BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig3652

Length=808
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006348242.1|  PREDICTED: choline transporter-like protein ...    392   2e-128   Solanum tuberosum [potatoes]
ref|XP_009595567.1|  PREDICTED: choline transporter-like protein 2      392   2e-128   Nicotiana tomentosiformis
ref|XP_009789519.1|  PREDICTED: choline transporter-like protein 2      391   7e-128   Nicotiana sylvestris
ref|XP_004244222.1|  PREDICTED: choline transporter-like protein 2      390   1e-127   Solanum lycopersicum
emb|CDP05904.1|  unnamed protein product                                377   2e-126   Coffea canephora [robusta coffee]
ref|XP_007021392.1|  Plasma-membrane choline transporter family p...    377   1e-122   
ref|XP_007021393.1|  Plasma-membrane choline transporter family p...    377   2e-122   Theobroma cacao [chocolate]
gb|EYU44898.1|  hypothetical protein MIMGU_mgv1a002214mg                377   2e-122   Erythranthe guttata [common monkey flower]
gb|KJB45693.1|  hypothetical protein B456_007G321200                    373   6e-121   Gossypium raimondii
gb|KHG10168.1|  Choline transporter-like protein 2                      371   4e-120   Gossypium arboreum [tree cotton]
ref|XP_011029459.1|  PREDICTED: choline transporter-like protein ...    369   3e-119   Populus euphratica
ref|XP_011029460.1|  PREDICTED: choline transporter-like protein ...    369   3e-119   Populus euphratica
ref|XP_002316905.2|  choline transporter-related family protein         367   1e-118   
ref|XP_004141227.1|  PREDICTED: choline transporter-like protein 2      367   2e-118   Cucumis sativus [cucumbers]
ref|XP_006451901.1|  hypothetical protein CICLE_v10007637mg             365   9e-118   Citrus clementina [clementine]
ref|XP_011082663.1|  PREDICTED: choline transporter-like protein 2      364   2e-117   Sesamum indicum [beniseed]
ref|XP_010098992.1|  hypothetical protein L484_025652                   363   2e-117   
ref|XP_003527259.1|  PREDICTED: choline transporter-like protein ...    364   2e-117   Glycine max [soybeans]
ref|XP_002284857.1|  PREDICTED: choline transporter-like protein 2      363   2e-117   Vitis vinifera
ref|XP_008452469.1|  PREDICTED: choline transporter-like protein 2      363   3e-117   Cucumis melo [Oriental melon]
gb|KJB13391.1|  hypothetical protein B456_002G072200                    363   3e-117   Gossypium raimondii
ref|XP_003540093.1|  PREDICTED: choline transporter-like protein ...    363   6e-117   Glycine max [soybeans]
gb|KHN23450.1|  Choline transporter-like protein 2                      363   6e-117   Glycine soja [wild soybean]
gb|KHN37168.1|  Choline transporter-like protein 2                      363   6e-117   Glycine soja [wild soybean]
ref|XP_002528555.1|  conserved hypothetical protein                     362   7e-117   Ricinus communis
emb|CAN73032.1|  hypothetical protein VITISV_026350                     363   1e-116   Vitis vinifera
ref|XP_010060542.1|  PREDICTED: choline transporter-like protein 2      362   1e-116   Eucalyptus grandis [rose gum]
ref|XP_009343591.1|  PREDICTED: choline transporter-like protein 2      360   5e-116   Pyrus x bretschneideri [bai li]
ref|XP_009356828.1|  PREDICTED: choline transporter-like protein 2      360   5e-116   Pyrus x bretschneideri [bai li]
ref|XP_008363605.1|  PREDICTED: choline transporter-like protein 2      360   5e-116   
ref|XP_004291650.1|  PREDICTED: choline transporter-like protein 2      359   1e-115   Fragaria vesca subsp. vesca
ref|XP_010242931.1|  PREDICTED: choline transporter-like protein 2      359   2e-115   Nelumbo nucifera [Indian lotus]
ref|XP_008386171.1|  PREDICTED: choline transporter-like protein 2      359   2e-115   
ref|XP_007213616.1|  hypothetical protein PRUPE_ppa002216mg             357   8e-115   Prunus persica
ref|XP_008226648.1|  PREDICTED: choline transporter-like protein 2      357   9e-115   Prunus mume [ume]
gb|KHN36810.1|  Choline transporter-like protein 2                      357   1e-114   Glycine soja [wild soybean]
ref|XP_006594780.1|  PREDICTED: choline transporter-like protein ...    357   1e-114   Glycine max [soybeans]
ref|XP_012084940.1|  PREDICTED: choline transporter-like protein 2      355   5e-114   Jatropha curcas
emb|CDX75828.1|  BnaC03g39110D                                          344   7e-114   
gb|KHG30658.1|  Choline transporter-like protein 2                      354   2e-113   Gossypium arboreum [tree cotton]
ref|XP_006299581.1|  hypothetical protein CARUB_v10015755mg             353   2e-113   Capsella rubella
ref|NP_566511.1|  plasma-membrane choline transporter family protein    353   3e-113   Arabidopsis thaliana [mouse-ear cress]
gb|KHN28052.1|  Choline transporter-like protein 5-A                    353   4e-113   Glycine soja [wild soybean]
ref|XP_003540458.1|  PREDICTED: choline transporter-like protein ...    353   5e-113   Glycine max [soybeans]
gb|AAF35404.1|  hypothetical protein                                    353   5e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009146249.1|  PREDICTED: choline transporter-like protein ...    350   6e-113   Brassica rapa
ref|XP_006406975.1|  hypothetical protein EUTSA_v10020171mg             352   9e-113   Eutrema salsugineum [saltwater cress]
gb|KFK38880.1|  hypothetical protein AALP_AA3G172900                    352   1e-112   Arabis alpina [alpine rockcress]
ref|XP_010487363.1|  PREDICTED: choline transporter-like protein 2      352   1e-112   Camelina sativa [gold-of-pleasure]
ref|XP_010465506.1|  PREDICTED: choline transporter-like protein 2      352   1e-112   Camelina sativa [gold-of-pleasure]
ref|XP_010502919.1|  PREDICTED: choline transporter-like protein 2      352   1e-112   Camelina sativa [gold-of-pleasure]
emb|CDX98556.1|  BnaC05g38190D                                          351   1e-112   
ref|XP_002882939.1|  hypothetical protein ARALYDRAFT_478976             351   2e-112   
ref|XP_009146248.1|  PREDICTED: choline transporter-like protein ...    351   2e-112   Brassica rapa
ref|XP_010545818.1|  PREDICTED: choline transporter-like protein ...    351   3e-112   Tarenaya hassleriana [spider flower]
dbj|BAB02367.1|  unnamed protein product                                350   3e-112   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004514344.1|  PREDICTED: choline transporter-like protein ...    350   5e-112   Cicer arietinum [garbanzo]
emb|CDX97664.1|  BnaA05g24150D                                          350   7e-112   
ref|XP_010545817.1|  PREDICTED: choline transporter-like protein ...    350   9e-112   Tarenaya hassleriana [spider flower]
gb|KEH19431.1|  plasma-membrane choline transporter family protein      349   1e-111   Medicago truncatula
ref|XP_009135440.1|  PREDICTED: choline transporter-like protein 2      348   2e-111   Brassica rapa
ref|XP_010535109.1|  PREDICTED: choline transporter-like protein 2      348   4e-111   Tarenaya hassleriana [spider flower]
ref|XP_010934827.1|  PREDICTED: choline transporter-like protein ...    344   7e-111   
ref|XP_008679492.1|  PREDICTED: choline transporter-like protein 2      346   2e-110   Zea mays [maize]
emb|CDX82434.1|  BnaA03g33870D                                          349   2e-110   
ref|XP_010934826.1|  PREDICTED: choline transporter-like protein ...    342   7e-110   
ref|XP_010934824.1|  PREDICTED: choline transporter-like protein ...    343   2e-109   
ref|XP_002444851.1|  hypothetical protein SORBIDRAFT_07g000250          343   3e-109   Sorghum bicolor [broomcorn]
ref|XP_006827775.1|  PREDICTED: choline transporter-like protein 2      343   3e-109   Amborella trichopoda
ref|XP_007133083.1|  hypothetical protein PHAVU_011G150000g             343   4e-109   Phaseolus vulgaris [French bean]
ref|XP_010695012.1|  PREDICTED: choline transporter-like protein 2      341   1e-108   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004972393.1|  PREDICTED: choline transporter-like protein ...    338   2e-107   Setaria italica
ref|XP_002448788.1|  hypothetical protein SORBIDRAFT_06g033190          338   2e-107   Sorghum bicolor [broomcorn]
ref|XP_004487693.1|  PREDICTED: choline transporter-like protein ...    338   2e-107   
gb|EPS61834.1|  hypothetical protein M569_12959                         345   6e-107   Genlisea aurea
ref|XP_008778474.1|  PREDICTED: choline transporter-like protein 2      337   7e-107   Phoenix dactylifera
ref|XP_008810449.1|  PREDICTED: choline transporter-like protein ...    335   2e-106   Phoenix dactylifera
ref|XP_009391078.1|  PREDICTED: choline transporter-like protein ...    335   2e-106   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009391079.1|  PREDICTED: choline transporter-like protein ...    335   2e-106   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001054289.1|  Os04g0681400                                       333   1e-105   
emb|CAJ86275.1|  H0901F07.12                                            333   1e-105   Oryza sativa [red rice]
ref|XP_009408146.1|  PREDICTED: choline transporter-like protein ...    333   2e-105   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009408147.1|  PREDICTED: choline transporter-like protein ...    333   2e-105   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006653038.1|  PREDICTED: choline transporter-like protein ...    333   2e-105   Oryza brachyantha
ref|XP_004960043.1|  PREDICTED: choline transporter-like protein ...    333   3e-105   Setaria italica
ref|XP_006659724.1|  PREDICTED: choline transporter-like protein ...    332   4e-105   Oryza brachyantha
ref|XP_010940429.1|  PREDICTED: choline transporter-like protein ...    332   8e-105   Elaeis guineensis
ref|XP_010940430.1|  PREDICTED: choline transporter-like protein ...    332   8e-105   Elaeis guineensis
gb|EAZ32442.1|  hypothetical protein OsJ_16653                          331   2e-104   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001054291.1|  Os04g0681600                                       330   2e-104   
ref|XP_003580838.1|  PREDICTED: choline transporter-like protein 2      325   2e-102   Brachypodium distachyon [annual false brome]
dbj|BAK04094.1|  predicted protein                                      325   3e-102   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003573246.1|  PREDICTED: choline transporter-like protein 2      324   7e-102   Brachypodium distachyon [annual false brome]
ref|XP_008668676.1|  PREDICTED: choline transporter-like protein 2      324   8e-102   Zea mays [maize]
gb|KEH38752.1|  plasma-membrane choline transporter family protein      316   4e-99    Medicago truncatula
dbj|BAK00584.1|  predicted protein                                      310   1e-96    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010934825.1|  PREDICTED: choline transporter-like protein ...    309   3e-96    
gb|EMT23496.1|  hypothetical protein F775_29578                         278   8e-84    
gb|EMT10231.1|  hypothetical protein F775_15809                         273   5e-83    
gb|KJB13392.1|  hypothetical protein B456_002G072200                    263   4e-79    Gossypium raimondii
ref|XP_008647208.1|  PREDICTED: choline transporter-like protein 2      259   8e-78    
ref|XP_006451902.1|  hypothetical protein CICLE_v10007637mg             258   3e-77    
emb|CAJ86278.1|  H0901F07.15                                            253   5e-75    Oryza sativa [red rice]
gb|EMS55310.1|  hypothetical protein TRIUR3_16176                       248   1e-73    Triticum urartu
ref|XP_001757700.1|  predicted protein                                  241   3e-70    
ref|XP_001771780.1|  predicted protein                                  189   3e-51    
ref|XP_009351421.1|  PREDICTED: choline transporter-like protein 2      187   4e-51    Pyrus x bretschneideri [bai li]
ref|XP_008810450.1|  PREDICTED: choline transporter-like protein ...    167   3e-46    Phoenix dactylifera
ref|XP_002500718.1|  choline transporter like family                    145   5e-36    Micromonas commoda
ref|XP_003064404.1|  choline transporter like family                    140   4e-34    Micromonas pusilla CCMP1545
ref|XP_001422243.1|  predicted protein                                  136   2e-32    Ostreococcus lucimarinus CCE9901
gb|KJB13393.1|  hypothetical protein B456_002G072200                    120   2e-32    Gossypium raimondii
ref|XP_007511067.1|  predicted protein                                  134   9e-32    Bathycoccus prasinos
gb|EEE61921.1|  hypothetical protein OsJ_16656                          115   1e-25    Oryza sativa Japonica Group [Japonica rice]
emb|CEG00747.1|  Choline transporter-like                               116   2e-25    Ostreococcus tauri
emb|CAJ86279.1|  H0901F07.16                                          85.1    4e-17    Oryza sativa [red rice]
emb|CDY20115.1|  BnaA01g28870D                                        81.6    4e-15    Brassica napus [oilseed rape]
ref|XP_003084176.1|  Choline transporter-like protein (ISS)           82.0    4e-14    
ref|XP_003062745.1|  choline transporter like family                  78.2    8e-13    Micromonas pusilla CCMP1545
ref|XP_009516634.1|  hypothetical protein PHYSODRAFT_309744           74.3    1e-11    Phytophthora sojae
gb|ETM54103.1|  hypothetical protein L914_02512                       73.9    2e-11    Phytophthora parasitica
gb|ETL47813.1|  hypothetical protein L916_02488                       73.9    2e-11    Phytophthora parasitica
gb|ETI54567.1|  hypothetical protein F443_02632                       73.9    2e-11    Phytophthora parasitica P1569
ref|XP_008915924.1|  hypothetical protein PPTG_19332                  73.9    2e-11    Phytophthora parasitica INRA-310
gb|ETK94437.1|  hypothetical protein L915_02517                       72.8    4e-11    Phytophthora parasitica
gb|ETO83324.1|  hypothetical protein F444_02633                       72.8    4e-11    Phytophthora parasitica P1976
gb|ETM00927.1|  hypothetical protein L917_02423                       72.8    4e-11    Phytophthora parasitica
gb|ETP52373.1|  hypothetical protein F442_02611                       72.8    4e-11    Phytophthora parasitica P10297
ref|XP_002952038.1|  hypothetical protein VOLCADRAFT_121040           72.4    7e-11    Volvox carteri f. nagariensis
ref|XP_008861285.1|  hypothetical protein H310_00321                  70.9    2e-10    Aphanomyces invadans
ref|XP_009533495.1|  hypothetical protein PHYSODRAFT_317831           68.9    7e-10    Phytophthora sojae
gb|EFA82487.1|  solute carrier family 44 protein member 2             68.9    8e-10    Heterostelium album PN500
gb|ETI31494.1|  hypothetical protein F443_21539                       68.9    9e-10    Phytophthora parasitica P1569
dbj|GAM18465.1|  hypothetical protein SAMD00019534_016400             68.6    1e-09    Acytostelium subglobosum LB1
gb|ETL78534.1|  hypothetical protein L917_20669                       68.6    1e-09    Phytophthora parasitica
ref|XP_008898417.1|  hypothetical protein PPTG_06268                  68.6    1e-09    Phytophthora parasitica INRA-310
gb|ETK71881.1|  hypothetical protein L915_20937                       68.6    1e-09    Phytophthora parasitica
ref|XP_009822172.1|  hypothetical protein H257_00933                  68.6    1e-09    Aphanomyces astaci
ref|XP_005648747.1|  DUF580-domain-containing protein                 67.4    3e-09    Coccomyxa subellipsoidea C-169
gb|ETO60218.1|  hypothetical protein F444_21552                       67.0    3e-09    Phytophthora parasitica P1976
gb|ETP29467.1|  hypothetical protein F442_21380                       67.0    3e-09    Phytophthora parasitica P10297
ref|XP_009496362.1|  hypothetical protein H696_04210                  66.2    6e-09    Fonticula alba
ref|XP_008612348.1|  hypothetical protein SDRG_08250                  65.5    1e-08    Saprolegnia diclina VS20
gb|EZA61792.1|  CTL-like protein                                      65.1    1e-08    Ooceraea biroi
ref|XP_011344346.1|  PREDICTED: CTL-like protein 1 isoform X1         65.1    2e-08    
ref|XP_002046340.1|  GJ12843                                          64.7    2e-08    Drosophila virilis
ref|XP_008557918.1|  PREDICTED: CTL-like protein 1                    64.3    3e-08    Microplitis demolitor
ref|XP_001983519.1|  GH15940                                          64.3    3e-08    Drosophila grimshawi
ref|XP_002901775.1|  choline transporter-like protein                 63.9    3e-08    Phytophthora infestans T30-4
gb|KDO33054.1|  hypothetical protein SPRG_01869                       63.9    3e-08    Saprolegnia parasitica CBS 223.65
ref|XP_011142428.1|  PREDICTED: CTL-like protein 1                    63.9    4e-08    Harpegnathos saltator
gb|ENN75884.1|  hypothetical protein YQE_07613                        63.5    4e-08    Dendroctonus ponderosae
ref|XP_002012151.1|  GI16591                                          63.2    7e-08    
ref|XP_008879484.1|  hypothetical protein H310_13674                  62.4    1e-07    Aphanomyces invadans
ref|XP_004363972.1|  choline transporter-like protein                 62.4    1e-07    Capsaspora owczarzaki ATCC 30864
ref|XP_002601395.1|  hypothetical protein BRAFLDRAFT_130395           62.0    1e-07    Branchiostoma floridae
ref|XP_003700774.1|  PREDICTED: CTL-like protein 1 isoform X1         62.0    2e-07    Megachile rotundata
ref|XP_012134577.1|  PREDICTED: CTL-like protein 1 isoform X2         61.6    2e-07    Megachile rotundata
ref|XP_011296701.1|  PREDICTED: CTL-like protein 1                    61.6    2e-07    Fopius arisanus
ref|XP_005835119.1|  hypothetical protein GUITHDRAFT_58746            60.8    4e-07    Guillardia theta CCMP2712
ref|XP_005835103.1|  hypothetical protein GUITHDRAFT_162533           60.8    4e-07    Guillardia theta CCMP2712
ref|XP_002026963.1|  GL12847                                          60.5    5e-07    Drosophila persimilis
ref|XP_011437365.1|  PREDICTED: choline transporter-like protein ...  58.2    6e-07    
ref|XP_011437364.1|  PREDICTED: choline transporter-like protein ...  57.8    6e-07    
ref|XP_001353058.1|  GA12051                                          60.1    6e-07    Drosophila pseudoobscura pseudoobscura
gb|EFN67677.1|  Choline transporter-like protein 1                    60.1    7e-07    Camponotus floridanus
ref|XP_011257359.1|  PREDICTED: CTL-like protein 1                    60.1    7e-07    Camponotus floridanus
ref|XP_006615719.1|  PREDICTED: CTL-like protein 1-like               59.3    1e-06    Apis dorsata [rock honeybee]
ref|XP_003698213.1|  PREDICTED: LOW QUALITY PROTEIN: CTL-like pro...  59.3    1e-06    Apis florea [dwarf honeybee]
ref|XP_002901659.1|  choline transporter-like protein                 59.3    1e-06    Phytophthora infestans T30-4
ref|XP_011866942.1|  PREDICTED: CTL-like protein 1                    58.9    1e-06    Vollenhovia emeryi
ref|XP_009519325.1|  hypothetical protein PHYSODRAFT_485041           58.9    1e-06    Phytophthora sojae
ref|XP_003484500.1|  PREDICTED: CTL-like protein 1-like               58.9    2e-06    
ref|XP_003399506.1|  PREDICTED: CTL-like protein 1-like               58.9    2e-06    Bombus terrestris [large earth bumblebee]
ref|XP_624708.1|  PREDICTED: CTL-like protein 1-like                  58.9    2e-06    
ref|XP_007885310.1|  PREDICTED: choline transporter-like protein 3    58.5    2e-06    Callorhinchus milii [Australian ghost shark]
ref|XP_003616781.1|  MJK13.4 protein                                  54.7    2e-06    
ref|XP_008469517.1|  PREDICTED: CTL-like protein 1                    58.5    2e-06    
ref|XP_011640422.1|  PREDICTED: CTL-like protein 1                    58.5    2e-06    Pogonomyrmex barbatus
ref|XP_011696064.1|  PREDICTED: CTL-like protein 1                    58.2    3e-06    Wasmannia auropunctata
ref|XP_002427703.1|  conserved hypothetical protein                   58.2    3e-06    Pediculus humanus corporis [human body lice]
ref|XP_006674882.1|  hypothetical protein BATDEDRAFT_1420             58.2    3e-06    Batrachochytrium dendrobatidis JAM81
ref|XP_001604227.1|  PREDICTED: CTL-like protein 1                    58.2    3e-06    Nasonia vitripennis
ref|XP_001971877.1|  GG15215                                          58.2    3e-06    Drosophila erecta
ref|XP_002681381.1|  choline transporter-like protein                 57.8    4e-06    Naegleria gruberi strain NEG-M
gb|EGI62812.1|  CTL-like protein 1                                    57.4    5e-06    Acromyrmex echinatior
ref|XP_011058838.1|  PREDICTED: CTL-like protein 1                    57.4    5e-06    Acromyrmex echinatior
ref|XP_012060621.1|  PREDICTED: CTL-like protein 1                    57.4    5e-06    Atta cephalotes
ref|XP_009841737.1|  hypothetical protein H257_15348                  57.4    5e-06    Aphanomyces astaci
gb|AAO39508.1|  RE36634p                                              57.4    6e-06    Drosophila melanogaster
gb|EFA10286.1|  hypothetical protein TcasGA2_TC012490                 57.0    7e-06    Tribolium castaneum [rust-red flour beetle]
ref|XP_008197900.1|  PREDICTED: CTL-like protein 1                    57.0    7e-06    Tribolium castaneum [rust-red flour beetle]
ref|XP_011161132.1|  PREDICTED: CTL-like protein 1                    57.0    8e-06    Solenopsis invicta [imported red fire ant]
ref|XP_007065238.1|  PREDICTED: choline transporter-like protein 3    56.6    1e-05    Chelonia mydas [green seaturtle]
gb|KFM56711.1|  CTL-like protein 1                                    56.6    1e-05    Stegodyphus mimosarum
ref|XP_002035324.1|  GM14646                                          56.6    1e-05    Drosophila sechellia
ref|XP_002083614.1|  GD13831                                          56.2    1e-05    
ref|NP_001261411.1|  CG1311, isoform B                                56.2    1e-05    Drosophila melanogaster
ref|NP_647884.1|  CG1311, isoform A                                   56.2    1e-05    Drosophila melanogaster
ref|XP_004350030.1|  solute carrier family 44 protein member 2        56.2    1e-05    Cavenderia fasciculata
ref|XP_002093680.1|  GE21434                                          56.2    1e-05    Drosophila yakuba
gb|ETN67201.1|  ctl transporter                                       56.2    2e-05    Anopheles darlingi [American malaria mosquito]
ref|XP_003292424.1|  hypothetical protein DICPUDRAFT_57949            55.8    2e-05    Dictyostelium purpureum
ref|XP_004997931.1|  hypothetical protein PTSG_01948                  55.8    2e-05    Salpingoeca rosetta
ref|XP_011501769.1|  PREDICTED: CTL-like protein 1                    55.8    2e-05    Ceratosolen solmsi marchali
ref|XP_316311.4|  AGAP006244-PA                                       55.8    2e-05    Anopheles gambiae str. PEST
ref|XP_001956143.1|  GF25058                                          55.5    2e-05    Drosophila ananassae
ref|XP_002074371.1|  GK10555                                          55.5    2e-05    Drosophila willistoni
gb|ETM49725.1|  hypothetical protein L914_06081                       55.5    2e-05    Phytophthora parasitica
ref|XP_009056507.1|  hypothetical protein LOTGIDRAFT_120296           55.5    2e-05    Lottia gigantea
gb|ETL96573.1|  hypothetical protein L917_05960                       55.5    2e-05    Phytophthora parasitica
ref|XP_008891710.1|  hypothetical protein PPTG_02391                  55.5    2e-05    Phytophthora parasitica INRA-310
gb|ETK89988.1|  hypothetical protein L915_06147                       55.5    3e-05    Phytophthora parasitica
gb|ETL43388.1|  hypothetical protein L916_06083                       55.5    3e-05    Phytophthora parasitica
gb|EPZ31046.1|  Choline transporter-like domain-containing protein    54.7    4e-05    Rozella allomycis CSF55
gb|EJY88486.1|  hypothetical protein OXYTRI_12340                     54.7    4e-05    Oxytricha trifallax
ref|XP_008617622.1|  hypothetical protein SDRG_13320                  54.7    5e-05    Saprolegnia diclina VS20
ref|XP_001429732.1|  hypothetical protein                             54.3    6e-05    Paramecium tetraurelia strain d4-2
ref|XP_004926445.1|  PREDICTED: CTL-like protein 1-like isoform X2    53.9    7e-05    Bombyx mori [silk moth]
ref|XP_004926444.1|  PREDICTED: CTL-like protein 1-like isoform X1    53.9    7e-05    Bombyx mori [silk moth]
ref|XP_001689518.1|  predicted protein                                53.9    8e-05    Chlamydomonas reinhardtii
gb|KDR21092.1|  CTL-like protein 1                                    53.9    8e-05    Zootermopsis nevadensis
ref|XP_006815345.1|  PREDICTED: choline transporter-like protein ...  53.5    9e-05    Saccoglossus kowalevskii
ref|XP_001654328.1|  AAEL001935-PA                                    53.9    9e-05    Aedes aegypti
ref|XP_003220049.1|  PREDICTED: choline transporter-like protein 3    53.1    1e-04    
ref|XP_005107742.1|  PREDICTED: choline transporter-like protein ...  52.8    2e-04    
ref|XP_005307600.1|  PREDICTED: choline transporter-like protein ...  52.8    2e-04    Chrysemys picta bellii
gb|EJY77044.1|  hypothetical protein OXYTRI_01325                     52.8    2e-04    Oxytricha trifallax
ref|XP_002731355.1|  PREDICTED: choline transporter-like protein ...  52.8    2e-04    Saccoglossus kowalevskii
ref|XP_009046858.1|  hypothetical protein LOTGIDRAFT_237969           52.4    2e-04    Lottia gigantea
gb|KFB36013.1|  AGAP006244-PA-like protein                            52.4    3e-04    Anopheles sinensis
ref|XP_011567525.1|  PREDICTED: CTL-like protein 1                    52.0    3e-04    Plutella xylostella [cabbage moth]
ref|XP_004519906.1|  PREDICTED: CTL-like protein 1-like isoform X4    52.0    3e-04    
ref|XP_011200860.1|  PREDICTED: CTL-like protein 1                    52.0    3e-04    Bactrocera dorsalis [papaya fruit fly]
ref|XP_009056508.1|  hypothetical protein LOTGIDRAFT_232925           52.0    3e-04    Lottia gigantea
ref|XP_004914329.1|  PREDICTED: choline transporter-like protein ...  51.2    3e-04    
emb|CDW80041.1|  solute carrier family 44 protein member              52.0    3e-04    Stylonychia lemnae
ref|XP_004519903.1|  PREDICTED: CTL-like protein 1-like isoform X1    52.0    3e-04    
ref|XP_011180668.1|  PREDICTED: CTL-like protein 1                    52.0    3e-04    Zeugodacus cucurbitae [melon fruit fly]
ref|XP_011415791.1|  PREDICTED: choline transporter-like protein ...  52.0    4e-04    Crassostrea gigas
ref|XP_011415793.1|  PREDICTED: choline transporter-like protein ...  52.0    4e-04    Crassostrea gigas
ref|XP_011415794.1|  PREDICTED: choline transporter-like protein ...  51.6    4e-04    Crassostrea gigas
gb|EKC37701.1|  Choline transporter-like protein 1                    51.6    4e-04    Crassostrea gigas
ref|XP_008605389.1|  hypothetical protein SDRG_01633                  51.2    6e-04    Saprolegnia diclina VS20
ref|XP_005178886.1|  PREDICTED: CTL-like protein 1                    50.8    7e-04    Musca domestica
ref|XP_002434061.1|  conserved hypothetical protein                   50.8    8e-04    Ixodes scapularis [blacklegged tick]
gb|KFM79681.1|  hypothetical protein X975_14148                       50.8    8e-04    Stegodyphus mimosarum
gb|ELU15407.1|  hypothetical protein CAPTEDRAFT_224558                50.8    0.001    Capitella teleta



>ref|XP_006348242.1| PREDICTED: choline transporter-like protein 2-like [Solanum tuberosum]
Length=699

 Score =   392 bits (1008),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 179/209 (86%), Positives = 196/209 (94%), Gaps = 1/209 (0%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGPLGAVIGKYPSSDG G    GDGIIKHNRKCRDVVFL+IFIAFWVAMIVNSSFGFNQ
Sbjct  1    MRGPLGAVIGKYPSSDG-GVAEKGDGIIKHNRKCRDVVFLVIFIAFWVAMIVNSSFGFNQ  59

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNPLRLTYGLDYKGNVCGDRHADP+L EL+LRYW+NPN+VY+SG KD+  KL NAR+ICL
Sbjct  60   GNPLRLTYGLDYKGNVCGDRHADPDLRELELRYWVNPNQVYESGSKDNQAKLSNARTICL  119

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
            MDCPIPSEDSLNWVCDYPEG++RL+V++WIDRNYDYFADLTP+LR  SLQLQGPCYPVIF
Sbjct  120  MDCPIPSEDSLNWVCDYPEGEVRLSVDDWIDRNYDYFADLTPDLRNTSLQLQGPCYPVIF  179

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGI  720
            PSVNVYWSCQ I+RASNVSLRHW+EMGG+
Sbjct  180  PSVNVYWSCQLISRASNVSLRHWREMGGV  208



>ref|XP_009595567.1| PREDICTED: choline transporter-like protein 2 [Nicotiana tomentosiformis]
Length=700

 Score =   392 bits (1008),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 178/209 (85%), Positives = 196/209 (94%), Gaps = 2/209 (1%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGPLGAVIG+YPSSDG  +  +GDGIIKHNRKCRDVVFL+IFIAFWVAMIVNSSFGFNQ
Sbjct  3    MRGPLGAVIGRYPSSDGTTQ--TGDGIIKHNRKCRDVVFLVIFIAFWVAMIVNSSFGFNQ  60

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNPLRLTYGLDYKGNVCGD HADP+L EL+LRYWLNPN+VY+SG KD+  K+ NAR+ICL
Sbjct  61   GNPLRLTYGLDYKGNVCGDTHADPDLRELELRYWLNPNQVYESGSKDNQAKISNARTICL  120

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
            MDCPIPSEDSLNWVCDYPEG++RL+V++WIDRNYDYFADLTP+LR  SLQLQGPCYPVIF
Sbjct  121  MDCPIPSEDSLNWVCDYPEGEVRLSVDDWIDRNYDYFADLTPDLRNTSLQLQGPCYPVIF  180

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGI  720
            PSVNVYWSCQ IARASNVSLRHWKEMGG+
Sbjct  181  PSVNVYWSCQLIARASNVSLRHWKEMGGV  209



>ref|XP_009789519.1| PREDICTED: choline transporter-like protein 2 [Nicotiana sylvestris]
Length=700

 Score =   391 bits (1004),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 176/209 (84%), Positives = 197/209 (94%), Gaps = 2/209 (1%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGPLGAVIG++PSSDG  +  +GDGIIKHNRKCRDVVFL+IFIAFWVAMIVNSSFGFNQ
Sbjct  3    MRGPLGAVIGRHPSSDGTTQ--TGDGIIKHNRKCRDVVFLVIFIAFWVAMIVNSSFGFNQ  60

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNPLRLTYGLDYKGNVCGDRHADP+L EL+LRYWLNPN+VY+SG KD+  K+ NAR+ICL
Sbjct  61   GNPLRLTYGLDYKGNVCGDRHADPDLRELELRYWLNPNQVYESGSKDNQAKISNARTICL  120

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
            MDCPIPSEDSLNWVCDYPEG++R++V++WIDRNYDYFADLTP+LR  SLQLQGPCYPVIF
Sbjct  121  MDCPIPSEDSLNWVCDYPEGEVRMSVDDWIDRNYDYFADLTPDLRNTSLQLQGPCYPVIF  180

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGI  720
            PSVNVYWSCQ IARASNVSLRHW+EMGG+
Sbjct  181  PSVNVYWSCQLIARASNVSLRHWREMGGV  209



>ref|XP_004244222.1| PREDICTED: choline transporter-like protein 2 [Solanum lycopersicum]
Length=699

 Score =   390 bits (1003),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 179/209 (86%), Positives = 194/209 (93%), Gaps = 1/209 (0%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGPLGAVIGKYPSSDG G    GDGIIKHNRKCRDVVFL+IFI FWVAMIVNSSFGFNQ
Sbjct  1    MRGPLGAVIGKYPSSDG-GVAEKGDGIIKHNRKCRDVVFLVIFITFWVAMIVNSSFGFNQ  59

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNPLRLT GLDYKGNVCGDRHADP+L EL+LRYW+NPN+VY+SG KD+  KL NAR+ICL
Sbjct  60   GNPLRLTSGLDYKGNVCGDRHADPDLRELELRYWVNPNQVYESGSKDNQAKLSNARTICL  119

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
            MDCPIPSEDSLNWVCDYPEG++RL+V++WIDRNYDYFADLTP+LR  SLQLQGPCYPVIF
Sbjct  120  MDCPIPSEDSLNWVCDYPEGEVRLSVDDWIDRNYDYFADLTPDLRNTSLQLQGPCYPVIF  179

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGI  720
            PSVNVYWSCQ IARASNVSLRHWKEMGG+
Sbjct  180  PSVNVYWSCQLIARASNVSLRHWKEMGGV  208



>emb|CDP05904.1| unnamed protein product [Coffea canephora]
Length=374

 Score =   377 bits (967),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 173/206 (84%), Positives = 193/206 (94%), Gaps = 2/206 (1%)
 Frame = +1

Query  103  PLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNP  282
            PLG VIG+YPSSDGN ++  G GIIKHNRKCRDVVFL+IFIAFWVAMIVNSSFGFNQGNP
Sbjct  3    PLGPVIGRYPSSDGNTQM--GVGIIKHNRKCRDVVFLVIFIAFWVAMIVNSSFGFNQGNP  60

Query  283  LRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICLMDC  462
            LRL YGLDYKGNVCGDRHADP+L EL+LRYWLNPN+VYQSG K++ VKL NARSICL+DC
Sbjct  61   LRLVYGLDYKGNVCGDRHADPDLRELELRYWLNPNQVYQSGLKNAQVKLENARSICLLDC  120

Query  463  PIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIFPSV  642
            PIPSEDSLNWVCDYP+GD++L+ ++WIDRNYDYFADLTPELR  SLQLQGPCYPVIFPSV
Sbjct  121  PIPSEDSLNWVCDYPDGDVKLSTDDWIDRNYDYFADLTPELRNSSLQLQGPCYPVIFPSV  180

Query  643  NVYWSCQFIARASNVSLRHWKEMGGI  720
            NVYWSCQF+ARASNVSLRHW++MGG+
Sbjct  181  NVYWSCQFVARASNVSLRHWQQMGGV  206


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 45/74 (61%), Gaps = 8/74 (11%)
 Frame = +2

Query  590  KSPFSSRVHVTLSYFLALMFIG-AANLLLAHQMCLCGIGRRWVGLKIFEDIIIDKAIHRS  766
            + P    +  +++ + +  F+  A+N+ L H   + G+        I EDI+IDK+IHR+
Sbjct  169  QGPCYPVIFPSVNVYWSCQFVARASNVSLRHWQQMGGV-------NIMEDIVIDKSIHRA  221

Query  767  INSRSSVFKRYVAD  808
            INSRS+V KRYVAD
Sbjct  222  INSRSAVLKRYVAD  235



>ref|XP_007021392.1| Plasma-membrane choline transporter family protein isoform 1 
[Theobroma cacao]
 gb|EOY12917.1| Plasma-membrane choline transporter family protein isoform 1 
[Theobroma cacao]
Length=701

 Score =   377 bits (969),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 172/209 (82%), Positives = 190/209 (91%), Gaps = 3/209 (1%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGPLGAVIG+YPSSDG  ++    GIIKHNRKCRDV FL+IFIAFWVAMIVNSSFGFNQ
Sbjct  5    MRGPLGAVIGRYPSSDGTTQIG---GIIKHNRKCRDVAFLIIFIAFWVAMIVNSSFGFNQ  61

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNPLRLTYGLDYKGN+CGD HADP+L +L+L+YWLNPN+VYQSG KDS  KL NARSICL
Sbjct  62   GNPLRLTYGLDYKGNLCGDEHADPSLRQLELKYWLNPNQVYQSGVKDSQFKLSNARSICL  121

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
            +DCPIPSEDSLNWVCDYPEGDIRL+ ++WIDRNYDYF  LTPE+R  SLQLQGPCYPVIF
Sbjct  122  LDCPIPSEDSLNWVCDYPEGDIRLSKDDWIDRNYDYFEFLTPEMRNASLQLQGPCYPVIF  181

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGI  720
            PSVNVYWSCQFIARASN SLRHW++MGG+
Sbjct  182  PSVNVYWSCQFIARASNTSLRHWQQMGGV  210



>ref|XP_007021393.1| Plasma-membrane choline transporter family protein isoform 2 
[Theobroma cacao]
 gb|EOY12918.1| Plasma-membrane choline transporter family protein isoform 2 
[Theobroma cacao]
Length=697

 Score =   377 bits (968),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 172/209 (82%), Positives = 190/209 (91%), Gaps = 3/209 (1%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGPLGAVIG+YPSSDG  ++    GIIKHNRKCRDV FL+IFIAFWVAMIVNSSFGFNQ
Sbjct  1    MRGPLGAVIGRYPSSDGTTQIG---GIIKHNRKCRDVAFLIIFIAFWVAMIVNSSFGFNQ  57

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNPLRLTYGLDYKGN+CGD HADP+L +L+L+YWLNPN+VYQSG KDS  KL NARSICL
Sbjct  58   GNPLRLTYGLDYKGNLCGDEHADPSLRQLELKYWLNPNQVYQSGVKDSQFKLSNARSICL  117

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
            +DCPIPSEDSLNWVCDYPEGDIRL+ ++WIDRNYDYF  LTPE+R  SLQLQGPCYPVIF
Sbjct  118  LDCPIPSEDSLNWVCDYPEGDIRLSKDDWIDRNYDYFEFLTPEMRNASLQLQGPCYPVIF  177

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGI  720
            PSVNVYWSCQFIARASN SLRHW++MGG+
Sbjct  178  PSVNVYWSCQFIARASNTSLRHWQQMGGV  206



>gb|EYU44898.1| hypothetical protein MIMGU_mgv1a002214mg [Erythranthe guttata]
Length=700

 Score =   377 bits (967),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 170/210 (81%), Positives = 192/210 (91%), Gaps = 0/210 (0%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGPLG VIGKYPSS G+     G+ IIKHNRKCRDV FL++FIAFWVAMIVNSSFGFNQ
Sbjct  1    MRGPLGPVIGKYPSSSGDVNGGVGNDIIKHNRKCRDVAFLVVFIAFWVAMIVNSSFGFNQ  60

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNPLRL+YGLDYKGNVCGDRHAD +LHEL+LRYWLNPN+VYQ+G K+S  +L NARSICL
Sbjct  61   GNPLRLSYGLDYKGNVCGDRHADRDLHELELRYWLNPNQVYQTGLKESKFQLSNARSICL  120

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
            +DCPIPSEDSLNWVCDYPEGDI L++++WIDRNYDYFADLTP LR  SLQLQGPCYPVIF
Sbjct  121  LDCPIPSEDSLNWVCDYPEGDIHLSMDDWIDRNYDYFADLTPILRNSSLQLQGPCYPVIF  180

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGIE  723
            PSVNVYW+CQFIARASNVSL+HW++MGG++
Sbjct  181  PSVNVYWTCQFIARASNVSLKHWEQMGGVK  210


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  716  GLKIFEDIIIDKAIHRSINSRSSVFKRYVAD  808
            G+K+ EDI IDK+IH+SINSRSSV KRYVAD
Sbjct  208  GVKVIEDIAIDKSIHKSINSRSSVLKRYVAD  238



>gb|KJB45693.1| hypothetical protein B456_007G321200 [Gossypium raimondii]
Length=697

 Score =   373 bits (957),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 169/209 (81%), Positives = 190/209 (91%), Gaps = 3/209 (1%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGPLGAVIG+YPSSDG  E+    GII+HNRKCRD+VFL+IFIAFWVAMIVNSSFGFNQ
Sbjct  1    MRGPLGAVIGRYPSSDGTTEIG---GIIRHNRKCRDIVFLVIFIAFWVAMIVNSSFGFNQ  57

