BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig3569

Length=672
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KJB42837.1|  hypothetical protein B456_007G169700                    246   2e-76   Gossypium raimondii
ref|XP_009804684.1|  PREDICTED: protein disulfide isomerase-like 2-3    248   2e-76   Nicotiana sylvestris
ref|XP_011085485.1|  PREDICTED: protein disulfide isomerase-like 2-3    246   2e-75   Sesamum indicum [beniseed]
gb|KJB42838.1|  hypothetical protein B456_007G169700                    246   2e-75   Gossypium raimondii
ref|XP_011003479.1|  PREDICTED: protein disulfide isomerase-like 2-3    244   1e-74   Populus euphratica
ref|XP_010556968.1|  PREDICTED: protein disulfide-isomerase like ...    244   1e-74   Tarenaya hassleriana [spider flower]
ref|XP_011100470.1|  PREDICTED: protein disulfide isomerase-like 2-3    244   1e-74   Sesamum indicum [beniseed]
ref|XP_011016519.1|  PREDICTED: protein disulfide isomerase-like 2-3    244   1e-74   Populus euphratica
gb|KJB10303.1|  hypothetical protein B456_001G195100                    239   2e-74   Gossypium raimondii
gb|KJB10302.1|  hypothetical protein B456_001G195100                    239   2e-74   Gossypium raimondii
ref|XP_002320494.2|  thioredoxin family protein                         243   2e-74   Populus trichocarpa [western balsam poplar]
ref|XP_010035498.1|  PREDICTED: protein disulfide isomerase-like 2-3    242   6e-74   Eucalyptus grandis [rose gum]
gb|KJB10305.1|  hypothetical protein B456_001G195100                    238   1e-73   Gossypium raimondii
ref|XP_010522374.1|  PREDICTED: protein disulfide-isomerase 2-3-like    240   2e-73   Tarenaya hassleriana [spider flower]
ref|XP_010110229.1|  Protein disulfide-isomerase like 2-2               239   9e-73   
gb|KJB10301.1|  hypothetical protein B456_001G195100                    238   1e-72   Gossypium raimondii
gb|KJB10306.1|  hypothetical protein B456_001G195100                    238   1e-72   Gossypium raimondii
ref|XP_006829505.1|  PREDICTED: protein disulfide isomerase-like 2-3    238   2e-72   Amborella trichopoda
ref|XP_004304072.1|  PREDICTED: protein disulfide isomerase-like 2-3    238   2e-72   Fragaria vesca subsp. vesca
ref|XP_004143192.1|  PREDICTED: protein disulfide isomerase-like 2-3    238   3e-72   Cucumis sativus [cucumbers]
ref|XP_009365136.1|  PREDICTED: protein disulfide isomerase-like 2-3    237   6e-72   Pyrus x bretschneideri [bai li]
gb|KHG02314.1|  Protein disulfide-isomerase like 2-2                    236   7e-72   Gossypium arboreum [tree cotton]
ref|XP_008229815.1|  PREDICTED: protein disulfide isomerase-like 2-3    237   9e-72   Prunus mume [ume]
emb|CDP05711.1|  unnamed protein product                                236   9e-72   Coffea canephora [robusta coffee]
ref|XP_007215346.1|  hypothetical protein PRUPE_ppa005396mg             237   1e-71   Prunus persica
ref|XP_009409222.1|  PREDICTED: protein disulfide isomerase-like ...    236   2e-71   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009409223.1|  PREDICTED: protein disulfide isomerase-like ...    236   2e-71   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008379697.1|  PREDICTED: protein disulfide isomerase-like 2-3    235   3e-71   
ref|XP_008456396.1|  PREDICTED: protein disulfide isomerase-like 2-3    234   5e-71   Cucumis melo [Oriental melon]
ref|XP_009143922.1|  PREDICTED: protein disulfide-isomerase 2-3         234   6e-71   Brassica rapa
gb|AFK43048.1|  unknown                                                 234   7e-71   Lotus japonicus
emb|CDY52544.1|  BnaA05g35030D                                          234   7e-71   Brassica napus [oilseed rape]
ref|XP_008805603.1|  PREDICTED: protein disulfide isomerase-like 2-3    234   8e-71   Phoenix dactylifera
emb|CDY12149.1|  BnaC04g11790D                                          234   9e-71   Brassica napus [oilseed rape]
ref|XP_010252582.1|  PREDICTED: protein disulfide isomerase-like 2-3    233   2e-70   Nelumbo nucifera [Indian lotus]
ref|XP_006306333.1|  hypothetical protein CARUB_v10012209mg             232   4e-70   Capsella rubella
ref|XP_010484503.1|  PREDICTED: protein disulfide-isomerase like ...    232   5e-70   Camelina sativa [gold-of-pleasure]
ref|XP_004491086.1|  PREDICTED: protein disulfide isomerase-like ...    231   8e-70   Cicer arietinum [garbanzo]
ref|XP_006410429.1|  hypothetical protein EUTSA_v10016663mg             231   9e-70   Eutrema salsugineum [saltwater cress]
ref|XP_006418074.1|  hypothetical protein EUTSA_v10007682mg             231   9e-70   Eutrema salsugineum [saltwater cress]
ref|NP_001236576.1|  protein disulfide isomerse like protein prec...    231   1e-69   Glycine max [soybeans]
ref|NP_171990.3|  protein disulfide-isomerase like 2-2                  231   1e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002892256.1|  hypothetical protein ARALYDRAFT_470488             231   1e-69   Arabidopsis lyrata subsp. lyrata
gb|KHN44746.1|  Protein disulfide isomerase-like 2-3                    231   1e-69   Glycine soja [wild soybean]
ref|XP_010475171.1|  PREDICTED: protein disulfide-isomerase like 2-2    231   1e-69   Camelina sativa [gold-of-pleasure]
gb|AAF40463.1|AC004809_21  Strong simialrity to the disulfide iso...    231   1e-69   Arabidopsis thaliana [mouse-ear cress]
gb|EPS59466.1|  hypothetical protein M569_15341                         223   2e-69   Genlisea aurea
gb|ACU17741.1|  unknown                                                 231   2e-69   Glycine max [soybeans]
ref|XP_010509948.1|  PREDICTED: protein disulfide-isomerase 2-3 i...    230   2e-69   
ref|XP_006294195.1|  hypothetical protein CARUB_v10023191mg             230   3e-69   
ref|NP_180851.1|  protein disulfide-isomerase like 2-3                  230   4e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008342147.1|  PREDICTED: protein disulfide isomerase-like 2-3    229   4e-69   Malus domestica [apple tree]
ref|XP_010469533.1|  PREDICTED: protein disulfide-isomerase 2-3-like    229   8e-69   Camelina sativa [gold-of-pleasure]
ref|XP_002460311.1|  hypothetical protein SORBIDRAFT_02g026300          228   1e-68   Sorghum bicolor [broomcorn]
emb|CDY53400.1|  BnaAnng12480D                                          224   3e-68   Brassica napus [oilseed rape]
ref|NP_001105804.1|  protein disulfide isomerase8 precursor             227   4e-68   Zea mays [maize]
ref|XP_010413931.1|  PREDICTED: protein disulfide-isomerase 2-3-like    226   7e-68   Camelina sativa [gold-of-pleasure]
ref|XP_007141667.1|  hypothetical protein PHAVU_008G215100g             226   1e-67   Phaseolus vulgaris [French bean]
emb|CDX79497.1|  BnaC03g18330D                                          226   1e-67   
ref|XP_002881252.1|  hypothetical protein ARALYDRAFT_482234             225   2e-67   
ref|XP_012080662.1|  PREDICTED: protein disulfide isomerase-like 2-3    225   2e-67   Jatropha curcas
ref|XP_003616851.1|  Protein disulfide isomerase family                 224   4e-67   Medicago truncatula
ref|XP_009119218.1|  PREDICTED: protein disulfide-isomerase like 2-2    224   5e-67   Brassica rapa
emb|CDY18278.1|  BnaC05g03010D                                          224   6e-67   Brassica napus [oilseed rape]
ref|XP_009606235.1|  PREDICTED: protein disulfide isomerase-like 2-3    222   2e-66   Nicotiana tomentosiformis
ref|XP_010270060.1|  PREDICTED: protein disulfide isomerase-like ...    221   5e-66   Nelumbo nucifera [Indian lotus]
ref|XP_002276520.1|  PREDICTED: protein disulfide isomerase-like 2-3    221   7e-66   Vitis vinifera
ref|XP_003519441.1|  PREDICTED: protein disulfide isomerase-like ...    219   5e-65   Glycine max [soybeans]
ref|XP_008668262.1|  PREDICTED: uncharacterized protein LOC100381...    218   1e-64   
ref|XP_007049203.1|  PDI-like 2-2                                       218   1e-64   Theobroma cacao [chocolate]
dbj|BAD38009.1|  putative protein disulfide-isomerase A6 precursor      215   5e-64   Oryza sativa Japonica Group [Japonica rice]
gb|KHG30032.1|  Protein disulfide-isomerase like 2-2                    215   1e-63   Gossypium arboreum [tree cotton]
ref|NP_001063331.1|  Os09g0451500                                       215   2e-63   
gb|EEC84682.1|  hypothetical protein OsI_31602                          215   2e-63   Oryza sativa Indica Group [Indian rice]
ref|XP_010688926.1|  PREDICTED: protein disulfide isomerase-like 2-3    214   3e-63   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004243508.1|  PREDICTED: protein disulfide isomerase-like 2-3    214   4e-63   Solanum lycopersicum
gb|EYU43141.1|  hypothetical protein MIMGU_mgv1a006693mg                213   1e-62   Erythranthe guttata [common monkey flower]
ref|XP_006357974.1|  PREDICTED: protein disulfide isomerase-like ...    212   2e-62   Solanum tuberosum [potatoes]
ref|XP_006447669.1|  hypothetical protein CICLE_v10015327mg             210   8e-62   Citrus clementina [clementine]
ref|XP_006469595.1|  PREDICTED: LOW QUALITY PROTEIN: protein disu...    211   9e-62   
gb|KDO59568.1|  hypothetical protein CISIN_1g014216mg                   209   2e-61   Citrus sinensis [apfelsine]
gb|KFK31099.1|  hypothetical protein AALP_AA6G068000                    209   2e-61   Arabis alpina [alpine rockcress]
ref|XP_002528963.1|  protein disulfide isomerase, putative              207   2e-61   
gb|KDO59567.1|  hypothetical protein CISIN_1g014216mg                   209   3e-61   Citrus sinensis [apfelsine]
ref|XP_010913398.1|  PREDICTED: protein disulfide isomerase-like 2-3    206   5e-60   Elaeis guineensis
dbj|BAJ84858.1|  predicted protein                                      203   6e-59   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004956980.1|  PREDICTED: protein disulfide isomerase-like ...    202   9e-59   Setaria italica
gb|EMT02125.1|  Protein disulfide-isomerase A6                          198   4e-57   
emb|CBG91909.1|  putative PDI-like protein                              196   2e-56   Triticum aestivum [Canadian hard winter wheat]
emb|CBG91908.1|  putative PDI-like protein                              195   6e-56   Triticum aestivum [Canadian hard winter wheat]
dbj|BAO79454.1|  protein disulfide isomerase family protein 5-1         194   1e-55   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003578205.1|  PREDICTED: protein disulfide isomerase-like 2-3    194   2e-55   Brachypodium distachyon [annual false brome]
ref|XP_006661300.1|  PREDICTED: protein disulfide isomerase-like ...    191   2e-54   
emb|CBG91899.1|  putative PDI-like protein                              191   2e-54   Triticum aestivum [Canadian hard winter wheat]
gb|ACN39830.1|  unknown                                                 189   2e-53   Picea sitchensis
gb|KHN38504.1|  Protein disulfide isomerase-like 2-3                    184   4e-52   Glycine soja [wild soybean]
gb|EMS60416.1|  Protein disulfide isomerase-like 2-3                    179   2e-50   Triticum urartu
ref|XP_001780684.1|  predicted protein                                  174   9e-48   
gb|EAZ44947.1|  hypothetical protein OsJ_29589                          163   9e-47   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002973288.1|  hypothetical protein SELMODRAFT_232026             162   3e-43   Selaginella moellendorffii
ref|XP_002976616.1|  hypothetical protein SELMODRAFT_232834             160   1e-42   Selaginella moellendorffii
ref|XP_006869520.1|  PREDICTED: protein disulfide-isomerase A6          148   3e-38   Chrysochloris asiatica
gb|ABN09749.1|  Ribonuclease T2; Thioredoxin domain 2; Thioredoxi...    145   1e-37   Medicago truncatula
ref|XP_003594130.1|  Protein disulfide-isomerase A6                     145   1e-37   
gb|ELK29163.1|  Protein disulfide-isomerase A6                          146   3e-37   Myotis davidii
ref|XP_006765261.1|  PREDICTED: protein disulfide-isomerase A6          146   4e-37   
ref|XP_006102414.1|  PREDICTED: protein disulfide-isomerase A6          145   4e-37   
gb|EPQ08422.1|  Protein disulfide-isomerase A6                          145   5e-37   Myotis brandtii
ref|XP_005867329.1|  PREDICTED: protein disulfide-isomerase A6          144   1e-36   
ref|XP_011160406.1|  PREDICTED: protein disulfide-isomerase A6          144   1e-36   Solenopsis invicta [imported red fire ant]
ref|XP_007529904.1|  PREDICTED: protein disulfide-isomerase A6          143   2e-36   Erinaceus europaeus [common hedgehog]
ref|XP_007243763.1|  PREDICTED: protein disulfide-isomerase A6-like     137   3e-36   
ref|XP_005803193.1|  PREDICTED: protein disulfide-isomerase A6-li...    143   3e-36   Xiphophorus maculatus
ref|XP_003488434.1|  PREDICTED: protein disulfide-isomerase A6-like     142   4e-36   Bombus impatiens
ref|XP_007257385.1|  PREDICTED: protein disulfide-isomerase A6          142   4e-36   Astyanax mexicanus [blind cave fish]
ref|XP_005803194.1|  PREDICTED: protein disulfide-isomerase A6-li...    142   4e-36   Xiphophorus maculatus
ref|XP_003398403.1|  PREDICTED: protein disulfide-isomerase A6-like     142   4e-36   
ref|XP_008287318.1|  PREDICTED: protein disulfide-isomerase A6          142   5e-36   Stegastes partitus
ref|XP_007546385.1|  PREDICTED: protein disulfide-isomerase A6 is...    142   5e-36   Poecilia formosa
ref|XP_008160636.1|  PREDICTED: protein disulfide-isomerase A6          142   6e-36   Eptesicus fuscus
ref|XP_008528120.1|  PREDICTED: protein disulfide-isomerase A6          142   6e-36   Equus przewalskii [Przewalski horse]
ref|XP_007546392.1|  PREDICTED: protein disulfide-isomerase A6 is...    142   7e-36   Poecilia formosa
ref|XP_006903376.1|  PREDICTED: protein disulfide-isomerase A6-like     142   7e-36   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|NP_922915.2|  protein disulfide-isomerase A6 precursor              141   8e-36   Danio rerio [leopard danio]
gb|AAK71636.1|AF387900_1  protein disulfide isomerase-related pro...    141   9e-36   Danio rerio [leopard danio]
ref|XP_011689873.1|  PREDICTED: protein disulfide-isomerase A6          141   1e-35   Wasmannia auropunctata
ref|XP_011062424.1|  PREDICTED: protein disulfide-isomerase A6          141   1e-35   Acromyrmex echinatior
ref|XP_012055150.1|  PREDICTED: protein disulfide-isomerase A6          141   1e-35   Atta cephalotes
gb|EFN84761.1|  Protein disulfide-isomerase A6                          140   1e-35   Harpegnathos saltator
ref|XP_011139060.1|  PREDICTED: protein disulfide-isomerase A6 is...    140   2e-35   Harpegnathos saltator
emb|CDJ95511.1|  Thioredoxin domain containing protein                  140   3e-35   Haemonchus contortus [red stomach worm]
ref|XP_010887778.1|  PREDICTED: protein disulfide-isomerase A6          139   6e-35   Esox lucius
ref|XP_011139061.1|  PREDICTED: protein disulfide-isomerase A6 is...    139   7e-35   Harpegnathos saltator
gb|EGT53613.1|  hypothetical protein CAEBREN_31752                      139   9e-35   Caenorhabditis brenneri
ref|XP_011881632.1|  PREDICTED: protein disulfide-isomerase A6          138   1e-34   Vollenhovia emeryi
ref|NP_001265732.1|  protein disulfide-isomerase A6 precursor           138   1e-34   Ictalurus punctatus
ref|XP_010336276.1|  PREDICTED: protein disulfide-isomerase A6          139   1e-34   Saimiri boliviensis boliviensis
ref|XP_003458276.1|  PREDICTED: protein disulfide-isomerase A6-like     138   2e-34   Oreochromis niloticus
ref|XP_010781928.1|  PREDICTED: protein disulfide-isomerase A6          138   2e-34   Notothenia coriiceps [yellowbelly rockcod]
gb|ABG81451.1|  protein disulfide isomerase-associated 6                132   4e-34   Bos taurus [bovine]
ref|XP_011266529.1|  PREDICTED: protein disulfide-isomerase A6          137   5e-34   Camponotus floridanus
ref|XP_006976688.1|  PREDICTED: protein disulfide-isomerase A6          137   7e-34   Peromyscus maniculatus bairdii
ref|XP_004568809.1|  PREDICTED: protein disulfide-isomerase A6-li...    136   8e-34   Maylandia zebra
ref|XP_005731103.1|  PREDICTED: protein disulfide-isomerase A6-like     136   8e-34   Pundamilia nyererei
ref|XP_010962323.1|  PREDICTED: protein disulfide-isomerase A6          136   9e-34   Camelus bactrianus [camel]
ref|XP_006197174.1|  PREDICTED: protein disulfide-isomerase A6          135   1e-33   Vicugna pacos
ref|XP_003411934.1|  PREDICTED: protein disulfide-isomerase A6          135   1e-33   Loxodonta africana [African bush elephant]
ref|XP_006191925.1|  PREDICTED: protein disulfide-isomerase A6          135   1e-33   Camelus ferus
ref|XP_007195772.1|  PREDICTED: protein disulfide-isomerase A6          135   1e-33   
ref|XP_004568810.1|  PREDICTED: protein disulfide-isomerase A6-li...    135   1e-33   Maylandia zebra
ref|XP_003744350.1|  PREDICTED: protein disulfide-isomerase A6-like     135   2e-33   Galendromus occidentalis
gb|EHB04452.1|  Protein disulfide-isomerase A6                          135   2e-33   Heterocephalus glaber [naked mole rat]
ref|XP_007127699.1|  PREDICTED: protein disulfide-isomerase A6          135   2e-33   
ref|XP_004870016.1|  PREDICTED: protein disulfide-isomerase A6          135   2e-33   Heterocephalus glaber [naked mole rat]
gb|ELK13980.1|  Protein disulfide-isomerase A6                          135   2e-33   Pteropus alecto
ref|XP_006792591.1|  PREDICTED: protein disulfide-isomerase A6-li...    135   2e-33   Neolamprologus brichardi [lyretail cichlid]
ref|XP_004887060.1|  PREDICTED: protein disulfide-isomerase A6          135   2e-33   
ref|XP_004642404.1|  PREDICTED: protein disulfide-isomerase A6          135   3e-33   
ref|XP_006792592.1|  PREDICTED: protein disulfide-isomerase A6-li...    134   3e-33   Neolamprologus brichardi [lyretail cichlid]
ref|XP_001502324.3|  PREDICTED: protein disulfide-isomerase A6          134   4e-33   
ref|XP_008848336.1|  PREDICTED: protein disulfide-isomerase A6          134   4e-33   Nannospalax galili
ref|XP_004436529.1|  PREDICTED: protein disulfide-isomerase A6          134   4e-33   
gb|KFU90776.1|  Protein disulfide-isomerase A6                          134   4e-33   Chaetura pelagica
ref|XP_006910476.1|  PREDICTED: protein disulfide-isomerase A6          134   4e-33   
gb|ACI34364.1|  disulfide-isomerase A6 precursor                        134   4e-33   Salmo salar
ref|XP_005404513.1|  PREDICTED: protein disulfide-isomerase A6          135   5e-33   
ref|XP_011489880.1|  PREDICTED: protein disulfide-isomerase A6 is...    134   5e-33   Oryzias latipes [Japanese rice fish]
ref|XP_009997534.1|  PREDICTED: protein disulfide-isomerase A6          134   5e-33   Chaetura pelagica
ref|XP_532876.2|  PREDICTED: protein disulfide-isomerase A6             134   5e-33   Canis lupus familiaris [dogs]
emb|CDQ62935.1|  unnamed protein product                                134   5e-33   Oncorhynchus mykiss
emb|CAH65062.1|  hypothetical protein RCJMB04_2j3                       130   6e-33   Gallus gallus [bantam]
ref|XP_004582660.1|  PREDICTED: protein disulfide-isomerase A6 is...    133   7e-33   Ochotona princeps [southern American pika]
ref|XP_004083501.1|  PREDICTED: protein disulfide-isomerase A6 is...    133   8e-33   Oryzias latipes [Japanese rice fish]
emb|CAJ82905.1|  protein disulfide isomerase family A, member 6         133   8e-33   Xenopus tropicalis [western clawed frog]
ref|XP_011363442.1|  PREDICTED: protein disulfide-isomerase A6          135   8e-33   Pteropus vampyrus
ref|NP_001007974.1|  protein disulfide-isomerase A6 precursor           133   8e-33   Xenopus tropicalis [western clawed frog]
ref|XP_004582659.1|  PREDICTED: protein disulfide-isomerase A6 is...    133   9e-33   Ochotona princeps [southern American pika]
gb|EFB24563.1|  hypothetical protein PANDA_010457                       132   1e-32   Ailuropoda melanoleuca
ref|XP_002408975.1|  protein disulfide isomerase 1, putative            133   1e-32   Ixodes scapularis [blacklegged tick]
ref|XP_011820677.1|  PREDICTED: protein disulfide-isomerase A6 is...    133   1e-32   Mandrillus leucophaeus
ref|XP_009181940.1|  PREDICTED: protein disulfide-isomerase A6 is...    133   1e-32   
ref|NP_001253564.1|  protein disulfide-isomerase A6 precursor           133   1e-32   Macaca mulatta [rhesus macaque]
ref|NP_001182048.1|  protein disulfide-isomerase A6 precursor           133   1e-32   Sus scrofa [pigs]
ref|XP_003908325.1|  PREDICTED: protein disulfide-isomerase A6 is...    133   1e-32   Papio anubis [baboon]
ref|XP_007933283.1|  PREDICTED: protein disulfide-isomerase A6          132   1e-32   Orycteropus afer afer
ref|XP_004401842.1|  PREDICTED: protein disulfide-isomerase A6          132   1e-32   Odobenus rosmarus divergens
ref|XP_010377997.1|  PREDICTED: protein disulfide-isomerase A6          133   1e-32   Rhinopithecus roxellana
gb|EHH21891.1|  hypothetical protein EGK_05054                          133   1e-32   Macaca mulatta [rhesus macaque]
ref|XP_003971872.1|  PREDICTED: protein disulfide-isomerase A6 is...    132   1e-32   
ref|XP_011343321.1|  PREDICTED: protein disulfide-isomerase A6 is...    132   1e-32   Ooceraea biroi
ref|XP_011343320.1|  PREDICTED: protein disulfide-isomerase A6 is...    132   1e-32   Ooceraea biroi
ref|XP_006745860.1|  PREDICTED: protein disulfide-isomerase A6          132   1e-32   Leptonychotes weddellii
ref|XP_008686251.1|  PREDICTED: protein disulfide-isomerase A6          133   1e-32   Ursus maritimus [white bear]
ref|XP_011820676.1|  PREDICTED: protein disulfide-isomerase A6 is...    132   2e-32   Mandrillus leucophaeus
gb|AAI48887.1|  PDIA6 protein                                           132   2e-32   Bos taurus [bovine]
ref|XP_002921563.2|  PREDICTED: protein disulfide-isomerase A6          133   2e-32   Ailuropoda melanoleuca
ref|NP_001193274.1|  protein disulfide-isomerase A6 precursor           132   2e-32   Bos taurus [bovine]
gb|ELR58675.1|  Protein disulfide-isomerase A6                          132   2e-32   Bos mutus
ref|XP_004005734.1|  PREDICTED: protein disulfide-isomerase A6 is...    132   2e-32   
ref|XP_004686132.1|  PREDICTED: protein disulfide-isomerase A6          132   2e-32   
ref|XP_011508610.1|  PREDICTED: protein disulfide-isomerase A6 is...    132   2e-32   Homo sapiens [man]
emb|CDP96040.1|  Protein BM-TAG-320, isoform b                          132   2e-32   
ref|XP_010304195.1|  PREDICTED: protein disulfide-isomerase A6          132   2e-32   Balearica regulorum gibbericeps
gb|KFO12540.1|  Protein disulfide-isomerase A6                          132   2e-32   Balearica regulorum gibbericeps
ref|XP_008570350.1|  PREDICTED: protein disulfide-isomerase A6          132   2e-32   Galeopterus variegatus [Malayan flying lemur]
ref|XP_009961799.1|  PREDICTED: protein disulfide-isomerase A6          132   2e-32   Tyto alba [Schleiereule]
ref|XP_003215468.2|  PREDICTED: protein disulfide-isomerase A6          132   2e-32   Anolis carolinensis [Carolina anole]
ref|XP_004028893.1|  PREDICTED: protein disulfide-isomerase A6 is...    132   2e-32   
gb|KHJ46223.1|  protein disulfide-isomerase domain protein              132   2e-32   Trichuris suis
ref|NP_001269636.1|  protein disulfide-isomerase A6 isoform e pre...    132   2e-32   Homo sapiens [man]
ref|XP_006138598.1|  PREDICTED: protein disulfide-isomerase A6          132   3e-32   Pelodiscus sinensis [Chinese softshell turtle]
gb|KFV46902.1|  Protein disulfide-isomerase A6                          132   3e-32   Tyto alba [Schleiereule]
ref|XP_007456979.1|  PREDICTED: protein disulfide-isomerase A6          132   3e-32   Lipotes vexillifer [baiji]
ref|NP_001126483.1|  protein disulfide-isomerase A6 precursor           132   3e-32   Pongo abelii [orang utan]
ref|XP_005366580.1|  PREDICTED: protein disulfide-isomerase A6          132   3e-32   Microtus ochrogaster [prairie voles]
ref|NP_005733.1|  protein disulfide-isomerase A6 isoform d precursor    132   3e-32   Homo sapiens [man]
ref|NP_001233576.1|  protein disulfide-isomerase A6 precursor           132   3e-32   Pan troglodytes
ref|XP_004665748.1|  PREDICTED: protein disulfide-isomerase A6          132   3e-32   Jaculus jaculus
ref|XP_008248061.1|  PREDICTED: protein disulfide-isomerase A6          132   3e-32   Oryctolagus cuniculus [domestic rabbit]
ref|XP_004274932.1|  PREDICTED: protein disulfide-isomerase A6          132   3e-32   
ref|XP_004373116.1|  PREDICTED: protein disulfide-isomerase A6          132   3e-32   Trichechus manatus latirostris
dbj|BAG54757.1|  unnamed protein product                                132   3e-32   Homo sapiens [man]
ref|NP_001269635.1|  protein disulfide-isomerase A6 isoform c           131   3e-32   Homo sapiens [man]
dbj|BAH12614.1|  unnamed protein product                                131   3e-32   Homo sapiens [man]
gb|KFD51103.1|  hypothetical protein M513_08003                         132   3e-32   Trichuris suis
emb|CDQ71639.1|  unnamed protein product                                131   3e-32   Oncorhynchus mykiss
ref|NP_001269634.1|  protein disulfide-isomerase A6 isoform b           132   3e-32   Homo sapiens [man]
ref|XP_010850414.1|  PREDICTED: protein disulfide-isomerase A6          132   4e-32   Bison bison bison
ref|XP_004746019.1|  PREDICTED: protein disulfide-isomerase A6          131   4e-32   
dbj|BAF63672.1|  protein disulfide isomerase-1                          131   4e-32   Haemaphysalis longicornis
tpg|DAA24511.1|  TPA: protein disulfide isomerase family A, member 6    132   4e-32   Bos taurus [bovine]
ref|XP_008311310.1|  PREDICTED: protein disulfide-isomerase A6          131   4e-32   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_004310310.1|  PREDICTED: protein disulfide-isomerase A6 is...    131   4e-32   
ref|XP_005085000.1|  PREDICTED: protein disulfide-isomerase A6          131   4e-32   Mesocricetus auratus [Syrian golden hamster]
emb|CAG03659.1|  unnamed protein product                                131   4e-32   Tetraodon nigroviridis
ref|XP_003272792.1|  PREDICTED: LOW QUALITY PROTEIN: protein disu...    131   5e-32   
dbj|BAB24354.1|  unnamed protein product                                130   5e-32   Mus musculus [mouse]
ref|XP_002586165.1|  hypothetical protein BRAFLDRAFT_289141             131   5e-32   Branchiostoma floridae
ref|XP_006073828.1|  PREDICTED: LOW QUALITY PROTEIN: protein disu...    132   5e-32   
gb|EMP42001.1|  Protein disulfide-isomerase A6                          131   5e-32   Chelonia mydas [green seaturtle]
ref|XP_007053233.1|  PREDICTED: protein disulfide-isomerase A6          131   5e-32   
gb|ERE68285.1|  protein disulfide-isomerase A6-like protein             129   5e-32   Cricetulus griseus [Chinese hamsters]
gb|EDK98488.1|  protein disulfide isomerase associated 6, isoform...    130   5e-32   Mus musculus [mouse]
dbj|BAC86977.1|  unnamed protein product                                131   5e-32   Homo sapiens [man]
ref|NP_001269633.1|  protein disulfide-isomerase A6 isoform a           131   5e-32   Homo sapiens [man]
gb|ACI33422.1|  disulfide-isomerase A6 precursor                        131   5e-32   Salmo salar
ref|XP_009806227.1|  PREDICTED: protein disulfide-isomerase A6          130   6e-32   Gavia stellata
gb|KFV41194.1|  Protein disulfide-isomerase A6                          130   6e-32   Gavia stellata
ref|XP_010706217.1|  PREDICTED: protein disulfide-isomerase A6          130   6e-32   Meleagris gallopavo [common turkey]
gb|EDK98487.1|  protein disulfide isomerase associated 6, isoform...    130   6e-32   Mus musculus [mouse]
sp|Q63081.2|PDIA6_RAT  RecName: Full=Protein disulfide-isomerase ...    130   7e-32   Rattus norvegicus [brown rat]
ref|XP_001438686.1|  hypothetical protein                               130   8e-32   Paramecium tetraurelia strain d4-2
sp|Q922R8.3|PDIA6_MOUSE  RecName: Full=Protein disulfide-isomeras...    130   8e-32   Mus musculus [mouse]
ref|NP_082235.1|  protein disulfide-isomerase A6 precursor              130   8e-32   
ref|XP_009489926.1|  PREDICTED: protein disulfide-isomerase A6          130   8e-32   Pelecanus crispus
gb|KFQ39965.1|  Protein disulfide-isomerase A6                          130   8e-32   Mesitornis unicolor
ref|NP_001004442.1|  protein disulfide-isomerase A6 precursor           130   8e-32   Rattus norvegicus [brown rat]
gb|KFQ57711.1|  Protein disulfide-isomerase A6                          130   8e-32   Pelecanus crispus
ref|XP_002758076.1|  PREDICTED: protein disulfide-isomerase A6          130   8e-32   Callithrix jacchus [common marmoset]
ref|XP_005014200.1|  PREDICTED: protein disulfide-isomerase A6          130   8e-32   
emb|CAA55891.1|  CaBP1                                                  130   8e-32   Rattus norvegicus [brown rat]
ref|XP_008395804.1|  PREDICTED: protein disulfide-isomerase A6 is...    130   8e-32   Poecilia reticulata
gb|AAH06865.2|  Protein disulfide isomerase associated 6                130   8e-32   Mus musculus [mouse]
gb|KFV91574.1|  Protein disulfide-isomerase A6                          130   9e-32   Eurypyga helias
ref|XP_419952.1|  PREDICTED: protein disulfide-isomerase A6 isofo...    130   9e-32   Gallus gallus [bantam]
ref|XP_010145729.1|  PREDICTED: protein disulfide-isomerase A6          130   9e-32   Eurypyga helias
ref|XP_009585693.1|  PREDICTED: protein disulfide-isomerase A6          130   1e-31   Fulmarus glacialis
ref|XP_003984581.1|  PREDICTED: protein disulfide-isomerase A6          130   1e-31   
ref|XP_005000363.1|  PREDICTED: protein disulfide-isomerase A6 is...    130   1e-31   Cavia porcellus [guinea pig]
gb|KFV98779.1|  Protein disulfide-isomerase A6                          130   1e-31   Fulmarus glacialis
ref|XP_011610543.1|  PREDICTED: protein disulfide-isomerase A6 is...    130   1e-31   
ref|XP_003462749.1|  PREDICTED: protein disulfide-isomerase A6 is...    130   1e-31   Cavia porcellus [guinea pig]
ref|XP_003787439.1|  PREDICTED: protein disulfide-isomerase A6          130   1e-31   Otolemur garnettii
ref|XP_010189304.1|  PREDICTED: protein disulfide-isomerase A6          130   1e-31   Mesitornis unicolor
ref|XP_002196421.2|  PREDICTED: protein disulfide-isomerase A6          130   1e-31   
ref|XP_006012215.1|  PREDICTED: protein disulfide-isomerase A6 is...    130   1e-31   Latimeria chalumnae
ref|XP_009940378.1|  PREDICTED: protein disulfide-isomerase A6          130   1e-31   Opisthocomus hoazin [hoatzin]
ref|XP_008395805.1|  PREDICTED: protein disulfide-isomerase A6 is...    130   1e-31   Poecilia reticulata
gb|ABC75564.1|  protein disulfide isomerase-related protein P5 pr...    128   1e-31   Ictalurus punctatus
ref|XP_008493616.1|  PREDICTED: protein disulfide-isomerase A6          130   1e-31   
ref|XP_005967905.1|  PREDICTED: protein disulfide-isomerase A6          130   1e-31   
gb|KFO95889.1|  Protein disulfide-isomerase A6                          130   1e-31   
gb|KFV71961.1|  Protein disulfide-isomerase A6                          130   1e-31   
ref|XP_009666708.1|  PREDICTED: protein disulfide-isomerase A6          130   1e-31   
ref|XP_008063733.1|  PREDICTED: protein disulfide-isomerase A6          130   1e-31   
ref|XP_010073176.1|  PREDICTED: protein disulfide-isomerase A6          130   1e-31   
ref|XP_010738984.1|  PREDICTED: protein disulfide-isomerase A6          130   1e-31   
gb|KFQ65954.1|  Protein disulfide-isomerase A6                          130   1e-31   
gb|AAB50217.1|  protein disulfide isomerase-related protein 5           129   1e-31   
gb|KFR16570.1|  Protein disulfide-isomerase A6                          129   1e-31   
gb|KHN88358.1|  putative protein disulfide-isomerase A6                 129   1e-31   
ref|XP_009874965.1|  PREDICTED: protein disulfide-isomerase A6          130   2e-31   
gb|KFO87204.1|  Protein disulfide-isomerase A6                          129   2e-31   
ref|XP_009702308.1|  PREDICTED: protein disulfide-isomerase A6          129   2e-31   
gb|KFU96864.1|  Protein disulfide-isomerase A6                          129   2e-31   
gb|KFQ83261.1|  Protein disulfide-isomerase A6                          129   2e-31   
ref|XP_010130331.1|  PREDICTED: protein disulfide-isomerase A6          129   2e-31   
gb|KFP66932.1|  Protein disulfide-isomerase A6                          129   2e-31   
gb|KFP92383.1|  Protein disulfide-isomerase A6                          129   2e-31   
ref|XP_009463744.1|  PREDICTED: LOW QUALITY PROTEIN: protein disu...    129   2e-31   
ref|XP_003741496.1|  PREDICTED: protein disulfide-isomerase A6-like     132   2e-31   
ref|XP_010280693.1|  PREDICTED: protein disulfide-isomerase A6          129   2e-31   
ref|XP_005238268.1|  PREDICTED: protein disulfide-isomerase A6          129   2e-31   
gb|KFZ68639.1|  Protein disulfide-isomerase A6                          129   2e-31   
gb|ELW72031.1|  Protein disulfide-isomerase A6                          129   2e-31   
gb|EMC90288.1|  Protein disulfide-isomerase A6                          129   2e-31   
ref|XP_005506964.1|  PREDICTED: protein disulfide-isomerase A6          129   2e-31   
gb|KGL97075.1|  Protein disulfide-isomerase A6                          129   2e-31   
ref|XP_009068583.1|  PREDICTED: protein disulfide-isomerase A6          129   2e-31   
ref|XP_005432317.1|  PREDICTED: protein disulfide-isomerase A6          129   2e-31   
ref|XP_009888074.1|  PREDICTED: protein disulfide-isomerase A6          129   2e-31   
gb|KFP75924.1|  Protein disulfide-isomerase A6                          129   2e-31   
ref|XP_011575233.1|  PREDICTED: protein disulfide-isomerase A6          129   2e-31   
gb|KGL83930.1|  Protein disulfide-isomerase A6                          129   2e-31   
ref|XP_009330780.1|  PREDICTED: protein disulfide-isomerase A6          129   2e-31   
ref|XP_010222649.1|  PREDICTED: protein disulfide-isomerase A6          129   2e-31   
ref|XP_009273886.1|  PREDICTED: protein disulfide-isomerase A6          129   2e-31   
gb|KFQ44656.1|  Protein disulfide-isomerase A6                          129   2e-31   
gb|KFW73081.1|  Protein disulfide-isomerase A6                          129   2e-31   
ref|XP_005146160.1|  PREDICTED: protein disulfide-isomerase A6          129   2e-31   
gb|KFM05020.1|  Protein disulfide-isomerase A6                          129   2e-31   
ref|XP_005687063.1|  PREDICTED: protein disulfide-isomerase A6          129   2e-31   
ref|XP_009913272.1|  PREDICTED: protein disulfide-isomerase A6          129   2e-31   
gb|KFP35427.1|  Protein disulfide-isomerase A6                          129   3e-31   
ref|XP_007640104.1|  PREDICTED: protein disulfide-isomerase A6          129   3e-31   
gb|KFP27162.1|  Protein disulfide-isomerase A6                          129   3e-31   
ref|XP_010018621.1|  PREDICTED: protein disulfide-isomerase A6          129   3e-31   
ref|XP_010114738.1|  PREDICTED: protein disulfide-isomerase A6          129   3e-31   
sp|P38660.1|PDIA6_MESAU  RecName: Full=Protein disulfide-isomeras...    129   3e-31   
gb|KFQ00948.1|  Protein disulfide-isomerase A6                          129   3e-31   
ref|XP_007607763.1|  PREDICTED: protein disulfide-isomerase A6          129   3e-31   
gb|KFP16755.1|  Protein disulfide-isomerase A6                          129   3e-31   
gb|EGT47278.1|  hypothetical protein CAEBREN_31162                      129   3e-31   
ref|XP_009638086.1|  PREDICTED: protein disulfide-isomerase A6          129   3e-31   
ref|XP_010206382.1|  PREDICTED: protein disulfide-isomerase A6          129   3e-31   
ref|NP_001086643.1|  protein disulfide isomerase family A, member...    129   3e-31   
ref|XP_010564977.1|  PREDICTED: protein disulfide-isomerase A6          129   3e-31   
ref|XP_004459385.1|  PREDICTED: protein disulfide-isomerase A6          129   4e-31   
ref|XP_008935557.1|  PREDICTED: protein disulfide-isomerase A6          128   4e-31   
ref|XP_004609467.1|  PREDICTED: protein disulfide-isomerase A6          128   4e-31   
dbj|BAE39477.1|  unnamed protein product                                128   4e-31   
gb|KFQ26878.1|  Protein disulfide-isomerase A6                          128   5e-31   
ref|XP_009946939.1|  PREDICTED: protein disulfide-isomerase A6          128   5e-31   
ref|XP_001439775.1|  hypothetical protein                               128   5e-31   
ref|XP_005293176.1|  PREDICTED: protein disulfide-isomerase A6          128   5e-31   
ref|XP_005044328.1|  PREDICTED: protein disulfide-isomerase A6          128   6e-31   
ref|XP_005420347.1|  PREDICTED: protein disulfide-isomerase A6          128   6e-31   
gb|KFQ08834.1|  Protein disulfide-isomerase A6                          128   6e-31   
ref|XP_009045951.1|  hypothetical protein LOTGIDRAFT_151365             128   7e-31   
gb|KFV66878.1|  Protein disulfide-isomerase A6                          128   7e-31   
ref|XP_005521916.1|  PREDICTED: protein disulfide-isomerase A6 is...    128   7e-31   
gb|KFO75223.1|  Protein disulfide-isomerase A6                          127   7e-31   
ref|XP_009898142.1|  PREDICTED: protein disulfide-isomerase A6          127   8e-31   
ref|XP_007423659.1|  PREDICTED: protein disulfide-isomerase A6          127   8e-31   
ref|XP_005521917.1|  PREDICTED: protein disulfide-isomerase A6 is...    127   8e-31   
ref|XP_009093512.1|  PREDICTED: protein disulfide-isomerase A6          127   8e-31   
ref|XP_009557934.1|  PREDICTED: protein disulfide-isomerase A6          127   8e-31   
ref|XP_006612487.1|  PREDICTED: protein disulfide-isomerase A6-like     127   9e-31   
ref|XP_003706812.1|  PREDICTED: protein disulfide-isomerase A6          127   9e-31   
gb|KFV15259.1|  Protein disulfide-isomerase A6                          127   9e-31   
ref|XP_009981655.1|  PREDICTED: protein disulfide-isomerase A6          127   9e-31   
gb|KHJ93089.1|  protein disulfide-isomerase domain protein              127   1e-30   
gb|AEB26317.1|  protein disulfide isomerase                             127   1e-30   
ref|XP_009009748.1|  hypothetical protein HELRODRAFT_63467              127   2e-30   
ref|XP_003693801.1|  PREDICTED: protein disulfide-isomerase A6-like     127   2e-30   
ref|XP_010391624.1|  PREDICTED: protein disulfide-isomerase A6          127   2e-30   
ref|XP_002587888.1|  hypothetical protein BRAFLDRAFT_124879             127   2e-30   
ref|XP_008639999.1|  PREDICTED: protein disulfide-isomerase A6          127   2e-30   
gb|KFO65258.1|  Protein disulfide-isomerase A6                          126   2e-30   
gb|ADY90107.1|  protein disulfide isomerase A6                          126   2e-30   
ref|XP_010836180.1|  PREDICTED: LOW QUALITY PROTEIN: protein disu...    126   2e-30   
gb|ADK26817.1|  protein disulfide isomerase family A, member 6          126   2e-30   
ref|XP_005487253.1|  PREDICTED: protein disulfide-isomerase A6 is...    126   2e-30   
gb|ADK26725.1|  protein disulfide isomerase family A, member 6          126   2e-30   
gb|EFX87790.1|  hypothetical protein DAPPUDRAFT_306380                  126   2e-30   
ref|XP_005487254.1|  PREDICTED: protein disulfide-isomerase A6 is...    126   2e-30   
gb|KKA74764.1|  Thioredoxin                                             126   3e-30   
ref|XP_008864870.1|  protein disulfide-isomerase domain                 126   3e-30   
ref|XP_395981.2|  PREDICTED: protein disulfide-isomerase A6-like ...    125   3e-30   
ref|XP_007902471.1|  PREDICTED: protein disulfide-isomerase A6-like     125   4e-30   
gb|AIG55564.1|  secreted protein                                        125   4e-30   
gb|KFW88870.1|  Protein disulfide-isomerase A6                          125   5e-30   
ref|XP_007476199.1|  PREDICTED: protein disulfide-isomerase A6          125   5e-30   
ref|XP_008930983.1|  PREDICTED: protein disulfide-isomerase A6          125   5e-30   
ref|XP_009834821.1|  protein disulfide-isomerase domain                 125   7e-30   
ref|XP_003094567.1|  hypothetical protein CRE_30155                     125   7e-30   
ref|XP_005108921.1|  PREDICTED: protein disulfide-isomerase A6-like     125   7e-30   
ref|XP_011301143.1|  PREDICTED: protein disulfide-isomerase A6          125   8e-30   
ref|XP_011119472.1|  hypothetical protein AOL_s00043g684                125   9e-30   
ref|NP_509190.1|  Protein TAG-320                                       124   1e-29   
ref|XP_003117834.1|  CRE-TAG-320 protein                                124   1e-29   
ref|XP_006021844.1|  PREDICTED: LOW QUALITY PROTEIN: protein disu...    124   1e-29   
ref|XP_006257985.1|  PREDICTED: protein disulfide-isomerase A6          124   1e-29   
gb|EFO25483.2|  TAG-320 protein                                         124   2e-29   
ref|XP_005963820.1|  PREDICTED: protein disulfide-isomerase A6-like     124   2e-29   
ref|XP_004696438.1|  PREDICTED: protein disulfide-isomerase A6          124   2e-29   
gb|AIG56196.1|  secreted protein                                        123   2e-29   
emb|CDW52124.1|  protein disulfide isomerase A6                         123   3e-29   
gb|KFM68865.1|  Protein disulfide-isomerase A6                          123   3e-29   
ref|NP_001080305.1|  protein disulfide isomerase family A, member...    123   4e-29   
ref|XP_003757912.1|  PREDICTED: protein disulfide-isomerase A6          123   4e-29   
ref|XP_001629218.1|  predicted protein                                  122   4e-29   
ref|XP_002644986.1|  C. briggsae CBR-TAG-320 protein                    122   4e-29   
ref|XP_011647781.1|  PREDICTED: LOW QUALITY PROTEIN: protein disu...    122   5e-29   
ref|XP_011563070.1|  PREDICTED: protein disulfide-isomerase A6          122   5e-29   
ref|XP_001848695.1|  disulfide-isomerase A6                             122   8e-29   
gb|KIH58391.1|  protein disulfide-isomerase domain protein              116   8e-29   
ref|XP_004518575.1|  PREDICTED: protein disulfide-isomerase A6-like     122   1e-28   
ref|XP_001602967.1|  PREDICTED: probable protein disulfide-isomer...    121   1e-28   
gb|EJY83204.1|  Protein disulfide-isomerase domain containing pro...    120   1e-28   
gb|EFA11123.1|  hypothetical protein TcasGA2_TC004723                   121   2e-28   
ref|XP_010270061.1|  PREDICTED: protein disulfide isomerase-like ...    120   2e-28   
ref|XP_011446200.1|  PREDICTED: protein disulfide-isomerase A6-like     120   2e-28   
ref|NP_499613.1|  Protein Y49E10.4                                      120   3e-28   
pdb|3W8J|A  Chain A, Crystal Structure Of P5 A0 In A Complex With...    115   3e-28   
gb|KFO31202.1|  Protein disulfide-isomerase A6                          120   4e-28   
gb|ETN79262.1|  protein disulfide-isomerase domain protein              120   4e-28   
tpg|DAA24981.1|  TPA: PDIA6 protein-like                                120   5e-28   
gb|EHJ66984.1|  hypothetical protein KGM_18501                          119   7e-28   
gb|EGT52939.1|  CBN-TAG-320 protein                                     119   9e-28   
gb|KHJ93091.1|  protein disulfide-isomerase domain protein              114   1e-27   
pdb|4EF0|A  Chain A, Crystal Structure Of The First Catalytic Dom...    113   1e-27   
ref|XP_010627358.1|  PREDICTED: protein disulfide-isomerase A6          118   1e-27   
ref|XP_002641016.1|  Hypothetical protein CBG11768                      118   1e-27   
emb|CBY37570.1|  unnamed protein product                                118   2e-27   
emb|CBY07145.1|  unnamed protein product                                118   2e-27   
ref|XP_011206958.1|  PREDICTED: protein disulfide-isomerase A6          117   2e-27   
ref|XP_002002212.1|  GI13846                                            117   3e-27   
gb|KDO29489.1|  hypothetical protein SPRG_06029                         117   3e-27   
gb|EYB96326.1|  hypothetical protein Y032_0151g2809                     117   4e-27   
ref|XP_002051733.1|  GJ10673                                            117   4e-27   
pdb|3VWW|A  Chain A, Crystal Structure Of A0-domain Of P5 From H....    111   4e-27   
gb|EPB78680.1|  protein disulfide-isomerase domain protein              117   5e-27   
ref|XP_001898144.1|  Probable protein disulfide isomerase A6 prec...    116   7e-27   
ref|XP_001976216.1|  GG20128                                            116   7e-27   
gb|KDR20898.1|  Protein disulfide-isomerase A6                          116   8e-27   
ref|XP_008200598.1|  PREDICTED: protein disulfide-isomerase A6          116   8e-27   
ref|XP_011187125.1|  PREDICTED: probable protein disulfide-isomer...    116   1e-26   
gb|ELT97169.1|  hypothetical protein CAPTEDRAFT_222278                  115   1e-26   
pdb|2DML|A  Chain A, The Solution Structure Of The First Thioredo...    110   1e-26   
ref|XP_001948267.2|  PREDICTED: protein disulfide-isomerase A6          115   2e-26   
ref|XP_001356908.2|  GA19146                                            115   2e-26   
ref|XP_002015314.1|  GL18482                                            115   2e-26   
ref|XP_002953269.1|  hypothetical protein VOLCADRAFT_105867             115   2e-26   
ref|XP_004932411.1|  PREDICTED: protein disulfide-isomerase A6-like     115   2e-26   
ref|XP_008543798.1|  PREDICTED: protein disulfide-isomerase A6          115   2e-26   
ref|XP_002079636.1|  GD21912                                            115   2e-26   
ref|NP_609792.1|  calcium-binding protein 1, isoform A                  115   2e-26   
ref|XP_668568.1|  protein disulfide isomerase-related protein (pr...    114   3e-26   
ref|XP_002090414.1|  GE12817                                            114   3e-26   
dbj|BAJ90795.1|  predicted protein                                      114   4e-26   
ref|XP_011505126.1|  PREDICTED: probable protein disulfide-isomer...    114   4e-26   
ref|XP_002052260.1|  GJ17455                                            114   4e-26   
ref|XP_001434887.1|  hypothetical protein                               114   5e-26   
ref|XP_001449606.1|  hypothetical protein                               114   6e-26   
ref|XP_008883930.1|  protein disulfide isomerase-related protein ...    114   6e-26   
ref|XP_002038169.1|  GM17901                                            114   6e-26   
ref|XP_008907519.1|  protein disulfide-isomerase domain                 114   7e-26   
ref|XP_002367261.1|  thioredoxin, putative                              113   7e-26   
ref|XP_008609528.1|  hypothetical protein SDRG_05583                    113   1e-25   
ref|XP_001452252.1|  hypothetical protein                               112   1e-25   
ref|XP_011109017.1|  hypothetical protein H072_3033                     112   2e-25   
ref|XP_001423649.1|  hypothetical protein                               112   2e-25   
ref|XP_004027248.1|  protein disulfide isomerase family protein, ...    111   2e-25   
gb|EPT25079.1|  protein disulfide isomerase-related protein (prov...    113   2e-25   
gb|EPR63450.1|  putative protein disulfide isomerase-related prot...    113   2e-25   
ref|XP_004037455.1|  protein disulfide isomerase family protein, ...    112   3e-25   
gb|EWC46325.1|  hypothetical protein DRE_04496                          112   3e-25   
gb|ETL37147.1|  protein disulfide-isomerase domain                      112   3e-25   
ref|XP_008487078.1|  PREDICTED: protein disulfide-isomerase A6-like     111   4e-25   
ref|XP_002906746.1|  disulfide-isomerase, putative                      111   4e-25   
ref|XP_002620636.1|  disulfide isomerase                                111   5e-25   
gb|EEQ86364.1|  disulfide isomerase                                     111   6e-25   
ref|XP_003138581.1|  TAG-320 protein                                    110   6e-25   
ref|XP_006140909.1|  PREDICTED: protein disulfide-isomerase A6          111   1e-24   
ref|XP_628564.1|  protein disulfide isomerase, signal peptide, ER...    110   1e-24   
ref|XP_001010336.1|  protein disulfide-isomerase domain containin...    110   1e-24   
gb|ADD24382.1|  Probable protein disulfide-isomerase A6                 110   1e-24   
gb|KJJ26253.1|  Thioredoxin                                             109   1e-24   
emb|CDM27103.1|  Thioredoxin                                            110   2e-24   
ref|XP_009857523.1|  PREDICTED: protein disulfide-isomerase A6-like     109   2e-24   
ref|XP_002484112.1|  disulfide isomerase, putative                      110   2e-24   
emb|CDI74584.1|  thioredoxin, putative                                  109   2e-24   
gb|KIW65848.1|  protein disulfide-isomerase domain                      110   2e-24   
ref|XP_002066865.1|  GK24326                                            109   3e-24   
emb|CDJ56301.1|  thioredoxin, putative                                  108   3e-24   
dbj|GAM38043.1|  hypothetical protein TCE0_033f08473                    109   3e-24   
ref|XP_003388369.1|  PREDICTED: probable protein disulfide-isomer...    108   4e-24   
ref|XP_001540962.1|  conserved hypothetical protein                     108   5e-24   
gb|EPE09510.1|  disulfide isomerase                                     108   5e-24   
ref|XP_007812916.1|  disulfide isomerase                                108   5e-24   
gb|ENN76828.1|  hypothetical protein YQE_06669                          108   6e-24   
gb|ERL94682.1|  hypothetical protein D910_11957                         108   6e-24   
ref|XP_002428877.1|  protein disulfide isomerase, putative              108   6e-24   
ref|XP_002150153.1|  disulfide isomerase, putative                      108   7e-24   
gb|KIV77215.1|  protein disulfide-isomerase domain                      108   9e-24   
gb|EPZ34216.1|  Thioredoxin domain-containing protein                   108   1e-23   
ref|XP_005537263.1|  similar to protein disulfide isomerase-relat...    107   1e-23   
gb|KIZ01312.1|  protein disulfide isomerase family A, member 6          107   1e-23   
ref|XP_009177268.1|  hypothetical protein T265_12068                    104   2e-23   



