BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig3088

Length=715
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009777271.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    249   3e-76   Nicotiana sylvestris
ref|XP_006366999.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    249   5e-76   Solanum tuberosum [potatoes]
ref|XP_004247041.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    246   5e-75   Solanum lycopersicum
ref|XP_009610543.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    246   5e-75   Nicotiana tomentosiformis
ref|XP_011089044.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    246   9e-75   Sesamum indicum [beniseed]
emb|CDP03931.1|  unnamed protein product                                234   6e-71   Coffea canephora [robusta coffee]
gb|EYU39188.1|  hypothetical protein MIMGU_mgv1a006049mg                235   9e-71   Erythranthe guttata [common monkey flower]
ref|XP_008244679.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    234   2e-70   Prunus mume [ume]
gb|EPS58986.1|  hypothetical protein M569_15824                         232   1e-69   Genlisea aurea
ref|XP_008382581.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    231   3e-69   
ref|XP_004144397.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    231   4e-69   Cucumis sativus [cucumbers]
ref|XP_006386885.1|  3-glucanase family protein                         231   4e-69   Populus trichocarpa [western balsam poplar]
ref|XP_008356234.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    232   7e-69   
ref|XP_011024595.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    230   1e-68   Populus euphratica
ref|XP_009372203.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    229   3e-68   Pyrus x bretschneideri [bai li]
ref|XP_004290162.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    228   6e-68   Fragaria vesca subsp. vesca
gb|KDO46598.1|  hypothetical protein CISIN_1g038099mg                   220   2e-67   Citrus sinensis [apfelsine]
ref|XP_007049651.1|  O-Glycosyl hydrolases family 17 protein isof...    225   5e-67   
ref|XP_010100789.1|  putative glucan endo-1,3-beta-glucosidase A6       225   6e-67   Morus notabilis
ref|XP_008460404.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    223   4e-66   Cucumis melo [Oriental melon]
ref|XP_010036769.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    221   2e-65   Eucalyptus grandis [rose gum]
gb|KHG25787.1|  putative glucan endo-1,3-beta-glucosidase A6 -lik...    221   3e-65   Gossypium arboreum [tree cotton]
gb|KJB10878.1|  hypothetical protein B456_001G230200                    220   5e-65   Gossypium raimondii
gb|KJB10879.1|  hypothetical protein B456_001G230200                    220   6e-65   Gossypium raimondii
gb|KDP45279.1|  hypothetical protein JCGZ_15144                         219   1e-64   Jatropha curcas
ref|XP_012085272.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    219   1e-64   Jatropha curcas
ref|XP_003626949.1|  Beta-1 3-glucanase                                 219   1e-64   Medicago truncatula
ref|XP_004492271.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    218   4e-64   Cicer arietinum [garbanzo]
gb|KFK38190.1|  hypothetical protein AALP_AA3G081000                    217   7e-64   Arabis alpina [alpine rockcress]
gb|KEH22559.1|  glucan endo-1,3-beta-glucosidase-like protein           217   9e-64   Medicago truncatula
ref|XP_002884642.1|  glycosyl hydrolase family 17 protein               216   2e-63   Arabidopsis lyrata subsp. lyrata
ref|XP_003632052.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    216   3e-63   Vitis vinifera
emb|CDY28063.1|  BnaC05g44650D                                          214   7e-63   Brassica napus [oilseed rape]
ref|XP_011024596.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    214   1e-62   Populus euphratica
ref|XP_006407848.1|  hypothetical protein EUTSA_v10020660mg             214   2e-62   Eutrema salsugineum [saltwater cress]
ref|XP_006407849.1|  hypothetical protein EUTSA_v10020660mg             214   2e-62   
emb|CDY24629.1|  BnaA05g30280D                                          213   2e-62   Brassica napus [oilseed rape]
ref|XP_006297636.1|  hypothetical protein CARUB_v10013655mg             213   3e-62   Capsella rubella
ref|XP_010486278.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    213   4e-62   Camelina sativa [gold-of-pleasure]
ref|XP_009147086.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    213   4e-62   Brassica rapa
ref|XP_002303070.2|  3-glucanase family protein                         212   9e-62   
gb|AAF20214.1|AC012395_1  putative beta-1,3-glucanase precursor         211   9e-62   Arabidopsis thaliana [mouse-ear cress]
gb|KHN10950.1|  Putative glucan endo-1,3-beta-glucosidase A6            210   1e-61   Glycine soja [wild soybean]
ref|NP_683538.1|  O-Glycosyl hydrolases family 17 protein               211   1e-61   Arabidopsis thaliana [mouse-ear cress]
emb|CDY45466.1|  BnaC09g12840D                                          211   2e-61   Brassica napus [oilseed rape]
ref|XP_010464351.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    210   3e-61   Camelina sativa [gold-of-pleasure]
dbj|BAA89481.1|  beta-1,3-glucanase                                     210   5e-61   Salix gilgiana
gb|KJB84083.1|  hypothetical protein B456_N004800                       209   7e-61   Gossypium raimondii
gb|AAM65039.1|  putative glucan endo-1-3-beta-glucosidase               209   1e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010451138.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    209   1e-60   Camelina sativa [gold-of-pleasure]
ref|XP_003530849.2|  PREDICTED: probable glucan endo-1,3-beta-glu...    209   1e-60   Glycine max [soybeans]
ref|XP_010247391.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    209   2e-60   Nelumbo nucifera [Indian lotus]
gb|KHG02504.1|  putative glucan endo-1,3-beta-glucosidase A6 -lik...    208   2e-60   Gossypium arboreum [tree cotton]
ref|XP_004510238.1|  PREDICTED: putative copper-transporting ATPa...    216   4e-60   
emb|CDO96794.1|  unnamed protein product                                206   1e-59   Coffea canephora [robusta coffee]
ref|XP_006484802.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    206   2e-59   Citrus sinensis [apfelsine]
ref|XP_006437250.1|  hypothetical protein CICLE_v10031440mg             206   2e-59   Citrus clementina [clementine]
ref|XP_010552026.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    204   6e-59   Tarenaya hassleriana [spider flower]
ref|XP_010547131.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    204   6e-59   Tarenaya hassleriana [spider flower]
ref|XP_007140788.1|  hypothetical protein PHAVU_008G142200g             203   2e-58   Phaseolus vulgaris [French bean]
ref|XP_010685101.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    201   7e-58   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010246533.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    201   1e-57   Nelumbo nucifera [Indian lotus]
ref|XP_003541516.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    199   2e-57   Glycine max [soybeans]
ref|XP_003552101.2|  PREDICTED: probable glucan endo-1,3-beta-glu...    200   3e-57   Glycine max [soybeans]
gb|ADE76604.1|  unknown                                                 199   4e-57   Picea sitchensis
ref|XP_011620347.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    197   2e-56   Amborella trichopoda
gb|ERM97971.1|  hypothetical protein AMTR_s00117p00104410               197   4e-56   Amborella trichopoda
ref|XP_004505110.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    196   6e-56   
ref|XP_004298215.2|  PREDICTED: probable glucan endo-1,3-beta-glu...    193   2e-55   Fragaria vesca subsp. vesca
gb|KHN47213.1|  Putative glucan endo-1,3-beta-glucosidase A6            192   2e-55   Glycine soja [wild soybean]
gb|KEH30957.1|  glucan endo-1,3-beta-glucosidase-like protein           194   6e-55   Medicago truncatula
ref|XP_007153895.1|  hypothetical protein PHAVU_003G073900g             190   2e-54   Phaseolus vulgaris [French bean]
emb|CAN60692.1|  hypothetical protein VITISV_007558                     191   2e-54   Vitis vinifera
emb|CDY08004.1|  BnaC03g35190D                                          192   3e-54   Brassica napus [oilseed rape]
emb|CDX74052.1|  BnaA03g29950D                                          193   5e-54   
ref|XP_003632055.1|  PREDICTED: LOW QUALITY PROTEIN: probable glu...    191   6e-54   Vitis vinifera
ref|XP_009134961.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    191   7e-54   Brassica rapa
ref|XP_006299757.1|  hypothetical protein CARUB_v10015952mg             191   1e-53   Capsella rubella
ref|XP_002520622.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    190   2e-53   
ref|XP_006830552.2|  PREDICTED: probable glucan endo-1,3-beta-glu...    189   2e-53   
gb|ERM97968.1|  hypothetical protein AMTR_s00117p00097230               190   2e-53   Amborella trichopoda
ref|XP_010466734.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    190   2e-53   Camelina sativa [gold-of-pleasure]
ref|XP_010488453.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    190   2e-53   Camelina sativa [gold-of-pleasure]
ref|XP_007199923.1|  hypothetical protein PRUPE_ppa006984mg             187   2e-53   
ref|XP_006418839.1|  hypothetical protein EUTSA_v10002513mg             188   1e-52   Eutrema salsugineum [saltwater cress]
ref|XP_010023613.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    187   1e-52   
ref|XP_009373620.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    187   2e-52   
ref|XP_008222761.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    187   2e-52   
ref|XP_006421038.1|  hypothetical protein CICLE_v10004917mg             187   2e-52   
ref|XP_010512882.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    187   3e-52   Camelina sativa [gold-of-pleasure]
ref|XP_007221306.1|  hypothetical protein PRUPE_ppa016789mg             186   4e-52   
gb|AEN82021.1|  AT3G23770-like protein                                  177   5e-52   Capsella rubella
ref|XP_002883459.1|  hypothetical protein ARALYDRAFT_479892             186   6e-52   
gb|KDO47456.1|  hypothetical protein CISIN_1g012660mg                   186   6e-52   Citrus sinensis [apfelsine]
gb|AEN82027.1|  AT3G23770-like protein                                  177   1e-51   Capsella rubella
gb|KFK39673.1|  a6 anther-specific protein                              185   1e-51   Arabis alpina [alpine rockcress]
ref|NP_189019.1|  O-glycosyl hydrolases family 17 protein               185   1e-51   Arabidopsis thaliana [mouse-ear cress]
gb|ABK28569.1|  unknown                                                 185   1e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010532729.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    185   2e-51   Tarenaya hassleriana [spider flower]
emb|CDP15106.1|  unnamed protein product                                185   2e-51   Coffea canephora [robusta coffee]
emb|CDY59775.1|  BnaCnng35540D                                          185   2e-51   Brassica napus [oilseed rape]
gb|KJB10880.1|  hypothetical protein B456_001G230200                    183   2e-51   Gossypium raimondii
ref|XP_009102583.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    185   2e-51   Brassica rapa
ref|XP_009385472.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    185   2e-51   
emb|CDY63754.1|  BnaAnng19080D                                          184   2e-51   Brassica napus [oilseed rape]
ref|XP_008792940.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    184   3e-51   
ref|XP_002534357.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    182   3e-51   Ricinus communis
ref|XP_008792939.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    184   3e-51   Phoenix dactylifera
ref|XP_009135862.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    184   4e-51   Brassica rapa
ref|XP_008380636.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    184   4e-51   
ref|XP_006349905.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    184   4e-51   Solanum tuberosum [potatoes]
gb|AEN82023.1|  AT3G23770-like protein                                  175   4e-51   Capsella rubella
ref|XP_002444717.1|  hypothetical protein SORBIDRAFT_07g026540          184   4e-51   Sorghum bicolor [broomcorn]
ref|XP_010314851.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    183   5e-51   
gb|AAM64490.1|  beta-1,3-glucanase, putative                            183   9e-51   Arabidopsis thaliana [mouse-ear cress]
gb|ADG38498.1|  AT3G23770-like protein                                  174   1e-50   Capsella grandiflora
gb|ADG38497.1|  AT3G23770-like protein                                  174   1e-50   Capsella grandiflora
ref|XP_009625839.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    181   2e-50   Nicotiana tomentosiformis
ref|XP_009411847.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    182   2e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009625838.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    182   3e-50   Nicotiana tomentosiformis
gb|AEN82025.1|  AT3G23770-like protein                                  173   3e-50   Capsella rubella
ref|XP_009411846.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    182   3e-50   Musa acuminata subsp. malaccensis [pisang utan]
gb|ADG38499.1|  AT3G23770-like protein                                  173   3e-50   Capsella grandiflora
emb|CDY53213.1|  BnaC03g74070D                                          181   4e-50   Brassica napus [oilseed rape]
gb|ADG38503.1|  AT3G23770-like protein                                  173   4e-50   Neslia paniculata [ball mustard]
ref|XP_006373100.1|  hypothetical protein POPTR_0017s08720g             181   4e-50   Populus trichocarpa [western balsam poplar]
ref|XP_009777293.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    180   1e-49   Nicotiana sylvestris
gb|ADG38502.1|  AT3G23770-like protein                                  171   1e-49   Capsella grandiflora
ref|XP_011045808.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    179   2e-49   Populus euphratica
emb|CDY50110.1|  BnaC01g43580D                                          179   3e-49   Brassica napus [oilseed rape]
ref|XP_009106344.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    179   3e-49   Brassica rapa
emb|CDY18092.1|  BnaA01g23530D                                          178   7e-49   Brassica napus [oilseed rape]
ref|XP_010264204.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    174   9e-49   Nelumbo nucifera [Indian lotus]
ref|XP_002298669.2|  glucan endo-1 family protein                       176   1e-48   
ref|XP_011010072.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    177   1e-48   Populus euphratica
ref|XP_002462618.1|  hypothetical protein SORBIDRAFT_02g029080          177   2e-48   Sorghum bicolor [broomcorn]
ref|NP_193144.1|  putative glucan endo-1,3-beta-glucosidase A6          177   2e-48   Arabidopsis thaliana [mouse-ear cress]
gb|KEH22560.1|  glucan endo-1,3-beta-glucosidase-like protein           175   2e-48   Medicago truncatula
ref|XP_012078455.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    177   2e-48   Jatropha curcas
ref|XP_008439043.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    176   5e-48   Cucumis melo [Oriental melon]
gb|EYU31523.1|  hypothetical protein MIMGU_mgv1a005774mg                175   5e-48   Erythranthe guttata [common monkey flower]
ref|XP_002868315.1|  hypothetical protein ARALYDRAFT_493503             175   8e-48   
gb|EYU31522.1|  hypothetical protein MIMGU_mgv1a005774mg                175   9e-48   Erythranthe guttata [common monkey flower]
gb|KJB28087.1|  hypothetical protein B456_005G026800                    175   9e-48   Gossypium raimondii
ref|XP_011101604.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    174   2e-47   
gb|KEH18116.1|  O-glycosyl hydrolase family 17 protein                  172   2e-47   Medicago truncatula
ref|XP_009383834.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    174   3e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009383833.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    174   3e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004957267.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    173   6e-47   Setaria italica
ref|XP_007034194.1|  O-Glycosyl hydrolases family 17 protein            173   1e-46   
gb|KFK36299.1|  hypothetical protein AALP_AA4G104300                    172   1e-46   Arabis alpina [alpine rockcress]
ref|XP_006282877.1|  hypothetical protein CARUB_v10006945mg             172   1e-46   Capsella rubella
ref|XP_010450129.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    172   2e-46   
ref|XP_010450110.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    171   3e-46   Camelina sativa [gold-of-pleasure]
ref|XP_002971665.1|  hypothetical protein SELMODRAFT_231791             171   3e-46   
ref|XP_002976500.1|  hypothetical protein SELMODRAFT_105435             171   3e-46   
gb|EEC84834.1|  hypothetical protein OsI_31928                          171   4e-46   Oryza sativa Indica Group [Indian rice]
ref|NP_001149815.1|  glucan endo-1,3-beta-glucosidase A6 precursor      170   9e-46   Zea mays [maize]
ref|XP_003572424.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    171   1e-45   Brachypodium distachyon [annual false brome]
ref|XP_010435194.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    169   1e-45   Camelina sativa [gold-of-pleasure]
ref|NP_001063586.1|  Os09g0502200                                       169   1e-45   
ref|XP_011651104.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    168   2e-45   Cucumis sativus [cucumbers]
gb|KGN57233.1|  hypothetical protein Csa_3G172380                       169   3e-45   Cucumis sativus [cucumbers]
ref|XP_010527440.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    168   3e-45   Tarenaya hassleriana [spider flower]
ref|XP_002973407.1|  hypothetical protein SELMODRAFT_413735             168   8e-45   
ref|XP_002965673.1|  hypothetical protein SELMODRAFT_85067              166   9e-45   
dbj|BAJ88052.1|  predicted protein                                      167   1e-44   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK05423.1|  predicted protein                                      166   1e-44   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KCW48409.1|  hypothetical protein EUGRSUZ_K02112                     164   3e-44   Eucalyptus grandis [rose gum]
dbj|BAK04571.1|  predicted protein                                      166   4e-44   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006414816.1|  hypothetical protein EUTSA_v10025081mg             165   5e-44   Eutrema salsugineum [saltwater cress]
ref|XP_010238330.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    164   7e-44   Brachypodium distachyon [annual false brome]
emb|CAB71021.1|  putative beta-1,3-glucanase                            161   3e-43   Hieracium piloselloides
emb|CBI39414.3|  unnamed protein product                                160   4e-43   Vitis vinifera
dbj|BAG16366.1|  tapetum-specific protein A6 family protein             160   6e-43   Brassica rapa var. perviridis [kabuna]
ref|XP_009144683.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    160   2e-42   Brassica rapa
emb|CDY08310.1|  BnaA05g13090D                                          160   2e-42   Brassica napus [oilseed rape]
gb|ABR16205.1|  unknown                                                 160   3e-42   Picea sitchensis
ref|NP_001062294.2|  Os08g0525800                                       159   9e-42   
dbj|BAC75423.1|  putative beta-1,3-glucanase                            159   1e-41   Oryza sativa Japonica Group [Japonica rice]
emb|CDY12371.1|  BnaC08g08340D                                          158   2e-41   Brassica napus [oilseed rape]
ref|XP_010673323.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    158   2e-41   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY27122.1|  BnaA08g07600D                                          158   2e-41   Brassica napus [oilseed rape]
ref|XP_009108090.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    158   2e-41   Brassica rapa
dbj|BAG16359.1|  tapetum-specific protein A6 family protein             156   3e-41   Brassica oleracea var. italica [asparagus broccoli]
emb|CDY06469.1|  BnaC06g11750D                                          157   6e-41   
emb|CAA49513.1|  beta-1,3-glucanase homologue                           157   6e-41   Brassica napus [oilseed rape]
ref|XP_002964439.1|  hypothetical protein SELMODRAFT_230318             154   7e-41   
emb|CDY01191.1|  BnaA04g06280D                                          155   2e-40   
ref|XP_009139564.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    155   2e-40   Brassica rapa
ref|XP_002975355.1|  hypothetical protein SELMODRAFT_103308             152   2e-40   Selaginella moellendorffii
ref|XP_002972033.1|  hypothetical protein SELMODRAFT_96745              154   4e-40   
emb|CDY12732.1|  BnaC04g29090D                                          154   6e-40   Brassica napus [oilseed rape]
ref|NP_001051879.1|  Os03g0845600                                       153   1e-39   
ref|XP_002980798.1|  hypothetical protein SELMODRAFT_444643             152   1e-39   Selaginella moellendorffii
gb|EAZ07710.1|  hypothetical protein OsI_29967                          156   1e-39   Oryza sativa Indica Group [Indian rice]
ref|XP_002972579.1|  hypothetical protein SELMODRAFT_97838              152   2e-39   
ref|XP_006492526.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    150   3e-39   
ref|XP_004973968.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    150   3e-39   Setaria italica
gb|ADG38393.1|  AT3G07320-like protein                                  145   4e-39   Capsella grandiflora
gb|ADG38397.1|  AT3G07320-like protein                                  145   4e-39   Capsella grandiflora
gb|ADG38398.1|  AT3G07320-like protein                                  145   5e-39   Capsella grandiflora
ref|XP_008643986.1|  PREDICTED: uncharacterized protein LOC100382...    151   6e-39   Zea mays [maize]
ref|XP_002961854.1|  hypothetical protein SELMODRAFT_437767             150   9e-39   Selaginella moellendorffii
ref|XP_008792941.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    149   1e-38   
gb|EEC76519.1|  hypothetical protein OsI_14305                          150   2e-38   Oryza sativa Indica Group [Indian rice]
ref|XP_006661404.1|  PREDICTED: LOW QUALITY PROTEIN: probable glu...    149   3e-38   
ref|XP_010026682.1|  PREDICTED: LOW QUALITY PROTEIN: probable glu...    146   4e-38   
gb|ADG38399.1|  AT3G07320-like protein                                  143   4e-38   Neslia paniculata [ball mustard]
ref|XP_002316783.2|  glycosyl hydrolase family 17 family protein        149   4e-38   Populus trichocarpa [western balsam poplar]
ref|XP_011044921.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    149   4e-38   Populus euphratica
gb|ADG38396.1|  AT3G07320-like protein                                  142   6e-38   Capsella grandiflora
ref|XP_008364550.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 14     148   9e-38   
gb|KDO62116.1|  hypothetical protein CISIN_1g0115512mg                  148   1e-37   Citrus sinensis [apfelsine]
ref|XP_008230022.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11     145   1e-37   
gb|KDO62115.1|  hypothetical protein CISIN_1g0115512mg                  147   1e-37   Citrus sinensis [apfelsine]
ref|XP_009348307.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    147   1e-37   Pyrus x bretschneideri [bai li]
ref|XP_009334153.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    147   1e-37   Pyrus x bretschneideri [bai li]
gb|KDO62114.1|  hypothetical protein CISIN_1g0115512mg                  147   2e-37   Citrus sinensis [apfelsine]
ref|XP_007020717.1|  O-Glycosyl hydrolases family 17 protein            147   2e-37   
gb|AEN81798.1|  AT3G07320-like protein                                  141   2e-37   Capsella rubella
ref|XP_009361042.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    147   2e-37   Pyrus x bretschneideri [bai li]
gb|AEN81800.1|  AT3G07320-like protein                                  141   2e-37   Capsella rubella
ref|XP_006452449.1|  hypothetical protein CICLE_v10008176mg             147   3e-37   Citrus clementina [clementine]
ref|XP_006475009.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    146   3e-37   Citrus sinensis [apfelsine]
gb|EYU33669.1|  hypothetical protein MIMGU_mgv1a005896mg                146   3e-37   Erythranthe guttata [common monkey flower]
ref|XP_010539314.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     145   6e-37   Tarenaya hassleriana [spider flower]
ref|XP_007215327.1|  hypothetical protein PRUPE_ppa005206mg             145   6e-37   
ref|XP_003581305.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    145   7e-37   Brachypodium distachyon [annual false brome]
ref|XP_012080639.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     145   8e-37   Jatropha curcas
ref|XP_008385844.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    144   2e-36   
ref|XP_002274828.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     144   3e-36   Vitis vinifera
ref|XP_010433433.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    143   3e-36   Camelina sativa [gold-of-pleasure]
ref|XP_006344866.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    144   3e-36   Solanum tuberosum [potatoes]
gb|AFU52656.1|  beta-1,3-glucanase 23                                   143   4e-36   Solanum tuberosum [potatoes]
ref|XP_006344865.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    143   4e-36   Solanum tuberosum [potatoes]
ref|XP_012070897.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    143   5e-36   Jatropha curcas
gb|KDP39185.1|  hypothetical protein JCGZ_00942                         143   5e-36   Jatropha curcas
ref|XP_010448205.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    142   6e-36   
ref|XP_009771279.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    142   6e-36   Nicotiana sylvestris
ref|XP_004251911.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    142   1e-35   Solanum lycopersicum
dbj|BAC53928.1|  beta-1,3-glucanase-like protein                        140   1e-35   Nicotiana tabacum [American tobacco]
ref|XP_004294409.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    142   1e-35   Fragaria vesca subsp. vesca
ref|XP_002463526.1|  hypothetical protein SORBIDRAFT_01g001430          141   2e-35   Sorghum bicolor [broomcorn]
ref|XP_002278044.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     141   3e-35   Vitis vinifera
ref|XP_003519593.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    141   3e-35   
ref|XP_004243515.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     140   3e-35   Solanum lycopersicum
ref|XP_006283767.1|  hypothetical protein CARUB_v10004853mg             140   3e-35   
ref|XP_009365112.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    140   3e-35   
ref|XP_009794437.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    140   4e-35   Nicotiana sylvestris
ref|XP_009365111.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    140   4e-35   Pyrus x bretschneideri [bai li]
ref|XP_006357966.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    140   4e-35   Solanum tuberosum [potatoes]
ref|XP_010110627.1|  Glucan endo-1,3-beta-glucosidase 13                140   4e-35   
gb|EPS59841.1|  hypothetical protein M569_14964                         140   5e-35   Genlisea aurea
gb|EEC82195.1|  hypothetical protein OsI_26335                          141   5e-35   Oryza sativa Indica Group [Indian rice]
gb|KHN44765.1|  Glucan endo-1,3-beta-glucosidase 11                     139   5e-35   Glycine soja [wild soybean]
emb|CDP14397.1|  unnamed protein product                                140   5e-35   Coffea canephora [robusta coffee]
ref|XP_009628415.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     140   5e-35   Nicotiana tomentosiformis
emb|CDX92794.1|  BnaC07g40520D                                          140   5e-35   
ref|XP_006357965.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    140   8e-35   
gb|ADU15553.1|  GLU                                                     139   8e-35   Gossypium hirsutum [American cotton]
gb|KHG04965.1|  hypothetical protein F383_30444                         139   8e-35   Gossypium arboreum [tree cotton]
gb|KJB37880.1|  hypothetical protein B456_006G224700                    139   8e-35   Gossypium raimondii
gb|KFK29190.1|  hypothetical protein AALP_AA7G101400                    139   1e-34   Arabis alpina [alpine rockcress]
emb|CDP13790.1|  unnamed protein product                                140   1e-34   Coffea canephora [robusta coffee]
ref|NP_001275111.1|  glucan endo-1,3-beta-glucosidase 12-like pre...    139   1e-34   Solanum tuberosum [potatoes]
ref|XP_010545233.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     139   1e-34   Tarenaya hassleriana [spider flower]
gb|KEH41871.1|  O-glycosyl hydrolase family 17 protein                  139   1e-34   Medicago truncatula
gb|KJB62900.1|  hypothetical protein B456_009G442700                    139   1e-34   Gossypium raimondii
gb|KHN23902.1|  Glucan endo-1,3-beta-glucosidase 12                     139   1e-34   Glycine soja [wild soybean]
ref|XP_006575581.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    139   2e-34   Glycine max [soybeans]
ref|XP_003544773.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    139   2e-34   Glycine max [soybeans]
ref|XP_010438690.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    139   2e-34   Camelina sativa [gold-of-pleasure]
ref|NP_001059878.1|  Os07g0538000                                       139   2e-34   
ref|XP_007049174.1|  O-Glycosyl hydrolases family 17 protein isof...    139   2e-34   
ref|XP_010488778.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    139   2e-34   Camelina sativa [gold-of-pleasure]
ref|XP_010467085.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    139   2e-34   Camelina sativa [gold-of-pleasure]
ref|XP_004497650.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    138   2e-34   Cicer arietinum [garbanzo]
ref|XP_007049173.1|  O-Glycosyl hydrolases family 17 protein isof...    139   2e-34   
ref|XP_006595830.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    138   2e-34   
dbj|BAB17320.1|  elicitor inducible beta-1,3-glucanase NtEIG-E76        138   2e-34   
ref|XP_009595038.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    138   2e-34   
ref|XP_008379673.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    138   3e-34   
ref|XP_004140121.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     138   3e-34   
gb|EPS73917.1|  hypothetical protein M569_00835                         138   3e-34   
ref|XP_008449141.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     138   3e-34   
ref|XP_006413135.1|  hypothetical protein EUTSA_v10026799mg             138   3e-34   
ref|XP_010412737.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    138   3e-34   
ref|XP_011009684.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    138   3e-34   
ref|XP_008449478.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     138   4e-34   
ref|XP_002302861.2|  glycosyl hydrolase family 17 family protein        138   4e-34   
ref|XP_006386788.1|  hypothetical protein POPTR_0002s21700g             137   4e-34   
tpg|DAA63006.1|  TPA: putative O-glycosyl hydrolase family 17 pro...    139   4e-34   
ref|XP_008653189.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    139   4e-34   
ref|XP_010063042.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    137   4e-34   
dbj|BAF01341.1|  putative beta-1,3-glucanase                            135   4e-34   
gb|EMS66645.1|  Glucan endo-1,3-beta-glucosidase 3                      138   5e-34   
ref|XP_002462967.1|  hypothetical protein SORBIDRAFT_02g035480          137   5e-34   
ref|XP_010557676.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     137   5e-34   
ref|XP_004491103.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    137   5e-34   
tpg|DAA63007.1|  TPA: putative O-glycosyl hydrolase family 17 pro...    139   6e-34   
ref|XP_004491104.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    137   6e-34   
ref|XP_008226995.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    137   7e-34   
ref|XP_001759996.1|  predicted protein                                  135   1e-33   
ref|XP_001777261.1|  predicted protein                                  136   1e-33   
emb|CDY20780.1|  BnaA02g09200D                                          136   1e-33   
emb|CDY06601.1|  BnaC02g13250D                                          136   1e-33   
gb|EMT12040.1|  Glucan endo-1,3-beta-glucosidase 13                     136   1e-33   
ref|XP_009127019.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    136   1e-33   
ref|XP_006297583.1|  hypothetical protein CARUB_v10013604mg             136   2e-33   
emb|CDY46679.1|  BnaA03g48290D                                          135   2e-33   
gb|KCW70221.1|  hypothetical protein EUGRSUZ_F03494                     134   2e-33   
ref|XP_009127020.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    135   2e-33   
ref|XP_004304086.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     135   2e-33   
ref|XP_006396136.1|  hypothetical protein EUTSA_v10002515mg             135   2e-33   
ref|XP_010913393.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    135   3e-33   
emb|CDP05678.1|  unnamed protein product                                135   3e-33   
gb|KHG05496.1|  hypothetical protein F383_30989                         135   4e-33   
ref|XP_001775379.1|  predicted protein                                  134   4e-33   
ref|XP_001780045.1|  predicted protein                                  134   4e-33   
ref|XP_001779924.1|  predicted protein                                  134   4e-33   
ref|XP_009137621.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     134   5e-33   
dbj|BAE80092.1|  glycosyl hydrolase family 17                           134   5e-33   
ref|XP_001781801.1|  predicted protein                                  134   6e-33   
ref|XP_004149346.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     134   6e-33   
dbj|BAJ92436.1|  predicted protein                                      134   6e-33   
ref|XP_002867539.1|  hydrolase, hydrolyzing O-glycosyl compounds        134   6e-33   
gb|KJB10702.1|  hypothetical protein B456_001G216900                    134   6e-33   
ref|XP_002320484.1|  glycosyl hydrolase family 17 family protein        134   6e-33   
gb|AAD26909.1|  putative beta-1,3-glucanase                             134   7e-33   
gb|KJB10701.1|  hypothetical protein B456_001G216900                    134   7e-33   
ref|XP_007141644.1|  hypothetical protein PHAVU_008G213400g             134   7e-33   
ref|XP_002462970.1|  hypothetical protein SORBIDRAFT_02g035520          135   7e-33   
gb|EPS68573.1|  hypothetical protein M569_06194                         134   8e-33   
ref|NP_178637.2|  O-glycosyl hydrolases family 17 protein               134   8e-33   
ref|XP_002525335.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    134   8e-33   
ref|XP_002883709.1|  hypothetical protein ARALYDRAFT_480193             134   9e-33   
ref|XP_006401482.1|  hypothetical protein EUTSA_v10013478mg             134   1e-32   
ref|XP_007142328.1|  hypothetical protein PHAVU_008G271000g             134   1e-32   
ref|XP_010252551.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    134   1e-32   
tpg|DAA62996.1|  TPA: putative O-glycosyl hydrolase family 17 pro...    134   1e-32   
ref|XP_007212383.1|  hypothetical protein PRUPE_ppa005210mg             134   1e-32   
dbj|BAJ93567.1|  predicted protein                                      134   1e-32   
ref|XP_010689521.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     133   1e-32   
ref|XP_006647977.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    133   1e-32   
gb|AAZ40342.1|  beta-1,3-glucanase 2                                    133   2e-32   
ref|XP_003616906.1|  Glucan endo-1,3-beta-glucosidase                   133   2e-32   
gb|KFK27118.1|  hypothetical protein AALP_AA8G337200                    133   2e-32   
ref|XP_010449211.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    133   2e-32   
emb|CDY19908.1|  BnaC09g31740D                                          133   2e-32   
ref|NP_001151472.1|  hydrolase, hydrolyzing O-glycosyl compounds ...    133   2e-32   
ref|XP_006280442.1|  hypothetical protein CARUB_v10026374mg             132   2e-32   
ref|XP_002529472.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    132   2e-32   
emb|CDY17308.1|  BnaA10g09420D                                          132   3e-32   
ref|XP_002454630.1|  hypothetical protein SORBIDRAFT_04g034530          132   3e-32   
ref|XP_007204831.1|  hypothetical protein PRUPE_ppa1027206mg            132   3e-32   
ref|XP_002864380.1|  glycosyl hydrolase family 17 protein               132   3e-32   
ref|XP_009414127.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    132   3e-32   
ref|XP_004968988.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    133   4e-32   
ref|XP_001784285.1|  predicted protein                                  131   5e-32   
dbj|BAJ90025.1|  predicted protein                                      135   5e-32   
ref|XP_002967643.1|  hypothetical protein SELMODRAFT_88150              130   5e-32   
gb|AAD10386.1|  beta-1,3-glucanase precursor                            131   5e-32   
ref|XP_004147695.2|  PREDICTED: glucan endo-1,3-beta-glucosidase        131   5e-32   
gb|KGN50541.1|  hypothetical protein Csa_5G181480                       131   5e-32   
ref|XP_001764817.1|  predicted protein                                  130   5e-32   
ref|NP_568822.1|  O-Glycosyl hydrolases family 17 protein               131   6e-32   
ref|XP_011097840.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     131   6e-32   
ref|XP_010482941.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    131   6e-32   
gb|ACF88240.1|  unknown                                                 131   6e-32   
ref|NP_001136613.1|  uncharacterized protein LOC100216736 precursor     131   6e-32   
dbj|BAB08587.1|  beta-1,3-glucanase-like protein                        131   6e-32   
emb|CDY56498.1|  BnaAnng14330D                                          131   6e-32   
ref|XP_002964390.1|  hypothetical protein SELMODRAFT_82448              130   7e-32   
ref|XP_009102359.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     131   7e-32   
emb|CDY18049.1|  BnaC07g04210D                                          131   7e-32   
ref|NP_001154780.1|  O-Glycosyl hydrolases family 17 protein            131   7e-32   
ref|XP_010270042.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     131   8e-32   
ref|NP_001048260.1|  Os02g0771700                                       131   8e-32   
tpg|DAA41054.1|  TPA: putative O-glycosyl hydrolase family 17 pro...    127   9e-32   
ref|XP_002971087.1|  hypothetical protein SELMODRAFT_95153              129   1e-31   
ref|XP_001775863.1|  predicted protein                                  129   1e-31   
gb|EPS69142.1|  hypothetical protein M569_05624                         129   1e-31   
gb|ADT64455.1|  beta-1,3-glucosidase                                    128   1e-31   
ref|XP_011085458.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      130   1e-31   
ref|XP_010236896.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    130   1e-31   
gb|AAL77689.1|  AT5g55180/MCO15_13                                      130   2e-31   
ref|XP_010443128.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    130   2e-31   
gb|KHG21190.1|  hypothetical protein F383_01641                         130   2e-31   
gb|KDO36784.1|  hypothetical protein CISIN_1g009301mg                   130   2e-31   
ref|XP_002961999.1|  hypothetical protein SELMODRAFT_76182              128   2e-31   
emb|CAB36529.1|  putative beta-1, 3-glucanase                           130   2e-31   
ref|NP_194413.2|  O-Glycosyl hydrolases family 17 protein               130   2e-31   
gb|KHG21189.1|  hypothetical protein F383_01641                         130   2e-31   
gb|AAM66024.1|  beta-1,3-glucanase-like protein                         130   2e-31   
ref|XP_011047200.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     129   3e-31   
gb|ACF79018.1|  unknown                                                 129   3e-31   
ref|XP_006447645.1|  hypothetical protein CICLE_v10015086mg             129   3e-31   
dbj|BAJ87688.1|  predicted protein                                      129   3e-31   
gb|KJB13749.1|  hypothetical protein B456_002G092600                    129   3e-31   
ref|XP_008242469.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    129   3e-31   
ref|XP_008242470.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    129   3e-31   
ref|XP_006469612.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    130   3e-31   
gb|AAC04713.1|  beta-1,3-glucanase 7                                    125   4e-31   
gb|ACR35980.1|  unknown                                                 129   4e-31   
ref|XP_001752959.1|  predicted protein                                  127   4e-31   
gb|ERN17158.1|  hypothetical protein AMTR_s00044p00136160               125   4e-31   
ref|XP_009120040.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    129   4e-31   
ref|XP_009132400.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    129   4e-31   
ref|XP_009347789.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    128   5e-31   
ref|XP_009595793.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    128   5e-31   
ref|XP_009132399.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    129   5e-31   
ref|XP_003562973.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    129   5e-31   
gb|EYU27371.1|  hypothetical protein MIMGU_mgv1a005776mg                129   6e-31   
gb|EMT25818.1|  Glucan endo-1,3-beta-glucosidase 12                     129   7e-31   
ref|XP_009347788.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    127   8e-31   
ref|XP_004498531.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    127   9e-31   
ref|XP_011091523.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    128   1e-30   
emb|CDY36734.1|  BnaA03g11520D                                          127   1e-30   
ref|XP_007160277.1|  hypothetical protein PHAVU_002G307800g             128   1e-30   
gb|AGV54422.1|  glucan endo-1,3-beta-glucosidase 13-like protein        127   1e-30   
gb|EAZ04201.1|  hypothetical protein OsI_26344                          128   2e-30   
ref|NP_001059886.2|  Os07g0539400                                       128   2e-30   
gb|ACN39797.1|  unknown                                                 127   2e-30   
ref|XP_004954064.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    127   2e-30   
gb|EYU43154.1|  hypothetical protein MIMGU_mgv1a005917mg                127   2e-30   
dbj|BAC84505.1|  putative beta-1,3-glucanase                            128   2e-30   
ref|XP_004954063.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    127   2e-30   
gb|EPS64814.1|  hypothetical protein M569_09966                         125   2e-30   
ref|XP_008788767.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    127   3e-30   
ref|XP_007147908.1|  hypothetical protein PHAVU_006G165100g             126   3e-30   
ref|XP_004954062.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    127   3e-30   
ref|XP_009785958.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    126   3e-30   
gb|EMT31770.1|  Glucan endo-1,3-beta-glucosidase 13                     127   3e-30   
ref|XP_010538537.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    126   3e-30   
ref|XP_010538536.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    126   3e-30   
gb|KHM99816.1|  Glucan endo-1,3-beta-glucosidase 13                     126   3e-30   
emb|CDP00093.1|  unnamed protein product                                126   4e-30   
ref|XP_004957929.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    126   4e-30   
gb|EMT01043.1|  Glucan endo-1,3-beta-glucosidase 13                     127   4e-30   
ref|XP_002960423.1|  hypothetical protein SELMODRAFT_73476              126   4e-30   
ref|XP_001757144.1|  predicted protein                                  125   4e-30   
emb|CDY12009.1|  BnaC03g14350D                                          126   4e-30   
ref|XP_006580483.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     126   4e-30   
ref|XP_002967295.1|  hypothetical protein SELMODRAFT_87381              126   4e-30   
ref|XP_008670470.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    127   4e-30   
ref|XP_009405069.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    126   5e-30   
gb|EMS51674.1|  Glucan endo-1,3-beta-glucosidase 13                     127   5e-30   
gb|KEH30834.1|  glycoside hydrolase family 17 protein                   125   5e-30   
ref|XP_004968973.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    126   6e-30   
gb|EPS68882.1|  hypothetical protein M569_05882                         125   6e-30   
ref|XP_002987317.1|  hypothetical protein SELMODRAFT_125909             124   6e-30   
gb|KEH30836.1|  glycoside hydrolase family 17 protein                   125   6e-30   
ref|XP_001762206.1|  predicted protein                                  124   6e-30   
ref|XP_010252096.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11     125   6e-30   
gb|KEH30835.1|  glycoside hydrolase family 17 protein                   125   7e-30   
ref|XP_006855690.2|  PREDICTED: glucan endo-1,3-beta-D-glucosidase      125   7e-30   
gb|EMS62685.1|  Glucan endo-1,3-beta-glucosidase 13                     126   8e-30   
ref|XP_002984570.1|  hypothetical protein SELMODRAFT_234579             124   8e-30   
gb|KHN16652.1|  Glucan endo-1,3-beta-glucosidase 13                     125   8e-30   
ref|XP_006584807.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    125   8e-30   
ref|XP_004968994.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    125   9e-30   
gb|EYU43261.1|  hypothetical protein MIMGU_mgv1a008785mg                124   9e-30   
ref|XP_008669802.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    125   9e-30   
ref|XP_001766544.1|  predicted protein                                  125   9e-30   
ref|XP_004968993.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    125   9e-30   
gb|KFK39880.1|  hypothetical protein AALP_AA3G300600                    125   1e-29   
ref|XP_011626761.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     125   1e-29   
ref|XP_006435532.1|  hypothetical protein CICLE_v10033472mg             125   1e-29   
ref|XP_006486487.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    125   1e-29   
gb|ERN15184.1|  hypothetical protein AMTR_s00056p00158530               125   1e-29   
ref|XP_007009341.1|  O-Glycosyl hydrolases family 17 protein, put...    125   1e-29   
ref|XP_010915632.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    124   1e-29   
ref|XP_002864470.1|  glycosyl hydrolase family 17 protein               124   2e-29   
ref|XP_002976327.1|  hypothetical protein SELMODRAFT_105037             123   2e-29   
ref|XP_010675772.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    124   2e-29   
gb|AGA95870.1|  beta-1,3-glucanase                                      123   2e-29   
gb|AES71661.2|  glycoside hydrolase family 17 protein                   123   2e-29   
ref|XP_008374135.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    124   2e-29   
ref|XP_008352157.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    124   2e-29   
ref|XP_010925707.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    123   2e-29   
ref|XP_008805608.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    124   3e-29   
ref|XP_010925705.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    123   3e-29   
gb|KJB57237.1|  hypothetical protein B456_009G154800                    123   3e-29   
ref|XP_004233126.2|  PREDICTED: glucan endo-1,3-beta-glucosidase 14     123   3e-29   
gb|KJB57236.1|  hypothetical protein B456_009G154800                    123   4e-29   
gb|EMS65653.1|  Glucan endo-1,3-beta-glucosidase 13                     123   4e-29   
ref|XP_009392256.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        123   4e-29   
ref|XP_004968992.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    124   5e-29   
ref|XP_007025069.1|  Glycosyl hydrolase superfamily protein             123   5e-29   
ref|XP_003601410.1|  Glucan endo-1,3-beta-glucosidase                   123   5e-29   
gb|AHL24654.1|  Fra e 9.01 allergen                                     123   5e-29   
gb|AIR93911.1|  glucanase                                               122   5e-29   
ref|XP_006304941.1|  hypothetical protein CARUB_v10011427mg             122   5e-29   
ref|XP_004505292.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    122   5e-29   
gb|EMS58549.1|  Glucan endo-1,3-beta-glucosidase 13                     124   5e-29   
ref|XP_004502047.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    122   6e-29   
ref|XP_002530863.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    123   6e-29   
ref|NP_001241907.1|  uncharacterized protein LOC100790277               122   6e-29   
ref|XP_001780679.1|  predicted protein                                  122   6e-29   



