BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig3068

Length=615
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011071001.1|  PREDICTED: probable methyltransferase PMT2         295   1e-92   Sesamum indicum [beniseed]
ref|XP_011075499.1|  PREDICTED: probable methyltransferase PMT2         293   3e-92   Sesamum indicum [beniseed]
gb|EYU28744.1|  hypothetical protein MIMGU_mgv1a003087mg                285   8e-89   Erythranthe guttata [common monkey flower]
emb|CDP00327.1|  unnamed protein product                                284   2e-88   Coffea canephora [robusta coffee]
ref|XP_009626042.1|  PREDICTED: probable methyltransferase PMT2         284   2e-88   Nicotiana tomentosiformis
ref|XP_009793104.1|  PREDICTED: probable methyltransferase PMT2         283   3e-88   Nicotiana sylvestris
ref|XP_009761475.1|  PREDICTED: probable methyltransferase PMT2         281   2e-87   Nicotiana sylvestris
ref|XP_008221626.1|  PREDICTED: probable methyltransferase PMT2         281   3e-87   Prunus mume [ume]
ref|XP_007222021.1|  hypothetical protein PRUPE_ppa002971mg             280   3e-87   Prunus persica
ref|XP_009624681.1|  PREDICTED: probable methyltransferase PMT2         280   4e-87   Nicotiana tomentosiformis
gb|EYU22422.1|  hypothetical protein MIMGU_mgv1a003056mg                277   9e-87   Erythranthe guttata [common monkey flower]
ref|XP_006438677.1|  hypothetical protein CICLE_v10030989mg             279   1e-86   Citrus clementina [clementine]
ref|XP_010089758.1|  putative methyltransferase PMT2                    277   6e-86   Morus notabilis
ref|XP_006366703.1|  PREDICTED: probable methyltransferase PMT2-l...    277   7e-86   Solanum tuberosum [potatoes]
gb|EYU22421.1|  hypothetical protein MIMGU_mgv1a003056mg                276   1e-85   Erythranthe guttata [common monkey flower]
ref|XP_012067633.1|  PREDICTED: probable methyltransferase PMT2 i...    275   6e-85   Jatropha curcas
ref|XP_012067632.1|  PREDICTED: probable methyltransferase PMT2 i...    275   7e-85   Jatropha curcas
ref|XP_002522425.1|  ATP binding protein, putative                      273   2e-84   
gb|ABO92980.1|  putative methyltransferase                              272   6e-84   Solanum tuberosum [potatoes]
ref|XP_004238796.1|  PREDICTED: probable methyltransferase PMT2         271   2e-83   Solanum lycopersicum
gb|AAT38682.2|  Methyltransferase family protein, putative              271   5e-83   Solanum demissum
ref|XP_006366112.1|  PREDICTED: probable methyltransferase PMT2-l...    269   8e-83   Solanum tuberosum [potatoes]
ref|XP_010258374.1|  PREDICTED: probable methyltransferase PMT2         269   9e-83   Nelumbo nucifera [Indian lotus]
gb|KJB60758.1|  hypothetical protein B456_009G324300                    263   9e-83   Gossypium raimondii
gb|AAT38756.2|  Putative methyltransferase family protein               273   1e-82   Solanum demissum
gb|KJB80180.1|  hypothetical protein B456_013G084900                    268   2e-82   Gossypium raimondii
ref|XP_007046111.1|  S-adenosyl-L-methionine-dependent methyltran...    268   2e-82   
gb|KHG10506.1|  hypothetical protein F383_11349                         268   2e-82   Gossypium arboreum [tree cotton]
ref|XP_004297305.1|  PREDICTED: probable methyltransferase PMT2         267   3e-82   Fragaria vesca subsp. vesca
gb|AAT39937.2|  Putative methyltransferase family protein               271   3e-82   Solanum demissum
ref|XP_007153607.1|  hypothetical protein PHAVU_003G049900g             266   7e-82   Phaseolus vulgaris [French bean]
ref|XP_010527898.1|  PREDICTED: probable methyltransferase PMT2         266   8e-82   Tarenaya hassleriana [spider flower]
gb|AAU90305.2|  Methyltransferase, putative                             269   9e-82   Solanum tuberosum [potatoes]
gb|KJB60755.1|  hypothetical protein B456_009G324300                    264   9e-82   Gossypium raimondii
ref|NP_001280936.1|  uncharacterized protein LOC103402903               266   1e-81   Malus domestica [apple tree]
gb|KJB60756.1|  hypothetical protein B456_009G324300                    263   2e-81   Gossypium raimondii
ref|XP_010257294.1|  PREDICTED: probable methyltransferase PMT2         265   2e-81   Nelumbo nucifera [Indian lotus]