>gb|KJB42837.1| hypothetical protein B456_007G169700 [Gossypium raimondii]
Length=336

 Score =   246 bits (627),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            NALYGPS+PV+QL PSNFKSKVLNSNGVVLVEFFAPWCGHC+ALTPT+EK A+VLKGVAT
Sbjct  23   NALYGPSSPVVQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCQALTPTWEKAANVLKGVAT  82

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAALDADAH SLAQEYGI+GFPTIKVF PGK PVDYQGAR+ K + +F   Q++ LLKDR
Sbjct  83   VAALDADAHKSLAQEYGIRGFPTIKVFAPGKPPVDYQGARDVKPIAEFALKQVKALLKDR  142

Query  522  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            L GKA+GGSS+KSEPSASVELNSRNFD+LV+KSK+LW
Sbjct  143  LAGKASGGSSEKSEPSASVELNSRNFDELVLKSKELW  179


 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 66/111 (59%), Gaps = 2/111 (2%)
 Frame = +3

Query  177  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  356
            PS  V +LN  NF   VL S  + +VEFFAPWCGHCK L P +++ A+ LKG   +  +D
Sbjct  157  PSASV-ELNSRNFDELVLKSKELWIVEFFAPWCGHCKRLAPEWKRAANNLKGKVKLGHVD  215

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  506
             D+  SL   + ++GFPTI VF   K  PV Y+GAR A ++  F   Q+  
Sbjct  216  CDSEKSLMSRFNVQGFPTILVFGADKDSPVPYEGARTASAIESFALEQLET  266



>ref|XP_009804684.1| PREDICTED: protein disulfide isomerase-like 2-3 [Nicotiana sylvestris]
Length=432

 Score =   248 bits (633),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            NALYGPS+PVLQL PSNFKSKVLNSNG+VLVEFFAPWCGHCKALTP +EK A++LKGVAT
Sbjct  21   NALYGPSSPVLQLTPSNFKSKVLNSNGIVLVEFFAPWCGHCKALTPHWEKAATILKGVAT  80

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAALDADAH SLAQEYGI+GFPTIKVF PGK PVDYQGAREAK + +F   QI+ LLKDR
Sbjct  81   VAALDADAHQSLAQEYGIRGFPTIKVFAPGKPPVDYQGAREAKPIAEFALQQIKALLKDR  140

Query  522  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            + GKATGGSSQ SEPSAS+ELNSRNFD+ V+KSKDLW
Sbjct  141  VHGKATGGSSQNSEPSASIELNSRNFDEKVLKSKDLW  177


 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 65/106 (61%), Gaps = 1/106 (1%)
 Frame = +3

Query  192  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  371
            ++LN  NF  KVL S  + +VEFFAPWCGHCK L P ++K A  L+G   +  +D DA  
Sbjct  159  IELNSRNFDEKVLKSKDLWIVEFFAPWCGHCKKLAPEWKKAAKNLEGKVKLGHVDCDAEK  218

Query  372  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  506
            SL   Y ++GFPTI VF   K+ PV Y+GAR A ++  F   Q+  
Sbjct  219  SLMSRYNVQGFPTILVFGADKESPVPYEGARTAAAIESFGLEQLET  264



>ref|XP_011085485.1| PREDICTED: protein disulfide isomerase-like 2-3 [Sesamum indicum]
Length=432

 Score =   246 bits (627),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 144/156 (92%), Gaps = 0/156 (0%)
 Frame = +3

Query  165  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  344
            ALYGPS+PVLQLNP+NFKSKVLNSNGVVLVEFFAPWCGHC+ALTP +EK A+VLKGVATV
Sbjct  22   ALYGPSSPVLQLNPNNFKSKVLNSNGVVLVEFFAPWCGHCQALTPAWEKAANVLKGVATV  81

Query  345  aaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRL  524
            AALDADAH SLAQEYGI+GFPTIKVF PGK PVDYQGAR+ K +V+F   Q++ LLK+RL
Sbjct  82   AALDADAHQSLAQEYGIRGFPTIKVFAPGKPPVDYQGARDVKPIVEFALQQVKALLKERL  141

Query  525  DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            DGK+ GGSSQKSEPSASVELNSRNFD+LV+KSK+LW
Sbjct  142  DGKSAGGSSQKSEPSASVELNSRNFDELVLKSKELW  177


 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 65/111 (59%), Gaps = 2/111 (2%)
 Frame = +3

Query  177  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  356
            PS  V +LN  NF   VL S  + +VEFFAPWCGHCK L P ++K A+ LKG   +  +D
Sbjct  155  PSASV-ELNSRNFDELVLKSKELWIVEFFAPWCGHCKKLAPEWKKAANNLKGQVKLGHVD  213

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  506
             DA  SL   + ++GFPTI VF   K  P  Y+GAR A ++  F   Q+  
Sbjct  214  CDAEKSLMSRFNVQGFPTILVFGADKDSPFPYEGARSASAIESFALEQLET  264



>gb|KJB42838.1| hypothetical protein B456_007G169700 [Gossypium raimondii]
Length=434

 Score =   246 bits (627),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            NALYGPS+PV+QL PSNFKSKVLNSNGVVLVEFFAPWCGHC+ALTPT+EK A+VLKGVAT
Sbjct  23   NALYGPSSPVVQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCQALTPTWEKAANVLKGVAT  82

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAALDADAH SLAQEYGI+GFPTIKVF PGK PVDYQGAR+ K + +F   Q++ LLKDR
Sbjct  83   VAALDADAHKSLAQEYGIRGFPTIKVFAPGKPPVDYQGARDVKPIAEFALKQVKALLKDR  142

Query  522  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            L GKA+GGSS+KSEPSASVELNSRNFD+LV+KSK+LW
Sbjct  143  LAGKASGGSSEKSEPSASVELNSRNFDELVLKSKELW  179


 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 66/111 (59%), Gaps = 2/111 (2%)
 Frame = +3

Query  177  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  356
            PS  V +LN  NF   VL S  + +VEFFAPWCGHCK L P +++ A+ LKG   +  +D
Sbjct  157  PSASV-ELNSRNFDELVLKSKELWIVEFFAPWCGHCKRLAPEWKRAANNLKGKVKLGHVD  215

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  506
             D+  SL   + ++GFPTI VF   K  PV Y+GAR A ++  F   Q+  
Sbjct  216  CDSEKSLMSRFNVQGFPTILVFGADKDSPVPYEGARTASAIESFALEQLET  266



>ref|XP_011003479.1| PREDICTED: protein disulfide isomerase-like 2-3 [Populus euphratica]
Length=434

 Score =   244 bits (623),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 143/156 (92%), Gaps = 0/156 (0%)
 Frame = +3

Query  165  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  344
            ALYGPS+PVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPT+EK A+VLKGVATV
Sbjct  24   ALYGPSSPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTWEKAAAVLKGVATV  83

Query  345  aaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRL  524
            AALDADAH SLAQEYGI+GFPTIKVFVPG  P+DYQGAR+ K + +F   QI+ LLKDRL
Sbjct  84   AALDADAHQSLAQEYGIRGFPTIKVFVPGNPPIDYQGARDVKPIAEFALKQIKALLKDRL  143

Query  525  DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            +GK+TGGSS+KSE S SVELNSRNFD+LV+KSK+LW
Sbjct  144  NGKSTGGSSEKSETSLSVELNSRNFDELVLKSKELW  179


 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 65/106 (61%), Gaps = 1/106 (1%)
 Frame = +3

Query  192  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  371
            ++LN  NF   VL S  + +VEFFAPWCGHCK L P ++K A+ L+G   +  +D D+  
Sbjct  161  VELNSRNFDELVLKSKELWIVEFFAPWCGHCKKLAPEWKKAANNLQGKVKLGHVDCDSEK  220

Query  372  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  506
            SL   + ++GFPTI VF   K  P+ Y+GAR A ++  F   Q+ +
Sbjct  221  SLMSRFNVQGFPTILVFGADKDTPIPYEGARTASAIESFALEQLES  266



>ref|XP_010556968.1| PREDICTED: protein disulfide-isomerase like 2-2-like [Tarenaya 
hassleriana]
Length=441

 Score =   244 bits (623),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 144/159 (91%), Gaps = 2/159 (1%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            NALYGPS+PVLQL P+NFKSKVLNSNGVVLVEFFAPWCGHC+ALTPT+EKVA++LKGVAT
Sbjct  24   NALYGPSSPVLQLTPTNFKSKVLNSNGVVLVEFFAPWCGHCQALTPTWEKVANILKGVAT  83

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAA+DADAH S+AQEYGI+GFPTIKVFVPGK PVDYQGAREAK + +F   QI+ LLKDR
Sbjct  84   VAAIDADAHKSVAQEYGIRGFPTIKVFVPGKAPVDYQGAREAKPIAEFALQQIKALLKDR  143

Query  522  LDGKATGG--SSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            L GKATGG  S +KSEP+ASVELNS NFD+ V+KSKDLW
Sbjct  144  LHGKATGGGSSEKKSEPNASVELNSSNFDESVIKSKDLW  182


 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 62/100 (62%), Gaps = 1/100 (1%)
 Frame = +3

Query  192  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  371
            ++LN SNF   V+ S  + +VEFFAPWCGHCK L P ++K A  LKG   +  ++ DA  
Sbjct  164  VELNSSNFDESVIKSKDLWIVEFFAPWCGHCKKLAPEWKKAAKNLKGKVNLGHVNCDAEQ  223

Query  372  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFV  488
            SL   + ++GFPTI VF   K  P+ Y+GAR A ++  F 
Sbjct  224  SLMSRFKVQGFPTILVFGSDKNSPIPYEGARSASAIESFA  263



>ref|XP_011100470.1| PREDICTED: protein disulfide isomerase-like 2-3 [Sesamum indicum]
Length=438

 Score =   244 bits (622),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 126/156 (81%), Positives = 144/156 (92%), Gaps = 0/156 (0%)
 Frame = +3

Query  165  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  344
            ALYGPS+PV+QLNP+NFKSKVLNSNGVVLVEFFAPWCGHC+ALTPT+EKVA+VLKGVATV
Sbjct  28   ALYGPSSPVVQLNPNNFKSKVLNSNGVVLVEFFAPWCGHCQALTPTWEKVANVLKGVATV  87

Query  345  aaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRL  524
            AALDADAH SLAQEYGI+GFPTIKVF PGK P+DYQGAR+ K + DF   QI+ LLK+RL
Sbjct  88   AALDADAHKSLAQEYGIRGFPTIKVFAPGKTPLDYQGARDVKPIADFAYQQIKALLKERL  147

Query  525  DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            +GK+  GSSQKSEPSAS+ELNSRNFD+LV+KSK+LW
Sbjct  148  NGKSAEGSSQKSEPSASIELNSRNFDELVIKSKELW  183


 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/105 (44%), Positives = 64/105 (61%), Gaps = 1/105 (1%)
 Frame = +3

Query  192  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  371
            ++LN  NF   V+ S  + +VEFFAPWCGHCK L P ++K A+ LKG   +  +D DA  
Sbjct  165  IELNSRNFDELVIKSKELWIVEFFAPWCGHCKKLAPEWKKAANNLKGQVKLGHVDCDAEK  224

Query  372  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIR  503
            SL   + ++GFPTI VF   K+ P  Y+GAR A ++  F   Q+ 
Sbjct  225  SLMSRFNVQGFPTILVFGANKESPFPYEGARSASAIESFALEQLE  269



>ref|XP_011016519.1| PREDICTED: protein disulfide isomerase-like 2-3 [Populus euphratica]
Length=434

 Score =   244 bits (622),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 143/156 (92%), Gaps = 0/156 (0%)
 Frame = +3

Query  165  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  344
            ALYGPS+PVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPT+EK A+VLKGVATV
Sbjct  24   ALYGPSSPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTWEKAAAVLKGVATV  83

Query  345  aaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRL  524
            AALDADAH SLAQEYGI+GFPTIKVFVPG  P+DYQGAR+ K + +F   QI+ LLKDRL
Sbjct  84   AALDADAHQSLAQEYGIRGFPTIKVFVPGNPPIDYQGARDVKPIAEFALKQIKALLKDRL  143

Query  525  DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            +GK+TGGSS+KSE S SVELNSRNFD+LV+KSK+LW
Sbjct  144  NGKSTGGSSEKSETSLSVELNSRNFDELVLKSKELW  179


 Score = 82.4 bits (202),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 64/104 (62%), Gaps = 1/104 (1%)
 Frame = +3

Query  192  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  371
            ++LN  NF   VL S  + +VEFFAPWCGHCK L P ++K A+ L+G   +  +D D+  
Sbjct  161  VELNSRNFDELVLKSKELWIVEFFAPWCGHCKKLAPEWKKAANNLQGKVKLGHVDCDSEK  220

Query  372  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQI  500
            SL   + ++GFPTI VF   K  P+ Y+GAR A ++  F   Q+
Sbjct  221  SLMSRFNVQGFPTILVFGADKDTPIPYEGARTASAIESFALEQL  264



>gb|KJB10303.1| hypothetical protein B456_001G195100 [Gossypium raimondii]
Length=279

 Score =   239 bits (609),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            NA YGPS+PVLQL PSNFKSKVLNSNGVVLVEFFAPWCGHC+ALTPT+EK A+VL GVAT
Sbjct  23   NAFYGPSSPVLQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCQALTPTWEKAANVLNGVAT  82

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAALDADAH SLA+EYGI+GFPTIKVF PGK PVDYQGAR+ K + +F   Q++ LLKDR
Sbjct  83   VAALDADAHQSLAEEYGIRGFPTIKVFAPGKPPVDYQGARDVKPIAEFALQQVKALLKDR  142

Query  522  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            L GKA+GGSS+K +PSASVELNSRNFD+LV+KSK+LW
Sbjct  143  LAGKASGGSSEKYQPSASVELNSRNFDELVLKSKELW  179


 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 65/113 (58%), Gaps = 2/113 (2%)
 Frame = +3

Query  171  YGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaa  350
            Y PS  V +LN  NF   VL S  + +VEFFAPWCG CK L P ++K A+ LKG   +  
Sbjct  155  YQPSASV-ELNSRNFDELVLKSKELWIVEFFAPWCGRCKKLAPEWKKAANNLKGKVKLGH  213

Query  351  ldadahsslaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  506
            +D D+  SL   Y ++GFPTI  F   K  P+ Y+GAR A S+  F   Q+  
Sbjct  214  VDCDSEKSLMSRYKVQGFPTILAFGADKDGPIPYEGARNASSIESFALEQLET  266



>gb|KJB10302.1| hypothetical protein B456_001G195100 [Gossypium raimondii]
 gb|KJB10304.1| hypothetical protein B456_001G195100 [Gossypium raimondii]
Length=287

 Score =   239 bits (609),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            NA YGPS+PVLQL PSNFKSKVLNSNGVVLVEFFAPWCGHC+ALTPT+EK A+VL GVAT
Sbjct  23   NAFYGPSSPVLQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCQALTPTWEKAANVLNGVAT  82

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAALDADAH SLA+EYGI+GFPTIKVF PGK PVDYQGAR+ K + +F   Q++ LLKDR
Sbjct  83   VAALDADAHQSLAEEYGIRGFPTIKVFAPGKPPVDYQGARDVKPIAEFALQQVKALLKDR  142

Query  522  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            L GKA+GGSS+K +PSASVELNSRNFD+LV+KSK+LW
Sbjct  143  LAGKASGGSSEKYQPSASVELNSRNFDELVLKSKELW  179


 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 65/113 (58%), Gaps = 2/113 (2%)
 Frame = +3

Query  171  YGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaa  350
            Y PS  V +LN  NF   VL S  + +VEFFAPWCG CK L P ++K A+ LKG   +  
Sbjct  155  YQPSASV-ELNSRNFDELVLKSKELWIVEFFAPWCGRCKKLAPEWKKAANNLKGKVKLGH  213

Query  351  ldadahsslaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  506
            +D D+  SL   Y ++GFPTI  F   K  P+ Y+GAR A S+  F   Q+  
Sbjct  214  VDCDSEKSLMSRYKVQGFPTILAFGADKDGPIPYEGARNASSIESFALEQLET  266



>ref|XP_002320494.2| thioredoxin family protein [Populus trichocarpa]
 gb|EEE98809.2| thioredoxin family protein [Populus trichocarpa]
Length=434

 Score =   243 bits (621),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 143/156 (92%), Gaps = 0/156 (0%)
 Frame = +3

Query  165  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  344
            ALYGPS+PVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPT+EK A+VLKGVATV
Sbjct  24   ALYGPSSPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTWEKAAAVLKGVATV  83

Query  345  aaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRL  524
            AALDADAH SLAQEYGI+GFPTIKVFVPG  PVDYQGAR+ K + ++   QI+ LLKDRL
Sbjct  84   AALDADAHQSLAQEYGIRGFPTIKVFVPGNPPVDYQGARDVKPIAEYALKQIKALLKDRL  143

Query  525  DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            +GK+TGGSS+KSE S SVELNSRNFD+LV+KSK+LW
Sbjct  144  NGKSTGGSSEKSETSLSVELNSRNFDELVLKSKELW  179


 Score = 82.4 bits (202),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 64/106 (60%), Gaps = 1/106 (1%)
 Frame = +3

Query  192  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  371
            ++LN  NF   VL S  + +VEFFAPWCGHCK L P + K A+ L+G   +  +D D+  
Sbjct  161  VELNSRNFDELVLKSKELWIVEFFAPWCGHCKKLAPEWTKAANNLQGKVKLGHVDCDSEK  220

Query  372  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  506
            SL   + ++GFPTI VF   K  P+ Y+GAR A ++  F   Q+ +
Sbjct  221  SLMSRFNVQGFPTILVFGADKDTPIPYEGARTASAIESFALEQLES  266



>ref|XP_010035498.1| PREDICTED: protein disulfide isomerase-like 2-3 [Eucalyptus grandis]
 gb|KCW46917.1| hypothetical protein EUGRSUZ_K00732 [Eucalyptus grandis]
Length=436

 Score =   242 bits (618),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            +ALYGPS+PV+QL PSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPT+EK A+VLKGVAT
Sbjct  25   DALYGPSSPVVQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTWEKAATVLKGVAT  84

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAALDADAH SLAQEYGI+GFPTIKVFVPG+ P+DYQGARE K + +F   Q++ LLKDR
Sbjct  85   VAALDADAHQSLAQEYGIRGFPTIKVFVPGQPPIDYQGAREVKPIAEFALKQVKALLKDR  144

Query  522  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            L+GK+TGGSS+KSEPSAS EL S NFD+LV+KSK+LW
Sbjct  145  LNGKSTGGSSEKSEPSASAELTSSNFDELVLKSKELW  181


 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 62/105 (59%), Gaps = 1/105 (1%)
 Frame = +3

Query  195  QLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahss  374
            +L  SNF   VL S  + +VEFFAPWCGHCK L P ++K A  LKG   +  +D DA  S
Sbjct  164  ELTSSNFDELVLKSKELWVVEFFAPWCGHCKKLAPEWKKAAKNLKGKVKLGHVDCDAEKS  223

Query  375  laQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  506
            L   Y ++GFPTI VF   K  P+ ++GAR A ++  F   Q+  
Sbjct  224  LMSRYNVQGFPTILVFGADKDSPIPFEGARTASAIESFALEQLET  268



>gb|KJB10305.1| hypothetical protein B456_001G195100 [Gossypium raimondii]
Length=336

 Score =   238 bits (607),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            NA YGPS+PVLQL PSNFKSKVLNSNGVVLVEFFAPWCGHC+ALTPT+EK A+VL GVAT
Sbjct  23   NAFYGPSSPVLQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCQALTPTWEKAANVLNGVAT  82

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAALDADAH SLA+EYGI+GFPTIKVF PGK PVDYQGAR+ K + +F   Q++ LLKDR
Sbjct  83   VAALDADAHQSLAEEYGIRGFPTIKVFAPGKPPVDYQGARDVKPIAEFALQQVKALLKDR  142

Query  522  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            L GKA+GGSS+K +PSASVELNSRNFD+LV+KSK+LW
Sbjct  143  LAGKASGGSSEKYQPSASVELNSRNFDELVLKSKELW  179


 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 65/113 (58%), Gaps = 2/113 (2%)
 Frame = +3

Query  171  YGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaa  350
            Y PS  V +LN  NF   VL S  + +VEFFAPWCG CK L P ++K A+ LKG   +  
Sbjct  155  YQPSASV-ELNSRNFDELVLKSKELWIVEFFAPWCGRCKKLAPEWKKAANNLKGKVKLGH  213

Query  351  ldadahsslaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  506
            +D D+  SL   Y ++GFPTI  F   K  P+ Y+GAR A S+  F   Q+  
Sbjct  214  VDCDSEKSLMSRYKVQGFPTILAFGADKDGPIPYEGARNASSIESFALEQLET  266



>ref|XP_010522374.1| PREDICTED: protein disulfide-isomerase 2-3-like [Tarenaya hassleriana]
Length=430

 Score =   240 bits (613),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 144/159 (91%), Gaps = 2/159 (1%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            +ALYGPS+PV+QL PSNFKSKV+NSNGVVLVEFFAPWCGHC+ALTPT+EKVA++LKGVAT
Sbjct  24   SALYGPSSPVVQLTPSNFKSKVVNSNGVVLVEFFAPWCGHCQALTPTWEKVANILKGVAT  83

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAA+DADAH S+AQEYGIKGFPTIKVFVPGK P+DYQGAR+AK + +F   QI+ LLKDR
Sbjct  84   VAAIDADAHKSIAQEYGIKGFPTIKVFVPGKAPIDYQGARDAKPIAEFALQQIKALLKDR  143

Query  522  LDGKATGG--SSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            L GKA GG  S +KSEPSASVELNS NFD+LV+KSK+LW
Sbjct  144  LHGKANGGGSSEKKSEPSASVELNSSNFDELVIKSKELW  182


 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 63/104 (61%), Gaps = 2/104 (2%)
 Frame = +3

Query  177  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  356
            PS  V +LN SNF   V+ S  + +VEFFAPWCGHCK L P ++K A  LKG   +  ++
Sbjct  160  PSASV-ELNSSNFDELVIKSKELWIVEFFAPWCGHCKKLAPEWKKAAKNLKGKVNLGHVN  218

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQP-VDYQGAREAKSMVDF  485
             DA  SL   + ++GFPTI VF   K   + Y+GAR A ++  F
Sbjct  219  CDADQSLMSRFKVQGFPTILVFGADKSSHILYEGARTASAIESF  262



>ref|XP_010110229.1| Protein disulfide-isomerase like 2-2 [Morus notabilis]
 gb|EXC25526.1| Protein disulfide-isomerase like 2-2 [Morus notabilis]
Length=439

 Score =   239 bits (610),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 126/157 (80%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            +ALYGPS+PV+QL PSNF SKVLNSN VVLVEFFAPWCGHCKALTP +EK A+VLKGVAT
Sbjct  25   HALYGPSSPVVQLTPSNFNSKVLNSNRVVLVEFFAPWCGHCKALTPVWEKAATVLKGVAT  84

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAALDAD H SLAQEYGI+GFPTIKVFVPGK PVDYQGAR+ K +V+F   QI+ LLK+R
Sbjct  85   VAALDADEHKSLAQEYGIQGFPTIKVFVPGKPPVDYQGARDVKPIVEFALKQIKALLKER  144

Query  522  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            LDGKAT GS+ KSEPSASVELNS NFD+LV+KSKDLW
Sbjct  145  LDGKATSGSNGKSEPSASVELNSHNFDELVIKSKDLW  181


 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 65/111 (59%), Gaps = 2/111 (2%)
 Frame = +3

Query  177  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  356
            PS  V +LN  NF   V+ S  + +VEFFAPWCGHCK L P ++KVA+ LKG   +  +D
Sbjct  159  PSASV-ELNSHNFDELVIKSKDLWIVEFFAPWCGHCKKLAPEWKKVANNLKGKVKLGHVD  217

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  506
             DA  SL   + ++GFPTI VF   K  P  Y+G R A ++  F   Q+  
Sbjct  218  CDAEKSLMSRFNVQGFPTILVFGADKDSPTPYEGGRTASAIESFALEQLET  268



>gb|KJB10301.1| hypothetical protein B456_001G195100 [Gossypium raimondii]
Length=427

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            NA YGPS+PVLQL PSNFKSKVLNSNGVVLVEFFAPWCGHC+ALTPT+EK A+VL GVAT
Sbjct  23   NAFYGPSSPVLQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCQALTPTWEKAANVLNGVAT  82

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAALDADAH SLA+EYGI+GFPTIKVF PGK PVDYQGAR+ K + +F   Q++ LLKDR
Sbjct  83   VAALDADAHQSLAEEYGIRGFPTIKVFAPGKPPVDYQGARDVKPIAEFALQQVKALLKDR  142

Query  522  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            L GKA+GGSS+K +PSASVELNSRNFD+LV+KSK+LW
Sbjct  143  LAGKASGGSSEKYQPSASVELNSRNFDELVLKSKELW  179


 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 65/112 (58%), Gaps = 2/112 (2%)
 Frame = +3

Query  171  YGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaa  350
            Y PS  V +LN  NF   VL S  + +VEFFAPWCG CK L P ++K A+ LKG   +  
Sbjct  155  YQPSASV-ELNSRNFDELVLKSKELWIVEFFAPWCGRCKKLAPEWKKAANNLKGKVKLGH  213

Query  351  ldadahsslaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIR  503
            +D D+  SL   Y ++GFPTI  F   K  P+ Y+GAR A S+  F   Q+ 
Sbjct  214  VDCDSEKSLMSRYKVQGFPTILAFGADKDGPIPYEGARNASSIESFALEQLE  265



>gb|KJB10306.1| hypothetical protein B456_001G195100 [Gossypium raimondii]
Length=428

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            NA YGPS+PVLQL PSNFKSKVLNSNGVVLVEFFAPWCGHC+ALTPT+EK A+VL GVAT
Sbjct  23   NAFYGPSSPVLQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCQALTPTWEKAANVLNGVAT  82

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAALDADAH SLA+EYGI+GFPTIKVF PGK PVDYQGAR+ K + +F   Q++ LLKDR
Sbjct  83   VAALDADAHQSLAEEYGIRGFPTIKVFAPGKPPVDYQGARDVKPIAEFALQQVKALLKDR  142

Query  522  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            L GKA+GGSS+K +PSASVELNSRNFD+LV+KSK+LW
Sbjct  143  LAGKASGGSSEKYQPSASVELNSRNFDELVLKSKELW  179


 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 61/113 (54%), Gaps = 3/113 (3%)
 Frame = +3

Query  171  YGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKG-VATVa  347
            Y PS  V +LN  NF   VL S  + +VEFFAPWCG CK L P ++K A+ LKG V    
Sbjct  155  YQPSASV-ELNSRNFDELVLKSKELWIVEFFAPWCGRCKKLAPEWKKAANNLKGKVKLGH  213

Query  348  aldadahsslaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIR  503
                    SL   Y ++GFPTI  F   K  P+ Y+GAR A S+  F   Q+ 
Sbjct  214  VDCDSEKQSLMSRYKVQGFPTILAFGADKDGPIPYEGARNASSIESFALEQLE  266



>ref|XP_006829505.1| PREDICTED: protein disulfide isomerase-like 2-3 [Amborella trichopoda]
 gb|ERM96921.1| hypothetical protein AMTR_s00074p00124400 [Amborella trichopoda]
Length=429

 Score =   238 bits (607),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            +ALYGPS+ VL LNPSNFKSKVLNSNGVVLVEFFAPWCGHC+ALTPT+EKVA+VLKGVAT
Sbjct  18   DALYGPSSDVLILNPSNFKSKVLNSNGVVLVEFFAPWCGHCQALTPTWEKVATVLKGVAT  77

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAALDADAH SLAQEYGI+GFPTIKVF PGK P DYQGARE K + ++   QI+ LL+DR
Sbjct  78   VAALDADAHKSLAQEYGIRGFPTIKVFSPGKSPADYQGAREVKPIAEYAVQQIKALLRDR  137

Query  522  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            L+GKA GGS+ KSE SASVELNSRNFD++V+KSKDLW
Sbjct  138  LNGKAAGGSNTKSETSASVELNSRNFDEMVLKSKDLW  174


 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 62/106 (58%), Gaps = 1/106 (1%)
 Frame = +3

Query  192  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  371
            ++LN  NF   VL S  + +VEF+APWCGHCK L P ++K A+ LKG   +  +D D   
Sbjct  156  VELNSRNFDEMVLKSKDLWIVEFYAPWCGHCKKLAPEWKKAANNLKGKLKLGHVDCDTEK  215

Query  372  slaQEYGIKGFPTIKVF-VPGKQPVDYQGAREAKSMVDFVKAQIRN  506
            SL   + ++GFPTI VF V    P  Y+GAR A ++  F   Q+  
Sbjct  216  SLMSRFNVQGFPTILVFGVDKDSPYPYEGARAASAIESFALEQLET  261



>ref|XP_004304072.1| PREDICTED: protein disulfide isomerase-like 2-3 [Fragaria vesca 
subsp. vesca]
Length=437

 Score =   238 bits (607),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            +ALYGPS+PVLQL PSNFKSKVL+SN VVLVEFFAPWCGHC+ALTP +EKVA+VLKGVAT
Sbjct  25   DALYGPSSPVLQLTPSNFKSKVLDSNRVVLVEFFAPWCGHCRALTPIWEKVATVLKGVAT  84

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAALDADAH SLAQ+YGI+GFPTIKVFVPGK PVDYQGAR+ K + +F  +QI+ LLKDR
Sbjct  85   VAALDADAHKSLAQDYGIQGFPTIKVFVPGKPPVDYQGARDVKPIAEFALSQIKALLKDR  144

Query  522  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            L GK+TGGSS+K EP+ASVELNS+NFD+LVVKSK+LW
Sbjct  145  LSGKSTGGSSEKPEPNASVELNSKNFDELVVKSKELW  181


 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 61/99 (62%), Gaps = 1/99 (1%)
 Frame = +3

Query  192  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  371
            ++LN  NF   V+ S  + +VEFFAPWCGHCK L P ++K A  LKG   +  +D DA  
Sbjct  163  VELNSKNFDELVVKSKELWIVEFFAPWCGHCKKLAPEWKKAAKNLKGKVKLGHVDCDAEQ  222

Query  372  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDF  485
            SL   + ++GFPTI VF   K  PV Y+GAR A ++  F
Sbjct  223  SLMSRFNVQGFPTILVFGADKDSPVPYEGARTASAIESF  261



>ref|XP_004143192.1| PREDICTED: protein disulfide isomerase-like 2-3 [Cucumis sativus]
 gb|KGN47008.1| hypothetical protein Csa_6G168250 [Cucumis sativus]
Length=438

 Score =   238 bits (606),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 142/158 (90%), Gaps = 1/158 (1%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            NALYGPS+PVLQL PSNFKSKVLNSNG+VLVEFFAPWCGHC+ALTP +EK A+VLKGVAT
Sbjct  24   NALYGPSSPVLQLTPSNFKSKVLNSNGIVLVEFFAPWCGHCQALTPVWEKAATVLKGVAT  83

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAALDADAH SLAQEYGIKGFPTIKVF PGK PVDYQGAR+ K + +F   Q++ LLK+R
Sbjct  84   VAALDADAHKSLAQEYGIKGFPTIKVFAPGKPPVDYQGARDVKPIAEFALQQVKALLKER  143

Query  522  LDGKAT-GGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            L+GK T GGS++KSEP+AS ELNSRNFD+LV+KSKDLW
Sbjct  144  LNGKTTGGGSNEKSEPNASEELNSRNFDELVIKSKDLW  181


 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/105 (44%), Positives = 61/105 (58%), Gaps = 1/105 (1%)
 Frame = +3

Query  195  QLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahss  374
            +LN  NF   V+ S  + +VEFFAPWCGHCK L P ++K A  LKG   +  +D DA  S
Sbjct  164  ELNSRNFDELVIKSKDLWIVEFFAPWCGHCKRLAPEWKKAAKNLKGKVKLGHVDCDAEKS  223

Query  375  laQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRN  506
            L   + ++GFPTI VF   K  P+ Y+GAR A  +  F   Q+  
Sbjct  224  LMSRFNVQGFPTILVFGADKYSPITYEGARTASGIESFALDQLET  268



>ref|XP_009365136.1| PREDICTED: protein disulfide isomerase-like 2-3 [Pyrus x bretschneideri]
Length=435

 Score =   237 bits (604),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            +ALYGPS+PVLQL PSNFKSKVL+SN VVLVEFFAPWCGHC+ALTP +EK A+VLKGVAT
Sbjct  24   DALYGPSSPVLQLTPSNFKSKVLDSNRVVLVEFFAPWCGHCQALTPIWEKAATVLKGVAT  83

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAALDADAH SLAQEYGI+GFPTIKVFVPGK PVDYQGAR+ K + +F   QI+ LLKDR
Sbjct  84   VAALDADAHKSLAQEYGIRGFPTIKVFVPGKPPVDYQGARDVKPVAEFALQQIKALLKDR  143

Query  522  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            L GK TGGSS+KSEPSASVELNS+NF++LV+KSK+LW
Sbjct  144  LSGKTTGGSSEKSEPSASVELNSQNFNELVLKSKELW  180


 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 67/111 (60%), Gaps = 2/111 (2%)
 Frame = +3

Query  177  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  356
            PS  V +LN  NF   VL S  + +VEFFAPWCGHCK L P ++K A  L+G   +  +D
Sbjct  158  PSASV-ELNSQNFNELVLKSKELWIVEFFAPWCGHCKKLAPEWKKAAKNLQGKVKLGHVD  216

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  506
             DA  SL  ++ ++GFPTI VF   K+ P+ Y+GAR A ++  F   Q+  
Sbjct  217  CDAEKSLMSKFNVQGFPTILVFGADKESPLPYEGARSASAIESFALEQLET  267



>gb|KHG02314.1| Protein disulfide-isomerase like 2-2 [Gossypium arboreum]
Length=414

 Score =   236 bits (602),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            NA YGPS+PVLQL PSNFKSKVLNSNGVVLVEFFAPWCGHC+ALTPT+EK A+VL GVAT
Sbjct  23   NAFYGPSSPVLQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCQALTPTWEKAANVLNGVAT  82

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAALDADAH SLA+EYGI+GFPTIKVF PGK PVDYQGAR+ K + +F   Q++ LLKDR
Sbjct  83   VAALDADAHQSLAEEYGIRGFPTIKVFAPGKPPVDYQGARDVKPIAEFALQQVKALLKDR  142

Query  522  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            L GKA+ GS +KS+PSASVELNSRNFD+LV+KSK+LW
Sbjct  143  LAGKASEGSGEKSQPSASVELNSRNFDELVLKSKELW  179


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 59/112 (53%), Gaps = 3/112 (3%)
 Frame = +3

Query  177  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKG-VATVaal  353
            PS  V +LN  NF   VL S  + LVEFFAPWCGHCK L P ++  A+ LKG V      
Sbjct  157  PSASV-ELNSRNFDELVLKSKELWLVEFFAPWCGHCKKLAPEWKMAANNLKGKVKLGHVD  215

Query  354  dadahsslaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  506
                  SL   Y ++ FPTI  F   K  P+ Y+GAR A S+  F   Q+  
Sbjct  216  CDSEKQSLMSRYKVQEFPTILAFGADKDGPILYEGARAASSIESFALEQLET  267



>ref|XP_008229815.1| PREDICTED: protein disulfide isomerase-like 2-3 [Prunus mume]
Length=459

 Score =   237 bits (605),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 126/157 (80%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            +ALYGPS+PVLQL PSNFKSKVL+SN VVLVEFFAPWCGHC+ALTP +EK A+VLKGVAT
Sbjct  46   DALYGPSSPVLQLTPSNFKSKVLDSNRVVLVEFFAPWCGHCQALTPIWEKAATVLKGVAT  105

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAALDADAH SLAQEYGI+GFPTIKVFVPGK PVDYQGAR+ K + +F   QI+ LLKDR
Sbjct  106  VAALDADAHKSLAQEYGIRGFPTIKVFVPGKPPVDYQGARDVKPIAEFALQQIKVLLKDR  165

Query  522  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            L GKATGG S+KSEP+ASVELNS+NFD+LVVKSK+LW
Sbjct  166  LSGKATGGPSEKSEPNASVELNSQNFDELVVKSKELW  202


 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 63/106 (59%), Gaps = 1/106 (1%)
 Frame = +3

Query  192  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  371
            ++LN  NF   V+ S  + +VEFFAPWCGHCK L P ++K A  L+G   +  +D D   
Sbjct  184  VELNSQNFDELVVKSKELWIVEFFAPWCGHCKKLAPEWKKAAKNLQGKVKLGHVDCDVEK  243

Query  372  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  506
            SL   + ++GFPTI +F   K  P+ Y+GAR AK++  F   Q+  
Sbjct  244  SLMSRFNVQGFPTILIFGADKDTPLPYEGARTAKAIESFALEQLET  289



>emb|CDP05711.1| unnamed protein product [Coffea canephora]
Length=438

 Score =   236 bits (603),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 134/180 (74%), Positives = 144/180 (80%), Gaps = 23/180 (13%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSK--------------------VLNSNGVVLVEFFAPWCGH  281
            NALYGPS+PV+QLNPSNFKSK                    VLNSNGVVLVEFFAPWCGH
Sbjct  22   NALYGPSSPVVQLNPSNFKSKPSAFSFSPVVQLNPSNFKSKVLNSNGVVLVEFFAPWCGH  81

Query  282  CKALTPTYEKVASVLKGVATVaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAR  461
            CKALTPT+EK ASVLKGVATVAALDADAH SLAQEYGIKGFPTIKVF PGK PVDYQGAR
Sbjct  82   CKALTPTWEKAASVLKGVATVAALDADAHQSLAQEYGIKGFPTIKVFAPGKSPVDYQGAR  141

Query  462  EAKSMVDFVKAQIRNLLKDRLDGKATGGS---SQKSEPSASVELNSRNFDDLVVKSKDLW  632
            + K + +F   QI+ LLKDRL+GKATGGS   S+KSEPS SVELNS NFDDLV+KSKDLW
Sbjct  142  DVKPIAEFALQQIKALLKDRLNGKATGGSSEKSEKSEPSVSVELNSHNFDDLVLKSKDLW  201


 Score = 82.4 bits (202),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 65/110 (59%), Gaps = 2/110 (2%)
 Frame = +3

Query  177  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  356
            PS  V +LN  NF   VL S  + +VEFFAPWCGHCK L P ++K A+ LKG   +  +D
Sbjct  179  PSVSV-ELNSHNFDDLVLKSKDLWIVEFFAPWCGHCKRLAPEWKKAANNLKGKVKLGHVD  237

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIR  503
             DA  SL   + ++GFPTI VF   K  P  Y+GAR A ++  F   Q+ 
Sbjct  238  CDAEKSLMSRFNVQGFPTILVFGADKDSPSPYEGARTASAIESFALEQLE  287



>ref|XP_007215346.1| hypothetical protein PRUPE_ppa005396mg [Prunus persica]
 gb|EMJ16545.1| hypothetical protein PRUPE_ppa005396mg [Prunus persica]
Length=463

 Score =   237 bits (604),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 126/157 (80%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            +ALYGPS+PVLQL PSNFKSKVL+SN VVLVEFFAPWCGHC+ALTP +EK A+VLKGVAT
Sbjct  50   DALYGPSSPVLQLTPSNFKSKVLDSNRVVLVEFFAPWCGHCQALTPIWEKAATVLKGVAT  109

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAALDADAH SLAQEYGI+GFPTIKVFVPGK PVDYQGAR+ K + +F   QI+ LLKDR
Sbjct  110  VAALDADAHKSLAQEYGIRGFPTIKVFVPGKPPVDYQGARDVKPVAEFALQQIKVLLKDR  169

Query  522  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            L GKATGG S+KSEP+ASVELNS+NFD+LVVKSK+LW
Sbjct  170  LSGKATGGPSEKSEPNASVELNSQNFDELVVKSKELW  206


 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 63/106 (59%), Gaps = 1/106 (1%)
 Frame = +3

Query  192  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  371
            ++LN  NF   V+ S  + +VEFFAPWCGHCK L P ++K A  L+G   +  +D D   
Sbjct  188  VELNSQNFDELVVKSKELWIVEFFAPWCGHCKKLAPEWKKAAKNLQGKVKLGHVDCDVEK  247

Query  372  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  506
            SL   + ++GFPTI +F   K  P+ Y+GAR AK++  F   Q+  
Sbjct  248  SLMSRFNVQGFPTILIFGADKDTPLPYEGARTAKAIESFALEQLET  293



>ref|XP_009409222.1| PREDICTED: protein disulfide isomerase-like 2-3 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=431

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            NALY PS+PV+QLNPSNFKSKVLNSNGVVLVEFFAPWCGHC+ALTPT+EK A+VLKGVAT
Sbjct  19   NALYSPSSPVVQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCQALTPTWEKAATVLKGVAT  78

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            +AALDADAH SLAQEYGIKGFPTIKVF PGK PVDYQGAR+ K + +F   Q++ LLK+R
Sbjct  79   IAALDADAHKSLAQEYGIKGFPTIKVFSPGKPPVDYQGARDVKPIAEFALQQVKALLKER  138

Query  522  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            L GKA+G SS+KSEPSASV L S+NFD+LV+KSKD+W
Sbjct  139  LSGKASGDSSEKSEPSASVVLTSQNFDELVIKSKDVW  175


 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 60/111 (54%), Gaps = 3/111 (3%)
 Frame = +3

Query  177  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKG-VATVaal  353
            PS  V+ L   NF   V+ S  V +VEFFAPWCGHCK L P ++K A+ LKG V      
Sbjct  153  PSASVV-LTSQNFDELVIKSKDVWIVEFFAPWCGHCKKLAPEWKKAANNLKGKVKLGHVD  211

Query  354  dadahsslaQEYGIKGFPTIKVF-VPGKQPVDYQGAREAKSMVDFVKAQIR  503
                  SL   + ++GFPTI VF +    P  Y+GAR A ++  +   Q+ 
Sbjct  212  CDAEKQSLMSRFNVQGFPTILVFGLDKSSPYPYEGARTALAIEAYGLEQLE  262



>ref|XP_009409223.1| PREDICTED: protein disulfide isomerase-like 2-3 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=430

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            NALY PS+PV+QLNPSNFKSKVLNSNGVVLVEFFAPWCGHC+ALTPT+EK A+VLKGVAT
Sbjct  19   NALYSPSSPVVQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCQALTPTWEKAATVLKGVAT  78

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            +AALDADAH SLAQEYGIKGFPTIKVF PGK PVDYQGAR+ K + +F   Q++ LLK+R
Sbjct  79   IAALDADAHKSLAQEYGIKGFPTIKVFSPGKPPVDYQGARDVKPIAEFALQQVKALLKER  138

Query  522  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            L GKA+G SS+KSEPSASV L S+NFD+LV+KSKD+W
Sbjct  139  LSGKASGDSSEKSEPSASVVLTSQNFDELVIKSKDVW  175


 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 64/110 (58%), Gaps = 2/110 (2%)
 Frame = +3

Query  177  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  356
            PS  V+ L   NF   V+ S  V +VEFFAPWCGHCK L P ++K A+ LKG   +  +D
Sbjct  153  PSASVV-LTSQNFDELVIKSKDVWIVEFFAPWCGHCKKLAPEWKKAANNLKGKVKLGHVD  211

Query  357  adahsslaQEYGIKGFPTIKVF-VPGKQPVDYQGAREAKSMVDFVKAQIR  503
             DA  SL   + ++GFPTI VF +    P  Y+GAR A ++  +   Q+ 
Sbjct  212  CDAEKSLMSRFNVQGFPTILVFGLDKSSPYPYEGARTALAIEAYGLEQLE  261



>ref|XP_008379697.1| PREDICTED: protein disulfide isomerase-like 2-3 [Malus domestica]
Length=435

 Score =   235 bits (599),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            +ALYGPSTPVLQL PSNFKSKVL+SN VVLVEFFAPWCGHC+ALTP +EK A+VLKGVAT
Sbjct  24   DALYGPSTPVLQLTPSNFKSKVLDSNRVVLVEFFAPWCGHCQALTPIWEKAATVLKGVAT  83

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAALDADAH SLAQEYGI+G PTIKVFVPGK PVDYQGAR+ K + +F   QI+ LLKDR
Sbjct  84   VAALDADAHKSLAQEYGIRGXPTIKVFVPGKPPVDYQGARDVKPVAEFALQQIKALLKDR  143

Query  522  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            L GK TGGSS+KSEPSASVELNS+NF++LV+KSK+LW
Sbjct  144  LSGKTTGGSSEKSEPSASVELNSQNFNELVLKSKELW  180


 Score = 82.4 bits (202),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 66/111 (59%), Gaps = 2/111 (2%)
 Frame = +3

Query  177  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  356
            PS  V +LN  NF   VL S  + +VEFFAPWCGHCK L P ++K A  L+G   +  +D
Sbjct  158  PSASV-ELNSQNFNELVLKSKELWIVEFFAPWCGHCKKLAPEWKKAAKNLQGKVKLGHVD  216

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  506
             DA  SL  ++ ++GFPTI VF   K+ P+ Y+GAR A +   F   Q+  
Sbjct  217  CDAEKSLMSKFNVQGFPTILVFGADKESPLPYEGARSASAXESFALEQLET  267



>ref|XP_008456396.1| PREDICTED: protein disulfide isomerase-like 2-3 [Cucumis melo]
Length=438

 Score =   234 bits (598),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 141/158 (89%), Gaps = 1/158 (1%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            NALYG S+PVLQL PSNFKSKVLNSNG+VLVEFFAPWCGHC+ALTP +EK A++LKGVAT
Sbjct  24   NALYGASSPVLQLTPSNFKSKVLNSNGIVLVEFFAPWCGHCQALTPVWEKAATILKGVAT  83

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAALDADAH SLAQEYGIKGFPTIKVF PGK PVDYQGAR+ K + +F   Q++ LLK+R
Sbjct  84   VAALDADAHKSLAQEYGIKGFPTIKVFAPGKPPVDYQGARDVKPIAEFALQQVKALLKER  143

Query  522  LDGKAT-GGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            L+GK T GGS++KSEP+AS ELNSRNFD+LV+KSKDLW
Sbjct  144  LNGKTTGGGSNEKSEPNASEELNSRNFDELVIKSKDLW  181


 Score = 82.4 bits (202),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 46/105 (44%), Positives = 62/105 (59%), Gaps = 1/105 (1%)
 Frame = +3

