>ref|XP_002978944.1| hypothetical protein SELMODRAFT_110000 [Selaginella moellendorffii]
 gb|EFJ19901.1| hypothetical protein SELMODRAFT_110000 [Selaginella moellendorffii]
Length=432

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 62/128 (48%), Gaps = 10/128 (8%)
 Frame = +1

Query  307  WLSDSGMPPQKMAIQRVDIGE---RGLVALKNIRKGEKLLFVPPSLVITADSEWSVPDAG  477
            W+ + G+PP K++++  D+     R +VA ++++ G+  L VP SLV+T +         
Sbjct  3    WMLEQGLPPCKVSLKERDLNGKTIRYVVASEDLKPGDLALSVPMSLVVTLERVLGNETIA  62

Query  478  QVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQ-------PYSLLYWTRSELD  636
            ++L    + +   +A YL+ E    K S W  +I  L  Q         S L WT  ELD
Sbjct  63   ELLTTNKLSELACLALYLMYEKKRGKESFWYPFIRELDRQRGRGQVAVESPLLWTSEELD  122

Query  637  RYLEASQI  660
             Y   S++
Sbjct  123  EYFTGSRM  130



>ref|XP_004516567.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Cicer arietinum]
Length=489

 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 62/120 (52%), Gaps = 6/120 (5%)
 Frame = +1

Query  304  KWLSDSGMPPQKMAIQRVDIGER-GLVALKNIRKGEKLLFVPPSLVITADSEWSVPDAGQ  480
            KWL + G+  +K  ++   + E  GLVALK+I + + +L VP  L I  D+  +  + G 
Sbjct  59   KWLQEEGVITKKTPVKASVVPEGLGLVALKDISRDDVVLQVPKRLWINPDA-VAASEIGN  117

Query  481  VLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSLLYWTRSELDRYLEASQI  660
            V    G+  W  +A +LI E S    S W +Y   LP +  S +YW   EL   L+ +Q+
Sbjct  118  VCS--GLKPWLAVALFLIRERS-KSDSVWKHYFGILPQETDSTIYWLEEELSE-LQGTQL  173



>ref|XP_008221574.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Prunus mume]
Length=498

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 54/180 (30%), Positives = 80/180 (44%), Gaps = 23/180 (13%)
 Frame = +1

Query  142  RRALSSPICHTFFRRNPTSFT--TIRCSSVSTEAAKIQTVPWGCDTDSLDNASALQKWLS  315
            R  LS+ + H    + PT      +  +S+S+        P  CD           +WL 
Sbjct  20   RTKLSTTLTHFSLPKTPTHLKKPVLAVTSLSS--------PLQCDPSLPPAVQTFWQWLR  71

Query  316  DSGM-----PPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPSLVITADSEWSVPDAGQ  480
            D G+     P  K A+  V  G  GLVA +NI K E +L VP  L I  D+  S  + G 
Sbjct  72   DEGVVSAKSPAAKPAL--VPEG-MGLVAHRNIGKNEVVLEVPKRLWINPDAV-SASEIGN  127

Query  481  VLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSLLYWTRSELDRYLEASQI  660
            V    G+  W  +A +L+ E      S+W  Y+  LP    S ++W+  ELD  L+ +Q+
Sbjct  128  VCS--GLKPWVSVALFLLRE-KYRDDSKWRPYLDILPESTNSTVFWSEEELDE-LQGTQL  183



>ref|XP_007339513.1| SET domain-containing protein [Auricularia delicata TFB-10046 
SS5]
 gb|EJD52786.1| SET domain-containing protein [Auricularia delicata TFB-10046 
SS5]
Length=519

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 54/100 (54%), Gaps = 16/100 (16%)
 Frame = +1

Query  364  GERGLVALKNIRKGEKLLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATY-----  528
            G RGLVA+K I+ GE L  VP +L+++       P   Q+ +  G  DW  +  +     
Sbjct  29   GGRGLVAVKEIQVGETLFAVPRTLLLS-------PRTCQLPQLIGAQDWKRLNLHKGWSG  81

Query  529  ----LISEASLIKSSRWSNYISALPTQPYSLLYWTRSELD  636
                ++ E +   +S+W+ Y +A+PT+  +L++WT  EL+
Sbjct  82   LILCMLWEEAQGPASQWAGYFAAMPTEFSTLMFWTPEELE  121



>ref|XP_010683122.1| PREDICTED: fructose-bisphosphate aldolase-lysine N-methyltransferase, 
chloroplastic [Beta vulgaris subsp. vulgaris]
Length=487

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 60/119 (50%), Gaps = 5/119 (4%)
 Frame = +1

Query  307  WLSDSGMPPQKMAIQRVDIGER-GLVALKNIRKGEKLLFVPPSLVITADSEWSVPDAGQV  483
            WL+D G+   K  ++   + E  GL+A K+I + E +L VP    I  D+  +  + G V
Sbjct  58   WLTDKGIVSPKSPVKPGIVPEGLGLIAQKDIARNEVVLEVPRKFWIYPDT-VAASEIGSV  116

Query  484  LKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSLLYWTRSELDRYLEASQI  660
                G+  W  +A +L+ E  L  +S W  YI  LP    S +YW+  EL   L+ SQ+
Sbjct  117  CN--GLKPWVSVALFLMREKKLGDASSWKPYIDILPDSTNSTIYWSEEELSE-LQGSQL  172



>ref|XP_002991767.1| hypothetical protein SELMODRAFT_430007 [Selaginella moellendorffii]
 gb|EFJ07171.1| hypothetical protein SELMODRAFT_430007 [Selaginella moellendorffii]
Length=389

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 59/99 (60%), Gaps = 7/99 (7%)
 Frame = +1

Query  367  ERGLVALKNIRKGEKLLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEAS  546
            +RGL A ++IR GE+++ +P  LV+TA+    + D  + L      DW  +   +++E  
Sbjct  9    KRGLFAARSIRAGEQIVRIPHDLVLTAE---KLDDCVKKLLSTEY-DWCPLTLLILAEQH  64

Query  547  LIKSSRWSNYISALPT--QPYSLLYWTRSELDRYLEASQ  657
              ++SRW+ Y+S LP+    +S ++W + EL ++LE ++
Sbjct  65   KGEASRWAPYVSCLPSFGDHHSTIFWEKEEL-KFLECTR  102



>ref|XP_002989713.1| hypothetical protein SELMODRAFT_447801 [Selaginella moellendorffii]
 gb|EFJ09190.1| hypothetical protein SELMODRAFT_447801 [Selaginella moellendorffii]
Length=400

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 60/101 (59%), Gaps = 11/101 (11%)
 Frame = +1

Query  367  ERGLVALKNIRKGEKLLFVPPSLVITADSEWSVPDAGQVL--KRYGVPDWPLIATYLISE  540
            +RGL A ++IR GE+++ +P  LV+TA+    + D  + L    Y   DW  +   +++E
Sbjct  9    KRGLFAARSIRAGEQIVRIPHELVLTAE---KLDDCVKKLLSTEY---DWCPLTLLILAE  62

Query  541  ASLIKSSRWSNYISALPT--QPYSLLYWTRSELDRYLEASQ  657
                ++SRW+ Y+S LP+    +S ++W + EL ++LE ++
Sbjct  63   QHKGEASRWAPYVSCLPSFGDHHSTIFWGKEEL-KFLECTR  102



>ref|XP_001598126.1| hypothetical protein SS1G_00212 [Sclerotinia sclerotiorum 1980]
 gb|EDN90812.1| hypothetical protein SS1G_00212 [Sclerotinia sclerotiorum 1980 
UF-70]
Length=470

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 69/114 (61%), Gaps = 10/114 (9%)
 Frame = +1

Query  307  WLSDSGMPPQ-KMAIQRVDIGE----RGLVALKNIRKGEKLLFVPPSLVITADSEWSVPD  471
            WL + G+    KMA+  VD+ +    RG+VA  +I   E +  +P + V+ A +   +P 
Sbjct  16   WLKEMGVRTNPKMAL--VDLRQEGRGRGVVATGDIDDDEIIFSIPRNAVLNAQNVAPLPV  73

Query  472  AGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSLLYWTRSEL  633
            + ++ ++  +P W ++ + L++EA + ++S+W+ Y++ LP +  SL++W+ SEL
Sbjct  74   SRRLFEK--MPSWLVLTSILMTEAQM-ENSKWAPYLAVLPERLDSLVFWSDSEL  124



>ref|XP_008179710.1| PREDICTED: uncharacterized protein LOC103308320 [Acyrthosiphon 
pisum]
Length=301

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 47/102 (46%), Gaps = 5/102 (5%)
 Frame = +1

Query  295  ALQKWLSDSGMPPQKMAI--QRVDIGERGLVALKNIRKGEKLLFVPPSLVITADSEWSVP  468
            +L  W+   G  P    +     D G RGL+A +NI  G+ L  VP  LVIT DS    P
Sbjct  89   SLTTWMKSHGWKPTCRLVPASFADTG-RGLMAAQNIDAGQPLAIVPGCLVITVDSVSMSP  147

Query  469  DAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPT  594
                    Y      ++ATYL+ E      S W NYI +LPT
Sbjct  148  FGKHFTTVYKTQQ--VLATYLMFERHKGSESFWHNYIVSLPT  187



>ref|WP_043409385.1| hypothetical protein [Cystobacter violaceus]
 gb|KFA88255.1| hypothetical protein Q664_42470 [Cystobacter violaceus Cb vi76]
Length=457

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 41/122 (34%), Positives = 62/122 (51%), Gaps = 5/122 (4%)
 Frame = +1

Query  274  DSLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPSLVITADS  453
            DS    + L +WL D G    K+ I R   GER ++A  +I  GE +L VP   +IT + 
Sbjct  21   DSDQKLATLLRWLEDGGARLPKLHIARQQNGERSVLARADIAAGEAVLQVPRGHLITLEV  80

Query  454  EWSVPDAGQVLKRYGVPDWPLI--ATYLISEASLIKSSRWSNYISALPTQ-PYSLLYWTR  624
              S  D G++++ +  PD   I  A++L+ E  L   S W  Y+  LP   P+  L++  
Sbjct  81   AKS-SDIGRLIQSHVNPDNEEIYLASFLLQE-KLRPDSFWKPYVDTLPEAFPHVPLFFGD  138

Query  625  SE  630
            SE
Sbjct  139  SE  140



>ref|XP_008551338.1| PREDICTED: SET domain-containing protein 4 isoform X3 [Microplitis 
demolitor]
Length=416

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 55/120 (46%), Gaps = 1/120 (1%)
 Frame = +1

Query  274  DSLDNASALQKWLSDSG-MPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPSLVITAD  450
            + L     L+ W+   G  P   M      +  RGL+ L+NI     L+ +P  L+IT  
Sbjct  30   EDLSTIEQLESWMKSVGWTPSTNMKPTIFPVTHRGLITLENISPDTPLVKIPKELLITPS  89

Query  451  SEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSLLYWTRSE  630
              W+       +++ G     ++AT+L+ E  L  +S W +Y+ +LP    +  Y T+ E
Sbjct  90   VAWNSNVKSIFIEKNGYTGHSVLATFLLYEKHLGTTSTWKHYLDSLPNSYTTPSYCTKME  149