ref|XP_006586024.1|  PREDICTED: probable methyltransferase PMT2-l...    263   4e-81   
gb|KDO76124.1|  hypothetical protein CISIN_1g0367251mg                  255   4e-81   Citrus sinensis [apfelsine]
ref|XP_004228376.1|  PREDICTED: probable methyltransferase PMT2         265   5e-81   Solanum lycopersicum
gb|KJB60757.1|  hypothetical protein B456_009G324300                    265   5e-81   Gossypium raimondii
ref|XP_006602298.1|  PREDICTED: probable methyltransferase PMT2-like    264   6e-81   Glycine max [soybeans]
gb|KHN17371.1|  Putative methyltransferase PMT2                         264   7e-81   Glycine soja [wild soybean]
gb|ACJ85858.1|  unknown                                                 264   9e-81   Medicago truncatula
ref|XP_003628357.1|  hypothetical protein MTR_8g055840                  264   9e-81   Medicago truncatula
ref|XP_008339908.1|  PREDICTED: probable methyltransferase PMT2         263   1e-80   
ref|XP_003532062.1|  PREDICTED: probable methyltransferase PMT2-l...    263   1e-80   Glycine max [soybeans]
ref|XP_004511207.1|  PREDICTED: probable methyltransferase PMT2-l...    263   2e-80   Cicer arietinum [garbanzo]
ref|XP_002273644.1|  PREDICTED: probable methyltransferase PMT2         262   5e-80   Vitis vinifera
gb|KHG23981.1|  hypothetical protein F383_09020                         261   7e-80   Gossypium arboreum [tree cotton]
ref|XP_010552579.1|  PREDICTED: probable methyltransferase PMT2         261   8e-80   Tarenaya hassleriana [spider flower]
ref|XP_010532828.1|  PREDICTED: probable methyltransferase PMT2         260   2e-79   Tarenaya hassleriana [spider flower]
ref|XP_003518725.1|  PREDICTED: probable methyltransferase PMT2-like    259   4e-79   Glycine max [soybeans]
ref|XP_003517972.1|  PREDICTED: probable methyltransferase PMT2-like    259   4e-79   Glycine max [soybeans]
ref|XP_008441700.1|  PREDICTED: probable methyltransferase PMT2         259   6e-79   Cucumis melo [Oriental melon]
ref|XP_006415973.1|  hypothetical protein EUTSA_v10007096mg             259   6e-79   Eutrema salsugineum [saltwater cress]
ref|NP_849711.1|  putative methyltransferase PMT2                       256   7e-79   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011015217.1|  PREDICTED: probable methyltransferase PMT2         259   8e-79   Populus euphratica
ref|XP_011021619.1|  PREDICTED: probable methyltransferase PMT2         259   8e-79   Populus euphratica
ref|XP_007157631.1|  hypothetical protein PHAVU_002G085900g             258   1e-78   Phaseolus vulgaris [French bean]
ref|XP_004490044.1|  PREDICTED: probable methyltransferase PMT2-l...    258   1e-78   Cicer arietinum [garbanzo]
ref|XP_002315803.2|  hypothetical protein POPTR_0010s10420g             258   2e-78   Populus trichocarpa [western balsam poplar]
ref|XP_006303579.1|  hypothetical protein CARUB_v10011097mg             258   2e-78   Capsella rubella
ref|XP_010460256.1|  PREDICTED: probable methyltransferase PMT2         258   2e-78   Camelina sativa [gold-of-pleasure]
ref|XP_006439601.1|  hypothetical protein CICLE_v10019341mg             256   2e-78   
ref|XP_004138921.1|  PREDICTED: probable methyltransferase PMT2         258   2e-78   Cucumis sativus [cucumbers]
ref|XP_002311593.1|  hypothetical protein POPTR_0008s14720g             258   2e-78   Populus trichocarpa [western balsam poplar]
ref|XP_010498988.1|  PREDICTED: probable methyltransferase PMT2         258   2e-78   Camelina sativa [gold-of-pleasure]
gb|AAD14491.1|  Unknown protein                                         256   3e-78   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH19504.1|  AT1G26850                                              257   3e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002893375.1|  dehydration-responsive family protein              257   3e-78   
ref|XP_011027055.1|  PREDICTED: probable methyltransferase PMT2         257   3e-78   Populus euphratica
ref|XP_011025778.1|  PREDICTED: probable methyltransferase PMT2         257   3e-78   Populus euphratica
ref|XP_006476610.1|  PREDICTED: probable methyltransferase PMT2-l...    257   4e-78   Citrus sinensis [apfelsine]