Query  195  QLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahss  374
            +LN  NF   V+ S  + +VEFFAPWCGHCK L P ++K A  LKG   +  +D DA  S
Sbjct  164  ELNSRNFDELVIKSKDLWIVEFFAPWCGHCKRLAPEWKKAAKNLKGKVKLGHVDCDAEKS  223

Query  375  laQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  506
            L   + ++GFPTI VF   K  P+ Y+GAR A ++  F   Q+  
Sbjct  224  LMSRFNVQGFPTILVFGADKDSPIPYEGARTASAIESFALDQLET  268



>ref|XP_009143922.1| PREDICTED: protein disulfide-isomerase 2-3 [Brassica rapa]
Length=443

 Score =   234 bits (598),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 142/161 (88%), Gaps = 4/161 (2%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            NALYG S+PV+QL  SNFKSKVLNSNGVVLVEFFAPWCGHCKALTPT+EKVASVLKGVAT
Sbjct  24   NALYGSSSPVVQLTASNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTWEKVASVLKGVAT  83

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAA+DADAH S AQ+YGI+GFPTIKVFVPGK PVDYQGAR+AKS+ +F   QI+ LL DR
Sbjct  84   VAAIDADAHQSAAQDYGIQGFPTIKVFVPGKPPVDYQGARDAKSIANFAYKQIKALLSDR  143

Query  522  LDGKAT---GGSSQ-KSEPSASVELNSRNFDDLVVKSKDLW  632
            L+GK+    GGSS+ KSEPSASVELNS NFD+LV+KS DLW
Sbjct  144  LEGKSKPSGGGSSEKKSEPSASVELNSSNFDELVIKSNDLW  184


 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 62/104 (60%), Gaps = 2/104 (2%)
 Frame = +3

Query  177  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  356
            PS  V +LN SNF   V+ SN + +VEFFAPWCGHCK L P +++ A  LKG   +  ++
Sbjct  162  PSASV-ELNSSNFDELVIKSNDLWIVEFFAPWCGHCKKLAPEWKRAAKNLKGKVKLGHVN  220

Query  357  adahsslaQEYGIKGFPTIKVF-VPGKQPVDYQGAREAKSMVDF  485
             D   S+   + ++GFPTI VF V    P  Y GAR A ++  F
Sbjct  221  CDVEQSIMSRFKVQGFPTIMVFGVDKSSPYAYDGARSASAIESF  264



>gb|AFK43048.1| unknown [Lotus japonicus]
Length=440

 Score =   234 bits (597),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 121/157 (77%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            +ALYG S+PV+QLNPSNFKSKVLNS GVVLVEFFAPWCGHCKALTP +EK A+VLKGV T
Sbjct  28   HALYGASSPVVQLNPSNFKSKVLNSKGVVLVEFFAPWCGHCKALTPIWEKAATVLKGVVT  87

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAALDADAH +LAQEYGI+GFPTIKVF PGK PVDYQGAR+ K + ++   Q++ LLKDR
Sbjct  88   VAALDADAHQALAQEYGIRGFPTIKVFAPGKPPVDYQGARDVKPIAEYALQQVKALLKDR  147

Query  522  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            L+GKATGGS++K+E SASVELNSRNFD+LV+KSK+LW
Sbjct  148  LNGKATGGSNEKTETSASVELNSRNFDELVLKSKELW  184


 Score = 85.9 bits (211),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 65/106 (61%), Gaps = 1/106 (1%)
 Frame = +3

Query  192  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  371
            ++LN  NF   VL S  + +VEFFAPWCGHCK L P ++K ++ LKG   +  +D DA  
Sbjct  166  VELNSRNFDELVLKSKELWVVEFFAPWCGHCKKLAPEWKKASNNLKGKVKLGHVDCDADQ  225

Query  372  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  506
            SL   +G+KGFPTI VF   K  P+ Y+GAR A ++  F   Q+  
Sbjct  226  SLMSRFGVKGFPTILVFGADKDTPIPYEGARTASAIESFALEQLET  271



>emb|CDY52544.1| BnaA05g35030D [Brassica napus]
Length=444

 Score =   234 bits (598),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 142/161 (88%), Gaps = 4/161 (2%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            NALYG S+PV+QL  SNFKSKVLNSNGVVLVEFFAPWCGHCKALTPT+EKVASVLKGVAT
Sbjct  25   NALYGSSSPVVQLTASNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTWEKVASVLKGVAT  84

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAA+DADAH S AQ+YGI+GFPTIKVFVPGK PVDYQGAR+AKS+ +F   QI+ LL DR
Sbjct  85   VAAIDADAHQSAAQDYGIQGFPTIKVFVPGKPPVDYQGARDAKSIANFAYKQIKALLSDR  144

Query  522  LDGKAT---GGSSQ-KSEPSASVELNSRNFDDLVVKSKDLW  632
            L+GK+    GGSS+ KSEPSASVELNS NFD+LV+KS DLW
Sbjct  145  LEGKSKPSGGGSSEKKSEPSASVELNSSNFDELVIKSNDLW  185


 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 62/104 (60%), Gaps = 2/104 (2%)
 Frame = +3

Query  177  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  356
            PS  V +LN SNF   V+ SN + +VEFFAPWCGHCK L P +++ A  LKG   +  ++
Sbjct  163  PSASV-ELNSSNFDELVIKSNDLWIVEFFAPWCGHCKKLAPEWKRAAKNLKGKVKLGHVN  221

Query  357  adahsslaQEYGIKGFPTIKVF-VPGKQPVDYQGAREAKSMVDF  485
             D   S+   + ++GFPTI VF V    P  Y GAR A ++  F
Sbjct  222  CDVEQSIMSRFKVQGFPTIMVFGVDKSSPYAYDGARSASAIESF  265



>ref|XP_008805603.1| PREDICTED: protein disulfide isomerase-like 2-3 [Phoenix dactylifera]
Length=430

 Score =   234 bits (596),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 123/156 (79%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = +3

Query  165  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  344
            ALY PS+PV+QLNPSNFKSKVLN+NGVVLVEFFAPWCGHC+ALTPT+EK A+VLKGVATV
Sbjct  20   ALYSPSSPVVQLNPSNFKSKVLNANGVVLVEFFAPWCGHCQALTPTWEKAATVLKGVATV  79

Query  345  aaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRL  524
            AALDADAH SLAQEYGIKGFPTIKVF PGK PVDYQGAR+ K + +F   QI+ LLK+RL
Sbjct  80   AALDADAHKSLAQEYGIKGFPTIKVFSPGKPPVDYQGARDVKPIAEFALQQIKALLKERL  139

Query  525  DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            +GK++ GSS+KSE SAS+EL SRNFD+LV+KSKDLW
Sbjct  140  NGKSSRGSSEKSETSASIELTSRNFDELVLKSKDLW  175


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 62/106 (58%), Gaps = 1/106 (1%)
 Frame = +3

Query  192  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  371
            ++L   NF   VL S  + +VEFFAPWCGHCK L P ++K ++ LKG   +  +D DA  
Sbjct  157  IELTSRNFDELVLKSKDLWIVEFFAPWCGHCKKLAPEWKKASNNLKGKVKLGHVDCDAEK  216

Query  372  slaQEYGIKGFPTIKVF-VPGKQPVDYQGAREAKSMVDFVKAQIRN  506
            SL   + ++GFPTI VF +    P  Y+GAR A ++  F   Q+  
Sbjct  217  SLMSRFNVQGFPTILVFGIVKDSPYPYEGARVASAIESFALEQLET  262



>emb|CDY12149.1| BnaC04g11790D [Brassica napus]
Length=443

 Score =   234 bits (597),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 142/161 (88%), Gaps = 4/161 (2%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            NALYG S+PV+QL  SNFKSKVLNSNGVVLVEFFAPWCGHCKALTPT+EKVASVLKGVAT
Sbjct  24   NALYGSSSPVVQLTASNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTWEKVASVLKGVAT  83

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAA+DADAH S AQ+YGI+GFPTIKVFVPGK PVDYQGAR+AKS+ +F   QI+ LL DR
Sbjct  84   VAAIDADAHQSAAQDYGIQGFPTIKVFVPGKPPVDYQGARDAKSIANFAYKQIKALLSDR  143

Query  522  LDGKAT---GGSSQ-KSEPSASVELNSRNFDDLVVKSKDLW  632
            L+GK+    GGSS+ KSEPSASVELNS NFD+LV+KS DLW
Sbjct  144  LEGKSKPSGGGSSEKKSEPSASVELNSSNFDELVIKSNDLW  184


 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 62/104 (60%), Gaps = 2/104 (2%)
 Frame = +3

Query  177  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  356
            PS  V +LN SNF   V+ SN + +VEFFAPWCGHCK L P +++ A  LKG   +  ++
Sbjct  162  PSASV-ELNSSNFDELVIKSNDLWIVEFFAPWCGHCKKLAPEWKRAAKNLKGKVKLGHVN  220

Query  357  adahsslaQEYGIKGFPTIKVF-VPGKQPVDYQGAREAKSMVDF  485
             D   S+   + ++GFPTI VF V    P  Y GAR A ++  F
Sbjct  221  CDVEQSIMSRFKVQGFPTIMVFGVDKSSPYAYDGARSASAIESF  264



>ref|XP_010252582.1| PREDICTED: protein disulfide isomerase-like 2-3 [Nelumbo nucifera]
Length=434

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            +ALYGPS+PV+QL+PSNFK+KVLNSNGVVLVEFFAPWCGHC+ALTPT+EK A++LKGVAT
Sbjct  23   DALYGPSSPVVQLSPSNFKNKVLNSNGVVLVEFFAPWCGHCQALTPTWEKAATLLKGVAT  82

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAALDADAH SLAQE+GI+GFPTIK FVPGK PVDYQGAR+AK++ +F   QI+ L+K+R
Sbjct  83   VAALDADAHKSLAQEHGIQGFPTIKAFVPGKPPVDYQGARDAKAIAEFALKQIKALVKER  142

Query  522  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            L+ K  GGSS+KSEPSAS+ELNS+ FDD+V+KSKDLW
Sbjct  143  LNEKPAGGSSEKSEPSASIELNSQIFDDMVLKSKDLW  179


 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 62/105 (59%), Gaps = 1/105 (1%)
 Frame = +3

Query  192  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  371
            ++LN   F   VL S  + +VEFFAPWCGHCK L P ++K A+ LKG   +  ++ D   
Sbjct  161  IELNSQIFDDMVLKSKDLWIVEFFAPWCGHCKKLAPEWKKAANNLKGKVKLGHVNCDEEK  220

Query  372  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIR  503
            SL   + ++GFPTI VF   K  PV Y+GAR A ++  F   Q+ 
Sbjct  221  SLMSRFKVQGFPTILVFGADKDIPVSYEGARSASAIESFALEQLE  265



>ref|XP_006306333.1| hypothetical protein CARUB_v10012209mg [Capsella rubella]
 gb|EOA39231.1| hypothetical protein CARUB_v10012209mg [Capsella rubella]
Length=433

 Score =   232 bits (592),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 143/163 (88%), Gaps = 6/163 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            NALYG S+PV+QL PSNFKSKVLNSNGVVLVEFFAPWCGHCK+LTPT+EKVA+ LKG+AT
Sbjct  12   NALYGSSSPVVQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCKSLTPTWEKVANTLKGIAT  71

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAA+DADAH S++Q+YG++GFPTIKVFVPGK P+DYQGAR+AKS+  F   QI+ LLKDR
Sbjct  72   VAAIDADAHKSVSQDYGVRGFPTIKVFVPGKPPIDYQGARDAKSIAQFAIKQIKALLKDR  131

Query  522  LDGKAT-----GGSSQ-KSEPSASVELNSRNFDDLVVKSKDLW  632
            LDGK T     GGS+Q KSEPS SVELNS NFD+LV++SK+LW
Sbjct  132  LDGKTTGTKNGGGSNQKKSEPSVSVELNSSNFDELVIESKELW  174


 Score = 85.5 bits (210),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 68/111 (61%), Gaps = 2/111 (2%)
 Frame = +3

Query  177  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  356
            PS  V +LN SNF   V+ S  + +VEFFAPWCGHCK L P ++K A+ LKG   +  ++
Sbjct  152  PSVSV-ELNSSNFDELVIESKELWIVEFFAPWCGHCKKLAPEWKKAANKLKGKVKLGHVN  210

Query  357  adahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRN  506
             DA  S+   + ++G+PTI VF   K  PV Y+GAR A ++  F   Q+ +
Sbjct  211  CDAEQSIKSRFKVQGYPTILVFAADKSSPVPYEGARSASAIESFALEQLES  261



>ref|XP_010484503.1| PREDICTED: protein disulfide-isomerase like 2-2-like [Camelina 
sativa]
Length=445

 Score =   232 bits (592),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 144/163 (88%), Gaps = 6/163 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            NALYG S+PV+QL PSNFKSKVLNSNGVVLVEFFAPWCGHCK+LTPT+EKVA+ LKG+AT
Sbjct  24   NALYGSSSPVVQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCKSLTPTWEKVANTLKGIAT  83

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAA+DADAH S++Q+YG++GFPTIKVFVPGK P+DYQGAR+AKS+  F   QI+ LLK+R
Sbjct  84   VAAIDADAHKSVSQDYGVRGFPTIKVFVPGKPPIDYQGARDAKSIAQFAIKQIKALLKNR  143

Query  522  LDGKAT-----GGSSQ-KSEPSASVELNSRNFDDLVVKSKDLW  632
            LDGK T     GGSS+ KSEPSASVELNS NFD+LV++SK+LW
Sbjct  144  LDGKTTGTKNGGGSSEKKSEPSASVELNSSNFDELVIESKELW  186


 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 65/111 (59%), Gaps = 2/111 (2%)
 Frame = +3

Query  177  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  356
            PS  V +LN SNF   V+ S  + +VEFFAPWCGHCK L P ++K A  LK    +  ++
Sbjct  164  PSASV-ELNSSNFDELVIESKELWIVEFFAPWCGHCKKLAPEWKKAAKKLKEKVKLGHVN  222

Query  357  adahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRN  506
             D   S+   + ++GFPTI VF   K  PV Y+GAR A ++  F   Q+ +
Sbjct  223  CDVEQSIKSRFKVQGFPTILVFGADKSSPVPYEGARSASAIESFALEQLES  273



>ref|XP_004491086.1| PREDICTED: protein disulfide isomerase-like 2-3-like [Cicer arietinum]
Length=436

 Score =   231 bits (590),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 140/158 (89%), Gaps = 2/158 (1%)
 Frame = +3

Query  165  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  344
            ALYG S+PVLQL PSNFKSKVLNSNGVVLVEFFAPWCGHCKALTP +EK A+VLKGV TV
Sbjct  24   ALYGSSSPVLQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPIWEKAATVLKGVVTV  83

Query  345  aaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRL  524
            AALDADAH SLAQEYGI+GFPTIKVF PGK PVDYQGAR+ K + +F   Q++ LLK+R+
Sbjct  84   AALDADAHQSLAQEYGIRGFPTIKVFAPGKPPVDYQGARDVKPIAEFALQQVKALLKERI  143

Query  525  DGKATGGSSQKSE--PSASVELNSRNFDDLVVKSKDLW  632
            +GKATGGS++KSE   SASVELNSRNFD+LVVKSK+LW
Sbjct  144  NGKATGGSNEKSETSSSASVELNSRNFDELVVKSKELW  181


 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 66/110 (60%), Gaps = 1/110 (1%)
 Frame = +3

Query  180  STPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaalda  359
            S+  ++LN  NF   V+ S  + +VEFFAPWCGHCK L P ++K ++ LKG   +  +D 
Sbjct  159  SSASVELNSRNFDELVVKSKELWIVEFFAPWCGHCKKLAPEWKKASNNLKGKVKLGHVDC  218

Query  360  dahsslaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  506
            DA  SL   + ++GFPTI VF   K  P+ Y+GAR A ++  F   Q+  
Sbjct  219  DAEKSLMSRFNVQGFPTILVFGADKDTPIPYEGARSASAIESFALEQLET  268



>ref|XP_006410429.1| hypothetical protein EUTSA_v10016663mg [Eutrema salsugineum]
 gb|ESQ51882.1| hypothetical protein EUTSA_v10016663mg [Eutrema salsugineum]
Length=442

 Score =   231 bits (590),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 141/161 (88%), Gaps = 4/161 (2%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            NALYG S+PV+QL  +NFKSKVLNSNGVVLVEFFAPWCGHCKALTPT+EKVAS+LKGVAT
Sbjct  23   NALYGSSSPVVQLTATNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTWEKVASILKGVAT  82

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAA+DADAH S AQ+YGIKGFPTIKVFVPGK PVDYQGAR+AKS+ +F   QI+ LL DR
Sbjct  83   VAAIDADAHQSAAQDYGIKGFPTIKVFVPGKPPVDYQGARDAKSIANFAYKQIKALLSDR  142

Query  522  LDGKA--TGGSS--QKSEPSASVELNSRNFDDLVVKSKDLW  632
            L+GK+  TGG S  +KSE SASVELNS NFD+LV+KS DLW
Sbjct  143  LEGKSKPTGGGSNEKKSEASASVELNSSNFDELVIKSNDLW  183


 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 60/99 (61%), Gaps = 1/99 (1%)
 Frame = +3

Query  192  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  371
            ++LN SNF   V+ SN + +VEFFAPWCGHCK L P ++K A  LKG   +  ++ D   
Sbjct  165  VELNSSNFDELVIKSNDLWIVEFFAPWCGHCKNLAPEWKKAAKNLKGKVKLGHVNCDVEQ  224

Query  372  slaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDF  485
            S+   + ++GFPTI VF   K  P  Y GAR A ++  F
Sbjct  225  SIMSRFKVQGFPTIMVFGADKSSPYAYDGARSASAIESF  263



>ref|XP_006418074.1| hypothetical protein EUTSA_v10007682mg [Eutrema salsugineum]
 gb|ESQ36427.1| hypothetical protein EUTSA_v10007682mg [Eutrema salsugineum]
Length=434

 Score =   231 bits (589),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 143/163 (88%), Gaps = 6/163 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            NALYG S+PVLQL PSNFKSKVLNSNGVVLVEFFAPWCGHC++LTPT+EKVA+ LKGVAT
Sbjct  24   NALYGSSSPVLQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCQSLTPTWEKVATTLKGVAT  83

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAA+DADAH S++Q+YG++GFPTIKVFVPGK P+DYQGAR+AK++  F   QI+ LLKDR
Sbjct  84   VAAIDADAHKSVSQDYGVRGFPTIKVFVPGKPPIDYQGARDAKAISQFAIKQIKGLLKDR  143

Query  522  LDGKAT-----GGSSQ-KSEPSASVELNSRNFDDLVVKSKDLW  632
            LDGK       GGSS+ KSEPSASVELNS NFD+LV++SK+LW
Sbjct  144  LDGKTAGTKTGGGSSEKKSEPSASVELNSSNFDELVIESKELW  186


 Score = 85.5 bits (210),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 68/111 (61%), Gaps = 2/111 (2%)
 Frame = +3

Query  177  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  356
            PS  V +LN SNF   V+ S  + +VEFFAPWCGHCK L P ++K A+ LKG   +  ++
Sbjct  164  PSASV-ELNSSNFDELVIESKELWIVEFFAPWCGHCKKLAPEWKKAANKLKGKVKLGHVN  222

Query  357  adahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRN  506
             DA  S+   + ++GFPTI VF   K  PV Y+GAR A ++  F   Q+ +
Sbjct  223  CDADKSIQSRFKVQGFPTILVFGADKSSPVPYEGARSASAIESFALEQLES  273



>ref|NP_001236576.1| protein disulfide isomerse like protein precursor [Glycine max]
 dbj|BAF95902.1| protein disulfide isomerase family [Glycine max]
 dbj|BAD42856.2| protein disulfide isomerse like protein [Glycine max]
Length=438

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 121/157 (77%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            +ALYG S+PVLQL PSNFKSKVLNSNGVVLVEFFAPWCGHC+ALTP +EK A+VLKGV T
Sbjct  27   HALYGASSPVLQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCQALTPIWEKAATVLKGVVT  86

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAA+DADAH SLAQEYGI+GFPTIKVF PGK PVDYQGAR+ K + +F   Q++ LLKDR
Sbjct  87   VAAIDADAHPSLAQEYGIRGFPTIKVFAPGKPPVDYQGARDVKPIAEFALQQVKALLKDR  146

Query  522  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            L GKATGGSS K+E S+SVELNS NFD+LV+KSK+LW
Sbjct  147  LSGKATGGSSDKTETSSSVELNSGNFDELVIKSKELW  183


 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 64/106 (60%), Gaps = 1/106 (1%)
 Frame = +3

Query  192  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  371
            ++LN  NF   V+ S  + +VEFFAPWCGHCK L P ++K ++ LKG   +  +D DA  
Sbjct  165  VELNSGNFDELVIKSKELWIVEFFAPWCGHCKKLAPEWKKASNSLKGKVKLGHVDCDAEK  224

Query  372  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  506
            SL   + ++GFPTI VF   K  P+ Y+GAR A ++  F   Q+  
Sbjct  225  SLMSRFKVQGFPTILVFGADKDSPIPYEGARTALAIESFALEQLET  270



>ref|NP_171990.3| protein disulfide-isomerase like 2-2 [Arabidopsis thaliana]
 sp|Q9MAU6.2|PDI22_ARATH RecName: Full=Protein disulfide-isomerase like 2-2; Short=AtPDIL2-2; 
AltName: Full=Protein disulfide-isomerase 10; Short=PDI10; 
AltName: Full=Protein disulfide-isomerase like 5-1; Short=AtPDIL5-1; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AEE27773.1| protein disulfide-isomerase like 2-2 [Arabidopsis thaliana]
Length=447

 Score =   231 bits (590),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 143/164 (87%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            NALYG S+PVLQL PSNFKSKVLNSNGVVLVEFFAPWCGHC++LTPT+EKVAS LKG+AT
Sbjct  25   NALYGSSSPVLQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCQSLTPTWEKVASTLKGIAT  84

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAA+DADAH S++Q+YG++GFPTIKVFVPGK P+DYQGAR+AKS+  F   QI+ LLKDR
Sbjct  85   VAAIDADAHKSVSQDYGVRGFPTIKVFVPGKPPIDYQGARDAKSISQFAIKQIKALLKDR  144

Query  522  LDGKAT-----GGSSQ--KSEPSASVELNSRNFDDLVVKSKDLW  632
            LDGK +     GGSS+  KSEPSASVELNS NFD+LV +SK+LW
Sbjct  145  LDGKTSGTKNGGGSSEKKKSEPSASVELNSSNFDELVTESKELW  188


 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 67/111 (60%), Gaps = 2/111 (2%)
 Frame = +3

Query  177  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  356
            PS  V +LN SNF   V  S  + +VEFFAPWCGHCK L P ++K A+ LKG   +  ++
Sbjct  166  PSASV-ELNSSNFDELVTESKELWIVEFFAPWCGHCKKLAPEWKKAANNLKGKVKLGHVN  224

Query  357  adahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRN  506
             DA  S+   + ++GFPTI VF   K  PV Y+GAR A ++  F   Q+ +
Sbjct  225  CDAEQSIKSRFKVQGFPTILVFGSDKSSPVPYEGARSASAIESFALEQLES  275



>ref|XP_002892256.1| hypothetical protein ARALYDRAFT_470488 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68515.1| hypothetical protein ARALYDRAFT_470488 [Arabidopsis lyrata subsp. 
lyrata]
Length=442

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 139/159 (87%), Gaps = 2/159 (1%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            NALYG S+PVLQL PSNFKSKVLNSNGVVLVEFFAPWCGHC++LTPT+EKVA+ LKG+AT
Sbjct  25   NALYGSSSPVLQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCQSLTPTWEKVANTLKGIAT  84

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAA+DADAH S++Q+YG++GFPTIKVFVPGK P+DYQGAR+AKS+  F   QI+ LLKDR
Sbjct  85   VAAIDADAHKSVSQDYGVRGFPTIKVFVPGKPPIDYQGARDAKSISQFAIKQIKTLLKDR  144

Query  522  LDGKATG--GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            LDGK TG      KSEPSASVELNS NFD+LVV+SK LW
Sbjct  145  LDGKTTGTKNGGGKSEPSASVELNSSNFDELVVESKQLW  183


 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 68/111 (61%), Gaps = 2/111 (2%)
 Frame = +3

Query  177  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  356
            PS  V +LN SNF   V+ S  + +VEFFAPWCGHCK L P ++K A+ L+G   +  ++
Sbjct  161  PSASV-ELNSSNFDELVVESKQLWIVEFFAPWCGHCKKLAPEWKKAANKLQGKVKLGHVN  219

Query  357  adahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRN  506
             DA  S+   + ++GFPTI VF   K  PV Y+GAR A ++  F   Q+ +
Sbjct  220  CDAEQSIKSRFKVQGFPTILVFGADKSSPVPYEGARSASAIESFALEQLES  270



>gb|KHN44746.1| Protein disulfide isomerase-like 2-3 [Glycine soja]
Length=442

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 121/157 (77%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            +ALYG S+PVLQL PSNFKSKVLNSNGVVLVEFFAPWCGHC+ALTP +EK A+VLKGV T
Sbjct  27   HALYGASSPVLQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCQALTPIWEKAATVLKGVVT  86

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAA+DADAH SLAQEYGI+GFPTIKVF PGK PVDYQGAR+ K + +F   Q++ LLKDR
Sbjct  87   VAAIDADAHPSLAQEYGIRGFPTIKVFAPGKPPVDYQGARDVKPIAEFALQQVKALLKDR  146

Query  522  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            L GKATGGSS K+E S+SVELNS NFD+LV+KSK+LW
Sbjct  147  LSGKATGGSSDKTETSSSVELNSGNFDELVIKSKELW  183


 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 64/106 (60%), Gaps = 1/106 (1%)
 Frame = +3

Query  192  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  371
            ++LN  NF   V+ S  + +VEFFAPWCGHCK L P ++K ++ LKG   +  +D DA  
Sbjct  165  VELNSGNFDELVIKSKELWIVEFFAPWCGHCKKLAPEWKKASNSLKGKVKLGHVDCDAEK  224

Query  372  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  506
            SL   + ++GFPTI VF   K  P+ Y+GAR A ++  F   Q+  
Sbjct  225  SLMSRFKVQGFPTILVFGADKDSPIPYEGARTALAIESFALEQLET  270



>ref|XP_010475171.1| PREDICTED: protein disulfide-isomerase like 2-2 [Camelina sativa]
Length=448

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 142/163 (87%), Gaps = 6/163 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            NALYG S+PV+QL PSNFKSKVLNSNGVVLVEFFAPWCGHCK+LTPT+EKVA+ LKG+AT
Sbjct  27   NALYGSSSPVVQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCKSLTPTWEKVANTLKGIAT  86

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAA+DADAH S++Q+YG++GFPTIKVFVPGK P+DYQGAR+AKS+  F   QI+ LLKDR
Sbjct  87   VAAIDADAHKSVSQDYGVRGFPTIKVFVPGKPPIDYQGARDAKSIAQFAIKQIKALLKDR  146

Query  522  LDGKAT-----GGSSQ-KSEPSASVELNSRNFDDLVVKSKDLW  632
            LDGK T     GGSS+ KSEPS SVELNS NFD+LV +SK+LW
Sbjct  147  LDGKTTGTKNGGGSSEKKSEPSTSVELNSSNFDELVTESKELW  189


 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 65/111 (59%), Gaps = 2/111 (2%)
 Frame = +3

Query  177  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  356
            PST V +LN SNF   V  S  + +VEFFAPWCGHCK L P ++K A  LK    +  ++
Sbjct  167  PSTSV-ELNSSNFDELVTESKELWIVEFFAPWCGHCKKLAPEWKKAAKKLKEKVKLGHVN  225

Query  357  adahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRN  506
             D   S+   + ++GFPTI VF   K  PV Y+GAR A ++  F   Q+ +
Sbjct  226  CDVEQSIKSRFKVQGFPTILVFGADKSSPVPYEGARSASAIESFALEQLES  276



>gb|AAF40463.1|AC004809_21 Strong simialrity to the disulfide isomerase precursor homolog 
T21L14.14 gi|2702281 from A. thaliana on BAC gb|AC003033 [Arabidopsis 
thaliana]
 gb|AAM20664.1| disulfide isomerase-related protein, putative [Arabidopsis thaliana]
Length=443

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 143/164 (87%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            NALYG S+PVLQL PSNFKSKVLNSNGVVLVEFFAPWCGHC++LTPT+EKVAS LKG+AT
Sbjct  21   NALYGSSSPVLQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCQSLTPTWEKVASTLKGIAT  80

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAA+DADAH S++Q+YG++GFPTIKVFVPGK P+DYQGAR+AKS+  F   QI+ LLKDR
Sbjct  81   VAAIDADAHKSVSQDYGVRGFPTIKVFVPGKPPIDYQGARDAKSISQFAIKQIKALLKDR  140

Query  522  LDGKAT-----GGSSQ--KSEPSASVELNSRNFDDLVVKSKDLW  632
            LDGK +     GGSS+  KSEPSASVELNS NFD+LV +SK+LW
Sbjct  141  LDGKTSGTKNGGGSSEKKKSEPSASVELNSSNFDELVTESKELW  184


 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 67/111 (60%), Gaps = 2/111 (2%)
 Frame = +3

Query  177  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  356
            PS  V +LN SNF   V  S  + +VEFFAPWCGHCK L P ++K A+ LKG   +  ++
Sbjct  162  PSASV-ELNSSNFDELVTESKELWIVEFFAPWCGHCKKLAPEWKKAANNLKGKVKLGHVN  220

Query  357  adahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRN  506
             DA  S+   + ++GFPTI VF   K  PV Y+GAR A ++  F   Q+ +
Sbjct  221  CDAEQSIKSRFKVQGFPTILVFGSDKSSPVPYEGARSASAIESFALEQLES  271



>gb|EPS59466.1| hypothetical protein M569_15341, partial [Genlisea aurea]
Length=197

 Score =   223 bits (568),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 122/156 (78%), Positives = 138/156 (88%), Gaps = 0/156 (0%)
 Frame = +3

Query  165  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  344
            ALYGPS+ V+QLN +NFKSKVLNSNGVVLVEFFAPWCGHC+ALTPT+EK A++LKGVATV
Sbjct  1    ALYGPSSLVVQLNSNNFKSKVLNSNGVVLVEFFAPWCGHCQALTPTWEKAANILKGVATV  60

Query  345  aaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRL  524
            AA+DADAH SLAQEYGIKGFPTIKVF PGK PVDYQGARE K + +F   QI+ LL DRL
Sbjct  61   AAVDADAHKSLAQEYGIKGFPTIKVFAPGKPPVDYQGAREVKPIAEFAVKQIKALLSDRL  120

Query  525  DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            +GK   GSS+KSEPSASVELNSRNFD+LV+ SK+LW
Sbjct  121  NGKTPEGSSEKSEPSASVELNSRNFDELVINSKELW  156


 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 35/52 (67%), Gaps = 1/52 (2%)
 Frame = +3

Query  177  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKG  332
            PS  V +LN  NF   V+NS  + +VEFFAPWCGHCK L P ++K A  LKG
Sbjct  134  PSASV-ELNSRNFDELVINSKELWIVEFFAPWCGHCKKLAPEWKKAAKNLKG  184



>gb|ACU17741.1| unknown [Glycine max]
Length=436

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 121/157 (77%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            +ALYG S+PVLQL PSNFKSKVLNSNGVVLVEFFAPWCGHC+ALTP +EK A+VLKGV T
Sbjct  27   HALYGASSPVLQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCQALTPIWEKAATVLKGVVT  86

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAA+DADAH SLAQEYGI+GFPTIKVF PGK PVDYQGAR+ K + +F   Q++ LLKDR
Sbjct  87   VAAIDADAHPSLAQEYGIRGFPTIKVFAPGKPPVDYQGARDVKPIAEFALQQVKALLKDR  146

Query  522  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            L GKATGGSS K+E S+SVELNS NFD+LV+KSK+LW
Sbjct  147  LSGKATGGSSDKTETSSSVELNSGNFDELVIKSKELW  183


 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 64/106 (60%), Gaps = 1/106 (1%)
 Frame = +3

Query  192  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  371
            ++LN  NF   V+ S  + +VEFFAPWCGHCK L P ++K ++ LKG   +  +D DA  
Sbjct  165  VELNSGNFDELVIKSKELWIVEFFAPWCGHCKKLAPEWKKASNSLKGKVKLGHVDCDAEK  224

Query  372  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  506
            SL   + ++GFPTI VF   K  P+ Y+GAR A ++  F   Q+  
Sbjct  225  SLMSRFKVQGFPTILVFGADKDSPIPYEGARTALAIESFALEQLET  270



>ref|XP_010509948.1| PREDICTED: protein disulfide-isomerase 2-3 isoform X1 [Camelina 
sativa]
 ref|XP_010509949.1| PREDICTED: protein disulfide-isomerase 2-3 isoform X2 [Camelina 
sativa]
Length=440

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 142/161 (88%), Gaps = 4/161 (2%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            +ALYG S+PV+QL  SNFKSKVLNSNGVVLVEFFAPWCGHCKALTPT+EKVA++LKGVAT
Sbjct  23   SALYGSSSPVVQLTASNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTWEKVANILKGVAT  82

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAA+DADAH S AQ+YGIKGFPTIKVFVPGK PVDYQGAR+AKS+ +F   QI+ LL DR
Sbjct  83   VAAIDADAHQSAAQDYGIKGFPTIKVFVPGKPPVDYQGARDAKSIANFAYKQIKGLLSDR  142

Query  522  LDGKA--TGGSS--QKSEPSASVELNSRNFDDLVVKSKDLW  632
            L+GK+  TGG S  +KSEPSASVELNS NFD+LV+KS +LW
Sbjct  143  LEGKSKPTGGGSNEKKSEPSASVELNSSNFDELVIKSNELW  183


 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 65/111 (59%), Gaps = 2/111 (2%)
 Frame = +3

Query  177  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  356
            PS  V +LN SNF   V+ SN + +VEFFAPWCGHCK L P ++K A  LKG   +  ++
Sbjct  161  PSASV-ELNSSNFDELVIKSNELWIVEFFAPWCGHCKKLAPEWKKAAKNLKGKVKLGHVN  219

Query  357  adahsslaQEYGIKGFPTIKVF-VPGKQPVDYQGAREAKSMVDFVKAQIRN  506
             D   S+   + ++GFPTI VF +   +P  Y GAR A ++  F    + +
Sbjct  220  CDVEQSIMSRFKVQGFPTILVFGLDKSRPNSYDGARTASAIESFASELVES  270



>ref|XP_006294195.1| hypothetical protein CARUB_v10023191mg, partial [Capsella rubella]
 gb|EOA27093.1| hypothetical protein CARUB_v10023191mg, partial [Capsella rubella]
Length=452

 Score =   230 bits (587),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 142/161 (88%), Gaps = 4/161 (2%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            +ALYG S+PV+QL  SNFKSKVLNSNGVVLVEFFAPWCGHCKALTPT+EKVA++LKGVAT
Sbjct  35   SALYGSSSPVVQLTASNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTWEKVANILKGVAT  94

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAA+DADAH S AQ+YGIKGFPTIKVFVPGK P+DYQGAR+AKS+ +F   QI+ LL DR
Sbjct  95   VAAIDADAHQSAAQDYGIKGFPTIKVFVPGKPPIDYQGARDAKSIANFAYKQIKGLLSDR  154

Query  522  LDGKA--TGGSS--QKSEPSASVELNSRNFDDLVVKSKDLW  632
            L+GK+  TGG S  +KSEPSASVELNS NFD+LV+KS +LW
Sbjct  155  LEGKSKPTGGGSNEKKSEPSASVELNSSNFDELVIKSNELW  195


 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 64/111 (58%), Gaps = 2/111 (2%)
 Frame = +3

Query  177  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  356
            PS  V +LN SNF   V+ SN + +VEFFAPWCGHCK L P ++K A  LKG   +  ++
Sbjct  173  PSASV-ELNSSNFDELVIKSNELWIVEFFAPWCGHCKKLAPEWKKAAKNLKGKVNLGHVN  231

Query  357  adahsslaQEYGIKGFPTIKVF-VPGKQPVDYQGAREAKSMVDFVKAQIRN  506
             D   S+   + ++GFPTI VF +    P  Y GAR A ++  F    + +
Sbjct  232  CDVEQSIMSRFKVQGFPTILVFGLDKSNPTPYDGARSASAIESFASELVES  282



>ref|NP_180851.1| protein disulfide-isomerase like 2-3 [Arabidopsis thaliana]
 sp|O48773.1|PDI23_ARATH RecName: Full=Protein disulfide-isomerase 2-3; Short=AtPDIL2-3; 
AltName: Full=Protein disulfide-isomerase 5-2; Short=AtPDIL5-2; 
AltName: Full=Protein disulfide-isomerase 9; Short=PDI9; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAB91984.1| putative protein disulfide isomerase [Arabidopsis thaliana]
 gb|AAL06929.1| At2g32920/T21L14.14 [Arabidopsis thaliana]
 gb|AAL61928.1| putative protein disulfide isomerase [Arabidopsis thaliana]
 gb|AAM91128.1| putative protein disulfide isomerase [Arabidopsis thaliana]
 gb|AEC08762.1| protein disulfide-isomerase like 2-3 [Arabidopsis thaliana]
Length=440

 Score =   230 bits (586),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 142/161 (88%), Gaps = 4/161 (2%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            +ALYG S+PV+QL  SNFKSKVLNSNGVVLVEFFAPWCGHCKALTPT+EKVA++LKGVAT
Sbjct  23   SALYGSSSPVVQLTASNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTWEKVANILKGVAT  82

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAA+DADAH S AQ+YGIKGFPTIKVFVPGK P+DYQGAR+AKS+ +F   QI+ LL DR
Sbjct  83   VAAIDADAHQSAAQDYGIKGFPTIKVFVPGKAPIDYQGARDAKSIANFAYKQIKGLLSDR  142

Query  522  LDGKA--TGGSS--QKSEPSASVELNSRNFDDLVVKSKDLW  632
            L+GK+  TGG S  +KSEPSASVELN+ NFDDLV++S +LW
Sbjct  143  LEGKSKPTGGGSKEKKSEPSASVELNASNFDDLVIESNELW  183


 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 66/111 (59%), Gaps = 2/111 (2%)
 Frame = +3

Query  177  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  356
            PS  V +LN SNF   V+ SN + +VEFFAPWCGHCK L P +++ A  L+G   +  ++
Sbjct  161  PSASV-ELNASNFDDLVIESNELWIVEFFAPWCGHCKKLAPEWKRAAKNLQGKVKLGHVN  219

Query  357  adahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRN  506
             D   S+   + ++GFPTI VF P K  P  Y+GAR A ++  F    + +
Sbjct  220  CDVEQSIMSRFKVQGFPTILVFGPDKSSPYPYEGARSASAIESFASELVES  270



>ref|XP_008342147.1| PREDICTED: protein disulfide isomerase-like 2-3 [Malus domestica]
Length=434

 Score =   229 bits (585),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            +ALYGPS+PVLQL PSNFKSKVL+SN VVLVEFFAPWCGHC+ALTP +EK A+VLKGV  
Sbjct  23   DALYGPSSPVLQLTPSNFKSKVLDSNRVVLVEFFAPWCGHCQALTPIWEKAATVLKGVVA  82

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAALDADAH SLAQEYGI+GFPTIKVFVPGK PVDYQGAR+ K + +F   QI+ LLKDR
Sbjct  83   VAALDADAHKSLAQEYGIRGFPTIKVFVPGKPPVDYQGARDVKPIAEFALQQIKALLKDR  142

Query  522  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            L GK TGGSS+KSEPSASVELNS+NF++LV+KSKDLW
Sbjct  143  LSGKTTGGSSEKSEPSASVELNSQNFNELVLKSKDLW  179


 Score = 82.4 bits (202),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 66/111 (59%), Gaps = 2/111 (2%)
 Frame = +3

Query  177  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  356
            PS  V +LN  NF   VL S  + +VEFFAPWCGHCK L P ++K A  L+G   +  +D
Sbjct  157  PSASV-ELNSQNFNELVLKSKDLWIVEFFAPWCGHCKKLAPEWKKAAKNLQGKVKLGHVD  215

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  506
             DA  SL  ++ ++GFPTI VF   K  P+ Y+GAR A ++  F   Q+  
Sbjct  216  CDAEKSLMSKFNVQGFPTILVFGADKDSPLPYEGARSASAIESFALEQLET  266



>ref|XP_010469533.1| PREDICTED: protein disulfide-isomerase 2-3-like [Camelina sativa]
Length=440

 Score =   229 bits (583),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 142/161 (88%), Gaps = 4/161 (2%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            +ALYG S+PV+QL  SNFKSKVLNSNGVVLVEFFAPWCGHCK+LTPT+EKVA++LKGVAT
Sbjct  23   SALYGSSSPVVQLTASNFKSKVLNSNGVVLVEFFAPWCGHCKSLTPTWEKVANILKGVAT  82

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAA+DADAH S AQ+YGIKGFPTIKVFVPGK P+DYQGAR+AKS+ +F   QI+ LL DR
Sbjct  83   VAAIDADAHQSAAQDYGIKGFPTIKVFVPGKPPIDYQGARDAKSIANFAYKQIKGLLSDR  142

Query  522  LDGKA--TGGSS--QKSEPSASVELNSRNFDDLVVKSKDLW  632
            L+GK+  TGG S  +KSEPSASVELNS NFD+LV+KS +LW
Sbjct  143  LEGKSKPTGGGSNEKKSEPSASVELNSSNFDELVIKSNELW  183


 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 64/111 (58%), Gaps = 2/111 (2%)
 Frame = +3

Query  177  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  356
            PS  V +LN SNF   V+ SN + +VEFFAPWCGHCK L P ++K A  LKG   +  ++
Sbjct  161  PSASV-ELNSSNFDELVIKSNELWIVEFFAPWCGHCKKLAPEWKKAAKNLKGKVNLGHVN  219

Query  357  adahsslaQEYGIKGFPTIKVF-VPGKQPVDYQGAREAKSMVDFVKAQIRN  506
             D   S+   + ++GFPTI VF +    P  Y GAR A ++  F    + +
Sbjct  220  CDVEQSIMSRFKVQGFPTILVFGLDKSSPTSYDGARTASAIESFASELVES  270



>ref|XP_002460311.1| hypothetical protein SORBIDRAFT_02g026300 [Sorghum bicolor]
 gb|EER96832.1| hypothetical protein SORBIDRAFT_02g026300 [Sorghum bicolor]
Length=439

 Score =   228 bits (582),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 139/163 (85%), Gaps = 8/163 (5%)
 Frame = +3

Query  168  LYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVa  347
            LY   +PVLQLNP+NFKSKVLNSNGVVLVEFFAPWCGHCK L P +EK A VLKGVATVA
Sbjct  22   LYSAGSPVLQLNPNNFKSKVLNSNGVVLVEFFAPWCGHCKQLAPAWEKAAGVLKGVATVA  81

Query  348  aldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRLD  527
            ALDADAH +LAQEYGI+GFPTIKVF PGK PVDYQGAR+ K +V+F  +Q+++LL++RL 
Sbjct  82   ALDADAHQALAQEYGIRGFPTIKVFSPGKPPVDYQGARDVKPIVEFALSQVKSLLRERLS  141

Query  528  GKA--------TGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            GKA        +GGSS+KSEPSASVELNSRNFD+LVVKSKDLW
Sbjct  142  GKASAGSNGKTSGGSSEKSEPSASVELNSRNFDELVVKSKDLW  184


 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 66/110 (60%), Gaps = 2/110 (2%)
 Frame = +3

Query  177  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  356
            PS  V +LN  NF   V+ S  + +VEFFAPWCGHCK L P ++K A  LKG   +  +D
Sbjct  162  PSASV-ELNSRNFDELVVKSKDLWIVEFFAPWCGHCKKLAPEWKKAAKNLKGQVKLGHVD  220

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIR  503
             DA  SL  +Y ++GFPTI VF   K+ P  YQGAR + ++  F   Q+ 
Sbjct  221  CDAEKSLMSKYKVEGFPTILVFGADKESPFLYQGARVSSAIESFALEQLE  270



>emb|CDY53400.1| BnaAnng12480D [Brassica napus]
Length=338

 Score =   224 bits (571),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 138/163 (85%), Gaps = 6/163 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            NALYG S+PVLQL PSNFKSKV+NSNGVVLVEFFAPWCGHCK+LTPT+EKVA+ LKG+AT
Sbjct  27   NALYGSSSPVLQLTPSNFKSKVINSNGVVLVEFFAPWCGHCKSLTPTWEKVATTLKGIAT  86

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAA+DADAH S++Q+YG++GFPTIKVFVPGK P+DYQGAR+AK++  F   QI+ LLKDR
Sbjct  87   VAAIDADAHKSVSQDYGVRGFPTIKVFVPGKPPIDYQGARDAKAISQFAIKQIKALLKDR  146

Query  522  LD------GKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            LD          G S +KSEPSASVELNS NFD+LV +SKDLW
Sbjct  147  LDGKTTGTNTGGGSSEKKSEPSASVELNSSNFDELVTESKDLW  189


 Score = 84.3 bits (207),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 65/110 (59%), Gaps = 2/110 (2%)
 Frame = +3

Query  177  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  356
            PS  V +LN SNF   V  S  + +VEFFAPWCGHCK L P ++K A  LKG   +  +D
Sbjct  167  PSASV-ELNSSNFDELVTESKDLWIVEFFAPWCGHCKKLAPEWKKAAKNLKGKVKLGHVD  225

Query  357  adahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIR  503
             DA  ++   + +KGFPTI VF   K  P+ Y+GAR A ++  F   Q+ 
Sbjct  226  CDADKAIQSRFKVKGFPTILVFGADKSSPLPYEGARSASAIESFALEQLE  275



>ref|NP_001105804.1| protein disulfide isomerase8 precursor [Zea mays]
 gb|AAX09966.1| protein disulfide isomerase [Zea mays]
 gb|ACF78413.1| unknown [Zea mays]
 tpg|DAA61729.1| TPA: putative protein disulfide isomerase family protein [Zea 
mays]
Length=439

 Score =   227 bits (579),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 137/158 (87%), Gaps = 8/158 (5%)
 Frame = +3

Query  183  TPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldad  362
            +PVLQLNP+NFKSKVLNSNGVVLVEFFAPWCGHCK L P +EK A VLKGVATVAALDAD
Sbjct  27   SPVLQLNPNNFKSKVLNSNGVVLVEFFAPWCGHCKQLAPAWEKAAGVLKGVATVAALDAD  86

Query  363  ahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRLDGKA--  536
            AH +LAQEYGIKGFPTIKVF PGK PVDYQGAR+ K +V+F  +Q+++LL+DRL GKA  
Sbjct  87   AHQALAQEYGIKGFPTIKVFSPGKPPVDYQGARDVKPIVEFALSQVKSLLRDRLSGKASA  146

Query  537  ------TGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
                  +GGSS+KSEPSASVELNSRNFD+LVVKSKDLW
Sbjct  147  GSNGKTSGGSSEKSEPSASVELNSRNFDELVVKSKDLW  184


 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 66/110 (60%), Gaps = 2/110 (2%)
 Frame = +3

Query  177  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  356
            PS  V +LN  NF   V+ S  + +VEFFAPWCGHCK L P ++K A  LKG   +  +D
Sbjct  162  PSASV-ELNSRNFDELVVKSKDLWIVEFFAPWCGHCKKLAPEWKKAAKNLKGQVKLGHVD  220

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIR  503
             DA  SL  +Y ++GFPTI VF   K+ P  YQGAR A ++  F   Q+ 
Sbjct  221  CDAEKSLMSKYKVEGFPTILVFGADKESPFPYQGARVASAIESFALEQLE  270



>ref|XP_010413931.1| PREDICTED: protein disulfide-isomerase 2-3-like [Camelina sativa]
Length=440

 Score =   226 bits (577),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 141/161 (88%), Gaps = 4/161 (2%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            +ALYG S+PV+QL  SNFKSKVLNSNGVVLVEFFAPWCGHCKALTPT+EKVA++LKGVAT
Sbjct  23   SALYGSSSPVVQLTASNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTWEKVANILKGVAT  82

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAA+DADAH S AQ+YGI+ FPTIKVFVPGK P+DYQGAR+AKS+ +F   QI+ LL DR
Sbjct  83   VAAIDADAHQSAAQDYGIQSFPTIKVFVPGKPPIDYQGARDAKSIANFAYKQIKGLLSDR  142

Query  522  LDGKA--TGGSS--QKSEPSASVELNSRNFDDLVVKSKDLW  632
            L+GK+  TGG S  +KSEPSASVELNS NFD+LV+KS +LW
Sbjct  143  LEGKSKPTGGGSNEKKSEPSASVELNSSNFDELVIKSNELW  183


 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 64/111 (58%), Gaps = 2/111 (2%)
 Frame = +3

Query  177  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  356
            PS  V +LN SNF   V+ SN + +VEFFAPWCGHCK L P ++K A  LKG   +  ++
Sbjct  161  PSASV-ELNSSNFDELVIKSNELWIVEFFAPWCGHCKKLAPEWKKAAKNLKGKVNLGHVN  219

Query  357  adahsslaQEYGIKGFPTIKVF-VPGKQPVDYQGAREAKSMVDFVKAQIRN  506
             D   S+   + ++GFPTI VF +    P  Y GAR A ++  F    + +
Sbjct  220  CDVEQSIMSRFKVQGFPTILVFGLDKSSPTSYDGARTASAIESFASELVES  270



>ref|XP_007141667.1| hypothetical protein PHAVU_008G215100g [Phaseolus vulgaris]
 gb|ESW13661.1| hypothetical protein PHAVU_008G215100g [Phaseolus vulgaris]
Length=436

 Score =   226 bits (576),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 138/156 (88%), Gaps = 0/156 (0%)
 Frame = +3

Query  165  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  344
            ALYG S+PVLQL  SNFKSKVLN+NGVVLVEFFAPWCGHCKALTP +EK A+VLKGV TV
Sbjct  26   ALYGASSPVLQLTASNFKSKVLNANGVVLVEFFAPWCGHCKALTPIWEKAATVLKGVVTV  85

Query  345  aaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRL  524
            AALDADAHSSLAQEYGIKGFPTIKVF PGK P DYQGAR+ K + +F   Q++ LLK+RL
Sbjct  86   AALDADAHSSLAQEYGIKGFPTIKVFAPGKPPADYQGARDVKPIAEFALQQVKALLKERL  145