>sp|Q43088.1|RBCMT_PEA RecName: Full=Ribulose-1,5 bisphosphate carboxylase/oxygenase 
large subunit N-methyltransferase, chloroplastic; AltName: 
Full=[Fructose-bisphosphate aldolase]-lysine N-methyltransferase; 
AltName: Full=[Ribulose-bisphosphate carboxylase]-lysine 
N-methyltransferase; Short=PsLSMT; Short=RuBisCO LSMT; Short=RuBisCO 
methyltransferase; Short=rbcMT; Flags: Precursor 
[Pisum sativum]
 gb|AAA69903.1| ribulose-1,5 bisphosphate carboxylase large subunit N-methyltransferase 
[Pisum sativum]
Length=489

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 58/197 (29%), Positives = 91/197 (46%), Gaps = 34/197 (17%)
 Frame = +1

Query  97   STIFQSTLLPPF-SQSRRALS----SPICHTFFRRNPTSFTTIRCSSVSTEAA---KIQT  252
            +TIF    + PF   + +  S    +PI H   +R   SF+    +SV TE +    +QT
Sbjct  2    ATIFSGGSVSPFLFHTNKGTSFTPKAPILH--LKR---SFSAKSVASVGTEPSLSPAVQT  56

Query  253  VPWGCDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGER-GLVALKNIRKGEKLLFVPP  429
              W              KWL + G+   K  ++   + E  GLVALK+I + + +L VP 
Sbjct  57   F-W--------------KWLQEEGVITAKTPVKASVVTEGLGLVALKDISRNDVILQVPK  101

Query  430  SLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSL  609
             L I  D+  +  + G+V     +  W  +  +LI E S  + S W +Y   LP +  S 
Sbjct  102  RLWINPDA-VAASEIGRVCSE--LKPWLSVILFLIRERSR-EDSVWKHYFGILPQETDST  157

Query  610  LYWTRSELDRYLEASQI  660
            +YW+  EL   L+ SQ+
Sbjct  158  IYWSEEELQE-LQGSQL  173



>gb|KKA23272.1| SET domain protein [Rasamsonia emersonii CBS 393.64]
Length=555

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 51/97 (53%), Gaps = 3/97 (3%)
 Frame = +1

Query  370  RGLVALKNIRKGEKLLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASL  549
            RG+VA  +I  GE+L  +P  +V+T  +        Q L   G   W  +   +I E  L
Sbjct  116  RGVVARSDIADGEELFAIPRDVVLTVQNSGLKNRISQDLDELGP--WLSLIVVMIHEYLL  173

Query  550  IKSSRWSNYISALPTQPYSLLYWTRSELDRYLEASQI  660
             + S W++Y   LPT+  +L++WT SEL   L+AS I
Sbjct  174  GEKSVWAHYFRVLPTKFDTLMFWTDSELSE-LQASAI  209



>ref|XP_005848872.1| hypothetical protein CHLNCDRAFT_8187, partial [Chlorella variabilis]
 gb|EFN56770.1| hypothetical protein CHLNCDRAFT_8187, partial [Chlorella variabilis]
Length=398

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/95 (34%), Positives = 50/95 (53%), Gaps = 4/95 (4%)
 Frame = +1

Query  376  LVALKNIRKGEKLLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIK  555
            LV  K + KGE+L  VP +  ITAD+         +    G+  W  IA +L+ E ++  
Sbjct  1    LVCSKAVNKGEQLFAVPEAAWITADTAQQSQIGSHLT---GLESWLAIALFLLHERAMGN  57

Query  556  SSRWSNYISALPTQPYSLLYWTRSELDRYLEASQI  660
            +SRW+ YI+ LP    S + W  ++L   L+ SQ+
Sbjct  58   ASRWAPYIALLPADSGSPVQWEEADLAE-LQGSQV  91



>ref|XP_008551335.1| PREDICTED: SET domain-containing protein 4 isoform X1 [Microplitis 
demolitor]
Length=439

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 55/120 (46%), Gaps = 1/120 (1%)
 Frame = +1

Query  274  DSLDNASALQKWLSDSG-MPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPSLVITAD  450
            + L     L+ W+   G  P   M      +  RGL+ L+NI     L+ +P  L+IT  
Sbjct  30   EDLSTIEQLESWMKSVGWTPSTNMKPTIFPVTHRGLITLENISPDTPLVKIPKELLITPS  89

Query  451  SEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSLLYWTRSE  630
              W+       +++ G     ++AT+L+ E  L  +S W +Y+ +LP    +  Y T+ E
Sbjct  90   VAWNSNVKSIFIEKNGYTGHSVLATFLLYEKHLGTTSTWKHYLDSLPNSYTTPSYCTKME  149



>gb|KEH30791.1| rubisco large subunit N-methyltransferase [Medicago truncatula]
Length=351

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 63/120 (53%), Gaps = 6/120 (5%)
 Frame = +1

Query  304  KWLSDSGMPPQKMAIQRVDIGER-GLVALKNIRKGEKLLFVPPSLVITADSEWSVPDAGQ  480
            KWL + G+   K  ++   + E  GLVALK+I + + +L VP  L I  D+  S  + G+
Sbjct  60   KWLQEEGVITAKTPVKASVVPEGLGLVALKDISRNDVILQVPKRLWINPDAVAS-SEIGR  118

Query  481  VLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSLLYWTRSELDRYLEASQI  660
            V  +  +  W  +  +LI E S  + S W +Y   LP +  S +YW+  EL   L+ +Q+
Sbjct  119  VCSK--LTPWLSVMLFLIRERSR-EDSVWKHYFGILPQETDSTIYWSEEELQE-LQGTQL  174



>ref|XP_008551336.1| PREDICTED: SET domain-containing protein 4 isoform X2 [Microplitis 
demolitor]
 ref|XP_008551337.1| PREDICTED: SET domain-containing protein 4 isoform X2 [Microplitis 
demolitor]
Length=429