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNPLRLTYGLDYKGN+CGD+HA P L +L+L+YWLNPN+VYQSG KDS  KL NARSICL
Sbjct  58   GNPLRLTYGLDYKGNLCGDKHAHPGLRKLELKYWLNPNQVYQSGVKDSQFKLSNARSICL  117

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
             DCPIPSEDSLNWVCDYPEGDIRL++ +WI+RNYDY+  LTPE+R  SLQLQGPCYPVIF
Sbjct  118  WDCPIPSEDSLNWVCDYPEGDIRLSMRDWINRNYDYYEFLTPEMRNTSLQLQGPCYPVIF  177

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGI  720
            PSVNVYWSCQFIARASN+SLRHW++MGG+
Sbjct  178  PSVNVYWSCQFIARASNISLRHWQQMGGV  206


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 45/74 (61%), Gaps = 8/74 (11%)
 Frame = +2

Query  590  KSPFSSRVHVTLSYFLALMFIG-AANLLLAHQMCLCGIGRRWVGLKIFEDIIIDKAIHRS  766
            + P    +  +++ + +  FI  A+N+ L H   + G+        I ED++IDK+IHRS
Sbjct  169  QGPCYPVIFPSVNVYWSCQFIARASNISLRHWQQMGGV-------NINEDMVIDKSIHRS  221

Query  767  INSRSSVFKRYVAD  808
            INSRSSV KRY+AD
Sbjct  222  INSRSSVLKRYMAD  235



>gb|KHG10168.1| Choline transporter-like protein 2 [Gossypium arboreum]
Length=709

 Score =   371 bits (953),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 168/209 (80%), Positives = 189/209 (90%), Gaps = 3/209 (1%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGPLGAVIG+YPSSDG  E+    GII+HNRKCRD+VFL+IFIAFWVAMIVNSSFGFNQ
Sbjct  1    MRGPLGAVIGRYPSSDGTTEIG---GIIRHNRKCRDIVFLVIFIAFWVAMIVNSSFGFNQ  57

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNPLRLTYGLDYKGN+CGD+HA P L +L+L+YWLNPN+VYQSG KDS  KL NARSICL
Sbjct  58   GNPLRLTYGLDYKGNLCGDKHAHPGLRKLELKYWLNPNQVYQSGVKDSQFKLSNARSICL  117

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
             DCP PSEDSLNWVCDYPEGDIRL++ +WI+RNYDY+  LTPE+R  SLQLQGPCYPVIF
Sbjct  118  WDCPTPSEDSLNWVCDYPEGDIRLSMRDWINRNYDYYEFLTPEMRNTSLQLQGPCYPVIF  177

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGI  720
            PSVNVYWSCQFIARASN+SLRHW++MGG+
Sbjct  178  PSVNVYWSCQFIARASNISLRHWQQMGGV  206


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 45/74 (61%), Gaps = 8/74 (11%)
 Frame = +2

Query  590  KSPFSSRVHVTLSYFLALMFIG-AANLLLAHQMCLCGIGRRWVGLKIFEDIIIDKAIHRS  766
            + P    +  +++ + +  FI  A+N+ L H   + G+        I ED++IDK+IHRS
Sbjct  169  QGPCYPVIFPSVNVYWSCQFIARASNISLRHWQQMGGV-------NINEDMVIDKSIHRS  221

Query  767  INSRSSVFKRYVAD  808
            INSRSSV KRY+AD
Sbjct  222  INSRSSVLKRYMAD  235



>ref|XP_011029459.1| PREDICTED: choline transporter-like protein 2 isoform X1 [Populus 
euphratica]
Length=697

 Score =   369 bits (946),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 167/209 (80%), Positives = 189/209 (90%), Gaps = 3/209 (1%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGPLGAVIG+YPSSDG+ +V    GII+HNRKCRDV FL+IFIAFWVAMIVNSSFGFN+
Sbjct  1    MRGPLGAVIGRYPSSDGSTQVG---GIIRHNRKCRDVAFLVIFIAFWVAMIVNSSFGFNK  57

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNPLRLTYGLDYKGNVCGDRHA P L EL+L YWLNPN+VY SG K+S  KL NARSICL
Sbjct  58   GNPLRLTYGLDYKGNVCGDRHAHPGLRELELTYWLNPNQVYLSGLKNSQFKLANARSICL  117

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
            +DCPIPSED+LNWVCDYPEG+IRL+V++WIDRNYDYF  LTPE+R  SLQLQGPCYPVIF
Sbjct  118  LDCPIPSEDALNWVCDYPEGEIRLSVDDWIDRNYDYFEFLTPEMRNTSLQLQGPCYPVIF  177

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGI  720
            PSVNVYW CQ++ARASNVS+RHW++MGG+
Sbjct  178  PSVNVYWRCQYVARASNVSMRHWQQMGGV  206


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  716  GLKIFEDIIIDKAIHRSINSRSSVFKRYVAD  808
            G+ I EDIIIDK+IHRSIN+RSSV KRYVAD
Sbjct  205  GVNINEDIIIDKSIHRSINARSSVLKRYVAD  235



>ref|XP_011029460.1| PREDICTED: choline transporter-like protein 2 isoform X2 [Populus 
euphratica]
Length=697

 Score =   369 bits (946),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 167/209 (80%), Positives = 189/209 (90%), Gaps = 3/209 (1%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGPLGAVIG+YPSSDG+ +V    GII+HNRKCRDV FL+IFIAFWVAMIVNSSFGFN+
Sbjct  1    MRGPLGAVIGRYPSSDGSTQVG---GIIRHNRKCRDVAFLVIFIAFWVAMIVNSSFGFNK  57

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNPLRLTYGLDYKGNVCGDRHA P L EL+L YWLNPN+VY SG K+S  KL NARSICL
Sbjct  58   GNPLRLTYGLDYKGNVCGDRHAHPGLRELELTYWLNPNQVYLSGLKNSQFKLANARSICL  117

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
            +DCPIPSED+LNWVCDYPEG+IRL+V++WIDRNYDYF  LTPE+R  SLQLQGPCYPVIF
Sbjct  118  LDCPIPSEDALNWVCDYPEGEIRLSVDDWIDRNYDYFEFLTPEMRNTSLQLQGPCYPVIF  177

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGI  720
            PSVNVYW CQ++ARASNVS+RHW++MGG+
Sbjct  178  PSVNVYWRCQYVARASNVSMRHWQQMGGV  206


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  716  GLKIFEDIIIDKAIHRSINSRSSVFKRYVAD  808
            G+ I EDIIIDK+IHRSIN+RSSV KRYVAD
Sbjct  205  GVNINEDIIIDKSIHRSINARSSVLKRYVAD  235



>ref|XP_002316905.2| choline transporter-related family protein [Populus trichocarpa]
 gb|EEE97517.2| choline transporter-related family protein [Populus trichocarpa]
Length=697

 Score =   367 bits (942),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 165/209 (79%), Positives = 189/209 (90%), Gaps = 3/209 (1%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGPLGAVIG+YPSSDG+ +V    GII+HNRKCRDV FL+IFIAFWVAM+VNSSFGFN+
Sbjct  1    MRGPLGAVIGRYPSSDGSTQVG---GIIRHNRKCRDVAFLVIFIAFWVAMVVNSSFGFNK  57

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNPLRLTYGLDYKGNVCGDRHA P L EL+L YWLNPN+VY SG K+S  KL NAR+ICL
Sbjct  58   GNPLRLTYGLDYKGNVCGDRHAHPGLRELELTYWLNPNQVYLSGLKNSQFKLANARTICL  117

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
            +DCPIPSED+LNWVCDYPEG+IRL+V++WIDRNYDYF  LTPE+R  SLQLQGPCYPVIF
Sbjct  118  LDCPIPSEDALNWVCDYPEGEIRLSVDDWIDRNYDYFEFLTPEMRNTSLQLQGPCYPVIF  177

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGI  720
            PSVNVYW CQ++ARASNVS+RHW++MGG+
Sbjct  178  PSVNVYWRCQYVARASNVSMRHWQQMGGV  206


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  716  GLKIFEDIIIDKAIHRSINSRSSVFKRYVAD  808
            G+ I EDIIIDK+IHRSIN+RSSV KRYVAD
Sbjct  205  GVNINEDIIIDKSIHRSINARSSVLKRYVAD  235



>ref|XP_004141227.1| PREDICTED: choline transporter-like protein 2 [Cucumis sativus]
 gb|KGN55136.1| hypothetical protein Csa_4G637760 [Cucumis sativus]
Length=702

 Score =   367 bits (941),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/209 (80%), Positives = 188/209 (90%), Gaps = 3/209 (1%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGPLGAVIG+YPSSDGN ++    GII+HNRKCRD+VFL+IFIAFWV MIVNSSFGFNQ
Sbjct  1    MRGPLGAVIGRYPSSDGNAQMG---GIIRHNRKCRDIVFLVIFIAFWVGMIVNSSFGFNQ  57

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNPLRLTYGLDYKGNVCGD+HA+P L EL+L+YWLNPN+VYQSG KDS  KL +ARSICL
Sbjct  58   GNPLRLTYGLDYKGNVCGDKHANPGLRELELKYWLNPNQVYQSGLKDSQFKLADARSICL  117

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
            MDCP PSEDSLNWVCDYPEG+IRL++++WIDRNYDYF  LTPE+R  S+ LQGPCYPVIF
Sbjct  118  MDCPTPSEDSLNWVCDYPEGEIRLSMDDWIDRNYDYFEFLTPEMRNSSVNLQGPCYPVIF  177

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGI  720
            PSVNVYWSCQF+AR SNVSL HWK MGG+
Sbjct  178  PSVNVYWSCQFLARPSNVSLTHWKMMGGM  206



>ref|XP_006451901.1| hypothetical protein CICLE_v10007637mg [Citrus clementina]
 ref|XP_006464735.1| PREDICTED: choline transporter-like protein 2-like isoform X1 
[Citrus sinensis]
 gb|ESR65141.1| hypothetical protein CICLE_v10007637mg [Citrus clementina]
 gb|KDO74086.1| hypothetical protein CISIN_1g005448mg [Citrus sinensis]
Length=696

 Score =   365 bits (936),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 170/210 (81%), Positives = 189/210 (90%), Gaps = 4/210 (2%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGPLGAVIG+YPSSDG+  V    GIIKHNRKCRDV FL+IFIAFWVAMIVNSSFGFNQ
Sbjct  1    MRGPLGAVIGRYPSSDGS--VPIDGGIIKHNRKCRDVAFLVIFIAFWVAMIVNSSFGFNQ  58

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNPLRLTYGLDYKGNVCGDRHA   L EL+LRYWLNPN+VYQSG K S  KL NARSICL
Sbjct  59   GNPLRLTYGLDYKGNVCGDRHA--GLRELELRYWLNPNQVYQSGLKGSQFKLANARSICL  116

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
            +DCPIP+EDSLNWVCDYPEG+IRL++++WIDRNYDYF  LTPE+R  SLQLQGPCYPV+F
Sbjct  117  LDCPIPAEDSLNWVCDYPEGEIRLSMDDWIDRNYDYFEFLTPEMRNSSLQLQGPCYPVVF  176

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGIE  723
            PSVNVYWSCQFIARASN+SL+HW++MGG+ 
Sbjct  177  PSVNVYWSCQFIARASNMSLKHWQQMGGVT  206


 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 45/74 (61%), Gaps = 8/74 (11%)
 Frame = +2

Query  590  KSPFSSRVHVTLSYFLALMFIG-AANLLLAHQMCLCGIGRRWVGLKIFEDIIIDKAIHRS  766
            + P    V  +++ + +  FI  A+N+ L H   + G+        I ED++IDK+IHR+
Sbjct  168  QGPCYPVVFPSVNVYWSCQFIARASNMSLKHWQQMGGV-------TINEDLLIDKSIHRT  220

Query  767  INSRSSVFKRYVAD  808
            INSRS+V KRY+AD
Sbjct  221  INSRSAVLKRYMAD  234



>ref|XP_011082663.1| PREDICTED: choline transporter-like protein 2 [Sesamum indicum]
Length=702

 Score =   364 bits (935),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 168/212 (79%), Positives = 185/212 (87%), Gaps = 2/212 (1%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDG--IIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGF  267
            MRGPLG VIGKYPSS             IIKHNRKCRDVVFL+IFIAFW+AMIVNSSFGF
Sbjct  1    MRGPLGPVIGKYPSSSDGNGGMGNGSNDIIKHNRKCRDVVFLVIFIAFWIAMIVNSSFGF  60

Query  268  NQGNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSI  447
            NQGNP RL YGLDYKGNVCGDRHADP+L EL+LRYWLNPN+VYQ+G K S  +L NARSI
Sbjct  61   NQGNPSRLIYGLDYKGNVCGDRHADPDLRELELRYWLNPNQVYQTGVKGSKFQLSNARSI  120

Query  448  CLMDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPV  627
            CLMDCPIPSED +NWVCDYPEGDI ++V++WIDRNYDYFADLTPELR  SLQLQGPCYPV
Sbjct  121  CLMDCPIPSEDGVNWVCDYPEGDIHISVDDWIDRNYDYFADLTPELRNTSLQLQGPCYPV  180

Query  628  IFPSVNVYWSCQFIARASNVSLRHWKEMGGIE  723
            IFPSVNVYW+CQFIARASNVSL HW++MGG++
Sbjct  181  IFPSVNVYWTCQFIARASNVSLTHWQQMGGVK  212


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 45/74 (61%), Gaps = 8/74 (11%)
 Frame = +2

Query  590  KSPFSSRVHVTLSYFLALMFIG-AANLLLAHQMCLCGIGRRWVGLKIFEDIIIDKAIHRS  766
            + P    +  +++ +    FI  A+N+ L H        ++  G+K+ EDI IDK+IH++
Sbjct  174  QGPCYPVIFPSVNVYWTCQFIARASNVSLTHW-------QQMGGVKVIEDIAIDKSIHKA  226

Query  767  INSRSSVFKRYVAD  808
            INSRSSV KRYVAD
Sbjct  227  INSRSSVLKRYVAD  240



>ref|XP_010098992.1| hypothetical protein L484_025652 [Morus notabilis]
 gb|EXB76294.1| hypothetical protein L484_025652 [Morus notabilis]
Length=671

 Score =   363 bits (932),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 165/210 (79%), Positives = 193/210 (92%), Gaps = 3/210 (1%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGPLGAVIG+YPSSDG+ ++  G+GII+HNRKCRDVVFL+IF AFWVAMIVNSSFGFN+
Sbjct  1    MRGPLGAVIGRYPSSDGSAQMG-GNGIIRHNRKCRDVVFLVIFSAFWVAMIVNSSFGFNK  59

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNPLRLTYGLDYKGNVCGD+HA   L +L+LRYWLNPN+VYQSG KDS  KL NARSICL
Sbjct  60   GNPLRLTYGLDYKGNVCGDKHA--GLRQLELRYWLNPNQVYQSGLKDSGFKLANARSICL  117

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
            +DCP+PS+D+LNWVCDYPEGDIRL++++WIDRN+DYF  LTPE+R  SLQLQGPCYPVIF
Sbjct  118  LDCPMPSDDALNWVCDYPEGDIRLSMDDWIDRNFDYFEFLTPEMRNTSLQLQGPCYPVIF  177

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGIE  723
            PS+NVYWSCQFIAR+SN+SLRHW++MGG+ 
Sbjct  178  PSINVYWSCQFIARSSNMSLRHWQQMGGVH  207



>ref|XP_003527259.1| PREDICTED: choline transporter-like protein 2-like [Glycine max]
Length=699

 Score =   364 bits (934),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 164/209 (78%), Positives = 188/209 (90%), Gaps = 3/209 (1%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGPLGAVIG+YPSSDG   V+   GII+HNRKCRD++ L+IFIAFW+AMIVNSSFGFNQ
Sbjct  1    MRGPLGAVIGRYPSSDG---VTQMGGIIRHNRKCRDIIVLVIFIAFWIAMIVNSSFGFNQ  57

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNPLRLTYGLDYKGNVCGD+HA P L EL+LRYW NPN+VYQSG KDS  KL +ARSICL
Sbjct  58   GNPLRLTYGLDYKGNVCGDKHAHPGLSELELRYWQNPNQVYQSGLKDSQFKLADARSICL  117

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
             +CP+PSEDSLNWVCDYPEGDIRL++++WI+RNYDYF  LTPE+R  SLQLQGPCYPVIF
Sbjct  118  SECPMPSEDSLNWVCDYPEGDIRLSMKDWINRNYDYFEFLTPEMRNSSLQLQGPCYPVIF  177

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGI  720
            P+VNVYWSCQFIARASN SL+HW++MGG+
Sbjct  178  PTVNVYWSCQFIARASNTSLKHWQQMGGV  206


 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 45/74 (61%), Gaps = 8/74 (11%)
 Frame = +2

Query  590  KSPFSSRVHVTLSYFLALMFIG-AANLLLAHQMCLCGIGRRWVGLKIFEDIIIDKAIHRS  766
            + P    +  T++ + +  FI  A+N  L H        ++  G+ I EDI+IDK+IH+S
Sbjct  169  QGPCYPVIFPTVNVYWSCQFIARASNTSLKHW-------QQMGGVNINEDIVIDKSIHKS  221

Query  767  INSRSSVFKRYVAD  808
            INSRS+V +RY+AD
Sbjct  222  INSRSAVLERYMAD  235



>ref|XP_002284857.1| PREDICTED: choline transporter-like protein 2 [Vitis vinifera]
 emb|CBI20324.3| unnamed protein product [Vitis vinifera]
Length=697

 Score =   363 bits (933),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 163/210 (78%), Positives = 191/210 (91%), Gaps = 3/210 (1%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGPLGAVIG+YPSSDG+ ++    GII+HNRKCRD+ FL++FIAFWVAMIVNSSFGFN+
Sbjct  1    MRGPLGAVIGRYPSSDGSTQMG---GIIRHNRKCRDIAFLVLFIAFWVAMIVNSSFGFNK  57

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNPLRLT+GLDY+GNVCG+RHA  NL EL+LRYW+NPN+VYQSG K+S  KL NARSICL
Sbjct  58   GNPLRLTFGLDYEGNVCGNRHAKRNLRELELRYWVNPNQVYQSGLKNSGFKLSNARSICL  117

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
            M+CPIPSEDSLNWVCDYPEGDI L +++WIDRNYDYF  LTP++R  SLQLQGPCYPVIF
Sbjct  118  MECPIPSEDSLNWVCDYPEGDIHLTMDDWIDRNYDYFEFLTPDMRNTSLQLQGPCYPVIF  177

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGIE  723
            PSVNV+WSCQFIARASN+SLRHW++MGG++
Sbjct  178  PSVNVFWSCQFIARASNMSLRHWQQMGGVK  207


 Score = 57.0 bits (136),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 46/74 (62%), Gaps = 8/74 (11%)
 Frame = +2

Query  590  KSPFSSRVHVTLSYFLALMFIG-AANLLLAHQMCLCGIGRRWVGLKIFEDIIIDKAIHRS  766
            + P    +  +++ F +  FI  A+N+ L H   + G+       KI EDI+IDK+IHRS
Sbjct  169  QGPCYPVIFPSVNVFWSCQFIARASNMSLRHWQQMGGV-------KINEDIVIDKSIHRS  221

Query  767  INSRSSVFKRYVAD  808
            INSRSSV KRY+AD
Sbjct  222  INSRSSVLKRYMAD  235



>ref|XP_008452469.1| PREDICTED: choline transporter-like protein 2 [Cucumis melo]
Length=702

 Score =   363 bits (933),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 166/209 (79%), Positives = 187/209 (89%), Gaps = 3/209 (1%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGPLGAVIG+YPSSDGN ++    GII+HNRKCRD+VFL+IFIAFWV MIVNSSFGFNQ
Sbjct  1    MRGPLGAVIGRYPSSDGNAQMG---GIIRHNRKCRDIVFLVIFIAFWVGMIVNSSFGFNQ  57

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNPLRLTYGLDYKGNVCGD+HA+P L EL+L+YWLNPN+VYQSG KDS  KL +ARSICL
Sbjct  58   GNPLRLTYGLDYKGNVCGDKHANPGLRELELKYWLNPNQVYQSGLKDSQFKLADARSICL  117

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
            MDCP PSEDSLNWVCDYPEG+IRL++++WIDRNYDYF  LTPE+R  S+ LQGPCYPVIF
Sbjct  118  MDCPTPSEDSLNWVCDYPEGEIRLSMDDWIDRNYDYFEFLTPEMRNSSVNLQGPCYPVIF  177

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGI  720
            PSVNVYWSCQF+ R SNVSL HWK MGG+
Sbjct  178  PSVNVYWSCQFLDRPSNVSLTHWKLMGGM  206



>gb|KJB13391.1| hypothetical protein B456_002G072200 [Gossypium raimondii]
Length=697

 Score =   363 bits (933),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 164/210 (78%), Positives = 186/210 (89%), Gaps = 3/210 (1%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGPLGAV+ +YP SDG  E     GII+HNRKCRDV FL+IFIAFWVAMIVNSSFGFNQ
Sbjct  1    MRGPLGAVLERYPLSDGTTE---DGGIIRHNRKCRDVAFLVIFIAFWVAMIVNSSFGFNQ  57

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNPLRLTYGLDYKGNVCGD+HA P LH+L+L+YWLNPN+VYQSG KDS  KL NARSICL
Sbjct  58   GNPLRLTYGLDYKGNVCGDKHAHPGLHQLELKYWLNPNQVYQSGVKDSQFKLSNARSICL  117

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
            +DCP P EDSL+WVCDYPEGDI L++++WIDRNYDY+  LTPE++  SLQLQGPCYPVIF
Sbjct  118  LDCPTPLEDSLSWVCDYPEGDIHLSMDDWIDRNYDYYEILTPEMKNASLQLQGPCYPVIF  177

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGIE  723
            PSVNVYWSCQ+IARASN SLRHWK+MGG++
Sbjct  178  PSVNVYWSCQYIARASNASLRHWKQMGGVD  207



>ref|XP_003540093.1| PREDICTED: choline transporter-like protein 2-like [Glycine max]
Length=699

 Score =   363 bits (931),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 164/209 (78%), Positives = 186/209 (89%), Gaps = 3/209 (1%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGPLGAVIG+YPSSDG   V+   GII+HNRKCRD+  L+IFIAFW+AMIVNSSF FNQ
Sbjct  1    MRGPLGAVIGRYPSSDG---VTQMGGIIRHNRKCRDITVLVIFIAFWIAMIVNSSFAFNQ  57

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNPLRLTYGLDYKGNVCGD+HA P L EL+LRYW NPN+VYQSG KDS  KL +ARSICL
Sbjct  58   GNPLRLTYGLDYKGNVCGDKHAHPGLSELELRYWQNPNQVYQSGLKDSQFKLADARSICL  117

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
             +CP+PSEDSLNWVCDYPEGDIRL++++WI+RNYDYF  LTPE+R  SLQLQGPCYPVIF
Sbjct  118  SECPMPSEDSLNWVCDYPEGDIRLSMKDWINRNYDYFEFLTPEMRNSSLQLQGPCYPVIF  177

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGI  720
            PSVNVYWSCQFIARASN SL+HW++MGG+
Sbjct  178  PSVNVYWSCQFIARASNTSLKHWQQMGGV  206


 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  716  GLKIFEDIIIDKAIHRSINSRSSVFKRYVAD  808
            G+ I EDI+IDK+IH+SINSRSSV KRY+AD
Sbjct  205  GVNINEDIVIDKSIHKSINSRSSVLKRYMAD  235



>gb|KHN23450.1| Choline transporter-like protein 2 [Glycine soja]
Length=699

 Score =   363 bits (931),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 164/209 (78%), Positives = 186/209 (89%), Gaps = 3/209 (1%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGPLGAVIG+YPSSDG   V+   GII+HNRKCRD+  L+IFIAFW+AMIVNSSF FNQ
Sbjct  1    MRGPLGAVIGRYPSSDG---VTQMGGIIRHNRKCRDITVLVIFIAFWIAMIVNSSFAFNQ  57

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNPLRLTYGLDYKGNVCGD+HA P L EL+LRYW NPN+VYQSG KDS  KL +ARSICL
Sbjct  58   GNPLRLTYGLDYKGNVCGDKHAHPGLSELELRYWQNPNQVYQSGLKDSQFKLADARSICL  117

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
             +CP+PSEDSLNWVCDYPEGDIRL++++WI+RNYDYF  LTPE+R  SLQLQGPCYPVIF
Sbjct  118  SECPMPSEDSLNWVCDYPEGDIRLSMKDWINRNYDYFEFLTPEMRNSSLQLQGPCYPVIF  177

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGI  720
            PSVNVYWSCQFIARASN SL+HW++MGG+
Sbjct  178  PSVNVYWSCQFIARASNTSLKHWQQMGGV  206


 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  716  GLKIFEDIIIDKAIHRSINSRSSVFKRYVAD  808
            G+ I EDI+IDK+IH+SINSRSSV KRY+AD
Sbjct  205  GVNINEDIVIDKSIHKSINSRSSVLKRYMAD  235



>gb|KHN37168.1| Choline transporter-like protein 2 [Glycine soja]
Length=699

 Score =   363 bits (931),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 163/209 (78%), Positives = 188/209 (90%), Gaps = 3/209 (1%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGPLGAVIG+YPSSDG   V+   GII+HNRKCRD++ L+IFIAFW+AMIVNSSFGFNQ
Sbjct  1    MRGPLGAVIGRYPSSDG---VTQMGGIIRHNRKCRDIIVLVIFIAFWIAMIVNSSFGFNQ  57

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNPLRLTYGLDYKGNVCGD+HA P L EL+LRYW NPN+VYQSG KDS  KL +ARSICL
Sbjct  58   GNPLRLTYGLDYKGNVCGDKHAHPGLSELELRYWQNPNQVYQSGLKDSQFKLADARSICL  117

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
             +CP+PSEDSLNWVCDYPEGDIRL++++WI+RNYDYF  LTPE+R  SLQLQGPCYPVIF
Sbjct  118  SECPMPSEDSLNWVCDYPEGDIRLSMKDWINRNYDYFEFLTPEMRNSSLQLQGPCYPVIF  177

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGI  720
            P+VNVYW+CQFIARASN SL+HW++MGG+
Sbjct  178  PTVNVYWNCQFIARASNTSLKHWQQMGGV  206



>ref|XP_002528555.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF33810.1| conserved hypothetical protein [Ricinus communis]
Length=697

 Score =   362 bits (930),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 163/209 (78%), Positives = 189/209 (90%), Gaps = 3/209 (1%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGPLGAVIG+YPSSDG+ ++   DGII+ NRKCRDV FL+IFIAFWVAMIVNSSFGFNQ
Sbjct  1    MRGPLGAVIGRYPSSDGSTQI---DGIIRRNRKCRDVAFLVIFIAFWVAMIVNSSFGFNQ  57

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNPLRLTYGLDYKGNVCGD+HA P+L +L+L YWLNPN+VY SG K++  KL NARS+CL
Sbjct  58   GNPLRLTYGLDYKGNVCGDKHAHPDLDQLELMYWLNPNQVYLSGLKNTQFKLANARSVCL  117

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
            +DCPIPSED+LNWVCDYPEGDIRL++++WIDRNYDYF  LTPE+R  SL+LQGPCYPVIF
Sbjct  118  LDCPIPSEDALNWVCDYPEGDIRLSMDDWIDRNYDYFEFLTPEMRNTSLKLQGPCYPVIF  177

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGI  720
            PSVNV+W CQFIA ASNVSLRHW++MGG+
Sbjct  178  PSVNVFWRCQFIAHASNVSLRHWQQMGGV  206


 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 44/74 (59%), Gaps = 8/74 (11%)
 Frame = +2

Query  590  KSPFSSRVHVTLSYFLALMFIG-AANLLLAHQMCLCGIGRRWVGLKIFEDIIIDKAIHRS  766
            + P    +  +++ F    FI  A+N+ L H   + G+        I EDIIIDK+IH+S
Sbjct  169  QGPCYPVIFPSVNVFWRCQFIAHASNVSLRHWQQMGGV-------NINEDIIIDKSIHKS  221

Query  767  INSRSSVFKRYVAD  808
            IN+RSSV KRY+AD
Sbjct  222  INARSSVLKRYMAD  235



>emb|CAN73032.1| hypothetical protein VITISV_026350 [Vitis vinifera]
Length=738

 Score =   363 bits (931),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 163/210 (78%), Positives = 191/210 (91%), Gaps = 3/210 (1%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGPLGAVIG+YPSSDG+ ++    GII+HNRKCRD+ FL++FIAFWVAMIVNSSFGFN+
Sbjct  1    MRGPLGAVIGRYPSSDGSTQMG---GIIRHNRKCRDIAFLVLFIAFWVAMIVNSSFGFNK  57

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNPLRLT+GLDY+GNVCG+RHA  NL EL+LRYW+NPN+VYQSG K+S  KL NARSICL
Sbjct  58   GNPLRLTFGLDYEGNVCGNRHAKRNLRELELRYWVNPNQVYQSGLKNSGFKLSNARSICL  117

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
            M+CPIP EDSLNWVCDYPEGDIRL +++WIDRNYDYF  LTP++R  SLQLQGPCYPVIF
Sbjct  118  MECPIPLEDSLNWVCDYPEGDIRLTMDDWIDRNYDYFEFLTPDMRNTSLQLQGPCYPVIF  177

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGIE  723
            PSVNV+WSCQFIARASN+SLRHW++MGG++
Sbjct  178  PSVNVFWSCQFIARASNMSLRHWQQMGGVK  207


 Score = 57.0 bits (136),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 47/74 (64%), Gaps = 8/74 (11%)
 Frame = +2

Query  590  KSPFSSRVHVTLSYFLALMFIG-AANLLLAHQMCLCGIGRRWVGLKIFEDIIIDKAIHRS  766
            + P    +  +++ F +  FI  A+N+ L H        ++  G+KI EDI+IDK+IHRS
Sbjct  169  QGPCYPVIFPSVNVFWSCQFIARASNMSLRHW-------QQMGGVKINEDIVIDKSIHRS  221

Query  767  INSRSSVFKRYVAD  808
            INSRSSV KRY+AD
Sbjct  222  INSRSSVLKRYMAD  235



>ref|XP_010060542.1| PREDICTED: choline transporter-like protein 2 [Eucalyptus grandis]
 gb|KCW67319.1| hypothetical protein EUGRSUZ_F01103 [Eucalyptus grandis]
Length=700

 Score =   362 bits (929),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 163/210 (78%), Positives = 187/210 (89%), Gaps = 3/210 (1%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGPLG VIG+YPSSDG+ +V    GII+HNRKCRDV FL+ FIAFWVAMIVNSSFGFN+
Sbjct  1    MRGPLGPVIGRYPSSDGSTQVG---GIIRHNRKCRDVAFLVFFIAFWVAMIVNSSFGFNR  57

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNPLRLT+GLDYKGNVCGD+HA+P L +L LRYW+NPN+VYQSG KDS   L NARSICL
Sbjct  58   GNPLRLTFGLDYKGNVCGDKHANPGLRQLKLRYWMNPNQVYQSGLKDSQFNLANARSICL  117

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
            +DCP PS+DSLNWVCDYPEGDIR++ E+WIDR YDYF  LTPE+R  SLQLQGPCYPVIF
Sbjct  118  LDCPTPSDDSLNWVCDYPEGDIRISTEDWIDRYYDYFEFLTPEMRNTSLQLQGPCYPVIF  177

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGIE  723
            PSVNVYWSCQFIAR+SN+SLRHW++MGG++
Sbjct  178  PSVNVYWSCQFIARSSNMSLRHWQQMGGVK  207


 Score = 53.1 bits (126),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 3/38 (8%)
 Frame = +2

Query  704  RRWV---GLKIFEDIIIDKAIHRSINSRSSVFKRYVAD  808
            R W    G+KI EDI+ID++IHRSIN+RSSV KRY+AD
Sbjct  198  RHWQQMGGVKINEDIVIDRSIHRSINARSSVLKRYMAD  235



>ref|XP_009343591.1| PREDICTED: choline transporter-like protein 2 [Pyrus x bretschneideri]
Length=706

 Score =   360 bits (925),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 164/209 (78%), Positives = 188/209 (90%), Gaps = 3/209 (1%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGP+GAVIG+YP SDG+ ++ S   II+HNRKCRD+VFL+IFIAFWVAMIVNSSFGFNQ
Sbjct  1    MRGPMGAVIGRYPPSDGSAQMGS---IIRHNRKCRDLVFLVIFIAFWVAMIVNSSFGFNQ  57

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNPLRLTYGLDYKGNVCGD+HA P+L EL+L+YWLNPN+VY SG KD+  KL NARSICL
Sbjct  58   GNPLRLTYGLDYKGNVCGDKHAKPDLRELELKYWLNPNQVYLSGLKDNQFKLANARSICL  117

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
            MDCP PSEDSL+WVCDYP+GDIRL + +WIDRNYDY+  LTPE+R  SLQLQGPCYPVIF
Sbjct  118  MDCPTPSEDSLSWVCDYPDGDIRLKMGDWIDRNYDYYEFLTPEMRNTSLQLQGPCYPVIF  177

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGI  720
            PSVNVYW+CQFIAR SNVSLRHW++MGG+
Sbjct  178  PSVNVYWTCQFIARPSNVSLRHWQQMGGV  206


 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  716  GLKIFEDIIIDKAIHRSINSRSSVFKRYVAD  808
            G+ I EDIIIDK+IH++INSR+SVFKRY+AD
Sbjct  205  GVNINEDIIIDKSIHKAINSRASVFKRYMAD  235



>ref|XP_009356828.1| PREDICTED: choline transporter-like protein 2 [Pyrus x bretschneideri]
Length=706

 Score =   360 bits (925),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 164/209 (78%), Positives = 188/209 (90%), Gaps = 3/209 (1%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGP+GAVIG+YP SDG+ ++ S   II+HNRKCRD+VFL+IFIAFWVAMIVNSSFGFNQ
Sbjct  1    MRGPMGAVIGRYPPSDGSAQMGS---IIRHNRKCRDLVFLVIFIAFWVAMIVNSSFGFNQ  57

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNPLRLTYGLDYKGNVCGD+HA P+L EL+L+YWLNPN+VY SG KD+  KL NARSICL
Sbjct  58   GNPLRLTYGLDYKGNVCGDKHAKPDLRELELKYWLNPNQVYLSGLKDNQFKLANARSICL  117

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
            MDCP PSEDSL+WVCDYP+GDIRL + +WIDRNYDY+  LTPE+R  SLQLQGPCYPVIF
Sbjct  118  MDCPTPSEDSLSWVCDYPDGDIRLKMGDWIDRNYDYYEFLTPEMRNTSLQLQGPCYPVIF  177

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGI  720
            PSVNVYW+CQFIAR SNVSLRHW++MGG+
Sbjct  178  PSVNVYWTCQFIARPSNVSLRHWQQMGGV  206


 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  716  GLKIFEDIIIDKAIHRSINSRSSVFKRYVAD  808
            G+ I EDIIIDK+IH++INSR+SVFKRY+AD
Sbjct  205  GVNINEDIIIDKSIHKAINSRASVFKRYMAD  235



>ref|XP_008363605.1| PREDICTED: choline transporter-like protein 2 [Malus domestica]
Length=706

 Score =   360 bits (925),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 164/209 (78%), Positives = 187/209 (89%), Gaps = 3/209 (1%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGP+GAVIG+YP SDG+ ++ S   II+HNRKCRD+VFL+IFIAFWVAMIVNSSFGFNQ
Sbjct  1    MRGPMGAVIGRYPPSDGSAQMGS---IIRHNRKCRDLVFLVIFIAFWVAMIVNSSFGFNQ  57

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNPLRLTYGLDYKGNVCGD+HA P LHEL+L+YWLNPN+VY SG KD+  KL NARSICL
Sbjct  58   GNPLRLTYGLDYKGNVCGDKHAKPGLHELELKYWLNPNQVYLSGLKDNQFKLANARSICL  117

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
            MDCP PS DSL+WVCDYP+GDIRL + +WIDRNYDY+  LTPE+R  SLQLQGPCYPVIF
Sbjct  118  MDCPTPSVDSLSWVCDYPDGDIRLKMGDWIDRNYDYYEFLTPEMRNTSLQLQGPCYPVIF  177

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGI  720
            PSVNVYW+CQFIAR SNVSLRHW++MGG+
Sbjct  178  PSVNVYWTCQFIARPSNVSLRHWQQMGGV  206


 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  716  GLKIFEDIIIDKAIHRSINSRSSVFKRYVAD  808
            G+ I EDIIIDK+IH++INSR+SVFKRY+AD
Sbjct  205  GVNINEDIIIDKSIHKAINSRASVFKRYMAD  235



>ref|XP_004291650.1| PREDICTED: choline transporter-like protein 2 [Fragaria vesca 
subsp. vesca]
Length=702

 Score =   359 bits (922),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 163/209 (78%), Positives = 188/209 (90%), Gaps = 3/209 (1%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGPLGAVIG+YPSSDG+ ++ S   II+HNRKCRD+VFL+IFIAFWVAMIVNSSFGFNQ
Sbjct  1    MRGPLGAVIGRYPSSDGSDQMGS---IIRHNRKCRDLVFLIIFIAFWVAMIVNSSFGFNQ  57

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNPLRLTYGLDYKGNVCGD+HA P L EL+L+YWLNPN+VY SG KD+  KL NARSICL
Sbjct  58   GNPLRLTYGLDYKGNVCGDKHAHPGLRELELKYWLNPNQVYLSGLKDNQFKLENARSICL  117

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
            +DCP PS+D+LNWVCDYPEG+IRL++ +WIDRNYDYF  LTPE+R  SLQLQGPCYPVIF
Sbjct  118  LDCPSPSDDTLNWVCDYPEGEIRLSMSDWIDRNYDYFEFLTPEMRNASLQLQGPCYPVIF  177

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGI  720
            PSVNV+WSCQFIAR SN SL+HW++MGG+
Sbjct  178  PSVNVFWSCQFIARPSNSSLKHWQQMGGV  206



>ref|XP_010242931.1| PREDICTED: choline transporter-like protein 2 [Nelumbo nucifera]
Length=700

 Score =   359 bits (921),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 162/209 (78%), Positives = 186/209 (89%), Gaps = 3/209 (1%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGPLGAVIG+YPSSDG  EV    GIIKHNRKCRD+V L+ FI FW+ MIVN SF +N+
Sbjct  1    MRGPLGAVIGRYPSSDGQSEVG---GIIKHNRKCRDMVALIFFIGFWIGMIVNISFAYNR  57

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNPLRLTYGLDYKGNVCGD+HA+PNL ELDLRY+LNPN+VY++G K+S  KL NAR+ICL
Sbjct  58   GNPLRLTYGLDYKGNVCGDKHANPNLRELDLRYFLNPNQVYEAGTKNSQFKLANARTICL  117

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
            MDCPIPSEDSLNWVCDYPEGDIR+++++WIDRNYDYF  LTP++R  SLQLQGPCYPVIF
Sbjct  118  MDCPIPSEDSLNWVCDYPEGDIRISMDDWIDRNYDYFEFLTPDMRNTSLQLQGPCYPVIF  177

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGI  720
            PSVNVYWSCQ+IARASN+SLRHW EM G+
Sbjct  178  PSVNVYWSCQYIARASNMSLRHWHEMAGV  206


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 29/38 (76%), Gaps = 3/38 (8%)
 Frame = +2

Query  704  RRW---VGLKIFEDIIIDKAIHRSINSRSSVFKRYVAD  808
            R W    G+ I EDIIIDK+IHRSINSRS+  KRYVAD
Sbjct  198  RHWHEMAGVNINEDIIIDKSIHRSINSRSAALKRYVAD  235



>ref|XP_008386171.1| PREDICTED: choline transporter-like protein 2 [Malus domestica]
Length=706

 Score =   359 bits (921),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 162/210 (77%), Positives = 189/210 (90%), Gaps = 3/210 (1%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGP+GAVIG+YP SDG+ ++SS   II+HNRKCRD+VFL+IFIAFWVAMIVNSSFGFNQ
Sbjct  1    MRGPMGAVIGRYPPSDGSAQMSS---IIRHNRKCRDLVFLVIFIAFWVAMIVNSSFGFNQ  57

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNP RLTYGLDYKGNVCGD+HA P L EL+L+YWLNPN+VY SG KD+  KL NARSICL
Sbjct  58   GNPSRLTYGLDYKGNVCGDKHAKPGLKELELKYWLNPNQVYLSGLKDNQFKLANARSICL  117