ref|XP_008389474.1|  PREDICTED: probable methyltransferase PMT2         256   4e-78   Malus domestica [apple tree]
ref|XP_006439600.1|  hypothetical protein CICLE_v10019341mg             256   5e-78   Citrus clementina [clementine]
ref|NP_564265.1|  putative methyltransferase PMT2                       256   6e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003613748.1|  hypothetical protein MTR_5g040360                  255   2e-77   Medicago truncatula
ref|XP_009360348.1|  PREDICTED: probable methyltransferase PMT2         255   2e-77   Pyrus x bretschneideri [bai li]
ref|XP_008239959.1|  PREDICTED: probable methyltransferase PMT2         254   5e-77   Prunus mume [ume]
gb|EPS59468.1|  hypothetical protein M569_15338                         253   1e-76   Genlisea aurea
ref|XP_009103114.1|  PREDICTED: probable methyltransferase PMT2         252   2e-76   Brassica rapa
ref|XP_009782774.1|  PREDICTED: probable methyltransferase PMT2         252   2e-76   Nicotiana sylvestris
ref|XP_009115418.1|  PREDICTED: probable methyltransferase PMT2         251   4e-76   Brassica rapa
emb|CDY16198.1|  BnaA09g29320D                                          251   5e-76   Brassica napus [oilseed rape]
ref|XP_007210881.1|  hypothetical protein PRUPE_ppa003018mg             251   6e-76   Prunus persica
gb|EPS60507.1|  hypothetical protein M569_14296                         250   1e-75   Genlisea aurea
ref|XP_010551538.1|  PREDICTED: probable methyltransferase PMT2 i...    249   2e-75   Tarenaya hassleriana [spider flower]
ref|XP_009591906.1|  PREDICTED: probable methyltransferase PMT2         249   3e-75   Nicotiana tomentosiformis
ref|XP_010551537.1|  PREDICTED: probable methyltransferase PMT2 i...    249   3e-75   Tarenaya hassleriana [spider flower]
emb|CDY40268.1|  BnaA07g09320D                                          248   5e-75   Brassica napus [oilseed rape]
ref|XP_010683197.1|  PREDICTED: probable methyltransferase PMT2         247   1e-74   
ref|XP_007037318.1|  S-adenosyl-L-methionine-dependent methyltran...    246   3e-74   
ref|XP_010937119.1|  PREDICTED: probable methyltransferase PMT2 i...    246   5e-74   Elaeis guineensis
ref|XP_010937120.1|  PREDICTED: probable methyltransferase PMT2 i...    246   5e-74   
ref|XP_009390921.1|  PREDICTED: probable methyltransferase PMT2         245   1e-73   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008356626.1|  PREDICTED: probable methyltransferase PMT2         244   2e-73   
ref|XP_008351840.1|  PREDICTED: probable methyltransferase PMT2         233   2e-73   
ref|XP_009380165.1|  PREDICTED: probable methyltransferase PMT2         244   3e-73   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009369302.1|  PREDICTED: probable methyltransferase PMT2         243   5e-73   Pyrus x bretschneideri [bai li]
ref|XP_002511570.1|  ATP binding protein, putative                      243   8e-73   Ricinus communis
ref|XP_008781841.1|  PREDICTED: probable methyltransferase PMT2         243   1e-72   Phoenix dactylifera
ref|XP_009772034.1|  PREDICTED: probable methyltransferase PMT2         243   1e-72   Nicotiana sylvestris
ref|XP_006354784.1|  PREDICTED: probable methyltransferase PMT2-like    242   1e-72   Solanum tuberosum [potatoes]
ref|XP_009595709.1|  PREDICTED: probable methyltransferase PMT2         242   2e-72   Nicotiana tomentosiformis
ref|XP_010275323.1|  PREDICTED: probable methyltransferase PMT14        241   4e-72   Nelumbo nucifera [Indian lotus]
ref|XP_002275852.1|  PREDICTED: probable methyltransferase PMT2         241   6e-72   Vitis vinifera
emb|CAN60192.1|  hypothetical protein VITISV_038569                     240   7e-72   Vitis vinifera
ref|XP_004299370.1|  PREDICTED: probable methyltransferase PMT2         240   7e-72   Fragaria vesca subsp. vesca
ref|XP_010919849.1|  PREDICTED: probable methyltransferase PMT2         240   7e-72   
ref|XP_006364604.1|  PREDICTED: probable methyltransferase PMT2-like    239   1e-71   Solanum tuberosum [potatoes]
ref|XP_012080258.1|  PREDICTED: probable methyltransferase PMT2 i...    239   1e-71   
ref|XP_010066916.1|  PREDICTED: probable methyltransferase PMT2         239   2e-71   Eucalyptus grandis [rose gum]