>ref|XP_009777271.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Nicotiana 
sylvestris]
Length=466

 Score =   249 bits (637),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 140/163 (86%), Gaps = 0/163 (0%)
 Frame = +2

Query  227  HDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETN  406
              + LI+GLKA RVKIYDANP+IL+A   + +QVSVMVPNE+I NIS++Q LAD+WV+TN
Sbjct  45   KSVDLINGLKANRVKIYDANPEILKAFKGTKIQVSVMVPNELINNISTNQDLADQWVKTN  104

Query  407  VVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDM  586
            VVPFY +T IRYLLVGNEILSNPPNTTWF LVPA+RKIR SVKKFGL KIKVGTPLA+DM
Sbjct  105  VVPFYPDTMIRYLLVGNEILSNPPNTTWFNLVPAIRKIRYSVKKFGLGKIKVGTPLAIDM  164

Query  587  LEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            LE+S+PPS+G FRSD++  V  PLL FL+RT SFFF DVYPYF
Sbjct  165  LESSFPPSNGTFRSDISEKVMIPLLHFLNRTKSFFFIDVYPYF  207



>ref|XP_006366999.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Solanum tuberosum]
Length=464

 Score =   249 bits (635),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 119/163 (73%), Positives = 140/163 (86%), Gaps = 0/163 (0%)
 Frame = +2

Query  227  HDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETN  406
            + + LI GLKAKRVKIYD NP+IL AL  +++QVSVMVPNE+I NIS++Q LAD+WV+ N
Sbjct  43   NSVDLIKGLKAKRVKIYDTNPQILEALKGTNLQVSVMVPNELINNISTNQTLADQWVKNN  102

Query  407  VVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDM  586
            VVPFY  T IRYLLVGNEILS+PPNTTWF LVPA+RKIR SVKKFGL KIK+GTPLA+DM
Sbjct  103  VVPFYPHTMIRYLLVGNEILSSPPNTTWFNLVPAIRKIRFSVKKFGLGKIKIGTPLAIDM  162

Query  587  LEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            LE+S+PPS+G FRSD++  V KPLL FL+RT SFFF DVYPYF
Sbjct  163  LESSFPPSNGTFRSDISEKVMKPLLHFLNRTKSFFFIDVYPYF  205



>ref|XP_004247041.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Solanum 
lycopersicum]
Length=464

 Score =   246 bits (629),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 139/163 (85%), Gaps = 0/163 (0%)
 Frame = +2

Query  227  HDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETN  406
            + + LI GLKAKRVKIYD NP+IL AL  +++QVSVMVPNE+I NIS++Q LAD+WV+ N
Sbjct  43   NSVDLIKGLKAKRVKIYDTNPQILDALKGTNLQVSVMVPNELINNISTNQTLADQWVKNN  102

Query  407  VVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDM  586
            +VPFY  T IRYLLVGNEILS+PPNTTWF LVP +RKIR SVKKFGL KIKVGTPLA+DM
Sbjct  103  IVPFYPHTMIRYLLVGNEILSSPPNTTWFNLVPTIRKIRFSVKKFGLGKIKVGTPLAIDM  162

Query  587  LEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            LE+S+PPS+G FRSD++  V KPLL FL+RT SFFF DVYPYF
Sbjct  163  LESSFPPSNGTFRSDISEKVMKPLLHFLNRTKSFFFIDVYPYF  205



>ref|XP_009610543.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Nicotiana 
tomentosiformis]
Length=465

 Score =   246 bits (628),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 117/163 (72%), Positives = 141/163 (87%), Gaps = 0/163 (0%)
 Frame = +2

Query  227  HDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETN  406
              + LI+GLKA RVKIYDANP+IL+A   + +Q+SVMVPNE+I NIS++Q LAD+WV+TN
Sbjct  44   KSVDLINGLKANRVKIYDANPEILKAFKGTKLQLSVMVPNELINNISTNQDLADQWVKTN  103

Query  407  VVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDM  586
            VVPFY +T IRY+LVGNEILS+PPNTTWF LVPA+RKIR +VKKFGL KIKVGTPLA+DM
Sbjct  104  VVPFYPDTMIRYVLVGNEILSSPPNTTWFNLVPAIRKIRYAVKKFGLGKIKVGTPLAIDM  163

Query  587  LEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            LE+S+PPS+G FRSD++  V KPLL FL+RT SFFF DVYPYF
Sbjct  164  LESSFPPSNGTFRSDISEKVMKPLLHFLNRTKSFFFIDVYPYF  206



>ref|XP_011089044.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Sesamum 
indicum]
Length=461

 Score =   246 bits (627),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 138/162 (85%), Gaps = 0/162 (0%)
 Frame = +2

Query  230  DLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNV  409
             +QLI  L  KR+KIY  NPKIL+++  +D+Q+S+MVPN +IP+IS++Q LAD+WV+TNV
Sbjct  45   SIQLIQKLNGKRIKIYGTNPKILKSIQGTDLQISIMVPNNLIPDISTNQTLADQWVQTNV  104

Query  410  VPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDML  589
            VPFY E+KIRYLLVGNEILSNPPNTTWF+LVPAMRKIR SVKK+GL KIKVGTPLAMD L
Sbjct  105  VPFYPESKIRYLLVGNEILSNPPNTTWFKLVPAMRKIRSSVKKYGLHKIKVGTPLAMDAL  164

Query  590  EASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            E+S+PPS+G FRSD+   V +P+L FL+RT SFFF DVY YF
Sbjct  165  ESSFPPSNGTFRSDVREKVIRPMLHFLNRTKSFFFVDVYTYF  206



>emb|CDP03931.1| unnamed protein product [Coffea canephora]
Length=418

 Score =   234 bits (597),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 140/163 (86%), Gaps = 0/163 (0%)
 Frame = +2

Query  227  HDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETN  406
              ++LI GLKAK VKIYDANPKIL ALG + +QVSVMVPNEII NISS+Q LAD+WV+TN
Sbjct  45   KSVELIQGLKAKGVKIYDANPKILAALGGTPLQVSVMVPNEIITNISSNQTLADQWVKTN  104

Query  407  VVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDM  586
            VVPFY +T+IRYLLVGNEILS P  TTWF LVPAMR+IR SVK FGL K+KVGTPLAMD+
Sbjct  105  VVPFYRKTRIRYLLVGNEILSGPDKTTWFNLVPAMRRIRYSVKTFGLNKVKVGTPLAMDV  164

Query  587  LEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            L +S+PPSSG+FRSD++  V KPLLQFLDRT SFFF DVYPYF
Sbjct  165  LGSSFPPSSGSFRSDVSDKVLKPLLQFLDRTKSFFFIDVYPYF  207


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 2/47 (4%)
 Frame = +1

Query  160  GADISATVGICYGQLGNNLPTPSRSAAHPWLKGEAGQDLRCQPENPQ  300
            GA++SA VGICYGQLGNNLPTPS+S     ++G   + ++    NP+
Sbjct  22   GAEMSAKVGICYGQLGNNLPTPSKSVE--LIQGLKAKGVKIYDANPK  66



>gb|EYU39188.1| hypothetical protein MIMGU_mgv1a006049mg [Erythranthe guttata]
Length=459

 Score =   235 bits (599),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 140/164 (85%), Gaps = 0/164 (0%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
               +QLI  L AKR+KIY ANPKIL+++  +D+Q+S+MVPN++I  I ++Q LAD WV+T
Sbjct  43   EKSIQLIQKLNAKRIKIYGANPKILKSIQGTDLQISIMVPNQLISAIYNNQTLADDWVKT  102

Query  404  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  583
            NVVPFY ++KIRYLLVGNEILS+ PN+TWFQLVPA+R+IR +VKK+GL+K+KVGTPLAMD
Sbjct  103  NVVPFYPQSKIRYLLVGNEILSSQPNSTWFQLVPAIRRIRNAVKKYGLKKVKVGTPLAMD  162

Query  584  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            +LE+SYPPS+G FRSD++ +V +PLL FL+RT SFFF DVY YF
Sbjct  163  VLESSYPPSNGTFRSDVSETVVEPLLHFLNRTKSFFFVDVYTYF  206



>ref|XP_008244679.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Prunus 
mume]
Length=462

 Score =   234 bits (598),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/163 (69%), Positives = 134/163 (82%), Gaps = 0/163 (0%)
 Frame = +2

Query  227  HDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETN  406
              ++LI  LKAKRVKIYDANPKIL AL N+D+QVS+MVPNE+I NISS+Q LAD+WV  N
Sbjct  42   ESVKLIQSLKAKRVKIYDANPKILEALRNTDLQVSMMVPNELINNISSNQTLADQWVHAN  101

Query  407  VVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDM  586
            VVPFY ET IRYLLVGNEILS P  T WF LVPAMRKI+ ++K  G+ K+KVGTPLAMD+
Sbjct  102  VVPFYPETLIRYLLVGNEILSQPDKTIWFNLVPAMRKIKAALKTHGIAKVKVGTPLAMDV  161

Query  587  LEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            LE+S+PPS+G FRSD + SV KPLLQF+++T SFFF DVY  F
Sbjct  162  LESSFPPSNGTFRSDFSASVIKPLLQFVNKTKSFFFVDVYTSF  204



>gb|EPS58986.1| hypothetical protein M569_15824, partial [Genlisea aurea]
Length=453

 Score =   232 bits (591),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 136/167 (81%), Gaps = 1/167 (1%)
 Frame = +2

Query  218  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWV  397
            P    ++LI  LKA RVKIYDANP+IL+AL   ++ VSVM+PN++IP +++DQ  +D WV
Sbjct  31   PPSESVRLIEKLKAGRVKIYDANPEILKALKGKNLLVSVMLPNQLIPAVAADQKFSDEWV  90

Query  398  ETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLA  577
              NV PFY  TKIRY+LVGNEILSNPPNTTWF+LVPAM++IR SV K G++KIK+GTPLA
Sbjct  91   RKNVAPFYPATKIRYILVGNEILSNPPNTTWFELVPAMKRIRISVVKLGMKKIKIGTPLA  150

Query  578  MDMLEASYPPSSGAFRSD-LTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            MD+LE+SYPPS+GAFRS  +   V KPLL+FL+RT SFFF DVYPYF
Sbjct  151  MDVLESSYPPSAGAFRSGVIADDVIKPLLRFLNRTKSFFFVDVYPYF  197



>ref|XP_008382581.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Malus 
domestica]
Length=463

 Score =   231 bits (589),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 111/166 (67%), Positives = 135/166 (81%), Gaps = 0/166 (0%)
 Frame = +2

Query  218  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWV  397
            P    ++LI  LKAKRVK+YDANPKIL AL N+D+QVS+MVPNE+I NISS+Q LAD WV
Sbjct  39   PPSQSVKLIQSLKAKRVKLYDANPKILTALRNTDLQVSIMVPNELINNISSNQTLADHWV  98

Query  398  ETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLA  577
             TNVVPFY ET IRYLLVGNEILS P    W+ LVPAMRKI+ ++K   + K+KVGTPLA
Sbjct  99   HTNVVPFYPETLIRYLLVGNEILSQPDKQIWYNLVPAMRKIKAALKTHRITKVKVGTPLA  158

Query  578  MDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            MD+LE+S+PPS+G FRSD++G V KPLL+F+++T SFFF DVY YF
Sbjct  159  MDVLESSFPPSNGTFRSDVSGLVLKPLLKFINKTKSFFFVDVYTYF  204



>ref|XP_004144397.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Cucumis 
sativus]
 gb|KGN58384.1| hypothetical protein Csa_3G634360 [Cucumis sativus]
Length=466

 Score =   231 bits (589),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 137/166 (83%), Gaps = 0/166 (0%)
 Frame = +2

Query  218  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWV  397
            P  H + LI  L A+ VKIYDANP+IL+AL N+D++VSVMVPNE+I NISS Q LAD+WV
Sbjct  39   PPSHSVNLIKSLNAQIVKIYDANPQILKALKNTDLRVSVMVPNELIINISSSQNLADQWV  98

Query  398  ETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLA  577
             TN++PFY +TKIRYLLVGNEI+S+  N TWF LVPAMR+I+ S+K +G+ K+KVGTP A
Sbjct  99   RTNILPFYPQTKIRYLLVGNEIISSTGNQTWFSLVPAMRRIKHSLKTYGIHKVKVGTPSA  158

Query  578  MDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            MD+L++S+PPS+G FR+D+   V +P+LQFL+RT SFFF DVYPYF
Sbjct  159  MDVLQSSFPPSNGTFRADIADRVMRPMLQFLNRTKSFFFLDVYPYF  204



>ref|XP_006386885.1| 3-glucanase family protein [Populus trichocarpa]
 gb|ERP64682.1| 3-glucanase family protein [Populus trichocarpa]
Length=465

 Score =   231 bits (588),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 136/163 (83%), Gaps = 0/163 (0%)
 Frame = +2

Query  227  HDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETN  406
              ++L+  LKAKRVKIYDANP IL++L ++D+QVS+M+PNE+I NIS  Q+L+D WV+TN
Sbjct  43   ESVELLKSLKAKRVKIYDANPDILKSLKDTDIQVSIMIPNELIQNISKSQSLSDHWVKTN  102

Query  407  VVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDM  586
            VVP+Y + KIRYLLVGNEIL+NP   TWF LVPAMR+I+ S+K   + KIKVGTP A+++
Sbjct  103  VVPYYSDVKIRYLLVGNEILTNPDTGTWFNLVPAMRRIKASLKTHKITKIKVGTPSALNV  162

Query  587  LEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            LE+S+PPS+G FRSD++G + KP+L+FLDRT SFFF DVYPYF
Sbjct  163  LESSFPPSNGTFRSDISGPIIKPMLRFLDRTKSFFFIDVYPYF  205



>ref|XP_008356234.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Malus 
domestica]
Length=524

 Score =   232 bits (591),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 136/166 (82%), Gaps = 0/166 (0%)
 Frame = +2

Query  218  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWV  397
            P    ++LI  L AKRVK+YDANPKIL AL N+D+QVS+MVPNE+I NISS+Q LAD+WV
Sbjct  91   PPSQSVKLIQSLNAKRVKLYDANPKILAALRNTDLQVSIMVPNELISNISSNQTLADQWV  150

Query  398  ETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLA  577
             TNVVPFY +T IRYLLVGNEILS P    WF LVPAMRKI+ ++K   + K+KVGTPLA
Sbjct  151  RTNVVPFYPDTLIRYLLVGNEILSQPNKQIWFNLVPAMRKIKAALKTHRITKVKVGTPLA  210

Query  578  MDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            MD+LE+S+PPS+G FRSD++GSV KP+L+F+++T SFFF D+Y YF
Sbjct  211  MDVLESSFPPSNGTFRSDISGSVIKPMLKFINKTKSFFFVDLYTYF  256



>ref|XP_011024595.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Populus 
euphratica]
Length=465

 Score =   230 bits (586),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 136/163 (83%), Gaps = 0/163 (0%)
 Frame = +2

Query  227  HDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETN  406
              ++LI  LKAKRVKIYDANP IL++L ++D+QVS+M+PNE+I NIS  Q+L+D WV+TN
Sbjct  43   ESVELIKSLKAKRVKIYDANPDILKSLKDTDIQVSIMIPNELIQNISKSQSLSDHWVKTN  102

Query  407  VVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDM  586
            VVP+Y + KIRYLLVGNEIL+NP   TWF LVPAMR+I+ S+K   ++KIKVGT  A+++
Sbjct  103  VVPYYSDVKIRYLLVGNEILTNPDTGTWFNLVPAMRRIKASLKSHKIKKIKVGTTSAINV  162

Query  587  LEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            LE+S+PPS+G FRSD++G + KP+L+FLDRT SFFF DVYPYF
Sbjct  163  LESSFPPSNGTFRSDISGPIIKPMLRFLDRTKSFFFIDVYPYF  205



>ref|XP_009372203.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Pyrus 
x bretschneideri]
Length=463

 Score =   229 bits (583),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 135/166 (81%), Gaps = 0/166 (0%)
 Frame = +2

Query  218  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWV  397
            P    ++LI  LKAKRVK+YDANPKIL AL N+D+QVS+MVPNE+I NISS+Q LAD WV
Sbjct  39   PPSQSVKLIQSLKAKRVKLYDANPKILTALRNTDLQVSIMVPNELINNISSNQTLADHWV  98

Query  398  ETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLA  577
             TN+VPFY ET IRYLLVGNEILS P    W+ LVPAMRKI+ ++K   + K+KVGTPLA
Sbjct  99   YTNLVPFYPETLIRYLLVGNEILSQPDKQVWYNLVPAMRKIKAALKTHRITKVKVGTPLA  158

Query  578  MDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            MD+LE+S+PPS+G FRSD++G V KP+L+F+++T SFFF DVY YF
Sbjct  159  MDVLESSFPPSNGTFRSDVSGLVLKPMLKFINKTKSFFFVDVYTYF  204



>ref|XP_004290162.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Fragaria 
vesca subsp. vesca]
Length=463

 Score =   228 bits (581),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 109/163 (67%), Positives = 135/163 (83%), Gaps = 0/163 (0%)
 Frame = +2

Query  227  HDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETN  406
              ++LI  LKAKRVKIYDANPKIL AL N+D+QVS+MVPNE+I NISS+Q LA++WV  N
Sbjct  42   ESVKLIQNLKAKRVKIYDANPKILEALRNTDLQVSMMVPNELINNISSNQTLANQWVHAN  101

Query  407  VVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDM  586
            VVPFY  T IRYLLVGNEILS P  + WF LVPAMRKI++++K  G+ K+KVGTP AMD+
Sbjct  102  VVPFYPHTLIRYLLVGNEILSAPDKSIWFNLVPAMRKIKKALKIHGITKVKVGTPSAMDV  161

Query  587  LEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            LE+S+PPS+G FRSD++ SV KP+L+FL +T SFFF DVYP+F
Sbjct  162  LESSFPPSNGTFRSDISSSVIKPMLKFLFKTKSFFFVDVYPFF  204



>gb|KDO46598.1| hypothetical protein CISIN_1g038099mg, partial [Citrus sinensis]
Length=250

 Score =   220 bits (560),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 130/167 (78%), Gaps = 1/167 (1%)
 Frame = +2

Query  218  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNIS-SDQALADRW  394
            P      +I  LKA RVKIYDANPKIL+AL N D+QVS+MVPNEII NIS S Q L+D+W
Sbjct  41   PQESVELMIKSLKATRVKIYDANPKILKALKNIDIQVSIMVPNEIINNISLSSQTLSDQW  100

Query  395  VETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  574
            V TNV+P+   TKIRYLLVGNEILS P  + W  LVPAMRKIR+S+K  G RKIKVGTP 
Sbjct  101  VRTNVLPYLPGTKIRYLLVGNEILSLPDKSIWPNLVPAMRKIRKSLKTLGARKIKVGTPS  160

Query  575  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            AMD+L++S+PPS+G FRSD++ SV +P+L FL+RT SFFF D Y +F
Sbjct  161  AMDVLQSSFPPSNGTFRSDISESVMRPMLHFLNRTKSFFFVDAYTFF  207



>ref|XP_007049651.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
 gb|EOX93808.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
Length=461

 Score =   225 bits (574),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 134/163 (82%), Gaps = 0/163 (0%)
 Frame = +2

Query  227  HDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETN  406
              ++LI  L AKRVKIYDANP IL AL ++++QVS+MVPN+++ NIS++Q LAD WVE+N
Sbjct  40   QSVKLIQSLGAKRVKIYDANPDILNALKDTNLQVSIMVPNQLLTNISTNQKLADSWVESN  99

Query  407  VVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDM  586
            VVPFY +TKIRYLLVGNE++S+ P  TW+ +VPAMRK++ S+K   L KIKVGT +AMD+
Sbjct  100  VVPFYPKTKIRYLLVGNEVISSSPKETWYSIVPAMRKLKNSLKIHSLNKIKVGTSMAMDV  159

Query  587  LEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            LE+S+PPS+G FRSD+ G + KP+LQFL RT SF+F DVYPYF
Sbjct  160  LESSFPPSNGTFRSDIAGPIVKPMLQFLSRTKSFYFLDVYPYF  202



>ref|XP_010100789.1| putative glucan endo-1,3-beta-glucosidase A6 [Morus notabilis]
 gb|EXB84487.1| putative glucan endo-1,3-beta-glucosidase A6 [Morus notabilis]
Length=470

 Score =   225 bits (574),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 137/163 (84%), Gaps = 0/163 (0%)
 Frame = +2

Query  227  HDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETN  406
              ++LI  LKAKRVKIY+A+P+IL AL N+++QVS+MVPNEI+ NIS++Q LAD WV TN
Sbjct  46   RSVELIKTLKAKRVKIYNADPEILTALRNTNIQVSIMVPNEILINISTNQTLADEWVHTN  105

Query  407  VVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDM  586
            +VPFY +T IRYLLVGNEI+S+     W+ LVPAMRKI+ +++  G+RK+KVGTP AMD+
Sbjct  106  LVPFYHDTMIRYLLVGNEIISSTAKPVWYALVPAMRKIKSALRTHGIRKVKVGTPSAMDV  165

Query  587  LEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            L++S+PPS+G+FRSD++G + KP+LQFL+RT SFFF DVYPYF
Sbjct  166  LQSSFPPSNGSFRSDISGPIIKPMLQFLNRTKSFFFVDVYPYF  208



>ref|XP_008460404.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Cucumis 
melo]
Length=465

 Score =   223 bits (568),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 133/163 (82%), Gaps = 0/163 (0%)
 Frame = +2

Query  227  HDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETN  406
            H + LI  L A+ VKIYDANP+IL AL N+D++VSVMVPNE+I NISS+Q LAD+WV TN
Sbjct  42   HSVNLIKSLNAQIVKIYDANPQILNALKNTDLRVSVMVPNELIINISSNQNLADQWVRTN  101

Query  407  VVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDM  586
            ++PFY + KIRYLLVGNEI+S+  N TWF LVPAMR+I+ S+K +G+ K+KVGT  AMD+
Sbjct  102  ILPFYPQIKIRYLLVGNEIISSTGNQTWFSLVPAMRRIKHSLKTYGIHKVKVGTSSAMDV  161

Query  587  LEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            L++S+PPS+G FR D+   V +P+LQFL+RT SF+F DVYPYF
Sbjct  162  LQSSFPPSNGTFREDIADRVMRPMLQFLNRTKSFYFLDVYPYF  204



>ref|XP_010036769.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Eucalyptus 
grandis]
 gb|KCW48410.1| hypothetical protein EUGRSUZ_K02113 [Eucalyptus grandis]
 gb|KCW48411.1| hypothetical protein EUGRSUZ_K02113 [Eucalyptus grandis]
Length=466

 Score =   221 bits (564),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/158 (68%), Positives = 131/158 (83%), Gaps = 1/158 (1%)
 Frame = +2

Query  245  HGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYG  424
            H LKA+RVKIYDANP ILRAL ++ +QVSVMVPNE+I  I+ +Q LAD WV +NVVPF+ 
Sbjct  50   HQLKAQRVKIYDANPSILRALEHTGIQVSVMVPNELINAIAVNQTLADSWVGSNVVPFHP  109

Query  425  ETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL-RKIKVGTPLAMDMLEASY  601
             TKIRYLLVGNEILS+  NTTWF LVPAMRK+++++K+  +  K+KVGTPLAMD+L  SY
Sbjct  110  ATKIRYLLVGNEILSSADNTTWFNLVPAMRKVKKALKRHKVHHKVKVGTPLAMDVLATSY  169

Query  602  PPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            PPSSG+FR D++  V KP+LQFL+RT SFFF DVYPYF
Sbjct  170  PPSSGSFRPDVSDRVMKPMLQFLNRTKSFFFIDVYPYF  207



>gb|KHG25787.1| putative glucan endo-1,3-beta-glucosidase A6 -like protein [Gossypium 
arboreum]
Length=461

 Score =   221 bits (562),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 128/163 (79%), Gaps = 0/163 (0%)
 Frame = +2

Query  227  HDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETN  406
              ++LI  L+AKRVKIYDAN  IL AL  +++QV +MVPNEII NIS+ Q LAD WVETN
Sbjct  40   QSVKLIQSLRAKRVKIYDANHDILNALKGTNLQVCIMVPNEIINNISTSQKLADSWVETN  99

Query  407  VVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDM  586
            VVPFY  TKIRYLLVGNE++S  P   W  +VPAMRKI++S+K  GL KIKV T +AMD+
Sbjct  100  VVPFYSTTKIRYLLVGNEVISGSPKDIWPNIVPAMRKIKKSLKAHGLDKIKVSTSMAMDV  159

Query  587  LEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            LE+S+PPS+G FRSD+  S+ +PLLQFL RT SF+F DVYPYF
Sbjct  160  LESSFPPSNGTFRSDIADSIVRPLLQFLHRTKSFYFLDVYPYF  202



>gb|KJB10878.1| hypothetical protein B456_001G230200 [Gossypium raimondii]
Length=461

 Score =   220 bits (561),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 127/163 (78%), Gaps = 0/163 (0%)
 Frame = +2

Query  227  HDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETN  406
              ++LI  L AKRVKIYDAN  IL AL  +++QV +MVPNEII NIS+ Q LAD WVETN
Sbjct  40   QSVKLIQSLGAKRVKIYDANHDILNALKGTNLQVCIMVPNEIINNISTSQKLADSWVETN  99

Query  407  VVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDM  586
            VVPFY  TKIRYLLVGNE++S  P   W  +VPAMRKI++S+K  GL KIKV T +AMD+
Sbjct  100  VVPFYSTTKIRYLLVGNEVISGSPKDIWPNIVPAMRKIKKSLKTHGLDKIKVSTSMAMDV  159

Query  587  LEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            LE+S+PPS+G FRSD+  S+ +PLLQFL RT SF+F DVYPYF
Sbjct  160  LESSFPPSNGTFRSDIADSIVRPLLQFLHRTKSFYFLDVYPYF  202



>gb|KJB10879.1| hypothetical protein B456_001G230200 [Gossypium raimondii]
Length=460

 Score =   220 bits (560),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 127/163 (78%), Gaps = 0/163 (0%)
 Frame = +2

Query  227  HDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETN  406
              ++LI  L AKRVKIYDAN  IL AL  +++QV +MVPNEII NIS+ Q LAD WVETN
Sbjct  40   QSVKLIQSLGAKRVKIYDANHDILNALKGTNLQVCIMVPNEIINNISTSQKLADSWVETN  99

Query  407  VVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDM  586
            VVPFY  TKIRYLLVGNE++S  P   W  +VPAMRKI++S+K  GL KIKV T +AMD+
Sbjct  100  VVPFYSTTKIRYLLVGNEVISGSPKDIWPNIVPAMRKIKKSLKTHGLDKIKVSTSMAMDV  159

Query  587  LEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            LE+S+PPS+G FRSD+  S+ +PLLQFL RT SF+F DVYPYF
Sbjct  160  LESSFPPSNGTFRSDIADSIVRPLLQFLHRTKSFYFLDVYPYF  202



>gb|KDP45279.1| hypothetical protein JCGZ_15144 [Jatropha curcas]
Length=464

 Score =   219 bits (558),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 107/200 (54%), Positives = 144/200 (72%), Gaps = 7/200 (4%)
 Frame = +2

Query  137  YWPCHLFPAQISQLRSEYAT---VNWATTF----PHHHDLQLIHGLKAKRVKIYDANPKI  295
            ++P  +F    S   SE +    +NW T      P  H ++LI  LKAKRVKIY A+ +I
Sbjct  5    FFPLFVFALLFSTCSSEISNKIGINWGTLGNNLPPPPHTVELIKSLKAKRVKIYSADQEI  64

Query  296  LRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNP  475
            L AL N+D+QVS+M+PNE+IPN+S  Q  +D WV+ NVV F  + KIRYLLVGNEIL+NP
Sbjct  65   LTALKNTDIQVSIMLPNELIPNVSKSQHFSDHWVKNNVVRFLPDVKIRYLLVGNEILTNP  124

Query  476  PNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKP  655
               TWF LVPAMR+I+ S++ + + K+KVGTP A+++LE+S+PPS+G FRSD+   + +P
Sbjct  125  DVGTWFNLVPAMRRIKCSLRAYKIHKVKVGTPSALNVLESSFPPSNGTFRSDIADPIMRP  184

Query  656  LLQFLDRTNSFFFFDVYPYF  715
            +LQFL+RT SFFF DVYPYF
Sbjct  185  MLQFLNRTKSFFFLDVYPYF  204



>ref|XP_012085272.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Jatropha 
curcas]
Length=469

 Score =   219 bits (559),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 107/200 (54%), Positives = 144/200 (72%), Gaps = 7/200 (4%)
 Frame = +2

Query  137  YWPCHLFPAQISQLRSEYAT---VNWATTF----PHHHDLQLIHGLKAKRVKIYDANPKI  295
            ++P  +F    S   SE +    +NW T      P  H ++LI  LKAKRVKIY A+ +I
Sbjct  10   FFPLFVFALLFSTCSSEISNKIGINWGTLGNNLPPPPHTVELIKSLKAKRVKIYSADQEI  69

Query  296  LRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNP  475
            L AL N+D+QVS+M+PNE+IPN+S  Q  +D WV+ NVV F  + KIRYLLVGNEIL+NP
Sbjct  70   LTALKNTDIQVSIMLPNELIPNVSKSQHFSDHWVKNNVVRFLPDVKIRYLLVGNEILTNP  129

Query  476  PNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKP  655
               TWF LVPAMR+I+ S++ + + K+KVGTP A+++LE+S+PPS+G FRSD+   + +P
Sbjct  130  DVGTWFNLVPAMRRIKCSLRAYKIHKVKVGTPSALNVLESSFPPSNGTFRSDIADPIMRP  189

Query  656  LLQFLDRTNSFFFFDVYPYF  715
            +LQFL+RT SFFF DVYPYF
Sbjct  190  MLQFLNRTKSFFFLDVYPYF  209



>ref|XP_003626949.1| Beta-1 3-glucanase [Medicago truncatula]
 gb|AET01425.1| O-glycosyl hydrolase family 17 protein [Medicago truncatula]
Length=463

 Score =   219 bits (558),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 134/161 (83%), Gaps = 0/161 (0%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            + LI  LKAKRVKIYDANP+IL+AL N+ +QVS+M+PNE++ N+SS+Q LA++WV+TN+V
Sbjct  47   VSLIKNLKAKRVKIYDANPQILKALENTGIQVSIMLPNELVTNVSSNQTLANQWVQTNLV  106

Query  413  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLE  592
            PFY +T IRYLLVGNE++S+  N TW  +VPAM +++ S+  FGL K+KVGTPLAMD+L+
Sbjct  107  PFYSKTLIRYLLVGNELISSTTNQTWPHIVPAMYRMKHSLTIFGLHKVKVGTPLAMDVLQ  166

Query  593  ASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
             S+PPS+G FR+D+  SV KP+L+FL  TNSFFF DVYP+F
Sbjct  167  TSFPPSNGTFRNDIALSVMKPMLEFLHVTNSFFFLDVYPFF  207



>ref|XP_004492271.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Cicer arietinum]
Length=463

 Score =   218 bits (555),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 98/164 (60%), Positives = 135/164 (82%), Gaps = 0/164 (0%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
             + + LI  L +KR+KIYD NP+IL +L N+++QVS+M+PNE+I NIS++Q L+D+W+++
Sbjct  41   QNSISLIKSLNSKRIKIYDTNPQILTSLKNTNIQVSIMLPNELITNISTNQTLSDQWIKS  100

Query  404  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  583
            NVVPFY +T IRYLL+GNEI+S+ PN+TW  LVPAMR+I+ S+KKF ++KIKVGT  AMD
Sbjct  101  NVVPFYPQTLIRYLLIGNEIISSTPNSTWPHLVPAMRRIKHSLKKFRIKKIKVGTSSAMD  160

Query  584  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            +LE S+PPS+ AFR D+   V KP+L+FL+RT SFFF DVYP+F
Sbjct  161  VLETSFPPSNAAFRKDIAVQVIKPMLRFLNRTKSFFFLDVYPFF  204



>gb|KFK38190.1| hypothetical protein AALP_AA3G081000 [Arabis alpina]
Length=462

 Score =   217 bits (553),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 130/161 (81%), Gaps = 0/161 (0%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            ++LI  L AKRVK+YDANPKIL AL ++D+ VSVMVPNE+I NIS    L+D WV++ ++
Sbjct  44   IKLIQSLNAKRVKLYDANPKILTALNSTDISVSVMVPNELIINISKSNTLSDEWVKSKIL  103

Query  413  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLE  592
            PFY  TKIRYLLVGNEILS+  +     LVPAMRKI+RS+K  G++KIKVGT LA+D+L+
Sbjct  104  PFYPTTKIRYLLVGNEILSSQNSQLKSSLVPAMRKIQRSLKTLGVKKIKVGTTLAVDVLQ  163

Query  593  ASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
             S+PPSSG FRSD++GSV KP+LQFL+RT SF F DVYPYF
Sbjct  164  TSFPPSSGEFRSDISGSVMKPMLQFLNRTKSFLFVDVYPYF  204



>gb|KEH22559.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=463

 Score =   217 bits (552),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 133/161 (83%), Gaps = 0/161 (0%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            L LI  L AKR+KIYD NP+IL  L N+++QVS+M+PNE+I NISS+Q L+D+W+++N++
Sbjct  44   LSLIKSLNAKRIKIYDTNPQILTTLKNTNIQVSIMLPNELITNISSNQTLSDQWIKSNIL  103

Query  413  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLE  592
            P+Y +T IRYLLVGNEI+S+ PN+TW  LVPAMR+I+ S+KKF +++IKVGT  AMD+LE
Sbjct  104  PYYPQTLIRYLLVGNEIISSTPNSTWLHLVPAMRRIKHSLKKFRVKRIKVGTSSAMDVLE  163

Query  593  ASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
             S+PPS+ AFR D+   V KP+L+FL+RT SFFF DVYP+F
Sbjct  164  TSFPPSNAAFRKDIAVQVIKPMLRFLNRTKSFFFLDVYPFF  204



>ref|XP_002884642.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60901.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=460

 Score =   216 bits (549),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/161 (64%), Positives = 130/161 (81%), Gaps = 0/161 (0%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            + LI  L AKRVK+YDANPKIL AL  +D+ VSVMVPNE+I NIS  ++L+D W+ +N++
Sbjct  42   VNLIKSLNAKRVKLYDANPKILTALNGTDITVSVMVPNELIVNISKSESLSDDWIRSNIL  101

Query  413  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLE  592
            PFY  TKIRYLLVGNEILS P +     LVPAMRKI+RS+K  G++K+KVGT LA+D+L+
Sbjct  102  PFYPTTKIRYLLVGNEILSFPDSELKSSLVPAMRKIQRSLKSLGVKKVKVGTTLAVDVLQ  161

Query  593  ASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            +S+PPSSG FRSD++G V KP+LQFL+RT SF F DVYPYF
Sbjct  162  SSFPPSSGEFRSDISGLVMKPMLQFLNRTKSFLFVDVYPYF  202



>ref|XP_003632052.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Vitis 
vinifera]
 emb|CBI39470.3| unnamed protein product [Vitis vinifera]
Length=467

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 105/164 (64%), Positives = 132/164 (80%), Gaps = 1/164 (1%)
 Frame = +2

Query  227  HDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETN  406
              +QLI GLKA RVK+YD NP+IL AL  +++QVS+MVPN+ I NIS  Q L+D+WV+TN
Sbjct  45   RSVQLIKGLKAGRVKLYDPNPEILEALSGTELQVSIMVPNQQISNISRSQKLSDQWVKTN  104

Query  407  VVPFYGETKIRYLLVGNEILS-NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  583
            VVP+Y ET IRY+LVGNE+LS       W  LVPAMR+I+ S++KF + K+KVGTPLAMD
Sbjct  105  VVPYYPETMIRYVLVGNEVLSLYDQKQGWPDLVPAMRRIKGSLRKFHIHKVKVGTPLAMD  164