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
            +DCPIP EDSL+WVCDYP+GDIRL++++WIDRNYDY+  LTPELR  SLQLQGPCYPVIF
Sbjct  118  LDCPIPYEDSLSWVCDYPDGDIRLSMDDWIDRNYDYYEFLTPELRNTSLQLQGPCYPVIF  177

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGIE  723
            PS+NVYW+CQFIAR SNVSL HW++MGG++
Sbjct  178  PSINVYWTCQFIARPSNVSLTHWQQMGGVK  207


 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +2

Query  716  GLKIFEDIIIDKAIHRSINSRSSVFKRYVAD  808
            G+KI EDIIIDK+IH++INSRSSVFKRY+AD
Sbjct  205  GVKINEDIIIDKSIHKAINSRSSVFKRYMAD  235



>ref|XP_007213616.1| hypothetical protein PRUPE_ppa002216mg [Prunus persica]
 gb|EMJ14815.1| hypothetical protein PRUPE_ppa002216mg [Prunus persica]
Length=699

 Score =   357 bits (917),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 165/209 (79%), Positives = 189/209 (90%), Gaps = 4/209 (2%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGPLGAVIG+YPSSDG+ ++ S   II+HNRKCRD+VFL+IFIAFWVAMIVNSSFGFNQ
Sbjct  1    MRGPLGAVIGRYPSSDGSEQMGS---IIRHNRKCRDLVFLVIFIAFWVAMIVNSSFGFNQ  57

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNPLRLTYGLDYKGNVCGD+HA   L +L+L+YWLNPN+VY SG KD+  KL NARSICL
Sbjct  58   GNPLRLTYGLDYKGNVCGDKHAK-GLRQLELKYWLNPNQVYLSGLKDNQFKLANARSICL  116

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
            +DCP PSEDSL+WVCDYPEGDIRL++++WIDRNYDY+  LTPE+R  SLQLQGPCYPVIF
Sbjct  117  LDCPTPSEDSLSWVCDYPEGDIRLSMDDWIDRNYDYYEFLTPEMRNTSLQLQGPCYPVIF  176

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGI  720
            PSVNVYWSCQFIAR SNVSLRHW++MGG+
Sbjct  177  PSVNVYWSCQFIARPSNVSLRHWQQMGGV  205


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  716  GLKIFEDIIIDKAIHRSINSRSSVFKRYVAD  808
            G+ I EDIIIDK+IHRSINSRSSV KRY+AD
Sbjct  204  GVNINEDIIIDKSIHRSINSRSSVLKRYMAD  234



>ref|XP_008226648.1| PREDICTED: choline transporter-like protein 2 [Prunus mume]
Length=699

 Score =   357 bits (916),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 165/209 (79%), Positives = 189/209 (90%), Gaps = 4/209 (2%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGPLGAVIG+YPSSDG+ ++ S   II+HNRKCRD+VFL+IFIAFWVAMIVNSSFGFNQ
Sbjct  1    MRGPLGAVIGRYPSSDGSEQLGS---IIRHNRKCRDLVFLVIFIAFWVAMIVNSSFGFNQ  57

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNPLRLTYGLDYKGNVCGD+HA   L +L+L+YWLNPN+VY SG KD+  KL NARSICL
Sbjct  58   GNPLRLTYGLDYKGNVCGDKHAK-GLRQLELKYWLNPNQVYLSGLKDNQFKLANARSICL  116

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
            +DCP PSEDSL+WVCDYPEGDIRL++++WIDRNYDY+  LTPE+R  SLQLQGPCYPVIF
Sbjct  117  LDCPTPSEDSLSWVCDYPEGDIRLSMDDWIDRNYDYYEFLTPEMRNTSLQLQGPCYPVIF  176

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGI  720
            PSVNVYWSCQFIAR SNVSLRHW++MGG+
Sbjct  177  PSVNVYWSCQFIARPSNVSLRHWQQMGGV  205


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  716  GLKIFEDIIIDKAIHRSINSRSSVFKRYVAD  808
            G+ I EDIIIDK+IHRSINSRSSV KRY+AD
Sbjct  204  GVNINEDIIIDKSIHRSINSRSSVLKRYMAD  234



>gb|KHN36810.1| Choline transporter-like protein 2 [Glycine soja]
Length=696

 Score =   357 bits (915),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 160/210 (76%), Positives = 184/210 (88%), Gaps = 3/210 (1%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGPLGAVIG+YPSSDG   +    GII+HNRKCRD+ FL+IF+AFW+AMIVNSSF FN+
Sbjct  1    MRGPLGAVIGRYPSSDGTTHLG---GIIRHNRKCRDIAFLVIFVAFWIAMIVNSSFAFNR  57

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNPLRLTYGLDYKGNVCG +HA  +L EL+LRYWL+PN+VYQSG KDS  KL NARSICL
Sbjct  58   GNPLRLTYGLDYKGNVCGQKHAVQDLRELELRYWLSPNQVYQSGLKDSQFKLVNARSICL  117

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
            +DCPIPSEDSL WVCDYPEGDIR+++ +WID NYDYF  LTPE+R  SLQLQGPCYPVIF
Sbjct  118  LDCPIPSEDSLTWVCDYPEGDIRVSLNDWIDMNYDYFEFLTPEMRNSSLQLQGPCYPVIF  177

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGIE  723
            PSVNVYWSCQF A+ASNVSL+HW++MGG+ 
Sbjct  178  PSVNVYWSCQFTAKASNVSLKHWQQMGGVT  207



>ref|XP_006594780.1| PREDICTED: choline transporter-like protein 2-like [Glycine max]
Length=699

 Score =   357 bits (915),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 160/210 (76%), Positives = 184/210 (88%), Gaps = 3/210 (1%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGPLGAVIG+YPSSDG   +    GII+HNRKCRD+ FL+IF+AFW+AMIVNSSF FN+
Sbjct  1    MRGPLGAVIGRYPSSDGTTHLG---GIIRHNRKCRDIAFLVIFVAFWIAMIVNSSFAFNR  57

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNPLRLTYGLDYKGNVCG +HA  +L EL+LRYWL+PN+VYQSG KDS  KL NARSICL
Sbjct  58   GNPLRLTYGLDYKGNVCGQKHAVQDLRELELRYWLSPNQVYQSGLKDSQFKLVNARSICL  117

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
            +DCPIPSEDSL WVCDYPEGDI +++ +WID NYDYF  LTPE+R  SLQLQGPCYPVIF
Sbjct  118  LDCPIPSEDSLTWVCDYPEGDIHVSLNDWIDMNYDYFEFLTPEMRNSSLQLQGPCYPVIF  177

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGIE  723
            PSVNVYWSCQFIA+ASNVSL+HW++MGG+ 
Sbjct  178  PSVNVYWSCQFIAKASNVSLKHWQQMGGVT  207



>ref|XP_012084940.1| PREDICTED: choline transporter-like protein 2 [Jatropha curcas]
 gb|KDP27036.1| hypothetical protein JCGZ_20971 [Jatropha curcas]
Length=695

 Score =   355 bits (911),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 163/209 (78%), Positives = 185/209 (89%), Gaps = 5/209 (2%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGPLG VIG+YPSSDG+ ++    GII+HNRKCRDV FL+IFIAFWVAMIVNSSFGFN+
Sbjct  1    MRGPLGPVIGRYPSSDGSTQIG---GIIRHNRKCRDVAFLVIFIAFWVAMIVNSSFGFNK  57

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNPLRLTYGLDYKGNVCGDRHA   L EL+L YW+NPN+VY SG KDS  KL NARSICL
Sbjct  58   GNPLRLTYGLDYKGNVCGDRHA--GLRELELMYWVNPNQVYLSGLKDSQFKLANARSICL  115

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
            +DCPIPSED+LNWVCDYPEGDIRL++++WIDRNYDYF  LTPE+R  SLQLQGPCYPVIF
Sbjct  116  LDCPIPSEDALNWVCDYPEGDIRLSMDDWIDRNYDYFEFLTPEMRNTSLQLQGPCYPVIF  175

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGI  720
            PSVNV+W CQFIA ASNVS+RHW++M G+
Sbjct  176  PSVNVFWRCQFIAHASNVSMRHWQQMNGV  204


 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  716  GLKIFEDIIIDKAIHRSINSRSSVFKRYVAD  808
            G+ I EDIIIDK+IH+SINSRSSV KRY+AD
Sbjct  203  GVNINEDIIIDKSIHKSINSRSSVLKRYMAD  233



>emb|CDX75828.1| BnaC03g39110D [Brassica napus]
Length=365

 Score =   344 bits (883),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 156/210 (74%), Positives = 183/210 (87%), Gaps = 4/210 (2%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGPLGAVIG+Y SSDG    S  DGIIKHNRKCRD+ FL+IFIAFWV+MIVNSSFGFNQ
Sbjct  1    MRGPLGAVIGRYTSSDG----SDKDGIIKHNRKCRDITFLVIFIAFWVSMIVNSSFGFNQ  56

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNPLRLTYGLDY+GNVCG  H   +L +L+LRYWLNPN+VY+SG KD +  L NAR+ICL
Sbjct  57   GNPLRLTYGLDYEGNVCGSSHRHRDLAQLELRYWLNPNQVYESGLKDGETTLANARTICL  116

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
            +DCP PS+D+L+WVCDYP+G+IRL +++WIDRNYDYF  LTPE+R  SLQLQGPCYP+IF
Sbjct  117  LDCPEPSDDTLSWVCDYPDGEIRLKMDDWIDRNYDYFEFLTPEMRNSSLQLQGPCYPLIF  176

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGIE  723
            PSVNVYWSCQ+IARASN SLRHW++MGG+ 
Sbjct  177  PSVNVYWSCQYIARASNSSLRHWEQMGGVS  206



>gb|KHG30658.1| Choline transporter-like protein 2 [Gossypium arboreum]
Length=707

 Score =   354 bits (908),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 159/210 (76%), Positives = 184/210 (88%), Gaps = 6/210 (3%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGPLGAV+ +YP +  +G      GII+HNRKCRDV FL+IFIAFWVAMIVNSSFGFNQ
Sbjct  1    MRGPLGAVLERYPITTEDG------GIIRHNRKCRDVAFLVIFIAFWVAMIVNSSFGFNQ  54

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNPLRLTYGLDYKGNVCGD+HA P LH+L+L+YWLNPN+VYQSG KDS  KL NARSICL
Sbjct  55   GNPLRLTYGLDYKGNVCGDKHAHPGLHQLELKYWLNPNQVYQSGVKDSQFKLSNARSICL  114

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
            +DCP P EDSL+WVCDYPEGD+ L++++WIDRNYDY+  LT E++  SLQLQGPCYPVIF
Sbjct  115  LDCPTPLEDSLSWVCDYPEGDMHLSMDDWIDRNYDYYEILTSEMKNASLQLQGPCYPVIF  174

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGIE  723
            PSVNVYWSCQ+IARASN SLRHWK+MGG++
Sbjct  175  PSVNVYWSCQYIARASNASLRHWKQMGGVD  204



>ref|XP_006299581.1| hypothetical protein CARUB_v10015755mg [Capsella rubella]
 gb|EOA32479.1| hypothetical protein CARUB_v10015755mg [Capsella rubella]
Length=700

 Score =   353 bits (907),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 158/209 (76%), Positives = 186/209 (89%), Gaps = 3/209 (1%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGPLGAVIG+Y SSDG+    + DGIIKHNRKCRD+ FL+IFIAFWV+MIVNSSFGFNQ
Sbjct  1    MRGPLGAVIGRYTSSDGS---VANDGIIKHNRKCRDITFLVIFIAFWVSMIVNSSFGFNQ  57

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNPLRLTYGLDY+GNVCG +H   +L +L+LRYWLNPN+VY+SG KD ++KL NAR+ICL
Sbjct  58   GNPLRLTYGLDYEGNVCGSKHRHRDLTQLELRYWLNPNQVYESGLKDGELKLANARTICL  117

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
            +DCP PS+D+LNWVCDYP+G+IRL + +WIDRNYDYF  LTPE+R  SLQLQGPCYPVIF
Sbjct  118  LDCPAPSDDTLNWVCDYPDGEIRLKMNDWIDRNYDYFEFLTPEMRNSSLQLQGPCYPVIF  177

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGI  720
            PSVNVYWSCQ+IARASN SLRHW++MGG+
Sbjct  178  PSVNVYWSCQYIARASNSSLRHWQQMGGV  206



>ref|NP_566511.1| plasma-membrane choline transporter family protein [Arabidopsis 
thaliana]
 gb|AAK76591.1| unknown protein [Arabidopsis thaliana]
 gb|AAN71973.1| unknown protein [Arabidopsis thaliana]
 gb|AEE75661.1| plasma-membrane choline transporter family protein [Arabidopsis 
thaliana]
Length=700

 Score =   353 bits (906),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 158/209 (76%), Positives = 186/209 (89%), Gaps = 3/209 (1%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGPLGAVIG+Y SSDG+   +  DGIIKHNRKCRD+ FL+IFIAFWV+MIVNSSFGFNQ
Sbjct  1    MRGPLGAVIGRYTSSDGS---APNDGIIKHNRKCRDITFLIIFIAFWVSMIVNSSFGFNQ  57

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNPLRLTYGLDY+GNVCG +H   +L +L+LRYWLNPN+VY+SG KD ++KL NAR+ICL
Sbjct  58   GNPLRLTYGLDYEGNVCGSKHRHRDLTQLELRYWLNPNQVYESGLKDGELKLANARTICL  117

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
            +DCP PS+D+LNWVCDYP+G+IRL + +WIDRNYDYF  LTPE+R  SLQLQGPCYPVIF
Sbjct  118  LDCPAPSDDTLNWVCDYPDGEIRLKMNDWIDRNYDYFEFLTPEMRNSSLQLQGPCYPVIF  177

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGI  720
            PSVNVYWSCQ+IARASN SLRHW++MGG+
Sbjct  178  PSVNVYWSCQYIARASNSSLRHWQQMGGV  206



>gb|KHN28052.1| Choline transporter-like protein 5-A [Glycine soja]
Length=696

 Score =   353 bits (905),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 157/209 (75%), Positives = 183/209 (88%), Gaps = 3/209 (1%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGPLGAVIG+YPSSDG   +    GII+HN+KCRD+  L+IF+AFW+A+IVNSSF FN+
Sbjct  1    MRGPLGAVIGRYPSSDGTTHLG---GIIRHNKKCRDIAVLVIFVAFWIALIVNSSFAFNR  57

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNPLRLTYGLDYKGNVCG +HA  +L EL+LRYWL+PN+VYQSG KDS  KL NARSICL
Sbjct  58   GNPLRLTYGLDYKGNVCGQKHAVQDLRELELRYWLSPNQVYQSGLKDSQFKLANARSICL  117

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
            +DCPIPSEDSL WVCDYPEGDIR+++ +WID NYDYF  LTPE+R  SLQLQGPCYPVIF
Sbjct  118  LDCPIPSEDSLTWVCDYPEGDIRVSLNDWIDMNYDYFEFLTPEMRNSSLQLQGPCYPVIF  177

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGI  720
            PSVNVYWSCQFI +ASNVSL+HW++MGG+
Sbjct  178  PSVNVYWSCQFIVKASNVSLKHWRQMGGV  206



>ref|XP_003540458.1| PREDICTED: choline transporter-like protein 2-like [Glycine max]
Length=699

 Score =   353 bits (905),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 157/209 (75%), Positives = 183/209 (88%), Gaps = 3/209 (1%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGPLGAVIG+YPSSDG   +    GII+HN+KCRD+  L+IF+AFW+A+IVNSSF FN+
Sbjct  1    MRGPLGAVIGRYPSSDGTTHLG---GIIRHNKKCRDIAVLVIFVAFWIALIVNSSFAFNR  57

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNPLRLTYGLDYKGNVCG +HA  +L EL+LRYWL+PN+VYQSG KDS  KL NARSICL
Sbjct  58   GNPLRLTYGLDYKGNVCGQKHAVQDLRELELRYWLSPNQVYQSGLKDSQFKLANARSICL  117

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
            +DCPIPSEDSL WVCDYPEGDIR+++ +WID NYDYF  LTPE+R  SLQLQGPCYPVIF
Sbjct  118  LDCPIPSEDSLTWVCDYPEGDIRVSLNDWIDMNYDYFEFLTPEMRNSSLQLQGPCYPVIF  177

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGI  720
            PSVNVYWSCQFI +ASNVSL+HW++MGG+
Sbjct  178  PSVNVYWSCQFIVKASNVSLKHWRQMGGV  206



>gb|AAF35404.1| hypothetical protein [Arabidopsis thaliana]
Length=722

 Score =   353 bits (906),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 158/209 (76%), Positives = 185/209 (89%), Gaps = 3/209 (1%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGPLGAVIG+Y SSDG+      DGIIKHNRKCRD+ FL+IFIAFWV+MIVNSSFGFNQ
Sbjct  1    MRGPLGAVIGRYTSSDGSAP---NDGIIKHNRKCRDITFLIIFIAFWVSMIVNSSFGFNQ  57

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNPLRLTYGLDY+GNVCG +H   +L +L+LRYWLNPN+VY+SG KD ++KL NAR+ICL
Sbjct  58   GNPLRLTYGLDYEGNVCGSKHRHRDLTQLELRYWLNPNQVYESGLKDGELKLANARTICL  117

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
            +DCP PS+D+LNWVCDYP+G+IRL + +WIDRNYDYF  LTPE+R  SLQLQGPCYPVIF
Sbjct  118  LDCPAPSDDTLNWVCDYPDGEIRLKMNDWIDRNYDYFEFLTPEMRNSSLQLQGPCYPVIF  177

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGI  720
            PSVNVYWSCQ+IARASN SLRHW++MGG+
Sbjct  178  PSVNVYWSCQYIARASNSSLRHWQQMGGV  206



>ref|XP_009146249.1| PREDICTED: choline transporter-like protein 2 isoform X2 [Brassica 
rapa]
Length=621

 Score =   350 bits (898),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 157/210 (75%), Positives = 184/210 (88%), Gaps = 4/210 (2%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGPLGAVIG+Y SSDG    S  DGIIKHNRKCRD+ FL+IFIAFWV+MIVNSSFGFNQ
Sbjct  1    MRGPLGAVIGRYTSSDG----SEKDGIIKHNRKCRDITFLIIFIAFWVSMIVNSSFGFNQ  56

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNPLRLTYGLDY+GNVCG +H   +L +L+LRYWLNPN+VY+SG KD + KL NAR+ICL
Sbjct  57   GNPLRLTYGLDYEGNVCGSKHRHRDLTKLELRYWLNPNQVYESGLKDGEHKLANARTICL  116

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
            +DCP PS+D+LNWVCDYP+G+IRL + +W+DRNYDYF  LTPE+R  SLQLQGPCYP+IF
Sbjct  117  LDCPAPSDDTLNWVCDYPDGEIRLKMSDWVDRNYDYFEFLTPEMRNSSLQLQGPCYPIIF  176

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGIE  723
            PSVNVYWSCQ+IARASN SLRHW++MGG+ 
Sbjct  177  PSVNVYWSCQYIARASNSSLRHWQQMGGVS  206



>ref|XP_006406975.1| hypothetical protein EUTSA_v10020171mg [Eutrema salsugineum]
 gb|ESQ48428.1| hypothetical protein EUTSA_v10020171mg [Eutrema salsugineum]
Length=703

 Score =   352 bits (903),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 157/209 (75%), Positives = 186/209 (89%), Gaps = 3/209 (1%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGPLGAVIG+Y SSDG+   +  DGIIKHNRKCRD+ FL+IFIAFW++MIVNSSFGFNQ
Sbjct  1    MRGPLGAVIGRYTSSDGS---APNDGIIKHNRKCRDITFLVIFIAFWISMIVNSSFGFNQ  57

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNPLRLTYGLDY+GNVCG +H   +L +L+LRYWLNPN+VY+SG KD ++KL NAR+ICL
Sbjct  58   GNPLRLTYGLDYEGNVCGSKHHHRDLTQLELRYWLNPNQVYESGLKDGELKLANARTICL  117

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
            +DCP PS+D+LNWVCDYP+G+IRL + +WIDRNYDYF  LTPE+R  SLQLQGPCYPVIF
Sbjct  118  LDCPAPSDDTLNWVCDYPDGEIRLKMNDWIDRNYDYFEFLTPEMRNSSLQLQGPCYPVIF  177

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGI  720
            PSVNVYWSCQ+IARASN SLRHW++MGG+
Sbjct  178  PSVNVYWSCQYIARASNSSLRHWQQMGGV  206



>gb|KFK38880.1| hypothetical protein AALP_AA3G172900 [Arabis alpina]
Length=700

 Score =   352 bits (902),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 159/209 (76%), Positives = 185/209 (89%), Gaps = 3/209 (1%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGPLGAVIG+Y SSDG+      DGIIKHNRKCRD+ FL+IFIAFWV+MIVNSSFGFNQ
Sbjct  1    MRGPLGAVIGRYTSSDGS---VPNDGIIKHNRKCRDIAFLVIFIAFWVSMIVNSSFGFNQ  57

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNPLRLTYGLDY+GNVCG +H   +L EL+LRYWLNPN+VY+SG KD ++KL NAR+ICL
Sbjct  58   GNPLRLTYGLDYEGNVCGSKHRHRDLTELELRYWLNPNQVYESGLKDGELKLANARTICL  117

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
            +DCP PS+D+LNWVCDYP+G+IRL + +WIDRNYDYF  LTPE+R  SLQLQGPCYPVIF
Sbjct  118  LDCPEPSDDTLNWVCDYPDGEIRLKMNDWIDRNYDYFEFLTPEMRNSSLQLQGPCYPVIF  177

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGI  720
            PSVNVYWSCQ+IARASN SLRHW++MGG+
Sbjct  178  PSVNVYWSCQYIARASNSSLRHWQQMGGV  206



>ref|XP_010487363.1| PREDICTED: choline transporter-like protein 2 [Camelina sativa]
Length=700

 Score =   352 bits (902),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 156/209 (75%), Positives = 186/209 (89%), Gaps = 3/209 (1%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGPLGAVIG+Y SSDG+    + DGIIKHNRKCRD+ FL+IFI+FWV+MIVNSSFGFNQ
Sbjct  1    MRGPLGAVIGRYTSSDGS---VANDGIIKHNRKCRDITFLVIFISFWVSMIVNSSFGFNQ  57

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNPLRLTYGLDY+GNVCG +H   +L +LDLRYW+NPN+VY+SG KD ++KL NAR++CL
Sbjct  58   GNPLRLTYGLDYEGNVCGSKHRHRDLTQLDLRYWVNPNQVYESGLKDGELKLANARTVCL  117

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
            +DCP PS+D+LNWVCDYP+G+IRL + +WIDRNYDYF  LTPE+R  SLQLQGPCYPVIF
Sbjct  118  LDCPAPSDDTLNWVCDYPDGEIRLKMNDWIDRNYDYFEFLTPEMRNSSLQLQGPCYPVIF  177

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGI  720
            PSVNVYWSCQ+IARASN SLRHW++MGG+
Sbjct  178  PSVNVYWSCQYIARASNSSLRHWQQMGGV  206



>ref|XP_010465506.1| PREDICTED: choline transporter-like protein 2 [Camelina sativa]
Length=700

 Score =   352 bits (902),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 156/209 (75%), Positives = 186/209 (89%), Gaps = 3/209 (1%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGPLGAVIG+Y SSDG+    + DGIIKHNRKCRD+ FL+IFIAFWV+MIVNSSFGFNQ
Sbjct  1    MRGPLGAVIGRYTSSDGS---VANDGIIKHNRKCRDITFLVIFIAFWVSMIVNSSFGFNQ  57

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNPLRLTYGLDY+GNVCG +H   +L +L+LRYW+NPN+VY+SG KD ++KL NAR++CL
Sbjct  58   GNPLRLTYGLDYEGNVCGSKHRHRDLTQLELRYWVNPNQVYESGLKDGELKLANARTVCL  117

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
            +DCP PS+D+LNWVCDYP+G+IRL + +WIDRNYDYF  LTPE+R  SLQLQGPCYPVIF
Sbjct  118  LDCPAPSDDTLNWVCDYPDGEIRLKMNDWIDRNYDYFEFLTPEMRNSSLQLQGPCYPVIF  177

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGI  720
            PSVNVYWSCQ+IARASN SLRHW++MGG+
Sbjct  178  PSVNVYWSCQYIARASNSSLRHWQQMGGV  206



>ref|XP_010502919.1| PREDICTED: choline transporter-like protein 2 [Camelina sativa]
Length=700

 Score =   352 bits (902),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 156/209 (75%), Positives = 186/209 (89%), Gaps = 3/209 (1%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGPLGAVIG+Y SSDG+    + DGIIKHNRKCRD+ FL+IFIAFWV+MIVNSSFGFNQ
Sbjct  1    MRGPLGAVIGRYTSSDGS---VANDGIIKHNRKCRDITFLVIFIAFWVSMIVNSSFGFNQ  57

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNPLRLTYGLDY+GNVCG +H   +L +L+LRYW+NPN+VY+SG KD ++KL NAR++CL
Sbjct  58   GNPLRLTYGLDYEGNVCGSKHRHRDLTQLELRYWVNPNQVYESGLKDGELKLANARTVCL  117

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
            +DCP PS+D+LNWVCDYP+G+IRL + +WIDRNYDYF  LTPE+R  SLQLQGPCYPVIF
Sbjct  118  LDCPAPSDDTLNWVCDYPDGEIRLKMNDWIDRNYDYFEFLTPEMRNSSLQLQGPCYPVIF  177

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGI  720
            PSVNVYWSCQ+IARASN SLRHW++MGG+
Sbjct  178  PSVNVYWSCQYIARASNSSLRHWQQMGGV  206



>emb|CDX98556.1| BnaC05g38190D [Brassica napus]
Length=700

 Score =   351 bits (901),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 157/210 (75%), Positives = 184/210 (88%), Gaps = 4/210 (2%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGPLGAVIG+Y SSDG    S  DGIIKHNRKCRD+ FL+IFIAFWV+MIVNSSFGFNQ
Sbjct  1    MRGPLGAVIGRYTSSDG----SEKDGIIKHNRKCRDITFLIIFIAFWVSMIVNSSFGFNQ  56

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNPLRLTYGLDY+GNVCG +H   +L +L+LRYWLNPN+VY+SG KD + KL NAR+ICL
Sbjct  57   GNPLRLTYGLDYEGNVCGSKHRHRDLTKLELRYWLNPNQVYESGLKDGEHKLANARTICL  116

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
            +DCP PS+D+LNWVCDYP+G+IRL + +W+DRNYDYF  LTPE+R  SLQLQGPCYP+IF
Sbjct  117  LDCPAPSDDTLNWVCDYPDGEIRLKMSDWVDRNYDYFEFLTPEMRNSSLQLQGPCYPIIF  176

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGIE  723
            PSVNVYWSCQ+IARASN SLRHW++MGG+ 
Sbjct  177  PSVNVYWSCQYIARASNSSLRHWQQMGGVS  206



>ref|XP_002882939.1| hypothetical protein ARALYDRAFT_478976 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59198.1| hypothetical protein ARALYDRAFT_478976 [Arabidopsis lyrata subsp. 
lyrata]
Length=697

 Score =   351 bits (901),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 156/209 (75%), Positives = 186/209 (89%), Gaps = 3/209 (1%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGPLGAVIG+Y SSDG+   +  DGIIKHNRKCRD+ FL+IFIAFWV+MIVNSSFGFNQ
Sbjct  1    MRGPLGAVIGRYTSSDGS---APNDGIIKHNRKCRDITFLVIFIAFWVSMIVNSSFGFNQ  57

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNPLRLTYGLDY+GNVCG +H   +L +L++RYWLNPN+VY+SG KD ++KL NAR+ICL
Sbjct  58   GNPLRLTYGLDYEGNVCGSKHRHRDLTQLEIRYWLNPNQVYESGLKDGELKLANARTICL  117

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
            +DCP P++D+LNWVCDYP+G+IRL + +WIDRNYDYF  LTPE+R  SLQLQGPCYPVIF
Sbjct  118  LDCPAPTDDTLNWVCDYPDGEIRLKMNDWIDRNYDYFEFLTPEMRNSSLQLQGPCYPVIF  177

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGI  720
            PSVNVYWSCQ+IARASN SLRHW++MGG+
Sbjct  178  PSVNVYWSCQYIARASNSSLRHWQQMGGV  206



>ref|XP_009146248.1| PREDICTED: choline transporter-like protein 2 isoform X1 [Brassica 
rapa]
Length=700

 Score =   351 bits (901),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 157/210 (75%), Positives = 184/210 (88%), Gaps = 4/210 (2%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGPLGAVIG+Y SSDG    S  DGIIKHNRKCRD+ FL+IFIAFWV+MIVNSSFGFNQ
Sbjct  1    MRGPLGAVIGRYTSSDG----SEKDGIIKHNRKCRDITFLIIFIAFWVSMIVNSSFGFNQ  56

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNPLRLTYGLDY+GNVCG +H   +L +L+LRYWLNPN+VY+SG KD + KL NAR+ICL
Sbjct  57   GNPLRLTYGLDYEGNVCGSKHRHRDLTKLELRYWLNPNQVYESGLKDGEHKLANARTICL  116

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
            +DCP PS+D+LNWVCDYP+G+IRL + +W+DRNYDYF  LTPE+R  SLQLQGPCYP+IF
Sbjct  117  LDCPAPSDDTLNWVCDYPDGEIRLKMSDWVDRNYDYFEFLTPEMRNSSLQLQGPCYPIIF  176

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGIE  723
            PSVNVYWSCQ+IARASN SLRHW++MGG+ 
Sbjct  177  PSVNVYWSCQYIARASNSSLRHWQQMGGVS  206



>ref|XP_010545818.1| PREDICTED: choline transporter-like protein 2 isoform X2 [Tarenaya 
hassleriana]
Length=699

 Score =   351 bits (900),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 157/210 (75%), Positives = 185/210 (88%), Gaps = 3/210 (1%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGPLGAVIG+YPSSDG    +  DGIIKHNRKCRD+ FL++FIAFW++MIVNSSFGFN+
Sbjct  1    MRGPLGAVIGRYPSSDGT---APDDGIIKHNRKCRDIAFLVVFIAFWISMIVNSSFGFNK  57

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNPLRLTYGLDY+G+VCG +H   +L +L+LRYWLNPN+VY+SG KD   KL NARSICL
Sbjct  58   GNPLRLTYGLDYEGHVCGSKHPHRDLTQLELRYWLNPNQVYESGLKDGQFKLDNARSICL  117

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
            +DCPIP +D+LNWVCDYP+G+IRL++ +WIDRNYDYF  LTPE+R  SLQLQGPCYPVIF
Sbjct  118  LDCPIPYDDTLNWVCDYPDGEIRLSMNDWIDRNYDYFEFLTPEMRNSSLQLQGPCYPVIF  177

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGIE  723
            PSVNVYWSCQFIARASN SLRHW +MGG++
Sbjct  178  PSVNVYWSCQFIARASNTSLRHWNQMGGVQ  207


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  716  GLKIFEDIIIDKAIHRSINSRSSVFKRYVAD  808
            G++I ED++IDKAIHRSINSRSSV KRY+AD
Sbjct  205  GVQIQEDMLIDKAIHRSINSRSSVLKRYIAD  235



>dbj|BAB02367.1| unnamed protein product [Arabidopsis thaliana]
Length=697

 Score =   350 bits (899),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 158/209 (76%), Positives = 185/209 (89%), Gaps = 3/209 (1%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGPLGAVIG+Y SSDG+      DGIIKHNRKCRD+ FL+IFIAFWV+MIVNSSFGFNQ
Sbjct  1    MRGPLGAVIGRYTSSDGSAP---NDGIIKHNRKCRDITFLIIFIAFWVSMIVNSSFGFNQ  57

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNPLRLTYGLDY+GNVCG +H   +L +L+LRYWLNPN+VY+SG KD ++KL NAR+ICL
Sbjct  58   GNPLRLTYGLDYEGNVCGSKHRHRDLTQLELRYWLNPNQVYESGLKDGELKLANARTICL  117

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
            +DCP PS+D+LNWVCDYP+G+IRL + +WIDRNYDYF  LTPE+R  SLQLQGPCYPVIF
Sbjct  118  LDCPAPSDDTLNWVCDYPDGEIRLKMNDWIDRNYDYFEFLTPEMRNSSLQLQGPCYPVIF  177

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGI  720
            PSVNVYWSCQ+IARASN SLRHW++MGG+
Sbjct  178  PSVNVYWSCQYIARASNSSLRHWQQMGGV  206



>ref|XP_004514344.1| PREDICTED: choline transporter-like protein 2-like [Cicer arietinum]
Length=700

 Score =   350 bits (898),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 160/209 (77%), Positives = 181/209 (87%), Gaps = 3/209 (1%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGPLGAVIG Y SSDG   V+   GIIKHNRKCRD+  LLIFIAFW+AMIVNSSFGFNQ
Sbjct  1    MRGPLGAVIGSYTSSDG---VTQMGGIIKHNRKCRDITALLIFIAFWIAMIVNSSFGFNQ  57

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNPLRL YG+DYKGNVCGD+HA P L EL+LRYW NPN+VYQSG KDS  KL +ARSICL
Sbjct  58   GNPLRLIYGIDYKGNVCGDKHAHPGLGELELRYWQNPNQVYQSGLKDSQFKLADARSICL  117

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
              CPIPS+DSL+WVCDYPEGDIRL++E+W+ RNY+Y+  LT E+R  SLQLQGPCYPVIF
Sbjct  118  SGCPIPSDDSLDWVCDYPEGDIRLSMEDWVGRNYNYYEFLTQEMRNSSLQLQGPCYPVIF  177

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGI  720
            PS+NVYWSCQFIARASN SL+HW+EMGG+
Sbjct  178  PSINVYWSCQFIARASNTSLKHWQEMGGV  206



>emb|CDX97664.1| BnaA05g24150D [Brassica napus]
Length=700

 Score =   350 bits (897),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 156/210 (74%), Positives = 184/210 (88%), Gaps = 4/210 (2%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGPLGAVIG+Y SSDG    S  DGIIKHNRKCRD+ FL+IFIAFWV+MIVNSSFGFNQ
Sbjct  1    MRGPLGAVIGRYTSSDG----SEKDGIIKHNRKCRDITFLIIFIAFWVSMIVNSSFGFNQ  56

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNPLRLTYGLDY+GNVCG +H   +L +L+LRYWLNPN+VY++G KD + KL NAR+ICL
Sbjct  57   GNPLRLTYGLDYEGNVCGSKHRHRDLTKLELRYWLNPNQVYENGLKDGEHKLANARTICL  116

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
            +DCP PS+D+LNWVCDYP+G+IRL + +W+DRNYDYF  LTPE+R  SLQLQGPCYP+IF
Sbjct  117  LDCPAPSDDTLNWVCDYPDGEIRLKMSDWVDRNYDYFEFLTPEMRNSSLQLQGPCYPIIF  176

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGIE  723
            PSVNVYWSCQ+IARASN SLRHW++MGG+ 
Sbjct  177  PSVNVYWSCQYIARASNSSLRHWQQMGGVS  206



>ref|XP_010545817.1| PREDICTED: choline transporter-like protein 2 isoform X1 [Tarenaya 
hassleriana]
Length=715

 Score =   350 bits (897),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 157/210 (75%), Positives = 185/210 (88%), Gaps = 3/210 (1%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGPLGAVIG+YPSSDG    +  DGIIKHNRKCRD+ FL++FIAFW++MIVNSSFGFN+
Sbjct  1    MRGPLGAVIGRYPSSDGT---APDDGIIKHNRKCRDIAFLVVFIAFWISMIVNSSFGFNK  57

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNPLRLTYGLDY+G+VCG +H   +L +L+LRYWLNPN+VY+SG KD   KL NARSICL
Sbjct  58   GNPLRLTYGLDYEGHVCGSKHPHRDLTQLELRYWLNPNQVYESGLKDGQFKLDNARSICL  117

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
            +DCPIP +D+LNWVCDYP+G+IRL++ +WIDRNYDYF  LTPE+R  SLQLQGPCYPVIF
Sbjct  118  LDCPIPYDDTLNWVCDYPDGEIRLSMNDWIDRNYDYFEFLTPEMRNSSLQLQGPCYPVIF  177

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGIE  723
            PSVNVYWSCQFIARASN SLRHW +MGG++
Sbjct  178  PSVNVYWSCQFIARASNTSLRHWNQMGGVQ  207


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  716  GLKIFEDIIIDKAIHRSINSRSSVFKRYVAD  808
            G++I ED++IDKAIHRSINSRSSV KRY+AD
Sbjct  205  GVQIQEDMLIDKAIHRSINSRSSVLKRYIAD  235



>gb|KEH19431.1| plasma-membrane choline transporter family protein [Medicago 
truncatula]
Length=701

 Score =   349 bits (895),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 157/210 (75%), Positives = 181/210 (86%), Gaps = 2/210 (1%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGPLGAVIG Y SSDG  ++  G GIIKHNRKCRD+  L+ FIAFW+AMIVNSSFGFNQ
Sbjct  1    MRGPLGAVIGSYTSSDGVTQM--GGGIIKHNRKCRDITALVFFIAFWIAMIVNSSFGFNQ  58

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNPLRLTYGLDYKGNVCGD+HA P L EL++RYW NPN+VYQ+G KDS  KL NARSICL
Sbjct  59   GNPLRLTYGLDYKGNVCGDKHAHPGLGELEIRYWQNPNQVYQTGLKDSQFKLVNARSICL  118

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
             +CPIP++DSL WVCDYPEGDIRL++E+WI  +YDY+  LTP++R  SLQLQGPCYPVIF
Sbjct  119  SECPIPADDSLKWVCDYPEGDIRLSMEDWIKSDYDYYQFLTPDMRNSSLQLQGPCYPVIF  178

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGIE  723
            PSVNVYWSCQFIAR SN SL+HW++MGG+ 
Sbjct  179  PSVNVYWSCQFIARPSNTSLKHWEQMGGVS  208



>ref|XP_009135440.1| PREDICTED: choline transporter-like protein 2 [Brassica rapa]
Length=701

 Score =   348 bits (894),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 157/209 (75%), Positives = 183/209 (88%), Gaps = 4/209 (2%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGPLGAVIG+Y SSDG    S  DGIIKHNRKCRD+ FL+IFIAFWV+MIVNSSFGFNQ
Sbjct  1    MRGPLGAVIGRYTSSDG----SDKDGIIKHNRKCRDITFLVIFIAFWVSMIVNSSFGFNQ  56

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNPLRLTYGLDY+GNVCG  H   +L +L+LRYWLNPN+VY+SG KD +  L NAR+ICL
Sbjct  57   GNPLRLTYGLDYEGNVCGSSHRHRDLTQLELRYWLNPNQVYESGLKDGETTLANARTICL  116

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
            +DCP PS+D+L+WVCDYP+G+IRL +++WIDRNYDYF  LTPE+R  SLQLQGPCYP+IF
Sbjct  117  LDCPEPSDDTLSWVCDYPDGEIRLKMDDWIDRNYDYFEFLTPEMRNSSLQLQGPCYPLIF  176

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGI  720
            PSVNVYWSCQFIARASN SLRHW++MGG+
Sbjct  177  PSVNVYWSCQFIARASNSSLRHWEQMGGV  205



>ref|XP_010535109.1| PREDICTED: choline transporter-like protein 2 [Tarenaya hassleriana]
Length=700

 Score =   348 bits (892),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 157/210 (75%), Positives = 184/210 (88%), Gaps = 3/210 (1%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRG LGAVIGKYPSSDG+      DGIIKHNRKCRD+ FL++FIAFW++MIVNSSFGFNQ
Sbjct  1    MRGHLGAVIGKYPSSDGSAP---NDGIIKHNRKCRDIAFLVVFIAFWISMIVNSSFGFNQ  57

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNPLRLTYGLDY+G+VCG +H   +L +L+L+YWLNPN+VY+SG KD   KL NARSICL
Sbjct  58   GNPLRLTYGLDYEGHVCGSKHPHRDLTKLELKYWLNPNQVYKSGLKDGQFKLANARSICL  117

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
            +DCPIPS+D+LNWVC YP+G+IRL++ +WIDRNYDYF  LTPE+R  SLQLQGPCYPVIF
Sbjct  118  LDCPIPSDDTLNWVCVYPDGEIRLSLNDWIDRNYDYFEFLTPEMRNSSLQLQGPCYPVIF  177

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGIE  723
            PSVNVYWSCQFIARASN SLRHW +MGG++
Sbjct  178  PSVNVYWSCQFIARASNSSLRHWNQMGGVK  207


 Score = 53.9 bits (128),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 26/31 (84%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  716  GLKIFEDIIIDKAIHRSINSRSSVFKRYVAD  808
            G+KI E +IIDKAIHRSINSRSSV KRYVAD
Sbjct  205  GVKIQEGMIIDKAIHRSINSRSSVLKRYVAD  235