Query  525  DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            +GKATGGS++K+E S+SVELNS NFD+LV+KSK+LW
Sbjct  146  NGKATGGSNEKTETSSSVELNSGNFDELVLKSKELW  181


 Score = 82.4 bits (202),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 64/106 (60%), Gaps = 1/106 (1%)
 Frame = +3

Query  192  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  371
            ++LN  NF   VL S  + +VEFFAPWCGHCK L P ++K ++ LKG   +  +D DA  
Sbjct  163  VELNSGNFDELVLKSKELWIVEFFAPWCGHCKKLAPEWKKASNNLKGKVKLGHVDCDAEK  222

Query  372  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  506
            SL   + ++GFPTI VF   K  P+ Y+GAR A ++  F   Q+  
Sbjct  223  SLMSRFKVQGFPTILVFGADKDSPIPYEGARTAAAIESFALEQLET  268



>emb|CDX79497.1| BnaC03g18330D [Brassica napus]
Length=443

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 139/161 (86%), Gaps = 4/161 (2%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            NALYG S+PV+QL  SNFKSKVLNSNGVVLVEFFAPWCGHCKALTPT+EKVA VLKGVAT
Sbjct  24   NALYGSSSPVVQLTASNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTWEKVAGVLKGVAT  83

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAA+DADAH S AQ+YGIKGFPTI VFVPGK PVDYQGAR+AKS+ +F   Q++ L+ +R
Sbjct  84   VAAIDADAHQSAAQDYGIKGFPTITVFVPGKPPVDYQGARDAKSIANFAYKQVKALVSNR  143

Query  522  LDGKAT---GGSSQ-KSEPSASVELNSRNFDDLVVKSKDLW  632
            L+GK+    GGSS+ KSEPSASVEL S NFD+LV+KS DLW
Sbjct  144  LEGKSKPNGGGSSERKSEPSASVELTSSNFDELVIKSNDLW  184


 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 62/104 (60%), Gaps = 2/104 (2%)
 Frame = +3

Query  177  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  356
            PS  V +L  SNF   V+ SN + +VEFFAPWCGHCK L P ++K A  LKG   +  ++
Sbjct  162  PSASV-ELTSSNFDELVIKSNDLWIVEFFAPWCGHCKKLAPEWKKAAKNLKGKVKLGHVN  220

Query  357  adahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDF  485
             D   S+   + ++GFPTI VF   K  P  Y+GAR A ++  F
Sbjct  221  CDVEQSIMSRFKVQGFPTIMVFGADKSSPYAYEGARSASAIESF  264



>ref|XP_002881252.1| hypothetical protein ARALYDRAFT_482234 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57511.1| hypothetical protein ARALYDRAFT_482234 [Arabidopsis lyrata subsp. 
lyrata]
Length=440

 Score =   225 bits (574),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 141/161 (88%), Gaps = 4/161 (2%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            +ALYG S+PV+QL  SNFKSKVLNSNGVVLVEFFAPWCGHCKALTPT+EKVA++LKGVAT
Sbjct  23   SALYGSSSPVVQLTASNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTWEKVANILKGVAT  82

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAA+DADAH S AQ+YGIKGFPTIKVFVPGK P+DYQG R+AKS+ +F   QI+ LL DR
Sbjct  83   VAAIDADAHQSAAQDYGIKGFPTIKVFVPGKAPIDYQGERDAKSIANFAYKQIKGLLSDR  142

Query  522  LDGKA--TGGSS--QKSEPSASVELNSRNFDDLVVKSKDLW  632
            L+GK+  TGG S  +KSEPSASVELN+ NFD+LV++S +LW
Sbjct  143  LEGKSKPTGGGSKEKKSEPSASVELNAGNFDELVIESNELW  183


 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 65/111 (59%), Gaps = 2/111 (2%)
 Frame = +3

Query  177  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  356
            PS  V +LN  NF   V+ SN + +VEFFAPWCGHCK L P ++K A  L+G   +  ++
Sbjct  161  PSASV-ELNAGNFDELVIESNELWIVEFFAPWCGHCKKLAPEWKKAAKNLQGKVKLGHVN  219

Query  357  adahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRN  506
             D   S+   + ++GFPTI VF P K  P  Y+GAR A ++  F    + +
Sbjct  220  CDVEQSIMSRFKVQGFPTILVFGPDKSSPYPYEGARSASAIESFASELVES  270



>ref|XP_012080662.1| PREDICTED: protein disulfide isomerase-like 2-3 [Jatropha curcas]
 gb|KDP30825.1| hypothetical protein JCGZ_13768 [Jatropha curcas]
Length=434

 Score =   225 bits (573),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 145/157 (92%), Gaps = 0/157 (0%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            NALYGPS+PV+QLNPSNFKSKVLNSNGVVLVEFFAPWCGHC+ALTP +EK A++LKGVAT
Sbjct  23   NALYGPSSPVVQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCQALTPIWEKAANILKGVAT  82

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAALDADAH SLAQEYGI+GFPTIKVF PGK PVDYQGAREAK + +F   QI+ LLKDR
Sbjct  83   VAALDADAHQSLAQEYGIRGFPTIKVFAPGKPPVDYQGAREAKPIAEFALQQIKALLKDR  142

Query  522  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            L GK++GGSS+KSEP+AS+ELNSRNFD+LV+KSK+LW
Sbjct  143  LSGKSSGGSSEKSEPNASIELNSRNFDELVIKSKELW  179


 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 64/106 (60%), Gaps = 1/106 (1%)
 Frame = +3

Query  192  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  371
            ++LN  NF   V+ S  + +VEFFAPWCGHCK L P ++K AS LKG   +  +D DA  
Sbjct  161  IELNSRNFDELVIKSKELWVVEFFAPWCGHCKKLAPEWKKAASNLKGKVKLGHVDCDAEK  220

Query  372  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  506
            SL   + ++GFPTI VF   K  P+ Y+GAR A ++  F   Q+  
Sbjct  221  SLMSRFNVQGFPTILVFGADKDSPIPYEGARTASAIESFALDQLET  266



>ref|XP_003616851.1| Protein disulfide isomerase family [Medicago truncatula]
 gb|AES99809.1| protein disulfide isomerase-like protein [Medicago truncatula]
Length=435

 Score =   224 bits (572),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 139/159 (87%), Gaps = 2/159 (1%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            +ALYG S+PVLQL P+NFKSKVLNSNGVVLVEFFAPWCGHCKALTP +EK A+VLKGV T
Sbjct  21   HALYGSSSPVLQLTPNNFKSKVLNSNGVVLVEFFAPWCGHCKALTPIWEKAATVLKGVVT  80

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAALDADAH SLAQEYGI+GFPTIKVF PGK PVDYQGAR+ K + +F   Q++ LLK+R
Sbjct  81   VAALDADAHQSLAQEYGIRGFPTIKVFSPGKPPVDYQGARDVKPIAEFALQQVKALLKER  140

Query  522  LDGKATGGSSQKSEPSA--SVELNSRNFDDLVVKSKDLW  632
            L+GKATGGS++K E +A  SVELNS NFD+LV+KSK+LW
Sbjct  141  LNGKATGGSNEKKESTASSSVELNSSNFDELVIKSKELW  179


 Score = 82.4 bits (202),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 65/106 (61%), Gaps = 1/106 (1%)
 Frame = +3

Query  192  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  371
            ++LN SNF   V+ S  + +VEFFAPWCGHCK L P +++ ++ LKG   +  +D DA  
Sbjct  161  VELNSSNFDELVIKSKELWIVEFFAPWCGHCKKLAPEWKRASNNLKGKVKLGHVDCDADK  220

Query  372  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  506
            SL   + ++GFPTI VF   K  P+ Y+GAR A ++  F   Q+  
Sbjct  221  SLMSRFNVQGFPTILVFGADKDTPIPYEGARTAAAIESFALEQLET  266



>ref|XP_009119218.1| PREDICTED: protein disulfide-isomerase like 2-2 [Brassica rapa]
Length=438

 Score =   224 bits (571),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 122/185 (66%), Positives = 146/185 (79%), Gaps = 6/185 (3%)
 Frame = +3

Query  96   RMERSARFlplplllvtlittvNALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWC  275
            +M ++  F  L L+        NALYG S+PVLQL PSNFKSKV+NSNGVVLVEFFAPWC
Sbjct  6    KMNKTRVFTILSLVFAFSFDLSNALYGSSSPVLQLTPSNFKSKVINSNGVVLVEFFAPWC  65

Query  276  GHCKALTPTYEKVASVLKGVATVaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQG  455
            GHCK+LTPT+EKVA+ LKG+ATVAA+DADAH S++Q+YG++GFPTIKVFVPGK P+DYQG
Sbjct  66   GHCKSLTPTWEKVATTLKGIATVAAIDADAHKSVSQDYGVRGFPTIKVFVPGKPPIDYQG  125

Query  456  AREAKSMVDFVKAQIRNLLKDRLD------GKATGGSSQKSEPSASVELNSRNFDDLVVK  617
            AR+AK++  F   QI+ LLKDRLD          G S +KSEPSASVELNS NFD+LV +
Sbjct  126  ARDAKAISQFAIKQIKALLKDRLDGKTTGTTTGGGSSEKKSEPSASVELNSSNFDELVTE  185

Query  618  SKDLW  632
            SKDLW
Sbjct  186  SKDLW  190


 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 65/110 (59%), Gaps = 2/110 (2%)
 Frame = +3

Query  177  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  356
            PS  V +LN SNF   V  S  + +VEFFAPWCGHCK L P ++K A  LKG   +  +D
Sbjct  168  PSASV-ELNSSNFDELVTESKDLWIVEFFAPWCGHCKKLAPEWKKAAKNLKGKVKLGHVD  226

Query  357  adahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIR  503
             DA  ++   + +KGFPTI VF   K  P+ Y+GAR A ++  F   Q+ 
Sbjct  227  CDADKAIQSRFKVKGFPTILVFGADKSSPLPYEGARSASAIESFALEQLE  276



>emb|CDY18278.1| BnaC05g03010D [Brassica napus]
Length=436

 Score =   224 bits (571),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 122/185 (66%), Positives = 146/185 (79%), Gaps = 6/185 (3%)
 Frame = +3

Query  96   RMERSARFlplplllvtlittvNALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWC  275
            +M ++  F  L L+        NALYG S+PVLQL PSNFKSKV+NSNGVVLVEFFAPWC
Sbjct  4    KMNKTRVFTILSLVFAFSFDLSNALYGSSSPVLQLTPSNFKSKVINSNGVVLVEFFAPWC  63

Query  276  GHCKALTPTYEKVASVLKGVATVaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQG  455
            GHCK+LTPT+EKVA+ LKG+ATVAA+DADAH S++Q+YG++GFPTIKVFVPGK P+DYQG
Sbjct  64   GHCKSLTPTWEKVATTLKGIATVAAIDADAHKSVSQDYGVRGFPTIKVFVPGKPPIDYQG  123

Query  456  AREAKSMVDFVKAQIRNLLKDRLD------GKATGGSSQKSEPSASVELNSRNFDDLVVK  617
            AR+AK++  F   QI+ LLKDRLD          G S +KSEPSASVELNS NFD+LV +
Sbjct  124  ARDAKAISQFAIKQIKALLKDRLDGKTTGTNTGGGSSEKKSEPSASVELNSSNFDELVTE  183

Query  618  SKDLW  632
            SKDLW
Sbjct  184  SKDLW  188


 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 65/110 (59%), Gaps = 2/110 (2%)
 Frame = +3

Query  177  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  356
            PS  V +LN SNF   V  S  + +VEFFAPWCGHCK L P ++K A  LKG   +  +D
Sbjct  166  PSASV-ELNSSNFDELVTESKDLWIVEFFAPWCGHCKKLAPEWKKAAKNLKGKVKLGHVD  224

Query  357  adahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIR  503
             DA  ++   + +KGFPTI VF   K  P+ Y+GAR A ++  F   Q+ 
Sbjct  225  CDADKAIQSRFKVKGFPTILVFGADKSSPLPYEGARSASAIESFALEQLE  274



>ref|XP_009606235.1| PREDICTED: protein disulfide isomerase-like 2-3 [Nicotiana tomentosiformis]
Length=432

 Score =   222 bits (566),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 126/157 (80%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            NALYGPS+PVLQLNP+NFKSKVLNSNG+VLVEFFAPWCGHC++LTP +EK A++LKGVAT
Sbjct  21   NALYGPSSPVLQLNPNNFKSKVLNSNGIVLVEFFAPWCGHCQSLTPHWEKAATILKGVAT  80

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAALDADAH SLAQEYGI+GFPTIKVF PGK PVDYQGAREAK + +F   QI+ LLK+R
Sbjct  81   VAALDADAHKSLAQEYGIRGFPTIKVFAPGKPPVDYQGAREAKPIAEFALQQIKTLLKER  140

Query  522  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            + GKATGGSS+ SEPSASVELNSRNFD+ V+KSKDLW
Sbjct  141  VHGKATGGSSESSEPSASVELNSRNFDEKVLKSKDLW  177


 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 62/103 (60%), Gaps = 1/103 (1%)
 Frame = +3

Query  198  LNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahssl  377
            LN  NF  KVL S  + +VEFFAPWCGHCK L P ++K A  L+G   +  +D DA  SL
Sbjct  161  LNSRNFDEKVLKSKDLWIVEFFAPWCGHCKKLAPEWKKAAKNLEGKVKLGHVDCDAEKSL  220

Query  378  aQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIR  503
               + ++GFPTI VF   K  PV Y+GAR A ++  F   Q+ 
Sbjct  221  MSRFNVQGFPTILVFGADKDSPVPYEGARTASAIESFGLEQLE  263



>ref|XP_010270060.1| PREDICTED: protein disulfide isomerase-like 2-3 isoform X1 [Nelumbo 
nucifera]
Length=434

 Score =   221 bits (564),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            +ALYGPS+PV+QLNPSNFK+KVLNSNGVVLVEFFAPWCGHC+ALTPT+EK A+VLKGVAT
Sbjct  23   DALYGPSSPVVQLNPSNFKNKVLNSNGVVLVEFFAPWCGHCQALTPTWEKAATVLKGVAT  82

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAALDADAH SLAQEY I+GFPTIKVF PGK P+DY+GAR+AK + +F   QI+ LLK+R
Sbjct  83   VAALDADAHKSLAQEYKIQGFPTIKVFAPGKPPIDYRGARDAKGIAEFALQQIKALLKER  142

Query  522  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            + GKA+GGSS+ S+ SAS+ELNS+NFDD+V+KSKDLW
Sbjct  143  VHGKASGGSSETSKSSASIELNSKNFDDMVLKSKDLW  179


 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 62/106 (58%), Gaps = 1/106 (1%)
 Frame = +3

Query  192  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  371
            ++LN  NF   VL S  + +VEFFAPWCGHCK L P ++K A+ LKG   +  +D DA  
Sbjct  161  IELNSKNFDDMVLKSKDLWMVEFFAPWCGHCKKLAPEWKKAANNLKGKVKLGHVDCDAEK  220

Query  372  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  506
             L   + ++GFPTI VF   K  P  Y+GAR A S+  F   Q+  
Sbjct  221  FLMSRFKVEGFPTILVFGADKDSPTKYEGARFASSIESFALEQLET  266



>ref|XP_002276520.1| PREDICTED: protein disulfide isomerase-like 2-3 [Vitis vinifera]
 emb|CBI28881.3| unnamed protein product [Vitis vinifera]
Length=433

 Score =   221 bits (563),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +3

Query  168  LYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVa  347
            LYGPS+PV+QLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPT+EK ASVLKGVATVA
Sbjct  28   LYGPSSPVVQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTWEKAASVLKGVATVA  87

Query  348  aldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRLD  527
            ALDADA+ +LAQEYGI+GFPTIKVF PGK PVDYQGAR+ K + +F   QI+ LLK+RL 
Sbjct  88   ALDADANQALAQEYGIRGFPTIKVFAPGKPPVDYQGARDVKPIAEFALQQIKALLKERLS  147

Query  528  GKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            GKATGGSS+KSE S+SVEL S NFD+LV+KSKDLW
Sbjct  148  GKATGGSSEKSEISSSVELTSSNFDELVLKSKDLW  182


 Score = 82.4 bits (202),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 62/104 (60%), Gaps = 1/104 (1%)
 Frame = +3

Query  198  LNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahssl  377
            L  SNF   VL S  + +VEFFAPWCGHCK L P ++K A+ LKG   +  +D D+  SL
Sbjct  166  LTSSNFDELVLKSKDLWIVEFFAPWCGHCKKLAPEWKKAANNLKGKVKLGHVDCDSDKSL  225

Query  378  aQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  506
               + ++GFPTI VF   K  PV Y+GAR A ++  F   Q+  
Sbjct  226  MSRFSVQGFPTILVFGADKDTPVPYEGARTASAIESFALEQLET  269



>ref|XP_003519441.1| PREDICTED: protein disulfide isomerase-like 2-3-like [Glycine 
max]
Length=438

 Score =   219 bits (558),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 122/156 (78%), Positives = 138/156 (88%), Gaps = 0/156 (0%)
 Frame = +3

Query  165  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  344
            ALYG STPVLQL PSNFKSKVLNSNGVVLVEFFAPWCGHC+ALTP +EK A+VLKGV TV
Sbjct  28   ALYGASTPVLQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCQALTPIWEKAATVLKGVVTV  87

Query  345  aaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRL  524
            AA+DADAH SLAQEYGI+GFPTIKVF PGK PVDYQGAR+ K + +F   Q++ LLKDRL
Sbjct  88   AAIDADAHPSLAQEYGIRGFPTIKVFAPGKPPVDYQGARDVKPIAEFALQQVKALLKDRL  147

Query  525  DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
             GKATGGSS+K+E S+SVELNS NFD+LV+KSK+LW
Sbjct  148  SGKATGGSSEKTETSSSVELNSGNFDELVIKSKELW  183


 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 64/106 (60%), Gaps = 1/106 (1%)
 Frame = +3

Query  192  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  371
            ++LN  NF   V+ S  + +VEFFAPWCGHCK L P ++K ++ LKG   +  +D DA  
Sbjct  165  VELNSGNFDELVIKSKELWIVEFFAPWCGHCKKLAPEWKKASNNLKGKVKLGHVDCDAEK  224

Query  372  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  506
            SL   + ++GFPTI VF   K  P+ Y+GAR A ++  F   Q+  
Sbjct  225  SLMSRFKVQGFPTILVFGADKDSPIPYEGARTASAIESFALEQLET  270



>ref|XP_008668262.1| PREDICTED: uncharacterized protein LOC100381521 isoform X1 [Zea 
mays]
Length=439

 Score =   218 bits (556),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 135/162 (83%), Gaps = 8/162 (5%)
 Frame = +3

Query  171  YGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaa  350
            Y   +PVLQLN +NFKSKVLNSN VVLVEFFAPWCGHCK L PT+EK A VLKGVATVAA
Sbjct  23   YSSGSPVLQLNSNNFKSKVLNSNRVVLVEFFAPWCGHCKQLAPTWEKAAGVLKGVATVAA  82

Query  351  ldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRLDG  530
            LDADA  +LAQEYGIKGFPTIKVF PGK PVDYQGAR+ K +V+F  +Q++ LL+DRL G
Sbjct  83   LDADAQQALAQEYGIKGFPTIKVFSPGKSPVDYQGARDVKPIVEFALSQVKALLRDRLSG  142

Query  531  KA--------TGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            KA        +GGSS+K+EPSASVELNSRNFD+LVVKSKD+W
Sbjct  143  KASAGSNGKTSGGSSEKNEPSASVELNSRNFDELVVKSKDIW  184


 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 66/110 (60%), Gaps = 2/110 (2%)
 Frame = +3

Query  177  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  356
            PS  V +LN  NF   V+ S  + +VEFFAPWCGHCK L P ++K A  LKG   +  +D
Sbjct  162  PSASV-ELNSRNFDELVVKSKDIWIVEFFAPWCGHCKKLAPEWKKAAKNLKGQVKLGHVD  220

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIR  503
             DA  SL  +Y ++GFPTI VF   K+ P  YQGAR A ++  F   Q+ 
Sbjct  221  CDAEKSLMSKYKVEGFPTILVFGADKESPFPYQGARVASAIESFALEQLE  270



>ref|XP_007049203.1| PDI-like 2-2 [Theobroma cacao]
 gb|EOX93360.1| PDI-like 2-2 [Theobroma cacao]
Length=434

 Score =   218 bits (555),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 125/156 (80%), Positives = 142/156 (91%), Gaps = 0/156 (0%)
 Frame = +3

Query  165  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  344
            ALYGPS+PV+QL PSNFKSKVLNSNGVVLVEFFAPWCGHC+ALTPT+EK A+VLKGVATV
Sbjct  24   ALYGPSSPVVQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCQALTPTWEKAANVLKGVATV  83

Query  345  aaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRL  524
            AALDADAH SLAQEYGI+GFPTIK F PGK PVDYQGAR+ K + +F   Q++ LLKDRL
Sbjct  84   AALDADAHKSLAQEYGIRGFPTIKFFAPGKPPVDYQGARDVKPIAEFALQQVKALLKDRL  143

Query  525  DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
             GKA+GGSS+KSEPS+SVELNSRNFD+LV+KSK+LW
Sbjct  144  AGKASGGSSEKSEPSSSVELNSRNFDELVLKSKELW  179


 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 62/104 (60%), Gaps = 1/104 (1%)
 Frame = +3

Query  198  LNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahssl  377
            LN  NF   VL S  + +VEFFAPWCGHCK L P ++K A+ LKG   +  +D D+  SL
Sbjct  163  LNSRNFDELVLKSKELWIVEFFAPWCGHCKKLAPEWKKAANNLKGKVKLGHVDCDSEKSL  222

Query  378  aQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  506
               + ++GFPTI VF   K  P+ Y+GAR A ++  F   Q+  
Sbjct  223  MSRFNVQGFPTILVFGADKDSPIPYEGARTASAIESFALEQLET  266



>dbj|BAD38009.1| putative protein disulfide-isomerase A6 precursor [Oryza sativa 
Japonica Group]
 dbj|BAD38215.1| putative protein disulfide-isomerase A6 precursor [Oryza sativa 
Japonica Group]
Length=395

 Score =   215 bits (548),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 138/165 (84%), Gaps = 8/165 (5%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            +ALY   +PVLQ NP+NFKSKVLNSNGVVLVEFFAPWCGHC+ LTP +EK A VLKGVAT
Sbjct  22   SALYSAGSPVLQFNPNNFKSKVLNSNGVVLVEFFAPWCGHCQQLTPIWEKAAGVLKGVAT  81

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAALDADAH  LAQEYGI+GFPTIKVFVPGK PVDYQGAR+ K +V+F  +Q++ LL+DR
Sbjct  82   VAALDADAHKELAQEYGIRGFPTIKVFVPGKPPVDYQGARDVKPIVEFALSQVKALLRDR  141

Query  522  LDGKA--------TGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            L+GK         +GGSS+K+EPSAS+ELNS+NFD LV KSKDLW
Sbjct  142  LNGKTSAGSGGKKSGGSSEKTEPSASIELNSQNFDKLVTKSKDLW  186


 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 63/105 (60%), Gaps = 1/105 (1%)
 Frame = +3

Query  192  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  371
            ++LN  NF   V  S  + +VEFFAPWCGHCK L P ++K A  LKG   +  +D DA  
Sbjct  168  IELNSQNFDKLVTKSKDLWIVEFFAPWCGHCKKLAPEWKKAAKNLKGQVKLGHVDCDAEK  227

Query  372  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIR  503
            SL  +Y ++GFPTI VF   K+ P  YQGAR A ++  F   Q+ 
Sbjct  228  SLMSKYKVEGFPTILVFGADKESPFPYQGARVASAIESFALEQLE  272



>gb|KHG30032.1| Protein disulfide-isomerase like 2-2 [Gossypium arboreum]
Length=422

 Score =   215 bits (547),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            NALYGPS+PV+QL PSNFKSKVLNSNGVVLVEFFAPWCGHC+ LTPT+EK ++VLKGVAT
Sbjct  23   NALYGPSSPVVQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCQTLTPTWEKASNVLKGVAT  82

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAALDADAH SL+QEYGI+GFPTIKVFVPGK PVDY GAR+ K + +F   Q++ LLKDR
Sbjct  83   VAALDADAHKSLSQEYGIRGFPTIKVFVPGKPPVDYMGARDVKPIAEFALQQVKALLKDR  142

Query  522  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            L GKA+GGSS+KSE SASVELNS NFD+LV+KSK+LW
Sbjct  143  LAGKASGGSSEKSESSASVELNSHNFDELVLKSKELW  179


 Score = 82.4 bits (202),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 64/106 (60%), Gaps = 1/106 (1%)
 Frame = +3

Query  192  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  371
            ++LN  NF   VL S  + ++EFFAPWCGHCK L P +++ A+ LKG   +  +D D+  
Sbjct  161  VELNSHNFDELVLKSKELWILEFFAPWCGHCKRLAPEWKRAANNLKGKVKLGHVDCDSEK  220

Query  372  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  506
            SL   + ++GFPTI VF   K  PV Y+GAR A ++  F   Q+  
Sbjct  221  SLMSRFNVQGFPTILVFGADKDSPVPYEGARTASAIESFALEQLET  266



>ref|NP_001063331.1| Os09g0451500 [Oryza sativa Japonica Group]
 sp|Q67UF5.1|PDI23_ORYSJ RecName: Full=Protein disulfide isomerase-like 2-3; Short=OsPDIL2-3; 
AltName: Full=Protein disulfide isomerase-like 5-1; 
Short=OsPDIL5-1; Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAD38008.1| putative protein disulfide isomerase-related protein [Oryza sativa 
Japonica Group]
 dbj|BAD38214.1| putative protein disulfide isomerase-related protein [Oryza sativa 
Japonica Group]
 dbj|BAF25245.1| Os09g0451500 [Oryza sativa Japonica Group]
Length=441

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 138/165 (84%), Gaps = 8/165 (5%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            +ALY   +PVLQ NP+NFKSKVLNSNGVVLVEFFAPWCGHC+ LTP +EK A VLKGVAT
Sbjct  22   SALYSAGSPVLQFNPNNFKSKVLNSNGVVLVEFFAPWCGHCQQLTPIWEKAAGVLKGVAT  81

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAALDADAH  LAQEYGI+GFPTIKVFVPGK PVDYQGAR+ K +V+F  +Q++ LL+DR
Sbjct  82   VAALDADAHKELAQEYGIRGFPTIKVFVPGKPPVDYQGARDVKPIVEFALSQVKALLRDR  141

Query  522  LDGKA--------TGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            L+GK         +GGSS+K+EPSAS+ELNS+NFD LV KSKDLW
Sbjct  142  LNGKTSAGSGGKKSGGSSEKTEPSASIELNSQNFDKLVTKSKDLW  186


 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 63/105 (60%), Gaps = 1/105 (1%)
 Frame = +3

Query  192  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  371
            ++LN  NF   V  S  + +VEFFAPWCGHCK L P ++K A  LKG   +  +D DA  
Sbjct  168  IELNSQNFDKLVTKSKDLWIVEFFAPWCGHCKKLAPEWKKAAKNLKGQVKLGHVDCDAEK  227

Query  372  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIR  503
            SL  +Y ++GFPTI VF   K+ P  YQGAR A ++  F   Q+ 
Sbjct  228  SLMSKYKVEGFPTILVFGADKESPFPYQGARVASAIESFALEQLE  272



>gb|EEC84682.1| hypothetical protein OsI_31602 [Oryza sativa Indica Group]
Length=455

 Score =   215 bits (548),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 138/165 (84%), Gaps = 8/165 (5%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            +ALY   +PVLQ NP+NFKSKVLNSNGVVLVEFFAPWCGHC+ LTP +EK A VLKGVAT
Sbjct  22   SALYSAGSPVLQFNPNNFKSKVLNSNGVVLVEFFAPWCGHCQQLTPIWEKAAGVLKGVAT  81

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAALDADAH  LAQEYGI+GFPTIKVFVPGK PVDYQGAR+ K +V+F  +Q++ LL+DR
Sbjct  82   VAALDADAHKELAQEYGIRGFPTIKVFVPGKPPVDYQGARDVKPIVEFALSQVKALLRDR  141

Query  522  LDGKA--------TGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            L+GK         +GGSS+K+EPSAS+ELNS+NFD LV KSKDLW
Sbjct  142  LNGKTSAGSGGKKSGGSSEKTEPSASIELNSQNFDKLVTKSKDLW  186


 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 61/119 (51%), Gaps = 15/119 (13%)
 Frame = +3

Query  192  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaa-------  350
            ++LN  NF   V  S  + +VEFFAPWCGHCK L P ++K A  LKG   +         
Sbjct  168  IELNSQNFDKLVTKSKDLWIVEFFAPWCGHCKKLAPEWKKAAKNLKGQVKLGHVDCDAEK  227

Query  351  -------ldadahsslaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIR  503
                       ++ SL  +Y ++GFPTI VF   K+ P  YQGAR A ++  F   Q+ 
Sbjct  228  NTNSSVWSVDKSYRSLMSKYKVEGFPTILVFGADKESPFPYQGARVASAIESFALEQLE  286



>ref|XP_010688926.1| PREDICTED: protein disulfide isomerase-like 2-3 [Beta vulgaris 
subsp. vulgaris]
Length=438

 Score =   214 bits (546),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            NALY  S+PVLQL PSNFKSKVLNSNGVVLVEFFAPWCGHC++LTP +EK ASVLKGVAT
Sbjct  24   NALYSASSPVLQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCQSLTPIWEKAASVLKGVAT  83

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAALDADAH SLAQEYGIKGFPTIKVFV GK PVDY GAR+ K + +F   Q++ LLKDR
Sbjct  84   VAALDADAHKSLAQEYGIKGFPTIKVFVNGKGPVDYMGARDVKPIAEFALQQVKALLKDR  143

Query  522  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            L+GK+ G S +KSEPS+SVELNSRNFD+LV+KSKDLW
Sbjct  144  LNGKSGGSSEKKSEPSSSVELNSRNFDELVLKSKDLW  180


 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 62/105 (59%), Gaps = 1/105 (1%)
 Frame = +3

Query  192  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  371
            ++LN  NF   VL S  + +VEFFAPWCGHCK L P ++K A+ LKG   +  ++ D   
Sbjct  162  VELNSRNFDELVLKSKDLWVVEFFAPWCGHCKKLAPEWKKAANNLKGKVKLGHVNCDEEK  221

Query  372  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIR  503
            SL  ++ ++GFPTI VF   K  P  Y+GAR A  +  F   Q+ 
Sbjct  222  SLMSKFKVQGFPTILVFGADKDSPFPYEGARSASGIESFALEQLE  266



>ref|XP_004243508.1| PREDICTED: protein disulfide isomerase-like 2-3 [Solanum lycopersicum]
Length=432

 Score =   214 bits (544),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 122/157 (78%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            NALYGP++PV+QL  SNFKSKVLNS G+VLVEFFAPWCGHC+ALTP +EK A++LKGVAT
Sbjct  21   NALYGPTSPVVQLTESNFKSKVLNSKGIVLVEFFAPWCGHCQALTPAWEKAATILKGVAT  80

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAALDADAH SLAQEYGI+GFPTIKVF PGK PVDYQGAREAK + ++   QI+ LLK+R
Sbjct  81   VAALDADAHKSLAQEYGIRGFPTIKVFAPGKPPVDYQGAREAKPIAEYALQQIKALLKER  140

Query  522  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            + GKATGGSS+ SEPSASVELNSRNFD+ V+KSKDLW
Sbjct  141  IHGKATGGSSESSEPSASVELNSRNFDENVLKSKDLW  177


 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 62/104 (60%), Gaps = 1/104 (1%)
 Frame = +3

Query  198  LNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahssl  377
            LN  NF   VL S  + +VEFFAPWCGHCK L P ++K A  L+G   +  +D DA  SL
Sbjct  161  LNSRNFDENVLKSKDLWIVEFFAPWCGHCKKLAPEWKKAAKNLQGKVKLGHVDCDAEKSL  220

Query  378  aQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  506
               Y ++GFPTI VF   K+ PV Y+GAR A ++  F   Q+  
Sbjct  221  MSRYNVQGFPTILVFGADKESPVTYEGARTASAIESFGLEQLET  264



>gb|EYU43141.1| hypothetical protein MIMGU_mgv1a006693mg [Erythranthe guttata]
Length=434

 Score =   213 bits (541),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +3

Query  165  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  344
            ALYGPS+PVLQL   NFKSKVLNS GVV+VEFFAPWCGHC+ALTPT+EK A+VLKGVAT+
Sbjct  22   ALYGPSSPVLQLTADNFKSKVLNSKGVVVVEFFAPWCGHCQALTPTWEKAATVLKGVATI  81

Query  345  aaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRL  524
            AALDADAH SLAQEYGIKGFPTIKVF PGK PVDYQGAR+ K + +F   Q+R L+K+RL
Sbjct  82   AALDADAHQSLAQEYGIKGFPTIKVFSPGKPPVDYQGARDIKPIAEFALKQVRALVKERL  141

Query  525  DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            +GK++GGSS+KSEPSASVELNS NFD+LV+KSK+LW
Sbjct  142  EGKSSGGSSKKSEPSASVELNSSNFDELVLKSKELW  177


 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 66/111 (59%), Gaps = 2/111 (2%)
 Frame = +3

Query  177  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  356
            PS  V +LN SNF   VL S  + +VEFFAPWCGHCK L P +++ AS LKG   +  +D
Sbjct  155  PSASV-ELNSSNFDELVLKSKELWIVEFFAPWCGHCKKLAPEWKRAASSLKGQVKLGHVD  213

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  506
             DA  SL   + ++GFPTI VF   K  P  Y+GAR A ++  F   Q+  
Sbjct  214  CDAEKSLMSRFNVQGFPTIMVFGADKDSPFPYEGARSASAIESFALEQLET  264



>ref|XP_006357974.1| PREDICTED: protein disulfide isomerase-like 2-3-like [Solanum 
tuberosum]
Length=432

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 121/157 (77%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            NALYGP++PV+QL  SNFK+KVLNS G+VLVEFFAPWCGHC+ALTP +EK A++LKGVAT
Sbjct  21   NALYGPTSPVVQLTESNFKTKVLNSKGIVLVEFFAPWCGHCQALTPIWEKAATILKGVAT  80

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAALDADAH SLAQEYGI+GFPTIKVF PGK PVDYQGAREAK + ++   QI+ LLK+R
Sbjct  81   VAALDADAHKSLAQEYGIRGFPTIKVFAPGKPPVDYQGAREAKPIAEYALQQIKALLKER  140

Query  522  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            + GKATGGSS+ SEPSASVELNSRNFD+ V+KSKDLW
Sbjct  141  IHGKATGGSSESSEPSASVELNSRNFDENVLKSKDLW  177


 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 62/104 (60%), Gaps = 1/104 (1%)
 Frame = +3

Query  198  LNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahssl  377
            LN  NF   VL S  + +VEFFAPWCGHCK L P ++K A  L+G   +  +D DA  SL
Sbjct  161  LNSRNFDENVLKSKDLWIVEFFAPWCGHCKKLAPEWKKAAKNLQGKVKLGHVDCDAEKSL  220

Query  378  aQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  506
               Y ++GFPTI VF   K+ PV Y+GAR A ++  F   Q+  
Sbjct  221  MSRYNVQGFPTILVFGADKESPVPYEGARTASAIESFGLQQLET  264



>ref|XP_006447669.1| hypothetical protein CICLE_v10015327mg [Citrus clementina]
 gb|ESR60909.1| hypothetical protein CICLE_v10015327mg [Citrus clementina]
Length=428

 Score =   210 bits (535),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 135/159 (85%), Gaps = 2/159 (1%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            +ALYG S+PV+QL P+NFKSKVLN+NGVVLVEF+APWCGHC+ALTP +EK A+VLKGVAT
Sbjct  23   DALYGSSSPVVQLTPNNFKSKVLNANGVVLVEFYAPWCGHCQALTPIWEKAATVLKGVAT  82

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAALDA+ H SLAQEYGI+GFPTIKVFVPGK PVDYQGAR+ K + +FV  QI+ LLK+R
Sbjct  83   VAALDANEHQSLAQEYGIRGFPTIKVFVPGKPPVDYQGARDVKPIAEFVLQQIKALLKER  142

Query  522  LDGKAT--GGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            L GKAT       KS+ + S+ELNS NFD+LV+KSKDLW
Sbjct  143  LSGKATGGSSDKSKSDSNESIELNSSNFDELVLKSKDLW  181


 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 66/106 (62%), Gaps = 1/106 (1%)
 Frame = +3

Query  192  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  371
            ++LN SNF   VL S  + +VEFFAPWCGHCK L P ++K A+ LKG   +  +D D+  
Sbjct  163  IELNSSNFDELVLKSKDLWIVEFFAPWCGHCKKLAPEWKKAANNLKGKVKLGHVDCDSEK  222

Query  372  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  506
            SL  ++ ++GFPTI VF   K  P+ Y+GAR A ++  F   Q+  
Sbjct  223  SLMSKFNVQGFPTILVFGADKDSPIPYEGARTAGAIESFALEQLET  268



>ref|XP_006469595.1| PREDICTED: LOW QUALITY PROTEIN: protein disulfide isomerase-like 
2-3-like [Citrus sinensis]
Length=439

 Score =   211 bits (536),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 135/159 (85%), Gaps = 2/159 (1%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            +ALYG S+PV+QL P+NFKSKVLN+NGVVLVEF+APWCGHC+ALTP +EK A+VLKGVAT
Sbjct  23   DALYGSSSPVVQLTPNNFKSKVLNANGVVLVEFYAPWCGHCQALTPIWEKAATVLKGVAT  82

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAALDA+ H SLAQEYGI+GFPTIKVFVPGK PVDYQGAR+ K + +FV  QI+ LLK+R
Sbjct  83   VAALDANEHQSLAQEYGIRGFPTIKVFVPGKPPVDYQGARDVKPIAEFVLQQIKALLKER  142

Query  522  LDGKAT--GGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            L GKAT       KS+ + S+ELNS NFD+LV+KSKDLW
Sbjct  143  LSGKATGGSSDKSKSDSNESIELNSSNFDELVLKSKDLW  181


 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 66/106 (62%), Gaps = 1/106 (1%)
 Frame = +3

Query  192  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  371
            ++LN SNF   VL S  + +VEFFAPWCGHCK L P ++K A+ LKG   +  +D D+  
Sbjct  163  IELNSSNFDELVLKSKDLWIVEFFAPWCGHCKKLAPEWKKAANNLKGKVKLGHVDCDSEK  222

Query  372  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  506
            SL  ++ ++GFPTI VF   K  P+ Y+GAR A ++  F   Q+  
Sbjct  223  SLMSKFNVQGFPTILVFGADKDSPIPYEGARTAGAIESFALEQLET  268



>gb|KDO59568.1| hypothetical protein CISIN_1g014216mg [Citrus sinensis]
Length=411

 Score =   209 bits (532),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 134/159 (84%), Gaps = 2/159 (1%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            +ALYG S+PV+QL P+NFKSKVLN+NGVVLVEF+APWCGHC+ALTP +EK A+VLKGVAT
Sbjct  23   DALYGSSSPVVQLTPNNFKSKVLNANGVVLVEFYAPWCGHCQALTPIWEKAATVLKGVAT  82

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAALDA+ H SLAQEYGI+GFPTIKVFVPGK PVDYQGAR+ K + +F   QI+ LLK+R
Sbjct  83   VAALDANEHQSLAQEYGIRGFPTIKVFVPGKPPVDYQGARDVKPIAEFALQQIKALLKER  142

Query  522  LDGKAT--GGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            L GKAT       KS+ + S+ELNS NFD+LV+KSKDLW
Sbjct  143  LSGKATGGSSDKSKSDSNESIELNSSNFDELVLKSKDLW  181


 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 66/106 (62%), Gaps = 1/106 (1%)
 Frame = +3

Query  192  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  371
            ++LN SNF   VL S  + +VEFFAPWCGHCK L P ++K A+ LKG   +  +D D+  
Sbjct  163  IELNSSNFDELVLKSKDLWIVEFFAPWCGHCKKLAPEWKKAANNLKGKVKLGHVDCDSEK  222

Query  372  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  506
            SL  ++ ++GFPTI VF   K  P+ Y+GAR A ++  F   Q+  
Sbjct  223  SLMSKFNVQGFPTILVFGADKDSPIPYEGARTAGAIESFALEQLET  268



>gb|KFK31099.1| hypothetical protein AALP_AA6G068000 [Arabis alpina]
Length=441

 Score =   209 bits (533),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 137/161 (85%), Gaps = 4/161 (2%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            NALY PS+PV+QL  +NFKSKVLNSNGVVLVEFFAPWCGHCKALTPT+EKVAS+LKGVAT
Sbjct  23   NALYEPSSPVVQLTATNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTWEKVASILKGVAT  82

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAA+DADAH S  Q+YGIKGFPTIKVFV GK P+DYQGAR+AKS+ +F   QI+ L+ DR
Sbjct  83   VAAIDADAHQSAVQDYGIKGFPTIKVFVAGKPPIDYQGARDAKSIANFAYKQIKALVNDR  142

Query  522  LDGKA----TGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            L+GK+     G S +KSE SASVELN+ NFD+LV+KS +LW
Sbjct  143  LEGKSKPNGGGSSEKKSESSASVELNASNFDELVIKSNELW  183


 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 63/106 (59%), Gaps = 1/106 (1%)
 Frame = +3

Query  192  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  371
            ++LN SNF   V+ SN + +VEFFAPWCGHCK L P +++ A  LKG   +  ++ D   
Sbjct  165  VELNASNFDELVIKSNELWIVEFFAPWCGHCKKLAPEWKRAAKNLKGKVKLGHVNCDVEQ  224

Query  372  slaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRN  506
            S+   + ++GFPTI VF P K  P  Y+GAR A ++  F      N
Sbjct  225  SIMSRFKVQGFPTILVFGPDKSSPYPYEGARSASAIESFASELAEN  270



>ref|XP_002528963.1| protein disulfide isomerase, putative [Ricinus communis]
 gb|EEF33437.1| protein disulfide isomerase, putative [Ricinus communis]
Length=348

 Score =   207 bits (526),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = +3

Query  222  KVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahsslaQEYGIKG  401
            +VLN+NGVVLVEFFAPWCGHCKALTPT+EK A+VLKGVATVAALDADAH SLAQEYGI+G
Sbjct  6    RVLNANGVVLVEFFAPWCGHCKALTPTWEKAATVLKGVATVAALDADAHQSLAQEYGIRG  65

Query  402  FPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRLDGKATGGSSQKSEPSASVE  581
            FPTIKVF PGK PVDYQGAR+ K + +F   QI+ LLK+RL+GK+TGGS +KSEPSASVE
Sbjct  66   FPTIKVFAPGKPPVDYQGARDVKPIAEFALQQIKALLKERLNGKSTGGSKEKSEPSASVE  125

Query  582  LNSRNFDDLVVKSKDLW  632
            LNS NFDDLV+KSK+LW
Sbjct  126  LNSSNFDDLVLKSKELW  142


 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 66/111 (59%), Gaps = 2/111 (2%)
 Frame = +3

Query  177  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  356
            PS  V +LN SNF   VL S  + +VEFFAPWCGHCK L P ++K ++ L G   +  +D
Sbjct  120  PSASV-ELNSSNFDDLVLKSKELWIVEFFAPWCGHCKKLAPEWKKASNNLNGKVKMGHVD  178

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  506
             D+  SL   + ++GFPTI VF   K  P+ Y+GAR A ++  F   Q+  
Sbjct  179  CDSEKSLMSRFNVQGFPTILVFGADKDTPIPYEGARTASAIESFALEQLET  229



>gb|KDO59567.1| hypothetical protein CISIN_1g014216mg [Citrus sinensis]
Length=428

 Score =   209 bits (531),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 134/159 (84%), Gaps = 2/159 (1%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            +ALYG S+PV+QL P+NFKSKVLN+NGVVLVEF+APWCGHC+ALTP +EK A+VLKGVAT
Sbjct  23   DALYGSSSPVVQLTPNNFKSKVLNANGVVLVEFYAPWCGHCQALTPIWEKAATVLKGVAT  82

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAALDA+ H SLAQEYGI+GFPTIKVFVPGK PVDYQGAR+ K + +F   QI+ LLK+R
Sbjct  83   VAALDANEHQSLAQEYGIRGFPTIKVFVPGKPPVDYQGARDVKPIAEFALQQIKALLKER  142

Query  522  LDGKAT--GGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            L GKAT       KS+ + S+ELNS NFD+LV+KSKDLW
Sbjct  143  LSGKATGGSSDKSKSDSNESIELNSSNFDELVLKSKDLW  181


 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 66/106 (62%), Gaps = 1/106 (1%)
 Frame = +3

Query  192  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  371
            ++LN SNF   VL S  + +VEFFAPWCGHCK L P ++K A+ LKG   +  +D D+  
Sbjct  163  IELNSSNFDELVLKSKDLWIVEFFAPWCGHCKKLAPEWKKAANNLKGKVKLGHVDCDSEK  222

Query  372  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  506
            SL  ++ ++GFPTI VF   K  P+ Y+GAR A ++  F   Q+  
Sbjct  223  SLMSKFNVQGFPTILVFGADKDSPIPYEGARTAGAIESFALEQLET  268



>ref|XP_010913398.1| PREDICTED: protein disulfide isomerase-like 2-3 [Elaeis guineensis]
Length=429

 Score =   206 bits (523),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 138/156 (88%), Gaps = 0/156 (0%)
 Frame = +3

Query  165  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  344
            ALY  S+PV+QLNPSNF SKVLN+ GVVLVEFFAPWCGHC+ALTPT+EK A+VLKGVATV
Sbjct  19   ALYSSSSPVVQLNPSNFNSKVLNAKGVVLVEFFAPWCGHCQALTPTWEKAATVLKGVATV  78

Query  345  aaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRL  524
            AALDADAH SLAQEYGI GFPTIKVF+PGK PVDYQGAR+ K + +F   QI+ LLK+RL
Sbjct  79   AALDADAHKSLAQEYGIIGFPTIKVFLPGKPPVDYQGARDVKPIAEFALQQIKALLKERL  138

Query  525  DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
             GK++GGSS+KSE SASVEL SRNFD+LV+KSKDLW
Sbjct  139  HGKSSGGSSEKSETSASVELTSRNFDELVLKSKDLW  174


 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 62/106 (58%), Gaps = 1/106 (1%)
 Frame = +3

Query  192  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  371
            ++L   NF   VL S  + +VEFFAPWCGHCK L P ++K ++ LKG   +  +D DA  
Sbjct  156  VELTSRNFDELVLKSKDLWIVEFFAPWCGHCKKLAPEWKKASNNLKGKVKLGHVDCDAEK  215

Query  372  slaQEYGIKGFPTIKVF-VPGKQPVDYQGAREAKSMVDFVKAQIRN  506
            SL   + ++GFPTI VF +    P  Y+GAR A ++  F   Q+  
Sbjct  216  SLMSRFNVQGFPTILVFGIDKDSPYPYEGARVASAIESFALEQVET  261



>dbj|BAJ84858.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95210.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=440

 Score =   203 bits (517),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 132/159 (83%), Gaps = 10/159 (6%)
 Frame = +3

Query  183  TPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldad  362
            +PVLQLNP+NFK KVLN+NGVVLVEFFAPWCGHCK LTP +EK A VLKGVATVAALDAD
Sbjct  28   SPVLQLNPNNFK-KVLNANGVVLVEFFAPWCGHCKQLTPIWEKAAGVLKGVATVAALDAD  86

Query  363  ahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRLDGKA--  536
            AH  LAQ+YGI+GFPTIKVF+PGK PVDY+GAR+ K +V+F  +Q++ LL+DRLDGKA  
Sbjct  87   AHKELAQQYGIRGFPTIKVFLPGKPPVDYEGARDVKPIVNFALSQVKGLLRDRLDGKASG  146

Query  537  -------TGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
                    G S +K+EP+ SVELNS NFD+LV+KSKDLW
Sbjct  147  GSSSKTSGGSSEKKNEPNESVELNSSNFDELVIKSKDLW  185


 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 64/105 (61%), Gaps = 1/105 (1%)
 Frame = +3

Query  192  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  371
            ++LN SNF   V+ S  + +VEFFAPWCGHCK L P +++ A  LKG   +  +D D+  
Sbjct  167  VELNSSNFDELVIKSKDLWIVEFFAPWCGHCKKLAPEWKRAAKNLKGQVKLGHVDCDSDK  226

Query  372  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIR  503
            SL  +Y ++GFPTI VF   K  P  YQGAR A ++  F   Q+ 
Sbjct  227  SLMSKYKVEGFPTILVFGADKDSPFPYQGARAASAIESFALEQLE  271



>ref|XP_004956980.1| PREDICTED: protein disulfide isomerase-like 2-3-like [Setaria 
italica]
Length=440

 Score =   202 bits (515),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 116/158 (73%), Positives = 135/158 (85%), Gaps = 8/158 (5%)
 Frame = +3

Query  183  TPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldad  362
            +PVLQLNP+NFKSKVL +NGVVLVEFFAPWCGHCK L P +EK A VLKGVA VAALDAD
Sbjct  28   SPVLQLNPNNFKSKVLEANGVVLVEFFAPWCGHCKQLAPAWEKAAGVLKGVARVAALDAD  87

Query  363  ahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRLD-----  527
            AH +LAQEYGI+GFPTIKVF PGK PVDYQGAR+ K +V+F  +Q++ LL+DRL+     
Sbjct  88   AHQALAQEYGIRGFPTIKVFAPGKPPVDYQGARDVKPIVEFALSQVKALLRDRLNGKASG  147

Query  528  ---GKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
               GKA+GGSS+K+EPSASVELNSRNFD+LV+KSKDLW
Sbjct  148  GSSGKASGGSSEKNEPSASVELNSRNFDELVIKSKDLW  185


 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 66/110 (60%), Gaps = 2/110 (2%)
 Frame = +3

Query  177  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  356
            PS  V +LN  NF   V+ S  + +VEFFAPWCGHCK L P +++ A  LKG   +  +D
Sbjct  163  PSASV-ELNSRNFDELVIKSKDLWIVEFFAPWCGHCKKLAPEWKRAAKNLKGQVKLGHVD  221