ref|XP_012080255.1|  PREDICTED: probable methyltransferase PMT2 i...    239   2e-71   Jatropha curcas
emb|CDY45006.1|  BnaCnng12360D                                          238   4e-71   Brassica napus [oilseed rape]
ref|XP_006660624.1|  PREDICTED: probable methyltransferase PMT2-like    238   4e-71   Oryza brachyantha
gb|EPS64080.1|  hypothetical protein M569_10695                         237   1e-70   Genlisea aurea
emb|CDY46435.1|  BnaA08g19950D                                          236   2e-70   Brassica napus [oilseed rape]
ref|XP_006827213.1|  PREDICTED: probable methyltransferase PMT2         237   2e-70   
ref|XP_004241578.1|  PREDICTED: probable methyltransferase PMT2         236   2e-70   Solanum lycopersicum
gb|KHN12213.1|  Putative methyltransferase PMT2                         235   3e-70   Glycine soja [wild soybean]
ref|XP_004956815.1|  PREDICTED: probable methyltransferase PMT2-l...    236   4e-70   Setaria italica
ref|XP_004235979.1|  PREDICTED: probable methyltransferase PMT2         235   5e-70   Solanum lycopersicum
ref|NP_001146334.1|  uncharacterized protein LOC100279910               228   8e-70   
ref|XP_009110047.1|  PREDICTED: probable methyltransferase PMT2         235   9e-70   Brassica rapa
ref|XP_002282093.2|  PREDICTED: probable methyltransferase PMT14        234   1e-69   Vitis vinifera
ref|XP_008393149.1|  PREDICTED: probable methyltransferase PMT2         234   1e-69   
gb|EMS49438.1|  putative methyltransferase PMT2                         234   1e-69   Triticum urartu
ref|XP_009413462.1|  PREDICTED: probable methyltransferase PMT2         234   2e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003578117.1|  PREDICTED: probable methyltransferase PMT2         234   2e-69   Brachypodium distachyon [annual false brome]
gb|EMT27426.1|  hypothetical protein F775_29617                         233   4e-69   
ref|XP_010917038.1|  PREDICTED: probable methyltransferase PMT2         233   5e-69   Elaeis guineensis
ref|XP_004499421.1|  PREDICTED: probable methyltransferase PMT2-l...    232   1e-68   Cicer arietinum [garbanzo]
gb|KHN21848.1|  Putative methyltransferase PMT2                         231   2e-68   Glycine soja [wild soybean]
ref|XP_003523024.1|  PREDICTED: probable methyltransferase PMT2-l...    231   2e-68   Glycine max [soybeans]
ref|XP_008784684.1|  PREDICTED: probable methyltransferase PMT2         231   3e-68   Phoenix dactylifera
ref|XP_010091504.1|  putative methyltransferase PMT2                    230   7e-68   Morus notabilis
ref|XP_008651354.1|  PREDICTED: uncharacterized protein LOC100279...    230   7e-68   
ref|NP_001152470.1|  ankyrin protein kinase-like                        230   8e-68   
gb|KEH33485.1|  methyltransferase PMT2-like protein                     229   8e-68   Medicago truncatula
gb|KJB08228.1|  hypothetical protein B456_001G071800                    229   1e-67   Gossypium raimondii
ref|NP_001063174.1|  Os09g0415700                                       229   1e-67   
emb|CDP12320.1|  unnamed protein product                                233   3e-67   Coffea canephora [robusta coffee]
gb|KJB08229.1|  hypothetical protein B456_001G071800                    229   3e-67   Gossypium raimondii
gb|EAZ09099.1|  hypothetical protein OsI_31366                          227   9e-67   Oryza sativa Indica Group [Indian rice]
ref|XP_010668105.1|  PREDICTED: probable methyltransferase PMT2         226   1e-66   Beta vulgaris subsp. vulgaris [field beet]
emb|CDP12957.1|  unnamed protein product                                226   2e-66   Coffea canephora [robusta coffee]
ref|XP_004986789.1|  PREDICTED: probable methyltransferase PMT2-like    226   2e-66   
ref|XP_008229546.1|  PREDICTED: probable methyltransferase PMT14        226   2e-66   Prunus mume [ume]
ref|XP_008373611.1|  PREDICTED: probable methyltransferase PMT14        220   3e-66   
ref|NP_001065447.2|  Os10g0569300                                       225   3e-66   
ref|XP_006662085.1|  PREDICTED: probable methyltransferase PMT2-like    225   3e-66   Oryza brachyantha
ref|XP_008362975.1|  PREDICTED: probable methyltransferase PMT14        224   4e-66   
ref|XP_007138189.1|  hypothetical protein PHAVU_009G187900g             225   4e-66   Phaseolus vulgaris [French bean]