>ref|XP_010934827.1| PREDICTED: choline transporter-like protein 2 isoform X4 [Elaeis 
guineensis]
Length=585

 Score =   344 bits (882),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 155/213 (73%), Positives = 186/213 (87%), Gaps = 3/213 (1%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSS---GDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFG  264
            M  PLG ++G+Y ++ G    S    GDGII+HNRKCRD+VFL+IFIAFWVAMIVNSSFG
Sbjct  1    MGVPLGVIVGRYTTAGGGSGGSDGEMGDGIIRHNRKCRDLVFLVIFIAFWVAMIVNSSFG  60

Query  265  FNQGNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARS  444
            FNQGNPLRLTYGLDYKGNVCG +HA+P+L EL++RYWLNPN+VYQSG K S   L +A+S
Sbjct  61   FNQGNPLRLTYGLDYKGNVCGSKHANPDLRELEVRYWLNPNQVYQSGLKSSHFSLADAKS  120

Query  445  ICLMDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYP  624
            ICLM+CPIPSED LN++CDYPEGDIRL+V++WIDR+YDYF  LTP++R  SLQLQGPCYP
Sbjct  121  ICLMECPIPSEDGLNFICDYPEGDIRLSVDDWIDRDYDYFEFLTPDMRNSSLQLQGPCYP  180

Query  625  VIFPSVNVYWSCQFIARASNVSLRHWKEMGGIE  723
            +IFPSVNV+WSCQFIARASN+SLRHW++MGG+ 
Sbjct  181  IIFPSVNVHWSCQFIARASNISLRHWQQMGGVT  213



>ref|XP_008679492.1| PREDICTED: choline transporter-like protein 2 [Zea mays]
 gb|AFW65040.1| hypothetical protein ZEAMMB73_896694 [Zea mays]
Length=711

 Score =   346 bits (888),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 155/214 (72%), Positives = 188/214 (88%), Gaps = 6/214 (3%)
 Frame = +1

Query  100  GPLGAVIGKYPSS------DGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSF  261
            GPLGA+IG+YPSS      D  G+   G G+I+H+RKCRD  FL++F AFWVAMIVNSSF
Sbjct  6    GPLGAIIGRYPSSSAAAGDDEQGDPGPGGGVIRHDRKCRDWPFLVLFAAFWVAMIVNSSF  65

Query  262  GFNQGNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNAR  441
            GFNQGNPLRLTYGLDYKGN+CG RHADP+L++LD+RYW+NPN+VYQSG K S ++LP+A+
Sbjct  66   GFNQGNPLRLTYGLDYKGNICGSRHADPDLYQLDVRYWVNPNQVYQSGLKTSHIELPDAK  125

Query  442  SICLMDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCY  621
            +ICLM+CP+P+ED LN+VCDYPEGDIRL+V++WIDR+YDYF  LTP++R  SLQLQGPCY
Sbjct  126  TICLMECPLPAEDGLNFVCDYPEGDIRLSVDDWIDRDYDYFEYLTPDMRNSSLQLQGPCY  185

Query  622  PVIFPSVNVYWSCQFIARASNVSLRHWKEMGGIE  723
            PVIFPSVNVYWSCQFIARASN SL+HWK+MGG+ 
Sbjct  186  PVIFPSVNVYWSCQFIARASNASLKHWKDMGGVT  219



>emb|CDX82434.1| BnaA03g33870D [Brassica napus]
Length=839

 Score =   349 bits (896),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 157/210 (75%), Positives = 183/210 (87%), Gaps = 4/210 (2%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGPLGAVIG+Y SSDG    S  DGIIKHNRKCRD+ FL+IFIAFWV+MIVNSSFGFNQ
Sbjct  1    MRGPLGAVIGRYTSSDG----SDKDGIIKHNRKCRDITFLVIFIAFWVSMIVNSSFGFNQ  56

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNPLRLTYGLDY+GNVCG  H   +L +L+LRYWLNPN+VY+SG KD +  L NAR+ICL
Sbjct  57   GNPLRLTYGLDYEGNVCGSSHRHRDLTQLELRYWLNPNQVYESGLKDGETTLANARTICL  116

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
            +DCP PS+D+L+WVCDYP+G+IRL +++WIDRNYDYF  LTPE+R  SLQLQGPCYP+IF
Sbjct  117  LDCPEPSDDTLSWVCDYPDGEIRLKMDDWIDRNYDYFEFLTPEMRNSSLQLQGPCYPLIF  176

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGIE  723
            PSVNVYWSCQFIARASN SLRHW++MGG+ 
Sbjct  177  PSVNVYWSCQFIARASNSSLRHWEQMGGVS  206



>ref|XP_010934826.1| PREDICTED: choline transporter-like protein 2 isoform X3 [Elaeis 
guineensis]
Length=628

 Score =   342 bits (878),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 155/213 (73%), Positives = 186/213 (87%), Gaps = 3/213 (1%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSS---GDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFG  264
            M  PLG ++G+Y ++ G    S    GDGII+HNRKCRD+VFL+IFIAFWVAMIVNSSFG
Sbjct  1    MGVPLGVIVGRYTTAGGGSGGSDGEMGDGIIRHNRKCRDLVFLVIFIAFWVAMIVNSSFG  60

Query  265  FNQGNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARS  444
            FNQGNPLRLTYGLDYKGNVCG +HA+P+L EL++RYWLNPN+VYQSG K S   L +A+S
Sbjct  61   FNQGNPLRLTYGLDYKGNVCGSKHANPDLRELEVRYWLNPNQVYQSGLKSSHFSLADAKS  120

Query  445  ICLMDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYP  624
            ICLM+CPIPSED LN++CDYPEGDIRL+V++WIDR+YDYF  LTP++R  SLQLQGPCYP
Sbjct  121  ICLMECPIPSEDGLNFICDYPEGDIRLSVDDWIDRDYDYFEFLTPDMRNSSLQLQGPCYP  180

Query  625  VIFPSVNVYWSCQFIARASNVSLRHWKEMGGIE  723
            +IFPSVNV+WSCQFIARASN+SLRHW++MGG+ 
Sbjct  181  IIFPSVNVHWSCQFIARASNISLRHWQQMGGVT  213



>ref|XP_010934824.1| PREDICTED: choline transporter-like protein 2 isoform X1 [Elaeis 
guineensis]
Length=704

 Score =   343 bits (880),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 155/213 (73%), Positives = 186/213 (87%), Gaps = 3/213 (1%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSS---GDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFG  264
            M  PLG ++G+Y ++ G    S    GDGII+HNRKCRD+VFL+IFIAFWVAMIVNSSFG
Sbjct  1    MGVPLGVIVGRYTTAGGGSGGSDGEMGDGIIRHNRKCRDLVFLVIFIAFWVAMIVNSSFG  60

Query  265  FNQGNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARS  444
            FNQGNPLRLTYGLDYKGNVCG +HA+P+L EL++RYWLNPN+VYQSG K S   L +A+S
Sbjct  61   FNQGNPLRLTYGLDYKGNVCGSKHANPDLRELEVRYWLNPNQVYQSGLKSSHFSLADAKS  120

Query  445  ICLMDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYP  624
            ICLM+CPIPSED LN++CDYPEGDIRL+V++WIDR+YDYF  LTP++R  SLQLQGPCYP
Sbjct  121  ICLMECPIPSEDGLNFICDYPEGDIRLSVDDWIDRDYDYFEFLTPDMRNSSLQLQGPCYP  180

Query  625  VIFPSVNVYWSCQFIARASNVSLRHWKEMGGIE  723
            +IFPSVNV+WSCQFIARASN+SLRHW++MGG+ 
Sbjct  181  IIFPSVNVHWSCQFIARASNISLRHWQQMGGVT  213



>ref|XP_002444851.1| hypothetical protein SORBIDRAFT_07g000250 [Sorghum bicolor]
 gb|EES14346.1| hypothetical protein SORBIDRAFT_07g000250 [Sorghum bicolor]
Length=711

 Score =   343 bits (880),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 154/212 (73%), Positives = 184/212 (87%), Gaps = 4/212 (2%)
 Frame = +1

Query  100  GPLGAVIGKYPSS----DGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGF  267
            GPLGA+IG+YPS+    D  G+   G  +I+H+RKCRD  FL +F AFWVAMIVNSSFGF
Sbjct  6    GPLGAIIGRYPSAAAGDDEQGDPGPGGSVIRHDRKCRDWPFLFLFAAFWVAMIVNSSFGF  65

Query  268  NQGNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSI  447
            NQGNPLRLTYGLDYKGN+CG RH DP+L ELD+RYWLNPN+VYQSG K S ++LP+A++I
Sbjct  66   NQGNPLRLTYGLDYKGNICGSRHGDPDLRELDVRYWLNPNQVYQSGLKTSHIELPDAKAI  125

Query  448  CLMDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPV  627
            CLM+CP+P+ED LN+VCDYPEGDIRL+V++WIDR+YDYF  LTP++R  SLQLQGPCYPV
Sbjct  126  CLMECPLPAEDGLNFVCDYPEGDIRLSVDDWIDRDYDYFEYLTPDMRNSSLQLQGPCYPV  185

Query  628  IFPSVNVYWSCQFIARASNVSLRHWKEMGGIE  723
            IFPSVNVYWSCQFIARASN SL+HWK+MGG+ 
Sbjct  186  IFPSVNVYWSCQFIARASNASLKHWKDMGGVS  217



>ref|XP_006827775.1| PREDICTED: choline transporter-like protein 2 [Amborella trichopoda]
 gb|ERM95191.1| hypothetical protein AMTR_s00009p00264940 [Amborella trichopoda]
Length=701

 Score =   343 bits (879),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 157/213 (74%), Positives = 183/213 (86%), Gaps = 7/213 (3%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGD----GIIKHNRKCRDVVFLLIFIAFWVAMIVNSSF  261
            M GPLGA+IG+YP++   G  S+GD    GII+HNRKCRD+VFL+IFIAFWVAMIVNSSF
Sbjct  1    MGGPLGAIIGRYPTA---GAHSNGDPQLGGIIRHNRKCRDLVFLIIFIAFWVAMIVNSSF  57

Query  262  GFNQGNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNAR  441
            GFNQGNPLRLTYGLDYKGNVCG++HADP+L EL++RYWLNPN+VYQSG + S  KL +AR
Sbjct  58   GFNQGNPLRLTYGLDYKGNVCGNKHADPDLRELEVRYWLNPNQVYQSGLRKSQFKLGDAR  117

Query  442  SICLMDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCY  621
            SICLM+CP PSED LNWVCDYPEGDI L+++ WIDRNYDYF  LT  +R  SL LQGPCY
Sbjct  118  SICLMECPSPSEDILNWVCDYPEGDIHLSMDEWIDRNYDYFEFLTQPMRNSSLALQGPCY  177

Query  622  PVIFPSVNVYWSCQFIARASNVSLRHWKEMGGI  720
            P+IFPS+NVYWSCQFIA ASN SL HW++MGG+
Sbjct  178  PIIFPSINVYWSCQFIAHASNASLNHWRQMGGV  210



>ref|XP_007133083.1| hypothetical protein PHAVU_011G150000g [Phaseolus vulgaris]
 gb|ESW05077.1| hypothetical protein PHAVU_011G150000g [Phaseolus vulgaris]
Length=700

 Score =   343 bits (879),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 158/209 (76%), Positives = 181/209 (87%), Gaps = 3/209 (1%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGPLGAVIG++PSSDG   V+   GII+ NRKCRD+  L+IFIAF VAM+VNSSF FNQ
Sbjct  1    MRGPLGAVIGRFPSSDG---VTQMGGIIRRNRKCRDITVLVIFIAFSVAMVVNSSFAFNQ  57

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            GNPLRLTYGLDYKGNVCGD++A P L +L LRYW NPN+VY+SG KDS  KL +ARSICL
Sbjct  58   GNPLRLTYGLDYKGNVCGDKNAHPGLSDLVLRYWQNPNQVYESGLKDSKFKLGDARSICL  117

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
             +CPIPSEDSLNWVCDYPEGDIRL++ +W +RNYDYF  LTPE+R  SLQLQGPCYPVIF
Sbjct  118  SECPIPSEDSLNWVCDYPEGDIRLSMTDWANRNYDYFEFLTPEMRNSSLQLQGPCYPVIF  177

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGI  720
            PSVNVYWSCQFIARASN SL+HW++MGG+
Sbjct  178  PSVNVYWSCQFIARASNTSLKHWQQMGGV  206



>ref|XP_010695012.1| PREDICTED: choline transporter-like protein 2 [Beta vulgaris 
subsp. vulgaris]
Length=696

 Score =   341 bits (875),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 186/206 (90%), Gaps = 3/206 (1%)
 Frame = +1

Query  103  PLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNP  282
            P+G VIG+YPSSDG G++  G G+I+ NRKCRDVVFL+IFIAFWV+MIVNSSFGFN+GNP
Sbjct  3    PMGPVIGRYPSSDG-GQL--GGGVIRQNRKCRDVVFLVIFIAFWVSMIVNSSFGFNKGNP  59

Query  283  LRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICLMDC  462
            LRLTYGLDY+GN+CG +HA  +LHEL+LRYW+NPN+VY+SG K+S  KL +ARSICL+DC
Sbjct  60   LRLTYGLDYEGNLCGKKHAHRDLHELELRYWVNPNQVYESGLKNSAFKLADARSICLLDC  119

Query  463  PIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIFPSV  642
            PIP+EDSLNWVCDYP+GDI L+++ WIDRNYDYF  LTP++R  SLQLQGPCYPVI+PSV
Sbjct  120  PIPAEDSLNWVCDYPDGDIHLSLDEWIDRNYDYFEFLTPDMRNSSLQLQGPCYPVIYPSV  179

Query  643  NVYWSCQFIARASNVSLRHWKEMGGI  720
            NV+WSCQFIAR SN+SLRHW++MGG+
Sbjct  180  NVFWSCQFIARPSNMSLRHWQQMGGV  205



>ref|XP_004972393.1| PREDICTED: choline transporter-like protein 2-like [Setaria italica]
Length=701

 Score =   338 bits (867),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 151/208 (73%), Positives = 183/208 (88%), Gaps = 2/208 (1%)
 Frame = +1

Query  100  GPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGN  279
            GPLGA+IG+YPS+    E   G G+I+H+RKCRD  FLL+F AFWVAMIVNSSFGFNQGN
Sbjct  6    GPLGAIIGRYPSA--ADEQDPGGGVIRHDRKCRDWPFLLLFAAFWVAMIVNSSFGFNQGN  63

Query  280  PLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICLMD  459
            PLRLT+GLDYKGN+CG +HA P+L ELD+RYW+NPN+VYQSG K S + LP+ ++ICLM+
Sbjct  64   PLRLTFGLDYKGNICGSKHAVPDLRELDVRYWMNPNQVYQSGLKSSRINLPDVKAICLME  123

Query  460  CPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIFPS  639
            CP+P+ED LN+VCDYPEGDIRL+V++WIDR+YDYF  LTP++R  SLQLQGPCYPVIFPS
Sbjct  124  CPLPAEDGLNFVCDYPEGDIRLSVDDWIDRDYDYFEYLTPDMRNSSLQLQGPCYPVIFPS  183

Query  640  VNVYWSCQFIARASNVSLRHWKEMGGIE  723
            VNVYWSCQFIARASNVSL+HW++MGG+ 
Sbjct  184  VNVYWSCQFIARASNVSLKHWQQMGGVS  211



>ref|XP_002448788.1| hypothetical protein SORBIDRAFT_06g033190 [Sorghum bicolor]
 gb|EES13116.1| hypothetical protein SORBIDRAFT_06g033190 [Sorghum bicolor]
Length=705

 Score =   338 bits (868),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 150/213 (70%), Positives = 182/213 (85%), Gaps = 3/213 (1%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGD---GIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFG  264
            M GPLGA+IG+YPS+ G  E   G    GII+H+R+CRD+ FL++F AFWVAMIVNSSFG
Sbjct  1    MGGPLGAIIGRYPSAAGGDEQLGGGASGGIIRHDRRCRDIAFLVLFAAFWVAMIVNSSFG  60

Query  265  FNQGNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARS  444
            FNQGNPLRLTY LDYKGN+CGD+H  PNL ELD+RYW+NPN+VYQSG KDS V L +A++
Sbjct  61   FNQGNPLRLTYELDYKGNICGDKHGSPNLQELDVRYWMNPNQVYQSGLKDSKVNLADAKA  120

Query  445  ICLMDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYP  624
            ICLM+CP P+ D LN++CDYPEGDI L+V++WI+R+YDYF  LTP++R  SLQLQGPCYP
Sbjct  121  ICLMECPNPAVDGLNFICDYPEGDIHLSVDDWINRDYDYFEFLTPDMRNSSLQLQGPCYP  180

Query  625  VIFPSVNVYWSCQFIARASNVSLRHWKEMGGIE  723
            +IFP+VNVYWSCQFIARASNVSL+HW EMGG+ 
Sbjct  181  IIFPTVNVYWSCQFIARASNVSLKHWHEMGGVS  213



>ref|XP_004487693.1| PREDICTED: choline transporter-like protein 2-like [Cicer arietinum]
Length=693

 Score =   338 bits (866),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 151/210 (72%), Positives = 181/210 (86%), Gaps = 3/210 (1%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVS-SGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFN  270
            MRG LGAV+G+Y SSDG   +   G+GII+HNRKCRD+ FL+IFIAFWV+MIVNSSF FN
Sbjct  1    MRGSLGAVVGRYTSSDGTSTIHMGGNGIIRHNRKCRDIAFLVIFIAFWVSMIVNSSFAFN  60

Query  271  QGNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSIC  450
            +GNPLRLTYGLDYKGNVCGD+HA   L EL+L+YWLNPN+VYQ+  KDS  KL + RSIC
Sbjct  61   KGNPLRLTYGLDYKGNVCGDKHA--GLRELELKYWLNPNQVYQTELKDSQFKLADTRSIC  118

Query  451  LMDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVI  630
            L+DCPIP EDSL WVCDYPEGDIR+++ +WID NY+Y+  LT E++  SLQLQGPCYPVI
Sbjct  119  LLDCPIPYEDSLTWVCDYPEGDIRVSMNDWIDLNYNYYEFLTQEMKNSSLQLQGPCYPVI  178

Query  631  FPSVNVYWSCQFIARASNVSLRHWKEMGGI  720
            FP+VNVYWSCQFIA+ASNVSL+HW++MGG+
Sbjct  179  FPTVNVYWSCQFIAKASNVSLKHWQQMGGV  208



>gb|EPS61834.1| hypothetical protein M569_12959 [Genlisea aurea]
Length=1063

 Score =   345 bits (885),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 157/210 (75%), Positives = 180/210 (86%), Gaps = 7/210 (3%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQ  273
            MRGP     G++ S    G V+    II+HNRKCRDV FLL+FIAFW+ MIVNSSFGFN+
Sbjct  367  MRGP----PGRFSS---GGTVNGSVDIIRHNRKCRDVAFLLVFIAFWIGMIVNSSFGFNK  419

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICL  453
            G+P+RL YGLDYKGNVCGDRHA P+LHEL+LRYWLNPN+VYQS  K +   L NARSICL
Sbjct  420  GDPMRLNYGLDYKGNVCGDRHAVPDLHELELRYWLNPNQVYQSDVKGTSFILSNARSICL  479

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
            +DCPIPSEDSLNWVCDYPEGDI++++  WIDRNYDYFADLTPELR  SLQLQGPCYPVIF
Sbjct  480  LDCPIPSEDSLNWVCDYPEGDIKISIGEWIDRNYDYFADLTPELRNTSLQLQGPCYPVIF  539

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGIE  723
            PSVNVYW+CQFIARASNVS+RHW+EMGG++
Sbjct  540  PSVNVYWTCQFIARASNVSMRHWEEMGGVK  569



>ref|XP_008778474.1| PREDICTED: choline transporter-like protein 2 [Phoenix dactylifera]
Length=706

 Score =   337 bits (864),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 157/212 (74%), Positives = 182/212 (86%), Gaps = 4/212 (2%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDG----IIKHNRKCRDVVFLLIFIAFWVAMIVNSSF  261
            M GPLGA+IGK P++ G G   S       II+ NRKCRD+VFL IFIAFWVAMIVNSSF
Sbjct  1    MGGPLGAIIGKCPTAGGGGGGGSDGEMGSGIIRKNRKCRDLVFLAIFIAFWVAMIVNSSF  60

Query  262  GFNQGNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNAR  441
            GFNQGNPLRLTYGLDYKGNVCG++HADP+L EL++RYWLNPN+VYQSG K S   L +A+
Sbjct  61   GFNQGNPLRLTYGLDYKGNVCGNKHADPDLRELEVRYWLNPNQVYQSGLKSSQFSLADAK  120

Query  442  SICLMDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCY  621
            SICLM+CPIPSED LN++CDYPEGDI L+V++WIDRNYDYF  LTPE+R  SLQLQGPCY
Sbjct  121  SICLMECPIPSEDGLNYICDYPEGDIHLSVDDWIDRNYDYFEFLTPEMRNSSLQLQGPCY  180

Query  622  PVIFPSVNVYWSCQFIARASNVSLRHWKEMGG  717
            P+IFPSVNVYWSCQFIARASN+S++HW +MGG
Sbjct  181  PIIFPSVNVYWSCQFIARASNISVKHWLQMGG  212



>ref|XP_008810449.1| PREDICTED: choline transporter-like protein 2 isoform X1 [Phoenix 
dactylifera]
Length=679

 Score =   335 bits (859),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 147/187 (79%), Positives = 173/187 (93%), Gaps = 0/187 (0%)
 Frame = +1

Query  163  GDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHAD  342
            GDGII+HNRKCRD+VFL+IFIAFWVAMIVNSSFGFNQGNP+RLTYGLDYKGNVCG++HA+
Sbjct  2    GDGIIRHNRKCRDLVFLVIFIAFWVAMIVNSSFGFNQGNPVRLTYGLDYKGNVCGNKHAN  61

Query  343  PNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICLMDCPIPSEDSLNWVCDYPEGDIR  522
            P+L EL++RYWLNPN+VYQSG K S   L +A+SICLM+CPIPSED LN++CDYPEGDIR
Sbjct  62   PDLRELEVRYWLNPNQVYQSGLKSSHFSLADAKSICLMECPIPSEDGLNFICDYPEGDIR  121

Query  523  LAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIFPSVNVYWSCQFIARASNVSLRHW  702
            L+V++WIDR+YDYF  LTPE+R  SLQLQGPCYP+IFPSVNVYWSCQFIAR SN+SLRHW
Sbjct  122  LSVDDWIDRDYDYFEFLTPEMRNSSLQLQGPCYPIIFPSVNVYWSCQFIARPSNISLRHW  181

Query  703  KEMGGIE  723
            ++MGG+ 
Sbjct  182  QQMGGVT  188



>ref|XP_009391078.1| PREDICTED: choline transporter-like protein 2 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=707

 Score =   335 bits (860),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 156/215 (73%), Positives = 185/215 (86%), Gaps = 5/215 (2%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNG-----EVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSS  258
            M GPLGA+IG+ P +  +G      +    GII+HNRKCRD+VFL+IFIAFWVAMIVNSS
Sbjct  1    MGGPLGAIIGRCPVAAASGGNEDGRIGGDGGIIRHNRKCRDLVFLIIFIAFWVAMIVNSS  60

Query  259  FGFNQGNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNA  438
            FGFNQGNPLRL YGLDYKGN+CG+RHADP+L EL++RYWLNPN+VYQSG K+S   L +A
Sbjct  61   FGFNQGNPLRLMYGLDYKGNICGNRHADPDLRELEVRYWLNPNQVYQSGLKNSQFDLADA  120

Query  439  RSICLMDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPC  618
            +SICLM+CPIPSED +NWVCDYPEGDIRL+V++WIDR+YDY+  LT E R  SLQLQGPC
Sbjct  121  KSICLMECPIPSEDGINWVCDYPEGDIRLSVDDWIDRDYDYYEYLTTETRNSSLQLQGPC  180

Query  619  YPVIFPSVNVYWSCQFIARASNVSLRHWKEMGGIE  723
            YPVIFPSVNVYWSCQFIARASNVSL+ W++MGG++
Sbjct  181  YPVIFPSVNVYWSCQFIARASNVSLKQWQQMGGVD  215



>ref|XP_009391079.1| PREDICTED: choline transporter-like protein 2 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=706

 Score =   335 bits (860),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 156/215 (73%), Positives = 185/215 (86%), Gaps = 5/215 (2%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNG-----EVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSS  258
            M GPLGA+IG+ P +  +G      +    GII+HNRKCRD+VFL+IFIAFWVAMIVNSS
Sbjct  1    MGGPLGAIIGRCPVAAASGGNEDGRIGGDGGIIRHNRKCRDLVFLIIFIAFWVAMIVNSS  60

Query  259  FGFNQGNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNA  438
            FGFNQGNPLRL YGLDYKGN+CG+RHADP+L EL++RYWLNPN+VYQSG K+S   L +A
Sbjct  61   FGFNQGNPLRLMYGLDYKGNICGNRHADPDLRELEVRYWLNPNQVYQSGLKNSQFDLADA  120

Query  439  RSICLMDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPC  618
            +SICLM+CPIPSED +NWVCDYPEGDIRL+V++WIDR+YDY+  LT E R  SLQLQGPC
Sbjct  121  KSICLMECPIPSEDGINWVCDYPEGDIRLSVDDWIDRDYDYYEYLTTETRNSSLQLQGPC  180

Query  619  YPVIFPSVNVYWSCQFIARASNVSLRHWKEMGGIE  723
            YPVIFPSVNVYWSCQFIARASNVSL+ W++MGG++
Sbjct  181  YPVIFPSVNVYWSCQFIARASNVSLKQWQQMGGVD  215



>ref|NP_001054289.1| Os04g0681400 [Oryza sativa Japonica Group]
 emb|CAE05747.1| OSJNBb0017I01.27 [Oryza sativa Japonica Group]
 emb|CAE03422.1| OSJNBa0032F06.5 [Oryza sativa Japonica Group]
 dbj|BAF16203.1| Os04g0681400 [Oryza sativa Japonica Group]
 dbj|BAG92666.1| unnamed protein product [Oryza sativa Japonica Group]
Length=711

 Score =   333 bits (855),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 152/218 (70%), Positives = 185/218 (85%), Gaps = 9/218 (4%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDG---------IIKHNRKCRDVVFLLIFIAFWVAMI  246
            M GPLGA+IG++P++ G G      G         II+HNR+CRD+ FL++F AFWVAMI
Sbjct  1    MGGPLGAIIGRHPAAAGGGGGDELGGVGGGGGGDGIIRHNRRCRDLAFLVLFAAFWVAMI  60

Query  247  VNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVK  426
            VNSSFGFNQGNPLRLTY LDYKGN+CG RH DP+LHELD+RYW+NPN+VYQSG KD+ + 
Sbjct  61   VNSSFGFNQGNPLRLTYELDYKGNICGSRHGDPDLHELDVRYWMNPNQVYQSGVKDNKIN  120

Query  427  LPNARSICLMDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQL  606
            L +A++ICLM+CP+P+ D LN+VCDYPEGDIRL+V++WIDR+YDYF  LTP++R  SLQL
Sbjct  121  LADAKAICLMECPMPAADGLNFVCDYPEGDIRLSVDDWIDRDYDYFEFLTPDMRNSSLQL  180

Query  607  QGPCYPVIFPSVNVYWSCQFIARASNVSLRHWKEMGGI  720
            QGPCYPVIFPSVNVYWSCQFIARASNVSL+HW++MGGI
Sbjct  181  QGPCYPVIFPSVNVYWSCQFIARASNVSLKHWQQMGGI  218



>emb|CAJ86275.1| H0901F07.12 [Oryza sativa Indica Group]
 gb|EAY96079.1| hypothetical protein OsI_17953 [Oryza sativa Indica Group]
Length=711

 Score =   333 bits (855),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 152/218 (70%), Positives = 185/218 (85%), Gaps = 9/218 (4%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDG---------IIKHNRKCRDVVFLLIFIAFWVAMI  246
            M GPLGA+IG++P++ G G      G         II+HNR+CRD+ FL++F AFWVAMI
Sbjct  1    MGGPLGAIIGRHPAAAGGGGGDELGGVGGGGGGDGIIRHNRRCRDLAFLVLFAAFWVAMI  60

Query  247  VNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVK  426
            VNSSFGFNQGNPLRLTY LDYKGN+CG RH DP+LHELD+RYW+NPN+VYQSG KD+ + 
Sbjct  61   VNSSFGFNQGNPLRLTYELDYKGNICGSRHGDPDLHELDVRYWMNPNQVYQSGVKDNKIN  120

Query  427  LPNARSICLMDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQL  606
            L +A++ICLM+CP+P+ D LN+VCDYPEGDIRL+V++WIDR+YDYF  LTP++R  SLQL
Sbjct  121  LADAKAICLMECPMPAADGLNFVCDYPEGDIRLSVDDWIDRDYDYFEFLTPDMRNSSLQL  180

Query  607  QGPCYPVIFPSVNVYWSCQFIARASNVSLRHWKEMGGI  720
            QGPCYPVIFPSVNVYWSCQFIARASNVSL+HW++MGGI
Sbjct  181  QGPCYPVIFPSVNVYWSCQFIARASNVSLKHWQQMGGI  218



>ref|XP_009408146.1| PREDICTED: choline transporter-like protein 2 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=707

 Score =   333 bits (854),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 154/214 (72%), Positives = 182/214 (85%), Gaps = 5/214 (2%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGII-----KHNRKCRDVVFLLIFIAFWVAMIVNSS  258
            M GPLGA+IG++P++ G        G       +HNRKCRD+VFL+IFIAFWVAMIVNSS
Sbjct  1    MGGPLGAIIGRHPTAAGGDGDGQIGGGGGGGIIRHNRKCRDLVFLVIFIAFWVAMIVNSS  60

Query  259  FGFNQGNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNA  438
            FGFNQGNPLRLTYGLDYKGNVCG+RHA P+L EL +RYWLNPN+VY SG ++S   L +A
Sbjct  61   FGFNQGNPLRLTYGLDYKGNVCGNRHAKPDLRELMVRYWLNPNQVYLSGIENSQFNLADA  120

Query  439  RSICLMDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPC  618
            RSICLM+CP+PSED LNWVCDYPEGDIRL++++WI+R+YDY+  LT E+R  SLQLQGPC
Sbjct  121  RSICLMECPVPSEDGLNWVCDYPEGDIRLSMDDWINRDYDYYEFLTSEMRNSSLQLQGPC  180

Query  619  YPVIFPSVNVYWSCQFIARASNVSLRHWKEMGGI  720
            YPVIFPSVNVYWSCQFIARASNVSLRHW++MGG+
Sbjct  181  YPVIFPSVNVYWSCQFIARASNVSLRHWQQMGGV  214



>ref|XP_009408147.1| PREDICTED: choline transporter-like protein 2 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=706

 Score =   333 bits (854),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 154/214 (72%), Positives = 182/214 (85%), Gaps = 5/214 (2%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDGII-----KHNRKCRDVVFLLIFIAFWVAMIVNSS  258
            M GPLGA+IG++P++ G        G       +HNRKCRD+VFL+IFIAFWVAMIVNSS
Sbjct  1    MGGPLGAIIGRHPTAAGGDGDGQIGGGGGGGIIRHNRKCRDLVFLVIFIAFWVAMIVNSS  60

Query  259  FGFNQGNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNA  438
            FGFNQGNPLRLTYGLDYKGNVCG+RHA P+L EL +RYWLNPN+VY SG ++S   L +A
Sbjct  61   FGFNQGNPLRLTYGLDYKGNVCGNRHAKPDLRELMVRYWLNPNQVYLSGIENSQFNLADA  120

Query  439  RSICLMDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPC  618
            RSICLM+CP+PSED LNWVCDYPEGDIRL++++WI+R+YDY+  LT E+R  SLQLQGPC
Sbjct  121  RSICLMECPVPSEDGLNWVCDYPEGDIRLSMDDWINRDYDYYEFLTSEMRNSSLQLQGPC  180

Query  619  YPVIFPSVNVYWSCQFIARASNVSLRHWKEMGGI  720
            YPVIFPSVNVYWSCQFIARASNVSLRHW++MGG+
Sbjct  181  YPVIFPSVNVYWSCQFIARASNVSLRHWQQMGGV  214



>ref|XP_006653038.1| PREDICTED: choline transporter-like protein 2-like [Oryza brachyantha]
Length=709

 Score =   333 bits (853),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 154/216 (71%), Positives = 187/216 (87%), Gaps = 7/216 (3%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDG-------IIKHNRKCRDVVFLLIFIAFWVAMIVN  252
            M GPLGA+IG++P++ G GE   G G       II+HNR+CRD+ FL++F AFWVAMIVN
Sbjct  1    MGGPLGAIIGRHPAAAGGGEDELGGGGGGAGGGIIRHNRRCRDLAFLVLFAAFWVAMIVN  60

Query  253  SSFGFNQGNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLP  432
            SSFGFNQGNPLRLTY LDYKGNVCG RH DP+LHELD+RYW+NPN+VYQSG KDS + L 
Sbjct  61   SSFGFNQGNPLRLTYELDYKGNVCGSRHGDPDLHELDVRYWMNPNQVYQSGVKDSKINLA  120

Query  433  NARSICLMDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQG  612
            +A++ICLM+CPIP+ D LN+VCDYPEGDIRL+V++WI+R+YDYF  LTP++R  SLQLQG
Sbjct  121  DAKAICLMECPIPAADGLNFVCDYPEGDIRLSVDDWINRDYDYFEFLTPDMRNSSLQLQG  180

Query  613  PCYPVIFPSVNVYWSCQFIARASNVSLRHWKEMGGI  720
            PCYPVIFPSVNV+WSCQ+IARASNVSL+HW++MGGI
Sbjct  181  PCYPVIFPSVNVFWSCQYIARASNVSLKHWQQMGGI  216



>ref|XP_004960043.1| PREDICTED: choline transporter-like protein 2-like [Setaria italica]
Length=710

 Score =   333 bits (853),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 149/218 (68%), Positives = 183/218 (84%), Gaps = 8/218 (4%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDG--------IIKHNRKCRDVVFLLIFIAFWVAMIV  249
            M GPLGA+IG+YPS+   G      G        II+HNR+CRD+ FL++F AFWVAMIV
Sbjct  1    MGGPLGAIIGRYPSAAAGGGGEDELGGGGASGAGIIRHNRRCRDIAFLVLFAAFWVAMIV  60

Query  250  NSSFGFNQGNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKL  429
            NSSFGFNQGNPLRLTY LDYKGN+CGD+H DPNLHELD+RYW+NPN+VYQSG K+S V L
Sbjct  61   NSSFGFNQGNPLRLTYELDYKGNICGDKHGDPNLHELDVRYWMNPNQVYQSGLKNSKVNL  120

Query  430  PNARSICLMDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQ  609
             +A+++CLM+CP P+ D LN++CDYPEGDI L+V++WI+R+YDYF  LTP++R  SLQLQ
Sbjct  121  ADAKAVCLMECPNPAVDGLNFICDYPEGDIHLSVDDWINRDYDYFEFLTPDMRNSSLQLQ  180

Query  610  GPCYPVIFPSVNVYWSCQFIARASNVSLRHWKEMGGIE  723
            GPCYPVIFP+VNVYWSCQFIARASNVSL+HW++MGG+ 
Sbjct  181  GPCYPVIFPTVNVYWSCQFIARASNVSLKHWQQMGGVS  218



>ref|XP_006659724.1| PREDICTED: choline transporter-like protein 2-like [Oryza brachyantha]
Length=705

 Score =   332 bits (852),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 150/213 (70%), Positives = 182/213 (85%), Gaps = 3/213 (1%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSD---GNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFG  264
            M GPLGA+IG+  SS    G+ +   G  II H+RKCRD+ FL +F AF +AMI+NSSFG
Sbjct  1    MGGPLGAIIGRRYSSSAPAGDDDRGPGGAIITHDRKCRDLPFLALFAAFCLAMIINSSFG  60

Query  265  FNQGNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARS  444
            FNQGNPLRLTYGLDYKGN+CG RH DP+L ELD+RYW+NPN+VYQSG K S + LP+A++
Sbjct  61   FNQGNPLRLTYGLDYKGNICGSRHGDPDLRELDVRYWMNPNQVYQSGLKGSQINLPDAKA  120

Query  445  ICLMDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYP  624
            ICLM+CP+P+ED LN++CDYPEGDIRL+V++WIDR+YDYF  LTP++R  SLQLQGPCYP
Sbjct  121  ICLMECPLPAEDGLNFICDYPEGDIRLSVDDWIDRDYDYFEYLTPDMRNSSLQLQGPCYP  180

Query  625  VIFPSVNVYWSCQFIARASNVSLRHWKEMGGIE  723
            VIFPSVNVYWSCQFIARASNVSL+HW++MGGI 
Sbjct  181  VIFPSVNVYWSCQFIARASNVSLKHWQQMGGIS  213



>ref|XP_010940429.1| PREDICTED: choline transporter-like protein 2 isoform X1 [Elaeis 
guineensis]
Length=707

 Score =   332 bits (850),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 151/213 (71%), Positives = 183/213 (86%), Gaps = 5/213 (2%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDG-----IIKHNRKCRDVVFLLIFIAFWVAMIVNSS  258
            M GPLGA+IG+YP+++  G     DG     I++ NRKCRD+VFL+IFIAFWVAMIVNSS
Sbjct  1    MGGPLGAIIGRYPTAESGGGGGGSDGERGRGIVRKNRKCRDLVFLVIFIAFWVAMIVNSS  60

Query  259  FGFNQGNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNA  438
            FGFNQGNPLRLTYGLDYKGN+CG++HA+P+L  L++RYWLNPN+VYQSG K S   L +A
Sbjct  61   FGFNQGNPLRLTYGLDYKGNICGNKHANPDLRALEVRYWLNPNQVYQSGLKSSQFTLADA  120

Query  439  RSICLMDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPC  618
            +SICLM+CPIPSED LN++CDYPEG I L+V++WIDRNYDYF  LTP++R  SLQLQGPC
Sbjct  121  KSICLMECPIPSEDGLNFICDYPEGGIHLSVDDWIDRNYDYFEFLTPDMRNSSLQLQGPC  180

Query  619  YPVIFPSVNVYWSCQFIARASNVSLRHWKEMGG  717
            YP++FPSVNVYWSCQFIARASN+SL+HW +MGG
Sbjct  181  YPIVFPSVNVYWSCQFIARASNISLKHWLQMGG  213



>ref|XP_010940430.1| PREDICTED: choline transporter-like protein 2 isoform X2 [Elaeis 
guineensis]
Length=706

 Score =   332 bits (850),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 151/213 (71%), Positives = 183/213 (86%), Gaps = 5/213 (2%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDG-----IIKHNRKCRDVVFLLIFIAFWVAMIVNSS  258
            M GPLGA+IG+YP+++  G     DG     I++ NRKCRD+VFL+IFIAFWVAMIVNSS
Sbjct  1    MGGPLGAIIGRYPTAESGGGGGGSDGERGRGIVRKNRKCRDLVFLVIFIAFWVAMIVNSS  60

Query  259  FGFNQGNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNA  438
            FGFNQGNPLRLTYGLDYKGN+CG++HA+P+L  L++RYWLNPN+VYQSG K S   L +A
Sbjct  61   FGFNQGNPLRLTYGLDYKGNICGNKHANPDLRALEVRYWLNPNQVYQSGLKSSQFTLADA  120

Query  439  RSICLMDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPC  618
            +SICLM+CPIPSED LN++CDYPEG I L+V++WIDRNYDYF  LTP++R  SLQLQGPC
Sbjct  121  KSICLMECPIPSEDGLNFICDYPEGGIHLSVDDWIDRNYDYFEFLTPDMRNSSLQLQGPC  180

Query  619  YPVIFPSVNVYWSCQFIARASNVSLRHWKEMGG  717
            YP++FPSVNVYWSCQFIARASN+SL+HW +MGG
Sbjct  181  YPIVFPSVNVYWSCQFIARASNISLKHWLQMGG  213



>gb|EAZ32442.1| hypothetical protein OsJ_16653 [Oryza sativa Japonica Group]
Length=711

 Score =   331 bits (848),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 150/218 (69%), Positives = 184/218 (84%), Gaps = 9/218 (4%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDG---------IIKHNRKCRDVVFLLIFIAFWVAMI  246
            M GPLGA++G++P++ G        G         II+HNR+CRD+ FL++F AFWVAMI
Sbjct  1    MGGPLGAIMGRHPAAAGGAGGDELGGVGGGGGGDGIIRHNRRCRDLAFLVLFAAFWVAMI  60