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIR  503
             DA  SL  +Y ++GFPTI VF   K+ P  YQGAR A ++  F   Q+ 
Sbjct  222  CDAEKSLMSKYKVEGFPTILVFGADKESPFPYQGARVASAIESFALEQLE  271



>gb|EMT02125.1| Protein disulfide-isomerase A6 [Aegilops tauschii]
Length=422

 Score =   198 bits (503),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 134/159 (84%), Gaps = 10/159 (6%)
 Frame = +3

Query  183  TPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldad  362
            +PVLQLNP+NFK KVLN+NGVVLVEFFAPWCGHCK LTP +EK A VLKGVATVAALDAD
Sbjct  28   SPVLQLNPNNFK-KVLNANGVVLVEFFAPWCGHCKQLTPIWEKAAGVLKGVATVAALDAD  86

Query  363  ahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRLDGKATG  542
            AH  LAQ+YGI+GFPTIKVF+PGK PVDY+GAR+ K++V+F  +Q++ LL+DRLDGK +G
Sbjct  87   AHKELAQQYGIQGFPTIKVFLPGKPPVDYEGARDVKAIVNFALSQVKGLLRDRLDGKTSG  146

Query  543  GS---------SQKSEPSASVELNSRNFDDLVVKSKDLW  632
            GS          +K+EP+ SVELNS NFD+LVVKSKDLW
Sbjct  147  GSSGKTSGGSREKKTEPNESVELNSSNFDELVVKSKDLW  185


 Score = 85.5 bits (210),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 65/105 (62%), Gaps = 1/105 (1%)
 Frame = +3

Query  192  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  371
            ++LN SNF   V+ S  + +VEFFAPWCGHCK L P +++ A  LKG   +  +D D+  
Sbjct  167  VELNSSNFDELVVKSKDLWIVEFFAPWCGHCKKLAPEWKRAAKNLKGQVKLGHIDCDSDK  226

Query  372  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIR  503
            SL  +Y ++GFPTI VF   K+ P  YQGAR A ++  F   Q+ 
Sbjct  227  SLMSKYKVEGFPTILVFGADKESPFPYQGARAASAIESFALEQLE  271



>emb|CBG91909.1| putative PDI-like protein [Triticum aestivum]
Length=440

 Score =   196 bits (499),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 110/159 (69%), Positives = 129/159 (81%), Gaps = 10/159 (6%)
 Frame = +3

Query  183  TPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldad  362
            +PVLQLNP+NFK KVLN+NGVVLVEFFAPWCGHCK LTP +EK A VLKGVATVAALDAD
Sbjct  28   SPVLQLNPNNFK-KVLNANGVVLVEFFAPWCGHCKQLTPIWEKAAGVLKGVATVAALDAD  86

Query  363  ahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRLD-----  527
            AH  LAQ+YGI+GFPTIKVF+PGK PVDY+GAR+ K +V+F  +Q++ LL+DRLD     
Sbjct  87   AHKELAQQYGIRGFPTIKVFLPGKPPVDYEGARDVKPIVNFALSQVKGLLRDRLDGKTSG  146

Query  528  ----GKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
                  + G S +K EP+ SVELNS NFD+LVVKSKDLW
Sbjct  147  GSSGKTSGGSSEKKHEPNESVELNSSNFDELVVKSKDLW  185


 Score = 85.5 bits (210),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 65/105 (62%), Gaps = 1/105 (1%)
 Frame = +3

Query  192  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  371
            ++LN SNF   V+ S  + +VEFFAPWCGHCK L P +++ A  LKG   +  +D D+  
Sbjct  167  VELNSSNFDELVVKSKDLWIVEFFAPWCGHCKKLAPEWKRAAKNLKGQVKLGHVDCDSDK  226

Query  372  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIR  503
            SL  +Y ++GFPTI VF   K+ P  YQGAR A ++  F   Q+ 
Sbjct  227  SLMSKYKVEGFPTILVFGADKESPFPYQGARAASAIESFALEQLE  271



>emb|CBG91908.1| putative PDI-like protein [Triticum aestivum]
Length=440

 Score =   195 bits (496),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 130/159 (82%), Gaps = 10/159 (6%)
 Frame = +3

Query  183  TPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldad  362
            +PVLQLNP+NFK KVLN+NGVVLVEFFAPWCGHCK LTP +EK A VLKGVATVAALDAD
Sbjct  28   SPVLQLNPNNFK-KVLNANGVVLVEFFAPWCGHCKQLTPIWEKAAGVLKGVATVAALDAD  86

Query  363  ahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRLD-----  527
            AH  LAQ+YGI+GFPTIKVF+PGK PVDY+GAR+ + +V+F  +Q++ LL+DRLD     
Sbjct  87   AHKELAQQYGIRGFPTIKVFLPGKPPVDYEGARDVEPIVNFALSQVKGLLRDRLDGKTSG  146

Query  528  ----GKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
                  + G S +K+EP+ SVELNS NFD+LVVKSKDLW
Sbjct  147  GSSGKTSGGSSEKKNEPNESVELNSSNFDELVVKSKDLW  185


 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 65/105 (62%), Gaps = 1/105 (1%)
 Frame = +3

Query  192  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  371
            ++LN SNF   V+ S  + +VEFFAPWCGHCK L P +++ A  LKG   +  +D D+  
Sbjct  167  VELNSSNFDELVVKSKDLWIVEFFAPWCGHCKKLAPEWKRAAKNLKGQVKLGHVDCDSDK  226

Query  372  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIR  503
            SL  +Y ++GFPTI VF   K+ P  YQGAR A ++  F   Q+ 
Sbjct  227  SLMSKYKVEGFPTILVFGADKESPFPYQGARAASAIEPFALEQLE  271



>dbj|BAO79454.1| protein disulfide isomerase family protein 5-1 [Triticum aestivum]
Length=440

 Score =   194 bits (494),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 129/159 (81%), Gaps = 10/159 (6%)
 Frame = +3

Query  183  TPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldad  362
            +PV QLNP+NFK KVLN+NGVVLVEFFAPWCGHCK LTP +EK A VLKGVATVAALDAD
Sbjct  28   SPVHQLNPNNFK-KVLNANGVVLVEFFAPWCGHCKQLTPIWEKAAGVLKGVATVAALDAD  86

Query  363  ahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRLD-----  527
            AH  LAQ+YGI+GFPTIKVF+PGK PVDY+GAR+ K +V+F  +Q++ LL+DRLD     
Sbjct  87   AHKELAQQYGIRGFPTIKVFLPGKPPVDYEGARDVKPIVNFALSQVKGLLRDRLDGKTSG  146

Query  528  ----GKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
                  + G S +K+EP+ SVELNS NFD+LVVKSKDLW
Sbjct  147  GSSGKTSGGSSEKKNEPNESVELNSSNFDELVVKSKDLW  185


 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 65/105 (62%), Gaps = 1/105 (1%)
 Frame = +3

Query  192  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  371
            ++LN SNF   V+ S  + +VEFFAPWCGHCK L P +++ A  LKG   +  +D D+  
Sbjct  167  VELNSSNFDELVVKSKDLWIVEFFAPWCGHCKKLAPEWKRAAKNLKGQVKLGHVDCDSDK  226

Query  372  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIR  503
            SL  +Y ++GFPTI VF   K+ P  YQGAR A ++  F   Q+ 
Sbjct  227  SLMSKYKVEGFPTILVFGADKESPFPYQGARAASAIEPFALEQLE  271



>ref|XP_003578205.1| PREDICTED: protein disulfide isomerase-like 2-3 [Brachypodium 
distachyon]
Length=440

 Score =   194 bits (492),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 130/159 (82%), Gaps = 10/159 (6%)
 Frame = +3

Query  183  TPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldad  362
            +PVLQLNP+NFK KVLN+NGVVLVEFFAPWCGHCK LTPT+EK A VLKGVAT+AALDAD
Sbjct  28   SPVLQLNPNNFK-KVLNANGVVLVEFFAPWCGHCKQLTPTWEKAAGVLKGVATIAALDAD  86

Query  363  ahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRLD-----  527
            AH  LAQ+YGI+GFPTIKVF+PGK PVDY+GAR+ K +V+F   Q+++LLKDRLD     
Sbjct  87   AHKELAQQYGIQGFPTIKVFIPGKPPVDYEGARDVKPIVNFALQQVKSLLKDRLDGKTSG  146

Query  528  ----GKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
                  + G S +K++ + S+ELNS NFD+LV+KSKDLW
Sbjct  147  GSSGKTSGGSSEKKTDTNESIELNSSNFDELVIKSKDLW  185


 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 65/105 (62%), Gaps = 1/105 (1%)
 Frame = +3

Query  192  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  371
            ++LN SNF   V+ S  + +VEFFAPWCGHCK L P +++ A  LKG   +  +D D+  
Sbjct  167  IELNSSNFDELVIKSKDLWIVEFFAPWCGHCKKLAPEWKRAAKNLKGQVKLGHVDCDSDK  226

Query  372  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIR  503
            SL  +Y ++GFPTI VF   K+ P  YQGAR A ++  F   Q+ 
Sbjct  227  SLMSKYKVEGFPTILVFGADKESPFPYQGARAASAIESFALEQLE  271



>ref|XP_006661300.1| PREDICTED: protein disulfide isomerase-like 2-3-like [Oryza brachyantha]
Length=425

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 103/145 (71%), Positives = 120/145 (83%), Gaps = 8/145 (6%)
 Frame = +3

Query  222  KVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahsslaQEYGIKG  401
            +VLNSNGVVLVEFFAPWCGHC+ LTPT+EK A +LKGVATVAALDADAH  LAQEYGI+G
Sbjct  26   RVLNSNGVVLVEFFAPWCGHCQQLTPTWEKAAGILKGVATVAALDADAHKELAQEYGIRG  85

Query  402  FPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRLDGKATGG--------SSQK  557
            FPTIKVFVPGK P DYQGAR+ K +V+F   Q++ LL+DRL GK + G        SS+K
Sbjct  86   FPTIKVFVPGKPPADYQGARDVKPIVEFALKQVKGLLRDRLSGKTSAGSDSKASSGSSEK  145

Query  558  SEPSASVELNSRNFDDLVVKSKDLW  632
            +E SAS+ELNSRNFD+LV+KSKDLW
Sbjct  146  TEASASIELNSRNFDELVIKSKDLW  170


 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 64/105 (61%), Gaps = 1/105 (1%)
 Frame = +3

Query  192  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  371
            ++LN  NF   V+ S  + +VEFFAPWCGHCK L P +++ A  LKG   +  +D DA  
Sbjct  152  IELNSRNFDELVIKSKDLWIVEFFAPWCGHCKKLAPEWKRAAKNLKGQVKLGHVDCDADK  211

Query  372  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIR  503
            SL  +Y ++GFPTI VF   K+ P  YQGAR A ++  F   Q+ 
Sbjct  212  SLMSKYKVEGFPTILVFGADKESPFPYQGARVASAIESFALEQLE  256



>emb|CBG91899.1| putative PDI-like protein [Triticum aestivum]
Length=440

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 129/159 (81%), Gaps = 10/159 (6%)
 Frame = +3

Query  183  TPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldad  362
            +PVLQLNP+NFK KVLN+NGVVLVEFFAPWCG CK LTP +EK A VLKGVATVAALDAD
Sbjct  28   SPVLQLNPNNFK-KVLNANGVVLVEFFAPWCGLCKQLTPIWEKAAGVLKGVATVAALDAD  86

Query  363  ahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRLD-----  527
            AH  LAQ+YGI+GFPTIKVF+PGK PVDY+GAR+ K +V+F  +Q++ LL+DRLD     
Sbjct  87   AHKELAQQYGIRGFPTIKVFLPGKPPVDYEGARDVKPIVNFALSQVQGLLRDRLDGKTSG  146

Query  528  ----GKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
                  + G S +K+EP+ SVELNS NFD+LVV+SKDLW
Sbjct  147  GSSGKTSGGSSEKKNEPNESVELNSSNFDELVVRSKDLW  185


 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 65/105 (62%), Gaps = 1/105 (1%)
 Frame = +3

Query  192  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  371
            ++LN SNF   V+ S  + +VEFFAPWCGHCK L P +++ A  LKG   +  +D D+  
Sbjct  167  VELNSSNFDELVVRSKDLWIVEFFAPWCGHCKKLAPEWKRAAKNLKGQVKLGHVDCDSDK  226

Query  372  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIR  503
            SL  +Y ++GFPTI VF   K+ P  YQGAR A ++  F   Q+ 
Sbjct  227  SLMSKYKVEGFPTILVFGADKESPFPYQGARAASAIEPFALEQLE  271



>gb|ACN39830.1| unknown [Picea sitchensis]
Length=445

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 107/160 (67%), Positives = 129/160 (81%), Gaps = 5/160 (3%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
             ALYGPS+ VL L PS FKSKVLNS+G+VLVEFFAPWCGHC+ALTP +EK A++LKG  T
Sbjct  32   EALYGPSSDVLLLTPSTFKSKVLNSDGIVLVEFFAPWCGHCQALTPIWEKTAAILKGFVT  91

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAALDADAH SLAQEYGI+GFPTIKVF PGK P+ YQGAR+ K + +F   Q++ ++KDR
Sbjct  92   VAALDADAHKSLAQEYGIQGFPTIKVFTPGKPPIAYQGARDPKPIAEFAIQQLKTIVKDR  151

Query  522  LDGKATGGSSQK---SEPSASVELNSRNFDDLVVKSKDLW  632
            L+GK   GS++K   S  S+SVEL S NFDD+V+KSKD W
Sbjct  152  LNGKT--GSNKKSSSSSSSSSVELTSNNFDDIVLKSKDPW  189


 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 64/106 (60%), Gaps = 1/106 (1%)
 Frame = +3

Query  192  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  371
            ++L  +NF   VL S    LVEF+APWCGHCK L P ++K A+ LKG   +  ++ D+  
Sbjct  171  VELTSNNFDDIVLKSKDPWLVEFYAPWCGHCKKLGPEWKKAANNLKGKVNMGQVNCDSEK  230

Query  372  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  506
            SL   + ++GFPTI VF   K+ PV Y+GAR A ++  F   Q+  
Sbjct  231  SLMSRFNVQGFPTILVFGSDKESPVPYEGARTASAIESFALEQLET  276



>gb|KHN38504.1| Protein disulfide isomerase-like 2-3 [Glycine soja]
Length=391

 Score =   184 bits (467),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 121/137 (88%), Gaps = 0/137 (0%)
 Frame = +3

Query  222  KVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahsslaQEYGIKG  401
            +VLNSNGVVLVEFFAPWCGHC+ALTP +EK A+VLKGV TVAA+DADAH SLAQEYGI+G
Sbjct  9    QVLNSNGVVLVEFFAPWCGHCQALTPIWEKAATVLKGVVTVAAIDADAHPSLAQEYGIRG  68

Query  402  FPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRLDGKATGGSSQKSEPSASVE  581
            FPTIKVF PGK PVDYQGAR+ K + +F   Q++ LLKDRL GKATGGSS+K+E S+SVE
Sbjct  69   FPTIKVFAPGKPPVDYQGARDVKPIAEFALQQVKALLKDRLSGKATGGSSEKTETSSSVE  128

Query  582  LNSRNFDDLVVKSKDLW  632
            LNS NFD+LV+KSK+LW
Sbjct  129  LNSGNFDELVIKSKELW  145


 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/111 (39%), Positives = 62/111 (56%), Gaps = 6/111 (5%)
 Frame = +3

Query  192  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV-----aald  356
            ++LN  NF   V+ S  + +VEFFAPWCGHCK L P ++K ++ LKG   +      A  
Sbjct  127  VELNSGNFDELVIKSKELWIVEFFAPWCGHCKKLAPEWKKASNNLKGKVKLGHVDCDAEK  186

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  506
               + SL   + ++GFPTI VF   K  P+ Y+GAR A ++  F   Q+  
Sbjct  187  DICYQSLMSRFKVQGFPTILVFGADKDSPIPYEGARTASAIESFALEQLET  237



>gb|EMS60416.1| Protein disulfide isomerase-like 2-3 [Triticum urartu]
Length=371

 Score =   179 bits (454),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 110/192 (57%), Positives = 130/192 (68%), Gaps = 43/192 (22%)
 Frame = +3

Query  183  TPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldad  362
            +PVLQLNP+NFK KVLN+NGVVLVEFFAPWCGHCK LTP +EK A VLKGVATVAALDAD
Sbjct  28   SPVLQLNPNNFK-KVLNANGVVLVEFFAPWCGHCKQLTPIWEKAAGVLKGVATVAALDAD  86

Query  363  ahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQ---------------  497
            AH  LAQ+YGI+GFPTIKVF+PGK PVDY+GAR+ K +V+F  +Q               
Sbjct  87   AHKELAQQYGIRGFPTIKVFLPGKPPVDYEGARDVKPIVNFALSQTFKPLYPTYKPNRRE  146

Query  498  ------------------IRNLLKDRLD---------GKATGGSSQKSEPSASVELNSRN  596
                              ++ LL+DRLD           + G S +K+EP+ SVELNS N
Sbjct  147  YEFVSYVAKVVSFHFHYKVKGLLRDRLDGKTSGGSSGKTSGGSSEKKNEPNESVELNSSN  206

Query  597  FDDLVVKSKDLW  632
            FD+LVVKSKDLW
Sbjct  207  FDELVVKSKDLW  218


 Score = 84.7 bits (208),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 65/105 (62%), Gaps = 1/105 (1%)
 Frame = +3

Query  192  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  371
            ++LN SNF   V+ S  + +VEFFAPWCGHCK L P +++ A  LKG   +  +D D+  
Sbjct  200  VELNSSNFDELVVKSKDLWIVEFFAPWCGHCKKLAPEWKRAAKNLKGQVKLGHVDCDSDK  259

Query  372  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIR  503
            SL  +Y ++GFPTI VF   K+ P  YQGAR A ++  F   Q+ 
Sbjct  260  SLMSKYKVEGFPTILVFGADKESPFPYQGARAASAIESFALEQLE  304



>ref|XP_001780684.1| predicted protein [Physcomitrella patens]
 gb|EDQ54468.1| predicted protein [Physcomitrella patens]
Length=427

 Score =   174 bits (440),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 121/163 (74%), Gaps = 6/163 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            +ALYGPS+ V+QL  SNFK+KVL + G+VLVEF+A WCGHCK L P +EK A+ LKG+ T
Sbjct  18   SALYGPSSDVVQLTSSNFKNKVLGAEGIVLVEFYANWCGHCKNLAPAWEKAATSLKGIVT  77

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            VAA+DAD H  LAQ+YGI+GFPTIKVF  GK P+DYQGAREAK++VD+   Q++ L  DR
Sbjct  78   VAAVDADTHKDLAQQYGIQGFPTIKVFGLGKSPIDYQGAREAKAIVDYALQQVKTLALDR  137

Query  522  LDGKATGGSSQKSE------PSASVELNSRNFDDLVVKSKDLW  632
            L+GK+    S   +      PSAS EL+S NFD LVV+S D W
Sbjct  138  LNGKSGSKKSSSKKDKDSNGPSASTELSSSNFDKLVVQSDDTW  180


 Score = 85.5 bits (210),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 69/111 (62%), Gaps = 2/111 (2%)
 Frame = +3

Query  174  GPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaal  353
            GPS    +L+ SNF   V+ S+   L+EF+APWCGHCK L P ++  A  LKG   +  +
Sbjct  157  GPSAST-ELSSSNFDKLVVQSDDTWLIEFYAPWCGHCKKLAPEWKTAAKNLKGKMKLGQV  215

Query  354  dadahsslaQEYGIKGFPTIKVF-VPGKQPVDYQGAREAKSMVDFVKAQIR  503
            D + +  LAQ+YGI+GFPTI +F V  + P  Y+GAR A ++  +  +Q+ 
Sbjct  216  DCETNKDLAQKYGIQGFPTIMLFGVDKENPTLYEGARTAGAIESYAISQLE  266



>gb|EAZ44947.1| hypothetical protein OsJ_29589 [Oryza sativa Japonica Group]
Length=143

 Score =   163 bits (412),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            +ALY   +PVLQ NP+NFKSKVLNSNGVVLVEFFAPWCGHC+ LTP +EK A VLKGVAT
Sbjct  22   SALYSAGSPVLQFNPNNFKSKVLNSNGVVLVEFFAPWCGHCQQLTPIWEKAAGVLKGVAT  81

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIR  503
            VAALDADAH  LAQEYGI+GFPTIKVFVPGK PVDYQGAR+ K +V+F  +Q +
Sbjct  82   VAALDADAHKELAQEYGIRGFPTIKVFVPGKPPVDYQGARDVKPIVEFALSQTK  135



>ref|XP_002973288.1| hypothetical protein SELMODRAFT_232026 [Selaginella moellendorffii]
 gb|EFJ25662.1| hypothetical protein SELMODRAFT_232026 [Selaginella moellendorffii]
Length=442

 Score =   162 bits (409),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 113/158 (72%), Gaps = 3/158 (2%)
 Frame = +3

Query  168  LYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVa  347
            LY  S+ V+ +NPSNFKSKVL++ G+V+VEFFA WCGHCKAL P ++K A+ LKG+ T+A
Sbjct  28   LYDASSDVVIVNPSNFKSKVLDAKGIVIVEFFANWCGHCKALAPAWDKAATALKGIVTIA  87

Query  348  aldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRLD  527
            A+DAD H SLA EYG++GFPTIKVF  GK P+DYQG REAK +V+F   Q + L  DRL 
Sbjct  88   AVDADTHKSLAAEYGLQGFPTIKVFGVGKSPIDYQGPREAKGIVEFALQQAKTLALDRLK  147

Query  528  GKATGGSSQKSEPS---ASVELNSRNFDDLVVKSKDLW  632
             K      +K  P    AS+EL   NFD+ V+KS D+W
Sbjct  148  SKKKSQDKEKKNPDKEKASIELTPTNFDEQVLKSNDIW  185


 Score = 91.3 bits (225),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 63/96 (66%), Gaps = 1/96 (1%)
 Frame = +3

Query  192  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  371
            ++L P+NF  +VL SN + LVEFFAPWCGHCK L P ++  A  LKG   +  +D DAH 
Sbjct  167  IELTPTNFDEQVLKSNDIWLVEFFAPWCGHCKKLAPEWKNAAKRLKGKVKLGQVDGDAHK  226

Query  372  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSM  476
             L  +Y + GFPTI VF   KQ P  YQGAR+A ++
Sbjct  227  DLMSKYSVTGFPTILVFGADKQNPTVYQGARDASAI  262



>ref|XP_002976616.1| hypothetical protein SELMODRAFT_232834 [Selaginella moellendorffii]
 gb|EFJ22285.1| hypothetical protein SELMODRAFT_232834 [Selaginella moellendorffii]
Length=442

 Score =   160 bits (404),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 111/158 (70%), Gaps = 3/158 (2%)
 Frame = +3

Query  168  LYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVa  347
            LY  S+ V+ +NPSNFKSKVL++ G+V+VEFFA WCGHCKAL P ++K A+ LKG+ T+A
Sbjct  28   LYDASSDVVIVNPSNFKSKVLDAKGIVIVEFFANWCGHCKALAPAWDKAATALKGIVTIA  87

Query  348  aldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRL-  524
            A+DAD H SLA EYG++GFPTIKVF  GK P+DYQG REAK +V+F   Q + L  DRL 
Sbjct  88   AVDADTHKSLAAEYGLQGFPTIKVFGVGKSPIDYQGPREAKGIVEFALQQAKTLALDRLK  147

Query  525  --DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
                        + +  AS+EL   NFD+ V+KS D+W
Sbjct  148  SKKKSQDKEKKNQDKEKASIELTPTNFDEQVLKSNDIW  185


 Score = 91.3 bits (225),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 63/96 (66%), Gaps = 1/96 (1%)
 Frame = +3

Query  192  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  371
            ++L P+NF  +VL SN + LVEFFAPWCGHCK L P ++  A  LKG   +  +D DAH 
Sbjct  167  IELTPTNFDEQVLKSNDIWLVEFFAPWCGHCKKLAPEWKNAAKRLKGKVKLGQVDGDAHK  226

Query  372  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSM  476
             L  +Y + GFPTI VF   KQ P  YQGAR+A ++
Sbjct  227  DLMSKYSVTGFPTILVFGADKQNPTVYQGARDASAI  262



>ref|XP_006869520.1| PREDICTED: protein disulfide-isomerase A6 [Chrysochloris asiatica]
Length=437

 Score =   148 bits (374),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 109/160 (68%), Gaps = 3/160 (2%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ S+ + LVEFFAPWCGHC+ LTP ++KVA+ LKGV  
Sbjct  18   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFFAPWCGHCQRLTPEWKKVATALKGVVK  77

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R A+++VD   + +R L+KD
Sbjct  78   VGAVDADKHQSLGGQYGVQGFPTIKIFSSNKNRPEDYQGGRTAEAIVDAALSAVRQLVKD  137

Query  519  RLDGKATG--GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G++ G  G S+ S     +EL    FD  V+ S+D+W
Sbjct  138  RLGGRSGGKQGRSEGSSKKDVIELTDDTFDKNVLDSEDVW  177


 Score = 85.1 bits (209),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L    F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  158  VIELTDDTFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  217

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A A+  LA  Y I+GFPTIK+F  G+ PVDY G R   ++V
Sbjct  218  ATANQMLANRYEIRGFPTIKIFQKGESPVDYDGGRTKSNIV  258



>gb|ABN09749.1| Ribonuclease T2; Thioredoxin domain 2; Thioredoxin fold [Medicago 
truncatula]
 gb|AES64381.2| T2 family ribonuclease [Medicago truncatula]
Length=349

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +3

Query  165  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  344
            A+YG S+ VLQL P NF SKVLNSN VVLVEFFAP CGHC+ LTP +EK A+VLKGV TV
Sbjct  22   AIYGSSSTVLQLTPDNFNSKVLNSNEVVLVEFFAPRCGHCEVLTPIWEKAATVLKGVVTV  81

Query  345  aaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQI  500
            AALDADAH SLA EYGI+GFPTIK F PGK PVDYQGAR+ K++ +F   Q+
Sbjct  82   AALDADAHKSLAHEYGIRGFPTIKAFSPGKPPVDYQGARDLKAITEFAIQQV  133



>ref|XP_003594130.1| Protein disulfide-isomerase A6 [Medicago truncatula]
Length=379

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +3

Query  165  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  344
            A+YG S+ VLQL P NF SKVLNSN VVLVEFFAP CGHC+ LTP +EK A+VLKGV TV
Sbjct  22   AIYGSSSTVLQLTPDNFNSKVLNSNEVVLVEFFAPRCGHCEVLTPIWEKAATVLKGVVTV  81

Query  345  aaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQI  500
            AALDADAH SLA EYGI+GFPTIK F PGK PVDYQGAR+ K++ +F   Q+
Sbjct  82   AALDADAHKSLAHEYGIRGFPTIKAFSPGKPPVDYQGARDLKAITEFAIQQV  133



>gb|ELK29163.1| Protein disulfide-isomerase A6 [Myotis davidii]
Length=525

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 81/162 (50%), Positives = 108/162 (67%), Gaps = 5/162 (3%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ SN +  VEFFAPWCGHC+ LTP ++KVA+ LKGV  
Sbjct  105  NGLYSSSDDVIELTPSNFNQEVIQSNSLWFVEFFAPWCGHCQRLTPEWKKVATALKGVVK  164

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R A ++VD     +R L+KD
Sbjct  165  VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTADAIVDAALGALRQLVKD  224

Query  519  RLDGKA-TGGSSQKSEPSAS---VELNSRNFDDLVVKSKDLW  632
            RL G+  + G   +SE S+    +EL   NFD  V+ S+D+W
Sbjct  225  RLGGRGYSSGRQGRSESSSKKDVIELTDDNFDKNVLDSEDVW  266


 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   NF   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  247  VIELTDDNFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  306

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A A+  L   YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  307  ATANQMLTGRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  347



>ref|XP_006765261.1| PREDICTED: protein disulfide-isomerase A6 [Myotis davidii]
Length=539

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 81/162 (50%), Positives = 108/162 (67%), Gaps = 5/162 (3%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ SN +  VEFFAPWCGHC+ LTP ++KVA+ LKGV  
Sbjct  119  NGLYSSSDDVIELTPSNFNQEVIQSNSLWFVEFFAPWCGHCQRLTPEWKKVATALKGVVK  178

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R A ++VD     +R L+KD
Sbjct  179  VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTADAIVDAALGALRQLVKD  238

Query  519  RLDGKA-TGGSSQKSEPSAS---VELNSRNFDDLVVKSKDLW  632
            RL G+  + G   +SE S+    +EL   NFD  V+ S+D+W
Sbjct  239  RLGGRGYSSGRQGRSESSSKKDVIELTDDNFDKNVLDSEDVW  280


 Score = 89.4 bits (220),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   NF   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  261  VIELTDDNFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  320

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A A+  L   YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  321  ATANQMLTGRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  361



>ref|XP_006102414.1| PREDICTED: protein disulfide-isomerase A6 [Myotis lucifugus]
Length=503

 Score =   145 bits (367),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 81/162 (50%), Positives = 109/162 (67%), Gaps = 5/162 (3%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ SN +  VEFFAPWCGHC+ LTP ++KVA+ LKGV  
Sbjct  83   NGLYSSSDDVIELTPSNFNQEVIQSNSLWFVEFFAPWCGHCQRLTPEWKKVATALKGVVK  142

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R A ++VD   + +R L+KD
Sbjct  143  VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTADAIVDAALSALRQLVKD  202

Query  519  RLDGKA-TGGSSQKSEPSAS---VELNSRNFDDLVVKSKDLW  632
            RL G+  + G   +SE S+    +EL   NFD  V+ S+D+W
Sbjct  203  RLGGRGYSSGRQGRSESSSKKDVIELTDDNFDKNVLDSEDVW  244


 Score = 89.0 bits (219),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   NF   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  225  VIELTDDNFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  284

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A A+  L   YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  285  ATANQMLTGRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  325



>gb|EPQ08422.1| Protein disulfide-isomerase A6 [Myotis brandtii]
Length=460

 Score =   145 bits (366),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 109/162 (67%), Gaps = 5/162 (3%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ SN +  VEFFAPWCGHC+ LTP ++KVA+ LKGV  
Sbjct  40   NGLYSSSDDVIELTPSNFNQEVIQSNSLWFVEFFAPWCGHCQRLTPEWKKVATALKGVVK  99

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R A ++VD   + +R L+KD
Sbjct  100  VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTADAIVDAALSALRQLIKD  159

Query  519  RLDGKA-TGGSSQKSEPSAS---VELNSRNFDDLVVKSKDLW  632
            RL G+  + G   +SE S+    +EL   +FD  V+ S+D+W
Sbjct  160  RLGGRGYSSGRQGRSESSSKKDVIELTDDSFDKNVLDSEDVW  201


 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   +F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  182  VIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  241

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A A+  L   YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  242  ATANQMLTGRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  282



>ref|XP_005867329.1| PREDICTED: protein disulfide-isomerase A6 [Myotis brandtii]
Length=471

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 109/162 (67%), Gaps = 5/162 (3%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ SN +  VEFFAPWCGHC+ LTP ++KVA+ LKGV  
Sbjct  51   NGLYSSSDDVIELTPSNFNQEVIQSNSLWFVEFFAPWCGHCQRLTPEWKKVATALKGVVK  110

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R A ++VD   + +R L+KD
Sbjct  111  VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTADAIVDAALSALRQLIKD  170

Query  519  RLDGKA-TGGSSQKSEPSAS---VELNSRNFDDLVVKSKDLW  632
            RL G+  + G   +SE S+    +EL   +FD  V+ S+D+W
Sbjct  171  RLGGRGYSSGRQGRSESSSKKDVIELTDDSFDKNVLDSEDVW  212


 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   +F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  193  VIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  252

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A A+  L   YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  253  ATANQMLTGRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  293



>ref|XP_011160406.1| PREDICTED: protein disulfide-isomerase A6 [Solenopsis invicta]
 gb|EFZ17811.1| hypothetical protein SINV_06451, partial [Solenopsis invicta]
Length=439

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 102/157 (65%), Gaps = 0/157 (0%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N +Y  ++ V+ L P+NF + VLNS+ + +VEF+APWCGHC+ LTP Y+K A+ LKGV  
Sbjct  26   NCMYASNSAVVDLRPNNFDNLVLNSDHIWIVEFYAPWCGHCQQLTPEYDKAATALKGVVK  85

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            V A++AD H SL  +YG++GFPTIK+F   K+P DY G R A  +VD         ++  
Sbjct  86   VGAVNADEHKSLGSKYGVRGFPTIKIFGLDKKPEDYNGPRSAAGIVDAALNAASQKVRKV  145

Query  522  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            L GK +GG S+  +P   +EL   NFD  V+ S+D+W
Sbjct  146  LGGKTSGGESKSKDPKDVIELTDENFDKNVLNSEDMW  182


 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 63/104 (61%), Gaps = 4/104 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadah  368
            V++L   NF   VLNS  + LVEF+APWCGHCK L P +   A+ LKG   + ALDA  +
Sbjct  163  VIELTDENFDKNVLNSEDMWLVEFYAPWCGHCKNLAPEWAAAATELKGKVKLGALDATVN  222

Query  369  sslaQEYGIKGFPTIKVFVPGKQPV----DYQGAREAKSMVDFV  488
            +    +Y IKG+PTIK F PGK+      DY G R +  +V++ 
Sbjct  223  TLKTSKYEIKGYPTIKFFAPGKKDADSVQDYDGGRTSGDIVNWA  266



>ref|XP_007529904.1| PREDICTED: protein disulfide-isomerase A6 [Erinaceus europaeus]
Length=440

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 107/164 (65%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ SN + LVEF+APWCGHC+ LTP ++K AS LKGV  
Sbjct  18   NGLYSSSDDVIELTPSNFNQEVIQSNSLWLVEFYAPWCGHCQRLTPEWKKAASALKGVVK  77

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A++AD H SL  +YG++GFPTIK+F   K +  DYQG R ++++VD     +R L+KD
Sbjct  78   VGAVNADKHQSLGGQYGVQGFPTIKIFGSNKNRAEDYQGGRTSEAIVDAALTALRQLVKD  137

Query  519  RLDGKATGGSSQKSEPSAS------VELNSRNFDDLVVKSKDLW  632
            RL G+  G SS K   S S      +EL   NFD  V+ S+D+W
Sbjct  138  RLAGRDGGYSSGKQGRSESSSKKDVIELTDDNFDTNVLDSEDVW  181


 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 64/101 (63%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   NF + VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  162  VIELTDDNFDTNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKDQTKGKVKLAAVD  221

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  LA  YGI+GFPTIK+F  G+ P+DY G R    +V
Sbjct  222  ATVNQVLASRYGIRGFPTIKIFQKGESPMDYDGGRTKSDIV  262



>ref|XP_007243763.1| PREDICTED: protein disulfide-isomerase A6-like, partial [Astyanax 
mexicanus]
Length=205

 Score =   137 bits (346),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 78/170 (46%), Positives = 110/170 (65%), Gaps = 14/170 (8%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            + LY  S  V++LNPSNF  +VL S+ + LVEF+APWCGHC++L P ++K AS LKGV  
Sbjct  23   HGLYSASDDVIELNPSNFNREVLQSDSLWLVEFYAPWCGHCQSLVPEWKKAASALKGVVK  82

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            + A+DAD H+SL  +YG++GFPTIK+F   K +P +YQG R ++++VD     +R+++KD
Sbjct  83   IGAVDADQHNSLGGQYGVRGFPTIKIFGANKNKPEEYQGGRSSQAIVDTALNALRSIVKD  142

Query  519  RLDGKATGGSSQKSEPSAS------------VELNSRNFDDLVVKSKDLW  632
            RL GK TGGS    + S              +EL   NFD+ V  S D+W
Sbjct  143  RLSGK-TGGSDYSRQSSGGGGGSSGGSKQDVIELTDDNFDEKVFGSDDVW  191


 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCK  287
            V++L   NF  KV  S+ V +VEFFAPWCGHCK
Sbjct  172  VIELTDDNFDEKVFGSDDVWMVEFFAPWCGHCK  204



>ref|XP_005803193.1| PREDICTED: protein disulfide-isomerase A6-like isoform X1 [Xiphophorus 
maculatus]
Length=440

 Score =   143 bits (360),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 108/162 (67%), Gaps = 6/162 (4%)
 Frame = +3

Query  165  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  344
            A+Y  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC++L P ++K A+ LKG+  V
Sbjct  19   AMYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQSLAPEWKKAATALKGIVKV  78

Query  345  aaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
             A+DAD H SL  +YG++GFPTIKVF   K +P +YQG R ++++VD     +R L+K+R
Sbjct  79   GAVDADQHKSLGGQYGVRGFPTIKVFGANKNKPEEYQGGRSSQAIVDGAMNALRALVKER  138

Query  522  LDGKATGGSSQKSEPSAS-----VELNSRNFDDLVVKSKDLW  632
            L GK+ G S  K + S       VEL   NFD+ V+ S D+W
Sbjct  139  LSGKSGGSSYNKQQSSGGSKKDVVELTDDNFDETVLNSDDVW  180


 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 66/107 (62%), Gaps = 4/107 (4%)
 Frame = +3

Query  174  GPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVAT  341
            G    V++L   NF   VLNS+ V LVEFFAPWCGHCK L P +   A+ +    KG   
Sbjct  156  GSKKDVVELTDDNFDETVLNSDDVWLVEFFAPWCGHCKNLEPEWAAAATAVKEQTKGKVR  215

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVD  482
            + A+DA  H  ++  YG++GFP+IK+F  G++P DYQG R    +++
Sbjct  216  LGAVDATVHQVVSSRYGVRGFPSIKIFRKGEEPEDYQGGRTRGDIIE  262



>ref|XP_003488434.1| PREDICTED: protein disulfide-isomerase A6-like [Bombus impatiens]
Length=428

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 100/157 (64%), Gaps = 0/157 (0%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            + LY  ++ V++L P+NF S VLNS+ V +VEFFAPWCGHC+ LTP Y+K A+ LKG+  
Sbjct  15   HCLYSSNSDVIELKPNNFDSLVLNSDNVWIVEFFAPWCGHCQQLTPEYDKAATALKGIVK  74

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            V A++AD H SL   YGI+GFPTIK+F    +P DY G R A  +VD          +  
Sbjct  75   VGAVNADEHKSLGSRYGIQGFPTIKIFGTDNKPEDYNGPRTATGIVDAALNAASQKARRA  134

Query  522  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            L GK +GG S+  +    +EL   NFD +V+ S+D+W
Sbjct  135  LGGKRSGGDSKSKDSKDVIELTDDNFDKMVMNSEDMW  171


 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 64/106 (60%), Gaps = 4/106 (4%)
 Frame = +3

Query  180  STPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaalda  359
            S  V++L   NF   V+NS  + LVEF+APWCGHCK L P +   A+ LKG   + A+DA
Sbjct  149  SKDVIELTDDNFDKMVMNSEDMWLVEFYAPWCGHCKNLAPIWASAATELKGKVKLGAIDA  208

Query  360  dahsslaQEYGIKGFPTIKVFVPGKQPVD----YQGAREAKSMVDF  485
              +   A +Y IKG+PTIK F PGK+  D    Y G R +  +V++
Sbjct  209  TVNRVKASQYEIKGYPTIKYFAPGKKSFDSVQEYDGGRTSSDIVNW  254



>ref|XP_007257385.1| PREDICTED: protein disulfide-isomerase A6 [Astyanax mexicanus]
Length=441

 Score =   142 bits (359),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 77/167 (46%), Positives = 108/167 (65%), Gaps = 11/167 (7%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            +  Y  S  V++LNPSNF  +VL S+ + L+EF+APWCGHC+ LTP ++K A+ LKG+  
Sbjct  17   HGFYTASDDVIELNPSNFNKQVLQSDSLWLIEFYAPWCGHCQRLTPDWKKAATALKGIVK  76

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            + A+DAD H SL  +YGI+GFPTIKVF   K +P DYQG R ++++V+     +R+L+KD
Sbjct  77   IGAVDADQHKSLGSQYGIRGFPTIKVFGANKNKPDDYQGGRTSEAIVEGAMTALRSLVKD  136

Query  519  RLDGKATGGSSQKSEPSAS---------VELNSRNFDDLVVKSKDLW  632
            RL G+ TGGS Q  +             VEL   NFD LV+   ++W
Sbjct  137  RLSGR-TGGSGQSKQSGGGSGAGDKKDVVELTDDNFDRLVLNGDEVW  182


 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 64/106 (60%), Gaps = 4/106 (4%)
 Frame = +3

Query  174  GPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVAT  341
            G    V++L   NF   VLN + V +VEFFAPWCGHCK L P +   A+ +    KG   
Sbjct  158  GDKKDVVELTDDNFDRLVLNGDEVWMVEFFAPWCGHCKRLEPEWTAAATAVKDQTKGKVK  217

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            + A+DA  H  LA  YGI+GFPTIK+F  G++P DY+G R    +V
Sbjct  218  LGAVDATVHQGLASRYGIRGFPTIKIFSKGEEPEDYEGGRTRADIV  263



>ref|XP_005803194.1| PREDICTED: protein disulfide-isomerase A6-like isoform X2 [Xiphophorus 
maculatus]
Length=439

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 107/161 (66%), Gaps = 5/161 (3%)
 Frame = +3

Query  165  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  344
            A+Y  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC++L P ++K A+ LKG+  V
Sbjct  19   AMYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQSLAPEWKKAATALKGIVKV  78

Query  345  aaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
             A+DAD H SL  +YG++GFPTIKVF   K +P +YQG R ++++VD     +R L+K+R
Sbjct  79   GAVDADQHKSLGGQYGVRGFPTIKVFGANKNKPEEYQGGRSSQAIVDGAMNALRALVKER  138

Query  522  LDGKATGGSSQKSEPSAS----VELNSRNFDDLVVKSKDLW  632
            L GK+ G S  K     S    VEL   NFD+ V+ S D+W
Sbjct  139  LSGKSGGSSYNKQSSGGSKKDVVELTDDNFDETVLNSDDVW  179


 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 66/107 (62%), Gaps = 4/107 (4%)
 Frame = +3

Query  174  GPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVAT  341
            G    V++L   NF   VLNS+ V LVEFFAPWCGHCK L P +   A+ +    KG   
Sbjct  155  GSKKDVVELTDDNFDETVLNSDDVWLVEFFAPWCGHCKNLEPEWAAAATAVKEQTKGKVR  214

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVD  482
            + A+DA  H  ++  YG++GFP+IK+F  G++P DYQG R    +++
Sbjct  215  LGAVDATVHQVVSSRYGVRGFPSIKIFRKGEEPEDYQGGRTRGDIIE  261



>ref|XP_003398403.1| PREDICTED: protein disulfide-isomerase A6-like [Bombus terrestris]
Length=428

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 100/157 (64%), Gaps = 0/157 (0%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            + LY  ++ V++L P+NF S VLNS+ V +VEFFAPWCGHC+ LTP Y+K A+ LKG+  
Sbjct  15   HCLYSSNSDVIELKPNNFDSLVLNSDNVWIVEFFAPWCGHCQQLTPEYDKAATALKGIVK  74

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            V A++AD H SL   YGI+GFPTIK+F    +P DY G R A  +VD          +  
Sbjct  75   VGAVNADEHKSLGSRYGIQGFPTIKIFGTDNKPEDYNGPRTATGIVDAALNAASQKARRA  134

Query  522  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            L GK +GG S+  +    +EL   NFD +V+ S+D+W
Sbjct  135  LGGKRSGGDSKSKDSKDVIELTDDNFDKIVMNSEDMW  171


 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 64/106 (60%), Gaps = 4/106 (4%)
 Frame = +3

Query  180  STPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaalda  359
            S  V++L   NF   V+NS  + LVEF+APWCGHCK L P +   A+ LKG   + A+DA
Sbjct  149  SKDVIELTDDNFDKIVMNSEDMWLVEFYAPWCGHCKNLAPIWASAATELKGKVKLGAIDA  208

Query  360  dahsslaQEYGIKGFPTIKVFVPGKQPVD----YQGAREAKSMVDF  485
              +   A +Y IKG+PTIK F PGK+  D    Y G R +  +V++
Sbjct  209  TVNRVKASQYEIKGYPTIKYFAPGKKSSDSVQEYDGGRTSSDIVNW  254



>ref|XP_008287318.1| PREDICTED: protein disulfide-isomerase A6 [Stegastes partitus]
Length=442

 Score =   142 bits (358),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 109/166 (66%), Gaps = 10/166 (6%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
             ALY     V++LNPSNF  +V+ S+ + LVEF+APWCGHC++LTP ++K A+ LKGV  
Sbjct  18   QALYSSGDDVVELNPSNFNREVIQSDSLWLVEFYAPWCGHCQSLTPEWKKAATALKGVVK  77

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG+KGFPTIK+F   K +P  YQG R ++++VD     +R+L+KD
Sbjct  78   VGAVDADQHKSLGGQYGVKGFPTIKIFGGNKNKPEAYQGGRSSQAIVDAAMNALRSLVKD  137

Query  519  RLDGKATGGSSQKSEPSAS--------VELNSRNFDDLVVKSKDLW  632
            RL GK +GGSS   +            VEL   NFD +V+ S D+W
Sbjct  138  RLSGK-SGGSSYNQQSGGGGGGSKKDVVELTDDNFDRMVLDSDDVW  182


 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 65/102 (64%), Gaps = 4/102 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   NF   VL+S+ V LVEFFAPWCGHCK L P +   A+ +    KG   + A+D
Sbjct  163  VVELTDDNFDRMVLDSDDVWLVEFFAPWCGHCKNLEPEWAAAATAVKEQTKGRVRLGAVD  222

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVD  482
            A  H  ++  YGI+GFPTIKVF  G++P DYQG R    +++
Sbjct  223  ATVHQVVSSRYGIRGFPTIKVFKKGEEPEDYQGGRSRGDIIE  264



>ref|XP_007546385.1| PREDICTED: protein disulfide-isomerase A6 isoform X1 [Poecilia 
formosa]
Length=440

 Score =   142 bits (358),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 107/162 (66%), Gaps = 6/162 (4%)
 Frame = +3

Query  165  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  344
            A+Y  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ L P ++K A+ LKG+  V
Sbjct  19   AMYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQNLAPEWKKAATALKGIVKV  78

Query  345  aaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
             A+DAD H SL  +YG++GFPTIKVF   K +P +YQG R ++++VD     +R L+K+R
Sbjct  79   GAVDADQHKSLGGQYGVRGFPTIKVFGANKNKPEEYQGGRSSQAIVDGAMNALRTLVKER  138

Query  522  LDGKATGGSSQKSEPSAS-----VELNSRNFDDLVVKSKDLW  632
            L GK+ G S  K + S       VEL   NFD+ V+ S D+W
Sbjct  139  LSGKSGGSSYNKQQSSGGSKKDVVELTDDNFDETVLNSDDVW  180


 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 66/107 (62%), Gaps = 4/107 (4%)
 Frame = +3

Query  174  GPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVAT  341
            G    V++L   NF   VLNS+ V LVEFFAPWCGHCK L P +   A+ +    KG   
Sbjct  156  GSKKDVVELTDDNFDETVLNSDDVWLVEFFAPWCGHCKNLEPEWAAAATAVKEQTKGKVR  215

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVD  482
            + A+DA  H  ++  YGI+GFPTIKVF  G++P DYQG R    +++
Sbjct  216  LGAVDATVHQVVSSRYGIRGFPTIKVFRKGEEPEDYQGGRTRGDIIE  262



>ref|XP_008160636.1| PREDICTED: protein disulfide-isomerase A6 [Eptesicus fuscus]
Length=438

 Score =   142 bits (357),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 79/162 (49%), Positives = 108/162 (67%), Gaps = 5/162 (3%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            + LY     V++L PSNF  +V+ SN + LVEFFAPWCGHC+ LTP ++KVA+ LKGV  
Sbjct  18   SGLYSSGDDVIELTPSNFNQEVIQSNSLWLVEFFAPWCGHCQRLTPEWKKVATALKGVVR  77

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R A ++VD     +R L+KD
Sbjct  78   VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTADAIVDAALGALRQLVKD  137

Query  519  RLDGKA-TGGSSQKSEPSAS---VELNSRNFDDLVVKSKDLW  632
            RL G+  + G   +SE S+    +EL   +FD  V+ S+D+W
Sbjct  138  RLGGRGYSSGRQGRSESSSKKDVIELTDDSFDKNVLDSEDVW  179


 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   +F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  160  VIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  219

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A A+  L   YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  220  ATANQMLTGRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  260



>ref|XP_008528120.1| PREDICTED: protein disulfide-isomerase A6 [Equus przewalskii]
Length=482

 Score =   142 bits (358),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 79/165 (48%), Positives = 111/165 (67%), Gaps = 8/165 (5%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++KVA+ LK V  
Sbjct  59   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKVATALKDVVK  118

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  119  VGAVDADKHQSLGGQYGVQGFPTIKIFGANKNRPEDYQGGRSGEAIVDAALSALRQLVKD  178

Query  519  RLDGKATGGSSQ----KSEPSAS---VELNSRNFDDLVVKSKDLW  632
            RL G++ GG S     +SE S+    +EL   +FD  V+ S+D+W
Sbjct  179  RLGGRSHGGYSSGKQGRSESSSKKDVIELTDDSFDKNVLDSEDVW  223


 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   +F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  204  VIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  263

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    ++
Sbjct  264  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDII  304



>ref|XP_007546392.1| PREDICTED: protein disulfide-isomerase A6 isoform X2 [Poecilia 
formosa]
Length=439

 Score =   142 bits (357),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 106/161 (66%), Gaps = 5/161 (3%)
 Frame = +3

Query  165  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  344
            A+Y  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ L P ++K A+ LKG+  V
Sbjct  19   AMYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQNLAPEWKKAATALKGIVKV  78

Query  345  aaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
             A+DAD H SL  +YG++GFPTIKVF   K +P +YQG R ++++VD     +R L+K+R
Sbjct  79   GAVDADQHKSLGGQYGVRGFPTIKVFGANKNKPEEYQGGRSSQAIVDGAMNALRTLVKER  138

Query  522  LDGKATGGSSQKSEPSAS----VELNSRNFDDLVVKSKDLW  632
            L GK+ G S  K     S    VEL   NFD+ V+ S D+W
Sbjct  139  LSGKSGGSSYNKQSSGGSKKDVVELTDDNFDETVLNSDDVW  179