ref|XP_006368452.1|  hypothetical protein POPTR_0001s02930g             225   4e-66   
ref|XP_002317981.2|  hypothetical protein POPTR_0012s07080g             225   5e-66   
ref|XP_002460211.1|  hypothetical protein SORBIDRAFT_02g024670          225   5e-66   Sorghum bicolor [broomcorn]
ref|XP_003574364.1|  PREDICTED: probable methyltransferase PMT2         224   6e-66   Brachypodium distachyon [annual false brome]
ref|XP_007039581.1|  S-adenosyl-L-methionine-dependent methyltran...    224   6e-66   
ref|XP_009371899.1|  PREDICTED: probable methyltransferase PMT14 ...    224   2e-65   Pyrus x bretschneideri [bai li]
ref|XP_009371893.1|  PREDICTED: probable methyltransferase PMT14 ...    224   2e-65   
ref|XP_010029626.1|  PREDICTED: probable methyltransferase PMT2 i...    222   2e-65   Eucalyptus grandis [rose gum]
ref|XP_006385609.1|  hypothetical protein POPTR_0003s08590g             223   3e-65   Populus trichocarpa [western balsam poplar]
gb|KJB51712.1|  hypothetical protein B456_008G228900                    221   3e-65   Gossypium raimondii
ref|XP_010029610.1|  PREDICTED: probable methyltransferase PMT2 i...    223   4e-65   Eucalyptus grandis [rose gum]
ref|XP_002528760.1|  ATP binding protein, putative                      222   6e-65   Ricinus communis
ref|XP_009393699.1|  PREDICTED: probable methyltransferase PMT2 i...    222   7e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009393700.1|  PREDICTED: probable methyltransferase PMT2 i...    222   7e-65   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB51709.1|  hypothetical protein B456_008G228900                    221   1e-64   Gossypium raimondii
gb|KHG27439.1|  hypothetical protein F383_15139                         221   2e-64   Gossypium arboreum [tree cotton]
dbj|BAJ85549.1|  predicted protein                                      221   3e-64   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008658538.1|  PREDICTED: probable methyltransferase PMT2         220   3e-64   Zea mays [maize]
ref|XP_011018634.1|  PREDICTED: probable methyltransferase PMT14 ...    218   3e-64   Populus euphratica
ref|XP_004508998.1|  PREDICTED: probable methyltransferase PMT14-...    220   3e-64   Cicer arietinum [garbanzo]
emb|CAH18000.1|  Ankyrin protein kinase-like                            219   6e-64   Poa pratensis
gb|KDO43765.1|  hypothetical protein CISIN_1g038698mg                   211   7e-64   Citrus sinensis [apfelsine]
ref|XP_011018632.1|  PREDICTED: probable methyltransferase PMT14 ...    218   1e-63   Populus euphratica
ref|XP_003524439.1|  PREDICTED: probable methyltransferase PMT14-...    218   2e-63   Glycine max [soybeans]
ref|XP_007210880.1|  hypothetical protein PRUPE_ppa003016mg             218   2e-63   Prunus persica
ref|XP_010110495.1|  putative methyltransferase PMT14                   218   3e-63   Morus notabilis
ref|XP_007155749.1|  hypothetical protein PHAVU_003G228500g             217   4e-63   Phaseolus vulgaris [French bean]
ref|XP_011013091.1|  PREDICTED: probable methyltransferase PMT2         217   4e-63   Populus euphratica
ref|XP_008448741.1|  PREDICTED: probable methyltransferase PMT14        217   5e-63   Cucumis melo [Oriental melon]
ref|XP_004300275.1|  PREDICTED: probable methyltransferase PMT14        216   9e-63   Fragaria vesca subsp. vesca
ref|XP_012089660.1|  PREDICTED: probable methyltransferase PMT14        216   1e-62   Jatropha curcas
gb|ACU17089.1|  unknown                                                 205   2e-62   Glycine max [soybeans]
gb|ACB54686.1|  methyltransferase                                       214   9e-62   Nicotiana benthamiana
ref|XP_009587333.1|  PREDICTED: probable methyltransferase PMT14        214   9e-62   Nicotiana tomentosiformis
ref|XP_011032031.1|  PREDICTED: probable methyltransferase PMT14        213   1e-61   Populus euphratica
gb|EAZ17038.1|  hypothetical protein OsJ_32528                          213   1e-61   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004150171.1|  PREDICTED: probable methyltransferase PMT14        213   1e-61   Cucumis sativus [cucumbers]
ref|XP_009793368.1|  PREDICTED: probable methyltransferase PMT14        213   3e-61   Nicotiana sylvestris