Query  247  VNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVK  426
            VNSSFGFNQGNPLRLTY LDYKGN+CG RH DP+LHELD+RYW+NPN+VYQSG KD+ + 
Sbjct  61   VNSSFGFNQGNPLRLTYELDYKGNICGSRHGDPDLHELDVRYWMNPNQVYQSGVKDNKIN  120

Query  427  LPNARSICLMDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQL  606
            L +A++ICLM+CP+P+ D LN+VCDYPEGDIRL+V++WIDR+YDYF  LTP++R  SLQL
Sbjct  121  LADAKAICLMECPMPAADGLNFVCDYPEGDIRLSVDDWIDRDYDYFEFLTPDMRNSSLQL  180

Query  607  QGPCYPVIFPSVNVYWSCQFIARASNVSLRHWKEMGGI  720
            QGPCYPVIFPSVNVYWSCQFIARASNVSL+HW++MGGI
Sbjct  181  QGPCYPVIFPSVNVYWSCQFIARASNVSLKHWQQMGGI  218



>ref|NP_001054291.1| Os04g0681600 [Oryza sativa Japonica Group]
 emb|CAE03425.1| OSJNBa0032F06.8 [Oryza sativa Japonica Group]
 dbj|BAF16205.1| Os04g0681600 [Oryza sativa Japonica Group]
 dbj|BAG97153.1| unnamed protein product [Oryza sativa Japonica Group]
Length=711

 Score =   330 bits (847),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 150/218 (69%), Positives = 184/218 (84%), Gaps = 9/218 (4%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDG---------IIKHNRKCRDVVFLLIFIAFWVAMI  246
            M GPLGA+IG++P++ G G      G         II+HNR+CRD+ FL++F AFWVAMI
Sbjct  1    MGGPLGAIIGRHPAAAGGGGEDELGGGGGGGDGGGIIRHNRRCRDLAFLVLFAAFWVAMI  60

Query  247  VNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVK  426
            VNSSFGFNQGNPLRLTY LDYKGN+CG RH DP+LHELD+RYW+NPN+VYQSG KD+ + 
Sbjct  61   VNSSFGFNQGNPLRLTYELDYKGNICGSRHGDPDLHELDVRYWMNPNQVYQSGVKDNKIN  120

Query  427  LPNARSICLMDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQL  606
            L +A++ICLM+CPIP+ D LN+VCDYPEGDIRL++++WI+R+YDYF  L P++R  SLQL
Sbjct  121  LADAKAICLMECPIPAADGLNFVCDYPEGDIRLSIDDWINRDYDYFEFLAPDMRNSSLQL  180

Query  607  QGPCYPVIFPSVNVYWSCQFIARASNVSLRHWKEMGGI  720
            QGPCYPVIFPSVNVYWSCQFIARASNVSL+HW++MGGI
Sbjct  181  QGPCYPVIFPSVNVYWSCQFIARASNVSLKHWQQMGGI  218



>ref|XP_003580838.1| PREDICTED: choline transporter-like protein 2 [Brachypodium distachyon]
Length=712

 Score =   325 bits (834),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 149/219 (68%), Positives = 182/219 (83%), Gaps = 10/219 (5%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDG----------IIKHNRKCRDVVFLLIFIAFWVAM  243
            M GPLGA+IG+YPS+   G      G          II+H+R+CRD+ FL++F AFWVAM
Sbjct  1    MGGPLGAIIGRYPSAATGGGGEDELGSGGGGGGGEGIIRHDRRCRDLAFLVLFAAFWVAM  60

Query  244  IVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDV  423
            IVNSSFGFNQGNPLRLTY LDYKGNVCGDRH DP++HELD+RYW++PN+VYQSG K S V
Sbjct  61   IVNSSFGFNQGNPLRLTYELDYKGNVCGDRHGDPDVHELDVRYWMDPNQVYQSGLKSSKV  120

Query  424  KLPNARSICLMDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQ  603
             L +A++ICLM+CP P+ D LN+VCDYPEGDI+L+V++WI+R+YDYF  LTP++R  SLQ
Sbjct  121  NLADAKAICLMECPTPAPDRLNFVCDYPEGDIKLSVDDWINRDYDYFDFLTPDMRNSSLQ  180

Query  604  LQGPCYPVIFPSVNVYWSCQFIARASNVSLRHWKEMGGI  720
            LQGPCYPVIFPSVNVYWSCQ+IARASNVSL+HW +MGG+
Sbjct  181  LQGPCYPVIFPSVNVYWSCQYIARASNVSLKHWLQMGGV  219



>dbj|BAK04094.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=712

 Score =   325 bits (833),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 145/219 (66%), Positives = 180/219 (82%), Gaps = 10/219 (5%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEV----------SSGDGIIKHNRKCRDVVFLLIFIAFWVAM  243
            M GPLGA+IG+YPS+                ++  GII+H+R+CRD+ FL++F AFWVAM
Sbjct  1    MGGPLGAIIGRYPSATATAGAGGEDADAGGGTASLGIIRHDRRCRDLAFLVLFAAFWVAM  60

Query  244  IVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDV  423
            IVNSSF FNQGNPLRLTY LDYKGNVCGDRH DP++HEL++RYWL+PN+VYQSG K S  
Sbjct  61   IVNSSFAFNQGNPLRLTYELDYKGNVCGDRHGDPDVHELEVRYWLDPNQVYQSGLKGSKT  120

Query  424  KLPNARSICLMDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQ  603
             L +A++ICLM+CP P+ D LN+VCDYPEGDIRL+V++WI+R+Y+YF  LTP++R  SLQ
Sbjct  121  NLADAKAICLMECPTPAPDGLNFVCDYPEGDIRLSVDDWINRDYNYFDVLTPDMRNSSLQ  180

Query  604  LQGPCYPVIFPSVNVYWSCQFIARASNVSLRHWKEMGGI  720
            LQGPCYPVIFPSVNVYWSCQ+IARASNVSL HW ++GG+
Sbjct  181  LQGPCYPVIFPSVNVYWSCQYIARASNVSLTHWLQLGGV  219



>ref|XP_003573246.1| PREDICTED: choline transporter-like protein 2 [Brachypodium distachyon]
Length=709

 Score =   324 bits (830),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 146/215 (68%), Positives = 182/215 (85%), Gaps = 5/215 (2%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDG-----IIKHNRKCRDVVFLLIFIAFWVAMIVNSS  258
            MR PLGA+IG++ S+   G     D      +I+H+RKCRD+ FL +F AFWVAMIVNSS
Sbjct  1    MRWPLGAIIGRHASAAAAGAGGEKDAGAGAGVIRHDRKCRDLPFLALFAAFWVAMIVNSS  60

Query  259  FGFNQGNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNA  438
            FGFNQGNPLRLT+GLDYKGN+CG +H DPNLHELD+RYW+NPN+VYQSG K + + LP+A
Sbjct  61   FGFNQGNPLRLTFGLDYKGNICGSKHGDPNLHELDVRYWMNPNQVYQSGLKSNQINLPDA  120

Query  439  RSICLMDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPC  618
            ++ICLM+CP P+ED LN+VCDYP+GDIRL+V++WIDR+YDYF  LTP++R  SLQLQGPC
Sbjct  121  KAICLMECPYPAEDGLNFVCDYPDGDIRLSVDDWIDRDYDYFEYLTPDMRNSSLQLQGPC  180

Query  619  YPVIFPSVNVYWSCQFIARASNVSLRHWKEMGGIE  723
            YP+IFPS+NVYWSCQFIAR SNVSL+HW++MGG+ 
Sbjct  181  YPIIFPSINVYWSCQFIARPSNVSLKHWQQMGGVS  215



>ref|XP_008668676.1| PREDICTED: choline transporter-like protein 2 [Zea mays]
 tpg|DAA35311.1| TPA: hypothetical protein ZEAMMB73_361718 [Zea mays]
Length=705

 Score =   324 bits (830),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 145/213 (68%), Positives = 182/213 (85%), Gaps = 3/213 (1%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGE---VSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFG  264
            M GPLGA+IG+YPS+ G  E     +G GII+H+R+CRD+  L++F AFWVAMIVNSSFG
Sbjct  1    MGGPLGAIIGRYPSAAGGDEQLGGGAGGGIIRHDRRCRDIAVLVLFAAFWVAMIVNSSFG  60

Query  265  FNQGNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARS  444
            FNQGNPLRLTY LDYKGNVCGD+H +PNL ELD+RYW+NPN+VYQSG K+S V L +A++
Sbjct  61   FNQGNPLRLTYELDYKGNVCGDKHGNPNLQELDVRYWMNPNQVYQSGLKNSKVNLADAKA  120

Query  445  ICLMDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYP  624
            ICLM+CP P+ D LN++CDYPEG+I L+V++WI+R+YDY+  LTP+++  SLQLQGPCYP
Sbjct  121  ICLMECPNPAVDGLNYICDYPEGNIDLSVDDWINRDYDYYEFLTPDMKNSSLQLQGPCYP  180

Query  625  VIFPSVNVYWSCQFIARASNVSLRHWKEMGGIE  723
            +IFP+VNVYWSCQFIARASNVSL+HW E GG+ 
Sbjct  181  IIFPTVNVYWSCQFIARASNVSLKHWHETGGVS  213



>gb|KEH38752.1| plasma-membrane choline transporter family protein [Medicago 
truncatula]
Length=688

 Score =   316 bits (810),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 168/187 (90%), Gaps = 2/187 (1%)
 Frame = +1

Query  163  GDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHAD  342
            G+GIIKHNRKCRD+V L+IFIAFW+AMIVNSSF FN+GNP RLT+GLDYKGNVCGD+HA 
Sbjct  12   GNGIIKHNRKCRDIVVLVIFIAFWIAMIVNSSFAFNRGNPFRLTFGLDYKGNVCGDKHA-  70

Query  343  PNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICLMDCPIPSEDSLNWVCDYPEGDIR  522
              LH+L+L+YWLNPN+VYQSG KDS +KL +ARSICL+DCP+P EDSL WVCDYPEGDI 
Sbjct  71   -GLHQLELKYWLNPNQVYQSGLKDSQLKLGDARSICLLDCPVPREDSLVWVCDYPEGDIV  129

Query  523  LAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIFPSVNVYWSCQFIARASNVSLRHW  702
            +++++WID NY+Y+A LTPE+R  SLQLQGPCYPVIFPSVNV+WSCQFIARASNVSL  W
Sbjct  130  VSMDDWIDMNYNYYAFLTPEMRNSSLQLQGPCYPVIFPSVNVHWSCQFIARASNVSLSLW  189

Query  703  KEMGGIE  723
            ++MGG+ 
Sbjct  190  QQMGGVS  196



>dbj|BAK00584.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=706

 Score =   310 bits (794),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 136/184 (74%), Positives = 164/184 (89%), Gaps = 0/184 (0%)
 Frame = +1

Query  172  IIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADPNL  351
            II+H+RKCRD+ FL +F AFWVAMIVNSSFGFNQG+PLRLTYGLDYKGN+CG +  DP+L
Sbjct  29   IIRHDRKCRDLPFLALFAAFWVAMIVNSSFGFNQGSPLRLTYGLDYKGNICGSKRGDPDL  88

Query  352  HELDLRYWLNPNEVYQSGPKDSDVKLPNARSICLMDCPIPSEDSLNWVCDYPEGDIRLAV  531
             ELD+RYWLNPN+VYQSG K+S   L +A+SICLM+CP P+ED LN+VCDYPEGDIRL+V
Sbjct  89   SELDVRYWLNPNQVYQSGLKNSTSDLADAKSICLMECPYPAEDGLNFVCDYPEGDIRLSV  148

Query  532  ENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIFPSVNVYWSCQFIARASNVSLRHWKEM  711
            ++WIDR+YDYF  LTP++R  SLQLQGPCYP+IFPS+NVYWSCQFIAR SNVSL+HW++M
Sbjct  149  DDWIDRDYDYFEYLTPDMRNSSLQLQGPCYPIIFPSINVYWSCQFIARPSNVSLKHWQQM  208

Query  712  GGIE  723
            GG+ 
Sbjct  209  GGVS  212



>ref|XP_010934825.1| PREDICTED: choline transporter-like protein 2 isoform X2 [Elaeis 
guineensis]
Length=692

 Score =   309 bits (791),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 144/213 (68%), Positives = 174/213 (82%), Gaps = 15/213 (7%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSS---GDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFG  264
            M  PLG ++G+Y ++ G    S    GDGII+HNRKCRD+VFL+IFIAFWVAMIVNSSFG
Sbjct  1    MGVPLGVIVGRYTTAGGGSGGSDGEMGDGIIRHNRKCRDLVFLVIFIAFWVAMIVNSSFG  60

Query  265  FNQGNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARS  444
            FNQGNPLRLTYGLDYKGNVCG +HA+P+L EL++RYWLNPN+VYQSG K S   L +A+S
Sbjct  61   FNQGNPLRLTYGLDYKGNVCGSKHANPDLRELEVRYWLNPNQVYQSGLKSSHFSLADAKS  120

Query  445  ICLMDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYP  624
            ICLM+CPIPSED LN++CDYPEGDIRL+V++WIDR+YDYF  LTP++R  SLQLQ     
Sbjct  121  ICLMECPIPSEDGLNFICDYPEGDIRLSVDDWIDRDYDYFEFLTPDMRNSSLQLQ-----  175

Query  625  VIFPSVNVYWSCQFIARASNVSLRHWKEMGGIE  723
                   V+WSCQFIARASN+SLRHW++MGG+ 
Sbjct  176  -------VHWSCQFIARASNISLRHWQQMGGVT  201



>gb|EMT23496.1| hypothetical protein F775_29578 [Aegilops tauschii]
Length=781

 Score =   278 bits (711),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = +1

Query  241  MIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSD  420
            MIVNSSFGFNQG+PLRLTYGLDYKGN+CG +H DP+L ELD+RYW+NPN+VYQSG K+S 
Sbjct  1    MIVNSSFGFNQGSPLRLTYGLDYKGNICGSKHGDPDLSELDVRYWVNPNQVYQSGLKNST  60

Query  421  VKLPNARSICLMDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSL  600
              L +A+SICLM+CP P+ED LN+VCDYPEGDIRL+V++WIDR+YDYF  LTP++R  SL
Sbjct  61   SDLADAKSICLMECPYPAEDGLNFVCDYPEGDIRLSVDDWIDRDYDYFEYLTPDMRNSSL  120

Query  601  QLQGPCYPVIFPSVNVYWSCQFIARASNVSLRHWKEMGGIE  723
            QLQGPCYP+IFPS+NVYWSCQFIAR SNVSL+HW++MGG+ 
Sbjct  121  QLQGPCYPIIFPSINVYWSCQFIARPSNVSLKHWQQMGGVS  161



>gb|EMT10231.1| hypothetical protein F775_15809 [Aegilops tauschii]
Length=653

 Score =   273 bits (699),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = +1

Query  241  MIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSD  420
            MIVNSSF FNQGNPLRLTY LDYKGNVCGDRH DP++HEL++RYWL+PN+VYQSG K S 
Sbjct  1    MIVNSSFAFNQGNPLRLTYELDYKGNVCGDRHGDPDVHELEVRYWLDPNQVYQSGVKGSK  60

Query  421  VKLPNARSICLMDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSL  600
              L +A++ICLM+CP P+ D LN+VCDYPEGDIRL+V++WI+R+Y+YF  LTP++R  SL
Sbjct  61   ANLADAKAICLMECPTPAPDGLNFVCDYPEGDIRLSVDDWINRDYNYFEMLTPDMRNSSL  120

Query  601  QLQGPCYPVIFPSVNVYWSCQFIARASNVSLRHWKEMGGI  720
            QLQGPCYPVIFPSVNVYWSCQ+IARASNVSL HW++MGG+
Sbjct  121  QLQGPCYPVIFPSVNVYWSCQYIARASNVSLTHWQQMGGV  160



>gb|KJB13392.1| hypothetical protein B456_002G072200 [Gossypium raimondii]
Length=644

 Score =   263 bits (671),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  286  RLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICLMDCP  465
            +LTYGLDYKGNVCGD+HA P LH+L+L+YWLNPN+VYQSG KDS  KL NARSICL+DCP
Sbjct  9    KLTYGLDYKGNVCGDKHAHPGLHQLELKYWLNPNQVYQSGVKDSQFKLSNARSICLLDCP  68

Query  466  IPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIFPSVN  645
             P EDSL+WVCDYPEGDI L++++WIDRNYDY+  LTPE++  SLQLQGPCYPVIFPSVN
Sbjct  69   TPLEDSLSWVCDYPEGDIHLSMDDWIDRNYDYYEILTPEMKNASLQLQGPCYPVIFPSVN  128

Query  646  VYWSCQFIARASNVSLRHWKEMGGIE  723
            VYWSCQ+IARASN SLRHWK+MGG++
Sbjct  129  VYWSCQYIARASNASLRHWKQMGGVD  154



>ref|XP_008647208.1| PREDICTED: choline transporter-like protein 2, partial [Zea mays]
Length=640

 Score =   259 bits (662),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +1

Query  286  RLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICLMDCP  465
            RLTYGLDYKGN+CG RHADP+L++LD+RYW+NPN+VYQSG K S ++LP+A++ICLM+CP
Sbjct  3    RLTYGLDYKGNICGSRHADPDLYQLDVRYWVNPNQVYQSGLKTSHIELPDAKTICLMECP  62

Query  466  IPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIFPSVN  645
            +P+ED LN+VCDYPEGDIRL+V++WIDR+YDYF  LTP++R  SLQLQGPCYPVIFPSVN
Sbjct  63   LPAEDGLNFVCDYPEGDIRLSVDDWIDRDYDYFEYLTPDMRNSSLQLQGPCYPVIFPSVN  122

Query  646  VYWSCQFIARASNVSLRHWKEMGGIE  723
            VYWSCQFIARASN SL+HWK+MGG+ 
Sbjct  123  VYWSCQFIARASNASLKHWKDMGGVT  148



>ref|XP_006451902.1| hypothetical protein CICLE_v10007637mg [Citrus clementina]
 ref|XP_006464736.1| PREDICTED: choline transporter-like protein 2-like isoform X2 
[Citrus sinensis]
 gb|ESR65142.1| hypothetical protein CICLE_v10007637mg [Citrus clementina]
Length=646

 Score =   258 bits (659),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 131/145 (90%), Gaps = 2/145 (1%)
 Frame = +1

Query  289  LTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICLMDCPI  468
            LTYGLDYKGNVCGDRHA   L EL+LRYWLNPN+VYQSG K S  KL NARSICL+DCPI
Sbjct  14   LTYGLDYKGNVCGDRHA--GLRELELRYWLNPNQVYQSGLKGSQFKLANARSICLLDCPI  71

Query  469  PSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIFPSVNV  648
            P+EDSLNWVCDYPEG+IRL++++WIDRNYDYF  LTPE+R  SLQLQGPCYPV+FPSVNV
Sbjct  72   PAEDSLNWVCDYPEGEIRLSMDDWIDRNYDYFEFLTPEMRNSSLQLQGPCYPVVFPSVNV  131

Query  649  YWSCQFIARASNVSLRHWKEMGGIE  723
            YWSCQFIARASN+SL+HW++MGG+ 
Sbjct  132  YWSCQFIARASNMSLKHWQQMGGVT  156


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 45/74 (61%), Gaps = 8/74 (11%)
 Frame = +2

Query  590  KSPFSSRVHVTLSYFLALMFIG-AANLLLAHQMCLCGIGRRWVGLKIFEDIIIDKAIHRS  766
            + P    V  +++ + +  FI  A+N+ L H   + G+        I ED++IDK+IHR+
Sbjct  118  QGPCYPVVFPSVNVYWSCQFIARASNMSLKHWQQMGGV-------TINEDLLIDKSIHRT  170

Query  767  INSRSSVFKRYVAD  808
            INSRS+V KRY+AD
Sbjct  171  INSRSAVLKRYMAD  184



>emb|CAJ86278.1| H0901F07.15 [Oryza sativa Indica Group]
 emb|CAJ86286.1| H0124B04.3 [Oryza sativa Indica Group]
 gb|EAY96082.1| hypothetical protein OsI_17956 [Oryza sativa Indica Group]
Length=678

 Score =   253 bits (645),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  283  LRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICLMDC  462
            L LTY LDYKGN+CG RH DP+LHELD+RYW+NPN+VYQSG KD+ + L +A++ICLM+C
Sbjct  40   LGLTYELDYKGNICGSRHGDPDLHELDVRYWMNPNQVYQSGVKDNKINLADAKAICLMEC  99

Query  463  PIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIFPSV  642
            PIP+ D LN+VCDYPEGDIRL++++WI+R+YDYF  LTP++R  SLQLQGPCYPVIFPSV
Sbjct  100  PIPAADGLNFVCDYPEGDIRLSIDDWINRDYDYFEFLTPDMRNSSLQLQGPCYPVIFPSV  159

Query  643  NVYWSCQFIARASNVSLRHWKEMGGI  720
            NVYWSCQFIARASNVSL+HW++MGGI
Sbjct  160  NVYWSCQFIARASNVSLKHWQQMGGI  185



>gb|EMS55310.1| hypothetical protein TRIUR3_16176 [Triticum urartu]
Length=608

 Score =   248 bits (632),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = +1

Query  283  LRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICLMDC  462
            +RLTYGLDYKGN+CG +H DP+L ELD+RYW+NPN+VYQSG K+S   L +A++ICLM+C
Sbjct  1    MRLTYGLDYKGNICGSKHGDPDLSELDVRYWVNPNQVYQSGLKNSTNDLADAKAICLMEC  60

Query  463  PIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIFPSV  642
            P P+ED LN+VCDYPEGDIRL+V++WIDR+YDYF  LTP++R  SLQLQGPCYP+IFPS+
Sbjct  61   PYPAEDGLNFVCDYPEGDIRLSVDDWIDRDYDYFEYLTPDMRNSSLQLQGPCYPIIFPSI  120

Query  643  NVYWSCQFIARASNVSLRHWKEMGGIE  723
            NVYWSCQFIAR SNVSL+HW++MGG+ 
Sbjct  121  NVYWSCQFIARPSNVSLKHWQQMGGVS  147



>ref|XP_001757700.1| predicted protein [Physcomitrella patens]
 gb|EDQ77340.1| predicted protein [Physcomitrella patens]
Length=766

 Score =   241 bits (616),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/201 (54%), Positives = 138/201 (69%), Gaps = 4/201 (2%)
 Frame = +1

Query  133  SSDGNGEVSSGDGI----IKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYG  300
            S+ G  +  +G G     IK NR CRD++FL++F+A+ V +I+ SS+GF+ G+P RL YG
Sbjct  59   SAPGYADQEAGTGPQKPRIKQNRTCRDILFLILFLAYGVGIIIASSYGFHNGDPRRLVYG  118

Query  301  LDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICLMDCPIPSED  480
            LDYKGN CGD    PNL + D+RYWLNPN+VY+SG       L +ARSICL DCPIPS  
Sbjct  119  LDYKGNTCGDNKGSPNLKDYDIRYWLNPNQVYKSGLTSDPFNLGDARSICLADCPIPSAT  178

Query  481  SLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIFPSVNVYWSC  660
            +L WVCDYPEG I+L +  W  RNYDYF+ LTPE +  S  L GPCYPV+F S N++WSC
Sbjct  179  NLTWVCDYPEGPIKLTMSEWGARNYDYFSMLTPEQQASSFNLTGPCYPVLFTSTNLFWSC  238

Query  661  QFIARASNVSLRHWKEMGGIE  723
            Q  +  SN SL  W+  GG E
Sbjct  239  QLASTPSNTSLSLWQSAGGTE  259



>ref|XP_001771780.1| predicted protein [Physcomitrella patens]
 gb|EDQ63388.1| predicted protein [Physcomitrella patens]
Length=753

 Score =   189 bits (479),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/185 (46%), Positives = 127/185 (69%), Gaps = 4/185 (2%)
 Frame = +1

Query  175  IKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADP-NL  351
            I+   KC+D+ FL +F+ F +  IV +SFGFN+GNP RL +GLDYKGNVCGD+ A P +L
Sbjct  45   IRRVHKCQDLAFLAVFLVFCIGFIVETSFGFNKGNPRRLVHGLDYKGNVCGDKKATPGSL  104

Query  352  HELDLRYWLNPNEVYQSGPKDSDVKLPNARSICLMDCPIP-SEDSLNWVCDYPEGDIR-L  525
              L + YW+NP++++ +G K +  ++ NAR IC+ DCP+  +  +L WVCDYPEG +R +
Sbjct  105  EGLGVLYWVNPSQLFLAGEKATPFRVTNARGICVRDCPVAGNATTLLWVCDYPEGSMRNI  164

Query  526  AVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIFPSVN-VYWSCQFIARASNVSLRHW  702
            ++  W  R+Y+YF  LTP+ +  S +L+GPCYPV+FPS N V+W CQ      N +++ W
Sbjct  165  SMAQWAKRSYNYFDLLTPDQQASSKRLEGPCYPVLFPSSNAVFWRCQLEPFPLNQTMQLW  224

Query  703  KEMGG  717
              + G
Sbjct  225  TSLNG  229



>ref|XP_009351421.1| PREDICTED: choline transporter-like protein 2, partial [Pyrus 
x bretschneideri]
Length=623

 Score =   187 bits (476),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 105/134 (78%), Gaps = 0/134 (0%)
 Frame = +1

Query  322  CGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICLMDCPIPSEDSLNWVCD  501
            CG +++ P+L +  ++YW NPN+V Q+G K + ++L +ARSICL +CPIPS+++LNWVCD
Sbjct  1    CGGKNSRPDLQQFQVKYWQNPNQVSQTGLKKNPIRLDDARSICLKECPIPSDEALNWVCD  60

Query  502  YPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIFPSVNVYWSCQFIARAS  681
            YPEG I L ++ W+DRNYDY+  L+P  R  SLQLQGPCYPVIFP+ NV W+C+F AR S
Sbjct  61   YPEGRISLTMDEWLDRNYDYYEFLSPPQRNSSLQLQGPCYPVIFPTTNVMWNCEFAARPS  120

Query  682  NVSLRHWKEMGGIE  723
            N SLR WK MGG+E
Sbjct  121  NFSLRFWKNMGGME  134



>ref|XP_008810450.1| PREDICTED: choline transporter-like protein 2 isoform X2 [Phoenix 
dactylifera]
 ref|XP_008810452.1| PREDICTED: choline transporter-like protein 2 isoform X2 [Phoenix 
dactylifera]
 ref|XP_008810453.1| PREDICTED: choline transporter-like protein 2 isoform X2 [Phoenix 
dactylifera]
Length=581

 Score =   167 bits (422),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 70/90 (78%), Positives = 83/90 (92%), Gaps = 0/90 (0%)
 Frame = +1

Query  454  MDCPIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
            M+CPIPSED LN++CDYPEGDIRL+V++WIDR+YDYF  LTPE+R  SLQLQGPCYP+IF
Sbjct  1    MECPIPSEDGLNFICDYPEGDIRLSVDDWIDRDYDYFEFLTPEMRNSSLQLQGPCYPIIF  60

Query  634  PSVNVYWSCQFIARASNVSLRHWKEMGGIE  723
            PSVNVYWSCQFIAR SN+SLRHW++MGG+ 
Sbjct  61   PSVNVYWSCQFIARPSNISLRHWQQMGGVT  90


 Score = 46.2 bits (108),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  716  GLKIFEDIIIDKAIHRSINSRSSVFKRYVAD  808
            G+ I E+I+IDK IHR+INS S+V KRYVAD
Sbjct  88   GVTIEENILIDKTIHRAINSPSAVLKRYVAD  118



>ref|XP_002500718.1| choline transporter like family [Micromonas sp. RCC299]
 gb|ACO61976.1| choline transporter like family [Micromonas sp. RCC299]
Length=700

 Score =   145 bits (367),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 68/179 (38%), Positives = 103/179 (58%), Gaps = 13/179 (7%)
 Frame = +1

Query  175  IKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADPNLH  354
            +  NR+C DV+FLL+++AF +   +    GF  G+P  L YG DY+GN+C +        
Sbjct  1    MNRNRRCTDVLFLLLYVAFMIVFFIIGIVGFTGGDPRILLYGTDYEGNLCTE--------  52

Query  355  ELDLRYWLNPNEVYQSGPKDSDVKLPNARSICLMDCPIPSEDSLNWVCDYPE-----GDI  519
            +L +RYW+NP E+Y+         + + +SICL DCP      LNWVC+YP+     G  
Sbjct  53   DLPVRYWVNPLEIYELTQATHTYDMKDVKSICLKDCPSTGASGLNWVCNYPDSVDGRGYA  112

Query  520  RLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIFPSVNVYWSCQFIARASNVSLR  696
             +    W   NYDY++ L+ +L+K SL  +GPCYPV+ P+VN Y SC +   +S  ++ 
Sbjct  113  GMTRAEWAANNYDYYSSLSADLKKDSLNNKGPCYPVLLPTVNNYESCTYYGNSSATAVT  171



>ref|XP_003064404.1| choline transporter like family [Micromonas pusilla CCMP1545]
 gb|EEH51309.1| choline transporter like family [Micromonas pusilla CCMP1545]
Length=716

 Score =   140 bits (354),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 66/186 (35%), Positives = 112/186 (60%), Gaps = 17/186 (9%)
 Frame = +1

Query  160  SGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHA  339
            +G+  ++ NR+C DV+F LIF+AFWV M+   ++GF++G+P  L YG DY+GN+CG    
Sbjct  14   TGEEYMEKNRRCTDVLFTLIFLAFWVGMVYAGAYGFSKGDPRILVYGTDYQGNLCG----  69

Query  340  DPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICLMDCPIPSEDSLNWVCDYPEG--  513
               L +  +RY++NP EV ++G   +   + +A+SICL  CP  S  +L+WVC+YP+   
Sbjct  70   KGALEDFKVRYFVNPYEVLEAG-NTAGANIKDAKSICLKACPAAS-STLSWVCNYPDSLD  127

Query  514  --------DIRLAVENWIDRNYDYFADLTPELRKKSLQL-QGPCYPVIFPSVNVYWSCQF  666
                        + + W   NYDY++ +T    + + ++ +GPCYPV+ P+   Y +C +
Sbjct  128  SRGLNAITSTTTSYDQWAAMNYDYYSSITTGSHQANSRVYKGPCYPVLLPTTESYGTCSY  187

Query  667  IARASN  684
             A+ ++
Sbjct  188  YAKQTS  193



>ref|XP_001422243.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABP00560.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=687

 Score =   136 bits (342),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 101/179 (56%), Gaps = 21/179 (12%)
 Frame = +1

Query  187  RKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADPNLHELDL  366
            RKC D++FL++FIAFW+AM+V   +G   G P  L +G DY+G VC     D        
Sbjct  1    RKCTDILFLIVFIAFWIAMLVLGFYGVGTGKPKILLFGTDYRGEVCDQGKND----GFKT  56

Query  367  RYWLNPNEVY--------QSGPKDSDVKLPNARSICLMDCPIP--SEDSLNWVCDYPEGD  516
            RY++NP E+         QS        L +A+SICL +CP P  +  S+ +VCDYPE D
Sbjct  57   RYFMNPGELAWAAGVHTDQSASATRKYNLRDAKSICLKECPKPTMTASSVAFVCDYPE-D  115

Query  517  IRLAVE------NWIDRNYDYFADLTPELRKKSLQLQGPCYPVIFPSVNVYWSCQFIAR  675
            + +A +       W+  NYDY+  L+   +  SL+  GPCYPV++ SVN +++CQ   R
Sbjct  116  VTIASQPNYDKNQWVADNYDYYQYLSGPQKTSSLKWMGPCYPVLYESVNTFYTCQLFVR  174



>gb|KJB13393.1| hypothetical protein B456_002G072200 [Gossypium raimondii]
Length=555

 Score =   120 bits (301),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +1

Query  529  VENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIFPSVNVYWSCQFIARASNVSLRHWKE  708
            +++WIDRNYDY+  LTPE++  SLQLQGPCYPVIFPSVNVYWSCQ+IARASN SLRHWK+
Sbjct  1    MDDWIDRNYDYYEILTPEMKNASLQLQGPCYPVIFPSVNVYWSCQYIARASNASLRHWKQ  60

Query  709  MGGIE  723
            MGG++
Sbjct  61   MGGVD  65


 Score = 46.6 bits (109),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  716  GLKIFEDIIIDKAIHRSINSRSSVFKRYVAD  808
            G+ I EDI++DK+IH  INSRSSV KRY+AD
Sbjct  63   GVDIKEDIVVDKSIHSFINSRSSVLKRYMAD  93



>ref|XP_007511067.1| predicted protein [Bathycoccus prasinos]
 emb|CCO66627.1| predicted protein [Bathycoccus prasinos]
Length=757

 Score =   134 bits (337),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 82/220 (37%), Positives = 115/220 (52%), Gaps = 30/220 (14%)
 Frame = +1

Query  130  PSSDGNGEVSSGDGIIKH-NRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLD  306
            P +D +G    GD  I+   R+C DV+FLL FIAFWV M+    +GF  G+P  L  G D
Sbjct  20   PDADPHG----GDDFIEGGKRRCTDVLFLLAFIAFWVGMLACGGYGFTNGDPALLIMGTD  75

Query  307  YKGNVCGDR------HADPNLHE---LDLRYWLNPNEVYQ---------SGPK--DSDVK  426
            Y+G +C ++          N+ +   L  RYW N  EV           + P    S   
Sbjct  76   YEGVLCDEKGTGVAGTGSGNVIDNSGLKTRYWANFLEVAAVARSAAVAATTPSFASSSYT  135

Query  427  LPNARSICLMDCPIPSEDS--LNWVCDYPEGD---IRLAVENWIDRNYDYFADLTPELRK  591
            L +A+S+C+  CP PSE +  + W CDYPE +    +L  E W  +N D ++DLT   + 
Sbjct  136  LADAKSMCVSTCPQPSETAGQVTWFCDYPESNSYAAQLTKEAWKTKNGDVYSDLTDAEKV  195

Query  592  KSLQLQGPCYPVIFPSVNVYWSCQFIARASNVSLRHWKEM  711
             SLQL+GPCYPV+ PSVN Y+SC +    S  S   +  +
Sbjct  196  TSLQLKGPCYPVLIPSVNTYFSCNYYGNFSQSSFDAFTAL  235



>gb|EEE61921.1| hypothetical protein OsJ_16656 [Oryza sativa Japonica Group]
Length=565

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 76/117 (65%), Gaps = 1/117 (1%)
 Frame = +1

Query  283  LRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICLMDC  462
            L LTY LDYKGN+CG RH DP+LHELD+RYW+NPN+VYQSG KD+ + L +A++ICLM+C
Sbjct  40   LGLTYELDYKGNICGSRHGDPDLHELDVRYWMNPNQVYQSGVKDNKINLADAKAICLMEC  99

Query  463  PIPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
            PIP+ D LN+      G I +     ID+      +    + K+ +   G  +PV+ 
Sbjct  100  PIPAADGLNFHWQ-QMGGINIDENILIDKTIHKAINSKSSVLKRYVADIGKSWPVLI  155



>emb|CEG00747.1| Choline transporter-like [Ostreococcus tauri]
Length=722

 Score =   116 bits (290),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 63/189 (33%), Positives = 104/189 (55%), Gaps = 13/189 (7%)
 Frame = +1

Query  166  DGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADP  345
            D  +K  R+C D++FL++++AFW+AM     +G  +G+P  L +G D+ G +CG    + 
Sbjct  6    DAHLKKPRRCTDILFLIVYVAFWIAMFALGFYGVGKGDPTALVFGADFNGELCG----EG  61

Query  346  NLHELDLRYWLNPNEV-YQSGPKDSDVKLPN-----ARSICLMDCPIPSEDS--LNWVCD  501
            N      RY +NP EV Y +G  D   ++ N     A+S C+ +CP P   S  + W C 
Sbjct  62   NNTGFKTRYLVNPLEVMYAAGALDGTTRMGNYNLRDAKSYCVKECPTPKNTSGQVQWFCS  121

Query  502  YPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIFPSVNVYWSCQFIARAS  681
             P+  +    ENW   +YDY++ L+   +  S Q++GPCYPV+  +VN +++CQF     
Sbjct  122  -PDHALAGTRENWAANDYDYYSSLSSSEKTTSQQMKGPCYPVLVNTVNTFFTCQFFGSGD  180

Query  682  NVSLRHWKE  708
            + +L   + 
Sbjct  181  DHALTELRS  189



>emb|CAJ86279.1| H0901F07.16 [Oryza sativa Indica Group]
 emb|CAJ86287.1| H0124B04.4 [Oryza sativa Indica Group]
 gb|EAY96083.1| hypothetical protein OsI_17957 [Oryza sativa Indica Group]
 gb|EAZ32446.1| hypothetical protein OsJ_16657 [Oryza sativa Japonica Group]
Length=104

 Score = 85.1 bits (209),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 55/75 (73%), Gaps = 9/75 (12%)
 Frame = +1

Query  94   MRGPLGAVIGKYPSSDGNGEVSSGDG---------IIKHNRKCRDVVFLLIFIAFWVAMI  246
            M GPLGA+IG++P++ G G      G         II+HNR+CRD+ FL++F AFWVAMI
Sbjct  1    MGGPLGAIIGRHPAAAGGGGEDELGGGGGGGDGGGIIRHNRRCRDLAFLVLFAAFWVAMI  60

Query  247  VNSSFGFNQGNPLRL  291
            VNSSFGFNQGNPLR+
Sbjct  61   VNSSFGFNQGNPLRI  75



>emb|CDY20115.1| BnaA01g28870D [Brassica napus]
Length=222

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +1

Query  583  LRKKSLQLQGPCYPVIFPSVNVYWSCQFIARASNVSLRHWKEMGGI  720
            +R  SLQLQG CYP+IFPSVNVYWSCQ+IARASN+SL HW++M G+
Sbjct  1    MRNSSLQLQGLCYPLIFPSVNVYWSCQYIARASNLSLSHWQKMNGV  46



>ref|XP_003084176.1| Choline transporter-like protein (ISS) [Ostreococcus tauri]
Length=698

 Score = 82.0 bits (201),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 50/153 (33%), Positives = 80/153 (52%), Gaps = 13/153 (8%)
 Frame = +1

Query  274  GNPLRLTYGLDYKGNVCGDRHADPNLHELDLRYWLNPNEV-YQSGPKDSDVKLPN-----  435
            G+P  L +G D+ G +CG+     N      RY +NP EV Y +G  D   ++ N     
Sbjct  18   GDPTALVFGADFNGELCGE----GNNTGFKTRYLVNPLEVMYAAGALDGTTRMGNYNLRD  73

Query  436  ARSICLMDCPIPSEDS--LNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQ  609
            A+S C+ +CP P   S  + W C  P+  +    ENW   +YDY++ L+   +  S Q++
Sbjct  74   AKSYCVKECPTPKNTSGQVQWFCS-PDHALAGTRENWAANDYDYYSSLSSSEKTTSQQMK  132

Query  610  GPCYPVIFPSVNVYWSCQFIARASNVSLRHWKE  708
            GPCYPV+  +VN +++CQF     + +L   + 
Sbjct  133  GPCYPVLVNTVNTFFTCQFFGSGDDHALTELRS  165



>ref|XP_003062745.1| choline transporter like family [Micromonas pusilla CCMP1545]
 gb|EEH52684.1| choline transporter like family [Micromonas pusilla CCMP1545]
Length=687

 Score = 78.2 bits (191),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 49/175 (28%), Positives = 82/175 (47%), Gaps = 25/175 (14%)
 Frame = +1

Query  166  DGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADP  345
            +G+I  NR+C DV+FLLIF AF V M++     F +G+P  L YG+D    +CG + +  
Sbjct  14   EGLIT-NRRCTDVLFLLIFSAFMVGMVIVGYTAFTEGDPNLLAYGIDSSAYLCGTKASKT  72

Query  346  --------NLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICLMDCPIP----------  471
                       +   R +L+ + V   GP      + +A+S+C+  CP+           
Sbjct  73   WTSDAAASAAPDFSTRKYLHWSRVQDYGP-----NMASAQSVCVESCPVATITTEGSTSL  127

Query  472  SEDSLNWVCD-YPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIF  633
            ++ S  + C  Y +  +   +    D + +Y+A L    +  S   +GPCYP  F
Sbjct  128  TQSSQTYTCQYYIKSSVAGTLSGVGDWDVNYYAKLASAQQTTSNNGEGPCYPNFF  182