 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 66/107 (62%), Gaps = 4/107 (4%)
 Frame = +3

Query  174  GPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVAT  341
            G    V++L   NF   VLNS+ V LVEFFAPWCGHCK L P +   A+ +    KG   
Sbjct  155  GSKKDVVELTDDNFDETVLNSDDVWLVEFFAPWCGHCKNLEPEWAAAATAVKEQTKGKVR  214

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVD  482
            + A+DA  H  ++  YGI+GFPTIKVF  G++P DYQG R    +++
Sbjct  215  LGAVDATVHQVVSSRYGIRGFPTIKVFRKGEEPEDYQGGRTRGDIIE  261



>ref|XP_006903376.1| PREDICTED: protein disulfide-isomerase A6-like [Elephantulus 
edwardii]
Length=508

 Score =   142 bits (358),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 78/163 (48%), Positives = 109/163 (67%), Gaps = 6/163 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ S+ + L+EF+APWCGHC+ LTP ++KVA+ LKG   
Sbjct  87   NGLYSSSDDVIELTPSNFNREVIQSDSLWLIEFYAPWCGHCQRLTPEWKKVATALKGTVK  146

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R A+++VD   + +R L+KD
Sbjct  147  VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTAEAIVDSAVSAVRQLVKD  206

Query  519  RLDGKA--TGGSSQKSEPSAS---VELNSRNFDDLVVKSKDLW  632
            RL GK+  + G   +SE S+    +EL    FD  V+ S D+W
Sbjct  207  RLGGKSGYSSGKQGRSESSSKKDVIELTDDTFDKNVLDSDDVW  249


 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 66/101 (65%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L    F   VL+S+ V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  230  VIELTDDTFDKNVLDSDDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  289

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A A+  L+Q YGI+GFPTIK+F  G+ PVDY G R   ++V
Sbjct  290  ATANQLLSQRYGIRGFPTIKIFQKGESPVDYDGGRTKSNIV  330



>ref|NP_922915.2| protein disulfide-isomerase A6 precursor [Danio rerio]
 gb|AAH44507.1| Protein disulfide isomerase-related protein (provisional) [Danio 
rerio]
 gb|AAI65811.1| Pdip5 protein [Danio rerio]
Length=440

 Score =   141 bits (356),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 82/164 (50%), Positives = 112/164 (68%), Gaps = 9/164 (5%)
 Frame = +3

Query  165  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  344
             LY  S  V++LNPSNF  +V+ S+ + LVEF+APWCGHCK+L P ++K A+ LKG+  V
Sbjct  19   GLYTSSDDVVELNPSNFNREVIQSDSLWLVEFYAPWCGHCKSLAPEWKKAATALKGIVKV  78

Query  345  aaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
             A+DAD H+SL  +YG++GFPTIK+F   K +P DYQG R  +++VD     +R+L+KDR
Sbjct  79   GAVDADQHNSLGGQYGVRGFPTIKIFGGNKHKPEDYQGGRTNQAIVDAALNALRSLVKDR  138

Query  522  LDGKATGGS--SQKSEPSAS-----VELNSRNFDDLVVKSKDLW  632
            L GK TGGS  S++S   A      VEL   NFD  V++S D+W
Sbjct  139  LGGK-TGGSDYSRQSGGGAGNKKDVVELTDDNFDRTVLESDDVW  181


 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 64/106 (60%), Gaps = 4/106 (4%)
 Frame = +3

Query  174  GPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVAT  341
            G    V++L   NF   VL S+ V LVEFFAPWCGHCK L P +   A+ +    KG   
Sbjct  157  GNKKDVVELTDDNFDRTVLESDDVWLVEFFAPWCGHCKNLEPEWTAAATEVKEQTKGKVR  216

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            +AA DA  H  LA  +GI+GFPTIKVF  G++P DYQG R    +V
Sbjct  217  LAAEDATVHQGLASRFGIRGFPTIKVFRKGEEPEDYQGGRTRSDIV  262



>gb|AAK71636.1|AF387900_1 protein disulfide isomerase-related protein P5 precursor [Danio 
rerio]
Length=440

 Score =   141 bits (356),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 82/164 (50%), Positives = 112/164 (68%), Gaps = 9/164 (5%)
 Frame = +3

Query  165  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  344
             LY  S  V++LNPSNF  +V+ S+ + LVEF+APWCGHCK+L P ++K A+ LKG+  V
Sbjct  19   GLYTSSDDVVELNPSNFNREVIQSDSLWLVEFYAPWCGHCKSLAPEWKKAATALKGIVKV  78

Query  345  aaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
             A+DAD H+SL  +YG++GFPTIK+F   K +P DYQG R  +++VD     +R+L+KDR
Sbjct  79   GAVDADQHNSLGGQYGVRGFPTIKIFGGNKHKPEDYQGGRTNQAIVDAALNALRSLVKDR  138

Query  522  LDGKATGGS--SQKSEPSAS-----VELNSRNFDDLVVKSKDLW  632
            L GK TGGS  S++S   A      VEL   NFD  V++S D+W
Sbjct  139  LGGK-TGGSDYSRQSGGGAGNKKDVVELTDDNFDRTVLESDDVW  181


 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 65/106 (61%), Gaps = 4/106 (4%)
 Frame = +3

Query  174  GPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVAT  341
            G    V++L   NF   VL S+ V LVEFFAPWCGHCK L P +   A+ +    KG   
Sbjct  157  GNKKDVVELTDDNFDRTVLESDDVWLVEFFAPWCGHCKNLEPEWTAAATEVKEQTKGKVK  216

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            +AA+DA  H  LA  +GI+GFPTIKVF  G++P DYQG R    +V
Sbjct  217  LAAVDATVHQGLASRFGIRGFPTIKVFRKGEEPEDYQGGRTRSDIV  262



>ref|XP_011689873.1| PREDICTED: protein disulfide-isomerase A6 [Wasmannia auropunctata]
Length=439

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 101/155 (65%), Gaps = 0/155 (0%)
 Frame = +3

Query  168  LYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVa  347
            LY  ++ V+ L P+NF + VLNS+ + +VEF+APWCGHC+ LTP Y+K A+ LKGV  V 
Sbjct  28   LYSSNSAVVDLRPNNFDNLVLNSDHIWIVEFYAPWCGHCQQLTPEYDKAATALKGVVKVG  87

Query  348  aldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRLD  527
            A++AD H SL  +YG++GFPTIK+F   K+P DY G R A  +VD         ++  L 
Sbjct  88   AVNADEHKSLGSKYGVRGFPTIKIFGLDKKPEDYNGPRSAAGIVDAALNAASQKVRKALG  147

Query  528  GKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            GKA+GG S+  +    +EL   NFD  V+ S+D+W
Sbjct  148  GKASGGESKSKDSKDVIELTDENFDKSVLNSEDMW  182


 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 66/107 (62%), Gaps = 4/107 (4%)
 Frame = +3

Query  180  STPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaalda  359
            S  V++L   NF   VLNS  + LVEF+APWCGHCK L P +   AS LKG   + ALDA
Sbjct  160  SKDVIELTDENFDKSVLNSEDMWLVEFYAPWCGHCKNLAPEWAAAASELKGKVKLGALDA  219

Query  360  dahsslaQEYGIKGFPTIKVFVPGKQPV----DYQGAREAKSMVDFV  488
              ++  A +Y IKG+PTIK F PGK+ V    DY G R +  +V++ 
Sbjct  220  TVNTLKASKYEIKGYPTIKFFAPGKKDVDSVQDYDGGRTSGDIVNWA  266



>ref|XP_011062424.1| PREDICTED: protein disulfide-isomerase A6 [Acromyrmex echinatior]
 gb|EGI60656.1| Protein disulfide-isomerase A6 [Acromyrmex echinatior]
Length=439

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 101/157 (64%), Gaps = 0/157 (0%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N +Y  ++ V+ L P+NF + VLNS+ + +VEF+APWCGHC+ LTP Y+K A+ LKGV  
Sbjct  26   NCMYASNSAVVDLRPNNFDNLVLNSDHIWVVEFYAPWCGHCQQLTPEYDKAATALKGVVK  85

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            V A++AD H SL  +YG++GFPTIK+F   K+P DY G R A  +VD         ++  
Sbjct  86   VGAVNADEHKSLGSKYGVRGFPTIKIFGLDKKPEDYNGPRSAAGIVDAALNAASQKVRKV  145

Query  522  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            L GK +GG S+  +    +EL   NFD  V+ S+D+W
Sbjct  146  LGGKTSGGESKSKDSKDVIELTDENFDKTVLNSEDMW  182


 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 65/107 (61%), Gaps = 4/107 (4%)
 Frame = +3

Query  180  STPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaalda  359
            S  V++L   NF   VLNS  + LVEF+APWCGHCK L P +   A+ LKG   + ALDA
Sbjct  160  SKDVIELTDENFDKTVLNSEDMWLVEFYAPWCGHCKNLAPEWATAATELKGKVKLGALDA  219

Query  360  dahsslaQEYGIKGFPTIKVFVPGKQPV----DYQGAREAKSMVDFV  488
              ++  A +Y IKG+PTIK F PGK+      DY G R +  +V++ 
Sbjct  220  TVNTLKASKYEIKGYPTIKFFAPGKKDADSMQDYDGGRTSGDIVNWA  266



>ref|XP_012055150.1| PREDICTED: protein disulfide-isomerase A6 [Atta cephalotes]
Length=439

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 101/157 (64%), Gaps = 0/157 (0%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N +Y  ++ V+ L P+NF + VLNS+ + +VEF+APWCGHC+ LTP Y+K A+ LKG+  
Sbjct  26   NCMYASNSAVVDLRPNNFDNLVLNSDHIWVVEFYAPWCGHCQQLTPEYDKAATALKGIVK  85

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            V A++AD H SL  +YG++GFPTIK+F   K+P DY G R A  +VD         ++  
Sbjct  86   VGAVNADEHKSLGSKYGVRGFPTIKIFGLDKKPEDYNGPRSAAGIVDAALNAANQKVRKV  145

Query  522  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            L GK +GG S+  +    +EL   NFD  V+ S+D+W
Sbjct  146  LGGKTSGGESKSKDSKDVIELTDENFDKTVLNSEDMW  182


 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 65/107 (61%), Gaps = 4/107 (4%)
 Frame = +3

Query  180  STPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaalda  359
            S  V++L   NF   VLNS  + LVEF+APWCGHCK L P +   A+ LKG   + ALDA
Sbjct  160  SKDVIELTDENFDKTVLNSEDMWLVEFYAPWCGHCKNLAPEWATAATELKGKIKLGALDA  219

Query  360  dahsslaQEYGIKGFPTIKVFVPGKQPV----DYQGAREAKSMVDFV  488
              ++  A +Y IKG+PTIK F PGK+      DY G R +  +V++ 
Sbjct  220  TVNTLKASKYEIKGYPTIKFFAPGKKDADSMQDYDGGRTSGDIVNWA  266



>gb|EFN84761.1| Protein disulfide-isomerase A6 [Harpegnathos saltator]
Length=420

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 101/157 (64%), Gaps = 0/157 (0%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N +Y  ++ V+ L P+NF + VLNS+ + +VEF+APWCGHC+ L P Y+K A+ LKGVA 
Sbjct  15   NCMYAANSAVIDLRPNNFDNLVLNSDHIWVVEFYAPWCGHCQQLMPEYDKAATALKGVAK  74

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            V A++AD H SL  +YG++GFPTIK+F    +P DY G R A  +VD     +   ++  
Sbjct  75   VGAVNADEHKSLGAKYGVRGFPTIKIFGLDSKPEDYNGQRTAAGIVDAALNAVSQKVRRT  134

Query  522  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            L GK TGG S+       +EL   NF+ +V+ S+D+W
Sbjct  135  LGGKKTGGDSKSKSSKDVIELTDENFEKMVLNSEDMW  171


 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 65/107 (61%), Gaps = 4/107 (4%)
 Frame = +3

Query  180  STPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaalda  359
            S  V++L   NF+  VLNS  + LVEF+APWCGHCK L P +   A+ LKG   + ALDA
Sbjct  149  SKDVIELTDENFEKMVLNSEDMWLVEFYAPWCGHCKNLAPEWATAATELKGKVKLGALDA  208

Query  360  dahsslaQEYGIKGFPTIKVFVPGKQPV----DYQGAREAKSMVDFV  488
              ++  A  Y IKG+PTIK F PGK+      DY G R +  +V++ 
Sbjct  209  TVNTLKASRYDIKGYPTIKYFSPGKKDADSVQDYDGGRTSGDIVNWA  255



>ref|XP_011139060.1| PREDICTED: protein disulfide-isomerase A6 isoform X1 [Harpegnathos 
saltator]
Length=438

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 101/157 (64%), Gaps = 0/157 (0%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N +Y  ++ V+ L P+NF + VLNS+ + +VEF+APWCGHC+ L P Y+K A+ LKGVA 
Sbjct  26   NCMYAANSAVIDLRPNNFDNLVLNSDHIWVVEFYAPWCGHCQQLMPEYDKAATALKGVAK  85

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            V A++AD H SL  +YG++GFPTIK+F    +P DY G R A  +VD     +   ++  
Sbjct  86   VGAVNADEHKSLGAKYGVRGFPTIKIFGLDSKPEDYNGQRTAAGIVDAALNAVSQKVRRT  145

Query  522  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            L GK TGG S+       +EL   NF+ +V+ S+D+W
Sbjct  146  LGGKKTGGDSKSKSSKDVIELTDENFEKMVLNSEDMW  182


 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 65/107 (61%), Gaps = 4/107 (4%)
 Frame = +3

Query  180  STPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaalda  359
            S  V++L   NF+  VLNS  + LVEF+APWCGHCK L P +   A+ LKG   + ALDA
Sbjct  160  SKDVIELTDENFEKMVLNSEDMWLVEFYAPWCGHCKNLAPEWATAATELKGKVKLGALDA  219

Query  360  dahsslaQEYGIKGFPTIKVFVPGKQPV----DYQGAREAKSMVDFV  488
              ++  A  Y IKG+PTIK F PGK+      DY G R +  +V++ 
Sbjct  220  TVNTLKASRYDIKGYPTIKYFSPGKKDADSVQDYDGGRTSGDIVNWA  266



>emb|CDJ95511.1| Thioredoxin domain containing protein [Haemonchus contortus]
Length=437

 Score =   140 bits (353),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 81/182 (45%), Positives = 110/182 (60%), Gaps = 4/182 (2%)
 Frame = +3

Query  99   MERSARFlplplllvtlittvNALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCG  278
            M RS+R L        L+ + +ALY     V++L  +NF+SKV+NS+ V +VEFFAPWCG
Sbjct  1    MSRSSRNLLTLFGAAFLLASCHALYSAKDDVVELTAANFRSKVINSDEVWVVEFFAPWCG  60

Query  279  HCKALTPTYEKVASVLKGVATVaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQG  455
            HCK L P Y+K A+ LKG+A V A+D   H SL   Y ++GFPTIK+F   K +P+DY G
Sbjct  61   HCKNLVPEYKKAATALKGIAKVGAVDMTVHESLGSTYRVQGFPTIKIFAANKDKPIDYNG  120

Query  456  AREAKSMVDFVKAQIRNLLKDRLDGKATGGSSQKSEPSAS---VELNSRNFDDLVVKSKD  626
            AR A+ +   V A+I+N +  RL+G   G     S        +EL   NF+ LV+ SKD
Sbjct  121  ARTAQGISSTVLAEIKNTVTSRLEGPGQGKGKDDSGSKGRGDVIELTDANFEKLVLNSKD  180

Query  627  LW  632
             W
Sbjct  181  PW  182


 Score = 94.0 bits (232),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 71/111 (64%), Gaps = 4/111 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadah  368
            V++L  +NF+  VLNS    LVEFFAPWCGHCK L P ++  AS LKG   + ALDA  H
Sbjct  163  VIELTDANFEKLVLNSKDPWLVEFFAPWCGHCKNLEPHWKAAASQLKGKVKLGALDATVH  222

Query  369  sslaQEYGIKGFPTIKVFVPG---KQPVDYQGAREAKSMVDFVKAQ-IRNL  509
            + ++ +YG++GFPTIK F PG      VDY G R    +V + +++ + NL
Sbjct  223  TLMSNKYGVRGFPTIKYFAPGSSDSDAVDYDGGRTTSDIVSWAESKAMENL  273



>ref|XP_010887778.1| PREDICTED: protein disulfide-isomerase A6 [Esox lucius]
Length=442

 Score =   139 bits (350),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 75/164 (46%), Positives = 106/164 (65%), Gaps = 8/164 (5%)
 Frame = +3

Query  165  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  344
              Y  S  V++LNPSNF  +VL S+ + L+EF+APWCGHC++LT  ++K A+ LKG+  V
Sbjct  19   GFYSASDDVVELNPSNFNREVLQSDSLWLIEFYAPWCGHCQSLTADWKKTATALKGIVKV  78

Query  345  aaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
             A+DAD H SL  +YG+KGFPTIK+F   K +P DYQGAR ++++VD     +R+L+KDR
Sbjct  79   GAVDADQHKSLGGQYGVKGFPTIKIFGANKNKPDDYQGARSSQAIVDGALNALRSLVKDR  138

Query  522  LDGKATGGSSQKSEPSAS-------VELNSRNFDDLVVKSKDLW  632
            + G++ G    +             VEL   NFD LV+ S D+W
Sbjct  139  MSGRSGGSDYNRQSGGGGGGSKKDVVELTDDNFDRLVLGSDDVW  182


 Score = 88.6 bits (218),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 44/101 (44%), Positives = 58/101 (57%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadah  368
            V++L   NF   VL S+ V LVEFFAPWCGHCK L P +   AS +K             
Sbjct  163  VVELTDDNFDRLVLGSDDVWLVEFFAPWCGHCKNLEPEWTAAASAVKEQTKDKVHLGAVD  222

Query  369  sslaQ----EYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            +++ Q     YGI+GFPTIK+F  G++P DYQG R    ++
Sbjct  223  ATVHQGLASRYGIRGFPTIKIFKKGEEPEDYQGGRTRSDII  263



>ref|XP_011139061.1| PREDICTED: protein disulfide-isomerase A6 isoform X2 [Harpegnathos 
saltator]
Length=411

 Score =   139 bits (349),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 100/155 (65%), Gaps = 0/155 (0%)
 Frame = +3

Query  168  LYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVa  347
            +Y  ++ V+ L P+NF + VLNS+ + +VEF+APWCGHC+ L P Y+K A+ LKGVA V 
Sbjct  1    MYAANSAVIDLRPNNFDNLVLNSDHIWVVEFYAPWCGHCQQLMPEYDKAATALKGVAKVG  60

Query  348  aldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRLD  527
            A++AD H SL  +YG++GFPTIK+F    +P DY G R A  +VD     +   ++  L 
Sbjct  61   AVNADEHKSLGAKYGVRGFPTIKIFGLDSKPEDYNGQRTAAGIVDAALNAVSQKVRRTLG  120

Query  528  GKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            GK TGG S+       +EL   NF+ +V+ S+D+W
Sbjct  121  GKKTGGDSKSKSSKDVIELTDENFEKMVLNSEDMW  155


 Score = 90.9 bits (224),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 65/107 (61%), Gaps = 4/107 (4%)
 Frame = +3

Query  180  STPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaalda  359
            S  V++L   NF+  VLNS  + LVEF+APWCGHCK L P +   A+ LKG   + ALDA
Sbjct  133  SKDVIELTDENFEKMVLNSEDMWLVEFYAPWCGHCKNLAPEWATAATELKGKVKLGALDA  192

Query  360  dahsslaQEYGIKGFPTIKVFVPGKQPV----DYQGAREAKSMVDFV  488
              ++  A  Y IKG+PTIK F PGK+      DY G R +  +V++ 
Sbjct  193  TVNTLKASRYDIKGYPTIKYFSPGKKDADSVQDYDGGRTSGDIVNWA  239



>gb|EGT53613.1| hypothetical protein CAEBREN_31752 [Caenorhabditis brenneri]
Length=433

 Score =   139 bits (349),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 98/156 (63%), Gaps = 1/156 (1%)
 Frame = +3

Query  165  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  344
            A Y PS  V++L  +NF SKVL S+ + +VEF+AP+CGHCK L P Y+K A +LKG+A V
Sbjct  18   AFYAPSDGVVELTDANFDSKVLKSDRIWIVEFYAPYCGHCKNLVPEYKKAAKLLKGIAAV  77

Query  345  aaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRL  524
             A+DA     +  EY IKG+PTIK+F  GK+ +DY G R AK + D VK  I   L +RL
Sbjct  78   GAIDATTQQGIPSEYSIKGYPTIKIFA-GKKSIDYNGPRTAKGIADAVKKAIGKTLDERL  136

Query  525  DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
             G  +  S++K +    V L   NF+ LV  SKD W
Sbjct  137  SGGKSEKSNKKGKGGDVVVLTDSNFEKLVFNSKDAW  172


 Score = 88.2 bits (217),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 69/116 (59%), Gaps = 4/116 (3%)
 Frame = +3

Query  174  GPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaal  353
            G    V+ L  SNF+  V NS    +VEF+APWCGHC+ L P +++ A  + G     AL
Sbjct  148  GKGGDVVVLTDSNFEKLVFNSKDAWMVEFYAPWCGHCQKLEPEWKRAAKEMGGKVKFGAL  207

Query  354  dadahsslaQEYGIKGFPTIKVFVPGKQPV----DYQGAREAKSMVDFVKAQIRNL  509
            DA AH S+A+++ I+GFPTIK F PG        DYQG R +  +V F +++  N+
Sbjct  208  DATAHESMARKFSIQGFPTIKFFAPGSSSASDAEDYQGGRTSSDLVSFAESKFENV  263



>ref|XP_011881632.1| PREDICTED: protein disulfide-isomerase A6 [Vollenhovia emeryi]
Length=439

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 101/157 (64%), Gaps = 0/157 (0%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N++Y  ++ V+ L P+NF + VLNS+ + +VEF+APWCGHC+ L P Y+K A+ LKGV  
Sbjct  26   NSMYASNSAVIDLRPNNFDNLVLNSDHIWVVEFYAPWCGHCQQLMPEYDKAATALKGVVK  85

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            V A++AD H SL  +YG++GFPTIK+F   K+P +Y G R A  +VD         ++  
Sbjct  86   VGAVNADEHKSLGGKYGVRGFPTIKIFGLDKKPEEYNGPRSAAGIVDAALNAASQKVRKS  145

Query  522  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            L GK +GG S+  +    +EL   NFD  V+ S+D+W
Sbjct  146  LGGKTSGGESKSKDSKDVIELTDENFDKTVLNSEDMW  182


 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 65/107 (61%), Gaps = 4/107 (4%)
 Frame = +3

Query  180  STPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaalda  359
            S  V++L   NF   VLNS  + LVEF+APWCGHCK L P +   A+ LKG   + ALDA
Sbjct  160  SKDVIELTDENFDKTVLNSEDMWLVEFYAPWCGHCKNLAPEWATAATELKGKVKLGALDA  219

Query  360  dahsslaQEYGIKGFPTIKVFVPGKQPV----DYQGAREAKSMVDFV  488
              ++  A +Y IKG+PTIK F PGK+      DY G R +  +V++ 
Sbjct  220  TVNTLKASKYEIKGYPTIKFFAPGKKDADSLQDYDGGRTSGDIVNWA  266



>ref|NP_001265732.1| protein disulfide-isomerase A6 precursor [Ictalurus punctatus]
 gb|AFL70280.1| protein disulfide-isomerase A6 [Ictalurus punctatus]
 gb|AFL70281.1| protein disulfide-isomerase A6 [Ictalurus punctatus]
Length=439

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 106/164 (65%), Gaps = 8/164 (5%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            + LY  S  V++LNPSNF  +VL S+ + LVEF+APWCGHC++L P ++K A+ LKGV  
Sbjct  18   HGLYSASDDVIELNPSNFNREVLQSDSLWLVEFYAPWCGHCQSLVPEWKKAATALKGVVK  77

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K  P DYQG R ++++V+      R+L+KD
Sbjct  78   VGAVDADQHKSLGGQYGVRGFPTIKIFGANKHKPEDYQGGRSSQAIVEAALNAARSLVKD  137

Query  519  RLDGKATGGSSQKSEPSAS------VELNSRNFDDLVVKSKDLW  632
            RL GK +GGS    + S        VEL   NFD +V+    +W
Sbjct  138  RLSGK-SGGSDYSRQSSGGGNKKDVVELTDDNFDRMVLDGDAVW  180


 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 64/106 (60%), Gaps = 4/106 (4%)
 Frame = +3

Query  174  GPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLK----GVAT  341
            G    V++L   NF   VL+ + V +VEFFAPWCGHCK L P +   A+ +K    G   
Sbjct  156  GNKKDVVELTDDNFDRMVLDGDAVWMVEFFAPWCGHCKNLEPEWTAAATQVKEQTSGRVK  215

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            + A+DA  H  LA  YGIKGFPTIK+F  G++P DYQG R    ++
Sbjct  216  LGAVDATVHQGLASRYGIKGFPTIKIFRKGEEPEDYQGGRTRSDII  261



>ref|XP_010336276.1| PREDICTED: protein disulfide-isomerase A6 [Saimiri boliviensis 
boliviensis]
Length=638

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 107/164 (65%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  216  NGLYSSSDDVIELTPSNFHREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  275

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +  L+KD
Sbjct  276  VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPGDYQGGRTGEAIVDAALSALHQLVKD  335

Query  519  RLDGKATGGSSQK------SEPSASVELNSRNFDDLVVKSKDLW  632
            RL+G++ G SS K      S     +EL   NFD  V+ S+D+W
Sbjct  336  RLEGRSGGYSSGKQGRGDSSSKKDVIELTDSNFDQNVLDSEDIW  379


 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 67/104 (64%), Gaps = 4/104 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L  SNF   VL+S  + +VEF+APWCGHCK L P +   AS +    KG   +AA+D
Sbjct  360  VIELTDSNFDQNVLDSEDIWMVEFYAPWCGHCKQLEPEWAAAASEVKEQTKGKVKLAAVD  419

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFV  488
            A A+  LA  YGI+GFPTIKVF  G+ PVDY GAR    +V + 
Sbjct  420  ATANQVLASRYGIRGFPTIKVFQKGESPVDYDGARTRSHIVSWA  463



>ref|XP_003458276.1| PREDICTED: protein disulfide-isomerase A6-like [Oreochromis niloticus]
Length=441

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 107/166 (64%), Gaps = 11/166 (7%)
 Frame = +3

Query  165  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  344
            ALY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ L P ++K A+ LKG+  V
Sbjct  19   ALYSASDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCRNLAPDWKKAATALKGIVKV  78

Query  345  aaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
             A+DAD H SL  +YG++GFPTIK+F   K +P +YQG R ++++VD     +RNL+K+R
Sbjct  79   GAVDADQHKSLGGQYGVRGFPTIKIFGANKNKPEEYQGGRSSQAIVDGAMNALRNLVKER  138

Query  522  LDGKATGGSSQKSEPSAS---------VELNSRNFDDLVVKSKDLW  632
            L G+ +GGS  K               VEL   NFD +V+ S D+W
Sbjct  139  LSGR-SGGSDYKQSGGGGSSGGNKKDVVELTDDNFDKMVLDSDDVW  183


 Score = 91.7 bits (226),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 66/102 (65%), Gaps = 4/102 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   NF   VL+S+ V LVEFFAPWCGHCK L P +   A+ +    KG   + A+D
Sbjct  164  VVELTDDNFDKMVLDSDDVWLVEFFAPWCGHCKNLEPEWAAAATAVKEQTKGKVRLGAVD  223

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVD  482
            A  H +++  YGI+GFPTIK+F  G++P DYQG R    +++
Sbjct  224  ATVHQAVSGRYGIRGFPTIKIFRKGEEPEDYQGGRTRGDIIE  265



>ref|XP_010781928.1| PREDICTED: protein disulfide-isomerase A6 [Notothenia coriiceps]
Length=443

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 109/164 (66%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
             A Y  S  V++LNPSNF  +VL S+ + L+EF+APWCGHC++LT  ++K A+ LKG+  
Sbjct  18   QAFYSASDDVVELNPSNFNKEVLQSDSLWLIEFYAPWCGHCQSLTADWKKAATTLKGIVK  77

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  ++G+KGFPTIKVF   K +P D+QG R ++++VD     + +L+KD
Sbjct  78   VGAVDADQHKSLGSQFGVKGFPTIKVFGANKNKPEDFQGGRTSQAIVDGAMKSLNSLVKD  137

Query  519  RLDGKATGGSSQKSEPSAS------VELNSRNFDDLVVKSKDLW  632
            RL GK+ G   ++S    +      VEL   NFD +V++ +++W
Sbjct  138  RLSGKSGGSGYKQSGGGGAGSKQDVVELTDDNFDKMVLQGEEVW  181


 Score = 88.2 bits (217),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 68/120 (57%), Gaps = 8/120 (7%)
 Frame = +3

Query  174  GPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVAT  341
            G    V++L   NF   VL    V LVEFFAPWCGHCK L P +   AS +    KG   
Sbjct  157  GSKQDVVELTDDNFDKMVLQGEEVWLVEFFAPWCGHCKNLEPEWTAAASAVMEQTKGKVR  216

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            + A+DA  H +++  YGI+GFPTIK+F  G++P D+QG R    ++    A+  +L  D 
Sbjct  217  LGAMDATVHQAVSGRYGIRGFPTIKIFRKGEEPEDFQGGRTRGDII----ARALDLFSDH  272



>gb|ABG81451.1| protein disulfide isomerase-associated 6 [Bos taurus]
Length=201

 Score =   132 bits (332),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 105/164 (64%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  18   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  77

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  78   VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNKPEDYQGGRTGEAIVDAALSALRQLVKD  137

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G+ +G      G    S     +EL   NFD  V+ S+D+W
Sbjct  138  RLGGRGSGYSSGKQGRGDSSSKKDVIELTDDNFDKNVLDSEDVW  181


 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTY  305
            V++L   NF   VL+S  V +VEF+APWCGHCK L P +
Sbjct  162  VIELTDDNFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEW  200



>ref|XP_011266529.1| PREDICTED: protein disulfide-isomerase A6 [Camponotus floridanus]
 gb|EFN61326.1| Protein disulfide-isomerase A6 [Camponotus floridanus]
Length=439

 Score =   137 bits (344),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 98/157 (62%), Gaps = 0/157 (0%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  ++ V+ L P+NF + VLNS+ + +VEF+APWCGHC+ LTP YEK A+ LKG+  
Sbjct  26   NCLYSSNSAVIDLRPNNFDNLVLNSDHIWVVEFYAPWCGHCQQLTPEYEKAANALKGIVK  85

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
            V A++AD H SL  +YG++GFPTIK+F    +P D+ G R A  +VD          +  
Sbjct  86   VGAVNADEHKSLGGKYGVRGFPTIKIFGLDSKPEDFNGPRSAAGIVDAALNAASKKARRA  145

Query  522  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            L GK     S+ S+P   +EL   NFD  V+ S+D+W
Sbjct  146  LSGKKADSDSKSSDPKDVIELTDENFDKTVLNSEDMW  182


 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 64/104 (62%), Gaps = 4/104 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadah  368
            V++L   NF   VLNS  + LVEF+APWCGHCK L P +   A+ LKG   + ALDA  +
Sbjct  163  VIELTDENFDKTVLNSEDMWLVEFYAPWCGHCKNLAPEWAAAATQLKGKVKLGALDATVN  222

Query  369  sslaQEYGIKGFPTIKVFVPGKQPVD----YQGAREAKSMVDFV  488
            +  A +Y IKG+PTIK F PGK+  D    Y G R +  +V++ 
Sbjct  223  TLKASKYEIKGYPTIKYFAPGKKDADSVQEYDGGRTSGDIVNWA  266



>ref|XP_006976688.1| PREDICTED: protein disulfide-isomerase A6 [Peromyscus maniculatus 
bairdii]
Length=602

 Score =   137 bits (345),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 78/164 (48%), Positives = 106/164 (65%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            + LY  S  V++L PSNF  +V+ SN + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  180  SGLYSSSDDVIELTPSNFNREVIQSNSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  239

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  240  VGAVDADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTGEAIVDAALSALRQLVKD  299

Query  519  RLDGKATGGSSQK------SEPSASVELNSRNFDDLVVKSKDLW  632
            RL G++ G SS K      S     VEL    FD  V+ S+D+W
Sbjct  300  RLAGRSGGYSSGKQGRGDSSSKKDVVELTDDTFDKNVLDSEDVW  343


 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 62/101 (61%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L    F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  324  VVELTDDTFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKDQTKGKVKLAAVD  383

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  384  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  424



>ref|XP_004568809.1| PREDICTED: protein disulfide-isomerase A6-like isoform X1 [Maylandia 
zebra]
 ref|XP_005921648.1| PREDICTED: protein disulfide-isomerase A6-like isoform X1 [Haplochromis 
burtoni]
Length=443

 Score =   136 bits (342),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 76/168 (45%), Positives = 107/168 (64%), Gaps = 13/168 (8%)
 Frame = +3

Query  165  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  344
            ALY  S  V++L  SNF  +V+ S+ + LVEF+APWCGHC+ L P ++K A+ LKG+  V
Sbjct  19   ALYSASDDVIELTQSNFNREVIQSDSLWLVEFYAPWCGHCRNLAPDWKKAATALKGIVKV  78

Query  345  aaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
             A+DAD H SL  +YG++GFPTIK+F   K +P +YQG R ++++VD     +RNL+K+R
Sbjct  79   GAVDADQHKSLGGQYGVRGFPTIKIFGANKNKPEEYQGGRSSQAIVDGAMNALRNLVKER  138

Query  522  LDGKATGGSSQKSEPSAS-----------VELNSRNFDDLVVKSKDLW  632
            L G+ +GGS  K +               VEL   NFD LV+ S D+W
Sbjct  139  LSGR-SGGSDYKQQSGGGGGSSGGNKKDVVELTDDNFDKLVLDSDDVW  185


 Score = 91.7 bits (226),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 65/102 (64%), Gaps = 4/102 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   NF   VL+S+ V LVEFFAPWCGHCK L P +   A+ +    KG   + A+D
Sbjct  166  VVELTDDNFDKLVLDSDDVWLVEFFAPWCGHCKNLEPEWAAAATAVKEQTKGKVRLGAVD  225

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVD  482
            A  H  ++  YGI+GFPTIK+F  G++P DYQG R    +++
Sbjct  226  ATVHQGVSSRYGIRGFPTIKIFRKGEEPEDYQGGRTRGDIIE  267



>ref|XP_005731103.1| PREDICTED: protein disulfide-isomerase A6-like [Pundamilia nyererei]
Length=443

 Score =   136 bits (342),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 76/168 (45%), Positives = 107/168 (64%), Gaps = 13/168 (8%)
 Frame = +3

Query  165  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  344
            ALY  S  V++L  SNF  +V+ S+ + LVEF+APWCGHC+ L P ++K A+ LKG+  V
Sbjct  19   ALYSASDDVIELTQSNFNREVIQSDSLWLVEFYAPWCGHCRNLAPDWKKAATALKGIVKV  78

Query  345  aaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
             A+DAD H SL  +YG++GFPTIK+F   K +P +YQG R ++++VD     +RNL+K+R
Sbjct  79   GAVDADQHKSLGGQYGVRGFPTIKIFGANKNKPEEYQGGRSSQAIVDGAMNALRNLVKER  138

Query  522  LDGKATGGSSQKSEPSAS-----------VELNSRNFDDLVVKSKDLW  632
            L G+ +GGS  K +               VEL   NFD LV+ S D+W
Sbjct  139  LSGR-SGGSDYKQQSGGGGGSSGGNKKDVVELTDDNFDKLVLDSDDVW  185


 Score = 91.7 bits (226),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 65/102 (64%), Gaps = 4/102 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   NF   VL+S+ V LVEFFAPWCGHCK L P +   A+ +    KG   + A+D
Sbjct  166  VVELTDDNFDKLVLDSDDVWLVEFFAPWCGHCKNLEPEWAAAATAVKEQTKGKVRLGAVD  225

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVD  482
            A  H  ++  YGI+GFPTIK+F  G++P DYQG R    +++
Sbjct  226  ATVHQGVSSRYGIRGFPTIKIFRKGEEPEDYQGGRTRGDIIE  267



>ref|XP_010962323.1| PREDICTED: protein disulfide-isomerase A6 [Camelus bactrianus]
 ref|XP_010981000.1| PREDICTED: protein disulfide-isomerase A6 [Camelus dromedarius]
Length=440

 Score =   136 bits (342),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 78/164 (48%), Positives = 108/164 (66%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ S+ + LVEFFAPWCGHC+ LTP ++KVA+ LK V  
Sbjct  18   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFFAPWCGHCQRLTPEWKKVATALKDVVK  77

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R ++++VD   + +R L+KD
Sbjct  78   VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTSEAIVDAALSALRQLVKD  137

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G+  G      G S+ S     +EL   +FD  V+ S+D+W
Sbjct  138  RLGGRGGGYSSGKQGRSESSSKKDVIELTDDSFDKNVLDSEDVW  181


 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   +F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  162  VIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  221

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  222  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  262



>ref|XP_006197174.1| PREDICTED: protein disulfide-isomerase A6 [Vicugna pacos]
Length=440

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 78/164 (48%), Positives = 108/164 (66%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ S+ + LVEFFAPWCGHC+ LTP ++KVA+ LK V  
Sbjct  18   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFFAPWCGHCQRLTPEWKKVATALKDVVK  77

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R ++++VD   + +R L+KD
Sbjct  78   VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTSEAIVDAALSALRQLVKD  137

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G+  G      G S+ S     +EL   +FD  V+ S+D+W
Sbjct  138  RLGGRGGGYSSGKQGRSESSSKKDVIELTDDSFDKNVLDSEDVW  181


 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   +F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  162  VIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  221

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  222  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  262



>ref|XP_003411934.1| PREDICTED: protein disulfide-isomerase A6 [Loxodonta africana]
Length=440

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 110/164 (67%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ S+ + L+EF+APWCGHC+ LTP ++KVA+ LK V  
Sbjct  18   NGLYSSSDDVIELTPSNFNREVIQSDSLWLIEFYAPWCGHCQRLTPEWKKVATALKDVVK  77

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SLA +YG++GFPTI++F   K +P DYQG R A+++VD   + +R L+KD
Sbjct  78   VGAVDADKHQSLAGQYGVQGFPTIRIFGSNKNRPEDYQGGRTAEAIVDAALSAVRQLVKD  137

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G++ G      G S+ S     +EL    FD  V++S+D+W
Sbjct  138  RLGGRSGGYSSGKQGRSESSSKKDVIELTDDTFDKNVLESEDVW  181


 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 61/101 (60%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L    F   VL S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  162  VIELTDDTFDKNVLESEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKDQTKGKVKLAAVD  221

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  222  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTKSDIV  262



>ref|XP_006191925.1| PREDICTED: protein disulfide-isomerase A6, partial [Camelus ferus]
Length=436

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 78/164 (48%), Positives = 108/164 (66%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ S+ + LVEFFAPWCGHC+ LTP ++KVA+ LK V  
Sbjct  14   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFFAPWCGHCQRLTPEWKKVATALKDVVK  73

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R ++++VD   + +R L+KD
Sbjct  74   VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTSEAIVDAALSALRQLVKD  133

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G+  G      G S+ S     +EL   +FD  V+ S+D+W
Sbjct  134  RLGGRGGGYSSGKQGRSESSSKKDVIELTDDSFDKNVLDSEDVW  177


 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   +F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  158  VIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  217

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  218  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  258



>ref|XP_007195772.1| PREDICTED: protein disulfide-isomerase A6 [Balaenoptera acutorostrata 
scammoni]
Length=429

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 78/164 (48%), Positives = 106/164 (65%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++KVA+ LK V  
Sbjct  18   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKVATALKDVVK  77

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K QP DYQG R  +++VD   + +R L+KD
Sbjct  78   VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNQPEDYQGGRTGEAIVDAALSALRQLVKD  137

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G++ G      G S  S     +EL    FD  V+ S+D+W
Sbjct  138  RLGGRSGGYSSGKQGRSDSSSKKDVIELTDDTFDKSVLDSEDVW  181


 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 61/101 (60%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L    F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  162  VIELTDDTFDKSVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  221

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  LA  Y I+GFPTIK+F  G+ PVDY G R    +V
Sbjct  222  ATVNQVLASRYEIRGFPTIKIFQKGESPVDYDGGRTRSDIV  262



>ref|XP_004568810.1| PREDICTED: protein disulfide-isomerase A6-like isoform X2 [Maylandia 
zebra]
 ref|XP_005921649.1| PREDICTED: protein disulfide-isomerase A6-like isoform X2 [Haplochromis 
burtoni]
Length=442

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 106/167 (63%), Gaps = 12/167 (7%)
 Frame = +3

Query  165  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  344
            ALY  S  V++L  SNF  +V+ S+ + LVEF+APWCGHC+ L P ++K A+ LKG+  V
Sbjct  19   ALYSASDDVIELTQSNFNREVIQSDSLWLVEFYAPWCGHCRNLAPDWKKAATALKGIVKV  78

Query  345  aaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
             A+DAD H SL  +YG++GFPTIK+F   K +P +YQG R ++++VD     +RNL+K+R
Sbjct  79   GAVDADQHKSLGGQYGVRGFPTIKIFGANKNKPEEYQGGRSSQAIVDGAMNALRNLVKER  138

Query  522  LDGKATGGSSQKSEPSAS----------VELNSRNFDDLVVKSKDLW  632
            L G+ +GGS  K                VEL   NFD LV+ S D+W
Sbjct  139  LSGR-SGGSDYKQSGGGGGSSGGNKKDVVELTDDNFDKLVLDSDDVW  184


 Score = 91.7 bits (226),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 65/102 (64%), Gaps = 4/102 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   NF   VL+S+ V LVEFFAPWCGHCK L P +   A+ +    KG   + A+D
Sbjct  165  VVELTDDNFDKLVLDSDDVWLVEFFAPWCGHCKNLEPEWAAAATAVKEQTKGKVRLGAVD  224

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVD  482
            A  H  ++  YGI+GFPTIK+F  G++P DYQG R    +++
Sbjct  225  ATVHQGVSSRYGIRGFPTIKIFRKGEEPEDYQGGRTRGDIIE  266



>ref|XP_003744350.1| PREDICTED: protein disulfide-isomerase A6-like [Metaseiulus occidentalis]
Length=443

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 77/163 (47%), Positives = 104/163 (64%), Gaps = 6/163 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            NALY     V++L P  F  +VLN + V +VEFFAPWCGHCK L P Y+K A  LKG+A 
Sbjct  18   NALYDSRDDVVELTPDTFSKRVLNGDQVWIVEFFAPWCGHCKNLAPEYKKAARALKGIAG  77

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPT+K+FVPG  +P++YQGAR A  + D V  +++NL+  
Sbjct  78   VGAVDADQHKSLPGQYGVRGFPTLKIFVPGNSKPIEYQGARTADGIADAVLREMKNLVNK  137

Query  519  RLDGKATGGSSQKSEPSAS-----VELNSRNFDDLVVKSKDLW  632
            +L   +  G S      +      V+L S NF  LV+ SKD+W
Sbjct  138  KLGKSSGSGGSSSGSGGSGNDKDVVQLTSENFRKLVLDSKDIW  180


 Score = 88.6 bits (218),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadah  368
            V+QL   NF+  VL+S  + LVEF+APWCGHCK L P + K A+ LKG   + A+D+  +
Sbjct  161  VVQLTSENFRKLVLDSKDIWLVEFYAPWCGHCKNLAPHWAKAATQLKGQVKLGAVDSTVY  220

Query  369  sslaQEYGIKGFPTIKVFVPG----KQPVDYQGAREAKSMV  479
              LAQEYG++G+PTIK F  G        +Y G R A  +V
Sbjct  221  QELAQEYGVRGYPTIKYFPAGPKDSNSAEEYNGGRTADDIV  261



>gb|EHB04452.1| Protein disulfide-isomerase A6, partial [Heterocephalus glaber]
Length=434

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 104/164 (63%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY     V++L P+NF  +V+ S+ + LVEF+APWCGHC+ L P ++K AS LK V  
Sbjct  12   NGLYSSGDAVIELTPANFNREVIQSDSLWLVEFYAPWCGHCQRLAPEWKKAASALKDVVK  71

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SLA +YG++GFPTIKVF   K +P DYQG R A+++VD   + +R L+KD
Sbjct  72   VGAVDADKHQSLAGQYGVQGFPTIKVFRADKNKPEDYQGGRTAEAIVDAALSALRQLVKD  131

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G+A        G S+ S     +EL    FD  V+ S D+W
Sbjct  132  RLGGRAGAQGSGRQGRSEGSGKKDVIELTDDTFDKNVLDSPDVW  175


 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L    F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  156  VIELTDDTFDKNVLDSPDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGRVKLAAVD  215

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A A+  LA  YGI+GFPTIK+F  G+ P+DY G R    +V
Sbjct  216  ATANQVLAGRYGIRGFPTIKIFQGGETPMDYDGGRTRSDIV  256



>ref|XP_007127699.1| PREDICTED: protein disulfide-isomerase A6 [Physeter catodon]
Length=440

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 78/164 (48%), Positives = 106/164 (65%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++KVA+ LK V  
Sbjct  18   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKVATALKDVVK  77

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K QP DYQG R  +++VD   + +R L+KD
Sbjct  78   VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNQPEDYQGGRTGEAIVDAALSALRQLVKD  137

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G++ G      G S  S     +EL    FD  V+ S+D+W
Sbjct  138  RLGGRSGGYSSGKQGRSDSSSKKDVIELTDDTFDKSVLDSEDVW  181


 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 61/101 (60%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L    F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  162  VIELTDDTFDKSVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  221

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  LA  Y I+GFPTIK+F  G+ PVDY G R    +V
Sbjct  222  ATINQVLASRYEIRGFPTIKIFQKGESPVDYDGGRTRSDIV  262



>ref|XP_004870016.1| PREDICTED: protein disulfide-isomerase A6 [Heterocephalus glaber]
Length=440

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 104/164 (63%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY     V++L P+NF  +V+ S+ + LVEF+APWCGHC+ L P ++K AS LK V  
Sbjct  18   NGLYSSGDAVIELTPANFNREVIQSDSLWLVEFYAPWCGHCQRLAPEWKKAASALKDVVK  77

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SLA +YG++GFPTIKVF   K +P DYQG R A+++VD   + +R L+KD
Sbjct  78   VGAVDADKHQSLAGQYGVQGFPTIKVFRADKNKPEDYQGGRTAEAIVDAALSALRQLVKD  137

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G+A        G S+ S     +EL    FD  V+ S D+W
Sbjct  138  RLGGRAGAQGSGRQGRSEGSGKKDVIELTDDTFDKNVLDSPDVW  181


 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L    F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  162  VIELTDDTFDKNVLDSPDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGRVKLAAVD  221

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A A+  LA  YGI+GFPTIK+F  G+ P+DY G R    +V
Sbjct  222  ATANQVLAGRYGIRGFPTIKIFQGGETPMDYDGGRTRSDIV  262



>gb|ELK13980.1| Protein disulfide-isomerase A6 [Pteropus alecto]
Length=469

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 104/164 (63%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ S  + LVEF+APWCGHC+ LTP ++KVA+ LK V  
Sbjct  47   NGLYSSSDDVIELTPSNFNQEVIQSGSLWLVEFYAPWCGHCQRLTPEWKKVATALKDVVK  106

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQGAR ++++VD   + +R L+KD
Sbjct  107  VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNKPEDYQGARTSEAIVDAALSAVRQLVKD  166

Query  519  RL------DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL            G S+ S     +EL   +FD  V+ S D+W
Sbjct  167  RLAGRGGGYSSGRQGRSESSSKKDVIELTDDSFDKNVLDSDDVW  210


 Score = 88.6 bits (218),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 65/101 (64%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   +F   VL+S+ V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  191  VIELTDDSFDKNVLDSDDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  250

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A A+  L+  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  251  ATANQVLSSRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  291



>ref|XP_006792591.1| PREDICTED: protein disulfide-isomerase A6-like isoform X1 [Neolamprologus 
brichardi]
Length=442

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/167 (45%), Positives = 106/167 (63%), Gaps = 12/167 (7%)
 Frame = +3

Query  165  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  344
            ALY  S  V++L  SNF  +V+ S+ + LVEF+APWCGHC+ L P ++K A+ LKG+  V
Sbjct  19   ALYSASDDVIELTQSNFNREVIQSDSLWLVEFYAPWCGHCRNLAPDWKKAATALKGIVKV  78

Query  345  aaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
             A+DAD H SL  +YG++GFPTIK+F   K +P +YQG R ++++VD     +RNL+K+R
Sbjct  79   GAVDADQHKSLGGQYGVRGFPTIKIFGANKNKPEEYQGGRSSQAIVDGAMNALRNLVKER  138

Query  522  LDGKATGGSSQKSEPSAS----------VELNSRNFDDLVVKSKDLW  632
            L G  +GGS  K +              VEL   NFD +V+ S D+W
Sbjct  139  LSG-GSGGSDYKQQSGGGGSSGGNKKDVVELTDDNFDKMVLDSDDVW  184


 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 65/102 (64%), Gaps = 4/102 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   NF   VL+S+ V LVEFFAPWCGHCK L P +   A+ +    KG   + A+D
Sbjct  165  VVELTDDNFDKMVLDSDDVWLVEFFAPWCGHCKNLEPEWAAAATTVKEQTKGKVRLGAVD  224

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVD  482
            A  H  ++  YGI+GFPTIK+F  G++P DYQG R    +++
Sbjct  225  ATVHQGVSSRYGIRGFPTIKIFRKGEEPEDYQGGRTRGDIIE  266



>ref|XP_004887060.1| PREDICTED: protein disulfide-isomerase A6 [Heterocephalus glaber]
Length=477

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 104/164 (63%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY     V++L P+NF  +V+ S+ + LVEF+APWCGHC+ L P ++K AS LK V  
Sbjct  55   NGLYSSGDAVIELTPANFNREVIQSDSLWLVEFYAPWCGHCQRLAPEWKKAASALKDVVK  114