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 55/120 (46%), Gaps = 1/120 (1%)
 Frame = +1

Query  274  DSLDNASALQKWLSDSG-MPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPSLVITAD  450
            + L     L+ W+   G  P   M      +  RGL+ L+NI     L+ +P  L+IT  
Sbjct  20   EDLSTIEQLESWMKSVGWTPSTNMKPTIFPVTHRGLITLENISPDTPLVKIPKELLITPS  79

Query  451  SEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSLLYWTRSE  630
              W+       +++ G     ++AT+L+ E  L  +S W +Y+ +LP    +  Y T+ E
Sbjct  80   VAWNSNVKSIFIEKNGYTGHSVLATFLLYEKHLGTTSTWKHYLDSLPNSYTTPSYCTKME  139



>ref|XP_011273526.1| hypothetical protein BN7_4206 [Wickerhamomyces ciferrii]
 emb|CCH44637.1| hypothetical protein BN7_4206 [Wickerhamomyces ciferrii]
Length=477

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/124 (26%), Positives = 62/124 (50%), Gaps = 8/124 (6%)
 Frame = +1

Query  283  DNASALQKWLSDSGM---PPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPSLVITADS  453
            ++    Q WL +SG+   P  K+   R     RGL++L++I + E L  +P ++++  ++
Sbjct  5    EDTHNFQNWLINSGVQISPKIKIEDLRYLSQGRGLISLQDINQDEILFKIPRNVLLNIET  64

Query  454  ---EWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSLLYWTR  624
                    +  ++L  Y    W  +   ++ E SL   S+W  Y   LP + +SL++W +
Sbjct  65   GSLSQINNNKEKLLTNYD--HWEGLILTILYELSLGNESKWFQYFKILPNEFHSLMFWEK  122

Query  625  SELD  636
             EL+
Sbjct  123  DELE  126



>ref|XP_002967739.1| hypothetical protein SELMODRAFT_408995 [Selaginella moellendorffii]
 gb|EFJ31086.1| hypothetical protein SELMODRAFT_408995 [Selaginella moellendorffii]
Length=421

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 53/98 (54%), Gaps = 5/98 (5%)
 Frame = +1

Query  367  ERGLVALKNIRKGEKLLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEAS  546
            +RGL A+++I+ GE +L V    ++TAD    +P   Q L   GV +W  +A  L+ E  
Sbjct  62   KRGLFAVRDIKAGECILRVSRDTMMTADR---LPLEFQQLLSSGVSEWAQLALLLLFEKR  118

Query  547  LIKSSRWSNYISALP--TQPYSLLYWTRSELDRYLEAS  654
              ++S W+ YIS LP     +S  +W + EL    E+S
Sbjct  119  AGEASIWAPYISCLPRWGTIHSTAFWRKEELTMIQESS  156



>ref|XP_006348752.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Solanum 
tuberosum]
Length=476

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 56/111 (50%), Gaps = 5/111 (5%)
 Frame = +1

Query  304  KWLSDSGMPPQKMAIQRVDIGER-GLVALKNIRKGEKLLFVPPSLVITADSEWSVPDAGQ  480
            KWL D G+   K  ++   + E  GLVA ++I KGE +L VP    I  D+  +  + G 
Sbjct  55   KWLCDEGVVSIKTPVKPGIVAEGLGLVAKRDISKGETVLGVPKRFWINTDAV-AESEIGN  113

Query  481  VLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSLLYWTRSEL  633
            V    G+  W  +A +L+ E      S+W  Y++ LP    S +YW+  EL
Sbjct  114  VCT--GLEPWISLALFLLRE-KWKDDSKWKYYMAVLPESTDSTIYWSEGEL  161



>ref|XP_001694672.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP02256.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=515

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 64/128 (50%), Gaps = 16/128 (13%)
 Frame = +1

Query  289  ASALQKWLSDSGMPPQKMA----IQRVDIGERGLVALKNIRKGEKLLFVP--PSLVITAD  450
            A A ++WL   G   +K A    ++ +  G+RG+VA   I +GE LL +P   +L +  D
Sbjct  2    AEAFEEWLDKHG--GKKHASLDLVKELPNGDRGVVATAPIAEGELLLLLPINCALYMPND  59

Query  451  SEW-----SVPDAGQVLKRYGVPDWPLIAT--YLISEASLIKSSRWSNYISAL-PTQPYS  606
             EW     S P+A   L  +     P +AT   L+SE +    S W+ Y+  L P+ P  
Sbjct  60   EEWAKRGSSFPEAVGYLHEHHRTLSPFLATTLALMSEVARGGESAWAAYVGTLPPSCPDC  119

Query  607  LLYWTRSE  630
            LL W++ E
Sbjct  120  LLNWSKEE  127



>ref|XP_002992361.1| hypothetical protein SELMODRAFT_430576 [Selaginella moellendorffii]
 gb|EFJ06511.1| hypothetical protein SELMODRAFT_430576 [Selaginella moellendorffii]
Length=463

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 53/98 (54%), Gaps = 5/98 (5%)
 Frame = +1

Query  367  ERGLVALKNIRKGEKLLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEAS  546
            +RGL A+++I+ GE +L V    ++TAD    +P   Q L   GV +W  +A  L+ E  
Sbjct  62   KRGLFAVRDIKAGECILRVSRDTMMTADR---LPLEFQQLLSSGVSEWAQLALLLLFEKR  118

Query  547  LIKSSRWSNYISALP--TQPYSLLYWTRSELDRYLEAS  654
              ++S W+ YIS LP     +S  +W + EL    E+S
Sbjct  119  AGEASIWAPYISCLPRWGTIHSTAFWRKEELAMIQESS  156