>ref|XP_009516634.1| hypothetical protein PHYSODRAFT_309744 [Phytophthora sojae]
 gb|EGZ29359.1| hypothetical protein PHYSODRAFT_309744 [Phytophthora sojae]
Length=747

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 55/188 (29%), Positives = 84/188 (45%), Gaps = 36/188 (19%)
 Frame = +1

Query  181  HNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGD-RHAD-----  342
            ++R+CRDV+ +L+F  FWV M+  +  GF  G P RL +G DY G  CG  +H D     
Sbjct  25   NSRRCRDVLCVLLFAVFWVGMVAIAIVGFMHGEPKRLLFGSDYNGTTCGTGKHEDQPLTF  84

Query  343  -PNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICLMDCPIPSEDSLNWVCDYP----  507
             P + +  L    NP+      P+D          +C+  CP    D+  ++C+Y     
Sbjct  85   YPRITQDLLEQAANPSL----APEDFSF-----YGVCVASCP----DAGTYICNYEAEAE  131

Query  508  -EGDIRLAVENWIDRNYDYFADLTPELRKKSLQL---QGPCYPVIFPSVNVYWSCQFIAR  675
             +GD  L  E   DR  +  A      R  SL +      C+ V  PS  V++ C  I  
Sbjct  132  IQGDSSLTTEE--DREKERKA------RATSLTVLPSDRECWLVALPSEQVFYRCLQITE  183

Query  676  ASNVSLRH  699
             ++ S+  
Sbjct  184  TNSTSVEK  191



>gb|ETM54103.1| hypothetical protein L914_02512 [Phytophthora parasitica]
Length=745

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/198 (27%), Positives = 85/198 (43%), Gaps = 32/198 (16%)
 Frame = +1

Query  184  NRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGD-RHADPNLHEL  360
            +RKCRDV+  L+F  FWV MI  ++ GF  G P RL YG DY G  CG  +  D     L
Sbjct  26   SRKCRDVICALLFAVFWVGMIAIAAVGFRHGEPKRLLYGSDYNGTTCGTGKQQD---QPL  82

Query  361  DLRYWLNPNEVYQSGPKDSDVKLPNARSICLMDCPIPSEDSLNWVCDYPEGDIRLAVENW  540
                 +  + + Q+      V   +   +C+  CP    D+  ++C+Y         E  
Sbjct  83   TFYPRITQDLLEQASNPALSVDDFSFYGVCVATCP----DAGTYICNYE-------AEAE  131

Query  541  IDRNYDYFADLTPELRKKS-------LQLQGPCYPVIFPSVNVYWSCQFIARASNVSL--  693
            I  +     D   E  +KS       L  +  C+ V  PS  V++ C  I   ++ S+  
Sbjct  132  IQSDTSLTTDKEREQERKSRATDFIILPSEKQCWLVALPSEKVFYRCLQITELNSTSIEK  191

Query  694  --------RHWKEMGGIE  723
                     +++E+ G++
Sbjct  192  CVVPGDEPEYYEELNGVQ  209



>gb|ETL47813.1| hypothetical protein L916_02488 [Phytophthora parasitica]
 gb|ETP24399.1| hypothetical protein F441_02595 [Phytophthora parasitica CJ01A1]
Length=745

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 54/198 (27%), Positives = 85/198 (43%), Gaps = 32/198 (16%)
 Frame = +1

Query  184  NRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGD-RHADPNLHEL  360
            +RKCRDV+  L+F  FWV MI  ++ GF  G P RL YG DY G  CG  +  D     L
Sbjct  26   SRKCRDVICALLFAVFWVGMIAIAAVGFMHGEPKRLLYGSDYNGTTCGTGKQQD---QPL  82

Query  361  DLRYWLNPNEVYQSGPKDSDVKLPNARSICLMDCPIPSEDSLNWVCDYPEGDIRLAVENW  540
                 +  + + Q+      V   +   +C+  CP    D+  ++C+Y         E  
Sbjct  83   TFYPRITQDLLEQASNPALSVDDFSFYGVCVATCP----DAGTYICNYE-------AEAE  131

Query  541  IDRNYDYFADLTPELRKKS-------LQLQGPCYPVIFPSVNVYWSCQFIARASNVSL--  693
            I  +     D   E  +KS       L  +  C+ V  PS  V++ C  I   ++ SL  
Sbjct  132  IQSDTSLTTDKEREQERKSRATDFIILPSEKQCWLVALPSEKVFYRCLQITELNSTSLEK  191

Query  694  --------RHWKEMGGIE  723
                     +++E+ G++
Sbjct  192  CVVPGDEPEYYEEVNGVQ  209



>gb|ETI54567.1| hypothetical protein F443_02632 [Phytophthora parasitica P1569]
Length=745

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/198 (27%), Positives = 85/198 (43%), Gaps = 32/198 (16%)
 Frame = +1

Query  184  NRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGD-RHADPNLHEL  360
            +RKCRDV+  L+F  FWV MI  ++ GF  G P RL YG DY G  CG  +  D     L
Sbjct  26   SRKCRDVICALLFAVFWVGMIAIAAVGFRHGEPKRLLYGSDYNGTTCGTGKQQD---QPL  82

Query  361  DLRYWLNPNEVYQSGPKDSDVKLPNARSICLMDCPIPSEDSLNWVCDYPEGDIRLAVENW  540
                 +  + + Q+      V   +   +C+  CP    D+  ++C+Y         E  
Sbjct  83   TFYPRITQDLLEQASNPALSVDDFSFYGVCVATCP----DAGTYICNYE-------AEAE  131

Query  541  IDRNYDYFADLTPELRKKS-------LQLQGPCYPVIFPSVNVYWSCQFIARASNVSL--  693
            I  +     D   E  +KS       L  +  C+ V  PS  V++ C  I   ++ S+  
Sbjct  132  IQSDTSLTTDKEREQERKSRATDFIILPSEKQCWLVALPSEKVFYRCLQITELNSTSIEK  191

Query  694  --------RHWKEMGGIE  723
                     +++E+ G++
Sbjct  192  CVVPGDEPEYYEELNGVQ  209



>ref|XP_008915924.1| hypothetical protein PPTG_19332 [Phytophthora parasitica INRA-310]
 gb|ETM98785.1| hypothetical protein PPTG_19332 [Phytophthora parasitica INRA-310]
Length=745

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/198 (27%), Positives = 85/198 (43%), Gaps = 32/198 (16%)
 Frame = +1

Query  184  NRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGD-RHADPNLHEL  360
            +RKCRDV+  L+F  FWV MI  ++ GF  G P RL YG DY G  CG  +  D     L
Sbjct  26   SRKCRDVICALLFAVFWVGMIAIAAVGFMHGEPKRLLYGSDYNGTTCGTGKQQD---QPL  82

Query  361  DLRYWLNPNEVYQSGPKDSDVKLPNARSICLMDCPIPSEDSLNWVCDYPEGDIRLAVENW  540
                 +  + + Q+      V   +   +C+  CP    D+  ++C+Y         E  
Sbjct  83   TFYPRITQDLLEQASNPALSVDDFSFYGVCVATCP----DAGTYICNYE-------AEAE  131

Query  541  IDRNYDYFADLTPELRKKS-------LQLQGPCYPVIFPSVNVYWSCQFIARASNVSL--  693
            I  +     D   E  +KS       L  +  C+ V  PS  V++ C  I   ++ S+  
Sbjct  132  IQSDTSLTTDKEREQERKSRATDFIILSSEKQCWLVALPSEKVFYRCLQITELNSTSIEK  191

Query  694  --------RHWKEMGGIE  723
                     +++E+ G++
Sbjct  192  CVVPGDEPEYYEEVNGVQ  209



>gb|ETK94437.1| hypothetical protein L915_02517 [Phytophthora parasitica]
Length=745

 Score = 72.8 bits (177),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 53/198 (27%), Positives = 85/198 (43%), Gaps = 32/198 (16%)
 Frame = +1

Query  184  NRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGD-RHADPNLHEL  360
            +RKCRDV+  L+F  FWV MI  ++ GF  G P RL YG DY G  CG  +  D     L
Sbjct  26   SRKCRDVICALLFAVFWVGMIAIAAVGFMHGEPKRLLYGSDYNGTTCGTGKQQD---QPL  82

Query  361  DLRYWLNPNEVYQSGPKDSDVKLPNARSICLMDCPIPSEDSLNWVCDYPEGDIRLAVENW  540
                 +  + + Q+      V   +   +C+  CP    D+  ++C+Y         E  
Sbjct  83   TFYPRITQDLLEQASNPALSVDDFSFYGVCVATCP----DAGTYICNYE-------AEAE  131

Query  541  IDRNYDYFADLTPELRKKS-------LQLQGPCYPVIFPSVNVYWSCQFIARASNVSL--  693
            I  +     D   E  +KS       L  +  C+ V  PS  V++ C  I   ++ S+  
Sbjct  132  IQSDTSLTTDKEREQERKSRATDFIILPSEKQCWLVALPSEKVFYRCLQITELNSTSIEK  191

Query  694  --------RHWKEMGGIE  723
                     +++E+ G++
Sbjct  192  CVVPGDEPEYYEEVNGVQ  209



>gb|ETO83324.1| hypothetical protein F444_02633 [Phytophthora parasitica P1976]
Length=745

 Score = 72.8 bits (177),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 53/198 (27%), Positives = 85/198 (43%), Gaps = 32/198 (16%)
 Frame = +1

Query  184  NRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGD-RHADPNLHEL  360
            +RKCRDV+  L+F  FWV MI  ++ GF  G P RL YG DY G  CG  +  D     L
Sbjct  26   SRKCRDVICALLFAVFWVGMIAIAAVGFMHGEPKRLLYGSDYNGTTCGTGKQQD---QPL  82

Query  361  DLRYWLNPNEVYQSGPKDSDVKLPNARSICLMDCPIPSEDSLNWVCDYPEGDIRLAVENW  540
                 +  + + Q+      V   +   +C+  CP    D+  ++C+Y         E  
Sbjct  83   TFYPRITQDLLEQASNPALSVDDFSFYGVCVATCP----DAGTYICNYE-------AEAE  131

Query  541  IDRNYDYFADLTPELRKKS-------LQLQGPCYPVIFPSVNVYWSCQFIARASNVSL--  693
            I  +     D   E  +KS       L  +  C+ V  PS  V++ C  I   ++ S+  
Sbjct  132  IQSDTSLTTDKEREQERKSRATDFIILPSEKQCWLVALPSEKVFYRCLQITELNSTSIEK  191

Query  694  --------RHWKEMGGIE  723
                     +++E+ G++
Sbjct  192  CVVPGDEPEYYEEVNGVQ  209



>gb|ETM00927.1| hypothetical protein L917_02423 [Phytophthora parasitica]
Length=745

 Score = 72.8 bits (177),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 53/198 (27%), Positives = 85/198 (43%), Gaps = 32/198 (16%)
 Frame = +1

Query  184  NRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGD-RHADPNLHEL  360
            +RKCRDV+  L+F  FWV MI  ++ GF  G P RL YG DY G  CG  +  D     L
Sbjct  26   SRKCRDVICALLFAVFWVGMIAIAAVGFMHGEPKRLLYGSDYNGTTCGTGKQQD---QPL  82

Query  361  DLRYWLNPNEVYQSGPKDSDVKLPNARSICLMDCPIPSEDSLNWVCDYPEGDIRLAVENW  540
                 +  + + Q+      V   +   +C+  CP    D+  ++C+Y         E  
Sbjct  83   TFYPRITQDLLEQASNPALSVDDFSFYGVCVATCP----DAGTYICNYE-------AEAE  131

Query  541  IDRNYDYFADLTPELRKKS-------LQLQGPCYPVIFPSVNVYWSCQFIARASNVSL--  693
            I  +     D   E  +KS       L  +  C+ V  PS  V++ C  I   ++ S+  
Sbjct  132  IQSDTSLTTDKEREQERKSRATDFIILPSEKQCWLVALPSEKVFYRCLQITELNSTSIEK  191

Query  694  --------RHWKEMGGIE  723
                     +++E+ G++
Sbjct  192  CVVPGDEPEYYEEVNGVQ  209



>gb|ETP52373.1| hypothetical protein F442_02611 [Phytophthora parasitica P10297]
Length=745

 Score = 72.8 bits (177),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 53/198 (27%), Positives = 85/198 (43%), Gaps = 32/198 (16%)
 Frame = +1

Query  184  NRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGD-RHADPNLHEL  360
            +RKCRDV+  L+F  FWV MI  ++ GF  G P RL YG DY G  CG  +  D     L
Sbjct  26   SRKCRDVICALLFAVFWVGMIAIAAVGFMHGEPKRLLYGSDYNGTTCGTGKQQD---QPL  82

Query  361  DLRYWLNPNEVYQSGPKDSDVKLPNARSICLMDCPIPSEDSLNWVCDYPEGDIRLAVENW  540
                 +  + + Q+      V   +   +C+  CP    D+  ++C+Y         E  
Sbjct  83   TFYPRITQDLLEQASNPALSVDDFSFYGVCVATCP----DAGTYICNYE-------AEAE  131

Query  541  IDRNYDYFADLTPELRKKS-------LQLQGPCYPVIFPSVNVYWSCQFIARASNVSL--  693
            I  +     D   E  +KS       L  +  C+ V  PS  V++ C  I   ++ S+  
Sbjct  132  IQSDTSLTTDKEREQERKSRATDFIILPSEKQCWLVALPSEKVFYRCLQITELNSTSIEK  191

Query  694  --------RHWKEMGGIE  723
                     +++E+ G++
Sbjct  192  CVVPGDEPEYYEEVNGVQ  209



>ref|XP_002952038.1| hypothetical protein VOLCADRAFT_121040 [Volvox carteri f. nagariensis]
 gb|EFJ46829.1| hypothetical protein VOLCADRAFT_121040 [Volvox carteri f. nagariensis]
Length=791

 Score = 72.4 bits (176),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 57/228 (25%), Positives = 91/228 (40%), Gaps = 62/228 (27%)
 Frame = +1

Query  142  GNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNV  321
            G+ +  + +G +   R+CRDV+ LL+FIAFW  M V   F F +G P R+ YG+D  G  
Sbjct  5    GDDDADTKEGFVVK-RRCRDVLCLLLFIAFWAGMFVICGFAFKEGEPNRVLYGVDSFGMT  63

Query  322  CGDRHADPNL----HELDLRYWLNPNEVYQSGPKDSDVKLPNARSICLMDCP--------  465
            CG ++   N+     +    YWLNP ++       S   +  A++IC   CP        
Sbjct  64   CGSKNKIFNVTFDFSDAKNLYWLNPLDLL------SISGISYAKTICAASCPGASQQCSA  117

Query  466  --IPSEDSLNWVCDY---PEGDIRLAVENWIDRNYDY-----------------------  561
              +P ++   + C Y    E ++   +    D +  Y                       
Sbjct  118  DNLPCQNGAKFTCPYYRFAEDNLYGLIPGVSDADTSYWSELALVTNITDSSASSFLSKLD  177

Query  562  -----FADLTPELRKKSLQL----------QGPCYPVIFPSVNVYWSC  660
                 F+ L  +LR     L           GPCYP +F +   ++ C
Sbjct  178  SLGGAFSTLAAQLRANFSGLYYQTQSQFPGNGPCYPNLFETSGFFYRC  225



>ref|XP_008861285.1| hypothetical protein H310_00321 [Aphanomyces invadans]
 gb|ETW09874.1| hypothetical protein H310_00321 [Aphanomyces invadans]
Length=781

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 43/77 (56%), Gaps = 4/77 (5%)
 Frame = +1

Query  130  PSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDY  309
            P+ D  G    G      NRKC D++  L+F+ FW+ MIV S   F +G P RL YG+D+
Sbjct  27   PTPDNGG----GTSFQTSNRKCTDILCTLLFVVFWIGMIVISVIAFTRGKPERLAYGMDF  82

Query  310  KGNVCGDRHADPNLHEL  360
            KG +CG   + P +  +
Sbjct  83   KGRICGTSGSTPGISSV  99



>ref|XP_009533495.1| hypothetical protein PHYSODRAFT_317831 [Phytophthora sojae]
 gb|EGZ10750.1| hypothetical protein PHYSODRAFT_317831 [Phytophthora sojae]
Length=819

 Score = 68.9 bits (167),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 37/125 (30%), Positives = 59/125 (47%), Gaps = 14/125 (11%)
 Frame = +1

Query  151  EVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGD  330
            E++S +    +NRKC DV+ LL F+ FW+ MI+ +  G+  G P RL YG D+ G  CG 
Sbjct  30   ELASTNPFRPNNRKCTDVLCLLFFVVFWIGMIIIAGVGYQHGKPQRLIYGTDWMGRTCGA  89

Query  331  RHAD----PNLHELDLRYWLNPN------EVYQSGPKDSDVKLPNAR----SICLMDCPI  468
            +       P     D +Y + P        +  SG     +  P+       +C+  CP+
Sbjct  90   KAEKTDNVPAYDFTDYKYMIYPRLSEDLMALAASGLSTKQLASPSTLRKLFGVCVSSCPL  149

Query  469  PSEDS  483
             +E +
Sbjct  150  LTEST  154



>gb|EFA82487.1| solute carrier family 44 protein member 2 [Polysphondylium pallidum 
PN500]
Length=623

 Score = 68.9 bits (167),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 62/128 (48%), Gaps = 16/128 (13%)
 Frame = +1

Query  145  NGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVC  324
            + EV    G+    RKC D +FL++F+AFW  M V + +G  +G+P RL YG DY+GN C
Sbjct  12   STEVIKNKGVYS-KRKCHDCLFLILFLAFWAGMAVVAHYGIKEGDPKRLLYGTDYEGNTC  70

Query  325  G-DRHADPNL---HELDLRYWLNPNEVYQSGPKDSDVKLPNARSICLMDCP----IPSED  480
            G D  A   L   H  D  +      +Y          L + R+IC+  CP    +  +D
Sbjct  71   GVDNIAAGKLPANHSRDFTHEKYVYFIYYP-------SLASYRTICVSSCPNETYLTPDD  123

Query  481  SLNWVCDY  504
                +C Y
Sbjct  124  PSQLICAY  131



>gb|ETI31494.1| hypothetical protein F443_21539 [Phytophthora parasitica P1569]
Length=811

 Score = 68.9 bits (167),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 40/127 (31%), Positives = 62/127 (49%), Gaps = 16/127 (13%)
 Frame = +1

Query  151  EVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGD  330
            EVSS +    +NR+C DV+ LL F+ FW+ MIV +  G+  G P RL YG D+ G  CG 
Sbjct  28   EVSSTNPFKPNNRRCTDVLCLLFFVVFWIGMIVIAGVGYKHGKPQRLIYGTDWMGRTCGA  87

Query  331  RHAD-----PNLHELDLRYWLNP------NEVYQSGPKDSDVKLPNAR----SICLMDCP  465
            + AD     P     D +Y + P        +  +G     +  P+       +C+  CP
Sbjct  88   Q-ADKTDTVPAYDFTDYKYMIYPRLSEDLKTLAAAGYTAKQLANPSTLRKLFGVCVPSCP  146

Query  466  IPSEDSL  486
            + +++ L
Sbjct  147  LITDNDL  153



>dbj|GAM18465.1| hypothetical protein SAMD00019534_016400, partial [Acytostelium 
subglobosum LB1]
Length=629

 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 64/127 (50%), Gaps = 18/127 (14%)
 Frame = +1

Query  151  EVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGD  330
            EV    G+    RKC D  FLL+FIAFW  MI+ + +G  +G+P RL YG DY+GN CG 
Sbjct  22   EVIRNKGVYA-KRKCHDCFFLLLFIAFWAGMIIVAVYGLREGDPKRLLYGTDYQGNTCGI  80

Query  331  RHAD----PNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICLMDCP-----IPSEDS  483
             +      P+ +  D   + N   VY          L + R+IC+  CP     IPS ++
Sbjct  81   DNVKAGKIPSNYSKD---FTNEKYVYFIYYP----LLTSYRAICVNQCPTVTYLIPSNET  133

Query  484  LNWVCDY  504
               +C Y
Sbjct  134  -ELICAY  139



>gb|ETL78534.1| hypothetical protein L917_20669 [Phytophthora parasitica]
 gb|ETM31798.1| hypothetical protein L914_20685 [Phytophthora parasitica]
 gb|ETP01309.1| hypothetical protein F441_21423 [Phytophthora parasitica CJ01A1]
Length=811

 Score = 68.6 bits (166),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 40/127 (31%), Positives = 62/127 (49%), Gaps = 16/127 (13%)
 Frame = +1

Query  151  EVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGD  330
            EVSS +    +NR+C DV+ LL F+ FW+ MIV +  G+  G P RL YG D+ G  CG 
Sbjct  28   EVSSTNPFKPNNRRCTDVLCLLFFVVFWIGMIVIAGVGYKHGKPQRLIYGTDWMGRTCGA  87

Query  331  RHAD-----PNLHELDLRYWLNP------NEVYQSGPKDSDVKLPNAR----SICLMDCP  465
            + AD     P     D +Y + P        +  +G     +  P+       +C+  CP
Sbjct  88   Q-ADKTDTVPAYDFTDYKYMIYPRLSEDLKTLAAAGYTAKQLANPSTLRKLFGVCVPSCP  146

Query  466  IPSEDSL  486
            + +++ L
Sbjct  147  LITDNDL  153



>ref|XP_008898417.1| hypothetical protein PPTG_06268 [Phytophthora parasitica INRA-310]
 gb|ETN16037.1| hypothetical protein PPTG_06268 [Phytophthora parasitica INRA-310]
Length=811

 Score = 68.6 bits (166),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 40/127 (31%), Positives = 62/127 (49%), Gaps = 16/127 (13%)
 Frame = +1

Query  151  EVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGD  330
            EVSS +    +NR+C DV+ LL F+ FW+ MIV +  G+  G P RL YG D+ G  CG 
Sbjct  28   EVSSTNPFKPNNRRCTDVLCLLFFVVFWIGMIVIAGVGYKHGKPQRLIYGTDWMGRTCGA  87

Query  331  RHAD-----PNLHELDLRYWLNP------NEVYQSGPKDSDVKLPNAR----SICLMDCP  465
            + AD     P     D +Y + P        +  +G     +  P+       +C+  CP
Sbjct  88   Q-ADKTDTVPAYDFTDYKYMIYPRLSEDLKTLAAAGYTAKQLANPSTLRKLFGVCVPSCP  146

Query  466  IPSEDSL  486
            + +++ L
Sbjct  147  LITDNDL  153



>gb|ETK71881.1| hypothetical protein L915_20937 [Phytophthora parasitica]
 gb|ETL25311.1| hypothetical protein L916_20818 [Phytophthora parasitica]
Length=811

 Score = 68.6 bits (166),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 40/127 (31%), Positives = 62/127 (49%), Gaps = 16/127 (13%)
 Frame = +1

Query  151  EVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGD  330
            EVSS +    +NR+C DV+ LL F+ FW+ MIV +  G+  G P RL YG D+ G  CG 
Sbjct  28   EVSSTNPFKPNNRRCTDVLCLLFFVVFWIGMIVIAGVGYKHGKPQRLIYGTDWMGRTCGA  87

Query  331  RHAD-----PNLHELDLRYWLNP------NEVYQSGPKDSDVKLPNAR----SICLMDCP  465
            + AD     P     D +Y + P        +  +G     +  P+       +C+  CP
Sbjct  88   Q-ADKTDTVPAYDFTDYKYMIYPRLSEDLKTLAAAGYTAKQLANPSTLRKLFGVCVPSCP  146

Query  466  IPSEDSL  486
            + +++ L
Sbjct  147  LITDNDL  153



>ref|XP_009822172.1| hypothetical protein H257_00933 [Aphanomyces astaci]
 gb|ETV87309.1| hypothetical protein H257_00933 [Aphanomyces astaci]
Length=784

 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/131 (30%), Positives = 55/131 (42%), Gaps = 15/131 (11%)
 Frame = +1

Query  133  SSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYK  312
            +S G      G      NRKC D++  L+F+ FW  MI  S   F +G P RL YG+D+K
Sbjct  25   ASPGGDNTGGGASFQTSNRKCTDILCTLLFVVFWAGMIAISVVAFTRGKPERLAYGMDFK  84

Query  313  GNVCGDRHADPNL----HELDLRYWLNPNEVYQS----------GPKDSDVKLPNARSIC  450
            G VCG     P      ++L    +L    + Q            P D +  L     +C
Sbjct  85   GRVCGTSGTTPGATAAPYDLTAYKYLAFPRLAQDLNAIALDPNFTPTDPN-NLKKLYGVC  143

Query  451  LMDCPIPSEDS  483
            +  CP    D+
Sbjct  144  VASCPTSRTDT  154



>ref|XP_005648747.1| DUF580-domain-containing protein, partial [Coccomyxa subellipsoidea 
C-169]
 gb|EIE24203.1| DUF580-domain-containing protein, partial [Coccomyxa subellipsoidea 
C-169]
Length=752

 Score = 67.4 bits (163),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 52/202 (26%), Positives = 86/202 (43%), Gaps = 59/202 (29%)
 Frame = +1

Query  214  LIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHA-----DPNLHELDLRYWL  378
            L +  FW  M+  +   F QG+P RL+YG+D  GN CG ++A      P+L E    Y+L
Sbjct  1    LCYAVFWAGMVYIAVIAFKQGHPARLSYGIDSSGNTCGQKNAWNGGSGPDLTEYKNLYYL  60

Query  379  NPNEVYQSGPKDSDVKLPNARSICLMDC----------PIPSEDSLNWVCDY--------  504
            NP E+      D++  L  ARS+C+ +C           +P   ++ + C Y        
Sbjct  61   NPLELL-----DTNTFL-GARSVCVKECLGTESACSISSLPCRSNVQYRCPYYRLAQDNL  114

Query  505  -----------------------PEGDIRLAVENWIDR-NYDYFADLTPELRKKSLQL--  606
                                     G   + ++   D+   D+F +++  L  + LQL  
Sbjct  115  FGTLNVTEEWSTSYWGSISSTNITAGQCNILLQYLPDKFRADFFGNVSNPLCGEYLQLTS  174

Query  607  ----QGPCYPVIFPSVNVYWSC  660
                +GPCYPV+  +V+ +  C
Sbjct  175  LYPGRGPCYPVLLETVDYFNRC  196



>gb|ETO60218.1| hypothetical protein F444_21552 [Phytophthora parasitica P1976]
Length=811

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 39/127 (31%), Positives = 61/127 (48%), Gaps = 16/127 (13%)
 Frame = +1

Query  151  EVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGD  330
            EVSS +    +NR+C DV+  L F+ FW+ MIV +  G+  G P RL YG D+ G  CG 
Sbjct  28   EVSSTNPFKPNNRRCTDVLCFLFFVVFWIGMIVIAGVGYKHGKPQRLIYGTDWMGRTCGA  87

Query  331  RHAD-----PNLHELDLRYWLNP------NEVYQSGPKDSDVKLPNAR----SICLMDCP  465
            + AD     P     D +Y + P        +  +G     +  P+       +C+  CP
Sbjct  88   Q-ADKTDTVPAYDFTDYKYMIYPRLSEDLKTLAAAGYTAKQLANPSTLRKLFGVCVPSCP  146

Query  466  IPSEDSL  486
            + +++ L
Sbjct  147  LITDNDL  153



>gb|ETP29467.1| hypothetical protein F442_21380 [Phytophthora parasitica P10297]
Length=811

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 39/127 (31%), Positives = 61/127 (48%), Gaps = 16/127 (13%)
 Frame = +1

Query  151  EVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGD  330
            EVSS +    +NR+C DV+  L F+ FW+ MIV +  G+  G P RL YG D+ G  CG 
Sbjct  28   EVSSTNPFKPNNRRCTDVLCFLFFVVFWIGMIVIAGVGYKHGKPQRLIYGTDWMGRTCGA  87

Query  331  RHAD-----PNLHELDLRYWLNP------NEVYQSGPKDSDVKLPNAR----SICLMDCP  465
            + AD     P     D +Y + P        +  +G     +  P+       +C+  CP
Sbjct  88   Q-ADKTDTVPAYDFTDYKYMIYPRLSEDLKTLAAAGYTAKQLANPSTLRKLFGVCVPSCP  146

Query  466  IPSEDSL  486
            + +++ L
Sbjct  147  LITDNDL  153



>ref|XP_009496362.1| hypothetical protein H696_04210 [Fonticula alba]
 gb|KCV68791.1| hypothetical protein H696_04210 [Fonticula alba]
Length=654

 Score = 66.2 bits (160),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 52/106 (49%), Gaps = 25/106 (24%)
 Frame = +1

Query  181  HNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCG--------DRH  336
            H R+CRDV + L+FI +W  M V   F +  G+P RL YG+DY+GNVCG        D  
Sbjct  41   HKRRCRDVFWGLLFILYWAGMAVLGYFAYKHGDPNRLIYGIDYEGNVCGNVDTFTGVDNT  100

Query  337  ADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICLMDCPIPS  474
            A P L  L+L     P+   +             + IC+  CPI S
Sbjct  101  ARPFLQYLEL-----PSPTLR------------GQGICVERCPIES  129



>ref|XP_008612348.1| hypothetical protein SDRG_08250 [Saprolegnia diclina VS20]
 gb|EQC34036.1| hypothetical protein SDRG_08250 [Saprolegnia diclina VS20]
Length=769

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 40/70 (57%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  SDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKG  315
            + G  + + G    K +RKC DV+ LL F+ FW+ M V S   + +G P RL YG+D+KG
Sbjct  16   AKGGQDGTEGSPFKKSSRKCTDVLCLLFFVLFWIGMAVISIVSYTKGQPQRLAYGMDFKG  75

Query  316  NVCGDRHADP  345
             +CG +    
Sbjct  76   RICGTQSTSA  85



>gb|EZA61792.1| CTL-like protein [Cerapachys biroi]
Length=672

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 56/114 (49%), Gaps = 20/114 (18%)
 Frame = +1

Query  187  RKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADPNLHELDL  366
            R C DV +L +F+AFW  MIV ++F    GNP+RL +G D  GN CG ++      EL  
Sbjct  19   RGCTDVFWLCLFLAFWFLMIVIAAFAVVYGNPMRLVHGYDSFGNTCGTKNKKFGSMELSG  78

Query  367  R--------YWLNPNEVYQSGPKDSDVKLPNARSICLMDCPIPSEDSLNWVCDY  504
            +        ++L+ N V QS              IC+  CP  S  S+  +C++
Sbjct  79   QDTSDKPYLFFLDINNVTQS------------LKICVKQCPFRSLKSIEDICNF  120



>ref|XP_011344346.1| PREDICTED: CTL-like protein 1 isoform X1 [Cerapachys biroi]
Length=721

 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 56/114 (49%), Gaps = 20/114 (18%)
 Frame = +1

Query  187  RKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADPNLHELDL  366
            R C DV +L +F+AFW  MIV ++F    GNP+RL +G D  GN CG ++      EL  
Sbjct  68   RGCTDVFWLCLFLAFWFLMIVIAAFAVVYGNPMRLVHGYDSFGNTCGTKNKKFGSMELSG  127

Query  367  R--------YWLNPNEVYQSGPKDSDVKLPNARSICLMDCPIPSEDSLNWVCDY  504
            +        ++L+ N V QS              IC+  CP  S  S+  +C++
Sbjct  128  QDTSDKPYLFFLDINNVTQS------------LKICVKQCPFRSLKSIEDICNF  169



>ref|XP_002046340.1| GJ12843 [Drosophila virilis]
 gb|EDW68682.1| GJ12843 [Drosophila virilis]
Length=694

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 59/129 (46%), Gaps = 30/129 (23%)
 Frame = +1

Query  118  IGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTY  297
            +G   S DG GE S+     K+ R C DV +L I+I FW+ +IV + F F  GNPLRL  
Sbjct  1    MGCAESKDGEGEASNNRNRPKY-RSCTDVFWLAIYILFWLFLIVIAIFSFVFGNPLRLIN  59

Query  298  GLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDS------------DVK-LPNA  438
            G D  GN CG +H                NE +Q+ P               DVK L  A
Sbjct  60   GYDSFGNTCGVQH----------------NERFQNFPLSGMNTIDKPELFYFDVKELKKA  103

Query  439  RSICLMDCP  465
              IC+  CP
Sbjct  104  LKICVKSCP  112



>ref|XP_008557918.1| PREDICTED: CTL-like protein 1 [Microplitis demolitor]
Length=670

 Score = 64.3 bits (155),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 59/108 (55%), Gaps = 3/108 (3%)
 Frame = +1

Query  187  RKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADPNLHELDL  366
            R C D+ +L +FI+FW  MI+ ++F    GNP+RL +G D  GN CG ++ +P    +DL
Sbjct  20   RGCTDIFWLCLFISFWFLMIMIAAFALVYGNPMRLVHGYDSFGNTCGMKN-NPVSKRVDL  78

Query  367  RYWLNPNEVYQSGPKDSDVKLPNARSICLMDCPIPSEDSLNWVCDYPE  510
                N ++ +      +D+K   +  IC+  CP     SLN +C + +
Sbjct  79   YSLDNSDKPFLFFFDMNDIK--QSLKICVKKCPNRIMTSLNDICQFHK  124



>ref|XP_001983519.1| GH15940 [Drosophila grimshawi]
 gb|EDV95867.1| GH15940 [Drosophila grimshawi]
Length=690

 Score = 64.3 bits (155),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 59/129 (46%), Gaps = 30/129 (23%)
 Frame = +1

Query  118  IGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTY  297
            +G   S DG GE  +     K+ R C DV++L I+I FW+ +IV + F F  GNPLRL  
Sbjct  1    MGCAESKDGEGEAQNNRNRPKY-RSCTDVIWLTIYILFWLFLIVIAIFSFVYGNPLRLIN  59

Query  298  GLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDS------------DVK-LPNA  438
            G D  GN CG +H                NE +Q+ P               DVK L  +
Sbjct  60   GYDSFGNTCGVKH----------------NEKFQNFPLSGMNTLDKPELFYFDVKELKKS  103

Query  439  RSICLMDCP  465
              IC+  CP
Sbjct  104  LKICVKACP  112



>ref|XP_002901775.1| choline transporter-like protein [Phytophthora infestans T30-4]
 gb|EEY57165.1| choline transporter-like protein [Phytophthora infestans T30-4]
Length=692

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 39/66 (59%), Gaps = 1/66 (2%)
 Frame = +1

Query  136  SDGNGEVSSGDGII-KHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYK  312
            S+  G     +G++ K  RKCRD +  ++FI +W+ MI+ +      G PL L YG DY 
Sbjct  12   SEKEGATDPRNGLVPKSQRKCRDGICCVVFIVYWIGMIIVAIVALQTGEPLSLIYGKDYN  71

Query  313  GNVCGD  330
            GNVCGD
Sbjct  72   GNVCGD  77



>gb|KDO33054.1| hypothetical protein SPRG_01869 [Saprolegnia parasitica CBS 223.65]
Length=775

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 39/70 (56%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  SDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKG  315
            + G  + + G    K +RKC DV+ LL F  FW+ M V S   + +G P RL YG+D+KG
Sbjct  16   AKGGQDGTEGSPFKKSSRKCTDVLCLLFFALFWIGMAVISIISYTKGQPQRLAYGMDFKG  75

Query  316  NVCGDRHADP  345
             +CG +    
Sbjct  76   RICGTQSTSA  85



>ref|XP_011142428.1| PREDICTED: CTL-like protein 1 [Harpegnathos saltator]
 gb|EFN82558.1| Choline transporter-like protein 1 [Harpegnathos saltator]
Length=671

 Score = 63.9 bits (154),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 56/117 (48%), Gaps = 21/117 (18%)
 Frame = +1

Query  187  RKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADPNLHELDL  366
            R C DV +L IFIAFW  MI+ ++F    GNPLRL  G D  GN CG ++ +P    ++L
Sbjct  19   RGCTDVFWLCIFIAFWFLMILIAAFAIVYGNPLRLINGYDSFGNTCGMKN-NPKFGSMEL  77

Query  367  RYWLNPNEVYQSGPKDSD---------VKLPNARSICLMDCPIPSEDSLNWVCDYPE  510
                       SG   SD           +  +  IC+  CP  +  S+  +CD+ E
Sbjct  78   -----------SGQDTSDKPFLFFLDIYNVTQSLKICVKQCPDRTLTSMKDICDFYE  123



>gb|ENN75884.1| hypothetical protein YQE_07613, partial [Dendroctonus ponderosae]
 gb|ERL88812.1| hypothetical protein D910_06194 [Dendroctonus ponderosae]
 gb|ERL96280.1| hypothetical protein D910_01703 [Dendroctonus ponderosae]
Length=669

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 59/127 (46%), Gaps = 21/127 (17%)
 Frame = +1

Query  187  RKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADPNLHELDL  366
            R C DV++L+++I FW  M++ ++F F  GNP+R+  G D  GN CG RH          
Sbjct  17   RTCTDVLWLILYILFWFLMVIIAAFSFVYGNPIRIINGYDSFGNTCGTRHNRV-------  69

Query  367  RYWLNPNEVYQSGPKDSD---------VKLPNARSICLMDCPIPSEDSLNWVCDYPEGDI  519
                    V  SG   SD           L  +  IC+ +CP  + DS+  + +Y    +
Sbjct  70   -----MGNVSLSGQDTSDKPYLLFYDIKNLGESLKICVKECPNKTMDSVTDIYNYHRAGV  124

Query  520  RLAVENW  540
             + + N+
Sbjct  125  DVCIYNF  131



>ref|XP_002012151.1| GI16591 [Drosophila mojavensis]
 gb|EDW17282.1| GI16591 [Drosophila mojavensis]
Length=681

 Score = 63.2 bits (152),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 42/73 (58%), Gaps = 1/73 (1%)
 Frame = +1

Query  118  IGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTY  297
            +G   S DG GE  S     K+ R C DV +L I+I FW+ +IV + F F  GNPLRL  
Sbjct  1    MGCAESKDGEGEAQSNRNRPKY-RSCTDVFWLAIYILFWLFLIVIAIFSFVFGNPLRLIN  59

Query  298  GLDYKGNVCGDRH  336
            G D  GN CG +H
Sbjct  60   GYDSFGNTCGVKH  72



>ref|XP_008879484.1| hypothetical protein H310_13674 [Aphanomyces invadans]
 gb|ETV91847.1| hypothetical protein H310_13674 [Aphanomyces invadans]
Length=755

 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 61/126 (48%), Gaps = 12/126 (10%)
 Frame = +1

Query  160  SGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHA  339
            +G     H RKCRDV+  ++F+ FW+ M V +  G   G P RL +G D+ G VCG    
Sbjct  15   TGGSTPTHTRKCRDVLCCVVFLVFWLGMAVLAIVGVANGTPERLLFGTDFNGTVCGTGRF  74

Query  340  DPNLHELDLRYWLNPNEVYQS--GPKDSDVKLPNARSICLMDCPIPSEDSLNWVCDY-PE  510
              + +    R  +N + + Q+  G    D+K      +C+  CP+  +    ++C Y  E
Sbjct  75   QDSTYLYFPR--INDDLLAQTAHGIAPLDMKF---YGLCVPSCPVQGD----YICAYTAE  125

Query  511  GDIRLA  528
              IR A
Sbjct  126  AQIRAA  131



>ref|XP_004363972.1| choline transporter-like protein [Capsaspora owczarzaki ATCC 
30864]
 gb|KJE92111.1| choline transporter-like protein [Capsaspora owczarzaki ATCC 
30864]
Length=668

 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +1

Query  181  HNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGD  330
            HNRKC DV   L+FI FW+ MI+ ++FGF  G+P RL   +D  GN+CG+
Sbjct  25   HNRKCTDVPCCLLFIVFWIGMIIIAAFGFANGDPFRLINPVDSMGNICGE  74



>ref|XP_002601395.1| hypothetical protein BRAFLDRAFT_130395 [Branchiostoma floridae]
 gb|EEN57407.1| hypothetical protein BRAFLDRAFT_130395 [Branchiostoma floridae]
Length=654

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 55/112 (49%), Gaps = 8/112 (7%)
 Frame = +1

Query  184  NRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCG---DRHADPNLH  354
            +R C DV+ L+IFI FWV M   +++    GN  RL YG D  GNVCG   +++A+ NL 
Sbjct  17   DRSCTDVIALVIFILFWVGMFFIAAYSIAGGNAYRLAYGTDSYGNVCGMKNEKNANINLK  76

Query  355  ELDLRYWLNPNEVYQSGPKDSDVKLPNARSICLMDCPIPSEDSLNWVCDYPE  510
               L     P   +      +D     A  IC+  CP    +S+  V D+ +
Sbjct  77   SAGLDMTGRPYVFFMDLFNPAD-----ALEICVSKCPDQDLNSIQDVQDFAK  123