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SLA +YG++GFPTIKVF   K +P DYQG R A+++VD   + +R L+KD
Sbjct  115  VGAVDADKHQSLAGQYGVQGFPTIKVFRADKNKPEDYQGGRTAEAIVDAALSALRQLVKD  174

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G+A        G S+ S     +EL    FD  V+ S D+W
Sbjct  175  RLGGRAGAQGSGRQGRSEGSGKKDVIELTDDTFDKNVLDSPDVW  218


 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L    F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  199  VIELTDDTFDKNVLDSPDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGRVKLAAVD  258

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A A+  LA  YGI+GFPTIK+F  G+ P+DY G R    +V
Sbjct  259  ATANQVLAGRYGIRGFPTIKIFQGGETPMDYDGGRTRSDIV  299



>ref|XP_004642404.1| PREDICTED: protein disulfide-isomerase A6 [Octodon degus]
Length=515

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 107/164 (65%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            + LY     V++L P+NF  +V+ S+ + LVEF+APWCGHC+ L P ++K A+ LK V  
Sbjct  93   HGLYSSGDAVIELTPTNFHREVIQSDSLWLVEFYAPWCGHCQRLAPEWKKAANALKDVVK  152

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R A+++VD   + +R L+KD
Sbjct  153  VGAVDADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTAEAIVDAALSAVRQLVKD  212

Query  519  RLDGKATGGSS---QKSEPSAS---VELNSRNFDDLVVKSKDLW  632
            RL G+A G SS    +SE S     +EL    FD+ V+ S D+W
Sbjct  213  RLGGRAGGHSSGRQGRSEGSGKKDVIELTDDTFDENVLDSPDVW  256


 Score = 86.3 bits (212),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 62/101 (61%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L    F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  237  VIELTDDTFDENVLDSPDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGRVKLAAVD  296

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  297  ATVNQVLASRYGIRGFPTIKIFQKGEAPVDYDGGRTRSDIV  337



>ref|XP_006792592.1| PREDICTED: protein disulfide-isomerase A6-like isoform X2 [Neolamprologus 
brichardi]
Length=441

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 105/166 (63%), Gaps = 11/166 (7%)
 Frame = +3

Query  165  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  344
            ALY  S  V++L  SNF  +V+ S+ + LVEF+APWCGHC+ L P ++K A+ LKG+  V
Sbjct  19   ALYSASDDVIELTQSNFNREVIQSDSLWLVEFYAPWCGHCRNLAPDWKKAATALKGIVKV  78

Query  345  aaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
             A+DAD H SL  +YG++GFPTIK+F   K +P +YQG R ++++VD     +RNL+K+R
Sbjct  79   GAVDADQHKSLGGQYGVRGFPTIKIFGANKNKPEEYQGGRSSQAIVDGAMNALRNLVKER  138

Query  522  LDGKATGGSSQKSEPSAS---------VELNSRNFDDLVVKSKDLW  632
            L G  +GGS  K               VEL   NFD +V+ S D+W
Sbjct  139  LSG-GSGGSDYKQSGGGGSSGGNKKDVVELTDDNFDKMVLDSDDVW  183


 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 65/102 (64%), Gaps = 4/102 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   NF   VL+S+ V LVEFFAPWCGHCK L P +   A+ +    KG   + A+D
Sbjct  164  VVELTDDNFDKMVLDSDDVWLVEFFAPWCGHCKNLEPEWAAAATTVKEQTKGKVRLGAVD  223

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVD  482
            A  H  ++  YGI+GFPTIK+F  G++P DYQG R    +++
Sbjct  224  ATVHQGVSSRYGIRGFPTIKIFRKGEEPEDYQGGRTRGDIIE  265



>ref|XP_001502324.3| PREDICTED: protein disulfide-isomerase A6 [Equus caballus]
Length=448

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 108/164 (66%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++KVA+ LK V  
Sbjct  26   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKVATALKDVVK  85

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  86   VGAVDADKHQSLGGQYGVQGFPTIKIFGANKNRPEDYQGGRSGEAIVDAALSALRQLVKD  145

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G++ G      G S+ S     +EL   +FD  V+ S+D+W
Sbjct  146  RLGGRSGGYSSGKQGRSESSSKKDVIELTDDSFDKNVLDSEDVW  189


 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   +F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  170  VIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  229

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    ++
Sbjct  230  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDII  270



>ref|XP_008848336.1| PREDICTED: protein disulfide-isomerase A6 [Nannospalax galili]
Length=440

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 106/164 (65%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ SN + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  18   NGLYSSSDDVIELTPSNFNREVIQSNSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  77

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  78   VGAVDADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTGEAIVDAALSALRQLVKD  137

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL GK+ G      G S  S     VEL   +FD  V+ S+D+W
Sbjct  138  RLGGKSGGYSSGKQGRSDSSSKKDVVELTDDSFDKHVLDSEDVW  181


 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   +F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  162  VVELTDDSFDKHVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  221

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  222  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  262



>ref|XP_004436529.1| PREDICTED: protein disulfide-isomerase A6 [Ceratotherium simum 
simum]
Length=432

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 107/164 (65%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ SN + LVEF+APWCGHC+ L P ++KVA+ LK V  
Sbjct  10   NGLYSSSDDVIELTPSNFNREVIQSNSLWLVEFYAPWCGHCQRLAPEWKKVATALKDVVK  69

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  70   VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKD  129

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G++ G      G S+ S     +EL   +FD  V+ S+D+W
Sbjct  130  RLGGRSGGYSSGKQGRSESSSKKDVIELTDDSFDKNVLDSEDVW  173


 Score = 88.2 bits (217),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   +F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  154  VIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  213

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  214  ATVNQELASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  254



>gb|KFU90776.1| Protein disulfide-isomerase A6, partial [Chaetura pelagica]
Length=440

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 75/169 (44%), Positives = 104/169 (62%), Gaps = 16/169 (9%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L P+NF  +V+ S  + LVEF+APWCGHC+ LTP ++K A+ LKGV  
Sbjct  17   NGLYSASDDVIELTPTNFNREVIQSESLWLVEFYAPWCGHCQRLTPEWKKAATALKGVVK  76

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPV-DYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K    DYQG R + ++VD   + +R+L+KD
Sbjct  77   VGAVDADKHQSLGGQYGVRGFPTIKIFGTNKNKAEDYQGGRTSDAIVDAALSALRSLVKD  136

Query  519  RL-----------DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL             + +GG  +K      +ELN  NFD  V+ S D+W
Sbjct  137  RLSGRSGGYSSGKQSRESGGGDKKD----VIELNDDNFDKKVINSDDVW  181


 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 67/106 (63%), Gaps = 4/106 (4%)
 Frame = +3

Query  174  GPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVAT  341
            G    V++LN  NF  KV+NS+ V +VEF+APWCGHCK L P +   A+ +    KG   
Sbjct  157  GDKKDVIELNDDNFDKKVINSDDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVK  216

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            +AA+DA  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  217  LAAVDATVNQMLAGRYGIRGFPTIKIFQKGEDPVDYDGGRTRSDIV  262



>ref|XP_006910476.1| PREDICTED: protein disulfide-isomerase A6 [Pteropus alecto]
Length=527

 Score =   134 bits (338),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 104/164 (63%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ S  + LVEF+APWCGHC+ LTP ++KVA+ LK V  
Sbjct  105  NGLYSSSDDVIELTPSNFNQEVIQSGSLWLVEFYAPWCGHCQRLTPEWKKVATALKDVVK  164

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQGAR ++++VD   + +R L+KD
Sbjct  165  VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNKPEDYQGARTSEAIVDAALSAVRQLVKD  224

Query  519  RL------DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL            G S+ S     +EL   +FD  V+ S D+W
Sbjct  225  RLAGRGGGYSSGRQGRSESSSKKDVIELTDDSFDKNVLDSDDVW  268


 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 65/101 (64%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   +F   VL+S+ V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  249  VIELTDDSFDKNVLDSDDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  308

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A A+  L+  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  309  ATANQVLSSRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  349



>gb|ACI34364.1| disulfide-isomerase A6 precursor [Salmo salar]
Length=442

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 104/164 (63%), Gaps = 8/164 (5%)
 Frame = +3

Query  165  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  344
              Y  +  V++LNPSNF  +VL S+ + L+EF+APWCGHC++LT  ++K A+ LKG+  V
Sbjct  19   GFYSANDDVVELNPSNFNREVLQSDSLWLIEFYAPWCGHCQSLTADWKKTATALKGIVKV  78

Query  345  aaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
             A+DAD H SL  +YG+KGFP+IK+F   K +P DYQG R ++++VD     +R L+KDR
Sbjct  79   GAVDADQHKSLGGQYGVKGFPSIKIFGANKSKPDDYQGGRSSQAIVDAALNTLRTLVKDR  138

Query  522  LDGKATGGSSQKSEPSAS-------VELNSRNFDDLVVKSKDLW  632
            + G++ G    +             VEL   NFD LV+ S ++W
Sbjct  139  MSGRSGGSDYSRQSGGGGGGSKKNVVELTDDNFDRLVLDSGEVW  182


 Score = 89.0 bits (219),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 43/101 (43%), Positives = 59/101 (58%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadah  368
            V++L   NF   VL+S  V LVEFFAPWCGHCK+L P +   AS +K             
Sbjct  163  VVELTDDNFDRLVLDSGEVWLVEFFAPWCGHCKSLEPEWAAAASAVKEQTKDKVHLGAVD  222

Query  369  sslaQ----EYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            +++ Q     YG++GFPTIK+F  G++P DYQG R    ++
Sbjct  223  ATVHQGLASRYGVRGFPTIKIFKKGEEPEDYQGGRTRGDII  263



>ref|XP_005404513.1| PREDICTED: protein disulfide-isomerase A6, partial [Chinchilla 
lanigera]
Length=610

 Score =   135 bits (339),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 75/164 (46%), Positives = 105/164 (64%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            + LY     V++L P+NF+ +V+ S+ + LVEF+APWCGHC+ L P ++KVAS LK V  
Sbjct  188  HGLYSSGDAVIELTPANFQREVIQSDSLWLVEFYAPWCGHCQRLAPEWKKVASALKDVVK  247

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R A+++VD   + +R L+KD
Sbjct  248  VGAVDADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTAEAIVDAALSAVRQLVKD  307

Query  519  RLDGKATGGSSQKSEPSAS------VELNSRNFDDLVVKSKDLW  632
            RL G+A G SS +            +EL    FD  V+ S D+W
Sbjct  308  RLSGRAGGQSSGRQGRGEGPGKKDVIELTDDTFDGNVLDSPDVW  351


 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 62/101 (61%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L    F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  332  VIELTDDTFDGNVLDSPDVWMVEFYAPWCGHCKNLEPEWSAAATEVKEQTKGRVKLAAVD  391

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  LA  YGI+GFPTIK+F  G+ P+DY G R    +V
Sbjct  392  ATVNQVLASRYGIRGFPTIKIFQKGEDPIDYDGGRTRSDIV  432



>ref|XP_011489880.1| PREDICTED: protein disulfide-isomerase A6 isoform X1 [Oryzias 
latipes]
Length=443

 Score =   134 bits (336),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 108/166 (65%), Gaps = 9/166 (5%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
             ALY PS  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ L P ++K A+ LKG+  
Sbjct  18   EALYSPSDDVVELTPSNFNREVMQSDSLWLVEFYAPWCGHCRNLAPDWKKAATALKGIVK  77

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P +YQGAR ++++VD     +R+L+KD
Sbjct  78   VGAVDADEHKSLGGQYGVRGFPTIKIFGANKNKPEEYQGARSSQAIVDGAMNALRSLVKD  137

Query  519  RLDGKATGGSSQKSEPSAS--------VELNSRNFDDLVVKSKDLW  632
            RL GK+      + +  +         VEL   NFD  V++S D+W
Sbjct  138  RLSGKSGSSGYSRQQSDSGSSGSSKDVVELTDDNFDKTVLQSDDVW  183


 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 64/102 (63%), Gaps = 4/102 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   NF   VL S+ V LVEFFAPWCGHCK L P +   A+ +    KG   + A+D
Sbjct  164  VVELTDDNFDKTVLQSDDVWLVEFFAPWCGHCKNLEPEWAAAATAVKEQTKGKVRLGAVD  223

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVD  482
            A  H  L+  YG++GFPTIK+F  G++P DYQG R    +++
Sbjct  224  ATVHQVLSSRYGVRGFPTIKIFRKGEEPEDYQGGRTRGDIIE  265



>ref|XP_009997534.1| PREDICTED: protein disulfide-isomerase A6 [Chaetura pelagica]
Length=464

 Score =   134 bits (337),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 75/169 (44%), Positives = 104/169 (62%), Gaps = 16/169 (9%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L P+NF  +V+ S  + LVEF+APWCGHC+ LTP ++K A+ LKGV  
Sbjct  41   NGLYSASDDVIELTPTNFNREVIQSESLWLVEFYAPWCGHCQRLTPEWKKAATALKGVVK  100

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPV-DYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K    DYQG R + ++VD   + +R+L+KD
Sbjct  101  VGAVDADKHQSLGGQYGVRGFPTIKIFGTNKNKAEDYQGGRTSDAIVDAALSALRSLVKD  160

Query  519  RL-----------DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL             + +GG  +K      +ELN  NFD  V+ S D+W
Sbjct  161  RLSGRSGGYSSGKQSRESGGGDKKD----VIELNDDNFDKKVINSDDVW  205


 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 67/106 (63%), Gaps = 4/106 (4%)
 Frame = +3

Query  174  GPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVAT  341
            G    V++LN  NF  KV+NS+ V +VEF+APWCGHCK L P +   A+ +    KG   
Sbjct  181  GDKKDVIELNDDNFDKKVINSDDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVK  240

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            +AA+DA  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  241  LAAVDATVNQMLAGRYGIRGFPTIKIFQKGEDPVDYDGGRTRSDIV  286



>ref|XP_532876.2| PREDICTED: protein disulfide-isomerase A6 [Canis lupus familiaris]
Length=440

 Score =   134 bits (336),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 106/164 (65%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++KVA+ LK V  
Sbjct  18   NGLYSSSDDVIELTPSNFNREVIQSDNLWLVEFYAPWCGHCQRLTPEWKKVATALKDVVK  77

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG+R  +++VD     +R L+KD
Sbjct  78   VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGSRTGEAIVDAALGALRQLVKD  137

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G+  G      G S+ S     +EL   +FD  V+ S D+W
Sbjct  138  RLGGRGGGYSSGKQGRSESSNKKDVIELTDDSFDKNVLDSDDVW  181


 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 65/101 (64%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   +F   VL+S+ V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  162  VIELTDDSFDKNVLDSDDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  221

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  LA  YGI+GFPTIK+F  G+ P++Y+G R    +V
Sbjct  222  ATVNQLLASRYGIRGFPTIKIFQKGESPMEYEGGRTRSDIV  262



>emb|CDQ62935.1| unnamed protein product [Oncorhynchus mykiss]
Length=443

 Score =   134 bits (336),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 70/165 (42%), Positives = 105/165 (64%), Gaps = 9/165 (5%)
 Frame = +3

Query  165  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  344
              Y  +  V++LNPSNF  +VL S+ + L+EF+APWCGHC++LT  ++K A+ LKG+  V
Sbjct  19   GFYSAADDVVELNPSNFNREVLQSDSLWLIEFYAPWCGHCQSLTADWKKTATALKGIVKV  78

Query  345  aaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
             A+DAD H SL  +YG++GFP+IK+F   K +P DYQG R ++++VD     +R L+KDR
Sbjct  79   GAVDADQHKSLGGQYGVRGFPSIKIFGANKNKPDDYQGGRSSQAIVDGALNTLRTLVKDR  138

Query  522  LDGKATGGSSQKSEPSAS--------VELNSRNFDDLVVKSKDLW  632
            + G++ G  + +              VEL   NFD LV+ S ++W
Sbjct  139  MSGRSGGSDNNRQSGGGGGGGSKKNVVELTDDNFDRLVLDSGEVW  183


 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/101 (44%), Positives = 59/101 (58%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadah  368
            V++L   NF   VL+S  V LVEFFAPWCGHCK+L P +   AS +K             
Sbjct  164  VVELTDDNFDRLVLDSGEVWLVEFFAPWCGHCKSLEPEWAAAASAVKEQTKDKVHLGAVD  223

Query  369  sslaQ----EYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            +++ Q     YGI+GFPTIK+F  G++P DYQG R    ++
Sbjct  224  ATVHQGLASRYGIRGFPTIKIFKKGEEPEDYQGGRTRGDII  264



>emb|CAH65062.1| hypothetical protein RCJMB04_2j3, partial [Gallus gallus]
Length=247

 Score =   130 bits (326),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 73/169 (43%), Positives = 104/169 (62%), Gaps = 16/169 (9%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L P+NF  +V+ S  + LVEF+APWCGHC+ LTP ++K A+ LKGV  
Sbjct  23   NGLYSASDDVIELTPTNFNKEVIQSESLWLVEFYAPWCGHCQRLTPEWKKAATALKGVVK  82

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPV-DYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K    DYQG R ++++VD   + +R+L+KD
Sbjct  83   VGAVDADKHQSLGGQYGVRGFPTIKIFGANKNKAEDYQGGRTSEAIVDAALSALRSLVKD  142

Query  519  RL-----------DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL             + +GG  +K      +EL   +FD  V+ S D+W
Sbjct  143  RLSGRSGGYSSGRQSRESGGGDKKD----VIELTDDSFDKNVINSDDVW  187


 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 52/85 (61%), Gaps = 4/85 (5%)
 Frame = +3

Query  174  GPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVAT  341
            G    V++L   +F   V+NS+ V +VEF+APWCGHCK L P +   A+ +    KG   
Sbjct  163  GDKKDVIELTDDSFDKNVINSDDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVK  222

Query  342  VaaldadahsslaQEYGIKGFPTIK  416
            +AA+DA  +  LA  YGI+GFP IK
Sbjct  223  LAAVDATVNQMLANRYGIRGFPPIK  247



>ref|XP_004582660.1| PREDICTED: protein disulfide-isomerase A6 isoform X2 [Ochotona 
princeps]
Length=440

 Score =   133 bits (335),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 75/164 (46%), Positives = 107/164 (65%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  18   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  77

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  78   VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKD  137

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G+++       G S  S     +EL   +FD+ V+ S+D+W
Sbjct  138  RLGGRSSSYSSGKQGRSDSSSKKDVIELTDDSFDENVLDSEDIW  181


 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   +F   VL+S  + +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  162  VIELTDDSFDENVLDSEDIWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  221

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  L+  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  222  ATVNQLLSSRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  262



>ref|XP_004083501.1| PREDICTED: protein disulfide-isomerase A6 isoform X2 [Oryzias 
latipes]
Length=442

 Score =   133 bits (335),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 108/165 (65%), Gaps = 8/165 (5%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
             ALY PS  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ L P ++K A+ LKG+  
Sbjct  18   EALYSPSDDVVELTPSNFNREVMQSDSLWLVEFYAPWCGHCRNLAPDWKKAATALKGIVK  77

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P +YQGAR ++++VD     +R+L+KD
Sbjct  78   VGAVDADEHKSLGGQYGVRGFPTIKIFGANKNKPEEYQGARSSQAIVDGAMNALRSLVKD  137

Query  519  RLDGKATGGSSQKSEPSAS-------VELNSRNFDDLVVKSKDLW  632
            RL GK+      +   S S       VEL   NFD  V++S D+W
Sbjct  138  RLSGKSGSSGYSRQSDSGSSGSSKDVVELTDDNFDKTVLQSDDVW  182


 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 64/102 (63%), Gaps = 4/102 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   NF   VL S+ V LVEFFAPWCGHCK L P +   A+ +    KG   + A+D
Sbjct  163  VVELTDDNFDKTVLQSDDVWLVEFFAPWCGHCKNLEPEWAAAATAVKEQTKGKVRLGAVD  222

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVD  482
            A  H  L+  YG++GFPTIK+F  G++P DYQG R    +++
Sbjct  223  ATVHQVLSSRYGVRGFPTIKIFRKGEEPEDYQGGRTRGDIIE  264



>emb|CAJ82905.1| protein disulfide isomerase family A, member 6 [Xenopus (Silurana) 
tropicalis]
Length=441

 Score =   133 bits (335),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 73/169 (43%), Positives = 107/169 (63%), Gaps = 16/169 (9%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            +A+Y PS  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LKGV  
Sbjct  18   SAMYSPSDDVIELTPSNFNKEVIQSDSLWLVEFYAPWCGHCQRLTPDWKKAATALKGVVK  77

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            + A++AD H SL  +YG++GFPTIKVF   K +P DYQG R A +++D   + +R+ +KD
Sbjct  78   IGAVNADQHQSLGGQYGVRGFPTIKVFGANKNKPDDYQGGRTADAIIDAALSSLRSFVKD  137

Query  519  RL-----------DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL              ++GG S+K      ++L    FD  V+ S D+W
Sbjct  138  RLGGRSGGSDSGRQSYSSGGGSKKD----VIDLTDDTFDKNVLNSDDVW  182


 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 61/106 (58%), Gaps = 4/106 (4%)
 Frame = +3

Query  174  GPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLK----GVAT  341
            G    V+ L    F   VLNS+ V  VEF+APWCGHCK L P +   A+ +K    G   
Sbjct  158  GSKKDVIDLTDDTFDKNVLNSDDVWFVEFYAPWCGHCKNLEPEWAAAATEIKQQTNGKVK  217

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            +AA+DA     LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  218  LAAVDATVSQVLASRYGIRGFPTIKIFQKGEDPVDYDGGRTKADIV  263



>ref|XP_011363442.1| PREDICTED: protein disulfide-isomerase A6 [Pteropus vampyrus]
Length=650

 Score =   135 bits (339),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 78/164 (48%), Positives = 107/164 (65%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ S  + LVEF+APWCGHC+ LTP ++KVA+ LK V  
Sbjct  228  NGLYSSSDDVIELTPSNFNQEVIQSGSLWLVEFYAPWCGHCQRLTPEWKKVATALKDVVK  287

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQGAR ++++VD   + +R L+KD
Sbjct  288  VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNKPEDYQGARTSEAIVDAALSAVRQLVKD  347

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G+  G      G S+ S     +EL   +FD  V+ S D+W
Sbjct  348  RLAGRGGGYSSGRQGRSESSSKKDVIELTDDSFDKNVLDSDDVW  391


 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 65/101 (64%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   +F   VL+S+ V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  372  VIELTDDSFDKNVLDSDDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  431

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A A+  L+  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  432  ATANQVLSSRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  472



>ref|NP_001007974.1| protein disulfide-isomerase A6 precursor [Xenopus (Silurana) 
tropicalis]
 gb|AAH80483.1| protein disulfide isomerase family A, member 6 [Xenopus (Silurana) 
tropicalis]
Length=441

 Score =   133 bits (335),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 73/169 (43%), Positives = 107/169 (63%), Gaps = 16/169 (9%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            +A+Y PS  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LKGV  
Sbjct  18   SAMYSPSDDVIELTPSNFNKEVIQSDSLWLVEFYAPWCGHCQRLTPDWKKAATALKGVVK  77

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            + A++AD H SL  +YG++GFPTIKVF   K +P DYQG R A +++D   + +R+ +KD
Sbjct  78   IGAVNADQHQSLGGQYGVRGFPTIKVFGANKNKPDDYQGGRTADAIIDAALSSLRSFVKD  137

Query  519  RL-----------DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL              ++GG S+K      ++L    FD  V+ S D+W
Sbjct  138  RLGGRSGGSDSGRQSYSSGGGSKKD----VIDLTDDTFDKNVLNSDDVW  182


 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 61/106 (58%), Gaps = 4/106 (4%)
 Frame = +3

Query  174  GPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLK----GVAT  341
            G    V+ L    F   VLNS+ V  VEF+APWCGHCK L P +   A+ +K    G   
Sbjct  158  GSKKDVIDLTDDTFDKNVLNSDDVWFVEFYAPWCGHCKNLEPEWAAAATEIKQQTNGKVK  217

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            +AA+DA     LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  218  LAAVDATVSQVLASRYGIRGFPTIKIFQKGEDPVDYDGGRTKPDIV  263



>ref|XP_004582659.1| PREDICTED: protein disulfide-isomerase A6 isoform X1 [Ochotona 
princeps]
Length=442

 Score =   133 bits (334),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 75/164 (46%), Positives = 107/164 (65%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  20   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  79

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  80   VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKD  139

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G+++       G S  S     +EL   +FD+ V+ S+D+W
Sbjct  140  RLGGRSSSYSSGKQGRSDSSSKKDVIELTDDSFDENVLDSEDIW  183


 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   +F   VL+S  + +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  164  VIELTDDSFDENVLDSEDIWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  223

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  L+  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  224  ATVNQLLSSRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  264



>gb|EFB24563.1| hypothetical protein PANDA_010457, partial [Ailuropoda melanoleuca]
Length=413

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 106/164 (65%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L P+NF  +V+ S+ + LVEF+APWCGHC+ LTP ++KVA+ LK V  
Sbjct  12   NGLYSSSDDVIELTPTNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKVATALKDVVK  71

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  72   VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKD  131

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G+  G      G S+ S     VEL   +FD  V+ S D+W
Sbjct  132  RLGGRGGGYSSGKQGRSESSSKKDVVELTDDSFDKNVLDSDDVW  175


 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 64/101 (63%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   +F   VL+S+ V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  156  VVELTDDSFDKNVLDSDDVWMVEFYAPWCGHCKNLEPEWAAAATEVREQTKGKVKLAAVD  215

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    ++
Sbjct  216  ATVNQLLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDII  256



>ref|XP_002408975.1| protein disulfide isomerase 1, putative [Ixodes scapularis]
 gb|EEC04085.1| protein disulfide isomerase 1, putative [Ixodes scapularis]
Length=435

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 108/157 (69%), Gaps = 5/157 (3%)
 Frame = +3

Query  168  LYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVa  347
            LYGP T V+ L+ +NF+++V++S+ V +VEFFAPWCGHC++  P Y K A+ LKGV  V 
Sbjct  19   LYGPHTEVVDLSSANFRNRVVDSDEVWIVEFFAPWCGHCQSFAPEYIKAAAALKGVVKVG  78

Query  348  aldadahsslaQEYGIKGFPTIKVF-VPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRL  524
            A+DAD   SLA +YG++GFPT+K+F V    P D+ GAR A+ +      +++ ++  RL
Sbjct  79   AVDADKDKSLAGQYGVRGFPTVKIFGVNKNSPTDFNGARTAEGVASAGLQELKKVVDQRL  138

Query  525  DGK-ATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
              K ++GGS  KS+    VEL+  NF++LV+ S+DLW
Sbjct  139  GKKTSSGGSKGKSD---VVELDESNFEELVLDSEDLW  172


 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 69/106 (65%), Gaps = 4/106 (4%)
 Frame = +3

Query  183  TPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldad  362
            + V++L+ SNF+  VL+S  + LVEFFAPWCGHCK L P +EK A+ LKG   + A+DA 
Sbjct  151  SDVVELDESNFEELVLDSEDLWLVEFFAPWCGHCKNLAPHWEKAATELKGKVKLGAVDAT  210

Query  363  ahsslaQEYGIKGFPTIKVFVPGKQPV----DYQGAREAKSMVDFV  488
             H  LA +YGIKGFPTIK F  GK+      +Y G R A  +V + 
Sbjct  211  VHQGLASKYGIKGFPTIKFFPGGKKDSSSAEEYNGGRTADDIVHWA  256



>ref|XP_011820677.1| PREDICTED: protein disulfide-isomerase A6 isoform X2 [Mandrillus 
leucophaeus]
Length=437

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 107/164 (65%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  15   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  74

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  75   VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKD  134

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G++ G      G S  S     +EL   +FD+ V+ S+D+W
Sbjct  135  RLGGRSGGYSSGKQGRSDSSSKKDVIELTDDSFDENVLDSEDVW  178


 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   +F   VL+S  V +VEF+APWCGHCK L P +   AS +    KG   +AA+D
Sbjct  159  VIELTDDSFDENVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVD  218

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  219  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  259



>ref|XP_009181940.1| PREDICTED: protein disulfide-isomerase A6 isoform X2 [Papio anubis]
Length=437

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 107/164 (65%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  15   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  74

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  75   VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKD  134

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G++ G      G S  S     +EL   +FD+ V+ S+D+W
Sbjct  135  RLGGRSGGYSSGKQGRSDSSSKKDVIELTDDSFDENVLDSEDVW  178


 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   +F   VL+S  V +VEF+APWCGHCK L P +   AS +    KG   +AA+D
Sbjct  159  VIELTDDSFDENVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVD  218

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  219  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  259



>ref|NP_001253564.1| protein disulfide-isomerase A6 precursor [Macaca mulatta]
 ref|XP_005576620.1| PREDICTED: protein disulfide-isomerase A6 [Macaca fascicularis]
 ref|XP_007969684.1| PREDICTED: protein disulfide-isomerase A6 isoform X1 [Chlorocebus 
sabaeus]
 ref|XP_007969685.1| PREDICTED: protein disulfide-isomerase A6 isoform X2 [Chlorocebus 
sabaeus]
 ref|XP_011747684.1| PREDICTED: protein disulfide-isomerase A6 [Macaca nemestrina]
 ref|XP_011900023.1| PREDICTED: protein disulfide-isomerase A6 [Cercocebus atys]
Length=440

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 107/164 (65%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  18   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  77

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  78   VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKD  137

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G++ G      G S  S     +EL   +FD+ V+ S+D+W
Sbjct  138  RLGGRSGGYSSGKQGRSDSSSKKDVIELTDDSFDENVLDSEDVW  181


 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   +F   VL+S  V +VEF+APWCGHCK L P +   AS +    KG   +AA+D
Sbjct  162  VIELTDDSFDENVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVD  221

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  222  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  262



>ref|NP_001182048.1| protein disulfide-isomerase A6 precursor [Sus scrofa]
 dbj|BAJ11758.1| protein disulfide isomerase P5 [Sus scrofa]
Length=440

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 106/164 (65%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++KVA+ LK V  
Sbjct  18   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKVATALKDVVK  77

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  78   VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKD  137

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G+  G      G S+ S     +EL    FD  V+ S+D+W
Sbjct  138  RLGGRGGGYSSGKQGRSEGSGKKDVIELTDDTFDKNVLDSEDVW  181


 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 62/101 (61%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L    F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  162  VIELTDDTFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  221

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  222  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  262



>ref|XP_003908325.1| PREDICTED: protein disulfide-isomerase A6 isoform X1 [Papio anubis]
Length=440

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 107/164 (65%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  18   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  77

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  78   VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKD  137

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G++ G      G S  S     +EL   +FD+ V+ S+D+W
Sbjct  138  RLGGRSGGYSSGKQGRSDSSSKKDVIELTDDSFDENVLDSEDVW  181


 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   +F   VL+S  V +VEF+APWCGHCK L P +   AS +    KG   +AA+D
Sbjct  162  VIELTDDSFDENVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVD  221

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  222  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  262



>ref|XP_007933283.1| PREDICTED: protein disulfide-isomerase A6 [Orycteropus afer afer]
Length=440

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 107/164 (65%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            + LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++KVA+ LKG+  
Sbjct  18   SGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQKLTPEWKKVATALKGIVR  77

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R A+++VD   +  R ++KD
Sbjct  78   VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTAEAIVDAAVSAARQIVKD  137

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G++ G      G S  S     +EL    FD  V+ S+D+W
Sbjct  138  RLGGRSGGYSSGKQGRSDSSSKKDVIELTDDTFDKNVLDSEDVW  181


 Score = 88.2 bits (217),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 64/101 (63%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L    F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  162  VIELTDDTFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  221

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A A+  LA  YGI+GFPTIK+F  G+ PVDY G R   ++V
Sbjct  222  ATANQMLASRYGIRGFPTIKIFQKGESPVDYDGGRSKSNIV  262



>ref|XP_004401842.1| PREDICTED: protein disulfide-isomerase A6 [Odobenus rosmarus 
divergens]
Length=440

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 78/164 (48%), Positives = 106/164 (65%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L+PSNF  +V+ S  + LVEF+APWCGHC+ LTP ++KVA+ LK V  
Sbjct  18   NGLYSSSDDVIELSPSNFNREVIQSASLWLVEFYAPWCGHCQRLTPEWKKVATALKDVVK  77

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  78   VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKD  137

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL GK  G      G S+ S     +EL   +FD  V+ S D+W
Sbjct  138  RLGGKGGGYSSGKQGRSESSSKKDVIELTDDSFDKNVLDSDDVW  181


 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   +F   VL+S+ V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  162  VIELTDDSFDKNVLDSDDVWMVEFYAPWCGHCKNLEPEWAAAATEVKDQTKGKVKLAAVD  221

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  LA  Y I+GFPTIK+F  G+ PVDY G R    +V
Sbjct  222  ATVNQLLASRYEIRGFPTIKIFQKGESPVDYDGGRTRSDIV  262



>ref|XP_010377997.1| PREDICTED: protein disulfide-isomerase A6 [Rhinopithecus roxellana]
Length=512

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 107/164 (65%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  90   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  149

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  150  VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKD  209

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G++ G      G S  S     +EL   +FD+ V+ S+D+W
Sbjct  210  RLGGRSGGYSSGKQGRSDSSSKKDVIELTDDSFDENVLDSEDVW  253


 Score = 89.4 bits (220),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   +F   VL+S  V +VEF+APWCGHCK L P +   AS +    KG   +AA+D
Sbjct  234  VIELTDDSFDENVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVD  293

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  294  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  334



>gb|EHH21891.1| hypothetical protein EGK_05054 [Macaca mulatta]
 gb|EHH55361.1| hypothetical protein EGM_04558 [Macaca fascicularis]
Length=508

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 107/164 (65%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  86   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  145

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  146  VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKD  205

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G++ G      G S  S     +EL   +FD+ V+ S+D+W
Sbjct  206  RLGGRSGGYSSGKQGRSDSSSKKDVIELTDDSFDENVLDSEDVW  249


 Score = 89.0 bits (219),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   +F   VL+S  V +VEF+APWCGHCK L P +   AS +    KG   +AA+D
Sbjct  230  VIELTDDSFDENVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVD  289

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  290  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  330



>ref|XP_003971872.1| PREDICTED: protein disulfide-isomerase A6 isoform X1 [Takifugu 
rubripes]
Length=442

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 109/164 (66%), Gaps = 8/164 (5%)
 Frame = +3

Query  165  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  344
            A Y P   V++L PSNF  +V+ S+ + LVEF+APWCGHC+ L P ++K A+ LKG+  V
Sbjct  19   AFYSPDDDVVELTPSNFNKEVIQSDALWLVEFYAPWCGHCRNLVPDWKKAAAALKGIVKV  78

Query  345  aaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
             A+DAD H SL  +YG++GFPTIK+F   K +P +YQG R ++++VD   + +R+L+K+R
Sbjct  79   GAVDADQHKSLGGQYGVRGFPTIKIFGANKNKPEEYQGGRSSQAIVDGALSALRSLVKER  138

Query  522  LDGKATGGSSQKSEPSAS-------VELNSRNFDDLVVKSKDLW  632
            L G ++G    K + S S       VEL   NFD +V++S ++W
Sbjct  139  LSGGSSGSGYNKQQQSGSGGSKKDVVELTDDNFDQMVLESGEVW  182


 Score = 91.3 bits (225),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 64/107 (60%), Gaps = 4/107 (4%)
 Frame = +3

Query  174  GPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVAT  341
            G    V++L   NF   VL S  V +VEFFAPWCGHCK L P +   A+ +    KG   
Sbjct  158  GSKKDVVELTDDNFDQMVLESGEVWMVEFFAPWCGHCKNLEPEWTAAATAVKEQTKGKVR  217

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVD  482
            + A+DA  H  ++  YGI+GFPTIK+F  G++P DYQG R    +++
Sbjct  218  LGAVDATVHQVVSSRYGIRGFPTIKIFRKGEEPEDYQGGRTRADIIE  264



>ref|XP_011343321.1| PREDICTED: protein disulfide-isomerase A6 isoform X2 [Cerapachys 
biroi]
 gb|EZA51474.1| Protein disulfide-isomerase A6 [Cerapachys biroi]
Length=412

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/155 (43%), Positives = 98/155 (63%), Gaps = 0/155 (0%)
 Frame = +3

Query  168  LYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVa  347
            +Y  ++ V+ L P+NF + VLNS+ + +VEF+APWCGHC+ L P Y+K A+ LKG+  V 
Sbjct  1    MYASNSAVVDLRPNNFDNLVLNSDHIWVVEFYAPWCGHCQQLMPEYDKAATALKGIIKVG  60

Query  348  aldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRLD  527
            A++AD H SL  +YG++GFPTIK+F    +P DY G R A  +++          +  L 
Sbjct  61   AVNADEHKSLGSKYGVRGFPTIKIFGLDSKPEDYNGPRTASGIIEAALNAAGQKARKALG  120

Query  528  GKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            GK TGG S+  +    +EL   NF+ LV+ S+D+W
Sbjct  121  GKKTGGDSKSKDSKDVIELTDENFEKLVLNSEDMW  155


 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 66/107 (62%), Gaps = 4/107 (4%)
 Frame = +3

Query  180  STPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaalda  359
            S  V++L   NF+  VLNS  + LVEF+APWCGHCK L P +   A+ LKG   + ALDA
Sbjct  133  SKDVIELTDENFEKLVLNSEDMWLVEFYAPWCGHCKNLAPEWAAAATELKGKVKLGALDA  192

Query  360  dahsslaQEYGIKGFPTIKVFVPGKQPVD----YQGAREAKSMVDFV  488
              ++  A +Y IKG+PTIK F PGK+  D    Y G R +  +V++ 
Sbjct  193  TVNTVKASKYEIKGYPTIKYFTPGKKDADSVQEYDGGRTSGDIVNWA  239



>ref|XP_011343320.1| PREDICTED: protein disulfide-isomerase A6 isoform X1 [Cerapachys 
biroi]
Length=439

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/155 (43%), Positives = 98/155 (63%), Gaps = 0/155 (0%)
 Frame = +3

Query  168  LYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVa  347
            +Y  ++ V+ L P+NF + VLNS+ + +VEF+APWCGHC+ L P Y+K A+ LKG+  V 
Sbjct  28   MYASNSAVVDLRPNNFDNLVLNSDHIWVVEFYAPWCGHCQQLMPEYDKAATALKGIIKVG  87

Query  348  aldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRLD  527
            A++AD H SL  +YG++GFPTIK+F    +P DY G R A  +++          +  L 
Sbjct  88   AVNADEHKSLGSKYGVRGFPTIKIFGLDSKPEDYNGPRTASGIIEAALNAAGQKARKALG  147

Query  528  GKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            GK TGG S+  +    +EL   NF+ LV+ S+D+W
Sbjct  148  GKKTGGDSKSKDSKDVIELTDENFEKLVLNSEDMW  182


 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 66/107 (62%), Gaps = 4/107 (4%)
 Frame = +3

Query  180  STPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaalda  359
            S  V++L   NF+  VLNS  + LVEF+APWCGHCK L P +   A+ LKG   + ALDA
Sbjct  160  SKDVIELTDENFEKLVLNSEDMWLVEFYAPWCGHCKNLAPEWAAAATELKGKVKLGALDA  219

Query  360  dahsslaQEYGIKGFPTIKVFVPGKQPVD----YQGAREAKSMVDFV  488
              ++  A +Y IKG+PTIK F PGK+  D    Y G R +  +V++ 
Sbjct  220  TVNTVKASKYEIKGYPTIKYFTPGKKDADSVQEYDGGRTSGDIVNWA  266



>ref|XP_006745860.1| PREDICTED: protein disulfide-isomerase A6 [Leptonychotes weddellii]
Length=432

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 105/164 (64%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ S  + LVEF+APWCGHC+ LTP ++KVA+ LK V  
Sbjct  10   NGLYSSSDDVIELTPSNFNREVIQSASLWLVEFYAPWCGHCQRLTPEWKKVATALKDVVK  69

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  70   VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKD  129

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G+  G      G S+ S     +EL   +FD  V+ S D+W
Sbjct  130  RLGGRGGGYSSGKQGRSESSSKKDVIELTDDSFDKNVLDSDDVW  173


 Score = 85.5 bits (210),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   +F   VL+S+ V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  154  VIELTDDSFDKNVLDSDDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  213

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  LA  Y I+GFPTIK+F  G+ PVDY G R    +V
Sbjct  214  ATGNQLLASRYEIRGFPTIKIFQKGESPVDYDGGRTRSDIV  254



>ref|XP_008686251.1| PREDICTED: protein disulfide-isomerase A6 [Ursus maritimus]
Length=540

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 106/164 (65%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L P+NF  +V+ S+ + LVEF+APWCGHC+ LTP ++KVA+ LK V  
Sbjct  103  NGLYSSSDDVIELTPTNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKVATALKDVVK  162

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  163  VGAVDADRHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKD  222

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G+  G      G S+ S     VEL   +FD  V+ S D+W
Sbjct  223  RLGGRGGGYSSGKQGRSESSSKKDVVELTDDSFDKNVLDSDDVW  266


 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 64/101 (63%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   +F   VL+S+ V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  247  VVELTDDSFDKNVLDSDDVWMVEFYAPWCGHCKNLEPEWAAAATEVKERTKGKVKLAAVD  306

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A A   LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  307  ATASQLLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  347



>ref|XP_011820676.1| PREDICTED: protein disulfide-isomerase A6 isoform X1 [Mandrillus 
leucophaeus]
Length=488

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 107/164 (65%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  66   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  125

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  126  VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKD  185

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G++ G      G S  S     +EL   +FD+ V+ S+D+W
Sbjct  186  RLGGRSGGYSSGKQGRSDSSSKKDVIELTDDSFDENVLDSEDVW  229


 Score = 89.0 bits (219),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   +F   VL+S  V +VEF+APWCGHCK L P +   AS +    KG   +AA+D
Sbjct  210  VIELTDDSFDENVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVD  269

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  270  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  310



>gb|AAI48887.1| PDIA6 protein [Bos taurus]
Length=453

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 105/164 (64%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  31   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  90

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  91   VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNKPEDYQGGRTGEAIVDAALSALRQLVKD  150

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G+ +G      G    S     +EL   NFD  V+ S+D+W
Sbjct  151  RLGGRGSGYSSGKQGRGDSSSKKDVIELTDDNFDKNVLDSEDVW  194


 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   NF   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  175  VIELTDDNFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  234

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  235  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  275



>ref|XP_002921563.2| PREDICTED: protein disulfide-isomerase A6 [Ailuropoda melanoleuca]
Length=534

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 106/164 (65%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L P+NF  +V+ S+ + LVEF+APWCGHC+ LTP ++KVA+ LK V  
Sbjct  112  NGLYSSSDDVIELTPTNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKVATALKDVVK  171

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  172  VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKD  231

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G+  G      G S+ S     VEL   +FD  V+ S D+W
Sbjct  232  RLGGRGGGYSSGKQGRSESSSKKDVVELTDDSFDKNVLDSDDVW  275


 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 64/101 (63%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   +F   VL+S+ V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  256  VVELTDDSFDKNVLDSDDVWMVEFYAPWCGHCKNLEPEWAAAATEVREQTKGKVKLAAVD  315

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    ++
Sbjct  316  ATVNQLLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDII  356



>ref|NP_001193274.1| protein disulfide-isomerase A6 precursor [Bos taurus]
 ref|XP_005892611.1| PREDICTED: protein disulfide-isomerase A6 [Bos mutus]
 ref|XP_011975252.1| PREDICTED: protein disulfide-isomerase A6 isoform X2 [Ovis aries 
musimon]
Length=440

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 105/164 (64%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  18   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  77

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  78   VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNKPEDYQGGRTGEAIVDAALSALRQLVKD  137

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G+ +G      G    S     +EL   NFD  V+ S+D+W
Sbjct  138  RLGGRGSGYSSGKQGRGDSSSKKDVIELTDDNFDKNVLDSEDVW  181


 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   NF   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  162  VIELTDDNFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  221

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  222  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  262



>gb|ELR58675.1| Protein disulfide-isomerase A6, partial [Bos mutus]
Length=444

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 105/164 (64%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  22   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  81

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  82   VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNKPEDYQGGRTGEAIVDAALSALRQLVKD  141

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G+ +G      G    S     +EL   NFD  V+ S+D+W
Sbjct  142  RLGGRGSGYSSGKQGRGDSSSKKDVIELTDDNFDKNVLDSEDVW  185


 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   NF   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  166  VIELTDDNFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  225

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  226  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  266



>ref|XP_004005734.1| PREDICTED: protein disulfide-isomerase A6 isoform X1 [Ovis aries]
Length=440

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 105/164 (64%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  18   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  77

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  78   VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNKPEDYQGGRTGEAIVDAALSALRQLVKD  137

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G+ +G      G    S     +EL   NFD  V+ S+D+W
Sbjct  138  RLGGRGSGYSSGKQGRGDSSSKKDVIELTDDNFDKNVLDSEDVW  181


 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   NF   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  162  VIELTDDNFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  221

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  222  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  262



>ref|XP_004686132.1| PREDICTED: protein disulfide-isomerase A6 [Condylura cristata]
Length=492

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 104/164 (63%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            + LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++KVA+ LKGV  
Sbjct  70   SGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKVATALKGVVK  129

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R   ++VD     +R L+KD
Sbjct  130  VGAVDADKHQSLGGQYGVQGFPTIKIFGANKNRPEDYQGGRTGDAIVDAALGTLRQLVKD  189

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G+  G      G  + S     +EL    FD+ V+ S D+W
Sbjct  190  RLGGRGGGYSSGKQGRGESSSKKDVIELTDDTFDENVLDSDDVW  233


 Score = 89.0 bits (219),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 64/101 (63%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L    F   VL+S+ V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  214  VIELTDDTFDENVLDSDDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  273

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A A+ +L   YGI+GFPTIKVF  G+ PVDY G R    +V
Sbjct  274  ATANQALTSRYGIRGFPTIKVFQKGESPVDYDGGRTRSDIV  314



>ref|XP_011508610.1| PREDICTED: protein disulfide-isomerase A6 isoform X1 [Homo sapiens]
Length=402

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 106/164 (65%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  18   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  77

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  78   VGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKD  137

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G++ G      G S  S     +EL   +FD  V+ S+D+W
Sbjct  138  RLGGRSGGYSSGKQGRSDSSSKKDVIELTDDSFDKNVLDSEDVW  181


 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   +F   VL+S  V +VEF+APWCGHCK L P +   AS +    KG   +AA+D
Sbjct  162  VIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVD  221

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  222  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  262



>emb|CDP96040.1| Protein BM-TAG-320, isoform b [Brugia malayi]
Length=435

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 105/162 (65%), Gaps = 5/162 (3%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            +ALY  +  V+QL  SNF +KVL S+ + +VEFFAPWCGHC+ L P Y K+A+ LKG+  
Sbjct  14   HALYDGNRNVIQLTESNFNNKVLKSDEIWIVEFFAPWCGHCQKLVPEYMKLANALKGIFK  73

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+D   H S+  +Y I+GFPTIK+F   K+ P+DYQG R A+++ D +  ++R  +  
Sbjct  74   VGAVDMTQHQSVGAQYNIQGFPTIKIFGADKKVPLDYQGPRTAQAITDSLINELRKTVNA  133

Query  519  RL----DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            +L      ++ G + +KS     +EL   NF+++V+ SKD+W
Sbjct  134  KLGISSSSQSRGANDKKSSGKYVIELTDSNFEEMVLHSKDIW  175


 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 65/102 (64%), Gaps = 3/102 (3%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadah  368
            V++L  SNF+  VL+S  + LVEFFAPWCGHCKAL P +E  AS L G   V ALDA  H
Sbjct  156  VIELTDSNFEEMVLHSKDIWLVEFFAPWCGHCKALKPHWEMAASELAGKVKVGALDATVH  215

Query  369  sslaQEYGIKGFPTIKVFVPGKQPV---DYQGAREAKSMVDF  485
             ++A  +GIKGFPTIK F PG       DY G R +  +V +
Sbjct  216  QAMASHFGIKGFPTIKYFAPGSSASDAEDYVGGRTSDDIVQY  257



>ref|XP_010304195.1| PREDICTED: protein disulfide-isomerase A6 [Balearica regulorum 
gibbericeps]
Length=444

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 74/169 (44%), Positives = 104/169 (62%), Gaps = 16/169 (9%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L P+NF  +V+ S  + LVEF+APWCGHC+ LTP ++K A+ LKGV  
Sbjct  21   NGLYSASDDVIELTPTNFNKEVIQSESLWLVEFYAPWCGHCQRLTPEWKKAATALKGVVK  80

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPV-DYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K    DYQG R + ++VD   + +R+L+KD
Sbjct  81   VGAVDADKHQSLGGQYGVRGFPTIKIFGANKNKAEDYQGGRTSDAIVDAALSALRSLVKD  140

Query  519  RL-----------DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL            G+ +GG  +K      +EL   +FD  V+ S D+W
Sbjct  141  RLSGRSGGYSSGKQGRESGGGDKKD----VIELTDDSFDKNVINSDDVW  185


 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 66/106 (62%), Gaps = 4/106 (4%)
 Frame = +3

Query  174  GPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVAT  341
            G    V++L   +F   V+NS+ V +VEF+APWCGHCK L P +   A+ +    KG   
Sbjct  161  GDKKDVIELTDDSFDKNVINSDDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVK  220

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            +AA+DA  +  LA  YGI+GFPTIK+F  G+ PVDY G+R    ++
Sbjct  221  LAAVDATVNQMLAGRYGIRGFPTIKIFQKGEDPVDYDGSRTRSDII  266



>gb|KFO12540.1| Protein disulfide-isomerase A6, partial [Balearica regulorum 
gibbericeps]
Length=440

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 74/169 (44%), Positives = 104/169 (62%), Gaps = 16/169 (9%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L P+NF  +V+ S  + LVEF+APWCGHC+ LTP ++K A+ LKGV  
Sbjct  17   NGLYSASDDVIELTPTNFNKEVIQSESLWLVEFYAPWCGHCQRLTPEWKKAATALKGVVK  76

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPV-DYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K    DYQG R + ++VD   + +R+L+KD
Sbjct  77   VGAVDADKHQSLGGQYGVRGFPTIKIFGANKNKAEDYQGGRTSDAIVDAALSALRSLVKD  136

Query  519  RL-----------DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL            G+ +GG  +K      +EL   +FD  V+ S D+W
Sbjct  137  RLSGRSGGYSSGKQGRESGGGDKKD----VIELTDDSFDKNVINSDDVW  181