Query  584  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            +LE+S+PPS+G FRSD++ SV KPLLQFL+RT SFFF DVYPYF
Sbjct  165  VLESSFPPSNGTFRSDISVSVVKPLLQFLNRTKSFFFLDVYPYF  208



>emb|CDY28063.1| BnaC05g44650D [Brassica napus]
Length=460

 Score =   214 bits (546),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 129/161 (80%), Gaps = 0/161 (0%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            + LI  L AK VK+YDANP IL AL  +D+ VSVMVPNE+I NI+  + L+D WV++NV+
Sbjct  42   VSLIKSLNAKSVKLYDANPSILAALKATDIVVSVMVPNELIVNITKSKTLSDDWVKSNVL  101

Query  413  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLE  592
            PFY  TKIRYLLVGNEILS+P +     LVPAMRKI+RS+K  G++K+KVGT LA+D+L 
Sbjct  102  PFYPSTKIRYLLVGNEILSSPDSELKSALVPAMRKIQRSLKTLGVKKVKVGTTLAVDVLN  161

Query  593  ASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            +SYPPSSG FRSD++GSV KP+LQFL+RT SF F DVYPYF
Sbjct  162  SSYPPSSGEFRSDISGSVMKPMLQFLNRTKSFLFVDVYPYF  202



>ref|XP_011024596.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Populus 
euphratica]
Length=465

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 128/153 (84%), Gaps = 0/153 (0%)
 Frame = +2

Query  227  HDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETN  406
              ++LI  LKAKRVKIYDANP IL++L N+D+QVS+MVPN +IPNIS  Q  +D+WV+TN
Sbjct  43   RSVELIKSLKAKRVKIYDANPDILKSLKNTDIQVSIMVPNALIPNISKSQYFSDQWVKTN  102

Query  407  VVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDM  586
            VVP+Y + KIRYLLVGNEIL+NP   TWF LVPAMR+I+ S+ +  +RKIKVGTP A+++
Sbjct  103  VVPYYSDVKIRYLLVGNEILTNPDTGTWFNLVPAMRRIKISLTRHNIRKIKVGTPSAINV  162

Query  587  LEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNS  685
            LE+S+PPS+G FRSD++G+V KP+LQFL+RT S
Sbjct  163  LESSFPPSNGTFRSDISGTVIKPMLQFLNRTKS  195



>ref|XP_006407848.1| hypothetical protein EUTSA_v10020660mg [Eutrema salsugineum]
 gb|ESQ49301.1| hypothetical protein EUTSA_v10020660mg [Eutrema salsugineum]
Length=469

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/161 (63%), Positives = 131/161 (81%), Gaps = 0/161 (0%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            ++LI  L AKRVK+YDANP IL AL  +D+ VSVMVPN++I NIS   +L+D W+ +N++
Sbjct  51   VKLIKSLNAKRVKLYDANPTILAALNATDIAVSVMVPNQLIVNISKSDSLSDDWIRSNIL  110

Query  413  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLE  592
            PFY +TKIRYLLVGNEILS+  +     LVPAMRKI+RS+K  G++K+KVGT LA+D+L+
Sbjct  111  PFYPDTKIRYLLVGNEILSSTDSELKSALVPAMRKIQRSLKTLGVKKVKVGTSLAVDVLQ  170

Query  593  ASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            +S+PPSSG FRSD++GSV KP+LQFL+RT SF F DVYPYF
Sbjct  171  SSFPPSSGEFRSDISGSVMKPMLQFLNRTKSFLFVDVYPYF  211



>ref|XP_006407849.1| hypothetical protein EUTSA_v10020660mg [Eutrema salsugineum]
 gb|ESQ49302.1| hypothetical protein EUTSA_v10020660mg [Eutrema salsugineum]
Length=470

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/161 (63%), Positives = 131/161 (81%), Gaps = 0/161 (0%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            ++LI  L AKRVK+YDANP IL AL  +D+ VSVMVPN++I NIS   +L+D W+ +N++
Sbjct  51   VKLIKSLNAKRVKLYDANPTILAALNATDIAVSVMVPNQLIVNISKSDSLSDDWIRSNIL  110

Query  413  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLE  592
            PFY +TKIRYLLVGNEILS+  +     LVPAMRKI+RS+K  G++K+KVGT LA+D+L+
Sbjct  111  PFYPDTKIRYLLVGNEILSSTDSELKSALVPAMRKIQRSLKTLGVKKVKVGTSLAVDVLQ  170

Query  593  ASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            +S+PPSSG FRSD++GSV KP+LQFL+RT SF F DVYPYF
Sbjct  171  SSFPPSSGEFRSDISGSVMKPMLQFLNRTKSFLFVDVYPYF  211



>emb|CDY24629.1| BnaA05g30280D [Brassica napus]
Length=460

 Score =   213 bits (543),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/161 (64%), Positives = 128/161 (80%), Gaps = 0/161 (0%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            + LI  L AK VK+YDANP IL AL  +D+ VSVMVPNE+I NI+  + L+D W+++NV+
Sbjct  42   VTLIKSLNAKSVKLYDANPSILAALNATDIVVSVMVPNELIVNITKSKTLSDDWIKSNVL  101

Query  413  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLE  592
            PFY  TKIRYLLVGNEILS+  +     LVPAMRKI+RS+K  G++K+KVGT LAMD+L 
Sbjct  102  PFYPSTKIRYLLVGNEILSSQDSELKSALVPAMRKIQRSLKTLGVKKVKVGTTLAMDVLN  161

Query  593  ASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            +SYPPSSG FRSD++GSV KP+LQFL+RT SF F DVYPYF
Sbjct  162  SSYPPSSGEFRSDISGSVMKPMLQFLNRTKSFLFVDVYPYF  202



>ref|XP_006297636.1| hypothetical protein CARUB_v10013655mg [Capsella rubella]
 gb|EOA30534.1| hypothetical protein CARUB_v10013655mg [Capsella rubella]
Length=460

 Score =   213 bits (542),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 128/161 (80%), Gaps = 0/161 (0%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            + LI  L AKRVK+YDANPKIL AL  +D+ VSVMVPNE++ NIS  ++L+D W+ +N++
Sbjct  42   VNLIKSLNAKRVKLYDANPKILAALNATDITVSVMVPNELLVNISKSESLSDDWIRSNIL  101

Query  413  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLE  592
            PFY  TKIRYLLVGNEILS+P +     LVPAMRKI+RS+K  G++K+KVGT LA+D+L+
Sbjct  102  PFYPTTKIRYLLVGNEILSSPDSELKASLVPAMRKIQRSLKSLGVKKVKVGTSLAVDVLQ  161

Query  593  ASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
             S+PPS G FR D++G V KP+LQFL+RT SF F DVYPYF
Sbjct  162  TSFPPSKGEFREDISGLVMKPMLQFLNRTKSFLFVDVYPYF  202



>ref|XP_010486278.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=461

 Score =   213 bits (541),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 128/161 (80%), Gaps = 0/161 (0%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            + LI  L AKRVK+YDANPKIL AL  +D+ VSVMVPNE++ NIS  + L+D W+ +N++
Sbjct  43   VNLIKSLNAKRVKLYDANPKILSALNATDITVSVMVPNELLVNISKSETLSDDWIRSNIL  102

Query  413  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLE  592
            PFY  TKIRYLLVGNEILS+  +     LVPAMRKI+RS+K  G++K+KVGT LA+D+L+
Sbjct  103  PFYPTTKIRYLLVGNEILSSTDSELKASLVPAMRKIQRSLKSLGVKKVKVGTSLAVDVLK  162

Query  593  ASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
             S+PPSSG F+ D++GSV KP+LQFL+RT SF F DVYPYF
Sbjct  163  TSFPPSSGEFKEDISGSVMKPMLQFLNRTKSFLFIDVYPYF  203



>ref|XP_009147086.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=501

 Score =   213 bits (543),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 103/161 (64%), Positives = 128/161 (80%), Gaps = 0/161 (0%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            + LI  L AK VK+YDANP IL AL  +D+ VSVMVPNE+I NI+  + L+D W+++NV+
Sbjct  83   VTLIKSLNAKSVKLYDANPSILAALNATDIVVSVMVPNELIVNITKSKTLSDDWIKSNVL  142

Query  413  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLE  592
            PFY  TKIRYLLVGNEILS+  +     LVPAMRKI+RS+K  G++K+KVGT LAMD+L 
Sbjct  143  PFYPSTKIRYLLVGNEILSSQDSELKSALVPAMRKIQRSLKTLGVKKVKVGTTLAMDVLN  202

Query  593  ASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            +SYPPSSG FRSD++GSV KP+LQFL+RT SF F DVYPYF
Sbjct  203  SSYPPSSGEFRSDISGSVMKPMLQFLNRTKSFLFVDVYPYF  243



>ref|XP_002303070.2| 3-glucanase family protein [Populus trichocarpa]
 gb|EEE82343.2| 3-glucanase family protein [Populus trichocarpa]
Length=465

 Score =   212 bits (539),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 127/153 (83%), Gaps = 0/153 (0%)
 Frame = +2

Query  227  HDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETN  406
              ++LI  LKAKRVKIYDANP IL++L N+D+QVS+MVPN +IPNIS  Q  +D+WV+TN
Sbjct  43   RSVELIKSLKAKRVKIYDANPDILKSLKNTDIQVSIMVPNALIPNISKSQYFSDQWVKTN  102

Query  407  VVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDM  586
            VVP+Y + KIRYLLVGNEIL+NP   TWF LVPAMR+I+ S+ +  +RKIKVGTP A+++
Sbjct  103  VVPYYSDVKIRYLLVGNEILTNPDTGTWFNLVPAMRRIKISLTRHNIRKIKVGTPSAINV  162

Query  587  LEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNS  685
            LE+S+PPS+G FR D++G+V KP+LQFL+RT S
Sbjct  163  LESSFPPSNGTFRPDISGTVIKPMLQFLNRTKS  195



>gb|AAF20214.1|AC012395_1 putative beta-1,3-glucanase precursor [Arabidopsis thaliana]
Length=440

 Score =   211 bits (537),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 127/161 (79%), Gaps = 0/161 (0%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            + LI  L AKRVK+YDANPKIL AL  +D+ VSVMVPNE++ NIS   +L+D W+ +N++
Sbjct  43   VNLIKSLNAKRVKLYDANPKILAALNGTDITVSVMVPNELLVNISKSASLSDDWIRSNIL  102

Query  413  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLE  592
            PFY  TKIRYLLVGNEILS P +     LVPAMRKI+RS+K  G++K+KVGT LA D+L+
Sbjct  103  PFYPTTKIRYLLVGNEILSLPDSELKSSLVPAMRKIQRSLKSLGVKKVKVGTTLATDVLQ  162

Query  593  ASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            +S+PPSSG FR D++G + KP+LQFL+RT SF F DVYPYF
Sbjct  163  SSFPPSSGEFREDISGLIMKPMLQFLNRTKSFLFVDVYPYF  203



>gb|KHN10950.1| Putative glucan endo-1,3-beta-glucosidase A6 [Glycine soja]
Length=397

 Score =   210 bits (534),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 131/167 (78%), Gaps = 1/167 (1%)
 Frame = +2

Query  218  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWV  397
            P    + LI  L AKRVK+YDANP IL AL ++ +QVS+MVPN++I NIS +Q+L+D+WV
Sbjct  42   PPQKSVSLITSLHAKRVKLYDANPAILHALRDTSLQVSIMVPNDLIVNISRNQSLSDKWV  101

Query  398  ETNVVPFYGETKIRYLLVGNEILSN-PPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  574
              NVVP++  T IRYLLVGNE+ S+  PN TW  LVPAMR+I+ S+K  G+RK+KVGT  
Sbjct  102  SDNVVPYHPRTLIRYLLVGNEVTSSTAPNGTWPYLVPAMRRIKHSLKSLGIRKVKVGTSS  161

Query  575  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            A+D+LEAS+PPS+GAFR DL+  V KP+L+FL+RT SFFF DVYP+F
Sbjct  162  AIDVLEASFPPSNGAFRKDLSAPVMKPMLKFLNRTKSFFFLDVYPFF  208



>ref|NP_683538.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 gb|AAF02143.1|AC009853_3 putative glucan endo-1-3-beta-glucosidase [Arabidopsis thaliana]
 dbj|BAC42699.1| putative beta-1,3-glucanase precursor [Arabidopsis thaliana]
 gb|AAO64098.1| putative glycosyl hydrolase [Arabidopsis thaliana]
 gb|AEE74528.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=460

 Score =   211 bits (537),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 127/161 (79%), Gaps = 0/161 (0%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            + LI  L AKRVK+YDANPKIL AL  +D+ VSVMVPNE++ NIS   +L+D W+ +N++
Sbjct  43   VNLIKSLNAKRVKLYDANPKILAALNGTDITVSVMVPNELLVNISKSASLSDDWIRSNIL  102

Query  413  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLE  592
            PFY  TKIRYLLVGNEILS P +     LVPAMRKI+RS+K  G++K+KVGT LA D+L+
Sbjct  103  PFYPTTKIRYLLVGNEILSLPDSELKSSLVPAMRKIQRSLKSLGVKKVKVGTTLATDVLQ  162

Query  593  ASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            +S+PPSSG FR D++G + KP+LQFL+RT SF F DVYPYF
Sbjct  163  SSFPPSSGEFREDISGLIMKPMLQFLNRTKSFLFVDVYPYF  203



>emb|CDY45466.1| BnaC09g12840D [Brassica napus]
Length=460

 Score =   211 bits (536),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/160 (63%), Positives = 128/160 (80%), Gaps = 0/160 (0%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            + LI  L AK VK+YDANP IL AL  +D+ VSVMVPNE+I NI+  + L+D W+++NV+
Sbjct  42   VSLIKSLNAKSVKLYDANPSILAALNATDIVVSVMVPNELIVNITKSKTLSDDWIKSNVL  101

Query  413  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLE  592
            PFY  TKIRYLLVGNEILS+P +     LVPAMRKI+RS+K  G++K+KVGT LA+D+L 
Sbjct  102  PFYPSTKIRYLLVGNEILSSPDSELKSALVPAMRKIQRSLKTLGVKKVKVGTTLAVDVLN  161

Query  593  ASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPY  712
            +SYPPSSG FRSD++GSV KP+LQFL+RT SF F DVYP+
Sbjct  162  SSYPPSSGEFRSDISGSVMKPMLQFLNRTKSFLFVDVYPF  201



>ref|XP_010464351.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=461

 Score =   210 bits (535),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 128/161 (80%), Gaps = 0/161 (0%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            + LI  L AKRVK+YDANPKIL AL ++D+ VSVMVPNE++ NIS  + L+D W+ +N++
Sbjct  43   VNLIKSLNAKRVKLYDANPKILTALNSTDITVSVMVPNELLVNISKSETLSDDWIRSNIL  102

Query  413  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLE  592
            PFY  TKIRYLLVGNEILS+  +     LVPAMRKI+RS+K  G++K+KVGT LA+D+L+
Sbjct  103  PFYPTTKIRYLLVGNEILSSTDSELKASLVPAMRKIQRSLKSLGVKKVKVGTSLAVDVLK  162

Query  593  ASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
             S+PPSSG F+ D++G V KP+LQFL+RT SF F DVYPYF
Sbjct  163  TSFPPSSGEFKEDISGLVMKPMLQFLNRTKSFLFVDVYPYF  203



>dbj|BAA89481.1| beta-1,3-glucanase [Salix gilgiana]
Length=478

 Score =   210 bits (534),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 126/153 (82%), Gaps = 0/153 (0%)
 Frame = +2

Query  227  HDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETN  406
              ++LI  LKAKRVKIYDANP IL++L N+D+QVS+MVPN +IPN+S+ Q  +D+WVETN
Sbjct  56   KSVELIKSLKAKRVKIYDANPDILKSLKNTDIQVSIMVPNALIPNMSTSQHFSDQWVETN  115

Query  407  VVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDM  586
            VVP+Y + KIRYLLVGNEIL+NP   TWF LVPAMR+I+ S+ +   RKIKVGTP A+++
Sbjct  116  VVPYYPDVKIRYLLVGNEILTNPDTGTWFNLVPAMRRIKISLTRRNFRKIKVGTPSAINV  175

Query  587  LEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNS  685
            LE+S PPS+G FRSD++G V KP+LQFL+RT S
Sbjct  176  LESSSPPSNGTFRSDVSGPVIKPMLQFLNRTKS  208



>gb|KJB84083.1| hypothetical protein B456_N004800 [Gossypium raimondii]
Length=464

 Score =   209 bits (533),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 127/164 (77%), Gaps = 0/164 (0%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
               ++LI  + A RVKIYDANP IL AL  +D+QVS+MVPN+ + NIS++Q LAD W+++
Sbjct  42   EKSVKLIQSIGANRVKIYDANPDILNALRGTDLQVSIMVPNQHLTNISTNQKLADSWIQS  101

Query  404  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  583
            NV+PFY + KIRYLLVGNE++S+ P   W+ +VPAMRKI+ ++    L KIKVGT +AMD
Sbjct  102  NVLPFYPKVKIRYLLVGNEVISSSPKEIWYSIVPAMRKIKNALNTHRLNKIKVGTSMAMD  161

Query  584  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            +LE+S+PPS+G FRSD+   + KP+LQFL RT SF+F DVYPYF
Sbjct  162  VLESSFPPSNGTFRSDIADPIVKPMLQFLSRTKSFYFLDVYPYF  205



>gb|AAM65039.1| putative glucan endo-1-3-beta-glucosidase [Arabidopsis thaliana]
Length=460

 Score =   209 bits (532),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 126/161 (78%), Gaps = 0/161 (0%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            + LI  L AKRVK+YDANPKIL AL  +D+ VSVMVPNE++ NIS   +L+D W+ +N++
Sbjct  43   VNLIKSLNAKRVKLYDANPKILAALNGTDITVSVMVPNELLVNISKSASLSDDWIRSNIL  102

Query  413  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLE  592
            PFY  TKIRYLLVGNEILS P +     LVPAMRKI+ S+K  G++K+KVGT LA D+L+
Sbjct  103  PFYPTTKIRYLLVGNEILSLPDSELKSSLVPAMRKIQHSLKSLGVKKVKVGTTLATDVLQ  162

Query  593  ASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            +S+PPSSG FR D++G + KP+LQFL+RT SF F DVYPYF
Sbjct  163  SSFPPSSGEFREDISGLIMKPMLQFLNRTKSFLFVDVYPYF  203



>ref|XP_010451138.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=461

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 126/161 (78%), Gaps = 0/161 (0%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            + LI  L AKRVK+YDANPKIL AL  +D+ VSVMVPNE++ NIS  + L+D W+ +N++
Sbjct  43   VNLIKSLNAKRVKLYDANPKILAALNATDITVSVMVPNELLVNISKSETLSDDWIRSNIL  102

Query  413  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLE  592
            PFY  TKIRYLLVGNEILS   +     LVPAMRKI+RS+K  G++K+KVGT LA+D+L+
Sbjct  103  PFYPTTKIRYLLVGNEILSFTDSELKASLVPAMRKIQRSLKSLGVKKVKVGTSLAVDVLK  162

Query  593  ASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
             S+PPSSG FR D++G V KP+LQFL+RT SF F DVYPYF
Sbjct  163  TSFPPSSGEFREDISGLVMKPMLQFLNRTKSFLFVDVYPYF  203



>ref|XP_003530849.2| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Glycine max]
Length=467

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 131/167 (78%), Gaps = 1/167 (1%)
 Frame = +2

Query  218  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWV  397
            P    + LI  L AKRVK+YDANP IL AL ++ +QVS+MVPN++I NIS +Q+L+D+WV
Sbjct  42   PPQKSVSLITSLHAKRVKLYDANPAILHALRDTSLQVSIMVPNDLIVNISRNQSLSDKWV  101

Query  398  ETNVVPFYGETKIRYLLVGNEILSN-PPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  574
              NVVP++  T IRYLLVGNE+ S+  PN TW  LVPAMR+I+ S+K  G+RK+KVGT  
Sbjct  102  SDNVVPYHPRTLIRYLLVGNEVTSSTAPNGTWPYLVPAMRRIKHSLKSLGIRKVKVGTSS  161

Query  575  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            A+D+LEAS+PPS+GAFR DL+  V KP+L+FL+RT SFFF DVYP+F
Sbjct  162  AIDVLEASFPPSNGAFRKDLSAPVMKPMLKFLNRTKSFFFLDVYPFF  208



>ref|XP_010247391.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Nelumbo 
nucifera]
Length=466

 Score =   209 bits (531),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/164 (60%), Positives = 129/164 (79%), Gaps = 3/164 (2%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            ++ I  L+A R+K+YDANP+IL AL  +++QVS+MVPN++I NISS QA+AD WV TNV+
Sbjct  43   IEFIKTLEAGRIKLYDANPEILNALAWTNIQVSIMVPNQLISNISSSQAVADEWVRTNVI  102

Query  413  PFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  583
            PFY +T IR+LLVGNEI    S+    TW+ LV AMR+I+ S+  + +R IKVGTP+AMD
Sbjct  103  PFYSKTLIRHLLVGNEIFNFYSDEDRQTWYNLVLAMRRIKHSLSTYNIRNIKVGTPVAMD  162

Query  584  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            +LE ++PPS+GAFRSD+   V KPLLQFL+RT SFFF DVYPYF
Sbjct  163  ILETAFPPSNGAFRSDIAVPVMKPLLQFLNRTRSFFFLDVYPYF  206



>gb|KHG02504.1| putative glucan endo-1,3-beta-glucosidase A6 -like protein [Gossypium 
arboreum]
Length=464

 Score =   208 bits (529),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 127/164 (77%), Gaps = 0/164 (0%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
               ++LI  + AKRVKIYDANP IL AL  +D+QVS+MVPN+ + NIS++Q LAD W+++
Sbjct  42   EKSVKLIQSIGAKRVKIYDANPDILNALRGTDLQVSIMVPNQHLTNISTNQKLADSWIQS  101

Query  404  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  583
            NV+PFY + KIRYLLVGNE++S+ P   W+ +VPAMRKI+ ++    L KIKVGT +AM 
Sbjct  102  NVLPFYPKVKIRYLLVGNEVISSSPKEIWYSIVPAMRKIKNALNTHRLNKIKVGTSMAMG  161

Query  584  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            +LE+S+PPS+G FRSD+   + KP+LQFL RT SF+F DVYPYF
Sbjct  162  VLESSFPPSNGTFRSDIAYPIVKPMLQFLSRTKSFYFLDVYPYF  205



>ref|XP_004510238.1| PREDICTED: putative copper-transporting ATPase HMA5-like [Cicer 
arietinum]
Length=1239

 Score =   216 bits (549),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 134/161 (83%), Gaps = 0/161 (0%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            + LI  LKAKRVKIYDANP+IL+AL N+ +QVS+M+PN++I +IS +Q L+++WV++N+V
Sbjct  823  ISLIKNLKAKRVKIYDANPQILKALENTGLQVSIMIPNQLITDISLNQTLSNQWVQSNLV  882

Query  413  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLE  592
            PFY +T IRYLLVGNE++S+  N TW  +VPAM +I+ S+  FGL K+KVGTPLAMD+L+
Sbjct  883  PFYPKTLIRYLLVGNELISSTTNQTWPHIVPAMHRIKNSLTNFGLHKVKVGTPLAMDILQ  942

Query  593  ASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
             S+PPS+G FR+D+  +V KP+L+FL+ TNSFFF DVYP+F
Sbjct  943  TSFPPSNGIFRNDIAFTVIKPMLEFLNITNSFFFLDVYPFF  983



>emb|CDO96794.1| unnamed protein product [Coffea canephora]
Length=446

 Score =   206 bits (523),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 105/186 (56%), Positives = 136/186 (73%), Gaps = 2/186 (1%)
 Frame = +2

Query  161  AQISQLRSEYATVNWATTFPHHHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMV  340
            AQI+Q+   Y  +      P    +QL+  L A +VK+YDANPKIL AL  S + ++VMV
Sbjct  23   AQINQVGVCYGQLGNNLPAPSQ-SVQLLQKLNATQVKLYDANPKILNALIGSKLYITVMV  81

Query  341  PNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKI  520
            PNE+I NISS+Q LA++WV+ NV+P+Y    IRY+LVGNE+LS      WF LVPA+++I
Sbjct  82   PNELIINISSNQTLANQWVQNNVIPYYPRAMIRYILVGNEVLSYYFKPLWFYLVPAVKRI  141

Query  521  RRSVKKFGLRKIKVGTPLAMDMLEAS-YPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFF  697
             +SVK FGL  +KVGTPLA+DMLE+S   PS+G FRSD+ G V KPLLQFL++TNSFFF 
Sbjct  142  HQSVKTFGLSNVKVGTPLAIDMLESSVLLPSNGTFRSDIAGKVVKPLLQFLNQTNSFFFV  201

Query  698  DVYPYF  715
            D+YPYF
Sbjct  202  DLYPYF  207



>ref|XP_006484802.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Citrus sinensis]
Length=466

 Score =   206 bits (523),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 125/167 (75%), Gaps = 1/167 (1%)
 Frame = +2

Query  218  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADR-W  394
            P      +I  LKA RVKIYDANPKIL+AL N+D+QVS+MVPNEII NIS         W
Sbjct  41   PQESVELMIKSLKATRVKIYDANPKILKALKNTDIQVSIMVPNEIINNISLSSQSLSDQW  100

Query  395  VETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  574
            V TNV+P+   TKIRYLLVGNEILS P  + W  LVPAMRKIR+S+K  G RKIKVGTP 
Sbjct  101  VRTNVLPYLPGTKIRYLLVGNEILSLPDKSIWPNLVPAMRKIRKSLKTLGARKIKVGTPS  160

Query  575  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            AMD+L++S+PPS+G FRSD++ SV +P+L FL+RT SFFF D Y +F
Sbjct  161  AMDVLQSSFPPSNGTFRSDISESVMRPMLHFLNRTKSFFFVDAYTFF  207



>ref|XP_006437250.1| hypothetical protein CICLE_v10031440mg [Citrus clementina]
 gb|ESR50490.1| hypothetical protein CICLE_v10031440mg [Citrus clementina]
Length=466

 Score =   206 bits (523),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 125/167 (75%), Gaps = 1/167 (1%)
 Frame = +2

Query  218  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADR-W  394
            P      +I  LKA RVKIYDANPKIL+AL N+D+QVS+MVPNEII NIS         W
Sbjct  41   PQESVELMIKSLKATRVKIYDANPKILKALKNTDIQVSIMVPNEIINNISLSSQSLSDQW  100

Query  395  VETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  574
            V TNV+P+   TKIRYLLVGNEILS P  + W  LVPAMRKIR+S+K  G RKIKVGTP 
Sbjct  101  VRTNVLPYLPGTKIRYLLVGNEILSLPDKSIWPNLVPAMRKIRKSLKTLGARKIKVGTPS  160

Query  575  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            AMD+L++S+PPS+G FRSD++ SV +P+L FL+RT SFFF D Y +F
Sbjct  161  AMDVLQSSFPPSNGTFRSDISESVMRPMLHFLNRTKSFFFVDAYTFF  207



>ref|XP_010552026.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Tarenaya 
hassleriana]
Length=460

 Score =   204 bits (520),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 101/163 (62%), Positives = 124/163 (76%), Gaps = 0/163 (0%)
 Frame = +2

Query  227  HDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETN  406
              ++LI  L A RVKIYDA+  IL AL  +D+ VSVMVPNE+I NIS  +  +D WV TN
Sbjct  40   ESVKLIRSLNATRVKIYDADHSILEALNGTDIAVSVMVPNEMIVNISKSRTQSDNWVLTN  99

Query  407  VVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDM  586
            V+PFY  TKI YLLVGNE+LSNP       LVPAMRKI++S+K+ G+ K+KVGT LAMD+
Sbjct  100  VLPFYPTTKILYLLVGNEVLSNPHPELRSGLVPAMRKIKQSLKRLGVHKVKVGTTLAMDV  159

Query  587  LEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            L+ SYPPSSG FRSD++G V KP+LQFL++T SF F DVYPYF
Sbjct  160  LQTSYPPSSGEFRSDISGLVMKPMLQFLNKTKSFLFVDVYPYF  202



>ref|XP_010547131.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Tarenaya 
hassleriana]
Length=460

 Score =   204 bits (519),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 100/163 (61%), Positives = 121/163 (74%), Gaps = 0/163 (0%)
 Frame = +2

Query  227  HDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETN  406
              ++LI  L A RVKIYDAN  IL+AL  +D+ VSVMVPNEII N+S  QA +D WV   
Sbjct  40   ESVKLIKSLNATRVKIYDANHSILKALNGTDIAVSVMVPNEIIVNVSKSQAQSDDWVRNK  99

Query  407  VVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDM  586
            ++PFY  TKIRYLLVGNE+LSNP       LV AM KI+ S+K+FG+ K+KVGT LAMD+
Sbjct  100  ILPFYPTTKIRYLLVGNEVLSNPDPALRSGLVSAMCKIKHSLKRFGVHKVKVGTTLAMDV  159

Query  587  LEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            L+ SYPPSSG FR D+ G V KP+LQFL++T SF F DVYPYF
Sbjct  160  LQTSYPPSSGEFRPDIAGRVMKPMLQFLNKTKSFLFVDVYPYF  202



>ref|XP_007140788.1| hypothetical protein PHAVU_008G142200g [Phaseolus vulgaris]
 gb|ESW12782.1| hypothetical protein PHAVU_008G142200g [Phaseolus vulgaris]
Length=465

 Score =   203 bits (516),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 126/166 (76%), Gaps = 0/166 (0%)
 Frame = +2

Query  218  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWV  397
            P    +  +  L AKRVK+YDANP IL AL ++ +QVSVMVPN++I NISS+Q LAD+WV
Sbjct  41   PARQSVSHLTSLHAKRVKLYDANPAILHALQHTRLQVSVMVPNDLIMNISSNQTLADKWV  100

Query  398  ETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLA  577
             +NV  F   T+IRY+LVGNEI+S+  N TW  +VPAMR+I+ ++K  G+RK+KVGT  A
Sbjct  101  SSNVAAFLPNTRIRYILVGNEIISSTTNATWRHVVPAMRRIKHALKSLGIRKVKVGTSSA  160

Query  578  MDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            MD+L+ S+PPS+ AFR D+   V KP+L+FL+RT SFFF DVYP+F
Sbjct  161  MDVLQTSFPPSNAAFREDIAVPVMKPMLKFLNRTKSFFFLDVYPFF  206



>ref|XP_010685101.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Beta 
vulgaris subsp. vulgaris]
Length=467

 Score =   201 bits (512),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 127/165 (77%), Gaps = 3/165 (2%)
 Frame = +2

Query  230  DLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNV  409
             ++LI  LKA RVK+Y+ +P+IL+AL  +++QVS+MVPNEII NIS++Q +A+ WV  N+
Sbjct  42   SVELIKSLKAGRVKLYNPDPEILKALNGTNIQVSIMVPNEIISNISTNQTMANEWVHKNL  101

Query  410  VPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAM  580
            V +Y  T IRYLLVGNEILS        TW  LVPAMRK++ ++K  G+RK+KVGT +AM
Sbjct  102  VAYYPHTLIRYLLVGNEILSLMGEADKKTWHDLVPAMRKLQYALKIHGIRKVKVGTTMAM  161

Query  581  DMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            D+LE+S+PPS+G FRSD+  SV +PLLQFL+ T SFFF D YPYF
Sbjct  162  DVLESSFPPSNGTFRSDIAVSVMRPLLQFLNNTKSFFFIDCYPYF  206



>ref|XP_010246533.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Nelumbo 
nucifera]
Length=466

 Score =   201 bits (512),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/166 (58%), Positives = 127/166 (77%), Gaps = 3/166 (2%)
 Frame = +2

Query  227  HDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETN  406
              ++LI  LKA RVK+YDANP IL+AL  +++ VS+MVPN++I NISS Q+LA+ WV TN
Sbjct  41   RSIELIKSLKAGRVKLYDANPDILKALEGTNIHVSIMVPNQLISNISSSQSLANEWVRTN  100

Query  407  VVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLA  577
            VVPFY +T IRYLLVGNEI    S+    TW+ LV AMR+++ S+K   +R IK+GT  A
Sbjct  101  VVPFYPKTLIRYLLVGNEIFSFYSDQDRQTWYDLVQAMRRLKYSLKIHSIRNIKIGTTAA  160

Query  578  MDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            MD+L++S+PPS+G FRSD++  V KPLLQFL+RT S+FF D YPYF
Sbjct  161  MDVLQSSFPPSNGTFRSDISIPVMKPLLQFLNRTKSYFFLDAYPYF  206



>ref|XP_003541516.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Glycine max]
Length=391

 Score =   199 bits (505),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/167 (56%), Positives = 126/167 (75%), Gaps = 3/167 (2%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
            H  ++L+  +KA RVKIYDANP+ILR L N+ ++VS+M+PN  I  I+++Q++AD WV  
Sbjct  38   HRSIELLTTMKAGRVKIYDANPEILRLLSNTKLKVSIMIPNNEISGIAANQSIADEWVRN  97

Query  404  NVVPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  574
            NV+P+Y  T IRYLL+GNE+LS      +  W  LVPAMR I RS++   +R IK+GTPL
Sbjct  98   NVLPYYPNTMIRYLLMGNEVLSYNSEQGHQMWRDLVPAMRSIERSLRAQNIRDIKIGTPL  157

Query  575  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            AMD+L++++PPSS AFRSD+  SV  P+L+FLD+T SFFF DVYPYF
Sbjct  158  AMDVLQSTFPPSSSAFRSDIRDSVMVPMLKFLDQTKSFFFIDVYPYF  204



>ref|XP_003552101.2| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Glycine max]
Length=467

 Score =   200 bits (509),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 128/167 (77%), Gaps = 1/167 (1%)
 Frame = +2

Query  218  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWV  397
            P    + LI  + AKRVK+YDANP IL AL ++ +QVS+MVPN++I NIS++Q L+D+WV
Sbjct  42   PPRESVSLITSVHAKRVKLYDANPSILHALQDTRLQVSIMVPNDLILNISTNQTLSDQWV  101

Query  398  ETNVVPFYGETKIRYLLVGNEILSNPPNTT-WFQLVPAMRKIRRSVKKFGLRKIKVGTPL  574
              NVVP++  T IRYLLVGNE+ S    T  W  LVPAMR+I+RS+K  G+RKIKVGT  
Sbjct  102  SDNVVPYHPRTLIRYLLVGNEVTSTTAATATWPHLVPAMRRIKRSLKSHGIRKIKVGTSS  161

Query  575  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            AMD+L+ S+PPS+GAFR DLT  V KP+L+FL+RT SFFF DVYP+F
Sbjct  162  AMDVLQTSFPPSNGAFRKDLTAPVMKPMLKFLNRTKSFFFLDVYPFF  208



>gb|ADE76604.1| unknown [Picea sitchensis]
Length=462

 Score =   199 bits (507),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 96/162 (59%), Positives = 126/162 (78%), Gaps = 1/162 (1%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            + LI  +KA RVKIYD NP+IL+AL ++ ++VSVMV NE I N+SS+Q+ A++WV+ NVV
Sbjct  47   IHLIQRMKAGRVKIYDTNPEILKALSHTGIKVSVMVKNEDIANVSSNQSFANKWVKNNVV  106

Query  413  PFYGETKIRYLLVGNEILSN-PPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDML  589
             FY  T+I  +LVGNEILS+   N TW+QLVPAM +IRR++ ++ L  IKVGTPLAMD+L
Sbjct  107  YFYPATRINIILVGNEILSDYSNNQTWYQLVPAMLRIRRALLRYKLHHIKVGTPLAMDVL  166

Query  590  EASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
              S+PPSSG FR D+  +V KP+L+FL RT S+FF DVYPYF
Sbjct  167  NTSFPPSSGIFRDDVAETVMKPMLEFLSRTRSYFFIDVYPYF  208



>ref|XP_011620347.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Amborella 
trichopoda]
Length=456

 Score =   197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 101/197 (51%), Positives = 131/197 (66%), Gaps = 18/197 (9%)
 Frame = +2

Query  146  CHLFPAQI------SQLRSEYATVNWATTFPHHHDLQLIHGLKAKRVKIYDANPKILRAL  307
            C  FP  I      S L S   ++N   T            +K  R+KIYD NP+IL AL
Sbjct  16   CGGFPIGINYGQLGSNLSSPLQSINLIQTL-----------IKVSRIKIYDTNPQILHAL  64

Query  308  GNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPP-NT  484
             N+ +QVSVM+PN+ I NIS+ Q  +D WV+TN++PFY  T+IR +LVGNE+LS+     
Sbjct  65   TNTKIQVSVMLPNQAIQNISATQEASDSWVKTNILPFYPLTRIRTILVGNEVLSDSSIEP  124

Query  485  TWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQ  664
            TW  LVPAM+ I+RS++  G+  IKVGTPLAMD+L+AS+PPSSGAFR D+  +V +PLLQ
Sbjct  125  TWTMLVPAMQNIKRSLRALGIHNIKVGTPLAMDVLKASFPPSSGAFRDDIAETVMRPLLQ  184

Query  665  FLDRTNSFFFFDVYPYF  715
            FL +T SFFF D YPY 
Sbjct  185  FLKKTKSFFFLDAYPYL  201



>gb|ERM97971.1| hypothetical protein AMTR_s00117p00104410 [Amborella trichopoda]
Length=482

 Score =   197 bits (501),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 123/165 (75%), Gaps = 2/165 (1%)
 Frame = +2

Query  227  HDLQLIHGL-KAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
              + LI  L K  R+KIYD NP+IL AL N+ +QVSVM+PN+ I NIS+ Q  +D WV+T
Sbjct  49   QSINLIQTLIKVSRIKIYDTNPQILHALTNTKIQVSVMLPNQAIQNISATQEASDSWVKT  108

Query  404  NVVPFYGETKIRYLLVGNEILSNPP-NTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAM  580
            N++PFY  T+IR +LVGNE+LS+     TW  LVPAM+ I+RS++  G+  IKVGTPLAM
Sbjct  109  NILPFYPLTRIRTILVGNEVLSDSSIEPTWTMLVPAMQNIKRSLRALGIHNIKVGTPLAM  168

Query  581  DMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            D+L+AS+PPSSGAFR D+  +V +PLLQFL +T SFFF D YPY 
Sbjct  169  DVLKASFPPSSGAFRDDIAETVMRPLLQFLKKTKSFFFLDAYPYL  213



>ref|XP_004505110.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Cicer arietinum]
Length=462

 Score =   196 bits (499),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 124/167 (74%), Gaps = 3/167 (2%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
            +  ++L+  +KA RVK+YDANP ILR L  + ++VS+M+PN  I  I+++Q++AD WV  
Sbjct  38   YRSIELLTIMKAARVKLYDANPDILRLLSTTKLKVSIMIPNHEISGIAANQSIADEWVRN  97

Query  404  NVVPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  574
            NVVPFY +T IR+LLVGNE+LS      +  W  LVPAMR I+RS+K   +R IK+GTPL
Sbjct  98   NVVPFYPKTMIRFLLVGNEVLSYNSEQGHKMWHDLVPAMRSIKRSLKSLNIRDIKIGTPL  157

Query  575  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            AMD+L++++PPS G FRSD+  SV  P+L+FLDRT SFFF D YPYF
Sbjct  158  AMDVLQSTFPPSRGTFRSDIRDSVIVPMLKFLDRTKSFFFIDAYPYF  204



>ref|XP_004298215.2| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Fragaria 
vesca subsp. vesca]
Length=380

 Score =   193 bits (491),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/167 (56%), Positives = 124/167 (74%), Gaps = 3/167 (2%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
            +  ++LI  +K  RVK+YDANP+ILR L  +++ VS+MVPN  I  I+SDQ+ AD W+  
Sbjct  39   NRSVELIKSMKIGRVKLYDANPEILRLLSGTNISVSIMVPNNEITGIASDQSKADEWIRN  98