gb|KCW77891.1|  hypothetical protein EUGRSUZ_D02155                     211   3e-61   Eucalyptus grandis [rose gum]
gb|EAY79581.1|  hypothetical protein OsI_34717                          211   4e-61   Oryza sativa Indica Group [Indian rice]
ref|NP_001050233.1|  Os03g0379100                                       212   4e-61   
ref|XP_006436790.1|  hypothetical protein CICLE_v10030990mg             212   4e-61   Citrus clementina [clementine]
ref|XP_006650137.1|  PREDICTED: probable methyltransferase PMT2-like    211   9e-61   Oryza brachyantha
ref|XP_010053567.1|  PREDICTED: probable methyltransferase PMT14        211   1e-60   Eucalyptus grandis [rose gum]
gb|ACA66248.1|  putative methyltransferase                              210   1e-60   Nicotiana benthamiana
gb|EMT05545.1|  hypothetical protein F775_20122                         209   6e-60   
gb|EYU33038.1|  hypothetical protein MIMGU_mgv1a004747mg                206   7e-60   Erythranthe guttata [common monkey flower]
ref|XP_010449513.1|  PREDICTED: probable methyltransferase PMT14        208   1e-59   
ref|XP_010439911.1|  PREDICTED: probable methyltransferase PMT14        207   2e-59   Camelina sativa [gold-of-pleasure]
ref|XP_003557818.1|  PREDICTED: probable methyltransferase PMT2         207   2e-59   Brachypodium distachyon [annual false brome]
ref|XP_010434585.1|  PREDICTED: probable methyltransferase PMT14        207   3e-59   
ref|XP_006414159.1|  hypothetical protein EUTSA_v10024685mg             206   6e-59   Eutrema salsugineum [saltwater cress]
ref|XP_006600888.1|  PREDICTED: probable methyltransferase PMT14 ...    206   7e-59   Glycine max [soybeans]
ref|NP_193537.2|  putative methyltransferase PMT14                      206   8e-59   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH19630.1|  AT4G18030                                              206   8e-59   Arabidopsis thaliana [mouse-ear cress]
emb|CAA17146.1|  putative protein                                       206   8e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002868016.1|  dehydration-responsive family protein              206   9e-59   
ref|XP_010695192.1|  PREDICTED: probable methyltransferase PMT14        206   9e-59   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010559283.1|  PREDICTED: probable methyltransferase PMT14        205   2e-58   Tarenaya hassleriana [spider flower]
ref|XP_010529126.1|  PREDICTED: probable methyltransferase PMT14        204   4e-58   Tarenaya hassleriana [spider flower]
ref|XP_006283339.1|  hypothetical protein CARUB_v10004377mg             204   5e-58   
ref|XP_004245869.1|  PREDICTED: probable methyltransferase PMT14        203   7e-58   Solanum lycopersicum
ref|XP_009131372.1|  PREDICTED: probable methyltransferase PMT14        203   8e-58   Brassica rapa
emb|CDX78823.1|  BnaA01g08900D                                          203   9e-58   
ref|XP_006358580.1|  PREDICTED: probable methyltransferase PMT14-...    201   4e-57   Solanum tuberosum [potatoes]
gb|KEH31563.1|  methyltransferase PMT14-like protein, putative          206   7e-57   Medicago truncatula
ref|XP_004984213.1|  PREDICTED: probable methyltransferase PMT2-l...    200   1e-56   Setaria italica
ref|XP_004984212.1|  PREDICTED: probable methyltransferase PMT2-l...    200   1e-56   
ref|XP_008659999.1|  PREDICTED: probable methyltransferase PMT2 i...    199   2e-56   
gb|AFW87980.1|  hypothetical protein ZEAMMB73_653302                    199   2e-56   
ref|XP_002467784.1|  hypothetical protein SORBIDRAFT_01g034010          197   8e-56   Sorghum bicolor [broomcorn]
ref|XP_008656343.1|  PREDICTED: probable methyltransferase PMT2         197   1e-55   
ref|XP_006280182.1|  hypothetical protein CARUB_v10026086mg             194   1e-54   
ref|XP_010481446.1|  PREDICTED: probable methyltransferase PMT14        191   3e-53   Camelina sativa [gold-of-pleasure]
ref|XP_008229550.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    187   1e-52   
ref|XP_010494834.1|  PREDICTED: probable methyltransferase PMT14        187   5e-52   
gb|AAL86466.1|AC077693_5  hypothetical protein                          188   6e-52   Oryza sativa Japonica Group [Japonica rice]