>emb|CDK27492.1| unnamed protein product [Kuraishia capsulata CBS 1993]
Length=562

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/104 (29%), Positives = 53/104 (51%), Gaps = 2/104 (2%)
 Frame = +1

Query  328  PPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPSLVITADSEW--SVPDAGQVLKRYGV  501
            P  ++A  R     RG++AL++I +GE L  +P ++++  ++    S+ D        G+
Sbjct  27   PKVQIADLRSQDQGRGVIALEDIEEGEILFSIPRNVILNVETSQLASLRDGEAKSVLLGL  86

Query  502  PDWPLIATYLISEASLIKSSRWSNYISALPTQPYSLLYWTRSEL  633
            P W  +   L  E SL   SRWS Y+  LP    + ++W+  E+
Sbjct  87   PQWEALILCLAYELSLGTDSRWSPYLHVLPKTSNTPMFWSDEEI  130



>pdb|2H21|A Chain A, Structure Of Rubisco Lsmt Bound To Adomet
 pdb|2H21|B Chain B, Structure Of Rubisco Lsmt Bound To Adomet
 pdb|2H21|C Chain C, Structure Of Rubisco Lsmt Bound To Adomet
 pdb|2H23|A Chain A, Structure Of Rubisco Lsmt Bound To Trimethyllysine And 
Adohcy
 pdb|2H23|B Chain B, Structure Of Rubisco Lsmt Bound To Trimethyllysine And 
Adohcy
 pdb|2H23|C Chain C, Structure Of Rubisco Lsmt Bound To Trimethyllysine And 
Adohcy
 pdb|2H2E|A Chain A, Structure Of Rubisco Lsmt Bound To Azaadomet And Lysine
 pdb|2H2E|B Chain B, Structure Of Rubisco Lsmt Bound To Azaadomet And Lysine
 pdb|2H2E|C Chain C, Structure Of Rubisco Lsmt Bound To Azaadomet And Lysine
 pdb|2H2J|A Chain A, Structure Of Rubisco Lsmt Bound To Sinefungin And Monomethyllysine
 pdb|2H2J|B Chain B, Structure Of Rubisco Lsmt Bound To Sinefungin And Monomethyllysine
 pdb|2H2J|C Chain C, Structure Of Rubisco Lsmt Bound To Sinefungin And Monomethyllysine
Length=440

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 62/120 (52%), Gaps = 6/120 (5%)
 Frame = +1

Query  304  KWLSDSGMPPQKMAIQRVDIGER-GLVALKNIRKGEKLLFVPPSLVITADSEWSVPDAGQ  480
            KWL + G+   K  ++   + E  GLVALK+I + + +L VP  L I  D+  +  + G+
Sbjct  11   KWLQEEGVITAKTPVKASVVTEGLGLVALKDISRNDVILQVPKRLWINPDA-VAASEIGR  69

Query  481  VLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSLLYWTRSELDRYLEASQI  660
            V     +  W  +  +LI E S  + S W +Y   LP +  S +YW+  EL   L+ SQ+
Sbjct  70   VCSE--LKPWLSVILFLIRERSR-EDSVWKHYFGILPQETDSTIYWSEEELQE-LQGSQL  125



>pdb|1MLV|A Chain A, Structure And Catalytic Mechanism Of A Set Domain Protein 
Methyltransferase
 pdb|1MLV|B Chain B, Structure And Catalytic Mechanism Of A Set Domain Protein 
Methyltransferase
 pdb|1MLV|C Chain C, Structure And Catalytic Mechanism Of A Set Domain Protein 
Methyltransferase
 pdb|1OZV|A Chain A, Crystal Structure Of The Set Domain Of Lsmt Bound To 
Lysine And Adohcy
 pdb|1OZV|B Chain B, Crystal Structure Of The Set Domain Of Lsmt Bound To 
Lysine And Adohcy
 pdb|1OZV|C Chain C, Crystal Structure Of The Set Domain Of Lsmt Bound To 
Lysine And Adohcy
 pdb|1P0Y|A Chain A, Crystal Structure Of The Set Domain Of Lsmt Bound To 
Melysine And Adohcy
 pdb|1P0Y|B Chain B, Crystal Structure Of The Set Domain Of Lsmt Bound To 
Melysine And Adohcy
 pdb|1P0Y|C Chain C, Crystal Structure Of The Set Domain Of Lsmt Bound To 
Melysine And Adohcy
Length=444

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 62/120 (52%), Gaps = 6/120 (5%)
 Frame = +1

Query  304  KWLSDSGMPPQKMAIQRVDIGER-GLVALKNIRKGEKLLFVPPSLVITADSEWSVPDAGQ  480
            KWL + G+   K  ++   + E  GLVALK+I + + +L VP  L I  D+  +  + G+
Sbjct  15   KWLQEEGVITAKTPVKASVVTEGLGLVALKDISRNDVILQVPKRLWINPDA-VAASEIGR  73

Query  481  VLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSLLYWTRSELDRYLEASQI  660
            V     +  W  +  +LI E S  + S W +Y   LP +  S +YW+  EL   L+ SQ+
Sbjct  74   VCSE--LKPWLSVILFLIRERSR-EDSVWKHYFGILPQETDSTIYWSEEELQE-LQGSQL  129



>gb|ESZ99431.1| hypothetical protein SBOR_0193 [Sclerotinia borealis F-4157]
Length=474

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 77/138 (56%), Gaps = 12/138 (9%)
 Frame = +1

Query  265  CDTDSLDNASA-LQKWLSDSGMPPQ-KMAIQRVDIGE----RGLVALKNIRKGEKLLFVP  426
             D D  +  +A    WL + G+    KMA+  VD+      RG+VA ++I+  E +  +P
Sbjct  1    MDVDDFEARTATFSSWLKEMGIRTNPKMAL--VDLRHEGRGRGVVATEDIKNDELIFSIP  58