Query  404  NVVPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  574
            NV+P+Y ET IRYLLVGNEILS   +     W  +VPAM KI+ S++   +  IK+GTPL
Sbjct  99   NVLPYYPETMIRYLLVGNEILSYFSDQDRRLWHDVVPAMTKIKHSLRAKNITNIKIGTPL  158

Query  575  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            AMD+L+ S+PPSSGAFRSD++ +V  PLL+FL+RT SFFF DVYP+F
Sbjct  159  AMDVLQTSFPPSSGAFRSDVSETVIVPLLRFLNRTKSFFFIDVYPFF  205



>gb|KHN47213.1| Putative glucan endo-1,3-beta-glucosidase A6 [Glycine soja]
Length=345

 Score =   192 bits (487),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/158 (58%), Positives = 121/158 (77%), Gaps = 3/158 (2%)
 Frame = +2

Query  251  LKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGET  430
            +KA RVKIYDANP+ILR L N+ ++VS+M+PN  I  I+++Q++AD WV  NV+P+Y  T
Sbjct  1    MKAGRVKIYDANPEILRLLSNTKLKVSIMIPNNEISGIAANQSIADEWVRNNVLPYYPNT  60

Query  431  KIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASY  601
             IRYLL+GNE+LS      +  W  LVPAMR I RS++   +R IK+GTPLAMD+L++++
Sbjct  61   MIRYLLMGNEVLSYNSEQGHQMWRDLVPAMRSIERSLRAQNIRDIKIGTPLAMDVLQSTF  120

Query  602  PPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            PPSS AFRSD+  SV  P+L+FLD+T SFFF DVYPYF
Sbjct  121  PPSSSAFRSDIRDSVMVPMLKFLDQTKSFFFIDVYPYF  158



>gb|KEH30957.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=462

 Score =   194 bits (492),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 123/167 (74%), Gaps = 3/167 (2%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
            +  ++L+  +KA RVK+YDANP ILR L  + ++VS+M+PN  I  I+++Q++AD WV  
Sbjct  38   YRSIELLTTMKAGRVKLYDANPDILRLLSTTKLKVSIMIPNHEISGIAANQSIADEWVRN  97

Query  404  NVVPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  574
            N++P+Y  T  RYLLVGNE+LS      +  W  LVPAMR I+R++    +R IK+GTPL
Sbjct  98   NILPYYPNTLFRYLLVGNEVLSYNSEQGHKMWHDLVPAMRSIKRALNSQNIRGIKIGTPL  157

Query  575  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            AMD+LE+++PPSSG FRSD+  SV  P+L+FL+RTNSFFF D YPYF
Sbjct  158  AMDVLESTFPPSSGTFRSDIRDSVMAPMLKFLNRTNSFFFIDAYPYF  204



>ref|XP_007153895.1| hypothetical protein PHAVU_003G073900g [Phaseolus vulgaris]
 gb|ESW25889.1| hypothetical protein PHAVU_003G073900g [Phaseolus vulgaris]
Length=368

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 123/167 (74%), Gaps = 3/167 (2%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
               ++L+  +KA  VK+YDANP+ILR L  + ++VS+M+PN  I  I+++Q++AD WV  
Sbjct  38   QRSIELLTSMKAGLVKLYDANPEILRLLSTTKLKVSIMIPNNEIAGIATNQSMADEWVRN  97

Query  404  NVVPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  574
            NV+P+Y +T IRYLLVGNE+LS      +  W  LVPAMR I RS+K   +R IK+GTPL
Sbjct  98   NVLPYYPKTLIRYLLVGNEVLSYNSEQGHQMWNDLVPAMRNIERSLKGQNIRDIKIGTPL  157

Query  575  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            AMD+L++++PPSSG FR D+  SV  P+L+FL+RT SFFF D+YPYF
Sbjct  158  AMDVLQSTFPPSSGTFRPDVRDSVMAPMLKFLNRTKSFFFIDIYPYF  204



>emb|CAN60692.1| hypothetical protein VITISV_007558 [Vitis vinifera]
Length=404

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 124/166 (75%), Gaps = 3/166 (2%)
 Frame = +2

Query  227  HDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETN  406
              ++LI  +KA RVK+YDANP+IL  L  + +QVS+MVPN+ I NISS+Q LAD+WV  N
Sbjct  39   QSIELIKSMKAGRVKLYDANPEILNLLSGTKIQVSIMVPNQEISNISSNQTLADQWVRDN  98

Query  407  VVPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLA  577
            V+ +Y +T IR+++VGNE+LS   +    TW  LVPAMR+I++S++   +  IKVGT +A
Sbjct  99   VLSYYPQTMIRFIVVGNEVLSYYSDRDRETWSNLVPAMRRIKKSLQANNIPNIKVGTSVA  158

Query  578  MDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            MD++E+S+PPSSG FRSD+  +V  PLL+FL  TNSFFF DVYPY 
Sbjct  159  MDVMESSFPPSSGMFRSDILDTVMVPLLEFLSGTNSFFFLDVYPYL  204



>emb|CDY08004.1| BnaC03g35190D [Brassica napus]
Length=460

 Score =   192 bits (487),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 101/161 (63%), Positives = 130/161 (81%), Gaps = 0/161 (0%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            ++LI  L AKRVK+YDANP IL AL  +D+ VSVMVPNE+I NIS   +L+D W+ +N++
Sbjct  42   VKLIQSLNAKRVKLYDANPAILAALNATDITVSVMVPNELIVNISKSSSLSDEWIRSNIL  101

Query  413  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLE  592
            PF+  TKIRYLLVGNEIL++  +     LVPAMRKI+RS+KK G++K+KVGT LA+D+L+
Sbjct  102  PFHPSTKIRYLLVGNEILTSADSELKSALVPAMRKIQRSLKKLGVKKVKVGTTLAVDVLK  161

Query  593  ASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
             S+PPSSG FRSD++GSV KP+LQFL+RT SF F DVYPYF
Sbjct  162  TSFPPSSGEFRSDISGSVMKPMLQFLNRTKSFLFVDVYPYF  202



>emb|CDX74052.1| BnaA03g29950D [Brassica napus]
Length=567

 Score =   193 bits (491),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 101/161 (63%), Positives = 128/161 (80%), Gaps = 0/161 (0%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            ++LI  L AKRVK+YDANP IL AL  +D+ VSVMVPNE+I NIS    L+D W+ +N++
Sbjct  42   VKLIQSLNAKRVKLYDANPAILAALNATDITVSVMVPNELIVNISKSSTLSDEWIRSNIL  101

Query  413  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLE  592
            PF+  TKIRYLLVGNEILS+  +     LVPAMRKI+RS+KK  ++K+KVGT LA+D+L+
Sbjct  102  PFHPTTKIRYLLVGNEILSSADSELKSALVPAMRKIQRSLKKLSVKKVKVGTTLAVDVLK  161

Query  593  ASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
             S+PPSSG FRSD++GSV KP+LQFL+RT SF F DVYPYF
Sbjct  162  TSFPPSSGEFRSDISGSVMKPMLQFLNRTKSFLFVDVYPYF  202



>ref|XP_003632055.1| PREDICTED: LOW QUALITY PROTEIN: probable glucan endo-1,3-beta-glucosidase 
A6 [Vitis vinifera]
Length=474

 Score =   191 bits (486),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 124/166 (75%), Gaps = 3/166 (2%)
 Frame = +2

Query  227  HDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETN  406
              ++LI  +KA RVK+YDANP+IL  L  + +QVS+MVPN+ I NISS+Q LAD+WV  N
Sbjct  51   QSIELIKSMKAGRVKLYDANPEILNLLSGTKIQVSIMVPNQEISNISSNQTLADQWVRDN  110

Query  407  VVPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLA  577
            V+ +Y +T IR+++VGNE+LS   +    TW  LVPAMR+I++S++   +  IKVGT +A
Sbjct  111  VLSYYPQTMIRFIVVGNEVLSYYSDRDRETWSNLVPAMRRIKKSLQANNIPNIKVGTSVA  170

Query  578  MDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            MD++E+S+PPSSG FRSD+  +V  PLL+FL  TNSFFF DVYPY 
Sbjct  171  MDVMESSFPPSSGMFRSDILDTVMVPLLEFLSGTNSFFFLDVYPYL  216



>ref|XP_009134961.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=460

 Score =   191 bits (485),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 101/161 (63%), Positives = 129/161 (80%), Gaps = 0/161 (0%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            ++LI  L AKRVK+YDANP IL AL  +D+ VSVM PNE++ NIS   +L+D W+ +N++
Sbjct  42   VKLIQSLNAKRVKLYDANPAILAALNATDITVSVMDPNELLVNISKSSSLSDEWITSNIL  101

Query  413  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLE  592
            PF+  TKIRYLLVGNEILS+  +     LVPAMRKI+RS+KK G++K+KVGT LA+D+LE
Sbjct  102  PFHPTTKIRYLLVGNEILSSTDSELKSALVPAMRKIQRSLKKLGVKKVKVGTTLAVDVLE  161

Query  593  ASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
             S+PPSSG FRSD++GSV KP+LQFL+RT SF F DVYPYF
Sbjct  162  TSFPPSSGEFRSDISGSVMKPMLQFLNRTKSFLFVDVYPYF  202



>ref|XP_006299757.1| hypothetical protein CARUB_v10015952mg [Capsella rubella]
 gb|EOA32655.1| hypothetical protein CARUB_v10015952mg [Capsella rubella]
Length=476

 Score =   191 bits (484),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 123/167 (74%), Gaps = 3/167 (2%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
            +  + LI  +KA  VK+YDA+P+ L+ L  +++ V++MVPN+ I ++ SDQA AD+WV T
Sbjct  52   YQSINLIKTIKAGHVKLYDADPETLKLLSKTNLYVTIMVPNDQIISVGSDQAAADKWVAT  111

Query  404  NVVPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  574
            NV+PFY +T+IR++LVGNE+LS   +     W  LVPAMRK+  S++  G+  IKVGTPL
Sbjct  112  NVLPFYPQTRIRFVLVGNEVLSYSSDQDKQIWANLVPAMRKVVNSLRARGIHNIKVGTPL  171

Query  575  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            AMD L +S+PPSSGAFR DL   V  PLL+FL+ TNSFFF DVYPYF
Sbjct  172  AMDALRSSFPPSSGAFREDLAVPVMLPLLKFLNGTNSFFFLDVYPYF  218



>ref|XP_002520622.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF41758.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=463

 Score =   190 bits (482),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 121/167 (72%), Gaps = 3/167 (2%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
            +  +Q++  +   RVK+YDANP+ILR L  + +QVSVMVPN  I NI+S+Q +A  WV  
Sbjct  43   YRSIQILQSMNTGRVKLYDANPEILRLLAGTKIQVSVMVPNNEINNIASNQTIAHNWVRE  102

Query  404  NVVPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  574
            NV+ +Y  T IR++LVGNEILS   +     W  LVPAMRKI+ S++   ++ IKVGTPL
Sbjct  103  NVLQYYPNTMIRFILVGNEILSYSSDQDKKIWSNLVPAMRKIKNSLRSHNIQNIKVGTPL  162

Query  575  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            AMD+L+ + PPS+G FRSD++G+V  PLL+FL+ T SFFF DVYPYF
Sbjct  163  AMDVLQTTSPPSNGTFRSDISGTVILPLLKFLNGTKSFFFIDVYPYF  209



>ref|XP_006830552.2| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Amborella 
trichopoda]
Length=450

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 121/156 (78%), Gaps = 1/156 (1%)
 Frame = +2

Query  251  LKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGET  430
            LK  RVK+Y+  P IL+AL N+++QV++MVPN+ IPNIS  Q ++D WV+ N++PFY +T
Sbjct  37   LKVPRVKLYEPRPDILQALSNTNIQVTIMVPNQAIPNISLSQNVSDSWVKINLLPFYPKT  96

Query  431  KIRYLLVGNEILSNPP-NTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASYPP  607
            +I+ LLVGNE+LS+P   TTW  LVPAMR ++ S++   +  IKVGT LAMD LE+S+PP
Sbjct  97   RIQTLLVGNEVLSDPSIKTTWSMLVPAMRNLKYSLRALDVGSIKVGTTLAMDTLESSFPP  156

Query  608  SSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            S+G FRSD+   V KPLLQFL++T SF+F DVYPYF
Sbjct  157  SNGTFRSDIAVPVIKPLLQFLNKTKSFYFVDVYPYF  192



>gb|ERM97968.1| hypothetical protein AMTR_s00117p00097230 [Amborella trichopoda]
Length=464

 Score =   190 bits (482),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 121/156 (78%), Gaps = 1/156 (1%)
 Frame = +2

Query  251  LKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGET  430
            LK  RVK+Y+  P IL+AL N+++QV++MVPN+ IPNIS  Q ++D WV+ N++PFY +T
Sbjct  51   LKVPRVKLYEPRPDILQALSNTNIQVTIMVPNQAIPNISLSQNVSDSWVKINLLPFYPKT  110

Query  431  KIRYLLVGNEILSNPP-NTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASYPP  607
            +I+ LLVGNE+LS+P   TTW  LVPAMR ++ S++   +  IKVGT LAMD LE+S+PP
Sbjct  111  RIQTLLVGNEVLSDPSIKTTWSMLVPAMRNLKYSLRALDVGSIKVGTTLAMDTLESSFPP  170

Query  608  SSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            S+G FRSD+   V KPLLQFL++T SF+F DVYPYF
Sbjct  171  SNGTFRSDIAVPVIKPLLQFLNKTKSFYFVDVYPYF  206



>ref|XP_010466734.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=474

 Score =   190 bits (482),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/167 (56%), Positives = 122/167 (73%), Gaps = 3/167 (2%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
            +  + LI  LKA  VK+YDA+P+ L+ L  +++ V++MVPN+ I +I +DQA AD WV T
Sbjct  52   YQSINLIKSLKAGHVKLYDADPETLKLLSKTNLYVTIMVPNDQIISIGADQATADNWVAT  111

Query  404  NVVPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  574
            NV+PFY +T+IR++LVGNEILS   +     W  LVPAMRK+  S++  G+  IKVGTPL
Sbjct  112  NVLPFYPQTRIRFVLVGNEILSYSSDQDKQIWANLVPAMRKVVNSLRVRGIHNIKVGTPL  171

Query  575  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            AMD L +S+PPSSGAFR D+   V  PLL+FL+ TNSFFF DVYPYF
Sbjct  172  AMDALRSSFPPSSGAFREDIAVPVMLPLLKFLNGTNSFFFLDVYPYF  218



>ref|XP_010488453.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=476

 Score =   190 bits (482),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 122/167 (73%), Gaps = 3/167 (2%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
            +  + LI  LKA  VK+YDA+P+ L+ L  +++ V++MVPN+ I +I +DQA AD W+ T
Sbjct  52   YQSINLIKSLKAGHVKLYDADPETLKLLSKTNLYVTIMVPNDQIISIGADQATADNWIAT  111

Query  404  NVVPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  574
            NV+PFY +T+IR++LVGNEILS   +     W  LVPAMRK+  S++  G+  IKVGTPL
Sbjct  112  NVLPFYPQTRIRFVLVGNEILSYSSDQDKQIWANLVPAMRKVVNSLRARGIHNIKVGTPL  171

Query  575  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            AMD L +S+PPSSGAFR D+   V  PLL+FL+ TNSFFF DVYPYF
Sbjct  172  AMDALRSSFPPSSGAFREDIAVPVMLPLLKFLNGTNSFFFLDVYPYF  218



>ref|XP_007199923.1| hypothetical protein PRUPE_ppa006984mg [Prunus persica]
 gb|EMJ01122.1| hypothetical protein PRUPE_ppa006984mg [Prunus persica]
Length=387

 Score =   187 bits (476),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 107/128 (84%), Gaps = 0/128 (0%)
 Frame = +2

Query  332  VMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAM  511
            +MVPNE+I NISS+Q LAD+WV  NVVPFY ET IRYLLVGNEILS P  T WF LVPAM
Sbjct  1    MMVPNELINNISSNQTLADQWVHANVVPFYPETLIRYLLVGNEILSQPDKTIWFNLVPAM  60

Query  512  RKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFF  691
            RKI+ ++K  G+ K+KVGTPLAMD+LE+S+PPS+G FRSD++ SV KPLLQF+++T SFF
Sbjct  61   RKIKAALKTHGITKVKVGTPLAMDVLESSFPPSNGTFRSDISTSVIKPLLQFVNKTKSFF  120

Query  692  FFDVYPYF  715
            F DVY YF
Sbjct  121  FVDVYTYF  128



>ref|XP_006418839.1| hypothetical protein EUTSA_v10002513mg [Eutrema salsugineum]
 gb|ESQ37275.1| hypothetical protein EUTSA_v10002513mg [Eutrema salsugineum]
Length=474

 Score =   188 bits (477),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 122/167 (73%), Gaps = 3/167 (2%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
            +  + LI  LKA  VK+YDA+P+ L+ L  +++ V++MVPN  I ++ SD+A AD WV T
Sbjct  50   YQSINLIKSLKAGHVKLYDADPETLKLLSQTNLYVTIMVPNNQIISVGSDKAAADNWVNT  109

Query  404  NVVPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  574
            NV+P++ +T+IR++LVGNEILS   +     W  LVPAMRKI  S++  G+  IKVGTPL
Sbjct  110  NVLPYHPQTRIRFVLVGNEILSYSSDQDKQIWSNLVPAMRKIVNSLRARGIHNIKVGTPL  169

Query  575  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            AMD+L +S+PPSSG FR ++T  V  PLL+FL+ TNSFFF DVYPYF
Sbjct  170  AMDVLRSSFPPSSGTFREEITAPVISPLLKFLNGTNSFFFLDVYPYF  216



>ref|XP_010023613.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Eucalyptus 
grandis]
 gb|KCW59922.1| hypothetical protein EUGRSUZ_H02646 [Eucalyptus grandis]
Length=440

 Score =   187 bits (475),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/169 (53%), Positives = 127/169 (75%), Gaps = 8/169 (5%)
 Frame = +2

Query  227  HDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETN  406
              ++ I  ++A+RVK+YDA+P+IL+ L  + VQVS+MV N+ IP ++S QALAD+WV  N
Sbjct  17   QSVERIQLMRARRVKLYDADPEILKLLSRTQVQVSIMVQNQEIPGVASSQALADKWVRNN  76

Query  407  VVPFYGETKIRYLLVGNEILSNPPNTT------WFQLVPAMRKIRRSVKKFGLRKIKVGT  568
            V+P+Y  T IR++LVGNE+LS   N+T      W  LVPAMR+I+ S++   +R IKVGT
Sbjct  77   VLPYYPRTMIRFILVGNEVLSY--NSTDRDRQLWGDLVPAMRRIKSSLRSNRIRNIKVGT  134

Query  569  PLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            P+AMD++E+++PPSSG FRSD+  SV  PL++FL+ T S+FF DVYPYF
Sbjct  135  PMAMDVVESTFPPSSGRFRSDVAESVIMPLVRFLNSTRSYFFLDVYPYF  183



>ref|XP_009373620.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Pyrus 
x bretschneideri]
Length=469

 Score =   187 bits (475),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 122/168 (73%), Gaps = 4/168 (2%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
            +  ++L+  + A RVK+YDA+P+IL+ L  +++QVS+MVPN  I  I+SDQ  AD WV  
Sbjct  38   NRSIELLMAMNAGRVKLYDADPEILKLLSGTNLQVSIMVPNNEISTIASDQIKADEWVRN  97

Query  404  NVVPFYGETKIRYLLVGNEILS----NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTP  571
            NV+P+Y ET IRYLL+GNE+LS    +     W+ LVPAM KI+ S+K   +  IKVGTP
Sbjct  98   NVLPYYPETMIRYLLIGNEVLSYNSSDQDRQMWYDLVPAMSKIKSSLKSQNITNIKVGTP  157

Query  572  LAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            LAMD L++++PPS   FR+D++ +V  P+L+FL+RT SFFF DVYP+F
Sbjct  158  LAMDALQSTFPPSKATFRADISDTVMAPMLRFLNRTKSFFFIDVYPFF  205



>ref|XP_008222761.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Prunus 
mume]
Length=477

 Score =   187 bits (475),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 122/168 (73%), Gaps = 4/168 (2%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
            +  ++LI  + A RVK+YDANP+IL  L  +++QVS+MVPN  I  I+S+QA AD WV  
Sbjct  47   NSSIELIKSMNAGRVKLYDANPEILNLLSGTNLQVSIMVPNSEISIIASNQAKADEWVRN  106

Query  404  NVVPFYGETKIRYLLVGNEILS----NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTP  571
            NV+P+Y +T IRYLLVGNE+LS    +     W  LVPAM KI+ S+K   +  IKVGTP
Sbjct  107  NVLPYYPQTMIRYLLVGNEVLSYNSSDQDRQMWLDLVPAMTKIKSSLKAQNITNIKVGTP  166

Query  572  LAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            LA+D+L++++PPS+  FR D++ SV  P+L+FL+RTNSF F DVYPYF
Sbjct  167  LAIDVLQSTFPPSNSMFRPDISNSVMAPMLRFLNRTNSFMFIDVYPYF  214



>ref|XP_006421038.1| hypothetical protein CICLE_v10004917mg [Citrus clementina]
 gb|ESR34278.1| hypothetical protein CICLE_v10004917mg [Citrus clementina]
Length=466

 Score =   187 bits (475),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 120/167 (72%), Gaps = 3/167 (2%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
            +  ++ I  LKA  VKIYDANP+IL+ L  +D++VS+MV N  I +I+S Q +AD+WV  
Sbjct  43   YQSIESIKFLKAGSVKIYDANPEILKLLSGTDLKVSIMVQNHEIIDIASKQKVADQWVHD  102

Query  404  NVVPFYGETKIRYLLVGNEILSNPPNT---TWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  574
            NV+ FY ET IR++LVGNEILS         W  LVPAM +I++ +    +  IKVGTPL
Sbjct  103  NVLSFYPETMIRFILVGNEILSQSSEEYKQIWKNLVPAMHRIKKCLNAHNIHNIKVGTPL  162

Query  575  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            AMD+ + ++PPS+G FRSD++ SV +PLLQFL+RT SFFF DVYPYF
Sbjct  163  AMDIFQTTFPPSNGTFRSDISASVMEPLLQFLNRTKSFFFLDVYPYF  209



>ref|XP_010512882.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=476

 Score =   187 bits (474),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 91/167 (54%), Positives = 121/167 (72%), Gaps = 3/167 (2%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
            +  + LI  LKA  VK+YDA+P+ L+ L  +++ V++MVPN+ I +I +DQA AD W+ T
Sbjct  52   YQSINLIKSLKAGHVKLYDADPETLKLLSKTNLYVTIMVPNDQIISIGADQATADNWIAT  111

Query  404  NVVPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  574
            NV+PF  +T+IR++LVGNEILS   +     W  LVPAMRK+  S++  G+  IKVGTPL
Sbjct  112  NVLPFSPQTRIRFVLVGNEILSYSSDQDKQIWANLVPAMRKVVNSLRARGIHNIKVGTPL  171

Query  575  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            AMD L +S+PPSSGAFR D+   V  PLL+FL+ TNSFFF DVYPYF
Sbjct  172  AMDALRSSFPPSSGAFREDIAVPVMLPLLKFLNGTNSFFFLDVYPYF  218



>ref|XP_007221306.1| hypothetical protein PRUPE_ppa016789mg, partial [Prunus persica]
 gb|EMJ22505.1| hypothetical protein PRUPE_ppa016789mg, partial [Prunus persica]
Length=452

 Score =   186 bits (473),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 120/168 (71%), Gaps = 4/168 (2%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
            +  ++ I  + A RVK+YDANP+IL  L  +++QVS+MVPN  I  I+S+QA AD WV  
Sbjct  22   NSSVEFIKSMNAGRVKLYDANPEILNLLSGTNLQVSIMVPNNEISTIASNQAKADEWVRN  81

Query  404  NVVPFYGETKIRYLLVGNEILS----NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTP  571
            NV+P+Y +T IRYLLVGNE+LS    +     W  LVPAM K + S+K   +  IKVGTP
Sbjct  82   NVLPYYPQTMIRYLLVGNEVLSYNSSDQDRQMWLDLVPAMTKFKSSLKAQNITNIKVGTP  141

Query  572  LAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            LAMD+LE+++PPS+  FR D++ SV  P+L+FL+RTNSF F DVYP+F
Sbjct  142  LAMDVLESTFPPSNSMFRPDISNSVMAPMLRFLNRTNSFMFIDVYPFF  189



>gb|AEN82021.1| AT3G23770-like protein, partial [Capsella rubella]
 gb|AEN82022.1| AT3G23770-like protein, partial [Capsella rubella]
 gb|AEN82024.1| AT3G23770-like protein, partial [Capsella rubella]
 gb|AEN82028.1| AT3G23770-like protein, partial [Capsella rubella]
Length=165

 Score =   177 bits (450),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 113/151 (75%), Gaps = 3/151 (2%)
 Frame = +2

Query  272  IYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLV  451
            +YDA+P+ L+ L  +++ V++MVPN+ I ++ SDQA AD WV TNV+PFY +T+IR++LV
Sbjct  1    LYDADPETLKLLSKTNLYVTIMVPNDQIISVGSDQAAADNWVATNVLPFYPQTRIRFVLV  60

Query  452  GNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAF  622
            GNE+LS   +     W  LVPAMRK+  S++  G+  IKVGTPLAMD L +S+PPSSGAF
Sbjct  61   GNEVLSYSSDQDKQIWANLVPAMRKVVNSLRARGIHNIKVGTPLAMDALRSSFPPSSGAF  120

Query  623  RSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            R DL   V  PLL+FL+ TNSFFF DVYPYF
Sbjct  121  REDLAVPVMLPLLKFLNGTNSFFFLDVYPYF  151



>ref|XP_002883459.1| hypothetical protein ARALYDRAFT_479892 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59718.1| hypothetical protein ARALYDRAFT_479892 [Arabidopsis lyrata subsp. 
lyrata]
Length=476

 Score =   186 bits (472),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 91/167 (54%), Positives = 120/167 (72%), Gaps = 3/167 (2%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
            +  + LI  LKA  VK+YDA+P+ L+ L  +++ V++MVPN  I +I +DQA AD WV T
Sbjct  52   YQSINLIKTLKAGHVKLYDADPETLKLLSKTNLYVTIMVPNNQIISIGADQAAADNWVAT  111

Query  404  NVVPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  574
            NV+P+Y +T+IR++LVGNEILS   +     W  LVPAMRK+  S++  G+  IKVGTPL
Sbjct  112  NVLPYYPQTRIRFVLVGNEILSYNTDQDKQIWANLVPAMRKVVNSLRARGIHNIKVGTPL  171

Query  575  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            AMD L +S+PPSSG FR D+   V  PLL+FL+ TNSFFF DVYPYF
Sbjct  172  AMDALRSSFPPSSGTFREDIAVPVMLPLLKFLNGTNSFFFLDVYPYF  218



>gb|KDO47456.1| hypothetical protein CISIN_1g012660mg [Citrus sinensis]
Length=459

 Score =   186 bits (471),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 120/167 (72%), Gaps = 3/167 (2%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
            +  ++ I  L+A  VKIYDANP+IL+ L  +D++VS+MV N  I +I+S Q +AD+WV  
Sbjct  43   YQSIESIKFLQAGSVKIYDANPEILKLLSGTDLKVSIMVQNHEIIDIASKQKVADQWVHD  102

Query  404  NVVPFYGETKIRYLLVGNEILSNPPNT---TWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  574
            NV+ FY ET IR++LVGNEILS         W  LVPAM +I++ +    +  IKVGTPL
Sbjct  103  NVLSFYPETMIRFILVGNEILSQSSEEYKQIWKNLVPAMHRIKKCLNAHNIHNIKVGTPL  162

Query  575  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            AMD+ + ++PPS+G FRSD++ SV +PLLQFL+RT SFFF DVYPYF
Sbjct  163  AMDIFQTTFPPSNGTFRSDISASVMEPLLQFLNRTKSFFFLDVYPYF  209



>gb|AEN82027.1| AT3G23770-like protein, partial [Capsella rubella]
Length=165

 Score =   177 bits (448),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 113/151 (75%), Gaps = 3/151 (2%)
 Frame = +2

Query  272  IYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLV  451
            +YDA+P+ L+ L  +++ V++MVPN+ I ++ +DQA AD WV TNV+PFY +T+IR++LV
Sbjct  1    LYDADPETLKLLSKTNLYVTIMVPNDQIISVGTDQAAADNWVATNVLPFYPQTRIRFVLV  60

Query  452  GNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAF  622
            GNE+LS   +     W  LVPAMRK+  S++  G+  IKVGTPLAMD L +S+PPSSGAF
Sbjct  61   GNEVLSYSSDQDKQIWANLVPAMRKVVNSLRARGIHNIKVGTPLAMDALRSSFPPSSGAF  120

Query  623  RSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            R DL   V  PLL+FL+ TNSFFF DVYPYF
Sbjct  121  REDLAVPVMLPLLKFLNGTNSFFFLDVYPYF  151



>gb|KFK39673.1| a6 anther-specific protein [Arabis alpina]
Length=474

 Score =   185 bits (470),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 120/167 (72%), Gaps = 3/167 (2%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
            +  + LI  +KA  VK+YDA+P+ L  L  +++ V++MVPN+ I +I SDQ+ AD WV T
Sbjct  50   YQSINLIKSIKAGHVKLYDADPETLMLLAQTNLYVTIMVPNDHIISIGSDQSAADNWVAT  109

Query  404  NVVPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  574
            +V+P+Y  T+IR++LVGNEILS   +     W  LVPAMRKI  S++  G+  IKVGTPL
Sbjct  110  SVIPYYPATRIRFVLVGNEILSYSSDQDKQIWTNLVPAMRKIVNSLRARGIHNIKVGTPL  169

Query  575  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            AMD+L +S+PPSSG FR D+   V  PLL+FL+ TNSFFF DVYPYF
Sbjct  170  AMDVLRSSFPPSSGTFREDVAAPVMLPLLKFLNGTNSFFFLDVYPYF  216



>ref|NP_189019.1| O-glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 dbj|BAB01853.1| beta-1,3-glucanase [Arabidopsis thaliana]
 gb|ABE65959.1| glycosyl hydrolase family 17 protein [Arabidopsis thaliana]
 gb|AEE76811.1| O-glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=476

 Score =   185 bits (470),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 128/188 (68%), Gaps = 4/188 (2%)
 Frame = +2

Query  161  AQISQLRSEYATVNWATTFPHHHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMV  340
            A  S++   Y  +     FP+   + LI  +KA  VK+YDA+P+ L+ L  +++ V++MV
Sbjct  32   ALASRIGINYGKLGNNLPFPYQ-SINLIKTIKAGHVKLYDADPETLKLLSTTNLYVTIMV  90

Query  341  PNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAM  511
            PN  I +I +DQA AD WV TNV+PF+ +T+IR++LVGNE+LS   +     W  LVPAM
Sbjct  91   PNNQIISIGADQAAADNWVATNVLPFHPQTRIRFVLVGNEVLSYSSDQDKQIWANLVPAM  150

Query  512  RKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFF  691
            RK+  S++  G+  IKVGTPLAMD L +S+PPSSG FR D+   V  PLL+FL+ TNSFF
Sbjct  151  RKVVNSLRARGIHNIKVGTPLAMDALRSSFPPSSGTFREDIAVPVMLPLLKFLNGTNSFF  210

Query  692  FFDVYPYF  715
            F DVYPYF
Sbjct  211  FLDVYPYF  218



>gb|ABK28569.1| unknown [Arabidopsis thaliana]
Length=477

 Score =   185 bits (470),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 128/188 (68%), Gaps = 4/188 (2%)
 Frame = +2

Query  161  AQISQLRSEYATVNWATTFPHHHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMV  340
            A  S++   Y  +     FP+   + LI  +KA  VK+YDA+P+ L+ L  +++ V++MV
Sbjct  32   ALASRIGINYGKLGNNLPFPYQ-SINLIKTIKAGHVKLYDADPETLKLLSTTNLYVTIMV  90

Query  341  PNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAM  511
            PN  I +I +DQA AD WV TNV+PF+ +T+IR++LVGNE+LS   +     W  LVPAM
Sbjct  91   PNNQIISIGADQAAADNWVATNVLPFHPQTRIRFVLVGNEVLSYSSDQDKQIWANLVPAM  150

Query  512  RKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFF  691
            RK+  S++  G+  IKVGTPLAMD L +S+PPSSG FR D+   V  PLL+FL+ TNSFF
Sbjct  151  RKVVNSLRARGIHNIKVGTPLAMDALRSSFPPSSGTFREDIAVPVMLPLLKFLNGTNSFF  210

Query  692  FFDVYPYF  715
            F DVYPYF
Sbjct  211  FLDVYPYF  218



>ref|XP_010532729.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Tarenaya 
hassleriana]
Length=480

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 121/167 (72%), Gaps = 3/167 (2%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
            +  + LI  +KA  VK+YDA+P+ L  L  +++ V++MVPN  + +I SDQ  AD WV+T
Sbjct  56   YQSINLIKSVKAGHVKLYDADPETLTLLSQTNLYVTIMVPNHQVISIGSDQTAADNWVKT  115

Query  404  NVVPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  574
            NV+P+Y +T IR++LVGNE+LS   +     W  LVPAMRK+  S++  G+R IKVGTPL
Sbjct  116  NVLPYYPQTLIRFVLVGNEVLSYSTDQDREVWRNLVPAMRKLVNSLRAQGIRNIKVGTPL  175

Query  575  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            AMD+L++++PPSSG FR D+ G V  PLL+FL+ TNSFFF D YPYF
Sbjct  176  AMDVLQSTFPPSSGTFREDIAGPVMLPLLKFLNGTNSFFFIDAYPYF  222



>emb|CDP15106.1| unnamed protein product [Coffea canephora]
Length=470

 Score =   185 bits (469),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 123/165 (75%), Gaps = 1/165 (1%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
            HH + L+  + A RVKIYDANP++L+ L  + +Q S+M+ + +IP+I+SDQ++AD+WV  
Sbjct  46   HHSINLLQSMNASRVKIYDANPEVLKLLSGTKLQASIMIQDGLIPDIASDQSIADQWVRD  105

Query  404  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  583
            NV+ +Y +T IR++LVGNEILS+     W+ LVPAM +I  S+K   ++ IKVGTP+AMD
Sbjct  106  NVLAYYPQTMIRFVLVGNEILSSNNTLLWYNLVPAMVRIHNSIKAQNIQNIKVGTPVAMD  165

Query  584  MLEASYPPSSGAFRSD-LTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            +LE+++PPSSG FR + L   V  PLL FL++T SFFF +V+PYF
Sbjct  166  ILESTFPPSSGKFRPEILNHQVTVPLLSFLNKTRSFFFVNVFPYF  210



>emb|CDY59775.1| BnaCnng35540D [Brassica napus]
Length=474

 Score =   185 bits (469),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 118/167 (71%), Gaps = 3/167 (2%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
            +  + LI  LKA  VK+YDA+ + L  L  +++ V++MVPN  I  I +DQ  AD WV T
Sbjct  50   YQSINLIKTLKAGHVKLYDADQETLTLLSKTNLYVTIMVPNNQIITIGADQTAADNWVNT  109

Query  404  NVVPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  574
            NV+P Y +T+IR++LVGNEILS   +    TW  LVPAMRKI  S++  G+  IKVGTPL
Sbjct  110  NVLPHYPQTRIRFVLVGNEILSYNSDQDKQTWANLVPAMRKIVNSLRARGIHNIKVGTPL  169

Query  575  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            AMD+L +SYPPSSGAFR ++   V  PLL+FL+ TNSFFF DVYPYF
Sbjct  170  AMDVLRSSYPPSSGAFREEVAAPVMLPLLKFLNGTNSFFFLDVYPYF  216



>gb|KJB10880.1| hypothetical protein B456_001G230200 [Gossypium raimondii]
Length=386

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 102/127 (80%), Gaps = 0/127 (0%)
 Frame = +2

Query  335  MVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMR  514
            MVPNEII NIS+ Q LAD WVETNVVPFY  TKIRYLLVGNE++S  P   W  +VPAMR
Sbjct  1    MVPNEIINNISTSQKLADSWVETNVVPFYSTTKIRYLLVGNEVISGSPKDIWPNIVPAMR  60

Query  515  KIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFF  694
            KI++S+K  GL KIKV T +AMD+LE+S+PPS+G FRSD+  S+ +PLLQFL RT SF+F
Sbjct  61   KIKKSLKTHGLDKIKVSTSMAMDVLESSFPPSNGTFRSDIADSIVRPLLQFLHRTKSFYF  120

Query  695  FDVYPYF  715
             DVYPYF
Sbjct  121  LDVYPYF  127



>ref|XP_009102583.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=478

 Score =   185 bits (469),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 118/167 (71%), Gaps = 3/167 (2%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
            +  + LI  LKA  VK+YDA+ + L  L  +++ V++MVPN  I  I +DQ  AD WV T
Sbjct  54   YQSINLIKTLKAGHVKLYDADQETLTLLSKTNLYVTIMVPNNQIITIGADQTAADNWVNT  113

Query  404  NVVPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  574
            NV+P Y +T+IR++LVGNEILS   +    TW  LVPAMRKI  S++  G+  IKVGTPL
Sbjct  114  NVLPHYPQTRIRFVLVGNEILSYNSDQDKQTWANLVPAMRKIVNSLRARGIHNIKVGTPL  173

Query  575  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            AMD+L +SYPPSSGAFR ++   V  PLL+FL+ TNSFFF DVYPYF
Sbjct  174  AMDVLRSSYPPSSGAFREEVAAPVMLPLLKFLNGTNSFFFLDVYPYF  220



>ref|XP_009385472.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009385473.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Musa 
acuminata subsp. malaccensis]
Length=474

 Score =   185 bits (469),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 117/163 (72%), Gaps = 2/163 (1%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            + L+H + A  VKIYDANP ILRAL  +  +VS+MVPNEIIP++  + + AD WV TN+ 
Sbjct  48   VHLLHSIGAGAVKIYDANPAILRALAGTRFRVSIMVPNEIIPSLGVNASAADAWVGTNLG  107

Query  413  PFYGETKIRYLLVGNEILS--NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDM  586
            PFY   ++RYLLVGNEILS  +  N+TW  LVPAM  I R++    +R +KVGT LAMD 
Sbjct  108  PFYPAVRVRYLLVGNEILSYTSLANSTWPFLVPAMVNIHRALSARSIRDVKVGTTLAMDA  167

Query  587  LEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            L  S+PPS+GAFRSD+   V +PLL+FL RT S++F D YPYF
Sbjct  168  LVTSFPPSAGAFRSDIAEPVMRPLLRFLHRTRSYYFVDAYPYF  210



>emb|CDY63754.1| BnaAnng19080D [Brassica napus]
Length=478

 Score =   184 bits (468),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 118/167 (71%), Gaps = 3/167 (2%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
            +  + LI  LKA  VK+YDA+ + L  L  +++ V++MVPN  I  I +DQ  AD WV T
Sbjct  54   YQSINLIKTLKAGHVKLYDADQETLTLLSKTNLYVTIMVPNNQIITIGADQTAADNWVNT  113

Query  404  NVVPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  574
            NV+P Y +T+IR++LVGNEILS   +    TW  LVPAMRKI  S++  G+  IKVGTPL
Sbjct  114  NVLPHYPQTRIRFVLVGNEILSYNSDQDKQTWANLVPAMRKIVNSLRARGIHNIKVGTPL  173

Query  575  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            AMD+L +SYPPSSGAFR ++   V  PLL+FL+ TNSFFF DVYPYF
Sbjct  174  AMDVLRSSYPPSSGAFREEVAALVMLPLLKFLNGTNSFFFLDVYPYF  220



>ref|XP_008792940.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X2 [Phoenix dactylifera]
Length=467