gb|EEC68449.1|  hypothetical protein OsI_36659                          183   1e-50   Oryza sativa Indica Group [Indian rice]
ref|XP_009114343.1|  PREDICTED: probable methyltransferase PMT14        183   2e-50   Brassica rapa
ref|NP_001068227.1|  Os11g0601600                                       182   4e-50   
emb|CDY35169.1|  BnaA09g18060D                                          181   2e-49   Brassica napus [oilseed rape]
ref|XP_002449806.1|  hypothetical protein SORBIDRAFT_05g023610          179   3e-49   
emb|CDY03207.1|  BnaC09g19490D                                          179   4e-49   
ref|XP_004979626.1|  PREDICTED: probable methyltransferase PMT2-like    179   4e-49   Setaria italica
tpg|DAA42264.1|  TPA: methyltransferase isoform 1                       178   2e-48   
ref|XP_008668148.1|  PREDICTED: methyltransferase isoform X1            177   3e-48   
ref|NP_001152056.1|  methyltransferase                                  173   6e-47   Zea mays [maize]
gb|KHN30834.1|  Putative methyltransferase PMT2                         167   4e-45   Glycine soja [wild soybean]
gb|KHN29896.1|  Putative methyltransferase PMT2                         160   4e-44   Glycine soja [wild soybean]
tpg|DAA45571.1|  TPA: hypothetical protein ZEAMMB73_269534              157   3e-41   
gb|EYU35839.1|  hypothetical protein MIMGU_mgv1a0064512mg               154   4e-41   Erythranthe guttata [common monkey flower]
gb|KHN21029.1|  Putative methyltransferase PMT14                        153   1e-39   Glycine soja [wild soybean]
ref|XP_001760613.1|  predicted protein                                  141   2e-35   
gb|EAY81488.1|  hypothetical protein OsI_36661                          140   3e-35   Oryza sativa Indica Group [Indian rice]
ref|XP_001778231.1|  predicted protein                                  136   8e-34   
gb|AFK36214.1|  unknown                                                 126   1e-33   Lotus japonicus
ref|XP_001782639.1|  predicted protein                                  134   5e-33   
gb|ABR16582.1|  unknown                                                 130   3e-31   Picea sitchensis
ref|XP_001779831.1|  predicted protein                                  128   1e-30   
ref|XP_002975160.1|  hypothetical protein SELMODRAFT_232460             126   5e-30   
ref|XP_008799521.1|  PREDICTED: probable methyltransferase PMT15        125   1e-29   Phoenix dactylifera
ref|XP_002977565.1|  hypothetical protein SELMODRAFT_443549             125   1e-29   
tpg|DAA46388.1|  TPA: hypothetical protein ZEAMMB73_857191              125   1e-29   
ref|XP_011016489.1|  PREDICTED: probable methyltransferase PMT17        122   3e-29   Populus euphratica
ref|XP_004964271.1|  PREDICTED: probable methyltransferase PMT17-...    124   3e-29   Setaria italica
ref|XP_002437666.1|  hypothetical protein SORBIDRAFT_10g000440          124   4e-29   Sorghum bicolor [broomcorn]
ref|XP_009384529.1|  PREDICTED: probable methyltransferase PMT15        123   8e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011004387.1|  PREDICTED: probable methyltransferase PMT18        123   8e-29   Populus euphratica
ref|XP_008796868.1|  PREDICTED: probable methyltransferase PMT17        123   9e-29   Phoenix dactylifera
ref|XP_007220534.1|  hypothetical protein PRUPE_ppa002801mg             122   1e-28   Prunus persica
gb|EYU33422.1|  hypothetical protein MIMGU_mgv1a002913mg                122   1e-28   Erythranthe guttata [common monkey flower]
ref|XP_002317647.1|  dehydration-responsive family protein              122   2e-28   Populus trichocarpa [western balsam poplar]
ref|XP_006846537.2|  PREDICTED: probable methyltransferase PMT17 ...    122   2e-28   Amborella trichopoda
ref|XP_011624208.1|  PREDICTED: probable methyltransferase PMT17 ...    122   2e-28   Amborella trichopoda
gb|EPS68701.1|  hypothetical protein M569_06064                         121   3e-28   Genlisea aurea
gb|EEE52366.1|  hypothetical protein OsJ_34430                          121   3e-28   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001147806.1|  methyltransferase                                  121   3e-28   Zea mays [maize]