Query  427  PSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYS  606
             + V+ A +   +P + ++ ++  +P W  + + L++E   + +S+W+ Y++ LP +  S
Sbjct  59   RNAVLNAQNANPLPISRRLSEK--MPSWLALTSILMAEGQ-VDNSKWAPYLAILPERLDS  115

Query  607  LLYWTRSELDRYLEASQI  660
            L++W+ SEL   L+AS +
Sbjct  116  LVFWSDSELAE-LQASAV  132



>ref|XP_002612559.1| hypothetical protein BRAFLDRAFT_219602 [Branchiostoma floridae]
 gb|EEN68568.1| hypothetical protein BRAFLDRAFT_219602 [Branchiostoma floridae]
Length=327

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/122 (28%), Positives = 66/122 (54%), Gaps = 3/122 (2%)
 Frame = +1

Query  277  SLDNASALQKWLSDSGMPPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPSLVITADSE  456
            S D++  L +WL  +G     + +       RG+++ +N+++G+ ++ +P +L+IT  + 
Sbjct  2    SRDDSIQLMRWLRRNGFRDSHLVLTDFPDTGRGVMSTRNLKEGDCIVSLPENLLITTTTV  61

Query  457  WSVPDAGQVLKRYGVPDWP--LIATYLISEASLIKSSRWSNYISALPTQPYSLLYWTRSE  630
             +    GQ +K +     P  +++ YLI+E S  K S W  YI  LPT   +  Y++ +E
Sbjct  62   VN-SHLGQYIKTWKPRLTPKQVLSLYLIAEKSRGKDSFWYPYIQTLPTSYTTPSYFSTAE  120

Query  631  LD  636
            +D
Sbjct  121  VD  122



>ref|XP_008800499.1| PREDICTED: [Fructose-bisphosphate aldolase]-lysine N-methyltransferase, 
chloroplastic [Phoenix dactylifera]
Length=492

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 58/114 (51%), Gaps = 7/114 (6%)
 Frame = +1

Query  304  KWLSDSGMPPQKMAIQRVD---IGER-GLVALKNIRKGEKLLFVPPSLVITADSEWSVPD  471
            +WLSD G+     +   V    + E  GLVA ++I K E ++ VP  L I  D+  +  D
Sbjct  60   RWLSDEGVVNSSSSPPSVKPEFVPEGLGLVAQRDITKNEVVVEVPKKLWINPDT-VAASD  118

Query  472  AGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSLLYWTRSEL  633
             G+V    G+  W  IA +L+ E +L  +S W  Y+  LP    S ++W+  EL
Sbjct  119  VGRVCG--GLKSWIAIALFLLREKALGSASSWRPYLDILPLATDSPIFWSEEEL  170



>ref|XP_002991099.1| hypothetical protein SELMODRAFT_429412 [Selaginella moellendorffii]
 gb|EFJ07907.1| hypothetical protein SELMODRAFT_429412 [Selaginella moellendorffii]
Length=428

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/94 (30%), Positives = 51/94 (54%), Gaps = 1/94 (1%)
 Frame = +1

Query  358  DIGERGLVALKNIRKGEKLLFVPPSLVITADSEWSVPDAGQVLKRYG-VPDWPLIATYLI  534
            D G RGL   +N+ +GE +L VP + +I        P+ G+VL  +  +    ++  YL+
Sbjct  36   DQGGRGLGVARNVEQGEMILRVPFAALIGVHCAREDPEFGKVLVDFAHLSSVQILTAYLL  95

Query  535  SEASLIKSSRWSNYISALPTQPYSLLYWTRSELD  636
            SE +  +SSRW +Y+   P   ++L +++  E +
Sbjct  96   SEVAKSRSSRWFSYLRHNPQVHHNLPHFSAMEAE  129



>ref|XP_006662882.1| PREDICTED: Fructose-bisphosphate aldolase-lysine N-methyltransferase, 
chloroplastic-like isoform X3 [Oryza brachyantha]
Length=218

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 51/91 (56%), Gaps = 5/91 (5%)
 Frame = +1

Query  370  RGLVALKNIRKGEKLLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASL  549
            R L A + I++G+ L+ VP  + +T D    +P   + L  +G+ D   +A  LI E  L
Sbjct  55   RSLFASEPIQEGDCLMQVPYHVQLTQDK---LPQQIRTLLAHGIGDTAKLAVLLIMEQHL  111

Query  550  IKSSRWSNYISALPT--QPYSLLYWTRSELD  636
               SRW+ YI +LPT  Q ++++ W  +EL+
Sbjct  112  ELESRWAPYIKSLPTKDQMHNMMLWDPNELN  142



>ref|XP_003057276.1| set domain protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH58921.1| set domain protein, partial [Micromonas pusilla CCMP1545]
Length=308

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 39/122 (32%), Positives = 69/122 (57%), Gaps = 9/122 (7%)
 Frame = +1

Query  307  WLSDSG-MPPQKMAIQRVDIGE-RGLVALKNIRKGEKLLFVPPSLVITADSEWSVPDAGQ  480
            WL++S  +P QK+ +  VD+ E RGLVA +++++GE LL +P + +IT   E +V ++  
Sbjct  1    WLTNSQRLPAQKLDLV-VDLPEGRGLVAREDVKRGEPLLEIPDASLITV--ERAVKESKL  57

Query  481  VLKRYGVPDWPLIATYLISEASLI----KSSRWSNYISALPTQPYSLLYWTRSELDRYLE  648
              K   + +W L+A +L  +A  I    +S  ++ Y+ ALP +   +L W   ++   L 
Sbjct  58   GPKHAELQEWSLLAAFLAEQALDIENGDESGVFAAYVKALPRRTGGVLDWPEEDVKTLLA  117