 Score =   184 bits (467),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 82/164 (50%), Positives = 123/164 (75%), Gaps = 1/164 (1%)
 Frame = +2

Query  227  HDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETN  406
              +  +  L+A  VKIYDANP ILRAL  + ++VS+MVPN++ P+++++++LAD W+  N
Sbjct  43   RSIGFLQSLRAGAVKIYDANPAILRALAGTRLRVSIMVPNQVFPSLAANRSLADAWLAAN  102

Query  407  VVPFYGETKIRYLLVGNEILSN-PPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  583
            ++PFY + +IR+LLVGNE+LS+    ++W  LVPAM  + R+++   +R +KVGT LAMD
Sbjct  103  LLPFYPQARIRFLLVGNEVLSDYSVKSSWPSLVPAMANLHRALRARSIRDVKVGTTLAMD  162

Query  584  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
             L+ S+PPS+G FR D+ G+V +PLL+F +RT SF+F DVYPYF
Sbjct  163  SLKTSFPPSAGEFRDDIAGTVIRPLLRFANRTRSFYFVDVYPYF  206



>ref|XP_002534357.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF28022.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=388

 Score =   182 bits (462),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  335  MVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMR  514
            MVPNE+I NIS  Q+L+D+WV +NVVPFY + KIRYLL+GNEIL+NP   TWF LVPAMR
Sbjct  1    MVPNELIANISKSQSLSDQWVNSNVVPFYPDVKIRYLLIGNEILTNPDTGTWFNLVPAMR  60

Query  515  KIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFF  694
            +I+ S++   + KIKV TP AM++LE+S+PPS+G FRSD++G + KP+LQFL+RT SFFF
Sbjct  61   RIKSSLRTHKIHKIKVSTPHAMNVLESSFPPSNGTFRSDISGPIIKPMLQFLNRTKSFFF  120

Query  695  FDVYPYF  715
             DVYPYF
Sbjct  121  LDVYPYF  127



>ref|XP_008792939.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X1 [Phoenix dactylifera]
Length=470

 Score =   184 bits (467),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 82/164 (50%), Positives = 123/164 (75%), Gaps = 1/164 (1%)
 Frame = +2

Query  227  HDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETN  406
              +  +  L+A  VKIYDANP ILRAL  + ++VS+MVPN++ P+++++++LAD W+  N
Sbjct  46   RSIGFLQSLRAGAVKIYDANPAILRALAGTRLRVSIMVPNQVFPSLAANRSLADAWLAAN  105

Query  407  VVPFYGETKIRYLLVGNEILSN-PPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  583
            ++PFY + +IR+LLVGNE+LS+    ++W  LVPAM  + R+++   +R +KVGT LAMD
Sbjct  106  LLPFYPQARIRFLLVGNEVLSDYSVKSSWPSLVPAMANLHRALRARSIRDVKVGTTLAMD  165

Query  584  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
             L+ S+PPS+G FR D+ G+V +PLL+F +RT SF+F DVYPYF
Sbjct  166  SLKTSFPPSAGEFRDDIAGTVIRPLLRFANRTRSFYFVDVYPYF  209



>ref|XP_009135862.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=480

 Score =   184 bits (467),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 118/167 (71%), Gaps = 3/167 (2%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
            +  + LI  + A  VK+YDA+P+ L  L  +++ V++MVPN  I  I +DQA AD WV T
Sbjct  56   YQSINLIKSINAGHVKLYDADPETLMVLSQTNLYVTIMVPNNHIIPIGADQAAADNWVNT  115

Query  404  NVVPFYGETKIRYLLVGNEILSNPPNT---TWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  574
            NV+  Y +TKIR++LVGNEILSN  +    TW  LVPAMRKI  S++  G+  IKVGTPL
Sbjct  116  NVLAHYPQTKIRFVLVGNEILSNNSDQDKQTWSSLVPAMRKIVTSLRARGIHNIKVGTPL  175

Query  575  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            AMD+L  S+PPSSGAFR ++   V  PLL+FL+ TNSFFF DVYPYF
Sbjct  176  AMDVLRTSFPPSSGAFREEVAALVMLPLLKFLNGTNSFFFLDVYPYF  222



>ref|XP_008380636.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Malus 
domestica]
Length=469

 Score =   184 bits (466),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 120/168 (71%), Gaps = 4/168 (2%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
            +  ++L+  + A RVK+YDA+ +IL+ L  +++QVS+MVPN  I  I SDQ  AD WV  
Sbjct  38   NRSIELLKAMNAGRVKLYDADLEILKLLSGTNLQVSIMVPNNEISTIXSDQTKADEWVRN  97

Query  404  NVVPFYGETKIRYLLVGNEILS----NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTP  571
            NV+P+Y ET IRYLL+GNE+LS    +     W+ LVPAM KI+ S+K   +  IKVGTP
Sbjct  98   NVLPYYPETMIRYLLIGNEVLSYNSSDQDRQMWYDLVPAMSKIKSSLKSQNITNIKVGTP  157

Query  572  LAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            LAMD L++++PPS   FR+D++ +V  P+L+FL+RT SFFF DVYP+F
Sbjct  158  LAMDALQSTFPPSKATFRADISDTVMAPMLRFLNRTRSFFFIDVYPFF  205



>ref|XP_006349905.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Solanum tuberosum]
Length=470

 Score =   184 bits (466),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 125/173 (72%), Gaps = 3/173 (2%)
 Frame = +2

Query  206  ATTFPHHHD-LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQAL  382
            A   P  +D ++L+  +KA RVKIYDANP+ILR L  +++QVS+MVPN  I  ++++Q+ 
Sbjct  39   ANNLPSPYDSIELLKNMKAGRVKIYDANPEILRLLSGTNLQVSIMVPNNQISIVAANQSA  98

Query  383  ADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTT-WFQLVPAMRKIRRSVKKFGLRKIK  559
            A++WV  NV+P+Y  T IRY+LVGNE+LSN  +   W+ L+PAM  IR S+ +  +  IK
Sbjct  99   ANQWVRDNVLPYYPNTMIRYILVGNEVLSNKDDQGLWYDLIPAMNNIRNSIDQHNIHNIK  158

Query  560  VGTPLAMDMLEASYPPSSGAFRSDLT-GSVFKPLLQFLDRTNSFFFFDVYPYF  715
            +GTP AMD+LE S+PPSSG FR D++  ++  PLL+FL+ T S+FF D YPYF
Sbjct  159  IGTPFAMDILETSFPPSSGEFRLDISRNNLLMPLLRFLNWTKSYFFLDAYPYF  211



>gb|AEN82023.1| AT3G23770-like protein, partial [Capsella rubella]
 gb|AEN82026.1| AT3G23770-like protein, partial [Capsella rubella]
Length=165

 Score =   175 bits (444),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 112/151 (74%), Gaps = 3/151 (2%)
 Frame = +2

Query  272  IYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLV  451
            +YDA+P+ L+ L  +++ V++MVPN+ I +I +DQA AD WV TNV+PFY +T+IR++LV
Sbjct  1    LYDADPETLKLLSKTNLYVTIMVPNDQIISIGADQAAADNWVATNVLPFYPQTRIRFVLV  60

Query  452  GNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAF  622
            GNE+LS   +     W  LVPAM K+  S++  G+  IKVGTPLAMD L +S+PPSSGAF
Sbjct  61   GNEVLSYSSDQDKQIWANLVPAMHKVVNSLRARGIHNIKVGTPLAMDALRSSFPPSSGAF  120

Query  623  RSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            R DL   V  PLL+FL+ TNSFFF DVYPYF
Sbjct  121  REDLAVPVMLPLLKFLNGTNSFFFLDVYPYF  151



>ref|XP_002444717.1| hypothetical protein SORBIDRAFT_07g026540 [Sorghum bicolor]
 gb|EES14212.1| hypothetical protein SORBIDRAFT_07g026540 [Sorghum bicolor]
Length=484

 Score =   184 bits (467),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 93/196 (47%), Positives = 124/196 (63%), Gaps = 8/196 (4%)
 Frame = +2

Query  146  CHLFPAQISQLRS---EYATVNWATTFPH-HHDLQLIHGLKAKRVKIYDANPKILRALGN  313
            CH   A  +  R     Y TV  A   P     +QL+    A  VKIYDAN  ILRAL  
Sbjct  35   CHCHGANGNGCRGLGINYGTV--ADDLPSASRSVQLLRATGAGAVKIYDANADILRALAG  92

Query  314  SDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPP--NTT  487
            + + VS+MVPN  IP+++S +A A+ WV  N+ P    T++ YLLVGNE+LSN     +T
Sbjct  93   TGMPVSIMVPNSAIPSLASSRAAAEDWVAANLAPHIPATRVAYLLVGNEVLSNRAIAGST  152

Query  488  WFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQF  667
            W  +VPAM  + R+++  G+RK+K+GT LAMD L ASYPPS+GAFR D+   V +PLL+F
Sbjct  153  WRSVVPAMANLHRALRAHGIRKVKIGTTLAMDALSASYPPSAGAFRDDIAEDVVRPLLRF  212

Query  668  LDRTNSFFFFDVYPYF  715
            L+ T S++F D YPYF
Sbjct  213  LNATGSYYFVDAYPYF  228



>ref|XP_010314851.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Solanum 
lycopersicum]
Length=463

 Score =   183 bits (465),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 124/173 (72%), Gaps = 3/173 (2%)
 Frame = +2

Query  206  ATTFPHHHD-LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQAL  382
            A   P  +D ++L+  +KA RVKIYDANP+ILR L  +++QVS+MVPN  I  ++++Q  
Sbjct  33   ANNLPSPYDSIELLKNMKAGRVKIYDANPEILRLLSGTNLQVSIMVPNNQISVVAANQTA  92

Query  383  ADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTT-WFQLVPAMRKIRRSVKKFGLRKIK  559
            A++WV  NV+P+Y  T IRY+LVGNE+LSN  +   W+ L+PAM  IR S+ +  +  IK
Sbjct  93   ANQWVRDNVLPYYPNTMIRYILVGNEVLSNKDDQGLWYDLIPAMNNIRNSIDQHNIHNIK  152

Query  560  VGTPLAMDMLEASYPPSSGAFRSDLT-GSVFKPLLQFLDRTNSFFFFDVYPYF  715
            +GTP AMD+LE ++PPSSG FR D++  ++  PLL+FL+ T S+FF D YPYF
Sbjct  153  IGTPFAMDLLETTFPPSSGEFRLDISRNNILMPLLRFLNWTRSYFFLDAYPYF  205



>gb|AAM64490.1| beta-1,3-glucanase, putative [Arabidopsis thaliana]
Length=476

 Score =   183 bits (464),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 120/167 (72%), Gaps = 3/167 (2%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
            +  + LI  +KA  VK+YDA+P+ L+ L  +++ V++MVPN  I +I +DQA AD WV T
Sbjct  52   YQSINLIKTIKAGHVKLYDADPETLKLLSTTNLYVTIMVPNNQIISIGADQAAADNWVAT  111

Query  404  NVVPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  574
            NV+PF+ +T+IR++LVGNE+LS   +     W  LVPAMRK+  S++  G+  IKVGTPL
Sbjct  112  NVLPFHPQTRIRFVLVGNEVLSYSSDQDKQIWANLVPAMRKVVNSLRARGIHNIKVGTPL  171

Query  575  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            AMD L +S+PPSSG FR D+   +  PLL+FL+ TNSFFF DVYPYF
Sbjct  172  AMDALRSSFPPSSGTFREDIAVPMMLPLLKFLNGTNSFFFLDVYPYF  218



>gb|ADG38498.1| AT3G23770-like protein [Capsella grandiflora]
 gb|ADG38500.1| AT3G23770-like protein [Capsella grandiflora]
 gb|ADG38501.1| AT3G23770-like protein [Capsella grandiflora]
Length=169

 Score =   174 bits (442),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 111/149 (74%), Gaps = 3/149 (2%)
 Frame = +2

Query  278  DANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGN  457
            DA+P+ L+ L  +++ V++MVPN+ I ++ SDQA AD WV TNV+PFY +T+IR++LVGN
Sbjct  1    DADPETLKLLSKTNLYVTIMVPNDQIISVGSDQAAADNWVATNVLPFYPQTRIRFVLVGN  60

Query  458  EILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRS  628
            E+LS   +     W  LVPAMRK+  S++  G+  IKVGTPLAMD L +S+PPSSGAFR 
Sbjct  61   EVLSYSSDQDKQIWANLVPAMRKVVNSLRARGIHNIKVGTPLAMDALRSSFPPSSGAFRE  120

Query  629  DLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            DL   V  PLL+FL+ TNSFFF DVYPYF
Sbjct  121  DLAVPVMLPLLKFLNGTNSFFFLDVYPYF  149



>gb|ADG38497.1| AT3G23770-like protein [Capsella grandiflora]
Length=169

 Score =   174 bits (442),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 111/149 (74%), Gaps = 3/149 (2%)
 Frame = +2

Query  278  DANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGN  457
            DA+P+ L+ L  +++ V++MVPN+ I ++ SDQA AD WV TNV+PFY +T+IR++LVGN
Sbjct  1    DADPETLKLLSKTNLYVTIMVPNDQIISVGSDQAAADNWVATNVLPFYPQTRIRFVLVGN  60

Query  458  EILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRS  628
            E+LS   +     W  LVPAMRK+  S++  G+  IKVGTPLAMD L +S+PPSSGAFR 
Sbjct  61   EVLSYSSDQDKQIWANLVPAMRKVVNSLRARGIHNIKVGTPLAMDALRSSFPPSSGAFRE  120

Query  629  DLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            DL   V  PLL+FL+ TNSFFF DVYPYF
Sbjct  121  DLAVPVMLPLLKFLNGTNSFFFLDVYPYF  149



>ref|XP_009625839.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X2 [Nicotiana tomentosiformis]
Length=440

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/166 (52%), Positives = 125/166 (75%), Gaps = 2/166 (1%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
            +  ++LI  +KA +VK+YDANP+ILR L  +++ VS+MVPN+ I  ++++Q++A++WV  
Sbjct  17   YESIELIKTMKAGKVKLYDANPEILRLLSGTNLHVSIMVPNDQISIVAANQSVANQWVRD  76

Query  404  NVVPFYGETKIRYLLVGNEILSNPPNTT-WFQLVPAMRKIRRSVKKFGLRKIKVGTPLAM  580
            NV+ +Y  T IRY+LVGNE+LSN  + + W+ LVPAMR I++S+    +  IK+GTPLAM
Sbjct  77   NVLSYYPNTMIRYILVGNEVLSNKDDQSLWYDLVPAMRNIKKSIDGHRIHNIKIGTPLAM  136

Query  581  DMLEASYPPSSGAFRSDL-TGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            DML+ S+PPSSG FR D+   S+  PLL+FL+ T S+FF DVYPYF
Sbjct  137  DMLQTSFPPSSGEFRLDIPRNSLLIPLLRFLNWTKSYFFIDVYPYF  182



>ref|XP_009411847.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=455

 Score =   182 bits (461),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 116/165 (70%), Gaps = 2/165 (1%)
 Frame = +2

Query  227  HDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETN  406
              + L+  L A  VKIYDANP IL AL  + ++VS+MVPNEI+P++ ++ +LAD WV  N
Sbjct  27   RSVALLQSLGAGAVKIYDANPAILCALAGTGLRVSIMVPNEIVPSLGANASLADAWVADN  86

Query  407  VVPFYGETKIRYLLVGNEILSNP--PNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAM  580
            + PFY   ++RY+LVGNEILS+    N+TW  LVPAM  I R+++   +  +KVGT LAM
Sbjct  87   LAPFYPAVRVRYVLVGNEILSDASLANSTWPFLVPAMANIHRALRARSVCDVKVGTTLAM  146

Query  581  DMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            D L  ++PPS+GAFR+D+ G V +PLL FL RT S++F D YPY 
Sbjct  147  DALATAFPPSAGAFRADIAGPVMRPLLDFLSRTRSYYFVDAYPYL  191



>ref|XP_009625838.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X1 [Nicotiana tomentosiformis]
Length=470

 Score =   182 bits (461),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 86/166 (52%), Positives = 125/166 (75%), Gaps = 2/166 (1%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
            +  ++LI  +KA +VK+YDANP+ILR L  +++ VS+MVPN+ I  ++++Q++A++WV  
Sbjct  47   YESIELIKTMKAGKVKLYDANPEILRLLSGTNLHVSIMVPNDQISIVAANQSVANQWVRD  106

Query  404  NVVPFYGETKIRYLLVGNEILSNPPNTT-WFQLVPAMRKIRRSVKKFGLRKIKVGTPLAM  580
            NV+ +Y  T IRY+LVGNE+LSN  + + W+ LVPAMR I++S+    +  IK+GTPLAM
Sbjct  107  NVLSYYPNTMIRYILVGNEVLSNKDDQSLWYDLVPAMRNIKKSIDGHRIHNIKIGTPLAM  166

Query  581  DMLEASYPPSSGAFRSDL-TGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            DML+ S+PPSSG FR D+   S+  PLL+FL+ T S+FF DVYPYF
Sbjct  167  DMLQTSFPPSSGEFRLDIPRNSLLIPLLRFLNWTKSYFFIDVYPYF  212



>gb|AEN82025.1| AT3G23770-like protein, partial [Capsella rubella]
Length=165

 Score =   173 bits (439),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/151 (56%), Positives = 112/151 (74%), Gaps = 3/151 (2%)
 Frame = +2

Query  272  IYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLV  451
            +YDA+P+ L+ L  +++ V++MVPN+ I +I +DQA AD WV TNV+PFY +T+IR++LV
Sbjct  1    LYDADPETLKLLSKTNLYVTIMVPNDQIISIGADQAAADNWVATNVLPFYPQTRIRFVLV  60

Query  452  GNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAF  622
            GNE+LS   +     W  LVPAM K+  S++  G+  IKVGTPLAMD L +S+PPSSGAF
Sbjct  61   GNEVLSYSSDQDKQIWANLVPAMHKVVNSLRARGIHNIKVGTPLAMDALRSSFPPSSGAF  120

Query  623  RSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            R DL   V  PLL+FL+ T+SFFF DVYPYF
Sbjct  121  REDLAVPVMLPLLKFLNGTSSFFFLDVYPYF  151



>ref|XP_009411846.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=469

 Score =   182 bits (461),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 116/165 (70%), Gaps = 2/165 (1%)
 Frame = +2

Query  227  HDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETN  406
              + L+  L A  VKIYDANP IL AL  + ++VS+MVPNEI+P++ ++ +LAD WV  N
Sbjct  41   RSVALLQSLGAGAVKIYDANPAILCALAGTGLRVSIMVPNEIVPSLGANASLADAWVADN  100

Query  407  VVPFYGETKIRYLLVGNEILSNP--PNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAM  580
            + PFY   ++RY+LVGNEILS+    N+TW  LVPAM  I R+++   +  +KVGT LAM
Sbjct  101  LAPFYPAVRVRYVLVGNEILSDASLANSTWPFLVPAMANIHRALRARSVCDVKVGTTLAM  160

Query  581  DMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            D L  ++PPS+GAFR+D+ G V +PLL FL RT S++F D YPY 
Sbjct  161  DALATAFPPSAGAFRADIAGPVMRPLLDFLSRTRSYYFVDAYPYL  205



>gb|ADG38499.1| AT3G23770-like protein [Capsella grandiflora]
Length=169

 Score =   173 bits (438),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 110/149 (74%), Gaps = 3/149 (2%)
 Frame = +2

Query  278  DANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGN  457
            DA+P+ L+ L  +++ V++MVPN  I ++ SDQA AD WV TNV+PFY +T+IR++LVGN
Sbjct  1    DADPETLKLLSKTNLYVTIMVPNXQIISVGSDQAAADXWVATNVLPFYPQTRIRFVLVGN  60

Query  458  EILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRS  628
            E+LS   +     W  LVPAMRK+  S++  G+  IKVGTPLAMD L +S+PPSSGAFR 
Sbjct  61   EVLSYSSDQDKQIWANLVPAMRKVVNSLRARGIHNIKVGTPLAMDALRSSFPPSSGAFRE  120

Query  629  DLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            DL   V  PLL+FL+ TNSFFF DVYPYF
Sbjct  121  DLAVPVMLPLLKFLNGTNSFFFLDVYPYF  149



>emb|CDY53213.1| BnaC03g74070D [Brassica napus]
Length=480

 Score =   181 bits (460),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 117/167 (70%), Gaps = 3/167 (2%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
            +  + LI  + A  VK+YDA+P+ L  L  +++ V++MVPN  I  I +DQA AD WV T
Sbjct  56   YQSINLIKSINAGHVKLYDADPETLMVLSQTNLYVTIMVPNNQIIPIGADQAAADNWVNT  115

Query  404  NVVPFYGETKIRYLLVGNEILSNPPNT---TWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  574
            NV+  Y +T+IR++LVGNEILSN  +    TW  LVPAMRKI  S++  G+  IKVGTPL
Sbjct  116  NVLAHYPQTRIRFVLVGNEILSNNSDQDKQTWSSLVPAMRKIITSLRARGIHNIKVGTPL  175

Query  575  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            AMD+L  S+PPSSGAFR ++   V  PLL+FL+ TNSFFF D YPYF
Sbjct  176  AMDVLRTSFPPSSGAFREEVAAPVMLPLLKFLNGTNSFFFLDSYPYF  222



>gb|ADG38503.1| AT3G23770-like protein [Neslia paniculata]
Length=169

 Score =   173 bits (438),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 110/149 (74%), Gaps = 3/149 (2%)
 Frame = +2

Query  278  DANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGN  457
            DA+P+ L+ L  +++ V++MVPN+ I  I SDQA AD WV T V+PFY +T+IR++LVGN
Sbjct  1    DADPETLKLLSKTNLYVTIMVPNDQIITIGSDQAAADNWVATKVIPFYPQTRIRFVLVGN  60

Query  458  EILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRS  628
            EILS   +     W  LVPAMRK+  S++  G+  IKVGTPLAMD L++S+PPSSGAFR 
Sbjct  61   EILSYSSDQDKQIWANLVPAMRKVVNSLRARGIHNIKVGTPLAMDALQSSFPPSSGAFRE  120

Query  629  DLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            D+   V  PLL+FL+ TN+FFF DVYPYF
Sbjct  121  DIAVPVMLPLLKFLNGTNTFFFLDVYPYF  149



>ref|XP_006373100.1| hypothetical protein POPTR_0017s08720g [Populus trichocarpa]
 gb|ERP50897.1| hypothetical protein POPTR_0017s08720g [Populus trichocarpa]
Length=466

 Score =   181 bits (459),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 86/166 (52%), Positives = 122/166 (73%), Gaps = 3/166 (2%)
 Frame = +2

Query  227  HDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETN  406
              ++ +  +KA  VK+YDANP+ILR L  +D++VS+MVPN  I NI+++Q  A++WVE N
Sbjct  43   QSIESLRAMKAGSVKLYDANPEILRLLAGTDIRVSIMVPNYEIINIATNQTSANKWVEDN  102

Query  407  VVPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLA  577
            V+ ++ ET IR +LVGNE+LS   +     W  LVPAMR+I+ S++   +R IKVGTPLA
Sbjct  103  VLAYHPETMIRTILVGNEVLSYCSDEGKRIWNHLVPAMRRIKISLRAQDIRNIKVGTPLA  162

Query  578  MDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            MD+L+ ++PPS+G FR D++ +V  PLL+FL+ T SFFF DVYPYF
Sbjct  163  MDVLQTTFPPSTGTFRPDISTTVMVPLLKFLNSTKSFFFIDVYPYF  208



>ref|XP_009777293.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Nicotiana 
sylvestris]
Length=470

 Score =   180 bits (457),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/167 (51%), Positives = 124/167 (74%), Gaps = 2/167 (1%)
 Frame = +2

Query  221  HHHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVE  400
             +  ++ +  +KA RVK+YDANP+ILR L  +++ VS+MVPN+ I  ++++Q+ A++WV 
Sbjct  46   QYESIEHMKNMKAGRVKLYDANPEILRLLSGTNLHVSIMVPNDQISIVAANQSAANQWVR  105

Query  401  TNVVPFYGETKIRYLLVGNEILSNPPNTT-WFQLVPAMRKIRRSVKKFGLRKIKVGTPLA  577
             NV+ +Y  T IRY+LVGNE+LSN  + + W+ LVPAMR I++S+ +  +  IK+GTPLA
Sbjct  106  DNVLSYYPNTMIRYILVGNEVLSNKDDQSLWYDLVPAMRNIKKSIDEHRIHNIKIGTPLA  165

Query  578  MDMLEASYPPSSGAFRSDL-TGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            MDML+ S+PPSSG FR D+   S+  PLL+FL+ T S+FF DVYPYF
Sbjct  166  MDMLQTSFPPSSGEFRLDIPRNSLLIPLLRFLNWTKSYFFIDVYPYF  212



>gb|ADG38502.1| AT3G23770-like protein [Capsella grandiflora]
Length=169

 Score =   171 bits (434),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 110/149 (74%), Gaps = 3/149 (2%)
 Frame = +2

Query  278  DANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGN  457
            DA+P+ L+ L  +++ V++MVPN+ I ++ SDQA AD WV TNV+PFY +T+IR++LVGN
Sbjct  1    DADPETLKLLSKTNLYVTIMVPNDQIISVGSDQAAADNWVATNVLPFYPQTRIRFVLVGN  60

Query  458  EILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRS  628
            E+LS   +     W  LVPAMRK+  S++  G+  IKVGTPLAMD L +S+PPSSGAFR 
Sbjct  61   EVLSYSSDQDKQIWANLVPAMRKVVNSLRARGIHNIKVGTPLAMDALRSSFPPSSGAFRE  120

Query  629  DLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            DL   V   LL+FL+ TNSFFF DVYPYF
Sbjct  121  DLAVPVMLXLLKFLNGTNSFFFLDVYPYF  149



>ref|XP_011045808.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Populus 
euphratica]
Length=475

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/167 (51%), Positives = 121/167 (72%), Gaps = 3/167 (2%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
            +  ++++  +KA  VK+YDANP+ILR L  +++ VS+MV N+ I NI+++Q  A++WVE 
Sbjct  51   YESIEILRSMKAGSVKLYDANPEILRLLARTNIHVSIMVSNDEIINIAANQTTANKWVED  110

Query  404  NVVPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  574
            NV+ +Y +T IR +LVGNE+LS   +     W  LVPAMR+I  S++   +R IKVGTPL
Sbjct  111  NVLRYYPDTIIRIILVGNEVLSYSSDAGKQIWNNLVPAMRRINISLRAQDIRNIKVGTPL  170

Query  575  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            AMD+L+ ++PPS+G FRSD++ SV  PLL FL+ T SFFF D YPYF
Sbjct  171  AMDVLQTAFPPSNGIFRSDISTSVMVPLLNFLNSTKSFFFIDAYPYF  217



>emb|CDY50110.1| BnaC01g43580D [Brassica napus]
Length=476

 Score =   179 bits (454),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 118/167 (71%), Gaps = 3/167 (2%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
            +  + L+  +KA  VK+YDA+ + L  L  +++ V++MVPN  I +I +DQA AD WV T
Sbjct  52   YQSINLVKSIKAGHVKLYDADQETLMLLSQTNLYVTIMVPNNQIISIGADQAAADNWVNT  111

Query  404  NVVPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  574
            NV+P Y +T+IR++LVGNEILS   +     W  LVPAMRKI  S++  G+  IKVGTPL
Sbjct  112  NVLPHYPQTRIRFVLVGNEILSYNSDQDKQIWANLVPAMRKIVNSLRARGIHNIKVGTPL  171

Query  575  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            AMD+L +S+PPS+G FR ++   V  PLL+FL+ TNSFFF DVYPYF
Sbjct  172  AMDVLRSSFPPSNGTFREEVAAPVMLPLLKFLNGTNSFFFLDVYPYF  218



>ref|XP_009106344.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=476

 Score =   179 bits (454),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 118/167 (71%), Gaps = 3/167 (2%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
            +  + L+  +KA  VK+YDA+ + L  L  +++ V++MVPN  I +I +DQA AD WV T
Sbjct  52   YQSINLVKSIKAGHVKLYDADQETLMLLSQTNLYVTIMVPNNQIISIGADQAAADNWVNT  111

Query  404  NVVPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  574
            NV+P Y +T+IR++LVGNEILS   +     W  LVPAMRKI  S++  G+  IKVGTPL
Sbjct  112  NVLPHYPQTRIRFVLVGNEILSYNSDQDKQIWANLVPAMRKIVNSLRARGIHNIKVGTPL  171

Query  575  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            AMD+L +S+PPS+G FR ++   V  PLL+FL+ TNSFFF DVYPYF
Sbjct  172  AMDVLRSSFPPSNGTFREEVAAPVMLPLLKFLNGTNSFFFLDVYPYF  218



>emb|CDY18092.1| BnaA01g23530D [Brassica napus]
Length=476

 Score =   178 bits (451),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 118/167 (71%), Gaps = 3/167 (2%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
            +  + L+  +KA  VK+YDA+ + L  L  +++ V++MVPN  I +I +DQA AD WV T
Sbjct  52   YQSINLVKSIKAGHVKLYDADQETLMLLSQTNLYVTIMVPNNQIISIGADQAAADNWVNT  111

Query  404  NVVPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  574
            NV+P Y +T+IR++LVGNEILS   +     W  LVPAMRK+  S++  G+  IKVGTPL
Sbjct  112  NVLPHYPQTRIRFVLVGNEILSYNSDQDKQIWANLVPAMRKMVNSLRARGIHNIKVGTPL  171

Query  575  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            AMD+L +S+PPS+G FR ++   V  PLL+FL+ TNSFFF DVYPYF
Sbjct  172  AMDVLRSSFPPSNGTFREEVAAPVMLPLLKFLNGTNSFFFLDVYPYF  218



>ref|XP_010264204.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Nelumbo 
nucifera]
Length=339

 Score =   174 bits (442),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 116/162 (72%), Gaps = 5/162 (3%)
 Frame = +2

Query  239  LIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPF  418
            LI  LKA  VK   ANP IL AL  +++QVS+MVPN++I NISS Q+LA+ WV TN VPF
Sbjct  38   LIKSLKAGHVK--HANPDILNALEGTNIQVSIMVPNQLISNISSSQSLANEWVRTNNVPF  95

Query  419  YGETKIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDML  589
            Y +T   YLLVGNEI S   N    TW+ LV AM +++ S+K   +R IK+GT +AMD+L
Sbjct  96   YPKTLTHYLLVGNEIFSFSSNQDRQTWYGLVQAMSRLKYSLKIHNIRNIKIGTTIAMDVL  155

Query  590  EASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            ++S+PPS+G FRSD++  V KPLLQFL+RT S+ F D YP F
Sbjct  156  QSSFPPSNGMFRSDISIPVMKPLLQFLNRTKSYSFLDAYPNF  197



>ref|XP_002298669.2| glucan endo-1 family protein [Populus trichocarpa]
 gb|EEE83474.2| glucan endo-1 family protein [Populus trichocarpa]
Length=416

 Score =   176 bits (446),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 117/158 (74%), Gaps = 3/158 (2%)
 Frame = +2

Query  251  LKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGET  430
            +KA  VK+YDANP+ILR L  +++ VS+MV N+ I NI+++Q  A++WVE NV+ +Y +T
Sbjct  1    MKAGSVKLYDANPEILRLLARTNIHVSIMVRNDEIINIAANQTTANKWVEDNVLRYYPDT  60

Query  431  KIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASY  601
             IR +LVGNE+LS   +     W  LVPAMR+I+ S++   +R IKVGTPLAMD+L+ ++
Sbjct  61   IIRTILVGNEVLSYSSDAGKQIWNHLVPAMRRIKISLRAQDIRNIKVGTPLAMDVLQTAF  120

Query  602  PPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            PPS+G FRSD++ SV  PLL FL+ T SFFF D YPYF
Sbjct  121  PPSNGTFRSDISTSVMVPLLNFLNSTKSFFFIDAYPYF  158



>ref|XP_011010072.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Populus 
euphratica]
Length=466

 Score =   177 bits (448),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 122/166 (73%), Gaps = 3/166 (2%)
 Frame = +2

Query  227  HDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETN  406
              ++ +  +KA  VK+YDANP+ILR L  +D++VS+MVPN  I +I+++Q  A++WVE N
Sbjct  43   QSIESLRAMKAGSVKLYDANPEILRLLAGTDIRVSIMVPNYEIISIATNQTSANKWVEDN  102

Query  407  VVPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLA  577
            V+ ++ ET IR +LVGNE+LS   +     W  LV AMR+I+ S++   +R IKVGTPLA
Sbjct  103  VLAYHPETMIRTILVGNEVLSYCSDEGKRIWNHLVLAMRRIKISLRAQDIRNIKVGTPLA  162

Query  578  MDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            MD+L+ ++PPS+G FRSD++ +V  PLL+FL+ T SFFF DVYPYF
Sbjct  163  MDVLQTAFPPSTGIFRSDISTTVMVPLLKFLNSTKSFFFIDVYPYF  208



>ref|XP_002462618.1| hypothetical protein SORBIDRAFT_02g029080 [Sorghum bicolor]
 gb|EER99139.1| hypothetical protein SORBIDRAFT_02g029080 [Sorghum bicolor]
Length=483

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/166 (52%), Positives = 118/166 (71%), Gaps = 5/166 (3%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            ++L+    A  VKIYDANP +LRAL  +   VS+MVPNEIIP++++  A ADRWV  N+V
Sbjct  55   VELLRAAGAGSVKIYDANPGVLRALAGTRWPVSIMVPNEIIPDLAASVAAADRWVAKNLV  114

Query  413  PFYGETKIRYLLVGNEILSNP--PNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDM  586
            P+Y  T++++LLVGNEILS+    N+TW +LVPAM  I RS++K G+  +K+GT LAMD 
Sbjct  115  PYYPATRVKFLLVGNEILSDHSIANSTWPRLVPAMENIHRSLRKRGISSVKIGTTLAMDA  174

Query  587  LEASY---PPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            L       PPS+  FR+D+  +V +PLL FL+ TNS++F D YPYF
Sbjct  175  LADGAFPRPPSAATFRADIAEAVVRPLLHFLNGTNSYYFVDAYPYF  220



>ref|NP_193144.1| putative glucan endo-1,3-beta-glucosidase A6 [Arabidopsis thaliana]
 sp|Q06915.1|EA6_ARATH RecName: Full=Probable glucan endo-1,3-beta-glucosidase A6; AltName: 
Full=(1->3)-beta-glucan endohydrolase; Short=(1->3)-beta-glucanase; 
AltName: Full=Anther-specific protein A6; AltName: 
Full=Beta-1,3-endoglucanase; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAA49853.1| A6 [Arabidopsis thaliana]
 emb|CAB10187.1| A6 anther-specific protein [Arabidopsis thaliana]
 emb|CAB78450.1| A6 anther-specific protein [Arabidopsis thaliana]
 gb|AAM20432.1| A6 anther-specific protein [Arabidopsis thaliana]
 gb|AAN72161.1| A6 anther-specific protein [Arabidopsis thaliana]
 gb|AEE83368.1| putative glucan endo-1,3-beta-glucosidase A6 [Arabidopsis thaliana]
Length=478

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 117/164 (71%), Gaps = 0/164 (0%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
            +  +  I  +KA  VK+YDA+P+ L  L  +++ V++ VPN  I  +SS+Q +AD WV T
Sbjct  57   YQSINFIKSIKAGHVKLYDADPESLTLLSQTNLYVTITVPNHQITALSSNQTIADEWVRT  116

Query  404  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  583
            N++P+Y +T+IR++LVGNEILS         LVPAMRKI  S++  G+  IKVGTPLAMD
Sbjct  117  NILPYYPQTQIRFVLVGNEILSYNSGNVSVNLVPAMRKIVNSLRLHGIHNIKVGTPLAMD  176

Query  584  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
             L +S+PPS+G FR ++TG V  PLL+FL+ TNS+FF +V+PYF
Sbjct  177  SLRSSFPPSNGTFREEITGPVMLPLLKFLNGTNSYFFLNVHPYF  220



>gb|KEH22560.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=386

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = +2

Query  335  MVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMR  514
            M+PNE+I NISS+Q L+D+W+++N++P+Y +T IRYLLVGNEI+S+ PN+TW  LVPAMR
Sbjct  1    MLPNELITNISSNQTLSDQWIKSNILPYYPQTLIRYLLVGNEIISSTPNSTWLHLVPAMR  60

Query  515  KIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFF  694
            +I+ S+KKF +++IKVGT  AMD+LE S+PPS+ AFR D+   V KP+L+FL+RT SFFF
Sbjct  61   RIKHSLKKFRVKRIKVGTSSAMDVLETSFPPSNAAFRKDIAVQVIKPMLRFLNRTKSFFF  120

Query  695  FDVYPYF  715
             DVYP+F
Sbjct  121  LDVYPFF  127



>ref|XP_012078455.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Jatropha 
curcas]
 gb|KDP32593.1| hypothetical protein JCGZ_13143 [Jatropha curcas]
Length=479

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/168 (51%), Positives = 122/168 (73%), Gaps = 6/168 (4%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
            +  +Q++  + A RVK+Y+A+P+ILR L  S +QVS+MVPN+ I  I+SDQ LA++WV  
Sbjct  56   YQSIQILKSINASRVKLYNADPEILRLLAGSKIQVSIMVPNQEIIRIASDQTLANQWVRQ  115

Query  404  NVVPFYGETKIRYLLVGNEILSN----PPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTP  571
            NV+ +Y  T IR++LVGNEI S+      N  W  LVPAMR I+ S+K   ++ IKVGTP
Sbjct  116  NVLQYYPNTMIRFILVGNEIFSSVSVQEQNYVWPNLVPAMRNIKNSLKIHNIKNIKVGTP  175

Query  572  LAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            L+MD+L+ ++PPS+G FR+++  S+  PLL+FL+ T S+FF DVYPYF
Sbjct  176  LSMDILQTTFPPSNGTFRTNV--SILPPLLKFLNGTKSYFFIDVYPYF  221



>ref|XP_008439043.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Cucumis 
melo]
Length=467

 Score =   176 bits (445),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 120/169 (71%), Gaps = 3/169 (2%)
 Frame = +2

Query  218  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWV  397
            P +  +++++ +K  RVK+YDAN +IL  L  +  QVS+M+PN  I +I+++Q  AD+W+
Sbjct  41   PPNLAIEMMNSMKVGRVKLYDANHEILGNLSKTKFQVSIMIPNNEISDIANNQTRADQWI  100

Query  398  ETNVVPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGT  568
              NV+PFY +T IR++LVGNE+LS   +     W  LVPAMR+I  S+K   L+ IKVGT
Sbjct  101  SNNVLPFYPQTMIRFILVGNEVLSFDSDKDRQVWNDLVPAMRRIWSSLKANNLQTIKVGT  160

Query  569  PLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            P+AMD+LE ++PPS G FRSD+  +V  P+L FL+ T SFFF +VYPYF
Sbjct  161  PVAMDILETTFPPSRGTFRSDIQQTVVAPMLNFLNETRSFFFANVYPYF  209



>gb|EYU31523.1| hypothetical protein MIMGU_mgv1a005774mg [Erythranthe guttata]
Length=426

 Score =   175 bits (443),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 116/161 (72%), Gaps = 0/161 (0%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            +QL+  +KA  VK+YDA+P++L+ L ++D+ V++MV N+ I  I+S+++ AD W++ NV+
Sbjct  52   IQLLLSMKAGHVKLYDADPEVLKLLSDTDLHVTIMVTNQEISMIASNESHADAWIDDNVL  111

Query  413  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLE  592
              Y  TKIR++LVGNE+ S      W  LVPAMR+I+RS+ K  +  IKVGTPLAMD LE
Sbjct  112  AHYPSTKIRFILVGNEVFSYNDRQLWLDLVPAMRRIKRSLNKHQIHNIKVGTPLAMDALE  171