>ref|XP_003700774.1| PREDICTED: CTL-like protein 1 isoform X1 [Megachile rotundata]
Length=673

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 57/118 (48%), Gaps = 23/118 (19%)
 Frame = +1

Query  187  RKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADPNLHELDL  366
            R+C D+ +L  FI FW  MI+ ++F    GNPLRL  G D  GN CG ++ +P    ++L
Sbjct  20   RRCTDIFWLCSFIVFWFLMILIAAFALVYGNPLRLINGYDSFGNTCGMKN-NPKFGSMEL  78

Query  367  R----------YWLNPNEVYQSGPKDSDVKLPNARSICLMDCPIPSEDSLNWVCDYPE  510
                       ++L+ N V QS              IC+  CP  +  ++N +C + E
Sbjct  79   SGQDTKDKPYLFFLDINNVTQS------------LKICVKKCPDRTITTMNEICKFYE  124



>ref|XP_012134577.1| PREDICTED: CTL-like protein 1 isoform X2 [Megachile rotundata]
Length=599

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 57/118 (48%), Gaps = 23/118 (19%)
 Frame = +1

Query  187  RKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADPNLHELDL  366
            R+C D+ +L  FI FW  MI+ ++F    GNPLRL  G D  GN CG ++ +P    ++L
Sbjct  20   RRCTDIFWLCSFIVFWFLMILIAAFALVYGNPLRLINGYDSFGNTCGMKN-NPKFGSMEL  78

Query  367  R----------YWLNPNEVYQSGPKDSDVKLPNARSICLMDCPIPSEDSLNWVCDYPE  510
                       ++L+ N V QS              IC+  CP  +  ++N +C + E
Sbjct  79   SGQDTKDKPYLFFLDINNVTQS------------LKICVKKCPDRTITTMNEICKFYE  124



>ref|XP_011296701.1| PREDICTED: CTL-like protein 1 [Fopius arisanus]
Length=670

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 56/106 (53%), Gaps = 3/106 (3%)
 Frame = +1

Query  187  RKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADPNLHELDL  366
            R+C D+ +L +FI FW AMI+ ++F    GNPLRL  G D  GN CG ++ +P   +++L
Sbjct  19   RRCTDIFWLCLFIIFWFAMIMIAAFALVYGNPLRLINGYDSFGNTCGTQN-NPKFGDMEL  77

Query  367  RYWLNPNEVYQSGPKDSDVKLPNARSICLMDCPIPSEDSLNWVCDY  504
                  ++ Y       D  L  +  IC+  CP  + +  + VC +
Sbjct  78   SGQDTSDKPYLFFLDVKD--LHQSLKICVKKCPDRTMNYTSEVCQF  121



>ref|XP_005835119.1| hypothetical protein GUITHDRAFT_58746, partial [Guillardia theta 
CCMP2712]
 gb|EKX48139.1| hypothetical protein GUITHDRAFT_58746, partial [Guillardia theta 
CCMP2712]
Length=538

 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 52/103 (50%), Gaps = 11/103 (11%)
 Frame = +1

Query  181  HNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADPNLHEL  360
             +RKC +V+ LL FI FW  M+V    GF +GNP RL YG D+ G  CG  + D      
Sbjct  1    QDRKCTNVLCLLFFICFWFGMLVVGIVGFVKGNPNRLRYGYDFLGRTCG--YGDVK----  54

Query  361  DLRYWLNPNEVYQSGPKDSDVKLPNARSICLMDCPIPSEDSLN  489
             L+Y   P   Y S    +D+      ++CL DC + +   L+
Sbjct  55   GLKYLYYPFP-YNSTSSSTDLT----WAVCLKDCGLTNASMLS  92



>ref|XP_005835103.1| hypothetical protein GUITHDRAFT_162533 [Guillardia theta CCMP2712]
 gb|EKX48123.1| hypothetical protein GUITHDRAFT_162533 [Guillardia theta CCMP2712]
Length=688

 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 58/129 (45%), Gaps = 23/129 (18%)
 Frame = +1

Query  121  GKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYG  300
            G  P    NGE    D  IK +R C D++  LIFI FW+ M++   F F+ G P RL YG
Sbjct  17   GGSPLKLENGE----DFEIKQHRGCTDMLCCLIFIVFWIGMLIVGIFAFSNGQPPRLHYG  72

Query  301  LDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICLMDCPIPSED  480
             D+ G  CG                +N N+     P+ S   L    S+C+  CP PS  
Sbjct  73   YDFLGQTCGTG--------------INSNKTLLYYPRPSSSNL--TWSVCVDVCP-PS--  113

Query  481  SLNWVCDYP  507
            SL   C  P
Sbjct  114  SLQIRCILP  122



>ref|XP_002026963.1| GL12847 [Drosophila persimilis]
 gb|EDW34774.1| GL12847 [Drosophila persimilis]
Length=692

 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 58/190 (31%), Positives = 80/190 (42%), Gaps = 23/190 (12%)
 Frame = +1

Query  118  IGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTY  297
            +G   S DG GE  +        R C DV +L ++I FW+ +IV + F F  GNPLR+  
Sbjct  1    MGCAESKDGEGETQNHR---PKYRSCTDVFWLALYIIFWLFLIVIAIFSFFYGNPLRIIN  57

Query  298  GLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVK-LPNARSICLMDCPIPS  474
            G D  GN CG ++ +   H+  L      N V +      DVK L  +  IC+  CP  +
Sbjct  58   GYDSFGNTCGVKN-NERFHDFPLS---GMNTVDKPELFYFDVKELKKSLKICVKTCPAKT  113

Query  475  EDSLNWVCD-YPEGDIRLAVENWIDRNYDYFADLTPELRK--KSLQLQGPCYPVIFPSVN  645
                + +   Y +    L         YDY  D    L    K+    GPC     PS  
Sbjct  114  LTKPSELLQYYTQTGSHLC-------KYDYNMDQLSTLGNDGKTFNFLGPC-----PSFP  161

Query  646  VYWSCQFIAR  675
            VY S   + R
Sbjct  162  VYESSPVLHR  171



>ref|XP_011437365.1| PREDICTED: choline transporter-like protein 1 isoform X2 [Crassostrea 
gigas]
Length=179

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 40/60 (67%), Gaps = 2/60 (3%)
 Frame = +1

Query  166  DGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADP  345
            DG I  +R+CRDVVFL+IFI +   M+  +  G +QG+P RL YG+D  GNVC DR   P
Sbjct  26   DGPIA-DRQCRDVVFLIIFILYLGGMVYVAYRGVSQGDPYRLVYGVDSWGNVC-DRKNTP  83



>ref|XP_011437364.1| PREDICTED: choline transporter-like protein 1 isoform X1 [Crassostrea 
gigas]
Length=184

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 40/60 (67%), Gaps = 2/60 (3%)
 Frame = +1

Query  166  DGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADP  345
            DG I  +R+CRDVVFL+IFI +   M+  +  G +QG+P RL YG+D  GNVC DR   P
Sbjct  31   DGPIA-DRQCRDVVFLIIFILYLGGMVYVAYRGVSQGDPYRLVYGVDSWGNVC-DRKNTP  88



>ref|XP_001353058.1| GA12051 [Drosophila pseudoobscura pseudoobscura]
 gb|EAL30559.1| GA12051 [Drosophila pseudoobscura pseudoobscura]
Length=692

 Score = 60.1 bits (144),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 58/190 (31%), Positives = 80/190 (42%), Gaps = 23/190 (12%)
 Frame = +1

Query  118  IGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTY  297
            +G   S DG GE  +        R C DV +L ++I FW+ +IV + F F  GNPLR+  
Sbjct  1    MGCAESKDGEGETQNHR---PKYRSCTDVFWLALYIIFWLFLIVIAIFSFFYGNPLRIIN  57

Query  298  GLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVK-LPNARSICLMDCPIPS  474
            G D  GN CG ++ +   H+  L      N V +      DVK L  +  IC+  CP  +
Sbjct  58   GYDSFGNTCGVKN-NERFHDFPLS---GMNTVDKPELFYFDVKELKKSLKICVKACPAKT  113

Query  475  EDSLNWVCD-YPEGDIRLAVENWIDRNYDYFADLTPELRK--KSLQLQGPCYPVIFPSVN  645
                + +   Y +    L         YDY  D    L    K+    GPC     PS  
Sbjct  114  LTKPSELLQYYTQTGSHLC-------KYDYNMDQLSTLGNDGKTFNFLGPC-----PSFP  161

Query  646  VYWSCQFIAR  675
            VY S   + R
Sbjct  162  VYESSPVLHR  171



>gb|EFN67677.1| Choline transporter-like protein 1 [Camponotus floridanus]
Length=699

 Score = 60.1 bits (144),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 54/115 (47%), Gaps = 22/115 (19%)
 Frame = +1

Query  187  RKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADPNLHELDL  366
            R C DV +L +FIAFW  MI+ ++F    GNPLRL  G D  GN CG +  +P    ++L
Sbjct  18   RGCTDVFWLCLFIAFWFLMILIAAFAIVYGNPLRLINGYDSFGNTCGTK--NPKFGSMEL  75

Query  367  RYWLNPNEVYQSGPKDSD---------VKLPNARSICLMDCPIPSEDSLNWVCDY  504
                       SG   SD           +  +  IC+  CP    +++N +C +
Sbjct  76   -----------SGQDTSDKPYLFFLDIYNVTQSLKICVKQCPDKVLENINDICTF  119



>ref|XP_011257359.1| PREDICTED: CTL-like protein 1 [Camponotus floridanus]
Length=671

 Score = 60.1 bits (144),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 54/115 (47%), Gaps = 22/115 (19%)
 Frame = +1

Query  187  RKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADPNLHELDL  366
            R C DV +L +FIAFW  MI+ ++F    GNPLRL  G D  GN CG +  +P    ++L
Sbjct  18   RGCTDVFWLCLFIAFWFLMILIAAFAIVYGNPLRLINGYDSFGNTCGTK--NPKFGSMEL  75

Query  367  RYWLNPNEVYQSGPKDSD---------VKLPNARSICLMDCPIPSEDSLNWVCDY  504
                       SG   SD           +  +  IC+  CP    +++N +C +
Sbjct  76   -----------SGQDTSDKPYLFFLDIYNVTQSLKICVKQCPDKVLENINDICTF  119



>ref|XP_006615719.1| PREDICTED: CTL-like protein 1-like [Apis dorsata]
Length=496

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 54/108 (50%), Gaps = 3/108 (3%)
 Frame = +1

Query  181  HNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADPNLHEL  360
            H R C D+ +L  FI FW  MI+ ++F    GNPLRL  G D  GN CG ++ +P    +
Sbjct  18   HVRGCTDIFWLCCFIIFWFLMILIAAFALVYGNPLRLINGYDSFGNTCGMKN-NPKFGSM  76

Query  361  DLRYWLNPNEVYQSGPKDSDVKLPNARSICLMDCPIPSEDSLNWVCDY  504
            +L      ++ Y       +V    +  IC+  CP  +  ++N +C +
Sbjct  77   ELSGQDTSDKPYLFFLDVHNV--TQSLKICVKKCPDRTMTTMNDICKF  122



>ref|XP_003698213.1| PREDICTED: LOW QUALITY PROTEIN: CTL-like protein 1-like [Apis 
florea]
Length=671

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/118 (30%), Positives = 57/118 (48%), Gaps = 22/118 (19%)
 Frame = +1

Query  181  HNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADPNLHEL  360
            H R C D+ +L  FI FW  MI+ ++F    GNPLRL  G D  GN CG ++ +P    +
Sbjct  17   HVRGCTDIFWLCCFIIFWFLMILIAAFALVYGNPLRLINGYDSFGNTCGMKN-NPKFGSM  75

Query  361  DLR----------YWLNPNEVYQSGPKDSDVKLPNARSICLMDCPIPSEDSLNWVCDY  504
            +L           ++L+ + V QS            +++C   CP  +  ++N +C +
Sbjct  76   ELSGQDTSDKPYLFFLDVHNVTQS-----------LKNLCXKKCPDRTMTTMNDICKF  122



>ref|XP_002901659.1| choline transporter-like protein [Phytophthora infestans T30-4]
 gb|EEY58715.1| choline transporter-like protein [Phytophthora infestans T30-4]
Length=743

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/186 (26%), Positives = 72/186 (39%), Gaps = 34/186 (18%)
 Frame = +1

Query  184  NRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHAD-------  342
            +RKCRDV   + F  FW+ MI  ++ G   G P RL YG DY G+ CG            
Sbjct  26   SRKCRDVPCAVFFTVFWLGMIAIAAVGLIHGEPRRLLYGADYNGSTCGTGKHQYQPLTFY  85

Query  343  PNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICLMDCPIPSEDSLNWVCDYPEGDIR  522
            P + +  L    NP+      P+D          +C+  CP     +  ++C Y      
Sbjct  86   PRVTQDLLEQASNPS----LAPEDFSF-----YGVCVARCP----GAGTYICSYE-----  127

Query  523  LAVENWIDRNYDYFADLTPELRKKSLQL-------QGPCYPVIFPSVNVYWSCQFIARAS  681
               E  I  +     D   E  +KS  +       +  C+ V  PS  V + C  I   +
Sbjct  128  --AEEEIQSDTSLSTDKEREEERKSRAVDRMVFPSEKQCWLVALPSEQVLYRCLQITELN  185

Query  682  NVSLRH  699
            + S+  
Sbjct  186  SSSVEK  191



>ref|XP_011866942.1| PREDICTED: CTL-like protein 1 [Vollenhovia emeryi]
Length=673

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 55/106 (52%), Gaps = 3/106 (3%)
 Frame = +1

Query  187  RKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADPNLHELDL  366
            R C DVV+L +F+AFW  MI+ ++F    GNP+RL  G D  GN CG ++ +P    ++L
Sbjct  19   RGCTDVVWLCLFVAFWFLMILIAAFAIVYGNPIRLINGYDSFGNTCGVKN-NPKFGSMEL  77

Query  367  RYWLNPNEVYQSGPKDSDVKLPNARSICLMDCPIPSEDSLNWVCDY  504
                  ++ Y      S+V    +  IC+  CP     ++  +C +
Sbjct  78   SGQDTSDKPYLFFLDISNV--TQSLKICVKKCPDRILSTIEDICKF  121



>ref|XP_009519325.1| hypothetical protein PHYSODRAFT_485041 [Phytophthora sojae]
 gb|EGZ24037.1| hypothetical protein PHYSODRAFT_485041 [Phytophthora sojae]
Length=740

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 36/66 (55%), Gaps = 1/66 (2%)
 Frame = +1

Query  136  SDGNGEVSSGDGII-KHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYK  312
            S+  G      G+  +  R+CRD    L+F+ +W+ MIV +      G PL L YG DY 
Sbjct  12   SEKEGAAGPRSGLAPQSARRCRDTFCCLLFVVYWIGMIVVAIVALQTGQPLSLIYGKDYN  71

Query  313  GNVCGD  330
            GNVCG+
Sbjct  72   GNVCGE  77



>ref|XP_003484500.1| PREDICTED: CTL-like protein 1-like [Bombus impatiens]
Length=670

 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 55/108 (51%), Gaps = 3/108 (3%)
 Frame = +1

Query  187  RKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADPNLHELDL  366
            R C D+ +L  FI FW  MI+ ++F    GNPLRL  G D  GN CG ++ +P    ++L
Sbjct  20   RGCTDIFWLCCFIVFWFLMILIAAFALVYGNPLRLINGYDSFGNTCGMKN-NPKFGSMEL  78

Query  367  RYWLNPNEVYQSGPKDSDVKLPNARSICLMDCPIPSEDSLNWVCDYPE  510
                  ++ +      S+V    +  IC+  CP  +  ++N +C + E
Sbjct  79   SGQDTSDKPFLFFLDISNVT--QSLKICVKKCPDRNMTTMNDICKFYE  124



>ref|XP_003399506.1| PREDICTED: CTL-like protein 1-like [Bombus terrestris]
Length=673

 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/117 (31%), Positives = 54/117 (46%), Gaps = 21/117 (18%)
 Frame = +1

Query  187  RKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADPNLHELDL  366
            R C D+ +L  FI FW  MI+ ++F    GNPLRL  G D  GN CG ++ +P    ++L
Sbjct  20   RGCTDIFWLCCFIVFWFLMILIAAFALVYGNPLRLINGYDSFGNTCGMKN-NPKFGSMEL  78

Query  367  RYWLNPNEVYQSGPKDSD---------VKLPNARSICLMDCPIPSEDSLNWVCDYPE  510
                       SG   SD           +  +  IC+  CP  +  ++N +C + E
Sbjct  79   -----------SGQDTSDKPFLFFLDIYNVTQSLKICVKKCPDRTMTTMNDICKFYE  124



>ref|XP_624708.1| PREDICTED: CTL-like protein 1-like [Apis mellifera]
Length=668

 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 53/109 (49%), Gaps = 3/109 (3%)
 Frame = +1

Query  178  KHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADPNLHE  357
             H R C D+ +L  FI FW  MI+ ++F    GNPLRL  G D  GN CG ++ +P    
Sbjct  17   THVRGCTDIFWLCCFIIFWFLMILIAAFALVYGNPLRLINGYDSFGNTCGMKN-NPKFGS  75

Query  358  LDLRYWLNPNEVYQSGPKDSDVKLPNARSICLMDCPIPSEDSLNWVCDY  504
            ++L      ++ Y       +V    +  IC+  CP     ++N +C +
Sbjct  76   MELSGQDTSDKPYLFFLDVHNV--TQSLKICVKKCPDRKMTTMNDICKF  122



>ref|XP_007885310.1| PREDICTED: choline transporter-like protein 3 [Callorhinchus 
milii]
Length=654

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 60/125 (48%), Gaps = 7/125 (6%)
 Frame = +1

Query  121  GKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYG  300
            G+Y  SD   +V S +   +  R+C DV++LLIF  FW  M+  + +    G+  RL +G
Sbjct  5    GRYQVSDR--DVLSREWRPQIYRRCTDVLWLLIFFLFWSGMMFIAGYALTVGSAERLIFG  62

Query  301  LDYKGNVCGDRHADPNLHELDLRYWLNPNEVY--QSGPKDSDVKLPNARSICLMDCPIPS  474
             D  GNVCG R+       L  +   N   V+   +   DS     N+ SIC+  CP   
Sbjct  63   YDSYGNVCGRRNVAIKGASLSGQDMTNRKLVFFLNACNVDSTNHTINSVSICVSRCP---  119

Query  475  EDSLN  489
            ED L 
Sbjct  120  EDELK  124



>ref|XP_003616781.1| MJK13.4 protein [Medicago truncatula]
Length=76

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  466  IPSEDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELR  588
            IP EDSL WVCDY EGDIR+++++WID NY+Y+  L   L+
Sbjct  9    IPPEDSLAWVCDYHEGDIRVSMDDWIDMNYNYYEFLVLLLQ  49



>ref|XP_008469517.1| PREDICTED: CTL-like protein 1 [Diaphorina citri]
Length=730

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 59/119 (50%), Gaps = 12/119 (10%)
 Frame = +1

Query  157  SSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRH  336
            ++GD I    R C DV+FL IFI F   MI  + F F  GNPLRL +G D  GN CG   
Sbjct  12   TNGDNI--KIRGCTDVLFLCIFILFLFVMIFIAGFAFVYGNPLRLIHGYDSFGNTCGSST  69

Query  337  AD---PNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICLMDCPIPSEDSLNWVCDY  504
             D    +L  LDL        +Y    ++  + L     IC+  CP  + +++N + ++
Sbjct  70   NDYIGTDLSGLDLS---EKKFLYYLDVRNLKLSL----QICVEKCPDRNMETMNDIQEF  121



>ref|XP_011640422.1| PREDICTED: CTL-like protein 1 [Pogonomyrmex barbatus]
Length=673

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 54/115 (47%), Gaps = 21/115 (18%)
 Frame = +1

Query  187  RKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADPNLHELDL  366
            R C DV++L +FIAFW  MI+ ++F    GNPLRL  G D  GN CG ++ +P    ++L
Sbjct  19   RGCTDVIWLCLFIAFWFLMILVAAFAIVYGNPLRLINGYDSFGNTCGVKN-NPKFGSMEL  77

Query  367  RYWLNPNEVYQSGPKDSD---------VKLPNARSICLMDCPIPSEDSLNWVCDY  504
                       SG   SD           +  +  IC+  CP     ++  +C +
Sbjct  78   -----------SGQDTSDKPYLFFLDIYNVTQSLKICVKQCPDRMLRTMKDICTF  121



>ref|XP_011696064.1| PREDICTED: CTL-like protein 1 [Wasmannia auropunctata]
Length=672

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 53/106 (50%), Gaps = 3/106 (3%)
 Frame = +1

Query  187  RKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADPNLHELDL  366
            R C DV +L +FIAFW  MI+ ++F    GNPLRL +G D  GN CG ++ +P    ++L
Sbjct  18   RGCTDVFWLCLFIAFWFLMILIAAFAIVYGNPLRLIHGYDSFGNTCGVKN-NPKFGNMEL  76

Query  367  RYWLNPNEVYQSGPKDSDVKLPNARSICLMDCPIPSEDSLNWVCDY  504
                   + Y       +V    +  IC+  CP     ++  +C +
Sbjct  77   SGQDTSEKPYLFFLDIYNV--TQSLKICVKKCPDRMLSTMEDICKF  120



>ref|XP_002427703.1| conserved hypothetical protein [Pediculus humanus corporis]
 gb|EEB14965.1| conserved hypothetical protein [Pediculus humanus corporis]
Length=664

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 83/172 (48%), Gaps = 36/172 (21%)
 Frame = +1

Query  187  RKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCG---DRHADPNLHE  357
            R C DV+ L+IFI FW  +I+ ++F    G+P RLT+G D  GN+CG   D+        
Sbjct  21   RGCTDVLMLIIFILFWFLLILIAAFALVFGHPKRLTHGYDDFGNICGAENDKIGSLEHSG  80

Query  358  LDLRYWLNPNEVYQSGPKDSDVKLPNARSICLMDCPIPSEDSLNWVCDYPEGDIRLAVEN  537
            LD+R        Y      S++K   +  IC+  CP    +S+N        D+R   + 
Sbjct  81   LDMR-----QRPYLFYLDISNIK--KSLKICVSKCPDRDLNSMN--------DLR---KF  122

Query  538  WIDRN-----YDY-FADLT---PELRKKSLQLQGPC--YPVIFPSVNVYWSC  660
            +++ N     YD+ F D+    PEL   ++   GPC  +PV + S+ V   C
Sbjct  123  YLETNSSLCQYDFKFEDVKARQPELFSSAM---GPCPVFPV-YKSIKVLKRC  170



>ref|XP_006674882.1| hypothetical protein BATDEDRAFT_1420, partial [Batrachochytrium 
dendrobatidis JAM81]
 gb|EGF83665.1| hypothetical protein BATDEDRAFT_1420, partial [Batrachochytrium 
dendrobatidis JAM81]
Length=611

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 76/182 (42%), Gaps = 33/182 (18%)
 Frame = +1

Query  175  IKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADPNLH  354
            I   RKCRD++FL++FI +W+ M   +    + G+P RL    DY G  CG  +   N  
Sbjct  1    IVTKRKCRDIIFLILFILYWIGMAFVAQSAISSGDPRRLLTPTDYLGEFCGMNNTVLNAS  60

Query  355  ELDLR-----YWLNPNEVYQSGPKDSDVKLPNARSICLMDCP---IPSEDSLNWVCDYPE  510
              DL      Y+LNP E+                ++C+  CP   I +      +C Y  
Sbjct  61   LSDLSTKPYLYYLNPVEL--------------NYAVCIASCPNITIATVTPSTGICIYSA  106

Query  511  GDIRLAVENWIDRNY-DYFADLT-PELRKKSLQLQGPCYPVIFPSVNVYWSCQFIARASN  684
                L        NY  Y +D T      KS  + G C P I P  +VY +  F A  + 
Sbjct  107  TPSIL--------NYTSYMSDQTCSSYIYKSTPVLGRCVP-IEPIPSVYVNQTFTAGNAT  157

Query  685  VS  690
            +S
Sbjct  158  IS  159



>ref|XP_001604227.1| PREDICTED: CTL-like protein 1 [Nasonia vitripennis]
Length=675

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 55/115 (48%), Gaps = 22/115 (19%)
 Frame = +1

Query  187  RKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADPNLHELDL  366
            R C D+ +L +FI FW  MI+ ++F F  G+P+RL  G D  GN CG  ++     EL  
Sbjct  22   RGCTDIFWLCLFITFWFLMILIAAFAFVYGSPIRLINGYDSFGNTCGVNNSKFGAMEL--  79

Query  367  RYWLNPNEVYQSGPKDSD---------VKLPNARSICLMDCPIPSEDSLNWVCDY  504
                       SG  +SD          K+  +  IC+  CP  + +S+  VC++
Sbjct  80   -----------SGQDNSDKPYLFFLDVSKVRQSLKICVKKCPERTLNSMVDVCNF  123



>ref|XP_001971877.1| GG15215 [Drosophila erecta]
 gb|EDV50903.1| GG15215 [Drosophila erecta]
Length=691

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 60/142 (42%), Gaps = 32/142 (23%)
 Frame = +1

Query  118  IGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTY  297
            +G   S DG GE  +        R C D  +L I+I FW+ +IV + F F  GNPLR+  
Sbjct  1    MGCAESKDGEGEAQNNR---PKYRSCTDTCWLAIYIIFWLFLIVIAIFSFVYGNPLRIIN  57

Query  298  GLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDS------------DVK-LPNA  438
            G D  GN CG ++                NE +QS P               DVK L  +
Sbjct  58   GYDSFGNTCGVKY----------------NEKFQSFPLSGMNTLDKPELFYFDVKELKKS  101

Query  439  RSICLMDCPIPSEDSLNWVCDY  504
              IC+  CP  +    + + +Y
Sbjct  102  LKICVKSCPAKTMTKGSELLEY  123



>ref|XP_002681381.1| choline transporter-like protein [Naegleria gruberi]
 gb|EFC48637.1| choline transporter-like protein, partial [Naegleria gruberi]
Length=641

 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 50/103 (49%), Gaps = 6/103 (6%)
 Frame = +1

Query  175  IKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADPNLH  354
            +   R C DV+ + +FI FW+ + + + FGF  GNP  L   LDY GN+CG      N +
Sbjct  2    VNRKRSCTDVLCIPVFILFWIGLFIIAGFGFWSGNPATLVEPLDYAGNMCGYAVGKGNSN  61

Query  355  ELDL---RYWLNPNEVYQSGPKD-SDVKLPNA--RSICLMDCP  465
              DL    Y   P E      KD +  +L +A    IC+  CP
Sbjct  62   VFDLSNRTYLWYPFEFRPDQLKDITTSRLISALGLGICVESCP  104



>gb|EGI62812.1| CTL-like protein 1 [Acromyrmex echinatior]
Length=673

 Score = 57.4 bits (137),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 54/116 (47%), Gaps = 23/116 (20%)
 Frame = +1

Query  187  RKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADPNLHELDL  366
            R C DV +L  FIAFW  MI+ ++F    GNPLRL  G D  GN CG ++ +P    ++L
Sbjct  19   RGCTDVFWLCFFIAFWFLMILIAAFAIVYGNPLRLINGYDSFGNTCGMKN-NPKFGSMEL  77

Query  367  R----------YWLNPNEVYQSGPKDSDVKLPNARSICLMDCPIPSEDSLNWVCDY  504
                       ++L+ N V QS              IC+  CP     ++  +C +
Sbjct  78   SGQDTSDKPYLFFLDINNVTQS------------LKICVKKCPDRILRTMEDICKF  121



>ref|XP_011058838.1| PREDICTED: CTL-like protein 1 [Acromyrmex echinatior]
Length=673

 Score = 57.4 bits (137),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 54/116 (47%), Gaps = 23/116 (20%)
 Frame = +1

Query  187  RKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADPNLHELDL  366
            R C DV +L  FIAFW  MI+ ++F    GNPLRL  G D  GN CG ++ +P    ++L
Sbjct  19   RGCTDVFWLCFFIAFWFLMILIAAFAIVYGNPLRLINGYDSFGNTCGMKN-NPKFGSMEL  77

Query  367  R----------YWLNPNEVYQSGPKDSDVKLPNARSICLMDCPIPSEDSLNWVCDY  504
                       ++L+ N V QS              IC+  CP     ++  +C +
Sbjct  78   SGQDTSDKPYLFFLDINNVTQS------------LKICVKKCPDRILRTMEDICKF  121



>ref|XP_012060621.1| PREDICTED: CTL-like protein 1 [Atta cephalotes]
Length=673

 Score = 57.4 bits (137),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 54/116 (47%), Gaps = 23/116 (20%)
 Frame = +1

Query  187  RKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADPNLHELDL  366
            R C DV +L  FIAFW  MI+ ++F    GNPLRL  G D  GN CG ++ +P    ++L
Sbjct  19   RGCTDVFWLCFFIAFWFLMILIAAFAIVYGNPLRLINGYDSFGNTCGMKN-NPQFGSMEL  77

Query  367  R----------YWLNPNEVYQSGPKDSDVKLPNARSICLMDCPIPSEDSLNWVCDY  504
                       ++L+ N V QS              IC+  CP     ++  +C +
Sbjct  78   SGQDTSDKPYLFFLDINNVTQS------------LKICVKKCPDRILRTMEDICKF  121



>ref|XP_009841737.1| hypothetical protein H257_15348 [Aphanomyces astaci]
 gb|ETV68783.1| hypothetical protein H257_15348 [Aphanomyces astaci]
Length=761

 Score = 57.4 bits (137),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 58/119 (49%), Gaps = 16/119 (13%)
 Frame = +1

Query  187  RKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDR-HADPNLHELD  363
            RKCRDV+  +IF  FW+ M V +  G   G P RL YG D+ G VCG    AD       
Sbjct  24   RKCRDVLCCVIFFVFWLGMAVLAVVGVANGTPERLLYGTDFNGTVCGTGVFADSTF----  79

Query  364  LRY-WLNPNEVYQS--GPKDSDVKLPNARSICLMDCPIPSEDSLNWVCDY-PEGDIRLA  528
            L Y  +N + + Q+  G    D+K      +C+  CP   E    ++C Y  E ++R A
Sbjct  80   LYYPRINDDMMTQAAHGISPLDMKF---YGLCVPSCPSQGE----YICAYTAEANLRAA  131



>gb|AAO39508.1| RE36634p [Drosophila melanogaster]
Length=691

 Score = 57.4 bits (137),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 55/189 (29%), Positives = 77/189 (41%), Gaps = 46/189 (24%)
 Frame = +1

Query  118  IGKYPSSDGNGEVSSGDGIIKHN-RKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLT  294
            +G   S DG GE  +     +H  R C D  +L I+I FW+ +IV + F F  GNPLR+ 
Sbjct  1    MGCAESKDGEGEAQNN----RHKYRSCTDTCWLAIYIIFWLFLIVIAIFSFVYGNPLRII  56

Query  295  YGLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDS------------DVK-LPN  435
             G D  GN CG ++                NE +Q  P               DVK L  
Sbjct  57   NGYDSFGNTCGVKY----------------NEKFQGFPLSGMNTLDKPELFYFDVKELKK  100

Query  436  ARSICLMDCPIPSEDSLNWVCD-YPEGDIRLAVENWIDRNYDY-FADLTPELR-KKSLQL  606
            +  IC+  CP  +    + + + Y +   +L         YDY    LT      K+   
Sbjct  101  SLKICVKSCPAKTMTKGSELLEYYSQTGTQLC-------KYDYNMQQLTTAGNDAKTFNF  153

Query  607  QGPC--YPV  627
             GPC  +PV
Sbjct  154  LGPCPSFPV  162



>gb|EFA10286.1| hypothetical protein TcasGA2_TC012490 [Tribolium castaneum]
Length=659

 Score = 57.0 bits (136),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 49/177 (28%), Positives = 81/177 (46%), Gaps = 36/177 (20%)
 Frame = +1

Query  184  NRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADPNLHELD  363
             R C DV +L ++IAFW+ M++ ++F F  GNP+R+  G D  GN+CG ++ +  +  L+
Sbjct  17   QRGCTDVFWLCLYIAFWLLMVLIAAFSFVYGNPIRIINGYDSFGNICGTKN-NRKMSNLE  75

Query  364  LRYWLNPNEVYQSGPKDSDVK---------LPNARSICLMDCPIPSEDSLNWVCD----Y  504
            +           SG   SD +         L  +  IC+  CP    ++L  V D    Y
Sbjct  76   V-----------SGLDTSDKQFLLFYDIKELKQSLKICVKQCP---TETLKKVEDIQKYY  121

Query  505  PEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIFPSVNVYWSCQFIAR  675
             +  + L      D NYD F + +   ++      GPC     P++ +Y S   + R
Sbjct  122  QKTGVSLCRY---DFNYDDFKNKSIANKEILSSYLGPC-----PALPIYESTPVLNR  170



>ref|XP_008197900.1| PREDICTED: CTL-like protein 1 [Tribolium castaneum]
Length=666

 Score = 57.0 bits (136),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 49/177 (28%), Positives = 81/177 (46%), Gaps = 36/177 (20%)
 Frame = +1

Query  184  NRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADPNLHELD  363
             R C DV +L ++IAFW+ M++ ++F F  GNP+R+  G D  GN+CG ++ +  +  L+
Sbjct  17   QRGCTDVFWLCLYIAFWLLMVLIAAFSFVYGNPIRIINGYDSFGNICGTKN-NRKMSNLE  75

Query  364  LRYWLNPNEVYQSGPKDSDVK---------LPNARSICLMDCPIPSEDSLNWVCD----Y  504
            +           SG   SD +         L  +  IC+  CP    ++L  V D    Y
Sbjct  76   V-----------SGLDTSDKQFLLFYDIKELKQSLKICVKQCP---TETLKKVEDIQKYY  121

Query  505  PEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPVIFPSVNVYWSCQFIAR  675
             +  + L      D NYD F + +   ++      GPC     P++ +Y S   + R
Sbjct  122  QKTGVSLCRY---DFNYDDFKNKSIANKEILSSYLGPC-----PALPIYESTPVLNR  170



>ref|XP_011161132.1| PREDICTED: CTL-like protein 1 [Solenopsis invicta]
Length=674

 Score = 57.0 bits (136),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 49/93 (53%), Gaps = 3/93 (3%)
 Frame = +1

Query  187  RKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADPNLHELDL  366
            R C DV++L  FIAFW  MI+ ++F    GNP+RL  G D  GN CG ++ +P    ++L
Sbjct  20   RGCTDVIWLCFFIAFWFFMILIAAFAIVYGNPMRLINGYDSFGNTCGVKN-NPKFGSMEL  78

Query  367  RYWLNPNEVYQSGPKDSDVKLPNARSICLMDCP  465
                  ++ Y      ++V    +  IC+  CP
Sbjct  79   SGQDTSDKPYLFFLDITNV--TQSLKICVKKCP  109



>ref|XP_007065238.1| PREDICTED: choline transporter-like protein 3 [Chelonia mydas]
Length=667

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 59/120 (49%), Gaps = 12/120 (10%)
 Frame = +1

Query  187  RKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADPNLHELDL  366
            RKC DV++L++F  FW  ++  + +    G+  RL YG D  GN+CG ++       L  
Sbjct  27   RKCTDVLWLILFFLFWAGLMFITGYAVTAGSAERLVYGYDSYGNICGKKNTHIEGAPLSG  86

Query  367  RYWLNPNEVY---QSGPKDSDVKLPNARSICLMDCPIPSEDSLNWVCDYPEGDIRLAVEN  537
            +   N   V+     G +  ++K+ N+ ++C+  CP    ++L         DI+L  +N
Sbjct  87   QDMTNKKHVFFLNSCGLEIKNLKI-NSIALCVSSCPQEQLNTLE--------DIQLFAKN  137



>gb|KFM56711.1| CTL-like protein 1, partial [Stegodyphus mimosarum]
Length=689

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 58/123 (47%), Gaps = 28/123 (23%)
 Frame = +1

Query  178  KHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHAD-----  342
            K  R+C D++ L IF  FW  +I  ++F F  G+P RL YG D  GN CG ++ +     
Sbjct  15   KRPRECTDILCLAIFCIFWGLLIFIAAFAFVIGDPTRLAYGQDSFGNTCGMKNEELGNMT  74

Query  343  ---PNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICLMDCPIPSEDSLNWVCDYPEG  513
                ++ E    ++LN   +YQS              IC+ +CP   + +L     Y E 
Sbjct  75   FSGMDMTERPYLFFLNMTNLYQS------------LKICVKECP---KHTL-----YNEK  114

Query  514  DIR  522
            DIR
Sbjct  115  DIR  117



>ref|XP_002035324.1| GM14646 [Drosophila sechellia]
 gb|EDW50460.1| GM14646 [Drosophila sechellia]
Length=691

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/142 (30%), Positives = 59/142 (42%), Gaps = 32/142 (23%)
 Frame = +1

Query  118  IGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTY  297
            +G   S DG GE  +        R C D  +L I+I FW+ +IV + F F  GNPLR+  
Sbjct  1    MGCAESKDGEGEAQNNR---PKYRSCTDTCWLAIYIIFWLFLIVIAIFSFVYGNPLRIIN  57

Query  298  GLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDS------------DVK-LPNA  438
            G D  GN CG ++                NE +Q  P               DVK L  +
Sbjct  58   GYDSFGNTCGVKY----------------NEKFQGFPLSGMNTLDKPELFYFDVKELKKS  101

Query  439  RSICLMDCPIPSEDSLNWVCDY  504
              IC+  CP  +    + + +Y
Sbjct  102  LKICVKSCPAKTMTKGSELLEY  123



>ref|XP_002083614.1| GD13831 [Drosophila simulans]
 gb|EDX09199.1| GD13831 [Drosophila simulans]
Length=691

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 54/188 (29%), Positives = 75/188 (40%), Gaps = 44/188 (23%)
 Frame = +1

Query  118  IGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTY  297
            +G   S DG GE  +        R C D  +L I+I FW+ +IV + F F  GNPLR+  
Sbjct  1    MGCAESKDGEGEAQNNR---PKYRSCTDTCWLAIYIIFWLFLIVIAIFSFVYGNPLRIIN  57

Query  298  GLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDS------------DVK-LPNA  438
            G D  GN CG ++                NE +Q  P               DVK L  +
Sbjct  58   GYDSFGNTCGVKY----------------NEKFQGFPLSGMNTLDKPELFYFDVKELKKS  101

Query  439  RSICLMDCPIPSEDSLNWVCD-YPEGDIRLAVENWIDRNYDY-FADLTPELR-KKSLQLQ  609
              IC+  CP  +    + + + Y +   +L         YDY    LT      K+    
Sbjct  102  LKICVKSCPAKTMTKGSELLEYYSQTGTQLC-------KYDYNMQQLTTAGNDAKTFNFL  154

Query  610  GPC--YPV  627
            GPC  +PV
Sbjct  155  GPCPSFPV  162



>ref|NP_001261411.1| CG1311, isoform B [Drosophila melanogaster]
 gb|AGB94106.1| CG1311, isoform B [Drosophila melanogaster]
Length=686

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/142 (30%), Positives = 59/142 (42%), Gaps = 32/142 (23%)
 Frame = +1

Query  118  IGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTY  297
            +G   S DG GE  +        R C D  +L I+I FW+ +IV + F F  GNPLR+  
Sbjct  1    MGCAESKDGEGEAQNNR---PKYRSCTDTCWLAIYIIFWLFLIVIAIFSFVYGNPLRIIN  57

Query  298  GLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDS------------DVK-LPNA  438
            G D  GN CG ++                NE +Q  P               DVK L  +
Sbjct  58   GYDSFGNTCGVKY----------------NEKFQGFPLSGMNTLDKPELFYFDVKELKKS  101

Query  439  RSICLMDCPIPSEDSLNWVCDY  504
              IC+  CP  +    + + +Y
Sbjct  102  LKICVKSCPAKTMTKGSELLEY  123



>ref|NP_647884.1| CG1311, isoform A [Drosophila melanogaster]
 sp|Q9VZE7.1|CTLH1_DROME RecName: Full=CTL-like protein 1 [Drosophila melanogaster]
 gb|AAF47876.1| CG1311, isoform A [Drosophila melanogaster]
 gb|AGW52184.1| FI21576p1 [Drosophila melanogaster]
Length=691

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/142 (30%), Positives = 59/142 (42%), Gaps = 32/142 (23%)
 Frame = +1

Query  118  IGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTY  297
            +G   S DG GE  +        R C D  +L I+I FW+ +IV + F F  GNPLR+  
Sbjct  1    MGCAESKDGEGEAQNNR---PKYRSCTDTCWLAIYIIFWLFLIVIAIFSFVYGNPLRIIN  57