Query  649  AS  654
             S
Sbjct  118  GS  119



>ref|XP_002621905.1| SET domain-containing protein [Blastomyces dermatitidis SLH14081]
 gb|EEQ73530.1| SET domain-containing protein [Blastomyces dermatitidis SLH14081]
 gb|EEQ90134.1| SET domain-containing protein [Blastomyces dermatitidis ER-3]
 gb|EGE83642.1| SET domain-containing protein [Blastomyces dermatitidis ATCC 
18188]
 gb|EQL34600.1| SET domain-containing protein 6 [Blastomyces dermatitidis ATCC 
26199]
 gb|EQL34601.1| SET domain-containing protein 6, variant [Blastomyces dermatitidis 
ATCC 26199]
Length=481

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 58/111 (52%), Gaps = 3/111 (3%)
 Frame = +1

Query  328  PPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPSLVITADSEWSVPDAGQVLKRYGVPD  507
            P  K+A  R +   RG+VAL NI + E+L  +P +LV++  +   + D   + ++   P 
Sbjct  34   PKIKIADLRSEGAGRGIVALSNINEDEELFAIPQNLVLSFQNS-KLKDLLHISEKDLGP-  91

Query  508  WPLIATYLISEASLIKSSRWSNYISALPTQPYSLLYWTRSELDRYLEASQI  660
            W  +   +I E     +S WS Y   LPT+  +L++WT  EL R L  S +
Sbjct  92   WLCLILVMIYEYLQGGASPWSRYFQVLPTEFDTLMFWTDEEL-RELSGSAV  141



>gb|KEH30792.1| rubisco large subunit N-methyltransferase [Medicago truncatula]
Length=490

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 63/120 (53%), Gaps = 6/120 (5%)
 Frame = +1

Query  304  KWLSDSGMPPQKMAIQRVDIGER-GLVALKNIRKGEKLLFVPPSLVITADSEWSVPDAGQ  480
            KWL + G+   K  ++   + E  GLVALK+I + + +L VP  L I  D+  S  + G+
Sbjct  60   KWLQEEGVITAKTPVKASVVPEGLGLVALKDISRNDVILQVPKRLWINPDAVAS-SEIGR  118

Query  481  VLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSLLYWTRSELDRYLEASQI  660
            V  +  +  W  +  +LI E S  + S W +Y   LP +  S +YW+  EL   L+ +Q+
Sbjct  119  VCSK--LTPWLSVMLFLIRERSR-EDSVWKHYFGILPQETDSTIYWSEEELQE-LQGTQL  174



>gb|KIW35468.1| hypothetical protein PV07_02164 [Cladophialophora immunda]
Length=488

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 59/99 (60%), Gaps = 7/99 (7%)
 Frame = +1

Query  370  RGLVALKNIRKGEKLLFVPPSLVITADSEWSVPDAGQVLKRYG-VPDW-PLIATYLISEA  543
            RG VA+++I + E+L  +P SLV+TA +  S+P A  VL+ +     W PLI T +I E 
Sbjct  48   RGAVAVEDIEEDEELFAIPRSLVLTAAAS-SIPSA--VLEPFSETGQWQPLIVT-IIYEY  103

Query  544  SLIKSSRWSNYISALPTQPYSLLYWTRSELDRYLEASQI  660
               + S W  Y   LPT+  SL++W  +EL + L+AS +
Sbjct  104  LRNEKSPWHAYFQVLPTKFDSLMFWNATEL-KALQASAV  141



>ref|XP_011463675.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Fragaria vesca 
subsp. vesca]
Length=625

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 42/133 (32%), Positives = 63/133 (47%), Gaps = 6/133 (5%)
 Frame = +1

Query  265  CDTDSLDNASALQKWLSDSGMPPQKMAIQRVDIGE-RGLVALKNIRKGEKLLFVPPSLVI  441
            CDT          +WL D G+   K   +   + E  GLVA ++I + E +L VP  L I
Sbjct  185  CDTSLPPAVQTFWQWLRDEGVVSSKTLAKPALVPEGMGLVANRDIARNEVVLEVPKRLWI  244

Query  442  TADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSLLYWT  621
              D+  S  + G V    G+  W  +A +L+ E S    S+W  Y   LP    S ++W+
Sbjct  245  NPDAV-SASEIGNVCS--GLKPWVSVALFLLREKSR-DDSKWRLYFDILPETTDSPVFWS  300

Query  622  RSELDRYLEASQI  660
              ELD  L+ +Q+
Sbjct  301  EEELDE-LQGTQL  312



>ref|XP_002153313.1| SET domain protein [Talaromyces marneffei ATCC 18224]
 gb|EEA18928.1| SET domain protein [Talaromyces marneffei ATCC 18224]
Length=481

 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 30/97 (31%), Positives = 49/97 (51%), Gaps = 3/97 (3%)
 Frame = +1

Query  370  RGLVALKNIRKGEKLLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASL  549
            RG+VA  NI++GE L  +P  +V+   +          LK  G   W  +   +I E SL
Sbjct  48   RGVVARSNIQEGEDLFHLPHHIVLMVKTSRLNQILADDLKNLGP--WLSLVVVMIYEYSL  105

Query  550  IKSSRWSNYISALPTQPYSLLYWTRSELDRYLEASQI  660
             + S W  Y   LP++  +L++W+  E  + L+AS +
Sbjct  106  GEQSNWKQYFQVLPSKFDTLMFWSEEEFSQ-LQASAV  141



>ref|XP_002563677.1| Pc20g11910 [Penicillium rubens Wisconsin 54-1255]
 emb|CAP86520.1| Pc20g11910 [Penicillium rubens Wisconsin 54-1255]
Length=487