Query  593  ASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            +++PPSS  FRS +   V  PL++FL+ T SFFF DVY YF
Sbjct  172  STFPPSSARFRSSIPAEVIVPLMRFLNSTKSFFFVDVYTYF  212



>ref|XP_002868315.1| hypothetical protein ARALYDRAFT_493503 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44574.1| hypothetical protein ARALYDRAFT_493503 [Arabidopsis lyrata subsp. 
lyrata]
Length=478

 Score =   175 bits (444),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 117/164 (71%), Gaps = 0/164 (0%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
            +  +  I  +KA  VK+YDA+P+ L  L  +++ V++ VPN  I ++SS+Q  AD WV T
Sbjct  57   YQSINFIKSIKAGHVKLYDADPESLTLLSQTNLYVTITVPNHQITSLSSNQTTADEWVRT  116

Query  404  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  583
            N++P+Y +T+IR++LVGNEILS         LVPAMRKI  S++  G+  IKVGTPLAMD
Sbjct  117  NILPYYPQTQIRFVLVGNEILSYNYGNVSANLVPAMRKIVNSLRLHGIHNIKVGTPLAMD  176

Query  584  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
             L +S+PPS+G FR ++TG V  PLL+FL+ TNS+FF +V+PYF
Sbjct  177  SLRSSFPPSNGTFREEITGPVMLPLLKFLNGTNSYFFLNVHPYF  220



>gb|EYU31522.1| hypothetical protein MIMGU_mgv1a005774mg [Erythranthe guttata]
Length=471

 Score =   175 bits (443),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 116/161 (72%), Gaps = 0/161 (0%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            +QL+  +KA  VK+YDA+P++L+ L ++D+ V++MV N+ I  I+S+++ AD W++ NV+
Sbjct  52   IQLLLSMKAGHVKLYDADPEVLKLLSDTDLHVTIMVTNQEISMIASNESHADAWIDDNVL  111

Query  413  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLE  592
              Y  TKIR++LVGNE+ S      W  LVPAMR+I+RS+ K  +  IKVGTPLAMD LE
Sbjct  112  AHYPSTKIRFILVGNEVFSYNDRQLWLDLVPAMRRIKRSLNKHQIHNIKVGTPLAMDALE  171

Query  593  ASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            +++PPSS  FRS +   V  PL++FL+ T SFFF DVY YF
Sbjct  172  STFPPSSARFRSSIPAEVIVPLMRFLNSTKSFFFVDVYTYF  212



>gb|KJB28087.1| hypothetical protein B456_005G026800 [Gossypium raimondii]
Length=462

 Score =   175 bits (443),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 78/164 (48%), Positives = 119/164 (73%), Gaps = 0/164 (0%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
            +  ++ +  + A R+K+YD++P+IL+ L  +++ VSVMV N  I  I+S QA+A++WV+ 
Sbjct  41   YQTIETVKSMNAGRIKLYDSDPEILKLLSGTNIHVSVMVQNNDIIRIASSQAVAEQWVQD  100

Query  404  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  583
            NV+ +Y +T IR++LVGNE+LS+     W  LV AMR+I+ S+    ++ IKVGTPLAMD
Sbjct  101  NVLAYYPDTMIRFVLVGNEVLSHQDRRIWLSLVSAMRRIKNSLNTHDIKNIKVGTPLAMD  160

Query  584  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            ++++++PPSS  FR D+T +V  PLL+FL+ T SFFF DVYPY 
Sbjct  161  VMQSTFPPSSSRFRPDITDTVMAPLLRFLNGTKSFFFIDVYPYL  204



>ref|XP_011101604.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Sesamum 
indicum]
Length=468

 Score =   174 bits (440),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/189 (47%), Positives = 123/189 (65%), Gaps = 4/189 (2%)
 Frame = +2

Query  161  AQISQLRSEYATVNWA---TTFPH-HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQV  328
            A    L SE   +N+       P  +  + L++ ++A  VK+YDANP++L+ L  +D+ V
Sbjct  21   ACSCALSSEKIGINYGRLGNNLPSPYQTITLLNSMEAGHVKLYDANPEVLKLLSGTDLHV  80

Query  329  SVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPA  508
            S+MV NE I  I+++Q+ AD WV+ NVV +Y  TKIR++LVGNE+ S      W  LVPA
Sbjct  81   SIMVTNEQISGIAANQSKADLWVQENVVAYYPSTKIRFVLVGNEVFSYNDLKMWHDLVPA  140

Query  509  MRKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSF  688
            MR I+RS+    +  +KV T +AM+ LE+S+PPSSG FRSD+ G V  PLL+FL+ T SF
Sbjct  141  MRNIKRSLSIRDIHNVKVSTAIAMETLESSFPPSSGKFRSDIPGEVILPLLKFLNGTKSF  200

Query  689  FFFDVYPYF  715
             F DVY YF
Sbjct  201  LFLDVYTYF  209



>gb|KEH18116.1| O-glycosyl hydrolase family 17 protein [Medicago truncatula]
Length=383

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  335  MVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMR  514
            M+PNE++ N+SS+Q LA++WV+TN+VPFY +T IRYLLVGNE++S+  N TW  +VPAM 
Sbjct  1    MLPNELVTNVSSNQTLANQWVQTNLVPFYSKTLIRYLLVGNELISSTTNQTWPHIVPAMY  60

Query  515  KIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFF  694
            +++ S+  FGL K+KVGTPLAMD+L+ S+PPS+G FR+D+  SV KP+L+FL  TNSFFF
Sbjct  61   RMKHSLTIFGLHKVKVGTPLAMDVLQTSFPPSNGTFRNDIALSVMKPMLEFLHVTNSFFF  120

Query  695  FDVYPYF  715
             DVYP+F
Sbjct  121  LDVYPFF  127



>ref|XP_009383834.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=475

 Score =   174 bits (440),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 86/165 (52%), Positives = 114/165 (69%), Gaps = 2/165 (1%)
 Frame = +2

Query  227  HDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETN  406
              + L+  + A  VKIYDANP ILRAL  + ++VS+MVPNEIIP++ ++ +LAD WV   
Sbjct  47   RSVALLRSIGAGAVKIYDANPAILRALAGTRLRVSIMVPNEIIPSLGTNASLADAWVAAY  106

Query  407  VVPFYGETKIRYLLVGNEILS--NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAM  580
            + PFY   ++RYLLVGNEILS  +  N+TW  LVPAM  I RS+    +R +KV T  AM
Sbjct  107  LTPFYPAVRVRYLLVGNEILSYTSLANSTWPFLVPAMVNIHRSLIARSIRDVKVSTTFAM  166

Query  581  DMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            D L  S+PPS+GAFRSD+   V +PLL+FL +T S++F D YPY 
Sbjct  167  DALGISFPPSAGAFRSDIAEPVIRPLLRFLHKTRSYYFVDAYPYL  211



>ref|XP_009383833.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=476

 Score =   174 bits (440),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 86/165 (52%), Positives = 114/165 (69%), Gaps = 2/165 (1%)
 Frame = +2

Query  227  HDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETN  406
              + L+  + A  VKIYDANP ILRAL  + ++VS+MVPNEIIP++ ++ +LAD WV   
Sbjct  48   RSVALLRSIGAGAVKIYDANPAILRALAGTRLRVSIMVPNEIIPSLGTNASLADAWVAAY  107

Query  407  VVPFYGETKIRYLLVGNEILS--NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAM  580
            + PFY   ++RYLLVGNEILS  +  N+TW  LVPAM  I RS+    +R +KV T  AM
Sbjct  108  LTPFYPAVRVRYLLVGNEILSYTSLANSTWPFLVPAMVNIHRSLIARSIRDVKVSTTFAM  167

Query  581  DMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            D L  S+PPS+GAFRSD+   V +PLL+FL +T S++F D YPY 
Sbjct  168  DALGISFPPSAGAFRSDIAEPVIRPLLRFLHKTRSYYFVDAYPYL  212



>ref|XP_004957267.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Setaria italica]
Length=483

 Score =   173 bits (438),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 117/166 (70%), Gaps = 5/166 (3%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            ++L+    A  VKIYDANP +LRAL  +   VS+MVPN+IIP+I++  A ADRWV  N+V
Sbjct  56   VELLRAAGAGSVKIYDANPGVLRALAGTRWPVSIMVPNQIIPDIAASAAAADRWVAENLV  115

Query  413  PFYGETKIRYLLVGNEILSN--PPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDM  586
            P+Y  T++++LLVGNEILS+    N+TW +LVPAM  I  S++K G+  +K+GT LAMD 
Sbjct  116  PYYPATRVKFLLVGNEILSDYSIANSTWLRLVPAMENIHLSLRKRGISSVKIGTTLAMDA  175

Query  587  LEAS---YPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            L       PPS+ AFR D+  SV +PLL FL+ TNS++F D YPYF
Sbjct  176  LADGDFPRPPSAAAFRPDIAASVVRPLLHFLNGTNSYYFVDAYPYF  221



>ref|XP_007034194.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
 gb|EOY05120.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
Length=552

 Score =   173 bits (439),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/167 (48%), Positives = 122/167 (73%), Gaps = 4/167 (2%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
            +  ++++  +KA+RVK+YD++P+IL+    +++ +++MVPN+ I  ISS Q  A++WV  
Sbjct  129  YQSIEIMKSMKARRVKLYDSDPEILKLFSGTNIDMAIMVPNKDIVLISSSQTAAEQWVRN  188

Query  404  NVVPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  574
            NV+  Y  T IR++LVGNE+LS       T W  LVPAMR+I+ S+    ++ IK+GTPL
Sbjct  189  NVLA-YPNTNIRFVLVGNEVLSYVSKQDQTIWAHLVPAMRRIKNSLSANDIKNIKIGTPL  247

Query  575  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            AMD+L++++PPSSG FRSD++ +V  PLL+FL+ + SFFF DVYPYF
Sbjct  248  AMDILQSTFPPSSGTFRSDISNTVMAPLLKFLNGSKSFFFLDVYPYF  294



>gb|KFK36299.1| hypothetical protein AALP_AA4G104300 [Arabis alpina]
Length=479

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 118/164 (72%), Gaps = 0/164 (0%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
            +  +  I  +KA  VK+YDA+P+ L  L  +++ V++ VPN  I ++SS+Q++A+ WV+T
Sbjct  58   YQSINFIKSIKAGHVKLYDADPETLTLLSQTNLYVTITVPNHQITSLSSNQSIAEDWVKT  117

Query  404  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  583
            N++P+Y +T+IR++LVGNEILS         LVPAMRKI  S++  G+  IKVGTPLAMD
Sbjct  118  NILPYYPQTQIRFVLVGNEILSAQDTNVTANLVPAMRKIVNSLRTHGIHNIKVGTPLAMD  177

Query  584  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
             L +++PPS+  FR D+ G +  PLL+FL+ TNS+FF +V+PYF
Sbjct  178  SLRSTFPPSNSTFREDIAGPLVLPLLKFLNGTNSYFFINVHPYF  221



>ref|XP_006282877.1| hypothetical protein CARUB_v10006945mg [Capsella rubella]
 gb|EOA15775.1| hypothetical protein CARUB_v10006945mg [Capsella rubella]
Length=478

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/164 (49%), Positives = 117/164 (71%), Gaps = 0/164 (0%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
            +  +  I  +KA  VK+YDA+P+ L  L  +++ V++ VPN  I ++SS+Q +AD WV T
Sbjct  57   YQSINFIKSIKAGHVKLYDADPESLTLLSQTNLYVTITVPNHQITSLSSNQTIADEWVRT  116

Query  404  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  583
            N++P+Y +T+IR++LVG+EILS         LVPAMRKI  S++  G+  IKVGTPLAMD
Sbjct  117  NIIPYYPQTQIRFVLVGHEILSYNYGNVSANLVPAMRKIVNSLRFHGIHNIKVGTPLAMD  176

Query  584  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
             L +S+PPS+G FR ++ G V  PLL+FL+ TNS+FF +V+PYF
Sbjct  177  SLRSSFPPSNGTFREEVAGPVILPLLKFLNGTNSYFFINVHPYF  220



>ref|XP_010450129.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=479

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/164 (49%), Positives = 116/164 (71%), Gaps = 0/164 (0%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
            +  +  I  +KA  VK+YDA+P+ L  L  +++ V++ VPN  I ++SS+Q  AD WV T
Sbjct  58   YQSINFIKSIKAGHVKLYDADPECLTLLSQTNLYVTITVPNHQITSLSSNQTTADEWVRT  117

Query  404  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  583
            N++P+Y +T+IR++LVGNE+LS         LVPAMRKI  S++  G+  IKVGTPLAMD
Sbjct  118  NILPYYPQTQIRFVLVGNEVLSYNYGNISANLVPAMRKIVNSLRFRGIHNIKVGTPLAMD  177

Query  584  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
             L +S+PPS+G FR ++ G V  PLL+FL+ TNS+FF +V+PYF
Sbjct  178  ALRSSFPPSNGTFREEIAGPVVLPLLKFLNGTNSYFFINVHPYF  221



>ref|XP_010450110.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=479

 Score =   171 bits (433),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/164 (50%), Positives = 116/164 (71%), Gaps = 0/164 (0%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
            +  +  I  +KA  VK+YDA+P+ L  L  +++ V++ VPN  I +ISS+Q  AD WV T
Sbjct  58   YQSINFIKSIKAGHVKLYDADPESLTLLSRTNLYVTITVPNHQITSISSNQTTADEWVRT  117

Query  404  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  583
            N++PFY +T+IR++LVGNE+L+         LVPAMRKI  S++  G+  IKVGTPLAMD
Sbjct  118  NILPFYPQTQIRFVLVGNEVLNYNYGNISANLVPAMRKIVNSLRFRGIHNIKVGTPLAMD  177

Query  584  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
             L +S+PPS+G FR ++ G V  PLL+FL+ TNS+FF +V+PYF
Sbjct  178  SLRSSFPPSNGTFREEIAGPVILPLLKFLNGTNSYFFINVHPYF  221



>ref|XP_002971665.1| hypothetical protein SELMODRAFT_231791 [Selaginella moellendorffii]
 gb|EFJ27414.1| hypothetical protein SELMODRAFT_231791 [Selaginella moellendorffii]
Length=449

 Score =   171 bits (432),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 115/164 (70%), Gaps = 3/164 (2%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            + LI  L   R KI+ A+  I+RA  NS V++SVMV N+ IP I+S Q+ AD WVE NV 
Sbjct  19   VGLIKDLGFDRAKIFSADSSIIRAFANSGVKLSVMVANQQIPEIASSQSSADAWVEKNVA  78

Query  413  PFYGETKIRYLLVGNEILSNPP--NTTWFQLVPAMRKIRRSVKKFGLR-KIKVGTPLAMD  583
             +Y +T I  +LVGNEILS+     +TW +LVPAM KI+ +V+KF L   IKV TPLA D
Sbjct  79   AYYPKTAIESVLVGNEILSDSSIRESTWPKLVPAMEKIQSAVEKFELAGSIKVSTPLASD  138

Query  584  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
             L  SYPPS+G+F+SD+  S+ +PLL+FL RTNSF+  +VYPYF
Sbjct  139  ALGNSYPPSAGSFKSDIAESIIQPLLEFLSRTNSFYCGNVYPYF  182



>ref|XP_002976500.1| hypothetical protein SELMODRAFT_105435, partial [Selaginella 
moellendorffii]
 gb|EFJ22169.1| hypothetical protein SELMODRAFT_105435, partial [Selaginella 
moellendorffii]
Length=461

 Score =   171 bits (432),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 120/165 (73%), Gaps = 4/165 (2%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            ++LI  LK  RVKIYDANP IL AL N+ V+V+VMVPN+ IP+++S Q+ AD WV++NV 
Sbjct  19   VELIRQLKLGRVKIYDANPSILSALANTSVKVTVMVPNQQIPSVASSQSFADEWVKSNVT  78

Query  413  PFYGETKIRYLLVGNEILSNPP--NTTWFQLVPAMRKIRRSVKKFGL-RKIKVGTPLAMD  583
             +Y  T+IR +L+GNEILS+     +TW +LVPAM+ I RS+ K GL RKIKV TP A+ 
Sbjct  79   AYYPFTRIRTVLIGNEILSDFSIRQSTWPKLVPAMKNIHRSLAKLGLHRKIKVSTPHALL  138

Query  584  MLEA-SYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            +L+   +PPS+G FR D+   + +P+L+FL  TNS FF D YP+F
Sbjct  139  VLQGYVFPPSNGTFRDDIAEPIIRPMLEFLHSTNSPFFVDAYPFF  183



>gb|EEC84834.1| hypothetical protein OsI_31928 [Oryza sativa Indica Group]
Length=477

 Score =   171 bits (432),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 88/199 (44%), Positives = 128/199 (64%), Gaps = 9/199 (5%)
 Frame = +2

Query  146  CHLFPAQISQLRSEYATVNWATTF----PHHHDLQLIHGLKAKRVKIYDANPKILRALGN  313
            CH+     S   +    VN+        P    ++L+  + A  VKIYDAN  +LRAL  
Sbjct  16   CHVVAQGRSTAAAHGIGVNYGRVADDIPPPARSVELLRAVGAGSVKIYDANSSVLRALAG  75

Query  314  SDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSN--PPNTT  487
            + ++VS+MVPNEIIP +++  A ADRWV  N+VP+Y ET+++YLLVGNE+LS+    N+T
Sbjct  76   TRMRVSIMVPNEIIPGLAASAAAADRWVAENLVPYYPETRVKYLLVGNELLSDYSIANST  135

Query  488  WFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASY---PPSSGAFRSDLTGSVFKPL  658
            W ++VPAM  +  S+++  +  +K+ T LAMD L +     PPS+ AFR D+ G V +PL
Sbjct  136  WPRIVPAMENLHVSLRRRRISSVKISTTLAMDALTSGSFPRPPSAAAFRPDIAGDVVRPL  195

Query  659  LQFLDRTNSFFFFDVYPYF  715
            L+FL+ TNS++F D YPYF
Sbjct  196  LRFLNGTNSYYFVDAYPYF  214



>ref|NP_001149815.1| glucan endo-1,3-beta-glucosidase A6 precursor [Zea mays]
 gb|ACG36890.1| glucan endo-1,3-beta-glucosidase A6 precursor [Zea mays]
 tpg|DAA62204.1| TPA: putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=479

 Score =   170 bits (430),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 117/166 (70%), Gaps = 5/166 (3%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            ++L+    A  VKIYDANP +LRAL  +   VS+MVPN+IIP++++  A ADRWV  N+V
Sbjct  51   VELLRAAGAGSVKIYDANPGVLRALAGTRWPVSIMVPNQIIPDLAASAAAADRWVAENLV  110

Query  413  PFYGETKIRYLLVGNEILSN--PPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDM  586
            P+Y  T++++LLVGNEILS+    N+TW  LVPAM  I RS++K  +  +K+GT LAMD 
Sbjct  111  PYYPATRVKFLLVGNEILSDLSIANSTWPHLVPAMENIHRSLRKRSISSVKIGTTLAMDA  170

Query  587  LEASY---PPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            L       PPS+ AFR+D+  +V +PLL FL+ TNS++F D YPYF
Sbjct  171  LADGAFPRPPSAAAFRADIAEAVVRPLLHFLNGTNSYYFVDAYPYF  216



>ref|XP_003572424.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brachypodium 
distachyon]
Length=590

 Score =   171 bits (433),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 115/164 (70%), Gaps = 3/164 (2%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNV-  409
            ++L+    A  VKIYDANP+IL A   + + VS MVPNEIIP+I++ +A A +WV  N+ 
Sbjct  62   VRLLRDAGAGAVKIYDANPEILSAFAGTGIPVSAMVPNEIIPSIAASRAAAHKWVVNNLP  121

Query  410  VPFYGETKIRYLLVGNEILSNPP--NTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  583
             P     KI YLLVGNE+LSN    ++TW  +VPAMR +R +++K G+ ++K+GTPLAMD
Sbjct  122  KPSSHGPKIVYLLVGNELLSNQAIKDSTWGAIVPAMRNLRHALRKHGMGRVKLGTPLAMD  181

Query  584  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
             L ASYPPSS  FR D+   V +PLL+FL+ T S++F D YPYF
Sbjct  182  ALSASYPPSSSLFRDDIELKVMRPLLRFLNLTKSYYFVDAYPYF  225



>ref|XP_010435194.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=479

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 116/164 (71%), Gaps = 0/164 (0%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
            +  +  I  +KA  VK+YDA+P+ L  L  +++ V++ VPN  I ++SS+Q  AD WV T
Sbjct  58   YQSINFIKSIKAGHVKLYDADPESLTLLSRTNLYVTITVPNHQITSLSSNQTTADEWVRT  117

Query  404  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  583
            N++P+Y +T+IR++LVGNE+L+         LVPAMRKI  S++  G+  IKVGTPLAMD
Sbjct  118  NILPYYPQTQIRFVLVGNEVLNYNYGNISANLVPAMRKIVNSLRFRGIHNIKVGTPLAMD  177

Query  584  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
             L +S+PPS+G FR ++ G V  PLL+FL+ TNS+FF +V+PYF
Sbjct  178  SLRSSFPPSNGTFREEIAGPVILPLLKFLNGTNSYFFINVHPYF  221



>ref|NP_001063586.1| Os09g0502200 [Oryza sativa Japonica Group]
 dbj|BAF25500.1| Os09g0502200 [Oryza sativa Japonica Group]
 gb|EEE69998.1| hypothetical protein OsJ_29910 [Oryza sativa Japonica Group]
Length=480

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 91/203 (45%), Positives = 132/203 (65%), Gaps = 14/203 (7%)
 Frame = +2

Query  146  CHLFPAQISQLRSEYAT----VNWATTF----PHHHDLQLIHGLKAKRVKIYDANPKILR  301
            CH+    ++Q RS  A     VN+        P    ++L+  + A  VKIYDAN  +LR
Sbjct  16   CHVG-VVVAQGRSTAAAHGIGVNYGRVADDIPPPARSVELLRAVGAGSVKIYDANSSVLR  74

Query  302  ALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSN--P  475
            AL  + ++VS+MVPNEIIP +++  A ADRWV  N+VP+Y ET+++YLLVGNE+LS+   
Sbjct  75   ALAGTRMRVSIMVPNEIIPGLAASAAAADRWVAENLVPYYPETRVKYLLVGNELLSDYSI  134

Query  476  PNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASY---PPSSGAFRSDLTGSV  646
             N+TW ++VPAM  +  S+++  +  +K+ T LAMD L +     PPS+ AFR D+ G V
Sbjct  135  ANSTWPRIVPAMENLHVSLRRRRISSVKISTTLAMDALTSGSFPRPPSAAAFRPDIAGDV  194

Query  647  FKPLLQFLDRTNSFFFFDVYPYF  715
             +PLL+FL+ TNS++F D YPYF
Sbjct  195  VRPLLRFLNGTNSYYFVDAYPYF  217



>ref|XP_011651104.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Cucumis 
sativus]
Length=467

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 117/164 (71%), Gaps = 3/164 (2%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            +++++ ++  RVK+YDAN +IL  L  +  QVS+M+PN  I  I+++Q  AD+W+  N++
Sbjct  46   IEMMNSMRVGRVKLYDANHEILSNLSKTKFQVSIMIPNNEISGIANNQTRADQWILNNLL  105

Query  413  PFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  583
            PFY +T IR++LVGNE+LS   +     W  LVPAMR+I  S+K   L+ I+VGTP+AMD
Sbjct  106  PFYPQTMIRFILVGNEVLSLDSDIDRQVWNDLVPAMRRIWSSLKANNLQIIRVGTPVAMD  165

Query  584  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            +LE ++PPS G FRSD+  +V  P+L FL+ T SFFF +VYPYF
Sbjct  166  VLETTFPPSRGTFRSDIQRTVVAPMLDFLNETRSFFFANVYPYF  209



>gb|KGN57233.1| hypothetical protein Csa_3G172380 [Cucumis sativus]
Length=487

 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 117/164 (71%), Gaps = 3/164 (2%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            +++++ ++  RVK+YDAN +IL  L  +  QVS+M+PN  I  I+++Q  AD+W+  N++
Sbjct  46   IEMMNSMRVGRVKLYDANHEILSNLSKTKFQVSIMIPNNEISGIANNQTRADQWILNNLL  105

Query  413  PFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  583
            PFY +T IR++LVGNE+LS   +     W  LVPAMR+I  S+K   L+ I+VGTP+AMD
Sbjct  106  PFYPQTMIRFILVGNEVLSLDSDIDRQVWNDLVPAMRRIWSSLKANNLQIIRVGTPVAMD  165

Query  584  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            +LE ++PPS G FRSD+  +V  P+L FL+ T SFFF +VYPYF
Sbjct  166  VLETTFPPSRGTFRSDIQRTVVAPMLDFLNETRSFFFANVYPYF  209



>ref|XP_010527440.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Tarenaya 
hassleriana]
Length=489

 Score =   168 bits (426),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 86/170 (51%), Positives = 118/170 (69%), Gaps = 6/170 (4%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
            +  + LI  + A  VK+YDA+P+ L  L  ++++V++MV N  I +I SDQ  AD WV T
Sbjct  57   YKSINLIKSVNAGHVKLYDADPETLILLSQTNLRVTIMVQNHDIVSIGSDQRAADDWVRT  116

Query  404  NVVPFYGETKIRYLLVGNEILS----NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTP  571
            NV+P+Y  T IR++LVGNE+LS    +     W  LVPAMRKI +S++  G+  +KVGTP
Sbjct  117  NVLPYYPRTLIRFVLVGNEVLSYYNTDQDRDIWRNLVPAMRKIVKSLRAQGIHNVKVGTP  176

Query  572  LAMDMLEA--SYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            LAMD+L++  ++PPSSG FR D+   V  PLL+FL+ TNSFFF DVYPYF
Sbjct  177  LAMDVLQSATTFPPSSGTFRDDIAFPVMLPLLKFLNGTNSFFFIDVYPYF  226



>ref|XP_002973407.1| hypothetical protein SELMODRAFT_413735 [Selaginella moellendorffii]
 gb|EFJ25781.1| hypothetical protein SELMODRAFT_413735 [Selaginella moellendorffii]
Length=541

 Score =   168 bits (425),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 121/166 (73%), Gaps = 5/166 (3%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            ++LI  LK  RVKIYDANP IL AL N+ V+V+VMVPN+ IP+++S Q+ AD WV++NV 
Sbjct  111  VELIRQLKLGRVKIYDANPSILSALANTSVKVTVMVPNQQIPSVASSQSFADEWVKSNVT  170

Query  413  PFYGETKIRYLLVGNEILSNPP--NTTWFQLVPAMRKIRRSVKKFGL-RKIKVGTPLA-M  580
             +Y  T+IR +L+GNEILS+     +TW +LVPAM+ I RS+ K GL RKIKV TP A +
Sbjct  171  AYYPFTRIRTVLIGNEILSDFSIRQSTWPKLVPAMKNIHRSLAKLGLHRKIKVSTPHALL  230

Query  581  DMLEA-SYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            ++L+   +PPS+G FR D+   + +P+L+FL  TNS FF D YP+F
Sbjct  231  NVLQGYVFPPSNGTFRDDIAEPIIRPMLEFLHSTNSPFFVDAYPFF  276



>ref|XP_002965673.1| hypothetical protein SELMODRAFT_85067 [Selaginella moellendorffii]
 gb|EFJ33093.1| hypothetical protein SELMODRAFT_85067 [Selaginella moellendorffii]
Length=449

 Score =   166 bits (421),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 115/164 (70%), Gaps = 3/164 (2%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            + LI  L   R KI+ A+  I+RA  NS V++SVMV N+ IP I+S Q+ AD WV+ NV 
Sbjct  19   VGLIKDLGFDRAKIFSADSSIIRAFANSGVKLSVMVANQQIPEIASSQSSADAWVKKNVA  78

Query  413  PFYGETKIRYLLVGNEILSNPP--NTTWFQLVPAMRKIRRSVKKFGLR-KIKVGTPLAMD  583
             +Y +T I  +LVGNEILS+     +TW +LVPAM KI+ +++KF L   IKV TPLA D
Sbjct  79   AYYPKTAIDSVLVGNEILSDSSIRESTWPKLVPAMEKIQSALEKFELAGSIKVSTPLASD  138

Query  584  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
             L  SYPPS+G+F+SD+  S+ +PLL+FL RTNSF+  +VYPYF
Sbjct  139  ALGNSYPPSAGSFKSDIAESIIQPLLEFLSRTNSFYCGNVYPYF  182



>dbj|BAJ88052.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=488

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 79/169 (47%), Positives = 117/169 (69%), Gaps = 5/169 (3%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
               +QL+    A  VKIYDANP +LRAL  + + VS+MVPN++IP++++  A ADRWV  
Sbjct  58   RRSVQLLRAAGAGSVKIYDANPAVLRALAGTGMAVSIMVPNQVIPDLAASYAAADRWVAA  117

Query  404  NVVPFYGETKIRYLLVGNEILSNP--PNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLA  577
            N++P+   T++++LLVGNE+LS+     +TW ++VPAM  + RS++   + ++K+GT LA
Sbjct  118  NLLPYLPRTRVKFLLVGNEVLSDGSIAASTWPRIVPAMENLHRSLRARRVSRVKLGTTLA  177

Query  578  MDMLEASY---PPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            MD L A     PPS+ AFR D+  SV +PLL+FL+ TNS++F D Y YF
Sbjct  178  MDALVAGAFPRPPSAAAFRPDIAESVLRPLLRFLEGTNSYYFVDAYTYF  226



>dbj|BAK05423.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=470

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/163 (48%), Positives = 117/163 (72%), Gaps = 3/163 (2%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            ++L+    A  VK+Y+A+ +IL AL  + + VSVMVPN++IP+++  +A A +WV  N+ 
Sbjct  52   VKLLRKANAGAVKLYNADQRILHALAGTGIPVSVMVPNDLIPSLADSRAAARKWVANNL-  110

Query  413  PFYGETKIRYLLVGNEILSNPP--NTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDM  586
              +   ++ YLLVGNE+LS P    +TW ++VPAM+ +R +++  GL ++K+GTPLAMD 
Sbjct  111  KRHPRVRVMYLLVGNELLSYPAIAASTWGKIVPAMKNLRYALRAIGLGRVKLGTPLAMDA  170

Query  587  LEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            L ASYPPS+GAFR D+ G+V +PLL FL+ T S++F D YPYF
Sbjct  171  LAASYPPSAGAFREDIAGTVMRPLLHFLNYTRSYYFVDAYPYF  213



>gb|KCW48409.1| hypothetical protein EUGRSUZ_K02112 [Eucalyptus grandis]
Length=418

 Score =   164 bits (416),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 112/170 (66%), Gaps = 33/170 (19%)
 Frame = +2

Query  251  LKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGET  430
            L +K VK+YDANP+IL AL N+ ++V  MVPNE+I NIS+DQAL+D WV +N++PFY +T
Sbjct  49   LSSKSVKLYDANPQILLALRNTGLEVCAMVPNELIANISADQALSDHWVGSNIIPFYPDT  108

Query  431  KIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEAS--YP  604
            KIR+LLVGNEILS+P N                  +  +R +KVG  +AM+ LE S  YP
Sbjct  109  KIRHLLVGNEILSDPGN------------------RHRIRNVKVGISMAMETLEGSSVYP  150

Query  605  PSSGAFRSDLTGSVFKPLLQFLDRT-------------NSFFFFDVYPYF  715
            PS+G+FRSD++GSV KP+LQFL  T              S+ +FD YPYF
Sbjct  151  PSNGSFRSDISGSVMKPMLQFLSETKSDLHFFFFFFGRESYLYFDAYPYF  200



>dbj|BAK04571.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=551

 Score =   166 bits (421),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 117/166 (70%), Gaps = 5/166 (3%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            +QL+    A  VKIYDANP +LRAL  + + VS+MVPN++IP++++  A ADRWV  N++
Sbjct  109  VQLLRAAGAGSVKIYDANPAVLRALAGTGMAVSIMVPNQVIPDLAASYAAADRWVAANLL  168

Query  413  PFYGETKIRYLLVGNEILSNP--PNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDM  586
            P+   T++++LLVGNE+LS+     +TW ++VPAM  + RS++   + ++K+GT LAMD 
Sbjct  169  PYLPRTRVKFLLVGNEVLSDGSIAASTWPRIVPAMENLHRSLRARRVSRVKLGTTLAMDA  228

Query  587  LEASY---PPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            L A     PPS+ AFR D+  SV +PLL+FL+ TNS++F D Y YF
Sbjct  229  LVAGAFPRPPSAAAFRPDIAESVLRPLLRFLEGTNSYYFVDAYTYF  274



>ref|XP_006414816.1| hypothetical protein EUTSA_v10025081mg [Eutrema salsugineum]
 gb|ESQ56269.1| hypothetical protein EUTSA_v10025081mg [Eutrema salsugineum]
Length=479

 Score =   165 bits (418),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 115/164 (70%), Gaps = 0/164 (0%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
            +  +  I  +KA  VK+YDA+P+ L  L ++++ V++ VPN  I ++ S+Q  A+ WV+T
Sbjct  58   YQSINFIKSIKAGHVKLYDADPESLTLLSHTNLYVTITVPNHQIISLGSNQTTAEDWVKT  117

Query  404  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  583
            N++P+Y +T+IR++LVGNEILS         LVPAMRKI  S++  G+  IKVGTPLAMD
Sbjct  118  NILPYYPQTQIRFVLVGNEILSAENRNITANLVPAMRKIVTSLRAHGIHNIKVGTPLAMD  177

Query  584  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
             L +++PPS+  FR D+ G +  PL++FL+ TNS+FF ++ PYF
Sbjct  178  SLRSTFPPSNSTFREDIAGELMLPLMKFLNGTNSYFFINLQPYF  221



>ref|XP_010238330.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brachypodium 
distachyon]
Length=477

 Score =   164 bits (416),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 117/166 (70%), Gaps = 5/166 (3%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            +QL+    A  VKIYDANP +LRAL  + + VS+MVPNEIIP++++  A AD WV  N++
Sbjct  53   VQLLRAAGAGSVKIYDANPAVLRALAGTRIPVSIMVPNEIIPDLAASAAKADEWVVQNLL  112

Query  413  PFYGETKIRYLLVGNEILSNP--PNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDM  586
            P+  +T++++LLVGNE+LS+     +TW ++VPAM  + RS++   +  +K+GT LAMD 
Sbjct  113  PYLAKTRVKFLLVGNEVLSDRSIATSTWPRIVPAMENLHRSLRARRVSSVKLGTTLAMDA  172

Query  587  LEASY---PPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            L +     PPS+  FR+D+  +V +PLL+FL+ TNS++F D YPYF
Sbjct  173  LVSGAFPRPPSAAVFRADIAEAVVRPLLRFLNGTNSYYFVDAYPYF  218



>emb|CAB71021.1| putative beta-1,3-glucanase [Hieracium piloselloides]
Length=379

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 116/165 (70%), Gaps = 5/165 (3%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            ++L+  + A RVK+YDA+ +IL  L   D++V++ V N+ I  I+++Q LAD+WV  +V+
Sbjct  58   IELLESMNAGRVKLYDADHEILHLLSGKDIEVAITVANDEISAIAANQHLADQWVYEHVL  117

Query  413  PFYGETKIRYLLVGNEILSNPPNTTWFQ----LVPAMRKIRRSVKKFGLRKIKVGTPLAM  580
              Y  TKIR++LVGNE+ S+  N    Q    LVPAMR+I+ ++K  G+R IKVGTPLAM
Sbjct  118  AHYPNTKIRFILVGNEVFSSTNNVQDMQIARDLVPAMRRIKNTIKAQGIRNIKVGTPLAM  177

Query  581  DMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            DM+E ++PPS+G+F+ D+   +  PLL++L+ T SF   DVYPYF
Sbjct  178  DMMETTFPPSNGSFKPDIR-ELMIPLLKYLNGTRSFVLVDVYPYF  221



>emb|CBI39414.3| unnamed protein product [Vitis vinifera]
Length=375

 Score =   160 bits (405),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 77/141 (55%), Positives = 105/141 (74%), Gaps = 3/141 (2%)
 Frame = +2

Query  302  ALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILS---N  472
            A   + +QVS+MVPN+ I NISS+Q LAD+WV  NV+ +Y +T IR+++VGNE+LS   +
Sbjct  25   AFTRTKIQVSIMVPNQEISNISSNQTLADQWVRDNVLSYYPQTMIRFIVVGNEVLSYYSD  84

Query  473  PPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFK  652
                TW  LVPAMR+I++S++   +  IKVGT +AMD++E+S+PPSSG FRSD+  +V  
Sbjct  85   RDRETWSNLVPAMRRIKKSLQANNIPNIKVGTSVAMDVMESSFPPSSGMFRSDILDTVMV  144

Query  653  PLLQFLDRTNSFFFFDVYPYF  715
            PLL+FL  TNSFFF DVYPY 
Sbjct  145  PLLEFLSGTNSFFFLDVYPYL  165



>dbj|BAG16366.1| tapetum-specific protein A6 family protein [Brassica rapa var. 
perviridis]
Length=399

 Score =   160 bits (406),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 114/164 (70%), Gaps = 0/164 (0%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
            +  +  I  +KA  VK+YDA+P+ L  L  +++ V++ VPN  I ++S++Q  AD WV+T
Sbjct  5    YQSINFIKLIKAGHVKLYDADPESLTLLSQTNLYVTIAVPNHQITSLSANQTTADDWVKT  64

Query  404  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  583
            N++P+Y +T+IR++LVGNEILS         +VPAMRKI  S++  G+  IKVGTPLAMD
Sbjct  65   NILPYYPQTQIRFVLVGNEILSVQDRNITANVVPAMRKIVNSLRAHGIHNIKVGTPLAMD  124

Query  584  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
             L +++PPS+  FR D+   +  PLL+FL+ TNS+FF ++ PYF
Sbjct  125  SLRSTFPPSNSTFREDIALPLMLPLLKFLNGTNSYFFINLQPYF  168



>ref|XP_009144683.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=479

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 114/164 (70%), Gaps = 0/164 (0%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
            +  +  I  +KA  VK+YDA+P+ L  L  +++ V++ VPN  I ++S++Q  AD WV+T
Sbjct  58   YQSINFIKLIKAGHVKLYDADPESLTLLSQTNLYVTIAVPNHQITSLSANQTTADDWVKT  117

Query  404  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  583
            N++P+Y +T+IR++LVGNEILS         +VPAMRKI  S++  G+  IKVGTPLAMD
Sbjct  118  NILPYYPQTQIRFVLVGNEILSVKDRNITANVVPAMRKIVNSLRAHGIHNIKVGTPLAMD  177

Query  584  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
             L +++PPS+  FR D+   +  PLL+FL+ TNS+FF ++ PYF
Sbjct  178  SLRSTFPPSNSTFREDIALPLMLPLLKFLNGTNSYFFINLQPYF  221



>emb|CDY08310.1| BnaA05g13090D [Brassica napus]
Length=479

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 114/164 (70%), Gaps = 0/164 (0%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
            +  +  I  +KA  VK+YDA+P+ L  L  +++ V++ VPN  I ++S++Q  AD WV+T
Sbjct  58   YQSINFIKLIKAGHVKLYDADPESLTLLSQTNLYVTIAVPNHQITSLSANQTTADDWVKT  117

Query  404  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  583
            N++P+Y +T+IR++LVGNEILS         +VPAMRKI  S++  G+  IKVGTPLAMD
Sbjct  118  NILPYYPQTQIRFVLVGNEILSVQDRNITANVVPAMRKIVNSLRAHGIHNIKVGTPLAMD  177

Query  584  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
             L +++PPS+  FR D+   +  PLL+FL+ TNS+FF ++ PYF
Sbjct  178  SLRSTFPPSNSTFREDIALPLMLPLLKFLNGTNSYFFINLQPYF  221