Query  298  GLDYKGNVCGDRHADPNLHELDLRYWLNPNEVYQSGPKDS------------DVK-LPNA  438
            G D  GN CG ++                NE +Q  P               DVK L  +
Sbjct  58   GYDSFGNTCGVKY----------------NEKFQGFPLSGMNTLDKPELFYFDVKELKKS  101

Query  439  RSICLMDCPIPSEDSLNWVCDY  504
              IC+  CP  +    + + +Y
Sbjct  102  LKICVKSCPAKTMTKGSELLEY  123



>ref|XP_004350030.1| solute carrier family 44 protein member 2 [Dictyostelium fasciculatum]
 gb|EGG13327.1| solute carrier family 44 protein member 2 [Dictyostelium fasciculatum]
Length=634

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 64/132 (48%), Gaps = 15/132 (11%)
 Frame = +1

Query  142  GNGEVSSGDGIIKHN-----RKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLD  306
            G G    G  +IK+      RKC D +FLL+F+AFW  MI  +     +GNPLRL YG D
Sbjct  15   GKGHDPRGHEVIKNKGVYDKRKCHDCLFLLLFLAFWGGMIAVAVIAVKEGNPLRLIYGTD  74

Query  307  YKGNVCG-DRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICLMDCP-----I  468
              GN+CG D  AD  L       +++   VY      +   L +AR +C+  CP     I
Sbjct  75   ENGNICGVDNIADGVLPANKSANFVDNKYVYYIVYTGN---LISARPVCVSQCPNETHLI  131

Query  469  PSEDSLNWVCDY  504
            P   S   VC Y
Sbjct  132  PDNAS-QLVCSY  142



>ref|XP_002093680.1| GE21434 [Drosophila yakuba]
 gb|EDW93392.1| GE21434 [Drosophila yakuba]
Length=691

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/137 (31%), Positives = 61/137 (45%), Gaps = 22/137 (16%)
 Frame = +1

Query  118  IGKYPSSDGNGEVSSGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTY  297
            +G   S DG GE  +        R C D  +L I+I FW+ +IV + F F  GNPLR+  
Sbjct  1    MGCAESKDGEGEAQNNR---PKYRSCTDTCWLAIYIIFWLFLIVIAIFSFVYGNPLRIIN  57

Query  298  GLDYKGNVCGDRHAD-------PNLHELDLRYWLNPNEVYQSGPKDSDVK-LPNARSICL  453
            G D  GN CG ++ +         ++ LD      P   Y       DVK L  +  IC+
Sbjct  58   GYDSFGNTCGVKYNEKFKGFPLSGMNTLD-----KPELFY------FDVKELKQSLKICV  106

Query  454  MDCPIPSEDSLNWVCDY  504
              CP  +    + + +Y
Sbjct  107  KTCPAKTMTKGSELLEY  123



>gb|ETN67201.1| ctl transporter [Anopheles darlingi]
Length=688

 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 56/186 (30%), Positives = 83/186 (45%), Gaps = 19/186 (10%)
 Frame = +1

Query  187  RKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADPNLHELDL  366
            R   D+ +L++++ FW+A+IV + F F  GNPLRL  G D  GN CG R  D     + L
Sbjct  17   RGHTDIFWLILYVIFWIALIVIAIFSFIYGNPLRLINGYDSFGNTCGVRSND-KYSNIPL  75

Query  367  RYWLNPNEVYQSGPKDSDVK-LPNARSICLMDCPIPSEDSLNWVCDYPEGDIRLAVENWI  543
                  N V +      D+K L +  ++C+ +C  P  + LN    Y   + R +     
Sbjct  76   S---GMNTVDKPYLFFLDIKELRHTITVCVKEC--PERELLNAAELYRYYEERQSKYCRY  130

Query  544  DRNYDYFADLTPELR-KKSLQLQGPCYPVIFPSVNVYWSCQFIAR----ASNVSLRHWKE  708
            D N      LT E    K   L GPC     P++ VY S   + R      N  ++  K+
Sbjct  131  DFNMSLL--LTSEASGPKYFDLTGPC-----PTLPVYQSSPVLHRCIPTGKNAPIQQVKK  183

Query  709  MGGIEN  726
            M  + N
Sbjct  184  MYALIN  189



>ref|XP_003292424.1| hypothetical protein DICPUDRAFT_57949 [Dictyostelium purpureum]
 gb|EGC31065.1| hypothetical protein DICPUDRAFT_57949 [Dictyostelium purpureum]
Length=620

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 58/110 (53%), Gaps = 7/110 (6%)
 Frame = +1

Query  193  CRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADP-NLHELDLR  369
            C+D  FLL+F+AFW  MIV + +G N GNP RL  G D  GN+CG  + +   L+    R
Sbjct  28   CQDCFFLLLFLAFWAGMIVIAVYGVNHGNPQRLVKGTDSYGNICGVNNIEEGKLNATQAR  87

Query  370  YWLNPNEVYQSGPKDSDVKLPNARSICLMDCP-----IPSEDSLNWVCDY  504
               +   VY     +  + LP  R +C+ +CP     IP  ++   +CDY
Sbjct  88   DLRDKKYVYFIYYTELSITLPTYRVVCVDECPNETFLIPQNET-ELICDY  136



>ref|XP_004997931.1| hypothetical protein PTSG_01948 [Salpingoeca rosetta]
 gb|EGD78975.1| hypothetical protein PTSG_01948 [Salpingoeca rosetta]
Length=640

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/104 (32%), Positives = 53/104 (51%), Gaps = 12/104 (12%)
 Frame = +1

Query  181  HNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADPNLHE-  357
              R C D++FL +F+AFW  MI  +   + +G+P RL  G D  GNVCG  +++  ++  
Sbjct  26   KKRSCTDILFLALFLAFWAGMIGIAYVAYTEGDPERLISGTDSFGNVCGRNNSNQVINST  85

Query  358  ---LDLRYWLNPNEVYQSGPKDSDVKLPNARSICLMDCPIPSED  480
               LD+    N + V+     +SD     A  +C+  CP  + D
Sbjct  86   NSGLDMT---NRSFVFFYNSGNSD-----ALRLCVSACPEVTTD  121



>ref|XP_011501769.1| PREDICTED: CTL-like protein 1 [Ceratosolen solmsi marchali]
Length=671

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/108 (31%), Positives = 58/108 (54%), Gaps = 3/108 (3%)
 Frame = +1

Query  187  RKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADPNLHELDL  366
            R C D+ +L +FIAFW  MI+ ++F F  G+P+RL  G D  GN CG ++ +     ++L
Sbjct  21   RGCTDIFWLCLFIAFWFLMILIAAFSFVYGDPIRLVNGYDSFGNTCGVKN-NQKFGSMEL  79

Query  367  RYWLNPNEVYQSGPKDSDVKLPNARSICLMDCPIPSEDSLNWVCDYPE  510
                  ++ Y      +++    +  IC+  CP  S  +++ VC++ E
Sbjct  80   SGQDTNDKPYLFFMDVANIM--QSLKICVKKCPHRSLFNMHDVCNFYE  125



>ref|XP_316311.4| AGAP006244-PA [Anopheles gambiae str. PEST]
 sp|Q7Q5R7.4|CTLH1_ANOGA RecName: Full=CTL-like protein 1 [Anopheles gambiae]
 gb|EAA10766.4| AGAP006244-PA [Anopheles gambiae str. PEST]
Length=690

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 51/190 (27%), Positives = 75/190 (39%), Gaps = 26/190 (14%)
 Frame = +1

Query  187  RKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADP-------  345
            R   D+ +L++++ FW+A+IV + F F  GNPLR+  G D  GN CG R  D        
Sbjct  18   RSPTDIFWLVLYVVFWIALIVIAVFSFIYGNPLRIINGYDSFGNTCGVRSNDKFSNFPLS  77

Query  346  --NLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICLMDCPIPSEDSLNWVCDYPEGDI  519
              N  +    ++L+  E            L +   IC+ +C  P  + LN    Y   + 
Sbjct  78   GMNTEDKPYLFFLDIKE------------LRHTLKICVKEC--PQRELLNAAELYRYYED  123

Query  520  RLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPV-IFPSVNVYWSCQFIARASNVSLR  696
            R       D N             K     GPC P  ++ S  V   C  I    N  L+
Sbjct  124  RKTKLCRYDFNMSMLQTQEANQGAKYFDFNGPCPPFPVYQSAPVLHRC--IPTGVNAPLQ  181

Query  697  HWKEMGGIEN  726
              K+M  + N
Sbjct  182  QVKKMYALIN  191



>ref|XP_001956143.1| GF25058 [Drosophila ananassae]
 gb|EDV38949.1| GF25058 [Drosophila ananassae]
Length=690

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +1

Query  187  RKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRH  336
            R C D+ +L+I+I FW+ +IV + F F  GNPLR+  G D  GN CG +H
Sbjct  21   RSCTDICWLVIYIIFWLFLIVIAIFSFVYGNPLRIINGYDSFGNTCGVKH  70



>ref|XP_002074371.1| GK10555 [Drosophila willistoni]
 gb|EDW85357.1| GK10555 [Drosophila willistoni]
Length=681

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 39/69 (57%), Gaps = 4/69 (6%)
 Frame = +1

Query  142  GNGEVSSGDGIIKHNR----KCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDY  309
            G  E +  +G  ++NR     C D  +L I+I FW+ +IV + F F  GNPLR+  G D 
Sbjct  2    GCAESTEREGSAQNNRPKYRTCTDTFWLAIYILFWLFLIVIAIFSFVYGNPLRIINGYDS  61

Query  310  KGNVCGDRH  336
             GN CG +H
Sbjct  62   FGNTCGVKH  70



>gb|ETM49725.1| hypothetical protein L914_06081 [Phytophthora parasitica]
Length=736

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 28/49 (57%), Gaps = 0/49 (0%)
 Frame = +1

Query  184  NRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGD  330
             RKCRD    L FI +W+ MIV +      G PL L YG DY GNVCG 
Sbjct  28   QRKCRDGFCCLWFIVYWIGMIVVAIIALQTGEPLSLIYGKDYNGNVCGK  76



>ref|XP_009056507.1| hypothetical protein LOTGIDRAFT_120296 [Lottia gigantea]
 gb|ESO92820.1| hypothetical protein LOTGIDRAFT_120296 [Lottia gigantea]
Length=689

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 43/71 (61%), Gaps = 3/71 (4%)
 Frame = +1

Query  160  SGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGD-RH  336
            S +G IK NR C DV+  LIF+ F V M+V S+ G+  G+P +L Y  D  GN+CG    
Sbjct  32   SFNGPIK-NRSCTDVLCCLIFLIFVVGMVVCSALGYAHGDPTKLVYPTDSDGNLCGSGNF  90

Query  337  AD-PNLHELDL  366
            AD PNL   DL
Sbjct  91   ADKPNLMFFDL  101



>gb|ETL96573.1| hypothetical protein L917_05960 [Phytophthora parasitica]
Length=736

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 28/49 (57%), Gaps = 0/49 (0%)
 Frame = +1

Query  184  NRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGD  330
             RKCRD    L FI +W+ MIV +      G PL L YG DY GNVCG 
Sbjct  28   QRKCRDGFCCLWFIVYWIGMIVVAIIALQTGEPLSLIYGKDYNGNVCGK  76



>ref|XP_008891710.1| hypothetical protein PPTG_02391 [Phytophthora parasitica INRA-310]
 gb|ETN22461.1| hypothetical protein PPTG_02391 [Phytophthora parasitica INRA-310]
Length=736

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 28/49 (57%), Gaps = 0/49 (0%)
 Frame = +1

Query  184  NRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGD  330
             RKCRD    L FI +W+ MIV +      G PL L YG DY GNVCG 
Sbjct  28   QRKCRDGFCCLWFIVYWIGMIVVAIIALQTGEPLSLIYGKDYNGNVCGK  76



>gb|ETK89988.1| hypothetical protein L915_06147 [Phytophthora parasitica]
 gb|ETO78827.1| hypothetical protein F444_06332 [Phytophthora parasitica P1976]
 gb|ETP19865.1| hypothetical protein F441_06276 [Phytophthora parasitica CJ01A1]
 gb|ETP47812.1| hypothetical protein F442_06314 [Phytophthora parasitica P10297]
Length=736

 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 28/49 (57%), Gaps = 0/49 (0%)
 Frame = +1

Query  184  NRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGD  330
             RKCRD    L FI +W+ MIV +      G PL L YG DY GNVCG 
Sbjct  28   QRKCRDGFCCLWFIVYWIGMIVVAIIALQTGEPLSLIYGKDYNGNVCGK  76



>gb|ETL43388.1| hypothetical protein L916_06083 [Phytophthora parasitica]
Length=736

 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 28/49 (57%), Gaps = 0/49 (0%)
 Frame = +1

Query  184  NRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGD  330
             RKCRD    L FI +W+ MIV +      G PL L YG DY GNVCG 
Sbjct  28   QRKCRDGFCCLWFIVYWIGMIVVAIIALQTGEPLSLIYGKDYNGNVCGK  76



>gb|EPZ31046.1| Choline transporter-like domain-containing protein [Rozella allomycis 
CSF55]
Length=626

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 57/110 (52%), Gaps = 10/110 (9%)
 Frame = +1

Query  181  HNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADPNLHEL  360
            H+R+CRD+ FL++F+ FW  M   + F +  G+   + YG D  GN+CG  ++  +  + 
Sbjct  17   HHRRCRDIFFLIVFLIFWGGMGFVAYFAWQFGSADSIKYGSDSLGNICGINNSLKDNTKP  76

Query  361  DLRYWLNPNEVYQSGPKDSDVKLPNARSICLMDCPIPSEDS--LNWVCDY  504
            DL    N  ++Y   P  +     ++  +C+  CP  ++ +   N +C +
Sbjct  77   DLT---NYTQLYYFNPLST-----SSTKVCVQQCPNTTQLASLTNLICKH  118



>gb|EJY88486.1| hypothetical protein OXYTRI_12340 [Oxytricha trifallax]
Length=651

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 47/101 (47%), Gaps = 7/101 (7%)
 Frame = +1

Query  184  NRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADPNLHELD  363
            NR C D++   +F+AF V M   +++GF  G+P+ L  G DY GN CG      +   L 
Sbjct  46   NRGCTDIICCFLFLAFCVGMAGTAAYGFINGDPMLLLTGWDYDGNGCGYNATTKDYGYL-  104

Query  364  LRYWLNPNEVYQSGPKDSDVKLPNARSICLMDCPIPSEDSL  486
              YW  P+         SD       S+C+  CP  S+  +
Sbjct  105  --YWPAPD----VSAISSDYYQAFKYSMCVKSCPSSSKTDV  139



>ref|XP_008617622.1| hypothetical protein SDRG_13320 [Saprolegnia diclina VS20]
 gb|EQC28983.1| hypothetical protein SDRG_13320 [Saprolegnia diclina VS20]
Length=608

 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/104 (28%), Positives = 50/104 (48%), Gaps = 16/104 (15%)
 Frame = +1

Query  166  DGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADP  345
            +   + +RKCRDV+ +L+F+  WV M   ++  +  GNP  L Y +D+ GN+C   + D 
Sbjct  16   NAFTEADRKCRDVLCILVFLLLWVGMAFVAAVAYQNGNPGALIYPVDHTGNLCNATYPD-  74

Query  346  NLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICLMDCPIPSE  477
                    Y+ +P         D+   +P    IC+  CP+  +
Sbjct  75   -------MYYPHPQA-------DASAHVPY-YGICVAQCPMKGD  103



>ref|XP_001429732.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK62334.1| unnamed protein product [Paramecium tetraurelia]
Length=649

 Score = 54.3 bits (129),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 44/95 (46%), Gaps = 15/95 (16%)
 Frame = +1

Query  181  HNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADPNLHEL  360
             NR+CRD++  L+F+    A +V  S GFNQG P RL+Y  D  G  CG  H D      
Sbjct  26   ENRQCRDLICFLLFVGATAAFVVIISMGFNQGKPERLSYAYDPNGRACG--HDDGV----  79

Query  361  DLRYWLNPNEVYQSGPKDSDVKLPNARSICLMDCP  465
                  N   +Y   P    +     RS+C+  CP
Sbjct  80   -----FNAPYIYLVAPLVGYLN----RSVCVSQCP  105



>ref|XP_004926445.1| PREDICTED: CTL-like protein 1-like isoform X2 [Bombyx mori]
Length=667

 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 34/110 (31%), Positives = 54/110 (49%), Gaps = 19/110 (17%)
 Frame = +1

Query  184  NRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDR-------HAD  342
             + C DV++L+I+I FW+ M++ +   F  GNP RL  G D  GN CG +       ++ 
Sbjct  19   KKGCTDVLWLVIYIVFWILMLIVACISFIYGNPQRLINGFDSFGNTCGVKSNKQLMNNSL  78

Query  343  PNLHELDLRYWLNPNEVYQSGPKDSDVK-LPNARSICLMDCPIPSEDSLN  489
              ++ LD +Y               DVK L  +  IC+ +CP    +SL+
Sbjct  79   SGINTLDKKYLF-----------FMDVKELRKSLKICVKECPNKKLESLD  117



>ref|XP_004926444.1| PREDICTED: CTL-like protein 1-like isoform X1 [Bombyx mori]
Length=668

 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 34/110 (31%), Positives = 54/110 (49%), Gaps = 19/110 (17%)
 Frame = +1

Query  184  NRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDR-------HAD  342
             + C DV++L+I+I FW+ M++ +   F  GNP RL  G D  GN CG +       ++ 
Sbjct  19   KKGCTDVLWLVIYIVFWILMLIVACISFIYGNPQRLINGFDSFGNTCGVKSNKQLMNNSL  78

Query  343  PNLHELDLRYWLNPNEVYQSGPKDSDVK-LPNARSICLMDCPIPSEDSLN  489
              ++ LD +Y               DVK L  +  IC+ +CP    +SL+
Sbjct  79   SGINTLDKKYLF-----------FMDVKELRKSLKICVKECPNKKLESLD  117



>ref|XP_001689518.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP09256.1| predicted protein [Chlamydomonas reinhardtii]
Length=777

 Score = 53.9 bits (128),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 45/89 (51%), Gaps = 11/89 (12%)
 Frame = +1

Query  214  LIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADPNLHELDLR-----YWL  378
            ++FIAFW  M +     F+QG P RL YG+D  G  CG ++   NL   DL      Y+ 
Sbjct  1    MLFIAFWAGMFIICGVAFSQGEPNRLVYGVDSWGMTCGTKNTLFNL-TFDLTEARNLYYF  59

Query  379  NPNEVYQSGPKDSDVKLPNARSICLMDCP  465
            NP ++  SG       L  A+++C   CP
Sbjct  60   NPTQLL-SGVTG----LLYAKTVCANSCP  83



>gb|KDR21092.1| CTL-like protein 1 [Zootermopsis nevadensis]
Length=667

 Score = 53.9 bits (128),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 48/98 (49%), Gaps = 11/98 (11%)
 Frame = +1

Query  184  NRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCG----DRHADPNL  351
             R C D+++L IFI FW  MI  ++F +  G+PL+L  G D  GN CG    ++     L
Sbjct  19   TRGCTDILWLCIFILFWFVMIYIAAFAYVYGDPLKLINGYDSFGNTCGVPNNEKMGGLEL  78

Query  352  HELDLRYWLNPNEVYQSGPKDSDVKLPNARSICLMDCP  465
              LD     +   ++    KD    + N+  IC+  CP
Sbjct  79   SGLDTS---DKRYLFYMDVKD----IQNSLKICVKQCP  109



>ref|XP_006815345.1| PREDICTED: choline transporter-like protein 1-like [Saccoglossus 
kowalevskii]
Length=385

 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 36/65 (55%), Gaps = 3/65 (5%)
 Frame = +1

Query  184  NRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHA---DPNLH  354
             R CRDV+ L+IF+AFW  M   +      G P RL +G D  GNVCG ++    +  L 
Sbjct  39   KRSCRDVICLIIFLAFWGGMGYIAYVAIRDGQPERLIFGADSYGNVCGSKNKPIDNVTLS  98

Query  355  ELDLR  369
             +D+R
Sbjct  99   GMDMR  103



>ref|XP_001654328.1| AAEL001935-PA [Aedes aegypti]
 sp|Q17JQ7.1|CTLH1_AEDAE RecName: Full=CTL-like protein 1 [Aedes aegypti]
 gb|EAT46917.1| AAEL001935-PA [Aedes aegypti]
Length=689

 Score = 53.9 bits (128),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +1

Query  187  RKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCG  327
            R C D+ +L+++I FW+A++V + F F  GNPLR+  G D  GN CG
Sbjct  18   RGCTDIFWLVVYILFWIALLVIAVFSFVYGNPLRVINGYDSFGNTCG  64



>ref|XP_003220049.1| PREDICTED: choline transporter-like protein 3 [Anolis carolinensis]
Length=657

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 57/116 (49%), Gaps = 10/116 (9%)
 Frame = +1

Query  187  RKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRH---ADPNLHE  357
            RKC D ++L+IF  FW  ++  + +    G+  RL +G D  GN+CG  +   A   L  
Sbjct  27   RKCTDPLWLMIFFLFWTGLMFITGYAITAGSAERLIFGYDSYGNICGRTNTPVAGAALSG  86

Query  358  LDLRYWLNPNEVY---QSGPKDSDVKLPNARSICLMDCPIPSEDSLNWVCDYPEGD  516
             D+R   N   V+     G    ++K+ N+ ++C+  CP    +SL  +  + E +
Sbjct  87   QDMR---NKRYVFFLNSCGMGIKNLKI-NSVALCVSSCPQEQLNSLEDIQHFAENN  138



>ref|XP_005107742.1| PREDICTED: choline transporter-like protein 1-like [Aplysia californica]
Length=618

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = +1

Query  178  KHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHAD  342
            + NR C D++  LIF+ F   MI  ++F  ++G+P RL YG D  GN C + ++D
Sbjct  28   RRNRGCTDIMVFLIFVFFVCGMIFIAAFSISKGDPFRLVYGTDSFGNTCDEDNSD  82



>ref|XP_005307600.1| PREDICTED: choline transporter-like protein 3 isoform X1 [Chrysemys 
picta bellii]
Length=667

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 49/102 (48%), Gaps = 2/102 (2%)
 Frame = +1

Query  187  RKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADPNLHELDL  366
            RKC DV++L++F  FW  ++  + +    G   RL +G D  GN+CG ++       L  
Sbjct  27   RKCTDVLWLILFFLFWAGLMFITGYAVTAGAAERLVFGYDSYGNICGRKNTYIQGAPLSG  86

Query  367  RYWLNPNEVYQSGPKDSDVK--LPNARSICLMDCPIPSEDSL  486
            +   N   V+       ++K    N+ ++C+  CP    +SL
Sbjct  87   QDMTNKKHVFFLNSCSLEIKNLKINSIALCVSSCPQEQLNSL  128



>gb|EJY77044.1| hypothetical protein OXYTRI_01325 [Oxytricha trifallax]
Length=601

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 49/102 (48%), Gaps = 23/102 (23%)
 Frame = +1

Query  181  HNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADPNLHEL  360
              RKC DV+F +IF+ F  AMI  S++G+ +G+P +L   LD  G++CG    DP   E 
Sbjct  11   KERKCTDVLFFIIFVIFLGAMIGCSAYGYQKGSPGKLFAPLDSDGHICG---YDPEYVEY  67

Query  361  DLRY-W------LNPNEVYQSGPKDSDVKLPNARSICLMDCP  465
               Y W       NP  ++ SG             +C+  CP
Sbjct  68   KYMYIWDIVAASKNPKSLFNSG-------------VCVKKCP  96



>ref|XP_002731355.1| PREDICTED: choline transporter-like protein 1-like [Saccoglossus 
kowalevskii]
Length=678

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 66/149 (44%), Gaps = 21/149 (14%)
 Frame = +1

Query  184  NRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADPNLHELD  363
             R+C D   ++IFI FW  M+  ++F F  GN  RL YG D  GNVC  +  +P +  + 
Sbjct  25   QRQCTDCTCVIIFILFWCGMLYIAAFSFTTGNVERLIYGYDSYGNVCNKK--NPPIENIP  82

Query  364  LR---YWLNPNEVYQSGPKDSDVKLPNARSICLMDCPIPSEDSLNWVCDYP-EGDIRLAV  531
                     P+  + +    SD     +  IC+  CP    ++++ V D+      RL  
Sbjct  83   FSGSDMTGKPHVFFMNVYNPSD-----SLEICVSKCPDIDLNTMSEVRDFTIRTGSRLC-  136

Query  532  ENWIDRNYDYFADLTPELRKKSLQLQGPC  618
                   YDY  D    +++ +   QGPC
Sbjct  137  ------RYDYEPDSYTSVKQGT---QGPC  156



>ref|XP_009046858.1| hypothetical protein LOTGIDRAFT_237969 [Lottia gigantea]
 gb|ESP02472.1| hypothetical protein LOTGIDRAFT_237969 [Lottia gigantea]
Length=628

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/119 (29%), Positives = 54/119 (45%), Gaps = 10/119 (8%)
 Frame = +1

Query  181  HNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRH---ADPNL  351
             NR  RDV+F+++ + +   M   S  G   GNP  L YG D  GN+C  ++      NL
Sbjct  18   ENRTVRDVLFIVLMLGYMAGMGYVSYIGITNGNPYSLFYGTDSWGNICSQQNEAIKGSNL  77

Query  352  HELDLRYWLNPNEVYQSGPKDSDVKL-----PNARSICLMDCPIPSEDSLNWVCDYPEG  513
              LD+R    P   Y       DV         +++IC+ +CP  +  S+  + ++  G
Sbjct  78   SGLDMR--TKPYIFYFDKDILKDVASGHYLDSTSKAICVSECPNETLSSVEEMQEFANG  134



>gb|KFB36013.1| AGAP006244-PA-like protein [Anopheles sinensis]
Length=689

 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 54/198 (27%), Positives = 78/198 (39%), Gaps = 43/198 (22%)
 Frame = +1

Query  187  RKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADP-------  345
            R   D+ +L+++I FWV +IV + F F  GNPLR+  G D  GN CG R  D        
Sbjct  18   RGHTDIFWLILYIVFWVGLIVIAIFSFIYGNPLRIINGYDSFGNTCGIRSNDKYSNFPLS  77

Query  346  --NLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICLMDCP---IPSEDSLNWVCD---  501
              N  +    ++L+  E            L +   IC+ +CP   I S   L    D   
Sbjct  78   GMNTEDKPYLFFLDIKE------------LRHTLKICVKECPTREIVSAAELYRYYDERN  125

Query  502  --YPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCYPV-IFPSVNVYWSCQFIA  672
              Y   D  +++    D N   + D             GPC P  ++ S  V   C  I 
Sbjct  126  TKYCRYDFNMSILQTQDSNGPKYFD-----------FNGPCPPFPVYQSAPVLHRC--IP  172

Query  673  RASNVSLRHWKEMGGIEN  726
               N  L+  K+M  + N
Sbjct  173  TGVNAPLQQVKKMYALIN  190



>ref|XP_011567525.1| PREDICTED: CTL-like protein 1, partial [Plutella xylostella]
Length=314

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 52/102 (51%), Gaps = 5/102 (5%)
 Frame = +1

Query  184  NRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADPNLHELD  363
             + C D+ +L+++I FW+ M+V ++  F  GNPLR+  G D  GN CG +  +  L +  
Sbjct  16   KKGCTDIFWLILYIIFWILMLVVAAISFVYGNPLRVINGFDSFGNTCGVKK-NAKLIDFP  74

Query  364  LRYWLNPNEVYQSGPKDSDVK-LPNARSICLMDCPIPSEDSL  486
            L      ++ Y       D+K L  +  IC+  CP    +SL
Sbjct  75   LAGISTEDKSYLFF---MDLKELRRSLKICVKKCPDKKLESL  113



>ref|XP_004519906.1| PREDICTED: CTL-like protein 1-like isoform X4 [Ceratitis capitata]
Length=682

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 47/98 (48%), Gaps = 13/98 (13%)
 Frame = +1

Query  187  RKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADPNLHELDL  366
            R C D  +L IFI FW+ +IV + F F  GNPLR+  G D  GN CG +  +        
Sbjct  20   RTCTDTFWLAIFILFWLFLIVIAIFSFVYGNPLRVINGYDSFGNTCGVKRNE--------  71

Query  367  RYWLNPNEVYQSGPKDS----DVKLP-NARSICLMDCP  465
            ++   PN    +  K      D K P  +  IC+ +CP
Sbjct  72   KFSTIPNSGMNTIDKPQLFYFDYKNPRQSIKICVKECP  109



>ref|XP_011200860.1| PREDICTED: CTL-like protein 1 [Bactrocera dorsalis]
 ref|XP_011200861.1| PREDICTED: CTL-like protein 1 [Bactrocera dorsalis]
Length=687

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = +1

Query  187  RKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRH  336
            R C D  +L IFI FW+ +IV + F F  GNPLR+  G D  GN CG + 
Sbjct  20   RTCTDTFWLAIFILFWLFLIVIAIFSFVYGNPLRVINGYDSFGNTCGVKR  69



>ref|XP_009056508.1| hypothetical protein LOTGIDRAFT_232925 [Lottia gigantea]
 gb|ESO92821.1| hypothetical protein LOTGIDRAFT_232925 [Lottia gigantea]
Length=705

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 44/164 (27%), Positives = 69/164 (42%), Gaps = 18/164 (11%)
 Frame = +1

Query  181  HNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRH-AD-PNLH  354
             NR C D+   ++F+ F + MI  S   +++G+P RL +  D KG +CG    AD P L 
Sbjct  29   ENRSCTDIFCCILFVVFIIGMISCSIVAYSRGDPQRLIHPTDSKGRLCGQGELADRPYLF  88

Query  355  ELDLRYWLNPNEVYQSGPKDSDVKLPNARSICLMDCPIPSEDSLNWVCDYPEGDIRLAVE  534
              DL       + ++ GP  +    P  + +C+  CP      L    D    +  + VE
Sbjct  89   FFDLF------QCFKMGPGVALAGCPTPQ-VCVKKCPSFQYVYLQARVDSTARNKTICVE  141

Query  535  NWIDRNYDYFADLTPELRK--------KSLQLQGPCYPVIFPSV  642
              +D N     D    ++K         S  + G C P IF  +
Sbjct  142  G-VDPNKGTLDDFESLVKKDYCAAYFVNSTSVVGRCIPSIFDKI  184



>ref|XP_004914329.1| PREDICTED: choline transporter-like protein 3-like [Xenopus (Silurana) 
tropicalis]
Length=270

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 56/106 (53%), Gaps = 4/106 (4%)
 Frame = +1

Query  187  RKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHAD-PN--LHE  357
            RKC D+ +L++F  FW  ++  + +    G   RL +G D  GNVCG R++  PN     
Sbjct  24   RKCTDIPWLVLFFVFWSGLVFIAGYALVAGAAERLVFGYDSYGNVCGRRNSPIPNAPFSG  83

Query  358  LDLRYWLNPNEVYQSGPKDSDVKLPNARSICLMDCPIPSEDSLNWV  495
             D+ Y  +   +     +  ++K+ N+ ++C+ DCP    ++L+ V
Sbjct  84   QDMTYRKHVFFLDSCNLEIRNLKI-NSVALCVSDCPQEQLNTLHEV  128



>emb|CDW80041.1| solute carrier family 44 protein member [Stylonychia lemnae]
Length=662

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 51/109 (47%), Gaps = 8/109 (7%)
 Frame = +1

Query  184  NRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADPNLHELD  363
            NR C DV+  L+F+AF V M   +++GF  G+P+ L  G DY  N CG      +   L 
Sbjct  45   NRSCTDVICCLLFLAFCVGMAGTAAYGFINGDPMLLLTGWDYDKNGCGYNTTTKDYPYL-  103

Query  364  LRYWLNPNEVYQSGPKDSDVKLPNARSICLMDCPIPSEDSLNWVCDYPE  510
              YW  P+    +    S+       S+C+ +CP     S   +C  P+
Sbjct  104  --YWPAPD----ASAISSNYYEAFRYSMCVKECP-TKNSSQAVLCKEPK  145



>ref|XP_004519903.1| PREDICTED: CTL-like protein 1-like isoform X1 [Ceratitis capitata]
 ref|XP_004519904.1| PREDICTED: CTL-like protein 1-like isoform X2 [Ceratitis capitata]
 ref|XP_004519905.1| PREDICTED: CTL-like protein 1-like isoform X3 [Ceratitis capitata]
Length=687

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 47/98 (48%), Gaps = 13/98 (13%)
 Frame = +1

Query  187  RKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADPNLHELDL  366
            R C D  +L IFI FW+ +IV + F F  GNPLR+  G D  GN CG +  +        
Sbjct  20   RTCTDTFWLAIFILFWLFLIVIAIFSFVYGNPLRVINGYDSFGNTCGVKRNE--------  71

Query  367  RYWLNPNEVYQSGPKDS----DVKLP-NARSICLMDCP  465
            ++   PN    +  K      D K P  +  IC+ +CP
Sbjct  72   KFSTIPNSGMNTIDKPQLFYFDYKNPRQSIKICVKECP  109



>ref|XP_011180668.1| PREDICTED: CTL-like protein 1 [Bactrocera cucurbitae]
 ref|XP_011180670.1| PREDICTED: CTL-like protein 1 [Bactrocera cucurbitae]
 ref|XP_011180671.1| PREDICTED: CTL-like protein 1 [Bactrocera cucurbitae]
Length=687

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = +1

Query  187  RKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRH  336
            R C D  +L IFI FW+ +IV + F F  GNPLR+  G D  GN CG + 
Sbjct  20   RTCTDTFWLAIFILFWLFLIVIAIFSFVYGNPLRVINGYDSFGNTCGVKR  69



>ref|XP_011415791.1| PREDICTED: choline transporter-like protein 1 isoform X1 [Crassostrea 
gigas]
Length=675

 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 29/49 (59%), Gaps = 0/49 (0%)
 Frame = +1

Query  184  NRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGD  330
            NR C D++ L++F+ FW  MI  ++F    G+  RL YG D  GN C +
Sbjct  51   NRGCTDIIILILFVLFWAGMIFIAAFSITHGDAWRLVYGYDSFGNTCDE  99



>ref|XP_011415793.1| PREDICTED: choline transporter-like protein 1 isoform X2 [Crassostrea 
gigas]
Length=675

 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 29/49 (59%), Gaps = 0/49 (0%)
 Frame = +1

Query  184  NRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGD  330
            NR C D++ L++F+ FW  MI  ++F    G+  RL YG D  GN C +
Sbjct  51   NRGCTDIIILILFVLFWAGMIFIAAFSITHGDAWRLVYGYDSFGNTCDE  99



>ref|XP_011415794.1| PREDICTED: choline transporter-like protein 1 isoform X3 [Crassostrea 
gigas]
 ref|XP_011415795.1| PREDICTED: choline transporter-like protein 1 isoform X3 [Crassostrea 
gigas]
 ref|XP_011415796.1| PREDICTED: choline transporter-like protein 1 isoform X3 [Crassostrea 
gigas]
Length=647

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 29/49 (59%), Gaps = 0/49 (0%)
 Frame = +1

Query  184  NRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGD  330
            NR C D++ L++F+ FW  MI  ++F    G+  RL YG D  GN C +
Sbjct  23   NRGCTDIIILILFVLFWAGMIFIAAFSITHGDAWRLVYGYDSFGNTCDE  71



>gb|EKC37701.1| Choline transporter-like protein 1 [Crassostrea gigas]
Length=647

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 29/49 (59%), Gaps = 0/49 (0%)
 Frame = +1

Query  184  NRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGD  330
            NR C D++ L++F+ FW  MI  ++F    G+  RL YG D  GN C +
Sbjct  23   NRGCTDIIILILFVLFWAGMIFIAAFSITHGDAWRLVYGYDSFGNTCDE  71



>ref|XP_008605389.1| hypothetical protein SDRG_01633 [Saprolegnia diclina VS20]
 gb|EQC41675.1| hypothetical protein SDRG_01633 [Saprolegnia diclina VS20]
Length=748

 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 64/128 (50%), Gaps = 17/128 (13%)
 Frame = +1

Query  160  SGDGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHA  339
            SG  +    RKCRDV+  L+F+ FW+ M + +  G + G P  L YG D+ G+VCG   +
Sbjct  15   SGGVVPNSTRKCRDVLCCLLFLLFWIGMAILAILGVSNGEPQSLIYGTDFNGSVCGTGDS  74

Query  340  DPNLHELDLRYW--LNPNEVYQS--GPKDSDVKLPNARSICLMDCPIPSEDSLNWVCDYP  507
            + +L      Y+  +  + + QS  G +  D+K      +C+  CP   +    ++C Y 
Sbjct  75   NASLI-----YYPRMTQDMLTQSAKGIQPLDMKF---FGLCVSACPSMGD----YICTYA  122

Query  508  -EGDIRLA  528
             E  IR A
Sbjct  123  TEASIRAA  130



>ref|XP_005178886.1| PREDICTED: CTL-like protein 1 [Musca domestica]
Length=683

 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 46/96 (48%), Gaps = 9/96 (9%)
 Frame = +1

Query  187  RKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHAD--PNLHEL  360
            R C D  +L ++I FW+ +IV + F F  GNPLR+  G D  GN CG +  +  P     
Sbjct  20   RTCTDTFWLAVYILFWLFLIVIAIFSFVYGNPLRVINGYDSFGNTCGVKKNERYPQFPLS  79

Query  361  DLRYWLNPNEVYQSGPKDSDVK-LPNARSICLMDCP  465
                   P  +Y       DVK L  +  +C+ +CP
Sbjct  80   GRNTLDTPQLLY------FDVKHLKKSLKVCVKECP  109



>ref|XP_002434061.1| conserved hypothetical protein [Ixodes scapularis]
 gb|EEC05461.1| conserved hypothetical protein, partial [Ixodes scapularis]
Length=626

 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 31/53 (58%), Gaps = 0/53 (0%)
 Frame = +1

Query  187  RKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVCGDRHADP  345
            R C D+   ++F+AFW   I  S+F F  GNP RL  G D  GNVCG  + +P
Sbjct  30   RGCTDLPCFVVFMAFWGTAIFVSAFAFVLGNPFRLISGYDSFGNVCGMNNDEP  82



>gb|KFM79681.1| hypothetical protein X975_14148, partial [Stegodyphus mimosarum]
Length=704

 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 49/189 (26%), Positives = 74/189 (39%), Gaps = 34/189 (18%)
 Frame = +1

Query  133  SSDGNGEVSSGD----GIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYG  300
            SS   GE  + D    G +KH R C D+  L +F+AF    IV + F F +G+P  L Y 
Sbjct  12   SSGKYGESLTYDPEFRGPVKH-RSCTDIFCLFLFVAFIGGWIVVAFFAFREGDPRLLLYP  70

Query  301  LDYKGNVC--GDRHADPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICLMDCPIPS  474
             D +G++C  GD      L   DL     P+ V+   P            +C+  CP  +
Sbjct  71   TDSEGHICGTGDLEDKKFLFFFDLMKCARPSVVFTGCPTP---------QVCVDKCPDET  121

Query  475  -----------EDSLNWVCDYPEGDIRLAVENWIDRNYDYFADLTPELRKKSLQLQGPCY  621
                       E     +C Y        +E  +        D   +L  +S  + G C 
Sbjct  122  FFANPYASNADEIKRKLICKYNVSKTDKTLEELLK------GDQCAQLYFRSTAMLGRCI  175

Query  622  P-VIFPSVN  645
            P ++F  V+
Sbjct  176  PEIVFKGVS  184



>gb|ELU15407.1| hypothetical protein CAPTEDRAFT_224558 [Capitella teleta]
Length=959

 Score = 50.8 bits (120),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 51/102 (50%), Gaps = 10/102 (10%)
 Frame = +1

Query  166  DGIIKHNRKCRDVVFLLIFIAFWVAMIVNSSFGFNQGNPLRLTYGLDYKGNVC--GDRHA  339
            +G IK NR C DV+  ++F+ F VA I+   + F  G+P  L Y  D +GN+C  GD   
Sbjct  38   NGPIK-NRSCTDVICCIMFLVFIVAFIIVGIWAFAMGDPRVLLYPSDSEGNICGYGDFEN  96

Query  340  DPNLHELDLRYWLNPNEVYQSGPKDSDVKLPNARSICLMDCP  465
             P +   DL       +  ++GP    +  P  + IC+  CP
Sbjct  97   KPYVFFFDLL------DCAKTGPAIIALGCPTPQ-ICIEQCP  131



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1683214431688