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 35/111 (32%), Positives = 60/111 (54%), Gaps = 2/111 (2%)
 Frame = +1

Query  328  PPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPSLVITADSEWSVPDAGQVLKRYGVPD  507
            P  ++A  R     RG+VA  NI +GE+L  VP ++V+T  +       G+ L+    P 
Sbjct  34   PKLRLADLRATGAGRGVVAQSNISEGEELFSVPRAMVLTVQNSELRTLLGENLEEQMGP-  92

Query  508  WPLIATYLISEASLIKSSRWSNYISALPTQPYSLLYWTRSELDRYLEASQI  660
            W  +   ++ E    + SRW+ Y   LP++  +L++W+ +EL + L+AS I
Sbjct  93   WLSLMLVMVYEYLQGEKSRWAPYFRVLPSRFDTLMFWSPAEL-QELQASTI  142



>gb|KIM94980.1| hypothetical protein OIDMADRAFT_171960 [Oidiodendron maius Zn]
Length=474

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 65/127 (51%), Gaps = 6/127 (5%)
 Frame = +1

Query  292  SALQKWLSDSGM---PPQKMAIQRVDIGERGLVALKNIRKGEKLLFVPPSLVIT-ADSEW  459
             A   WLS++G+   P  ++   R +   RG VA  +  + E +  +P S V+  A +  
Sbjct  11   DAFLTWLSEAGIRMSPKMQLRDLRSESRGRGAVATDDFEEDEIVFSIPRSAVLNIATALP  70

Query  460  SVPDAGQVLKRYGVPDWPLIATYLISEASLIKSSRWSNYISALPTQPYSLLYWTRSELDR  639
             +P  G       +P W  +   +ISE  + K S+W+ Y++ LP Q  SL++W+  E+ R
Sbjct  71   GIPTDGIRKAILSMPSWLALTALIISEG-VKKDSQWAPYLAVLPQQLDSLVFWSDPEI-R  128

Query  640  YLEASQI  660
             L+AS +
Sbjct  129  ELQASAV  135



>ref|XP_001783777.1| predicted protein [Physcomitrella patens]
 gb|EDQ51429.1| predicted protein, partial [Physcomitrella patens]
Length=395

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 52/91 (57%), Gaps = 5/91 (5%)
 Frame = +1

Query  370  RGLVALKNIRKGEKLLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASL  549
            R L A + I  GE++L V   L+IT +    +P   + L   GV +W  +A +++ E  L
Sbjct  1    RTLFAARPIEVGEQVLRVSGDLMITPNK---LPTEVKELLPTGVTEWARLALFILVEQHL  57

Query  550  IKSSRWSNYISALPT--QPYSLLYWTRSELD  636
             ++S+W+ YI+ LPT    +S ++W + EL+
Sbjct  58   GQASQWAPYINCLPTCGALHSTVFWKKEELE  88



>gb|KFX50163.1| Ribosomal N-lysine methyltransferase 4 [Talaromyces marneffei 
PM1]
Length=467

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 30/97 (31%), Positives = 49/97 (51%), Gaps = 3/97 (3%)
 Frame = +1

Query  370  RGLVALKNIRKGEKLLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASL  549
            RG+VA  NI++GE L  +P  +V+   +          LK  G   W  +   +I E SL
Sbjct  34   RGVVARSNIQEGEDLFHLPHHIVLMVKTSRLNQILADDLKNLGP--WLSLVVVMIYEYSL  91

Query  550  IKSSRWSNYISALPTQPYSLLYWTRSELDRYLEASQI  660
             + S W  Y   LP++  +L++W+  E  + L+AS +
Sbjct  92   GEQSNWKQYFQVLPSKFDTLMFWSEEEFSQ-LQASAV  127



>ref|XP_006662881.1| PREDICTED: Fructose-bisphosphate aldolase-lysine N-methyltransferase, 
chloroplastic-like isoform X2 [Oryza brachyantha]
Length=238

 Score = 49.3 bits (116),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 51/91 (56%), Gaps = 5/91 (5%)
 Frame = +1

Query  370  RGLVALKNIRKGEKLLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASL  549
            R L A + I++G+ L+ VP  + +T D    +P   + L  +G+ D   +A  LI E  L
Sbjct  55   RSLFASEPIQEGDCLMQVPYHVQLTQDK---LPQQIRTLLAHGIGDTAKLAVLLIMEQHL  111

Query  550  IKSSRWSNYISALPT--QPYSLLYWTRSELD  636
               SRW+ YI +LPT  Q ++++ W  +EL+
Sbjct  112  ELESRWAPYIKSLPTKDQMHNMMLWDPNELN  142



>ref|XP_006662880.1| PREDICTED: Fructose-bisphosphate aldolase-lysine N-methyltransferase, 
chloroplastic-like isoform X1 [Oryza brachyantha]
Length=241

 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 51/91 (56%), Gaps = 5/91 (5%)
 Frame = +1

Query  370  RGLVALKNIRKGEKLLFVPPSLVITADSEWSVPDAGQVLKRYGVPDWPLIATYLISEASL  549
            R L A + I++G+ L+ VP  + +T D    +P   + L  +G+ D   +A  LI E  L
Sbjct  55   RSLFASEPIQEGDCLMQVPYHVQLTQDK---LPQQIRTLLAHGIGDTAKLAVLLIMEQHL  111

Query  550  IKSSRWSNYISALPT--QPYSLLYWTRSELD  636
               SRW+ YI +LPT  Q ++++ W  +EL+
Sbjct  112  ELESRWAPYIKSLPTKDQMHNMMLWDPNELN  142



Lambda      K        H        a         alpha
   0.317    0.130    0.393    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1063448340092