>gb|ABR16205.1| unknown [Picea sitchensis]
Length=494

 Score =   160 bits (405),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/163 (50%), Positives = 112/163 (69%), Gaps = 2/163 (1%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            + LI  L+A  VKIYDA+P++L AL N+ +QV++ V N+ I NISS   +A++WV+ NV+
Sbjct  66   VALIKNLQAGYVKIYDADPQVLSALSNTALQVTITVRNQDISNISSSPTVAEQWVQANVL  125

Query  413  PFYGETKIRYLLVGNEILSNPPN-TTWFQLVPAMRKIRRSVKKFGLR-KIKVGTPLAMDM  586
            P Y  T I  ++VGNE+LS+  N  TW  ++PAM  I  S+   GL   IKV T LAMD+
Sbjct  126  PHYPSTLITAIMVGNEVLSDYQNQATWLLMLPAMPNIHASLLNHGLADSIKVTTSLAMDV  185

Query  587  LEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            L +SYPPS G FR+D+   V +PLL F++RT SF F D+YP+F
Sbjct  186  LSSSYPPSEGTFRNDVASPVLQPLLDFVNRTGSFVFLDIYPFF  228



>ref|NP_001062294.2| Os08g0525800 [Oryza sativa Japonica Group]
 dbj|BAF24208.2| Os08g0525800 [Oryza sativa Japonica Group]
Length=471

 Score =   159 bits (401),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 90/196 (46%), Positives = 120/196 (61%), Gaps = 8/196 (4%)
 Frame = +2

Query  146  CHLFPAQI-SQLRSEYATVNWATTFP-HHHDLQLIHGLKAKRVKIYDANPKILRALGNSD  319
            CH   A+    L   Y TV  A   P     ++L+    A  V+IYDAN  ILRAL  + 
Sbjct  22   CHCHVARGWGGLGVNYGTV--ADDLPTAARSVELLRAAGAGAVRIYDANADILRALAGTG  79

Query  320  VQVSVMVPNEIIPNISSDQALA--DRWVETNVVPFYGETKIRYLLVGNEILSN--PPNTT  487
            V VSV VPN+ IP++++  + A  D WV  N+ P     ++  LLVGNE+LS+     T 
Sbjct  80   VPVSVTVPNDAIPSLAAAASPAAVDEWVARNLAPHIPAARVLCLLVGNEVLSDRATAGTA  139

Query  488  WFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQF  667
            W  LVPAM  +RR++   GL ++KVGT LAMD L  SYPPS+GAFR D+ G+V +PLL+F
Sbjct  140  WPSLVPAMANLRRALSARGLGRVKVGTTLAMDALGTSYPPSAGAFRDDIAGAVVRPLLEF  199

Query  668  LDRTNSFFFFDVYPYF  715
            L+ T S++F D YPYF
Sbjct  200  LNATGSYYFVDAYPYF  215



>dbj|BAC75423.1| putative beta-1,3-glucanase [Oryza sativa Japonica Group]
Length=482

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 90/196 (46%), Positives = 120/196 (61%), Gaps = 8/196 (4%)
 Frame = +2

Query  146  CHLFPAQI-SQLRSEYATVNWATTFP-HHHDLQLIHGLKAKRVKIYDANPKILRALGNSD  319
            CH   A+    L   Y TV  A   P     ++L+    A  V+IYDAN  ILRAL  + 
Sbjct  22   CHCHVARGWGGLGVNYGTV--ADDLPTAARSVELLRAAGAGAVRIYDANADILRALAGTG  79

Query  320  VQVSVMVPNEIIPNISSDQALA--DRWVETNVVPFYGETKIRYLLVGNEILSN--PPNTT  487
            V VSV VPN+ IP++++  + A  D WV  N+ P     ++  LLVGNE+LS+     T 
Sbjct  80   VPVSVTVPNDAIPSLAAAASPAAVDEWVARNLAPHIPAARVLCLLVGNEVLSDRATAGTA  139

Query  488  WFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQF  667
            W  LVPAM  +RR++   GL ++KVGT LAMD L  SYPPS+GAFR D+ G+V +PLL+F
Sbjct  140  WPSLVPAMANLRRALSARGLGRVKVGTTLAMDALGTSYPPSAGAFRDDIAGAVVRPLLEF  199

Query  668  LDRTNSFFFFDVYPYF  715
            L+ T S++F D YPYF
Sbjct  200  LNATGSYYFVDAYPYF  215



>emb|CDY12371.1| BnaC08g08340D [Brassica napus]
Length=479

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 113/164 (69%), Gaps = 0/164 (0%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
            +  +  I  +KA  VK+YDA+P+ L  L ++++ VS+ V N  I ++ ++Q  A+ WV+T
Sbjct  58   YQSINFIKSIKAGHVKLYDADPETLTLLSHTNLYVSITVHNHQITSLGTNQTTAEDWVKT  117

Query  404  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  583
            N++P+Y +T+IR++LVGNEILS         LVPAMRKI  +++  G+  IKVGTPL MD
Sbjct  118  NILPYYPQTQIRFVLVGNEILSVQDRNITANLVPAMRKIVNALRAHGIHNIKVGTPLPMD  177

Query  584  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
             L +++PPS+  FR D+ G +  PLL+FL+ TNS+FF ++ PY+
Sbjct  178  SLRSTFPPSNSTFREDIAGPLMLPLLKFLNGTNSYFFINLQPYY  221



>ref|XP_010673323.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Beta 
vulgaris subsp. vulgaris]
Length=473

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 111/164 (68%), Gaps = 1/164 (1%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
            +  ++LI  + A  VK+YDA+P+ ++ L  +D+ VS+MV N+ I  ++++  LA++WV  
Sbjct  54   YKSIELIKSMNASMVKLYDADPETMKLLAGTDLHVSIMVRNDEIVELATNDTLANQWVHE  113

Query  404  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  583
            NV  +Y  T IR ++VGNE+ SN     W  LV AM+ IR ++    +  IKVGTPLAMD
Sbjct  114  NVFAYYPTTMIRSIMVGNEVYSNHNLEQWDNLVLAMQHIRNTLHTHDIHNIKVGTPLAMD  173

Query  584  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            +L +++PPS+G FR D T +   PLLQFL+RT SFFF D+YPYF
Sbjct  174  ILGSTFPPSNGTFRVD-TLTTIVPLLQFLNRTGSFFFLDIYPYF  216



>emb|CDY27122.1| BnaA08g07600D [Brassica napus]
Length=479

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 113/164 (69%), Gaps = 0/164 (0%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
            +  +  I  +KA  VK+YDA+P+ L  L ++++ VS+ V N  I ++ ++Q  A+ WV+T
Sbjct  58   YQSINFIKSIKAGHVKLYDADPETLTLLSHTNLYVSITVHNHQITSLGTNQTTAEDWVKT  117

Query  404  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  583
            N++P+Y +T+IR++LVGNEILS         LVPAMRKI  +++  G+  IKVGTPL MD
Sbjct  118  NILPYYPQTQIRFVLVGNEILSVQDRNITSNLVPAMRKIVNALRAHGIHNIKVGTPLPMD  177

Query  584  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
             L +++PPS+  FR D+ G +  PLL+FL+ TNS+FF ++ PY+
Sbjct  178  SLRSTFPPSNSTFREDIAGPLMLPLLKFLNGTNSYFFINLQPYY  221



>ref|XP_009108090.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=479

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 113/164 (69%), Gaps = 0/164 (0%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
            +  +  I  +KA  VK+YDA+P+ L  L ++++ VS+ V N  I ++ ++Q  A+ WV+T
Sbjct  58   YQSINFIKSIKAGHVKLYDADPETLTLLSHTNLYVSITVHNHQITSLGTNQTTAEDWVKT  117

Query  404  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  583
            N++P+Y +T+IR++LVGNEILS         LVPAMRKI  +++  G+  IKVGTPL MD
Sbjct  118  NILPYYPQTQIRFVLVGNEILSVQDRNITSNLVPAMRKIVNALRAHGIHNIKVGTPLPMD  177

Query  584  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
             L +++PPS+  FR D+ G +  PLL+FL+ TNS+FF ++ PY+
Sbjct  178  SLRSTFPPSNSTFREDIAGPLMLPLLKFLNGTNSYFFINLQPYY  221



>dbj|BAG16359.1| tapetum-specific protein A6 family protein [Brassica oleracea 
var. italica]
Length=399

 Score =   156 bits (394),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/164 (45%), Positives = 113/164 (69%), Gaps = 0/164 (0%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
            +  +  I  +KA  VK+YDA+P+ L  L  +++ V++ VP   I ++S++Q  A+ WV+T
Sbjct  5    YQSINFIKLIKAGHVKLYDADPESLTLLSQTNLYVTIAVPTHQITSLSANQTTAEDWVKT  64

Query  404  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  583
            N++P+Y +T+IR++LVGNEILS         +VPAMRKI  S++  G+  IKVGTPLAMD
Sbjct  65   NILPYYPQTQIRFVLVGNEILSVKDRNITGNVVPAMRKIVNSLRAHGIHNIKVGTPLAMD  124

Query  584  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
             L +++PPS+  FR D+   +  PLL+FL+ TNS+FF ++ PYF
Sbjct  125  SLRSTFPPSNSTFRGDIALPLMLPLLKFLNGTNSYFFINLQPYF  168



>emb|CDY06469.1| BnaC06g11750D [Brassica napus]
Length=479

 Score =   157 bits (396),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 74/164 (45%), Positives = 113/164 (69%), Gaps = 0/164 (0%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
            +  +  I  +KA  VK+YDA+P+ L  L  +++ V++ VP   I ++S++Q  A+ WV+T
Sbjct  58   YQSINFIKLIKAGHVKLYDADPESLTLLSQTNLYVTIAVPTHQITSLSANQTTAEDWVKT  117

Query  404  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  583
            N++P+Y +T+IR++LVGNEILS         +VPAMRKI  S++  G+  IKVGTPLAMD
Sbjct  118  NILPYYPQTQIRFVLVGNEILSVKDRNITGNVVPAMRKIVNSLRAHGIHNIKVGTPLAMD  177

Query  584  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
             L +++PPS+  FR D+   +  PLL+FL+ TNS+FF ++ PYF
Sbjct  178  SLRSTFPPSNSTFRGDIALPLMLPLLKFLNGTNSYFFINLQPYF  221



>emb|CAA49513.1| beta-1,3-glucanase homologue [Brassica napus]
Length=474

 Score =   157 bits (396),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 74/164 (45%), Positives = 113/164 (69%), Gaps = 0/164 (0%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
            +  +  I  +KA  VK+YDA+P+ L  L  +++ V++ VP   I ++S++Q  A+ WV+T
Sbjct  53   YQSINFIKLIKAGHVKLYDADPESLTLLSQTNLYVTIAVPTHQITSLSANQTTAEDWVKT  112

Query  404  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  583
            N++P+Y +T+IR++LVGNEILS         +VPAMRKI  S++  G+  IKVGTPLAMD
Sbjct  113  NILPYYPQTQIRFVLVGNEILSVKDRNITGNVVPAMRKIVNSLRAHGIHNIKVGTPLAMD  172

Query  584  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
             L +++PPS+  FR D+   +  PLL+FL+ TNS+FF ++ PYF
Sbjct  173  SLRSTFPPSNSTFRGDIALPLMLPLLKFLNGTNSYFFINLQPYF  216



>ref|XP_002964439.1| hypothetical protein SELMODRAFT_230318 [Selaginella moellendorffii]
 gb|EFJ34772.1| hypothetical protein SELMODRAFT_230318 [Selaginella moellendorffii]
Length=339

 Score =   154 bits (388),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 109/164 (66%), Gaps = 3/164 (2%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            + LI  L   RVKI+DA+ ++L AL N+ ++VS+MV N+ IP I+S+ + AD WV  NVV
Sbjct  32   VSLIKSLGIDRVKIFDADSQVLAALANTSIKVSIMVRNQDIPGIASNASHADSWVAQNVV  91

Query  413  PFYGETKIRYLLVGNEILSNPP--NTTWFQLVPAMRKIRRSVKKFGLR-KIKVGTPLAMD  583
              Y  T I  +LVGNEILS+    ++TW  LVPAM  I  S++   L  KIKV TPLA D
Sbjct  92   HHYPATHIATILVGNEILSDTSIKSSTWPALVPAMENIFASLQARNLTAKIKVSTPLASD  151

Query  584  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
             L  SYPPS+GAF S++  SV +PLL FL +T S +  +VYPYF
Sbjct  152  ALSTSYPPSAGAFHSEIATSVIQPLLAFLAKTGSSYHANVYPYF  195



>emb|CDY01191.1| BnaA04g06280D [Brassica napus]
Length=480

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 112/165 (68%), Gaps = 1/165 (1%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
            +  +  I  +KA  VK+YDA+P+ L  L  +++ V++ VPN +I ++S++Q  A+ WV+T
Sbjct  58   YQSINFIKSIKAGHVKLYDADPESLTLLSQTNLYVTITVPNHLITSLSTNQTTAEDWVQT  117

Query  404  NVVPFYGETKIRYLLVGNEILS-NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAM  580
            N++P+Y +T IR++LVGNEILS          +VPAMRKI  S++  G+  IKVGT L M
Sbjct  118  NIIPYYPQTHIRFVLVGNEILSVEERRNITANVVPAMRKIVTSLRAHGIHNIKVGTALDM  177

Query  581  DMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            D L +S+PPS+  FR D+   +  PLL+FL+ TNS+FF ++ PYF
Sbjct  178  DSLRSSFPPSNSTFREDIAEPLMLPLLKFLNGTNSYFFINLQPYF  222



>ref|XP_009139564.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=480

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 112/165 (68%), Gaps = 1/165 (1%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
            +  +  I  +KA  VK+YDA+P+ L  L  +++ V++ VPN +I ++S++Q  A+ WV+T
Sbjct  58   YQSINFIKSIKAGHVKLYDADPESLTLLSQTNLYVTITVPNHLITSLSTNQTTAEDWVQT  117

Query  404  NVVPFYGETKIRYLLVGNEILS-NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAM  580
            N++P+Y +T IR++LVGNEILS          +VPAMRKI  S++  G+  IKVGT L M
Sbjct  118  NIIPYYPQTHIRFVLVGNEILSVEERRNITANVVPAMRKIVTSLRAHGIHNIKVGTALDM  177

Query  581  DMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            D L +S+PPS+  FR D+   +  PLL+FL+ TNS+FF ++ PYF
Sbjct  178  DSLRSSFPPSNSTFREDIAEPLMLPLLKFLNGTNSYFFINLQPYF  222



>ref|XP_002975355.1| hypothetical protein SELMODRAFT_103308, partial [Selaginella 
moellendorffii]
 gb|EFJ23556.1| hypothetical protein SELMODRAFT_103308, partial [Selaginella 
moellendorffii]
Length=320

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/164 (50%), Positives = 108/164 (66%), Gaps = 3/164 (2%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            + LI  L   RVKI+DA+ ++L AL N+ ++VS+MV N+ IP I+S+ + AD WV  NVV
Sbjct  13   VSLIKSLGIDRVKIFDADSQVLAALANTSIKVSIMVRNQDIPGIASNASHADSWVAQNVV  72

Query  413  PFYGETKIRYLLVGNEILSNPP--NTTWFQLVPAMRKIRRSVKKFGLR-KIKVGTPLAMD  583
              Y  T I  +LVGNEILS+    ++TW  LVPAM  I  S++   L  KIKV TPLA D
Sbjct  73   HHYPATHIATILVGNEILSDTSIKSSTWPALVPAMENIFASLQARNLTAKIKVSTPLASD  132

Query  584  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
             L  SYPPS+G F S++  SV +PLL FL +T S +  +VYPYF
Sbjct  133  ALSTSYPPSAGTFHSEIATSVIQPLLAFLAKTGSSYHANVYPYF  176



>ref|XP_002972033.1| hypothetical protein SELMODRAFT_96745, partial [Selaginella moellendorffii]
 gb|EFJ26950.1| hypothetical protein SELMODRAFT_96745, partial [Selaginella moellendorffii]
Length=459

 Score =   154 bits (389),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 76/168 (45%), Positives = 115/168 (68%), Gaps = 3/168 (2%)
 Frame = +2

Query  218  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWV  397
            P    ++L+  LK + VKIYDANP +L+AL +++++V++MV N+ I  +++    +D+WV
Sbjct  14   PPARVVELLQSLKIRSVKIYDANPDVLKALQSTNLRVAIMVTNQEIEQMAASSNFSDQWV  73

Query  398  ETNVVPFYGETKIRYLLVGNEILSNPP--NTTWFQLVPAMRKIRRSVKKFGLRKIKVGTP  571
            + NV   Y  TKI   +VGNEILS+     T W +LVPAM  +  S+++ G  KIKV T 
Sbjct  74   QQNVAA-YPATKIETAIVGNEILSDLSLRQTVWSKLVPAMENLHSSLQRLGHGKIKVTTS  132

Query  572  LAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            LA+D L+ S+PPS GAFR D++ ++ +P+L+FL+ T S FF +VYPYF
Sbjct  133  LAIDCLKVSFPPSEGAFRDDVSDTIIQPMLKFLETTQSPFFINVYPYF  180



>emb|CDY12732.1| BnaC04g29090D [Brassica napus]
Length=480

 Score =   154 bits (389),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 73/165 (44%), Positives = 112/165 (68%), Gaps = 1/165 (1%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
            +  +  I  +KA  VK+YDA+P+ L  L  +++ V++ VPN +I ++S++Q  A+ WV+T
Sbjct  58   YQSINFIKSIKAGHVKLYDADPESLTLLSQTNLYVTITVPNHLITSLSTNQTSAEDWVQT  117

Query  404  NVVPFYGETKIRYLLVGNEILS-NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAM  580
            N+ P+Y +T IR++LVGNEILS          +VPAMRKI  S++  G+  IKVGT L M
Sbjct  118  NITPYYPQTHIRFVLVGNEILSVEERRNITANVVPAMRKIVTSLRAHGIHNIKVGTALDM  177

Query  581  DMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            D L +++PPS+  FR D+  ++  PLL+FL+ TNS+FF ++ PYF
Sbjct  178  DSLRSTFPPSNSTFREDIAETLMLPLLKFLNGTNSYFFINLQPYF  222



>ref|NP_001051879.1| Os03g0845600 [Oryza sativa Japonica Group]
 gb|AAO73280.1| putative beta-1,3-glucanase [Oryza sativa Japonica Group]
 gb|AAS07356.1| putative beta-1,3-glucanase [Oryza sativa Japonica Group]
 gb|ABF99870.1| Glycosyl hydrolases family 17 protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13793.1| Os03g0845600 [Oryza sativa Japonica Group]
 gb|EAZ29287.1| hypothetical protein OsJ_13350 [Oryza sativa Japonica Group]
 dbj|BAG98908.1| unnamed protein product [Oryza sativa Japonica Group]
Length=474

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/169 (43%), Positives = 106/169 (63%), Gaps = 3/169 (2%)
 Frame = +2

Query  218  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWV  397
            P H  L+L     A  V+ YD+N   L     S +     VPNE+IP++++ +  AD WV
Sbjct  40   PPHRALELARSAGAAAVRFYDSNATFLSPAAASGLVFVPGVPNELIPSLAASRRAADEWV  99

Query  398  ETNVVPFYGETKIRYLLVGNEILSNPPNTT-WFQLVPAMRKIRRSVKKFGLRKIKVGTPL  574
               ++PF    ++RYL VGNE+LS+P   + WFQLVPAM  + R++++ G+R++KV T L
Sbjct  100  AATLLPFRRNRRLRYLFVGNEVLSDPTTKSRWFQLVPAMANLERALRRHGMRRVKVSTTL  159

Query  575  AMDMLEAS--YPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
             MD L+    +PPS+G FR D+  +V +PLL FL+RT+S+ F D Y YF
Sbjct  160  GMDALDGQNVFPPSAGVFRPDIADAVVRPLLAFLERTDSYLFVDAYTYF  208



>ref|XP_002980798.1| hypothetical protein SELMODRAFT_444643 [Selaginella moellendorffii]
 gb|EFJ17983.1| hypothetical protein SELMODRAFT_444643 [Selaginella moellendorffii]
Length=464

 Score =   152 bits (385),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 114/166 (69%), Gaps = 2/166 (1%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
            +  ++L+  +  + VK++DANP++L AL NS ++V++MVPNEII  ++S Q+ AD W+  
Sbjct  45   NQTVELLKSMNVRLVKLFDANPQVLTALSNSSIRVTIMVPNEIIGAVASSQSSADDWIAQ  104

Query  404  NVVPFYGETKIRYLLVGNEILSNPP-NTTWFQLVPAMRKIRRSVKKFGL-RKIKVGTPLA  577
            +V+P+Y  T+I  ++VGNEI S P    TW QL+PA+  + RS++   L  +IK+ T +A
Sbjct  105  SVLPYYPSTQIIVIVVGNEIFSYPALAQTWQQLMPAIENLHRSLQSHNLDDRIKITTSVA  164

Query  578  MDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
             D+L ASYPPS G FR D+  +V KPLL FL  T + F+ ++YPYF
Sbjct  165  GDVLAASYPPSVGRFRPDIRDTVLKPLLGFLRTTRAPFYINLYPYF  210



>gb|EAZ07710.1| hypothetical protein OsI_29967 [Oryza sativa Indica Group]
Length=1020

 Score =   156 bits (395),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 90/196 (46%), Positives = 120/196 (61%), Gaps = 8/196 (4%)
 Frame = +2

Query  146  CHLFPAQI-SQLRSEYATVNWATTFP-HHHDLQLIHGLKAKRVKIYDANPKILRALGNSD  319
            CH   A+    L   Y TV  A   P     ++L+    A  V+IYDAN  ILRAL  + 
Sbjct  22   CHCHVARGWGGLGVNYGTV--ADDLPTAARSVELLRAAGAGAVRIYDANADILRALAGTG  79

Query  320  VQVSVMVPNEIIPNISSDQALA--DRWVETNVVPFYGETKIRYLLVGNEILSN--PPNTT  487
            V VSV VPN+ IP++++  + A  D WV  N+ P     ++  LLVGNE+LS+     T 
Sbjct  80   VPVSVTVPNDAIPSLAAAASPAAVDEWVARNLAPHIPAARVLCLLVGNEVLSDRATAGTA  139

Query  488  WFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQF  667
            W  LVPAM  +RR++   GL ++KVGT LAMD L  SYPPS+GAFR D+ G+V +PLL+F
Sbjct  140  WPSLVPAMANLRRALSARGLGRVKVGTTLAMDALGTSYPPSAGAFRDDIAGAVVRPLLEF  199

Query  668  LDRTNSFFFFDVYPYF  715
            L+ T S++F D YPYF
Sbjct  200  LNATGSYYFVDAYPYF  215



>ref|XP_002972579.1| hypothetical protein SELMODRAFT_97838, partial [Selaginella moellendorffii]
 gb|EFJ26665.1| hypothetical protein SELMODRAFT_97838, partial [Selaginella moellendorffii]
Length=460

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 113/163 (69%), Gaps = 3/163 (2%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            ++L+  LK + VKIYDANP +L+AL +++++V++MV N+ I  +++    +D+WV+ NV 
Sbjct  19   VELLQSLKIRSVKIYDANPDVLKALQSTNLRVAIMVTNQEIEQMAASSNFSDQWVQQNVA  78

Query  413  PFYGETKIRYLLVGNEILSNPP--NTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDM  586
              Y  TKI   +VGNEILS+     T W +LVPAM  +  S+++ G  KIKV T LA+D 
Sbjct  79   A-YPATKIETAIVGNEILSDLSLRQTVWSKLVPAMENLHSSLQRLGHGKIKVTTSLAIDC  137

Query  587  LEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            L+ S+PPS G FR D++ ++ +P+L+FL+ T S FF +VYPYF
Sbjct  138  LKVSFPPSDGVFRDDISDAIIQPMLKFLETTQSPFFINVYPYF  180



>ref|XP_006492526.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Citrus sinensis]
Length=389

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 93/130 (72%), Gaps = 3/130 (2%)
 Frame = +2

Query  335  MVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNT---TWFQLVP  505
            MV N  I +I+S Q +AD+WV  NV+ FY ET IR++LVGNEILS         W  LVP
Sbjct  1    MVQNHEIIDIASKQKVADQWVHDNVLSFYPETMIRFILVGNEILSQSSEEYKQIWKNLVP  60

Query  506  AMRKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNS  685
            AM +I++ +    +  IKVGTPLAMD+ + ++PPS+G FRSD++ SV +PLLQFL+RT S
Sbjct  61   AMHRIKKCLNAHNIHNIKVGTPLAMDIFQTTFPPSNGTFRSDISASVMEPLLQFLNRTKS  120

Query  686  FFFFDVYPYF  715
            FFF DVYPYF
Sbjct  121  FFFLDVYPYF  130



>ref|XP_004973968.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Setaria italica]
Length=389

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 93/129 (72%), Gaps = 2/129 (2%)
 Frame = +2

Query  335  MVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSN--PPNTTWFQLVPA  508
            MVPNE IP+++S +A A+ WV  N+ P     ++ YLLVGNE+LSN     +TW  +VPA
Sbjct  1    MVPNEAIPSLASSRAAAEGWVAANLAPHVPAARVMYLLVGNEVLSNRAAAGSTWRAIVPA  60

Query  509  MRKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSF  688
            M  + R+++  G+RK+K+GT LAMD L ASYPPS+GAFR D+  +V +PLL+FL+ T SF
Sbjct  61   MANLHRALRAHGIRKVKLGTTLAMDALSASYPPSAGAFRGDVAEAVIRPLLRFLNATRSF  120

Query  689  FFFDVYPYF  715
            +F D YPYF
Sbjct  121  YFVDAYPYF  129



>gb|ADG38393.1| AT3G07320-like protein [Capsella grandiflora]
 gb|ADG38394.1| AT3G07320-like protein [Capsella grandiflora]
 gb|ADG38395.1| AT3G07320-like protein [Capsella grandiflora]
Length=202

 Score =   145 bits (367),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = +2

Query  395  VETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  574
            + +N++PFY  TKIRYLLVGNEILS+P +     LVPAMRKI+RS+K  G++K+KVGT L
Sbjct  1    IRSNILPFYPTTKIRYLLVGNEILSSPDSELKASLVPAMRKIQRSLKSLGVKKVKVGTSL  60

Query  575  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            A+D+L+ S+PPS G FR D++G V KP+LQFL+RT SF F DVYPYF
Sbjct  61   AVDVLQTSFPPSKGEFREDISGLVMKPMLQFLNRTKSFLFVDVYPYF  107



>gb|ADG38397.1| AT3G07320-like protein [Capsella grandiflora]
Length=202

 Score =   145 bits (367),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = +2

Query  395  VETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  574
            + +N++PFY  TKIRYLLVGNEILS+P +     LVPAMRKI+RS+K  G++K+KVGT L
Sbjct  1    IRSNILPFYPTTKIRYLLVGNEILSSPDSELKASLVPAMRKIQRSLKSLGVKKVKVGTSL  60

Query  575  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            A+D+L+ S+PPS G FR D++G V KP+LQFL+RT SF F DVYPYF
Sbjct  61   AVDVLQTSFPPSKGEFREDISGLVMKPMLQFLNRTKSFLFVDVYPYF  107



>gb|ADG38398.1| AT3G07320-like protein [Capsella grandiflora]
Length=202

 Score =   145 bits (366),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = +2

Query  395  VETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  574
            + +N++PFY  TKIRYLLVGNEILS+P +     LVPAMRKI+RS+K  G++K+KVGT L
Sbjct  1    IRSNILPFYPTTKIRYLLVGNEILSSPDSELKASLVPAMRKIQRSLKSLGVKKVKVGTSL  60

Query  575  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            A+D+L+ S+PPS G FR D++G V KP+LQFL+RT SF F DVYPYF
Sbjct  61   AVDVLQTSFPPSXGEFREDISGLVMKPMLQFLNRTKSFLFVDVYPYF  107



>ref|XP_008643986.1| PREDICTED: uncharacterized protein LOC100382447 isoform X1 [Zea 
mays]
 tpg|DAA48156.1| TPA: putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=482

 Score =   151 bits (381),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 94/194 (48%), Positives = 124/194 (64%), Gaps = 6/194 (3%)
 Frame = +2

Query  146  CHLFPAQISQ-LRSEYATVNWATTFPH-HHDLQLIHGLKAKRVKIYDANPKILRALGNSD  319
            CH   A+  + L   Y TV  A   P     +QL+    A  VKIYDAN  ILRAL  + 
Sbjct  36   CHCHGAKGCRGLGINYGTV--ADDLPSASRSVQLLRAAGASAVKIYDANADILRALAGTG  93

Query  320  VQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPP--NTTWF  493
            V VS+MVPN  IP+++S +A A+ WV  N+ P    T++ +LLVGNE+LSN     +TW 
Sbjct  94   VPVSIMVPNSAIPSLASSRAAAEAWVAANLAPHIPATRVAHLLVGNEVLSNRAIAASTWR  153

Query  494  QLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLD  673
             +VPAM  +RR+++  GLR +K+GT LAMD L ASYPPS+GAFR D+   V  PLL+FL+
Sbjct  154  GVVPAMANLRRALRARGLRGVKLGTTLAMDALSASYPPSAGAFRGDIAEDVVLPLLRFLN  213

Query  674  RTNSFFFFDVYPYF  715
             T S++F D YPYF
Sbjct  214  ATRSYYFVDAYPYF  227



>ref|XP_002961854.1| hypothetical protein SELMODRAFT_437767 [Selaginella moellendorffii]
 gb|EFJ37114.1| hypothetical protein SELMODRAFT_437767 [Selaginella moellendorffii]
Length=464

 Score =   150 bits (380),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 113/166 (68%), Gaps = 2/166 (1%)
 Frame = +2

Query  224  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  403
            +  + L+  +  + VK++DANP++L AL NS ++V++MVPNEII  ++S Q+ AD W+  
Sbjct  45   NQTVALLKSMNVRLVKLFDANPQVLTALSNSSIRVTIMVPNEIIGAVASSQSSADDWIAQ  104

Query  404  NVVPFYGETKIRYLLVGNEILSNPP-NTTWFQLVPAMRKIRRSVKKFGL-RKIKVGTPLA  577
            +V+P+Y  T+I  ++VGNEI S P    TW QL+PA+  + R+++   L  +IK+ T +A
Sbjct  105  SVLPYYPSTQIIVIVVGNEIFSYPALAQTWQQLMPAIENLHRALQSHNLDDRIKITTSVA  164

Query  578  MDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
             D+L ASYPPS G FR D+  +V KPLL FL  T + F+ ++YPYF
Sbjct  165  GDVLAASYPPSVGRFRPDIRDTVLKPLLGFLRTTRAPFYINLYPYF  210



>ref|XP_008792941.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X3 [Phoenix dactylifera]
Length=389

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 99/128 (77%), Gaps = 1/128 (1%)
 Frame = +2

Query  335  MVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSN-PPNTTWFQLVPAM  511
            MVPN++ P+++++++LAD W+  N++PFY + +IR+LLVGNE+LS+    ++W  LVPAM
Sbjct  1    MVPNQVFPSLAANRSLADAWLAANLLPFYPQARIRFLLVGNEVLSDYSVKSSWPSLVPAM  60

Query  512  RKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFF  691
              + R+++   +R +KVGT LAMD L+ S+PPS+G FR D+ G+V +PLL+F +RT SF+
Sbjct  61   ANLHRALRARSIRDVKVGTTLAMDSLKTSFPPSAGEFRDDIAGTVIRPLLRFANRTRSFY  120

Query  692  FFDVYPYF  715
            F DVYPYF
Sbjct  121  FVDVYPYF  128



>gb|EEC76519.1| hypothetical protein OsI_14305 [Oryza sativa Indica Group]
Length=474

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/169 (42%), Positives = 105/169 (62%), Gaps = 3/169 (2%)
 Frame = +2

Query  218  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWV  397
            P H  L+L     A  V+ YD+N   L     S +     VPNE+IP++++ +  AD WV
Sbjct  40   PPHRALELARSAGAAAVRFYDSNATFLSPAAASGLVFVPGVPNELIPSLAASRRAADEWV  99

Query  398  ETNVVPFYGETKIRYLLVGNEILSNPPNTT-WFQLVPAMRKIRRSVKKFGLRKIKVGTPL  574
               ++PF    ++RYL VGNE+LS+P   + WFQLV AM  + R++++ G+R++KV T L
Sbjct  100  AATLLPFRRNRRLRYLFVGNEVLSDPTTKSRWFQLVSAMANLERALRRHGMRRVKVSTTL  159

Query  575  AMDMLEAS--YPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
             MD L+    +PPS+G FR D+  +V +PLL FL+RT+S+ F D Y YF
Sbjct  160  GMDALDGQNVFPPSAGVFRPDIADAVVRPLLAFLERTDSYLFVDAYTYF  208



>ref|XP_006661404.1| PREDICTED: LOW QUALITY PROTEIN: probable glucan endo-1,3-beta-glucosidase 
A6-like [Oryza brachyantha]
Length=521

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 76/168 (45%), Positives = 113/168 (67%), Gaps = 2/168 (1%)
 Frame = +2

Query  218  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWV  397
            P    ++L+  + A  VKIYD N  +LRAL  + ++VS+MVPNEIIP +++  A ADRWV
Sbjct  95   PPRRSVELLRAVGAGSVKIYDGNSSVLRALAGTGMRVSIMVPNEIIPGLAASAAAADRWV  154

Query  398  ETNVVPFYGETKIRYLLVGNEILSN--PPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTP  571
              N+VP+Y ET+++YLLVGNE+LS+    N+TW ++VPAM  +  S+++  +  +K+ T 
Sbjct  155  AENLVPYYPETRVKYLLVGNELLSDYSIANSTWPRIVPAMENLHASLRRRRISSVKISTT  214

Query  572  LAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            LAMD L +   P   +      G+V +PLL+FL+ TNS++F D YPYF
Sbjct  215  LAMDALSSGSFPRPPSAAGVXAGAVVRPLLRFLNGTNSYYFVDAYPYF  262



>ref|XP_010026682.1| PREDICTED: LOW QUALITY PROTEIN: probable glucan endo-1,3-beta-glucosidase 
A6 [Eucalyptus grandis]
Length=337

 Score =   146 bits (369),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 105/159 (66%), Gaps = 5/159 (3%)
 Frame = +2

Query  251  LKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGET  430
            ++A  VK+Y+A+P+IL+ L  + VQVS+MV N  IP ++S QALAD+WV  NV+ +Y  T
Sbjct  1    MRAGHVKLYNADPEILKLLSGTKVQVSIMVQNHEIPGVASSQALADKWVRNNVLLYYHGT  60

Query  431  KIRYLLVGNEILS----NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEAS  598
             IR++LVGNE  S    +  +  W  LVPAM +I+ S++  G+  IK GTPLA+      
Sbjct  61   MIRFVLVGNEFSSYNSTDRDHQLWRDLVPAMCRIKSSLRSNGIHNIKGGTPLAIRG-RIH  119

Query  599  YPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
             P  SG FRSD+  SV  PL++FL+ T S FF DVYPYF
Sbjct  120  IPSLSGRFRSDVAESVIMPLVRFLNSTRSHFFLDVYPYF  158



>gb|ADG38399.1| AT3G07320-like protein [Neslia paniculata]
Length=202

 Score =   143 bits (360),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = +2

Query  395  VETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  574
            + +N++PFY  TKIRYLLVGNEILS+  +     LVPAMR+I+RS+K  G++K+KVGT L
Sbjct  1    IRSNILPFYPTTKIRYLLVGNEILSSTDSELKSSLVPAMRRIQRSLKSLGVKKVKVGTSL  60

Query  575  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            A+D+L+ S+PPSSG FR D++G V KP+LQFL+RT SF F DVYPYF
Sbjct  61   AVDVLKTSFPPSSGEFREDISGLVMKPMLQFLNRTKSFLFVDVYPYF  107



>ref|XP_002316783.2| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
 gb|EEE97395.2| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
Length=476

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 107/157 (68%), Gaps = 3/157 (2%)
 Frame = +2

Query  245  HGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYG  424
            HG+   R+K+YD +  +L AL  S + V V +PNE++ ++++DQ+ AD WV+ N+   + 
Sbjct  55   HGIN--RIKLYDTDSDVLTALAGSSINVVVALPNELLSSVAADQSFADSWVKGNISQHFP  112

Query  425  ETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASYP  604
            +TKI  + VGNE+  +P NTT F LVPAM+ +  S+ KF L  IK+ +P+A+  L++SYP
Sbjct  113  QTKIEAIAVGNEVFVDPKNTTPF-LVPAMKNVHNSLVKFNLSSIKISSPIALSALQSSYP  171

Query  605  PSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
             S+G+F+++L G V KP+L FL +T S+   + YP+F
Sbjct  172  SSAGSFKTELIGPVIKPMLDFLRQTGSYLMINAYPFF  208



>ref|XP_011044921.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Populus 
euphratica]
Length=476

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 107/161 (66%), Gaps = 1/161 (1%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            + L+      R+K+YD +  +L AL  S + V V +PNE++ ++++DQ+ AD WV+ N+ 
Sbjct  49   VSLLKSQGINRIKLYDTDSDVLTALAGSSINVVVALPNELLSSVAADQSFADSWVKANIS  108

Query  413  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLE  592
              + +TKI  + VGNE+  +P NTT F LVPAM+ +  S+ KF L  IK+ +P+A+  L+
Sbjct  109  QHFPQTKIEAIAVGNEVFVDPKNTTPF-LVPAMKNVHNSLVKFNLSSIKISSPIALSALQ  167

Query  593  ASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            +SYP S+G+F+++L G V KP+L FL +T S+   + YP+F
Sbjct  168  SSYPSSAGSFKTELIGPVIKPMLDFLRQTGSYLMINAYPFF  208



>gb|ADG38396.1| AT3G07320-like protein [Capsella grandiflora]
Length=202

 Score =   142 bits (359),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 85/107 (79%), Gaps = 0/107 (0%)
 Frame = +2

Query  395  VETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPL  574
            + +N++PFY  TKIRYLLVGNEILS+P +     LVPAMRKI+RS+K  G++K+KVGT L
Sbjct  1    IRSNILPFYPTTKIRYLLVGNEILSSPDSELKASLVPAMRKIQRSLKSLGVKKVKVGTSL  60

Query  575  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            A+D+L+ S+PPS G FR D++  V KP+LQFL+RT SF F DVYPYF
Sbjct  61   AVDVLQTSFPPSKGEFREDISXLVMKPMLQFLNRTKSFLFVDVYPYF  107



>ref|XP_008364550.1| PREDICTED: glucan endo-1,3-beta-glucosidase 14 [Malus domestica]
 ref|XP_008364558.1| PREDICTED: glucan endo-1,3-beta-glucosidase 14 [Malus domestica]
Length=465

 Score =   148 bits (373),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 109/166 (66%), Gaps = 1/166 (1%)
 Frame = +2

Query  218  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWV  397
            P    + L+      +VK+YD +  +L AL NS + V V +PNE++ + +SD + AD+WV
Sbjct  41   PPEKVVALLKSQGINKVKLYDTDATVLTALANSGISVVVALPNELLSSAASDPSFADKWV  100

Query  398  ETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLA  577
            ++N+  ++ +T+I  + VGNE+  +P NTT F LVPAM+ I+ S+ K+ L  IK+ +P+A
Sbjct  101  QSNISHYHPKTQIEAIAVGNEVFVDPNNTTQF-LVPAMKNIQSSLVKYNLSSIKLSSPIA  159

Query  578  MDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            +  L +SYPPS+GAF  DL   V KP L+FL +T+S+   + YP+F
Sbjct  160  LSALNSSYPPSAGAFNPDLIEPVIKPFLEFLTQTSSYLMINAYPFF  205