 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 66/106 (62%), Gaps = 4/106 (4%)
 Frame = +3

Query  174  GPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVAT  341
            G    V++L   +F   V+NS+ V +VEF+APWCGHCK L P +   A+ +    KG   
Sbjct  157  GDKKDVIELTDDSFDKNVINSDDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVK  216

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            +AA+DA  +  LA  YGI+GFPTIK+F  G+ PVDY G+R    ++
Sbjct  217  LAAVDATVNQMLAGRYGIRGFPTIKIFQKGEDPVDYDGSRTRSDII  262



>ref|XP_008570350.1| PREDICTED: protein disulfide-isomerase A6 [Galeopterus variegatus]
Length=460

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 105/164 (64%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  +  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  38   NGLYSSTDDVIELTPSNFNQEVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  97

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD     +R L+KD
Sbjct  98   VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNKPEDYQGGRTGEAIVDAALNAVRQLVKD  157

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G++ G      G S  S     +EL   NFD  V+ S+D+W
Sbjct  158  RLGGRSGGYSSGKQGRSDSSSKKDVIELTDDNFDKNVLDSEDVW  201


 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   NF   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  182  VIELTDDNFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  241

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  242  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  282



>ref|XP_009961799.1| PREDICTED: protein disulfide-isomerase A6 [Tyto alba]
Length=444

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 74/169 (44%), Positives = 104/169 (62%), Gaps = 16/169 (9%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N+LY  S  V++L P+NF  +V+ S  + LVEF+APWCGHC+ LTP ++K A+ LKGV  
Sbjct  21   NSLYSSSDDVIELTPTNFNKEVIQSESLWLVEFYAPWCGHCQRLTPEWKKAATALKGVVK  80

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPV-DYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K    DYQG R + ++VD   + +R+L+KD
Sbjct  81   VGAVDADKHQSLGGQYGVRGFPTIKIFGANKNKAEDYQGGRTSDAIVDAALSALRSLVKD  140

Query  519  RL-----------DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL             + +GG  +K      +EL   NFD  V+ S D+W
Sbjct  141  RLSGRSGGYSSGKQSRESGGGDKKD----VIELTDDNFDKNVINSDDVW  185


 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 65/106 (61%), Gaps = 4/106 (4%)
 Frame = +3

Query  174  GPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVAT  341
            G    V++L   NF   V+NS+ V +VEF+APWCGHCK L P +   A+ +    KG   
Sbjct  161  GDKKDVIELTDDNFDKNVINSDDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVK  220

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            +AA+DA  +  LA  YGI+GFPTIK+F  G+ PVDY G R    ++
Sbjct  221  LAAVDATVNQMLASRYGIRGFPTIKIFQKGEDPVDYDGGRTRSDII  266



>ref|XP_003215468.2| PREDICTED: protein disulfide-isomerase A6 [Anolis carolinensis]
Length=490

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 106/170 (62%), Gaps = 17/170 (10%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N+LY  S  V++L P+NF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LKGV  
Sbjct  64   NSLYSSSDDVIELTPTNFNREVVQSDNLWLVEFYAPWCGHCQRLTPEWKKAATALKGVVK  123

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPV-DYQGAREAKSMVDFVKAQIRNLLKD  518
            + A+DAD H SL  +YG+KGFPTIK+F   K    DYQGAR + ++VD   + +R+L+KD
Sbjct  124  IGAVDADKHQSLGGQYGVKGFPTIKIFGANKNKAEDYQGARTSDAIVDAALSALRSLVKD  183

Query  519  RL------------DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL              + +GGS +K      +EL    FD  V+ S D+W
Sbjct  184  RLGGRGGGYSSGKQSSRESGGSGKKD----VIELTDDTFDKNVLDSNDVW  229


 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLK----GVATVaald  356
            V++L    F   VL+SN V LVEF+APWCGHCK L P +   A+ +K    G   +AA+D
Sbjct  210  VIELTDDTFDKNVLDSNDVWLVEFYAPWCGHCKNLEPEWAAAATEVKEQTNGKVKLAAVD  269

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  +A  YGI+GFPTIK+F  G+ P+DY G R    +V
Sbjct  270  ATVNQVVAGRYGIRGFPTIKIFQKGEDPIDYDGGRTKTDIV  310



>ref|XP_004028893.1| PREDICTED: protein disulfide-isomerase A6 isoform 2 [Gorilla 
gorilla gorilla]
Length=437

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 106/164 (65%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  15   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  74

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  75   VGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKD  134

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G++ G      G S  S     +EL   +FD  V+ S+D+W
Sbjct  135  RLGGRSGGYSSGKQGRSDSSSKKDVIELTDDSFDKNVLDSEDVW  178


 Score = 89.0 bits (219),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   +F   VL+S  V +VEF+APWCGHCK L P +   AS +    KG   +AA+D
Sbjct  159  VIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVD  218

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  219  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  259



>gb|KHJ46223.1| protein disulfide-isomerase domain protein [Trichuris suis]
Length=434

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/162 (40%), Positives = 102/162 (63%), Gaps = 5/162 (3%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            + LY  +  V++L  SNF+SKV++S+ V +VEF+APWCGHC+   P + K A  LKG+  
Sbjct  18   STLYSGNNDVVELTASNFQSKVIDSDAVWIVEFYAPWCGHCQNFAPEFAKAAKALKGIVK  77

Query  342  VaaldadahsslaQEYGIKGFPTIKVF-VPGKQPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V  +D D H S+   Y ++GFPT+K+F +   +P D+QG R A+++ D    +++ L++ 
Sbjct  78   VGGVDMDKHGSVGGPYNVQGFPTVKIFGIDKNKPTDFQGGRTAQALADAAINEVKRLVQM  137

Query  519  RLDGKATGGSSQKSEPSAS----VELNSRNFDDLVVKSKDLW  632
            RL G+  G  S+KS  + S    +EL   NF+D++  S D+W
Sbjct  138  RLTGRRPGADSKKSSSTGSAKDVIELTDSNFEDMITNSDDMW  179


 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 74/113 (65%), Gaps = 4/113 (4%)
 Frame = +3

Query  174  GPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaal  353
            G +  V++L  SNF+  + NS+ + LVEFFAPWCGHCK L P ++  A+ LKG   VAA+
Sbjct  155  GSAKDVIELTDSNFEDMITNSDDMWLVEFFAPWCGHCKNLAPHWQSAATQLKGRVKVAAI  214

Query  354  dadahsslaQEYGIKGFPTIKVFVPGKQPVD----YQGAREAKSMVDFVKAQI  500
            DA  ++ +AQ +GI+GFPTIK+F  G + +D    Y G R A  +V + + ++
Sbjct  215  DATVNTVMAQRFGIQGFPTIKMFPSGAKSLDDAVEYTGGRSASDIVQWAEEKL  267



>ref|NP_001269636.1| protein disulfide-isomerase A6 isoform e precursor [Homo sapiens]
 dbj|BAH11740.1| unnamed protein product [Homo sapiens]
Length=437

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 106/164 (65%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  15   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  74

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  75   VGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKD  134

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G++ G      G S  S     +EL   +FD  V+ S+D+W
Sbjct  135  RLGGRSGGYSSGKQGRSDSSSKKDVIELTDDSFDKNVLDSEDVW  178


 Score = 89.0 bits (219),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   +F   VL+S  V +VEF+APWCGHCK L P +   AS +    KG   +AA+D
Sbjct  159  VIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVD  218

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  219  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  259



>ref|XP_006138598.1| PREDICTED: protein disulfide-isomerase A6 [Pelodiscus sinensis]
Length=428

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 73/169 (43%), Positives = 109/169 (64%), Gaps = 17/169 (10%)
 Frame = +3

Query  165  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  344
            +LY  S  V++L P+NF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LKG+  V
Sbjct  5    SLYSSSDDVIELTPTNFNKEVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKGIVKV  64

Query  345  aaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
             A+DAD H SL  +YG++GFP+IK+F   K +P DYQG R ++++VD   + +R+L+KDR
Sbjct  65   GAVDADKHQSLGGQYGVRGFPSIKIFGSNKNKPEDYQGGRTSEAIVDAALSSLRSLVKDR  124

Query  522  L------------DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            L              + +GGS +K+     +EL   +FD  VV S D+W
Sbjct  125  LSGRSGGHSSGKQSSRESGGSDKKN----VIELTDDSFDKNVVNSDDVW  169


 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYE----KVASVLKGVATVaald  356
            V++L   +F   V+NS+ V LVEF+APWCGHCK L P +     +V    KG   +AA+D
Sbjct  150  VIELTDDSFDKNVVNSDDVWLVEFYAPWCGHCKNLEPEWAAAAIEVEEQTKGKVKLAAVD  209

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  210  ATVNQMLASRYGIRGFPTIKIFQKGEDPVDYDGGRTKSDIV  250



>gb|KFV46902.1| Protein disulfide-isomerase A6, partial [Tyto alba]
Length=440

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 74/169 (44%), Positives = 104/169 (62%), Gaps = 16/169 (9%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N+LY  S  V++L P+NF  +V+ S  + LVEF+APWCGHC+ LTP ++K A+ LKGV  
Sbjct  17   NSLYSSSDDVIELTPTNFNKEVIQSESLWLVEFYAPWCGHCQRLTPEWKKAATALKGVVK  76

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPV-DYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K    DYQG R + ++VD   + +R+L+KD
Sbjct  77   VGAVDADKHQSLGGQYGVRGFPTIKIFGANKNKAEDYQGGRTSDAIVDAALSALRSLVKD  136

Query  519  RL-----------DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL             + +GG  +K      +EL   NFD  V+ S D+W
Sbjct  137  RLSGRSGGYSSGKQSRESGGGDKKD----VIELTDDNFDKNVINSDDVW  181


 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 65/106 (61%), Gaps = 4/106 (4%)
 Frame = +3

Query  174  GPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVAT  341
            G    V++L   NF   V+NS+ V +VEF+APWCGHCK L P +   A+ +    KG   
Sbjct  157  GDKKDVIELTDDNFDKNVINSDDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVK  216

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            +AA+DA  +  LA  YGI+GFPTIK+F  G+ PVDY G R    ++
Sbjct  217  LAAVDATVNQMLASRYGIRGFPTIKIFQKGEDPVDYDGGRTRSDII  262



>ref|XP_007456979.1| PREDICTED: protein disulfide-isomerase A6 [Lipotes vexillifer]
Length=440

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 104/164 (63%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++KVA+ LK V  
Sbjct  18   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKVATALKDVVK  77

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K QP DYQG R  +++VD     +R L+K 
Sbjct  78   VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNQPEDYQGGRTGEAIVDAALGALRQLVKG  137

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G++ G      G S  S     +EL    FD  V+ S+D+W
Sbjct  138  RLGGRSGGYSSGKQGRSDSSSKKDVIELTDDTFDKSVLDSEDVW  181


 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 61/101 (60%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L    F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  162  VIELTDDTFDKSVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  221

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  LA  Y I+GFPTIK+F  G+ PVDY G R    +V
Sbjct  222  ATINQVLASRYEIRGFPTIKIFQKGESPVDYDGGRTRSDIV  262



>ref|NP_001126483.1| protein disulfide-isomerase A6 precursor [Pongo abelii]
 sp|Q5R6T1.1|PDIA6_PONAB RecName: Full=Protein disulfide-isomerase A6; Flags: Precursor 
[Pongo abelii]
 emb|CAH92529.1| hypothetical protein [Pongo abelii]
Length=440

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 106/164 (65%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  18   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  77

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  78   VGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKD  137

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G++ G      G S  S     +EL   +FD  V+ S+D+W
Sbjct  138  RLGGQSGGYSSGKQGRSDSSSKKDVIELTDDSFDKNVLDSEDVW  181


 Score = 89.0 bits (219),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   +F   VL+S  V +VEF+APWCGHCK L P +   AS +    KG   +AA+D
Sbjct  162  VIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVD  221

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  222  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  262



>ref|XP_005366580.1| PREDICTED: protein disulfide-isomerase A6 [Microtus ochrogaster]
Length=445

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 104/164 (63%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ SN + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  23   NGLYSSSDDVIELTPSNFNREVIQSNSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  82

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  83   VGAVDADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTGEAIVDAALSALRQLVKD  142

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G++ G      G    S     +EL    FD  V+ S+D+W
Sbjct  143  RLGGRSGGYSSGKQGRGDSSSKKDVIELTDDTFDKNVLDSEDVW  186


 Score = 85.9 bits (211),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 61/101 (60%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L    F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  167  VIELTDDTFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  226

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  LA  YGI+GFPTIK+F  G+ P DY G R    +V
Sbjct  227  ATVNQVLASRYGIRGFPTIKIFQKGESPADYDGGRTRSDIV  267



>ref|NP_005733.1| protein disulfide-isomerase A6 isoform d precursor [Homo sapiens]
 sp|Q15084.1|PDIA6_HUMAN RecName: Full=Protein disulfide-isomerase A6; AltName: Full=Endoplasmic 
reticulum protein 5; Short=ER protein 5; Short=ERp5; 
AltName: Full=Protein disulfide isomerase P5; AltName: Full=Thioredoxin 
domain-containing protein 7; Flags: Precursor 
[Homo sapiens]
 dbj|BAA08450.1| human P5 [Homo sapiens]
 gb|AAH01312.1| Protein disulfide isomerase family A, member 6 [Homo sapiens]
 gb|AAY24070.1| unknown [Homo sapiens]
 gb|EAX00950.1| protein disulfide isomerase family A, member 6, isoform CRA_b 
[Homo sapiens]
 gb|ABM82112.1| protein disulfide isomerase family A, member 6 [synthetic construct]
 gb|ABM85295.1| protein disulfide isomerase family A, member 6 [synthetic construct]
 dbj|BAF82117.1| unnamed protein product [Homo sapiens]
 gb|AIC50514.1| PDIA6, partial [synthetic construct]
Length=440

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 106/164 (65%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  18   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  77

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  78   VGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKD  137

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G++ G      G S  S     +EL   +FD  V+ S+D+W
Sbjct  138  RLGGRSGGYSSGKQGRSDSSSKKDVIELTDDSFDKNVLDSEDVW  181


 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   +F   VL+S  V +VEF+APWCGHCK L P +   AS +    KG   +AA+D
Sbjct  162  VIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVD  221

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  222  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  262



>ref|NP_001233576.1| protein disulfide-isomerase A6 precursor [Pan troglodytes]
 ref|XP_003827017.1| PREDICTED: protein disulfide-isomerase A6 [Pan paniscus]
 ref|XP_004028892.1| PREDICTED: protein disulfide-isomerase A6 isoform 1 [Gorilla 
gorilla gorilla]
 dbj|BAK63728.1| protein disulfide-isomerase A6 precursor [Pan troglodytes]
Length=440

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 106/164 (65%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  18   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  77

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  78   VGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKD  137

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G++ G      G S  S     +EL   +FD  V+ S+D+W
Sbjct  138  RLGGRSGGYSSGKQGRSDSSSKKDVIELTDDSFDKNVLDSEDVW  181


 Score = 88.6 bits (218),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   +F   VL+S  V +VEF+APWCGHCK L P +   AS +    KG   +AA+D
Sbjct  162  VIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVD  221

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  222  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  262



>ref|XP_004665748.1| PREDICTED: protein disulfide-isomerase A6 [Jaculus jaculus]
Length=440

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 104/164 (63%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ SN + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  18   NGLYSSSDDVIELTPSNFNREVIQSNSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  77

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  78   VGAVDADKHQSLGGQYGVQGFPTIKIFGANKNRPEDYQGGRTGEAIVDAALSALRQLVKD  137

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G++ G      G    S     VEL   +FD  V+ S D+W
Sbjct  138  RLGGRSGGYSSGKQGRGDSSSKKDVVELTDDSFDKNVLDSDDVW  181


 Score = 88.2 bits (217),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 64/101 (63%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   +F   VL+S+ V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  162  VVELTDDSFDKNVLDSDDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  221

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  222  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTKSDIV  262



>ref|XP_008248061.1| PREDICTED: protein disulfide-isomerase A6 [Oryctolagus cuniculus]
Length=440

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 105/164 (64%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K AS LK V  
Sbjct  18   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAASALKDVVK  77

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H +L  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  78   VGAVDADKHQALGGQYGVQGFPTIKIFGANKNRPEDYQGGRTGEAIVDAALSALRQLVKD  137

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G++        G    +     +EL   +FD+ V++S D+W
Sbjct  138  RLGGRSGSHSSGRQGRGDSASKKDVIELTDDSFDENVLESDDIW  181


 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   +F   VL S+ + +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  162  VIELTDDSFDENVLESDDIWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  221

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  L+  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  222  ATVNQMLSSRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  262



>ref|XP_004274932.1| PREDICTED: protein disulfide-isomerase A6 [Orcinus orca]
 ref|XP_004310311.1| PREDICTED: protein disulfide-isomerase A6 isoform 2 [Tursiops 
truncatus]
Length=440

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 104/164 (63%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++KVA+ LK V  
Sbjct  18   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKVATALKDVVK  77

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K QP DYQG R  +++VD     +R L+K 
Sbjct  78   VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNQPEDYQGGRTGEAIVDAALGALRQLVKG  137

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G++ G      G S  S     +EL    FD  V+ S+D+W
Sbjct  138  RLGGRSGGYSSGKQGRSDSSSKKDVIELTDDTFDKSVLDSEDVW  181


 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 61/101 (60%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L    F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  162  VIELTDDTFDKSVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  221

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  LA  Y I+GFPTIK+F  G+ PVDY G R    +V
Sbjct  222  ATVNQVLASRYEIRGFPTIKIFQKGESPVDYDGGRTRSDIV  262



>ref|XP_004373116.1| PREDICTED: protein disulfide-isomerase A6 [Trichechus manatus 
latirostris]
Length=440

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 75/164 (46%), Positives = 107/164 (65%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++KVA+ LK +  
Sbjct  18   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKVATALKDIVK  77

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +  DYQG R A+++VD   + +R L+KD
Sbjct  78   VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRAEDYQGGRTAEAIVDAAISAVRQLVKD  137

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            R+ G++ G      G S+ S     +EL    FD  V+ S+D+W
Sbjct  138  RIGGRSGGYSSGRQGRSESSSKKDVIELTDDTFDKNVLDSEDVW  181


 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 62/101 (61%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L    F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  162  VIELTDDTFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  221

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  222  ATVNQVLANRYGIRGFPTIKIFQKGEPPVDYDGGRTKSDIV  262



>dbj|BAG54757.1| unnamed protein product [Homo sapiens]
Length=488

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 106/164 (65%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  66   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  125

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  126  VGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKD  185

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G++ G      G S  S     +EL   +FD  V+ S+D+W
Sbjct  186  RLGGRSGGYSSGKQGRSDSSSKKDVIELTDDSFDKNVLDSEDVW  229


 Score = 89.0 bits (219),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   +F   VL+S  V +VEF+APWCGHCK L P +   AS +    KG   +AA+D
Sbjct  210  VIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGRVKLAAVD  269

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  270  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  310



>ref|NP_001269635.1| protein disulfide-isomerase A6 isoform c [Homo sapiens]
Length=445

 Score =   131 bits (330),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 106/164 (65%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  23   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  82

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  83   VGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKD  142

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G++ G      G S  S     +EL   +FD  V+ S+D+W
Sbjct  143  RLGGRSGGYSSGKQGRSDSSSKKDVIELTDDSFDKNVLDSEDVW  186


 Score = 88.6 bits (218),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   +F   VL+S  V +VEF+APWCGHCK L P +   AS +    KG   +AA+D
Sbjct  167  VIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVD  226

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  227  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  267



>dbj|BAH12614.1| unnamed protein product [Homo sapiens]
Length=445

 Score =   131 bits (330),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 106/164 (65%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  23   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPKWKKAATALKDVVK  82

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  83   VGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKD  142

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G++ G      G S  S     +EL   +FD  V+ S+D+W
Sbjct  143  RLGGRSGGYSSGKQGRSDSSSKKDVIELTDDSFDKNVLDSEDVW  186


 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 62/101 (61%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   +F   VL+S  V +VEF+ PWCGHCK L P +   AS +    KG   +AA+D
Sbjct  167  VIELTDDSFDKNVLDSEDVWMVEFYVPWCGHCKNLEPEWAAAASEVKEQTKGRVKLAAVD  226

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  227  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  267



>gb|KFD51103.1| hypothetical protein M513_08003 [Trichuris suis]
 gb|KFD63072.1| hypothetical protein M514_08003 [Trichuris suis]
Length=461

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/162 (40%), Positives = 102/162 (63%), Gaps = 5/162 (3%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            + LY  +  V++L  SNF+SKV++S+ V +VEF+APWCGHC+   P + K A  LKG+  
Sbjct  45   STLYSGNNDVVELTASNFQSKVIDSDAVWIVEFYAPWCGHCQNFAPEFAKAAKALKGIVK  104

Query  342  VaaldadahsslaQEYGIKGFPTIKVF-VPGKQPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V  +D D H S+   Y ++GFPT+K+F +   +P D+QG R A+++ D    +++ L++ 
Sbjct  105  VGGVDMDKHGSVGGPYNVQGFPTVKIFGIDKNKPTDFQGGRTAQALADAAINEVKRLVQM  164

Query  519  RLDGKATGGSSQKSEPSAS----VELNSRNFDDLVVKSKDLW  632
            RL G+  G  S+KS  + S    +EL   NF+D++  S D+W
Sbjct  165  RLTGRRPGADSKKSSSTGSAKDVIELTDSNFEDMITNSDDMW  206


 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 74/113 (65%), Gaps = 4/113 (4%)
 Frame = +3

Query  174  GPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaal  353
            G +  V++L  SNF+  + NS+ + LVEFFAPWCGHCK L P ++  A+ LKG   VAA+
Sbjct  182  GSAKDVIELTDSNFEDMITNSDDMWLVEFFAPWCGHCKNLAPHWQSAATQLKGRVKVAAI  241

Query  354  dadahsslaQEYGIKGFPTIKVFVPGKQPVD----YQGAREAKSMVDFVKAQI  500
            DA  ++ +AQ +GI+GFPTIK+F  G + +D    Y G R A  +V + + ++
Sbjct  242  DATVNTVMAQRFGIQGFPTIKMFPSGAKSLDDAVEYTGGRSASDIVQWAEEKL  294



>emb|CDQ71639.1| unnamed protein product [Oncorhynchus mykiss]
Length=448

 Score =   131 bits (330),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 103/164 (63%), Gaps = 8/164 (5%)
 Frame = +3

Query  165  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  344
              Y  S  V++LNPSNF  +VL S+ + L+EF+APWCGHC++LT  ++K A+ LKG+  V
Sbjct  25   GFYSASDDVVELNPSNFNREVLQSDSLWLIEFYAPWCGHCQSLTADWKKTATALKGIVKV  84

Query  345  aaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
             A+DAD H+SL  +Y +KGFPTIK+F   K +P DYQG R ++++VD     +  L+KDR
Sbjct  85   GAVDADQHNSLGGQYSVKGFPTIKIFGANKNKPDDYQGGRNSQAIVDGALNALHTLVKDR  144

Query  522  LDGKATGGSSQKSEPSAS-------VELNSRNFDDLVVKSKDLW  632
            + G++ G    +             VEL   NFD LV+ S ++W
Sbjct  145  MSGRSGGSDYSRQSGGGGGGSKKDVVELTDDNFDRLVLNSGEVW  188


 Score = 91.3 bits (225),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 59/101 (58%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadah  368
            V++L   NF   VLNS  V LVEFFAPWCGHCK+L P +   AS +K             
Sbjct  169  VVELTDDNFDRLVLNSGEVWLVEFFAPWCGHCKSLEPEWAAAASAVKEQTKDKVHLGAVD  228

Query  369  sslaQ----EYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            +++ Q     YGI+GFPTIK+F  G++P DYQG R    ++
Sbjct  229  ATVHQGLASRYGIRGFPTIKIFKKGEEPEDYQGGRTRGDII  269



>ref|NP_001269634.1| protein disulfide-isomerase A6 isoform b [Homo sapiens]
Length=488

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 106/164 (65%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  66   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  125

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  126  VGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKD  185

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G++ G      G S  S     +EL   +FD  V+ S+D+W
Sbjct  186  RLGGRSGGYSSGKQGRSDSSSKKDVIELTDDSFDKNVLDSEDVW  229


 Score = 89.0 bits (219),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   +F   VL+S  V +VEF+APWCGHCK L P +   AS +    KG   +AA+D
Sbjct  210  VIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVD  269

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  270  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  310



>ref|XP_010850414.1| PREDICTED: protein disulfide-isomerase A6 [Bison bison bison]
Length=540

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 77/167 (46%), Positives = 106/167 (63%), Gaps = 13/167 (8%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  118  NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  177

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  178  VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNKPEDYQGGRTGEAIVDAALSALRQLVKD  237

Query  519  RLDG---------KATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G         +  G SS K +    +EL   NFD  V+ S+D+W
Sbjct  238  RLGGRGSGYSSGKQGRGDSSSKKD---VIELTDDNFDKNVLDSEDVW  281


 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   NF   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  262  VIELTDDNFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  321

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  322  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  362



>ref|XP_004746019.1| PREDICTED: protein disulfide-isomerase A6 [Mustela putorius furo]
 ref|XP_004790281.1| PREDICTED: protein disulfide-isomerase A6 [Mustela putorius furo]
Length=454

 Score =   131 bits (330),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 104/164 (63%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  32   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  91

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD     +R L+KD
Sbjct  92   VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALGALRQLVKD  151

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G+  G      G S+ S     +EL   +FD  V+ S D+W
Sbjct  152  RLGGRGGGYSSGKQGRSESSSKKDVIELTDDSFDKNVLDSDDVW  195


 Score = 88.2 bits (217),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 65/101 (64%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLK----GVATVaald  356
            V++L   +F   VL+S+ V +VEF+APWCGHCK L P +   A+ +K    G   +AA+D
Sbjct  176  VIELTDDSFDKNVLDSDDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTQGKVKLAAVD  235

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A A+  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  236  ATANQFLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  276



>dbj|BAF63672.1| protein disulfide isomerase-1 [Haemaphysalis longicornis]
Length=435

 Score =   131 bits (330),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 103/157 (66%), Gaps = 3/157 (2%)
 Frame = +3

Query  165  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  344
            A+YGP T V+ L+P+NFK++V++S+ V +VEF+APWCGHC++  P Y K A+ LKG+  V
Sbjct  18   AMYGPHTEVVDLSPANFKNRVVDSDEVWIVEFYAPWCGHCQSFAPEYTKAAAALKGIVKV  77

Query  345  aaldadahsslaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRNLLKDR  521
             A+DAD   SL  +YG++GFPT+K+F   K  P DY G R A  +      + R ++  R
Sbjct  78   GAVDADKDKSLGGQYGVRGFPTVKIFGANKHNPTDYSGPRTADGVASAALQEARKVVDQR  137

Query  522  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            L G+ T G S   +    VEL+  NF++LV+KS DLW
Sbjct  138  L-GRKTSGGSSGGKSDV-VELDESNFEELVLKSDDLW  172


 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 66/103 (64%), Gaps = 4/103 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadah  368
            V++L+ SNF+  VL S+ + LVEFFAPWCGHCK L P + K A+ LKG   + A+DA  H
Sbjct  153  VVELDESNFEELVLKSDDLWLVEFFAPWCGHCKNLAPHWAKAATELKGKVKLGAVDATVH  212

Query  369  sslaQEYGIKGFPTIKVFVPGKQ----PVDYQGAREAKSMVDF  485
              LA ++ +KG+PTIK F  GK+      +Y G R A  +V +
Sbjct  213  QGLASQFDVKGYPTIKFFPGGKKDRHSAXEYNGGRTADDIVQW  255



>tpg|DAA24511.1| TPA: protein disulfide isomerase family A, member 6 [Bos taurus]
Length=590

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 105/164 (64%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  168  NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  227

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  228  VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNKPEDYQGGRTGEAIVDAALSALRQLVKD  287

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G+ +G      G    S     +EL   NFD  V+ S+D+W
Sbjct  288  RLGGRGSGYSSGKQGRGDSSSKKDVIELTDDNFDKNVLDSEDVW  331


 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   NF   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  312  VIELTDDNFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  371

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  372  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  412



>ref|XP_008311310.1| PREDICTED: protein disulfide-isomerase A6 [Cynoglossus semilaevis]
Length=438

 Score =   131 bits (330),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 111/160 (69%), Gaps = 4/160 (3%)
 Frame = +3

Query  165  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  344
            ALY PS  V++L  SNF  +V+ S+ + LVEF+APWCGHC+ L P ++K A+ LKG+  V
Sbjct  19   ALYSPSDDVVELTSSNFNREVIQSDSLWLVEFYAPWCGHCRNLAPDWKKAATALKGIVKV  78

Query  345  aaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
             A+DAD H+SL  +YG++GFPTIK+F   K +P +YQG R ++++VD     +RNL+K+R
Sbjct  79   GAVDADQHNSLGGQYGVRGFPTIKIFGANKNKPEEYQGGRSSQAIVDGAMNALRNLVKER  138

Query  522  LDGKATGGSSQKSEPSAS---VELNSRNFDDLVVKSKDLW  632
            L GK+ G   Q+S   +S   VEL   NFD +V++S D+W
Sbjct  139  LSGKSGGSGGQQSSGGSSKDVVELTDDNFDKMVMESDDIW  178


 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 65/102 (64%), Gaps = 4/102 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   NF   V+ S+ + LVEFFAPWCGHCK L P +   A+ +    KG   + A+D
Sbjct  159  VVELTDDNFDKMVMESDDIWLVEFFAPWCGHCKKLEPEWAAAATAVKEQTKGRVRLGAVD  218

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVD  482
            A  H +++  YGI+G+P+IKVF  G++P DYQG R    +++
Sbjct  219  ATVHQAVSSRYGIRGYPSIKVFRKGEEPEDYQGGRTRNDIIE  260



>ref|XP_004310310.1| PREDICTED: protein disulfide-isomerase A6 isoform 1 [Tursiops 
truncatus]
Length=448

 Score =   131 bits (330),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 104/164 (63%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++KVA+ LK V  
Sbjct  26   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKVATALKDVVK  85

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K QP DYQG R  +++VD     +R L+K 
Sbjct  86   VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNQPEDYQGGRTGEAIVDAALGALRQLVKG  145

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G++ G      G S  S     +EL    FD  V+ S+D+W
Sbjct  146  RLGGRSGGYSSGKQGRSDSSSKKDVIELTDDTFDKSVLDSEDVW  189


 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 61/101 (60%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L    F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  170  VIELTDDTFDKSVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  229

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  LA  Y I+GFPTIK+F  G+ PVDY G R    +V
Sbjct  230  ATVNQVLASRYEIRGFPTIKIFQKGESPVDYDGGRTRSDIV  270



>ref|XP_005085000.1| PREDICTED: protein disulfide-isomerase A6 [Mesocricetus auratus]
Length=445

 Score =   131 bits (330),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 103/164 (63%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ SN + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  23   NGLYSSSDDVIELTPSNFNREVIQSNSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  82

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  83   VGAVDADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTGEAIVDAALSALRQLVKD  142

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G++ G      G    S     +EL    FD  V+ S D+W
Sbjct  143  RLSGRSGGYSSGKQGRGDSSSKKDVIELTDDTFDKNVLDSDDVW  186


 Score = 88.2 bits (217),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L    F   VL+S+ V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  167  VIELTDDTFDKNVLDSDDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  226

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  227  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  267



>emb|CAG03659.1| unnamed protein product [Tetraodon nigroviridis]
Length=440

 Score =   131 bits (329),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 75/167 (45%), Positives = 109/167 (65%), Gaps = 16/167 (10%)
 Frame = +3

Query  165  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  344
            ALY     V++LNPSNF  +V+ S+ + LVEF+APWCGHC+ L P ++K A+ LKGV  V
Sbjct  19   ALYSSDDDVVELNPSNFNREVIQSDSLWLVEFYAPWCGHCRNLVPDWKKAATALKGVVKV  78

Query  345  aaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
             A+DAD H SL  +YG++GFPTIKVF   K +P +YQG R ++++VD   + +R+L+K+R
Sbjct  79   GAVDADQHKSLGGQYGVRGFPTIKVFGANKNKPEEYQGGRSSQAIVDGALSALRSLVKER  138

Query  522  LDG----------KATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            L G          ++TGGS +       VEL   NFD +V++  ++W
Sbjct  139  LSGGSSGSGYNKQQSTGGSKKD-----VVELTDDNFDQMVLEGDEVW  180


 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 64/107 (60%), Gaps = 4/107 (4%)
 Frame = +3

Query  174  GPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVAT  341
            G    V++L   NF   VL  + V +VEFFAPWCGHCK L P +   A+ +    KG   
Sbjct  156  GSKKDVVELTDDNFDQMVLEGDEVWMVEFFAPWCGHCKNLEPEWAAAATAVKEQTKGKVR  215

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVD  482
            + A+DA  H  ++  YGI+GFPTIK+F  G++P DYQG R    +++
Sbjct  216  LGAVDATVHQGVSGRYGIRGFPTIKIFRKGEEPEDYQGGRTRADIIE  262



>ref|XP_003272792.1| PREDICTED: LOW QUALITY PROTEIN: protein disulfide-isomerase A6 
[Nomascus leucogenys]
Length=441

 Score =   131 bits (329),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 106/164 (65%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ S+ V LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  18   NGLYSSSDDVIELTPSNFNREVIQSDSVWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  77

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+K+
Sbjct  78   VGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKE  137

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G++ G      G S  S     +EL   +FD  V+ S+D+W
Sbjct  138  RLGGQSGGYSSGKQGRSDSSSKKDVIELTDDSFDKNVLDSEDVW  181


 Score = 88.6 bits (218),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   +F   VL+S  V +VEF+APWCGHCK L P +   AS +    KG   +AA+D
Sbjct  162  VIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVD  221

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  222  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  262



>dbj|BAB24354.1| unnamed protein product [Mus musculus]
Length=391

 Score =   130 bits (328),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 75/164 (46%), Positives = 105/164 (64%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            + LY  S  V++L PSNF  +V+ S+G+ LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  23   SGLYSSSDDVIELTPSNFNREVIQSDGLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  82

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A++AD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  83   VGAVNADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTGEAIVDAALSALRQLVKD  142

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G++ G      G    S     VEL    FD  V+ S+D+W
Sbjct  143  RLGGRSGGYSSGKQGRGDSSSKKDVVELTDDTFDKNVLDSEDVW  186


 Score = 87.8 bits (216),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 62/101 (61%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L    F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  167  VVELTDDTFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  226

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  LA  YGIKGFPTIK+F  G+ PVDY G R    +V
Sbjct  227  ATMNQVLASRYGIKGFPTIKIFQKGESPVDYDGGRTRSDIV  267



>ref|XP_002586165.1| hypothetical protein BRAFLDRAFT_289141 [Branchiostoma floridae]
 gb|EEN42176.1| hypothetical protein BRAFLDRAFT_289141 [Branchiostoma floridae]
Length=443

 Score =   131 bits (329),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 100/166 (60%), Gaps = 9/166 (5%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            +ALY PS  V++L  SNF+ KV+ S  V LVEF+APWCGHCK L P ++K A+ LKGVA 
Sbjct  18   HALYSPSDDVIELTSSNFQQKVIQSGDVWLVEFYAPWCGHCKNLVPEWKKAATALKGVAK  77

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+D  AH S+   Y ++GFPTIKVF   K +P DY GAR A++MVD    Q++ ++K 
Sbjct  78   VGAVDMTAHQSVGGPYNVRGFPTIKVFGLNKDKPEDYNGARSAQAMVDSALQQVQKVVKA  137

Query  519  RLDGKATGGSSQKSEPSAS--------VELNSRNFDDLVVKSKDLW  632
            RL GK                      +EL   NF+D V+ S DLW
Sbjct  138  RLSGKGGKSGGSGGSGGQGSGGSKDDVIELTDSNFEDQVLNSDDLW  183


 Score = 97.8 bits (242),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 72/111 (65%), Gaps = 4/111 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadah  368
            V++L  SNF+ +VLNS+ + LVEFFAPWCGHCK L P +   A+ LKG   + ALDA  H
Sbjct  164  VIELTDSNFEDQVLNSDDLWLVEFFAPWCGHCKRLEPEWASAATELKGKVKLGALDATVH  223

Query  369  sslaQEYGIKGFPTIKVFVPGKQ---PVDYQGAREAKSMVDF-VKAQIRNL  509
            + +A  Y I+GFPTIKVF  GK+     DYQG R A  +V + + A   N+
Sbjct  224  TVMASRYQIQGFPTIKVFAAGKKDGDATDYQGGRTASDIVAYALDAHAENI  274



>ref|XP_006073828.1| PREDICTED: LOW QUALITY PROTEIN: protein disulfide-isomerase A6 
[Bubalus bubalis]
Length=590

 Score =   132 bits (332),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 77/167 (46%), Positives = 106/167 (63%), Gaps = 13/167 (8%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  168  NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  227

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  228  VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNKPEDYQGGRTGEAIVDAALSALRQLVKD  287

Query  519  RLDG---------KATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G         +  G SS K +    +EL   NFD  V+ S+D+W
Sbjct  288  RLGGRGSGYSSGKQGRGDSSSKKD---VIELTDDNFDKNVLDSEDVW  331


 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   NF   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  312  VIELTDDNFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  371

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  372  ATGNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  412



>gb|EMP42001.1| Protein disulfide-isomerase A6, partial [Chelonia mydas]
Length=465

 Score =   131 bits (330),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 74/170 (44%), Positives = 106/170 (62%), Gaps = 17/170 (10%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N+LY  S  V++L P+NF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LKGV  
Sbjct  14   NSLYSSSDDVIELTPTNFNKEVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKGVVK  73

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPV-DYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K    DYQG R ++++VD   + +R+L+KD
Sbjct  74   VGAVDADKHQSLGGQYGVRGFPTIKIFGSNKNKAEDYQGGRTSEAIVDAALSTLRSLVKD  133

Query  519  RL------------DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL              + +GG  +K      +EL   +FD  VV S D+W
Sbjct  134  RLSGRSGGYSSGKQSSRESGGGDKKD----VIELTDDSFDKNVVNSDDVW  179


 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 65/106 (61%), Gaps = 4/106 (4%)
 Frame = +3

Query  174  GPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVAT  341
            G    V++L   +F   V+NS+ V LVEF+APWCGHCK L P +   A+ +    KG   
Sbjct  155  GDKKDVIELTDDSFDKNVVNSDDVWLVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVK  214

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            +AA+DA  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  215  LAAVDATVNQMLASRYGIRGFPTIKIFQKGEDPVDYDGGRTRSDIV  260



>ref|XP_007053233.1| PREDICTED: protein disulfide-isomerase A6, partial [Chelonia 
mydas]
Length=445

 Score =   131 bits (329),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 74/170 (44%), Positives = 106/170 (62%), Gaps = 17/170 (10%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N+LY  S  V++L P+NF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LKGV  
Sbjct  21   NSLYSSSDDVIELTPTNFNKEVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKGVVK  80

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPV-DYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K    DYQG R ++++VD   + +R+L+KD
Sbjct  81   VGAVDADKHQSLGGQYGVRGFPTIKIFGSNKNKAEDYQGGRTSEAIVDAALSTLRSLVKD  140

Query  519  RL------------DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL              + +GG  +K      +EL   +FD  VV S D+W
Sbjct  141  RLSGRSGGYSSGKQSSRESGGGDKKD----VIELTDDSFDKNVVNSDDVW  186


 Score = 90.9 bits (224),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 65/106 (61%), Gaps = 4/106 (4%)
 Frame = +3

Query  174  GPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVAT  341
            G    V++L   +F   V+NS+ V LVEF+APWCGHCK L P +   A+ +    KG   
Sbjct  162  GDKKDVIELTDDSFDKNVVNSDDVWLVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVK  221

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            +AA+DA  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  222  LAAVDATVNQMLASRYGIRGFPTIKIFQKGEDPVDYDGGRTRSDIV  267



>gb|ERE68285.1| protein disulfide-isomerase A6-like protein [Cricetulus griseus]
Length=285

 Score =   129 bits (323),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 104/167 (62%), Gaps = 13/167 (8%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            + LY  S  V++L PSNF  +V+ SN + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  16   SGLYSSSDDVIELTPSNFNREVIQSNSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  75

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  76   VGAVDADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTGEAIVDAALSALRQLVKD  135

Query  519  RLDG---------KATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G         +  G SS K +    +EL    FD  V+ S D+W
Sbjct  136  RLSGRSGGYSSGKQGRGDSSSKKD---VIELTDDTFDKNVLDSDDVW  179


 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L    F   VL+S+ V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  160  VIELTDDTFDKNVLDSDDVWMVEFYAPWCGHCKNLEPEWATAATEVKEQTKGKVKLAAVD  219

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  220  ATVNQVLANRYGIRGFPTIKIFQKGEAPVDYDGGRTRSDIV  260



>gb|EDK98488.1| protein disulfide isomerase associated 6, isoform CRA_b, partial 
[Mus musculus]
Length=400

 Score =   130 bits (328),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 75/164 (46%), Positives = 105/164 (64%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            + LY  S  V++L PSNF  +V+ S+G+ LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  32   SGLYSSSDDVIELTPSNFNREVIQSDGLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  91

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A++AD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  92   VGAVNADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTGEAIVDAALSALRQLVKD  151

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G++ G      G    S     VEL    FD  V+ S+D+W
Sbjct  152  RLGGRSGGYSSGKQGRGDSSSKKDVVELTDDTFDKNVLDSEDVW  195


 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 62/101 (61%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L    F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  176  VVELTDDTFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  235

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  LA  YGIKGFPTIK+F  G+ PVDY G R    +V
Sbjct  236  ATVNQVLASRYGIKGFPTIKIFQKGESPVDYDGGRTRSDIV  276



>dbj|BAC86977.1| unnamed protein product [Homo sapiens]
Length=492

 Score =   131 bits (330),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 106/164 (65%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  70   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  129

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  130  VGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKD  189

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G++ G      G S  S     +EL   +FD  V+ S+D+W
Sbjct  190  RLGGRSGGYSSGKQGRSDSSSKKDVIELTDDSFDKNVLDSEDVW  233


 Score = 88.6 bits (218),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   +F   VL+S  V +VEF+APWCGHCK L P +   AS +    KG   +AA+D
Sbjct  214  VIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGRVKLAAVD  273

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  274  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  314



>ref|NP_001269633.1| protein disulfide-isomerase A6 isoform a [Homo sapiens]
Length=492

 Score =   131 bits (330),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 106/164 (65%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  70   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  129

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  130  VGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKD  189

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G++ G      G S  S     +EL   +FD  V+ S+D+W
Sbjct  190  RLGGRSGGYSSGKQGRSDSSSKKDVIELTDDSFDKNVLDSEDVW  233


 Score = 88.6 bits (218),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L   +F   VL+S  V +VEF+APWCGHCK L P +   AS +    KG   +AA+D
Sbjct  214  VIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVD  273

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  274  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  314



>gb|ACI33422.1| disulfide-isomerase A6 precursor [Salmo salar]
 gb|ACN10934.1| disulfide-isomerase A6 precursor [Salmo salar]
Length=443

 Score =   131 bits (329),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 103/166 (62%), Gaps = 10/166 (6%)
 Frame = +3

Query  165  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  344
              Y  S  V++LNPSNF  +VL S+ + L+EF+APWCGHC++LT  ++K A+ LKG+  V
Sbjct  18   GFYSASDDVVELNPSNFNQEVLQSDSLWLIEFYAPWCGHCQSLTADWKKTATALKGIVKV  77

Query  345  aaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKDR  521
             A+DAD H SL  +Y ++GFPTIK+F   K +P DYQG R ++++VD     ++ L+KDR
Sbjct  78   GAVDADQHKSLGGQYSVRGFPTIKIFGANKNKPDDYQGGRSSQAIVDGALNALQTLVKDR  137

Query  522  LDGKATGGSSQKSEPSAS---------VELNSRNFDDLVVKSKDLW  632
            + G++ G    +               VEL   NFD LV+ S ++W
Sbjct  138  MSGRSGGSDYSRQSGGGGGGGGSKKDVVELTDDNFDRLVLNSDEVW  183


 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 60/101 (59%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadah  368
            V++L   NF   VLNS+ V LVEFFAPWCGHCK+L P +   AS +K             
Sbjct  164  VVELTDDNFDRLVLNSDEVWLVEFFAPWCGHCKSLEPEWAAAASAVKEQTKDKVHLGAVD  223

Query  369  sslaQ----EYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            +++ Q     YGI+GFPTIK+F  G++P DYQG R    ++
Sbjct  224  ATVHQGLASRYGIRGFPTIKIFKKGEEPEDYQGGRTRGDII  264



>ref|XP_009806227.1| PREDICTED: protein disulfide-isomerase A6 [Gavia stellata]
Length=444

 Score =   130 bits (328),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 74/169 (44%), Positives = 103/169 (61%), Gaps = 16/169 (9%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L P+NF  +V+ S  + LVEF+APWCGHC+ LTP ++K A+ LKGV  
Sbjct  21   NGLYSASDDVIELTPTNFNKEVIQSESLWLVEFYAPWCGHCQRLTPEWKKAATALKGVVK  80

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPV-DYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K    DYQG R + S+VD   + +R+L+KD
Sbjct  81   VGAVDADKHQSLGGQYGVRGFPTIKIFGANKNKAEDYQGGRTSDSIVDAALSALRSLVKD  140

Query  519  RL-----------DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL             + +GG  +K      +EL   +FD  V+ S D+W
Sbjct  141  RLSGRSGGYSSGKQSRESGGGDKKD----VIELTDDSFDKNVINSDDVW  185


 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 65/106 (61%), Gaps = 4/106 (4%)
 Frame = +3

Query  174  GPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVAT  341
            G    V++L   +F   V+NS+ V +VEF+APWCGHCK L P +   A+ +    KG   
Sbjct  161  GDKKDVIELTDDSFDKNVINSDDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVK  220

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            +AA+DA  +  LA  YGI+GFPTIK+F  G+ PVDY G R    ++
Sbjct  221  LAAVDATINQMLAGRYGIRGFPTIKIFQKGEDPVDYDGGRTRSDII  266



>gb|KFV41194.1| Protein disulfide-isomerase A6, partial [Gavia stellata]
Length=440

 Score =   130 bits (328),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 74/169 (44%), Positives = 103/169 (61%), Gaps = 16/169 (9%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L P+NF  +V+ S  + LVEF+APWCGHC+ LTP ++K A+ LKGV  
Sbjct  17   NGLYSASDDVIELTPTNFNKEVIQSESLWLVEFYAPWCGHCQRLTPEWKKAATALKGVVK  76

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPV-DYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K    DYQG R + S+VD   + +R+L+KD
Sbjct  77   VGAVDADKHQSLGGQYGVRGFPTIKIFGANKNKAEDYQGGRTSDSIVDAALSALRSLVKD  136

Query  519  RL-----------DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL             + +GG  +K      +EL   +FD  V+ S D+W
Sbjct  137  RLSGRSGGYSSGKQSRESGGGDKKD----VIELTDDSFDKNVINSDDVW  181


 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 65/106 (61%), Gaps = 4/106 (4%)
 Frame = +3

Query  174  GPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVAT  341
            G    V++L   +F   V+NS+ V +VEF+APWCGHCK L P +   A+ +    KG   
Sbjct  157  GDKKDVIELTDDSFDKNVINSDDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVK  216

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            +AA+DA  +  LA  YGI+GFPTIK+F  G+ PVDY G R    ++
Sbjct  217  LAAVDATINQMLAGRYGIRGFPTIKIFQKGEDPVDYDGGRTRSDII  262



>ref|XP_010706217.1| PREDICTED: protein disulfide-isomerase A6 [Meleagris gallopavo]
Length=447

 Score =   130 bits (328),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 74/169 (44%), Positives = 104/169 (62%), Gaps = 16/169 (9%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            N LY  S  V++L P+NF  +V+ S  + LVEF+APWCGHC+ LTP ++K A+ LKGV  
Sbjct  23   NGLYSASDDVIELTPTNFNKEVIQSESLWLVEFYAPWCGHCQRLTPEWKKAATALKGVVK  82

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPV-DYQGAREAKSMVDFVKAQIRNLLKD  518
            V A+DAD H SL  +YG++GFPTIK+F   K    DYQG R ++++VD   + +R+L+KD
Sbjct  83   VGAVDADKHQSLGGQYGVRGFPTIKIFGANKNKAEDYQGGRTSEAIVDAALSALRSLVKD  142

Query  519  RL-----------DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL             + +GG  +K      VEL   +FD  V+ S D+W
Sbjct  143  RLSGRSGGYSSGRQSRESGGGDKKD----VVELTDDSFDKNVINSDDVW  187


 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 65/106 (61%), Gaps = 4/106 (4%)
 Frame = +3

Query  174  GPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVAT  341
            G    V++L   +F   V+NS+ V +VEF+APWCGHCK L P +   A+ +    KG   
Sbjct  163  GDKKDVVELTDDSFDKNVINSDDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVK  222

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            +AA+DA  +  LA  YGI+GFPTIK+F  G+ PVDY G R    ++
Sbjct  223  LAAVDATVNQMLASRYGIRGFPTIKIFQKGEDPVDYDGGRTRSDII  268



>gb|EDK98487.1| protein disulfide isomerase associated 6, isoform CRA_a [Mus 
musculus]
Length=414

 Score =   130 bits (327),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 75/164 (46%), Positives = 105/164 (64%), Gaps = 7/164 (4%)
 Frame = +3

Query  162  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  341
            + LY  S  V++L PSNF  +V+ S+G+ LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  23   SGLYSSSDDVIELTPSNFNREVIQSDGLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  82

Query  342  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  518
            V A++AD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  83   VGAVNADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTGEAIVDAALSALRQLVKD  142

Query  519  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLW  632
            RL G++ G      G    S     VEL    FD  V+ S+D+W
Sbjct  143  RLGGRSGGYSSGKQGRGDSSSKKDVVELTDDTFDKNVLDSEDVW  186


 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 62/101 (61%), Gaps = 4/101 (4%)
 Frame = +3

Query  189  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  356
            V++L    F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  167  VVELTDDTFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  226

Query  357  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  479
            A  +  LA  YGIKGFPTIK+F  G+ PVDY G R    +V
Sbjct  227  ATVNQVLASRYGIKGFPTIKIFQKGESPVDYDGGRTRSDIV  267



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1119419305360