>gb|KDO62116.1| hypothetical protein CISIN_1g0115512mg [Citrus sinensis]
Length=475

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 106/162 (65%), Gaps = 2/162 (1%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            ++L+   +  RVK YD +  +L AL NSD+ V V  PNE +   ++DQ+  D WV+ N+ 
Sbjct  44   VELLKSQRIDRVKTYDTDSAVLAALANSDISVVVAFPNEELSKAAADQSFTDNWVQANIS  103

Query  413  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL-RKIKVGTPLAMDML  589
             +Y  TKI  + VGNE+ ++P NTT F LVPAM+ +  S+ K+ L   +KV +P+A+  L
Sbjct  104  KYYPATKIEAVAVGNEVFADPKNTTPF-LVPAMKNVYNSLVKYKLDSNVKVSSPIALGAL  162

Query  590  EASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            + SYPPSSG+F+SDL     KP+L+FL +T+S+   + YP+F
Sbjct  163  QNSYPPSSGSFKSDLIEPALKPMLEFLRKTSSYLMVNAYPFF  204



>ref|XP_008230022.1| PREDICTED: glucan endo-1,3-beta-glucosidase 11 [Prunus mume]
Length=344

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 110/161 (68%), Gaps = 2/161 (1%)
 Frame = +2

Query  236  QLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVP  415
            QL+     +RVK++D++P +LRAL  S+++V+V VPNE++ +++  Q+ A  WV+ NVV 
Sbjct  53   QLLKSQGLERVKVFDSDPAVLRALAGSNIKVTVDVPNELLSSVAKSQSFATNWVQRNVVA  112

Query  416  FYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRK-IKVGTPLAMDMLE  592
            ++  T+I  + VGNE+  +  NTT F L+PAM+ I  ++  F +   IKV +P+A+  L+
Sbjct  113  YHPNTEIEAIAVGNEVFVDTHNTTKF-LIPAMKNIHTALIHFDIHSAIKVSSPIALSALQ  171

Query  593  ASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
             SYP S+G+FR +L  +VFKP+L+FL +T S+   + YPYF
Sbjct  172  NSYPASAGSFRPELVETVFKPMLEFLRQTGSYLMVNAYPYF  212



>gb|KDO62115.1| hypothetical protein CISIN_1g0115512mg [Citrus sinensis]
Length=472

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 106/162 (65%), Gaps = 2/162 (1%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            ++L+   +  RVK YD +  +L AL NSD+ V V  PNE +   ++DQ+  D WV+ N+ 
Sbjct  44   VELLKSQRIDRVKTYDTDSAVLAALANSDISVVVAFPNEELSKAAADQSFTDNWVQANIS  103

Query  413  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL-RKIKVGTPLAMDML  589
             +Y  TKI  + VGNE+ ++P NTT F LVPAM+ +  S+ K+ L   +KV +P+A+  L
Sbjct  104  KYYPATKIEAVAVGNEVFADPKNTTPF-LVPAMKNVYNSLVKYKLDSNVKVSSPIALGAL  162

Query  590  EASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            + SYPPSSG+F+SDL     KP+L+FL +T+S+   + YP+F
Sbjct  163  QNSYPPSSGSFKSDLIEPALKPMLEFLRKTSSYLMVNAYPFF  204



>ref|XP_009348307.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Pyrus x bretschneideri]
Length=463

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 109/166 (66%), Gaps = 1/166 (1%)
 Frame = +2

Query  218  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWV  397
            P    + L       +VK+YD +  +L AL NS + V V +PNE++ + +SD + AD+WV
Sbjct  39   PPEKVVALFKSQGINKVKLYDTDAAVLTALANSGIGVVVAIPNELLSSAASDPSFADKWV  98

Query  398  ETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLA  577
            ++N+  ++ +T+I  + VGNE+ ++P NTT F LVPA++ I+ S+ K+ L  IK+ +P A
Sbjct  99   QSNISQYHPKTQIEAIAVGNEVFADPNNTTQF-LVPAIKNIQSSLVKYNLSSIKLSSPFA  157

Query  578  MDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            +  L +SYPPS+GAF+ DL   V KP L+FL +T+S+   + YP+F
Sbjct  158  LSALNSSYPPSAGAFKPDLIEPVIKPFLEFLTQTSSYLMINAYPFF  203



>ref|XP_009334153.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Pyrus x bretschneideri]
Length=463

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 109/166 (66%), Gaps = 1/166 (1%)
 Frame = +2

Query  218  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWV  397
            P    + L       +VK+YD +  +L AL NS + V V +PNE++ + +SD + AD+WV
Sbjct  39   PPEKVVALFKSQGINKVKLYDTDAAVLTALANSGIGVVVAIPNELLSSAASDPSFADKWV  98

Query  398  ETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLA  577
            ++N+  ++ +T+I  + VGNE+ ++P NTT F LVPA++ I+ S+ K+ L  IK+ +P A
Sbjct  99   QSNISQYHPKTQIEAIAVGNEVFADPNNTTQF-LVPAIKNIQSSLVKYNLSSIKLSSPFA  157

Query  578  MDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            +  L +SYPPS+GAF+ DL   V KP L+FL +T+S+   + YP+F
Sbjct  158  LSALNSSYPPSAGAFKPDLIEPVIKPFLEFLTQTSSYLMINAYPFF  203



>gb|KDO62114.1| hypothetical protein CISIN_1g0115512mg [Citrus sinensis]
Length=483

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 106/162 (65%), Gaps = 2/162 (1%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            ++L+   +  RVK YD +  +L AL NSD+ V V  PNE +   ++DQ+  D WV+ N+ 
Sbjct  44   VELLKSQRIDRVKTYDTDSAVLAALANSDISVVVAFPNEELSKAAADQSFTDNWVQANIS  103

Query  413  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL-RKIKVGTPLAMDML  589
             +Y  TKI  + VGNE+ ++P NTT F LVPAM+ +  S+ K+ L   +KV +P+A+  L
Sbjct  104  KYYPATKIEAVAVGNEVFADPKNTTPF-LVPAMKNVYNSLVKYKLDSNVKVSSPIALGAL  162

Query  590  EASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            + SYPPSSG+F+SDL     KP+L+FL +T+S+   + YP+F
Sbjct  163  QNSYPPSSGSFKSDLIEPALKPMLEFLRKTSSYLMVNAYPFF  204



>ref|XP_007020717.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
 gb|EOY12242.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
Length=475

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/162 (41%), Positives = 109/162 (67%), Gaps = 2/162 (1%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            ++L+  +  ++VK+YD +  +L AL NS + V V +PNE++ + ++DQ+ AD WV++N+ 
Sbjct  51   VELLKSIGVEKVKLYDTDATVLTALANSGISVMVALPNELLASAAADQSFADNWVQSNIS  110

Query  413  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL-RKIKVGTPLAMDML  589
             FY  TKI  + VGNE+  +P NTT + +VPAM+ +  S+ KF L   IK+ +P+A+  L
Sbjct  111  KFYPATKIEAIAVGNEVFVDPKNTTSY-VVPAMKNVHASLVKFNLDSNIKISSPIALSAL  169

Query  590  EASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            + SYP S+G+F+ DL   V KP+L FL +T+S+   + YP+F
Sbjct  170  QNSYPSSAGSFKPDLVEPVIKPMLDFLKQTDSYLMVNAYPFF  211



>gb|AEN81798.1| AT3G07320-like protein, partial [Capsella rubella]
 gb|AEN81799.1| AT3G07320-like protein, partial [Capsella rubella]
 gb|AEN81801.1| AT3G07320-like protein, partial [Capsella rubella]
 gb|AEN81802.1| AT3G07320-like protein, partial [Capsella rubella]
 gb|AEN81804.1| AT3G07320-like protein, partial [Capsella rubella]
 gb|AEN81805.1| AT3G07320-like protein, partial [Capsella rubella]
Length=209

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +2

Query  407  VVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDM  586
            ++PFY  TKIRYLLVGNEILS+P +     LVPAMRKI+RS+K  G++K+KVGT LA+D+
Sbjct  1    ILPFYPTTKIRYLLVGNEILSSPDSELKASLVPAMRKIQRSLKSLGVKKVKVGTSLAVDV  60

Query  587  LEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            L+ S+PPS G FR D++G V KP+LQFL+RT SF F DVYPYF
Sbjct  61   LQTSFPPSKGEFREDISGLVMKPMLQFLNRTKSFLFVDVYPYF  103



>ref|XP_009361042.1| PREDICTED: glucan endo-1,3-beta-glucosidase 14-like [Pyrus x 
bretschneideri]
Length=465

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 111/166 (67%), Gaps = 1/166 (1%)
 Frame = +2

Query  218  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWV  397
            P    + L+      +VK+YD +  +L AL NS + V V +PN+++ + +SD + AD+WV
Sbjct  41   PPEKVVALLKSQGINKVKLYDTDATVLTALANSGISVVVALPNDLLSSAASDPSFADKWV  100

Query  398  ETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLA  577
            ++N+  ++ +T+I  + VGNE+  +P NTT F LVPA++ I+ S+ K+ L  IK+ +P+A
Sbjct  101  QSNISHYHPKTQIEAIAVGNEVFVDPNNTTQF-LVPAIKNIQSSLVKYNLSSIKLSSPIA  159

Query  578  MDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            +  L +SYPPS+GAF+ DL   V KPLL+FL +T+S+   + YP+F
Sbjct  160  LSSLNSSYPPSAGAFKPDLIEPVIKPLLEFLTQTSSYLMINAYPFF  205



>gb|AEN81800.1| AT3G07320-like protein, partial [Capsella rubella]
 gb|AEN81803.1| AT3G07320-like protein, partial [Capsella rubella]
Length=209

 Score =   141 bits (355),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +2

Query  407  VVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDM  586
            ++PFY  TKIRYLLVGNEILS+P +     LVPAMRKI+RS+K  G++K+KVGT LA+D+
Sbjct  1    ILPFYPTTKIRYLLVGNEILSSPDSELKASLVPAMRKIQRSLKSLGVKKVKVGTSLAVDV  60

Query  587  LEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            L+ S+PPS G FR D++G V KP+LQFL+RT SF F DVYPYF
Sbjct  61   LQTSFPPSKGEFREDISGLVMKPMLQFLNRTKSFLFVDVYPYF  103



>ref|XP_006452449.1| hypothetical protein CICLE_v10008176mg [Citrus clementina]
 gb|ESR65689.1| hypothetical protein CICLE_v10008176mg [Citrus clementina]
Length=473

 Score =   147 bits (370),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 105/162 (65%), Gaps = 2/162 (1%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            ++L+      RVK YD +  +L AL NSD+ V V  PNE +   ++DQ+  D WV+ N+ 
Sbjct  45   VELLKSQGIGRVKTYDTDSAVLAALANSDISVVVAFPNEELSKAAADQSFTDNWVQANIS  104

Query  413  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL-RKIKVGTPLAMDML  589
             +Y  TKI  + VGNE+ ++P NTT F LVPAM+ +  S+ K+ L   +KV +P+A+  L
Sbjct  105  KYYPATKIEAVAVGNEVFADPKNTTPF-LVPAMKNVYNSLVKYKLDSNVKVSSPIALGAL  163

Query  590  EASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            + SYPPSSG+F+SDL     KP+L+FL +T+S+   + YP+F
Sbjct  164  QNSYPPSSGSFKSDLIEPALKPMLEFLRKTSSYLMVNAYPFF  205



>ref|XP_006475009.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Citrus sinensis]
Length=472

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 105/162 (65%), Gaps = 2/162 (1%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            ++L+      RVK YD +  +L AL NSD+ V V  PNE +   ++DQ+  D WV+ N+ 
Sbjct  44   VELLKSQGIGRVKTYDTDSAVLAALANSDISVVVAFPNEELSKAAADQSFTDNWVQANIS  103

Query  413  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL-RKIKVGTPLAMDML  589
             +Y  TKI  + VGNE+ ++P NTT F LVPAM+ +  S+ K+ L   +KV +P+A+  L
Sbjct  104  KYYPATKIEAVAVGNEVFADPKNTTPF-LVPAMKNVYNSLVKYKLDSNVKVSSPIALGAL  162

Query  590  EASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            + SYPPSSG+F+SDL     KP+L+FL +T+S+   + YP+F
Sbjct  163  QNSYPPSSGSFKSDLIEPALKPMLEFLRKTSSYLMVNAYPFF  204



>gb|EYU33669.1| hypothetical protein MIMGU_mgv1a005896mg [Erythranthe guttata]
Length=466

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 106/152 (70%), Gaps = 3/152 (2%)
 Frame = +2

Query  263  RVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRY  442
            RVKI+D +  +L ALG S + V+V +PNE + + ++DQ+  D WV++N++P++  T +  
Sbjct  58   RVKIFDTDAAVLSALGGSGISVTVAMPNEQLSSAAADQSFTDTWVQSNILPYHPNTIVDA  117

Query  443  LLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRK-IKVGTPLAMDMLEASYPPSSGA  619
            + VGNE+ ++P NT +  LVPAM+ +  S+ K+ +   IKV +P+AM  L++SYPPSSG+
Sbjct  118  IAVGNEVFADPANTAF--LVPAMKNVYASLVKYDVASTIKVSSPVAMGALQSSYPPSSGS  175

Query  620  FRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            F  DL   V KP+L+FL +T SFF  +VYP+F
Sbjct  176  FEPDLVEPVMKPMLEFLQQTGSFFMANVYPFF  207



>ref|XP_010539314.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Tarenaya hassleriana]
Length=462

 Score =   145 bits (367),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 108/162 (67%), Gaps = 2/162 (1%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            ++L+      RVK+YD +  +L AL NS ++V V +PNE++ + ++DQ+ AD+WVE N+ 
Sbjct  44   VELLKTQGIHRVKLYDTDKTVLTALANSSIKVVVALPNELLSSAAADQSFADKWVEANIT  103

Query  413  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL-RKIKVGTPLAMDML  589
             +Y  T+I  + VGNE+  +P NTT F LV AM+ +  S+ K+ L R IKV +P+A+  L
Sbjct  104  KYYPSTEIEAIAVGNEVFVDPNNTTEF-LVQAMKNVHSSLVKYDLDRSIKVSSPIALSSL  162

Query  590  EASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
             +SYPPS+G+F+SDL   V KP+L    +T+S+   + YP+F
Sbjct  163  ASSYPPSAGSFKSDLVEPVIKPMLDLFRQTSSYLMVNAYPFF  204



>ref|XP_007215327.1| hypothetical protein PRUPE_ppa005206mg [Prunus persica]
 gb|EMJ16526.1| hypothetical protein PRUPE_ppa005206mg [Prunus persica]
Length=472

 Score =   145 bits (367),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 68/162 (42%), Positives = 111/162 (69%), Gaps = 2/162 (1%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            +QL+     +RVK++D++P +LRAL  S+++V+V VPNE++ +++  Q+ A  WV+ NVV
Sbjct  43   MQLLKSQGLERVKVFDSDPAVLRALAGSNIKVTVDVPNELLSSVAKSQSFATNWVQRNVV  102

Query  413  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRK-IKVGTPLAMDML  589
             ++  T+I  + VGNE+  +  NTT F L+PAM+ I  ++  F +   IKV +P+A+  L
Sbjct  103  AYHPNTQIEAIAVGNEVFVDTHNTTKF-LIPAMKNIHTALIHFDIHSAIKVSSPIALSAL  161

Query  590  EASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            + SYP S+G+FR +L  +VFKP+L+FL +T S+   + YPYF
Sbjct  162  QNSYPASAGSFRPELVETVFKPMLEFLRQTGSYLMVNAYPYF  203



>ref|XP_003581305.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brachypodium 
distachyon]
Length=473

 Score =   145 bits (367),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 72/169 (43%), Positives = 105/169 (62%), Gaps = 3/169 (2%)
 Frame = +2

Query  218  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWV  397
            P H  L+L     A  V+ YD+N  +L A  +S +     VPNE+IP++S+ +  AD WV
Sbjct  44   PPHVALELARSAGAAAVRFYDSNATLLAAASSSGLGFVPGVPNELIPSLSASRRAADAWV  103

Query  398  ETNVVPFYGETKIRYLLVGNEILSNPPNTT-WFQLVPAMRKIRRSVKKFGLRKIKVGTPL  574
             + ++PF    ++RYL VGNE+LS+P   + W QLVPAM  + R++++ GL ++KV T L
Sbjct  104  ASTLLPFRRNPRLRYLFVGNEVLSDPTTKSRWSQLVPAMANLHRALRRHGLGRVKVSTTL  163

Query  575  AMDML--EASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
             MD L  +  +PPS+G FR D+     +PLL FL+RT S+ F D Y YF
Sbjct  164  GMDALVGQNVFPPSAGVFRPDIVDVAVRPLLAFLERTESYLFVDTYTYF  212



>ref|XP_012080639.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Jatropha curcas]
 gb|KDP30806.1| hypothetical protein JCGZ_13749 [Jatropha curcas]
Length=469

 Score =   145 bits (366),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 111/162 (69%), Gaps = 2/162 (1%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            +QL+     +RVK++DA+P +L+AL  S ++V+V +PNE++ + +  Q+ A  WV+ N+ 
Sbjct  42   VQLLKSQGLQRVKVFDADPAVLKALSGSSIKVTVDLPNELLYSAAKRQSFALSWVQRNIA  101

Query  413  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRK-IKVGTPLAMDML  589
             +Y  T+I  + VGNE+  +P NTT F L+PAM+ I ++++K  L   IK+ +P+A+  L
Sbjct  102  AYYPSTQIEAIAVGNEVFVDPHNTTKF-LIPAMKNIHQALEKLNLHSDIKISSPIALSAL  160

Query  590  EASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            ++SYP S+GAFRS+L   VFKPLL FL +T S+   + YP+F
Sbjct  161  QSSYPSSAGAFRSELIEPVFKPLLDFLRQTGSYLMVNAYPFF  202



>ref|XP_008385844.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Malus domestica]
Length=454

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 108/158 (68%), Gaps = 3/158 (2%)
 Frame = +2

Query  242  IHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFY  421
            I G+   +VK+YD +  +L AL NS + V V +PNE++ + +SD + AD+WV++N+  ++
Sbjct  49   IQGIN--KVKLYDTDAAVLTALANSGIGVVVALPNELLSSAASDPSFADKWVQSNISQYH  106

Query  422  GETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASY  601
             +T+I  + VGNE+ ++P NTT F LVPA++ I+ S+ K+ L  IK+ +P A+  L +SY
Sbjct  107  PKTQIEAIAVGNEVFADPNNTTQF-LVPAIKNIQSSLVKYNLSSIKLSSPFALSALNSSY  165

Query  602  PPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            PPS+G F+ DL   V KPLL+ L +T+S+   + YP+F
Sbjct  166  PPSAGVFKPDLIEPVIKPLLEXLTQTSSYLMINAYPFF  203



>ref|XP_002274828.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Vitis vinifera]
Length=471

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/162 (41%), Positives = 111/162 (69%), Gaps = 2/162 (1%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            +QL+     +RVK++D +P +L+ALG S ++V+V +PNE++ + +  Q+ A+ WV+ NV 
Sbjct  42   VQLLKSQGIERVKVFDTDPAVLKALGESGIKVTVDLPNELLISAAKRQSFANTWVQKNVA  101

Query  413  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRK-IKVGTPLAMDML  589
             ++  TKI  + VGNE+  +P NTT   LVPA++ I +++ K+ L   IKV +P+A+  L
Sbjct  102  DYFPATKIEAIAVGNEVFVDPHNTT-LSLVPALKNIHKALVKYNLHSHIKVSSPVALSAL  160

Query  590  EASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            ++SYP S+G+FR +L   VFKP+L+FL +T S+   + YP+F
Sbjct  161  QSSYPSSAGSFRQELIEPVFKPMLEFLRQTGSYLMVNAYPFF  202



>ref|XP_010433433.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Camelina 
sativa]
Length=455

 Score =   143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 81/203 (40%), Positives = 119/203 (59%), Gaps = 11/203 (5%)
 Frame = +2

Query  137  YWPC----HLFPA-QISQLRSEYATVNW---ATTFPHHHDL-QLIHGLKAKRVKIYDANP  289
            + PC     LFP    +   S    VN+   A   P   ++  L+      R+KIYD + 
Sbjct  5    FLPCFLILCLFPTISFTHAESGMIGVNYGRIANNLPSPKNVVSLLKSQGISRIKIYDTDK  64

Query  290  KILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILS  469
             +L AL NS ++V V +PNE++ + SS+Q+ ADRW++TNV   +  T+I  + VGNE+  
Sbjct  65   NVLAALANSGIKVIVALPNELLSSASSNQSFADRWIQTNVASHFPATEIEAIAVGNEVFV  124

Query  470  NPPNTTWFQLVPAMRKIRRSVKKFGLRK-IKVGTPLAMDMLEASYPPSSGAFRSDLTGSV  646
            +P NTT + L PAM+ I  S+ K  L K IK+ +P+A+  L  SYPPSSG+F+ DL   V
Sbjct  125  DPKNTTPY-LDPAMKNIHTSLVKHNLDKAIKISSPVALSALANSYPPSSGSFKPDLIEPV  183

Query  647  FKPLLQFLDRTNSFFFFDVYPYF  715
             KP+L  L RT+S+   + YP+F
Sbjct  184  IKPMLDLLQRTSSYLMVNAYPFF  206



>ref|XP_006344866.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Solanum 
tuberosum]
Length=518

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/162 (42%), Positives = 108/162 (67%), Gaps = 2/162 (1%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            +QL+      RVK+YD +  +L AL  S++ V+V +PNE + + +S Q+  D WV++N++
Sbjct  87   VQLLKSQGINRVKLYDTDSAVLTALSGSNISVTVALPNEQLSDAASKQSFTDSWVQSNII  146

Query  413  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL-RKIKVGTPLAMDML  589
             +Y +T I  + VGNE+  +P NTT F LVPAM+ +  S+ K+G+   IKV +P+A+  L
Sbjct  147  RYYPKTNIESIAVGNEVFVDPKNTTKF-LVPAMKNVYASLVKYGVASSIKVSSPVALSAL  205

Query  590  EASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            + SYP SSG+F++DL   V KP+L FL ++ SF   ++YP+F
Sbjct  206  QNSYPSSSGSFKTDLIEPVIKPMLSFLKQSGSFLAVNIYPFF  247



>gb|AFU52656.1| beta-1,3-glucanase 23 [Solanum tuberosum]
Length=473

 Score =   143 bits (361),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 68/162 (42%), Positives = 108/162 (67%), Gaps = 2/162 (1%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            +QL+      RVK+YD +  +L AL  S++ V+V +PNE + + +S Q+  D WV++N++
Sbjct  43   VQLLKSQGINRVKLYDTDSAVLTALSGSNISVTVALPNEQLSDAASKQSFTDSWVQSNIL  102

Query  413  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL-RKIKVGTPLAMDML  589
             +Y +T I  + VGNE+  +P NTT F LVPAM+ +  S+ K+G+   IKV +P+A+  L
Sbjct  103  RYYPKTNIESIAVGNEVFVDPKNTTKF-LVPAMKNVYASLVKYGVASSIKVSSPVALSAL  161

Query  590  EASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            + SYP SSG+F++DL   V KP+L FL ++ SF   ++YP+F
Sbjct  162  QNSYPSSSGSFKTDLIEPVIKPMLSFLKQSGSFLAVNIYPFF  203



>ref|XP_006344865.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Solanum 
tuberosum]
Length=480

 Score =   143 bits (361),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 68/162 (42%), Positives = 108/162 (67%), Gaps = 2/162 (1%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            +QL+      RVK+YD +  +L AL  S++ V+V +PNE + + +S Q+  D WV++N++
Sbjct  43   VQLLKSQGINRVKLYDTDSAVLTALSGSNISVTVALPNEQLSDAASKQSFTDSWVQSNII  102

Query  413  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL-RKIKVGTPLAMDML  589
             +Y +T I  + VGNE+  +P NTT F LVPAM+ +  S+ K+G+   IKV +P+A+  L
Sbjct  103  RYYPKTNIESIAVGNEVFVDPNNTTKF-LVPAMKNVYASLVKYGVASSIKVSSPVALSAL  161

Query  590  EASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            + SYP SSG+F++DL   V KP+L FL ++ SF   ++YP+F
Sbjct  162  QNSYPSSSGSFKTDLIEPVIKPMLSFLKQSGSFLAVNIYPFF  203



>ref|XP_012070897.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Jatropha 
curcas]
Length=472

 Score =   143 bits (360),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 107/161 (66%), Gaps = 2/161 (1%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            ++L+      R K+YD +  +L AL NS + V V +PNE++ + ++DQ+ AD+WV+ N+ 
Sbjct  50   VELLKSQGINRAKLYDTDSTVLTALANSGISVVVALPNELLASTAADQSFADKWVQANIS  109

Query  413  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLE  592
             +Y +T+I  + VGNE+  +P NTT F LVPAM+ +  S+ KF    IK+ +P+A+  L+
Sbjct  110  QYYPQTQIEAIAVGNEVFVDPNNTTKF-LVPAMKNVYNSLVKFNHSSIKISSPIALSALQ  168

Query  593  ASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            +SYP S+G+F+ DL   V KP+L+FL ++ S+   + YP+F
Sbjct  169  SSYPSSAGSFKPDLV-PVMKPMLEFLRQSGSYLMINAYPFF  208



>gb|KDP39185.1| hypothetical protein JCGZ_00942 [Jatropha curcas]
Length=463

 Score =   143 bits (360),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 107/161 (66%), Gaps = 2/161 (1%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            ++L+      R K+YD +  +L AL NS + V V +PNE++ + ++DQ+ AD+WV+ N+ 
Sbjct  41   VELLKSQGINRAKLYDTDSTVLTALANSGISVVVALPNELLASTAADQSFADKWVQANIS  100

Query  413  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLE  592
             +Y +T+I  + VGNE+  +P NTT F LVPAM+ +  S+ KF    IK+ +P+A+  L+
Sbjct  101  QYYPQTQIEAIAVGNEVFVDPNNTTKF-LVPAMKNVYNSLVKFNHSSIKISSPIALSALQ  159

Query  593  ASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            +SYP S+G+F+ DL   V KP+L+FL ++ S+   + YP+F
Sbjct  160  SSYPSSAGSFKPDLV-PVMKPMLEFLRQSGSYLMINAYPFF  199



>ref|XP_010448205.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Camelina 
sativa]
Length=457

 Score =   142 bits (359),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 80/203 (39%), Positives = 120/203 (59%), Gaps = 11/203 (5%)
 Frame = +2

Query  137  YWPC----HLFPA-QISQLRSEYATVNW---ATTFPHHHDL-QLIHGLKAKRVKIYDANP  289
            + PC     LFP    +   S    VN+   A   P   ++  L+      R+KIYD + 
Sbjct  5    FLPCFLILCLFPTISFTHTESGMIGVNYGRIANNLPSPKNVVSLLKSQGINRIKIYDTDK  64

Query  290  KILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILS  469
            K+L AL N+ ++V V +PNE++ + SS+Q+ AD W++TNV   +  T+I  + VGNE+  
Sbjct  65   KVLTALANTGIKVIVALPNELLSSASSNQSFADHWIQTNVASHFPATEIEAIAVGNEVFV  124

Query  470  NPPNTTWFQLVPAMRKIRRSVKKFGLRK-IKVGTPLAMDMLEASYPPSSGAFRSDLTGSV  646
            +P NTT + LVPAM+ I  S+ K  L K IK+ +P+A+  L  SYPPSSG+F+ +L   V
Sbjct  125  DPKNTTPY-LVPAMKNIHTSLVKRNLDKAIKISSPVALSALANSYPPSSGSFKPELIEPV  183

Query  647  FKPLLQFLDRTNSFFFFDVYPYF  715
             KP+L  L RT+S+   + YP+F
Sbjct  184  IKPMLDLLQRTSSYLMVNAYPFF  206



>ref|XP_009771279.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like, partial 
[Nicotiana sylvestris]
Length=455

 Score =   142 bits (359),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 70/153 (46%), Positives = 104/153 (68%), Gaps = 2/153 (1%)
 Frame = +2

Query  260  KRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIR  439
            +RVK+YD +P +L+AL  S + V+V +PNE++ N +  Q+ A  WV+ NVV +Y  T+I 
Sbjct  37   ERVKVYDTDPAVLKALSGSGIMVTVNLPNELLYNAAKRQSFAYSWVQRNVVAYYPSTQIE  96

Query  440  YLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLR-KIKVGTPLAMDMLEASYPPSSG  616
             + VGNE+  +P NTT F LVPAM+ I  ++ K+ +  KIKV +P+A+  L+ SYP S+G
Sbjct  97   SIAVGNEVFVDPHNTTRF-LVPAMKNIHEALLKYNIHDKIKVSSPVALSALQNSYPSSAG  155

Query  617  AFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            +FRS+L   V KP+L FL +T SF   + YP+F
Sbjct  156  SFRSELVEPVIKPMLDFLRQTGSFLMVNCYPFF  188



>ref|XP_004251911.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Solanum 
lycopersicum]
Length=480

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/162 (42%), Positives = 108/162 (67%), Gaps = 2/162 (1%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            +QL+      RVK+YD +  +L AL  S++ VSV +PNE + + +S Q+  D WV++N+V
Sbjct  43   VQLLKSQGIHRVKLYDTDSAVLTALSGSNISVSVALPNEQLSDAASKQSFTDSWVQSNIV  102

Query  413  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL-RKIKVGTPLAMDML  589
             +Y +T I  + VGNE+  +P NTT F LVPAM+ +  S+ K+G+   IKV +P+A+  L
Sbjct  103  RYYPKTNIESIAVGNEVFVDPNNTTKF-LVPAMKNVYASLVKYGVASSIKVSSPVALSAL  161

Query  590  EASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            + SYP S+G+F+++L   V KP+L FL ++ SF   ++YP+F
Sbjct  162  QNSYPSSAGSFKTELIEPVIKPMLSFLKQSGSFLAVNIYPFF  203



>dbj|BAC53928.1| beta-1,3-glucanase-like protein [Nicotiana tabacum]
Length=358

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/167 (40%), Positives = 108/167 (65%), Gaps = 2/167 (1%)
 Frame = +2

Query  218  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWV  397
            P    +QL+      RVK+YD +  +L AL  S++ V+V +PNE + + +  Q+  D WV
Sbjct  37   PPAQVVQLLKTQGVNRVKLYDTDSNVLTALSGSNISVTVALPNEQLADAAGKQSFTDSWV  96

Query  398  ETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL-RKIKVGTPL  574
            ++N++ +Y +T+I  + VGNE+  +P NTT F LVPAM+ +  S+ K+G+ + IKV +P+
Sbjct  97   QSNILTYYPKTQIESIAVGNEVFVDPKNTTKF-LVPAMKNMYASLVKYGVAQSIKVSSPV  155

Query  575  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            A+  L  SYP S+G+F+ DL   V KP+L FL +T S+   ++YP+F
Sbjct  156  ALSALGNSYPSSAGSFKPDLVEPVIKPMLSFLKQTGSYLMVNIYPFF  202



>ref|XP_004294409.1| PREDICTED: glucan endo-1,3-beta-glucosidase 14-like [Fragaria 
vesca subsp. vesca]
Length=464

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/162 (41%), Positives = 107/162 (66%), Gaps = 2/162 (1%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            + L+       VK+YD +  +L AL +S++ V V +PNE++ + + DQ+ AD+WV+ N+ 
Sbjct  46   VDLLKSQGITNVKLYDTDAAVLTALADSNISVIVCLPNELLSSAAKDQSFADKWVQANIS  105

Query  413  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL-RKIKVGTPLAMDML  589
             +Y +T+I  + VGNE+L +  N T F LVPAM+ I  S+KK+ L   IK+ +P+++  L
Sbjct  106  HYYPKTQIEAIAVGNEVLDDKNNATDF-LVPAMKNIHASLKKYNLDSSIKLSSPISLTAL  164

Query  590  EASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            ++SYPPS+G+F+ DL   V KPLL FL +T S+   + YP+F
Sbjct  165  QSSYPPSAGSFKPDLVQPVIKPLLDFLQQTGSYLMVNAYPFF  206



>ref|XP_002463526.1| hypothetical protein SORBIDRAFT_01g001430 [Sorghum bicolor]
 gb|EER90524.1| hypothetical protein SORBIDRAFT_01g001430 [Sorghum bicolor]
Length=483

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/164 (46%), Positives = 104/164 (63%), Gaps = 3/164 (2%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            L+L     A  V+ YDAN  +L A   S ++    VPNE+IP++++ Q  AD WV T ++
Sbjct  56   LELARSAGASAVRFYDANATMLAAAAASGLEFVPSVPNELIPSLAASQRAADAWVATTLL  115

Query  413  PFYGETKIRYLLVGNEILSNP-PNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDML  589
            PF G  ++RYL VGNE+LS+P   + W +LVPAM  + R++ + GL  +KV T  +M  L
Sbjct  116  PFRGNPRLRYLFVGNEVLSDPTARSRWPRLVPAMANVHRALHRHGLGSVKVSTTFSMHEL  175

Query  590  EAS--YPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            E    +PPS+GAFR D+ G+V +PLL FLDRT S  F D Y YF
Sbjct  176  EGQNVFPPSAGAFRPDIAGAVVRPLLAFLDRTGSPLFVDAYTYF  219



>ref|XP_002278044.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Vitis vinifera]
 emb|CBI26687.3| unnamed protein product [Vitis vinifera]
Length=471

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/164 (41%), Positives = 112/164 (68%), Gaps = 5/164 (3%)
 Frame = +2

Query  236  QLIHGLKAK---RVKIYDANPKILRALGNSDVQVSVMVPNEIIPNIS-SDQALADRWVET  403
            Q++  LKA+   +VK++DA+  +L AL NS V V V +PNE++ + + +D + +++WV+T
Sbjct  40   QVVELLKAQGINKVKLFDADSTVLTALANSGVSVVVALPNELLSSAAATDGSFSEKWVQT  99

Query  404  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMD  583
            N+  ++  T+I  + VGNE+  +P NTT F LVPAM  + +S+ K  L  IK+ +P+A+ 
Sbjct  100  NIAQYHPSTQIEAIAVGNEVFVDPNNTTQF-LVPAMNNVYKSLVKHNLSSIKISSPVALS  158

Query  584  MLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
             L +SYPPS+G F+ +L  +V KP+L+FL +T+S+   + YP+F
Sbjct  159  ALNSSYPPSAGVFKPELIETVMKPMLEFLRKTSSYLMVNAYPFF  202



>ref|XP_003519593.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Glycine 
max]
Length=471

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/162 (40%), Positives = 105/162 (65%), Gaps = 2/162 (1%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            ++L+      RVK+YD +  +L A  NS ++V V +PNE++ N ++DQ+  D WV+ N+ 
Sbjct  49   VELLKAQGLNRVKLYDTDATVLTAFANSGIKVVVAMPNELLANAAADQSFTDAWVQANIS  108

Query  413  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRK-IKVGTPLAMDML  589
             +Y  T+I  + VGNE+  +P NTT F LVPAM+ +  S+ K+ L K IK+ +P+A+  L
Sbjct  109  TYYPATQIEAIAVGNEVFVDPNNTTKF-LVPAMKNVHASLTKYNLDKNIKISSPIALSAL  167

Query  590  EASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            + S+P SSG+F+++L   V KP+L  L +T S+   + YP+F
Sbjct  168  QNSFPASSGSFKTELVEPVIKPMLDLLRQTGSYLMVNAYPFF  209



>ref|XP_004243515.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Solanum lycopersicum]
Length=468

 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/162 (42%), Positives = 106/162 (65%), Gaps = 2/162 (1%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            + L+     +RVK+YD +P +L+AL  SD++V+V +PNE++ N +   + A  WVE NV 
Sbjct  45   IALLKSQGVERVKVYDTDPAVLKALSGSDIKVTVNLPNELLYNAAKRPSFAYSWVEKNVA  104

Query  413  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLR-KIKVGTPLAMDML  589
             +Y  T+I  + VGNE+  +P NTT F LV AM+ + +++ KF    KIK+ +P+A+  L
Sbjct  105  AYYPSTQIESIAVGNEVFVDPHNTTRF-LVSAMKNVHQALVKFNFHDKIKISSPVALSAL  163

Query  590  EASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            + SYP S+G+FRS+L   V KP+L FL +T S+   + YP+F
Sbjct  164  QNSYPSSAGSFRSELVEPVIKPMLDFLRQTGSYLMVNCYPFF  205



>ref|XP_006283767.1| hypothetical protein CARUB_v10004853mg [Capsella rubella]
 gb|EOA16665.1| hypothetical protein CARUB_v10004853mg [Capsella rubella]
Length=432

 Score =   140 bits (353),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 106/162 (65%), Gaps = 2/162 (1%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            + L+      R+KIYD +  +L AL NS ++V V +PNE++ + +S+Q+ AD WV+TNV 
Sbjct  20   VNLVKSQGISRIKIYDTDKNVLTALANSGIKVIVALPNELLFSAASNQSFADYWVQTNVT  79

Query  413  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRK-IKVGTPLAMDML  589
             ++  T+I  + VGNE+  +P NTT + LVPAM+ I  S+ K+ L K IK+ +P+A+  L
Sbjct  80   SYFPATEIEAIAVGNEVFVDPKNTTPY-LVPAMKNIHTSLVKYNLDKAIKISSPVALSAL  138

Query  590  EASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
              SYPPSSG+F+ DL   V +P+L  L  T+S+   + YP+F
Sbjct  139  ANSYPPSSGSFKPDLIEPVIRPMLDLLQHTSSYLMVNAYPFF  180



>ref|XP_009365112.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 isoform X2 [Pyrus 
x bretschneideri]
Length=471

 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/162 (42%), Positives = 108/162 (67%), Gaps = 2/162 (1%)
 Frame = +2

Query  233  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  412
            +QL+     +RVK++D++P +LRAL  SD++V+V +PNE++ + +  Q+ A  WV+ NVV
Sbjct  51   VQLLKSQGLERVKVFDSDPAVLRALAGSDIKVTVDLPNELLSSAAKSQSFATNWVQRNVV  110

Query  413  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLR-KIKVGTPLAMDML  589
             ++  T+I  + VGNE+  +  NTT F L+ AM+ I  ++  F L   IKV +P+A+  L
Sbjct  111  AYHPNTQIEAIGVGNEVFVDTHNTTKF-LISAMKNIHTALVHFNLESSIKVSSPIALSAL  169

Query  590  EASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            + SYP S+G+FR +L   VFKP+L+FL +T S+   + YPYF
Sbjct  170  QNSYPSSAGSFRPELVEPVFKPMLEFLRQTGSYLMVNCYPYF  211



>ref|XP_009794437.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Nicotiana 
sylvestris]
Length=475

 Score =   140 bits (354),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 67/167 (40%), Positives = 108/167 (65%), Gaps = 2/167 (1%)
 Frame = +2

Query  218  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWV  397
            P    +QL+      RVK+YD +  +L AL  S++ V+V +PNE + + +  Q+  D WV
Sbjct  37   PPAQVVQLLKTQGVNRVKLYDTDSNVLTALSGSNISVTVALPNEQLADAAGKQSFTDSWV  96

Query  398  ETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL-RKIKVGTPL  574
            ++N++ +Y +T+I  + VGNE+  +P NTT F LVPAM+ +  S+ K+G+ + IKV +P+
Sbjct  97   QSNILTYYPKTQIESIAVGNEVFVDPKNTTKF-LVPAMKNMYASLVKYGVAQSIKVSSPV  155

Query  575  AMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  715
            A+  L  SYP S+G+F+ DL   V KP+L FL +T S+   ++YP+F
Sbjct  156  ALSALGNSYPSSAGSFKPDLVEPVIKPMLSFLKQTGSYLMVNIYPFF  202



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1295251989378