ref|XP_006857883.1|  PREDICTED: probable methyltransferase PMT16        121   4e-28   Amborella trichopoda
ref|XP_009405347.1|  PREDICTED: probable methyltransferase PMT17 ...    120   5e-28   
ref|XP_008232735.1|  PREDICTED: probable methyltransferase PMT15        120   8e-28   Prunus mume [ume]
ref|XP_009405306.1|  PREDICTED: probable methyltransferase PMT17 ...    120   9e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009405339.1|  PREDICTED: probable methyltransferase PMT17 ...    120   9e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004145886.1|  PREDICTED: probable methyltransferase PMT18        119   2e-27   Cucumis sativus [cucumbers]
ref|XP_010419631.1|  PREDICTED: probable methyltransferase PMT15        119   2e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010456248.1|  PREDICTED: probable methyltransferase PMT15        119   2e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010427380.1|  PREDICTED: probable methyltransferase PMT15        119   3e-27   
ref|XP_008437487.1|  PREDICTED: probable methyltransferase PMT18        118   4e-27   
gb|ABR16934.1|  unknown                                                 118   5e-27   
ref|XP_008663475.1|  PREDICTED: probable methyltransferase PMT15        118   5e-27   
ref|XP_011038052.1|  PREDICTED: probable methyltransferase PMT17        118   5e-27   
ref|XP_006655679.1|  PREDICTED: probable methyltransferase PMT17-...    118   5e-27   
ref|XP_003525323.1|  PREDICTED: probable methyltransferase PMT18-...    118   5e-27   
ref|XP_006655678.1|  PREDICTED: probable methyltransferase PMT17-...    117   6e-27   
ref|XP_010676941.1|  PREDICTED: probable methyltransferase PMT17        118   6e-27   
gb|EYU19524.1|  hypothetical protein MIMGU_mgv1a002864mg                117   7e-27   
ref|XP_010933740.1|  PREDICTED: probable methyltransferase PMT17        117   7e-27   
ref|XP_010053660.1|  PREDICTED: probable methyltransferase PMT15        117   8e-27   
ref|XP_011070323.1|  PREDICTED: probable methyltransferase PMT18        117   8e-27   
emb|CDP12267.1|  unnamed protein product                                117   9e-27   
ref|XP_009389104.1|  PREDICTED: probable methyltransferase PMT17        117   1e-26   
ref|XP_010919407.1|  PREDICTED: probable methyltransferase PMT17        117   1e-26   
ref|XP_008375906.1|  PREDICTED: probable methyltransferase PMT15        117   1e-26   
ref|XP_003580353.1|  PREDICTED: probable methyltransferase PMT15        117   1e-26   
ref|XP_007039271.1|  S-adenosyl-L-methionine-dependent methyltran...    117   1e-26   
ref|XP_002466953.1|  hypothetical protein SORBIDRAFT_01g017340          116   2e-26   
gb|KJB24074.1|  hypothetical protein B456_004G127200                    116   2e-26   
ref|XP_009343539.1|  PREDICTED: probable methyltransferase PMT15        116   2e-26   
gb|EYU32062.1|  hypothetical protein MIMGU_mgv1a003954mg                115   2e-26   
ref|XP_011076214.1|  PREDICTED: probable methyltransferase PMT15        116   2e-26   
ref|XP_011101180.1|  PREDICTED: probable methyltransferase PMT16        116   3e-26   
ref|XP_008795397.1|  PREDICTED: probable methyltransferase PMT15        115   3e-26   
ref|XP_008791705.1|  PREDICTED: probable methyltransferase PMT17        115   4e-26   
ref|XP_008668482.1|  PREDICTED: uncharacterized protein LOC100384...    115   4e-26   
ref|XP_006439163.1|  hypothetical protein CICLE_v10019302mg             115   4e-26   
tpg|DAA36414.1|  TPA: hypothetical protein ZEAMMB73_585119              115   4e-26   
ref|XP_004309496.1|  PREDICTED: probable methyltransferase PMT18        115   5e-26   
ref|XP_012090301.1|  PREDICTED: probable methyltransferase PMT16        115   6e-26   
ref|XP_006340522.1|  PREDICTED: probable methyltransferase PMT15-...    115   7e-26   
ref|XP_009398109.1|  PREDICTED: probable methyltransferase PMT18        115   7e-26   
ref|XP_006287263.1|  hypothetical protein CARUB_v10000453mg             114   7e-26   
gb|KEH21299.1|  methyltransferase PMT16, putative                       114   8e-26   
ref|XP_008813543.1|  PREDICTED: probable methyltransferase PMT17 ...    114   8e-26   
ref|XP_008813541.1|  PREDICTED: probable methyltransferase PMT17 ...    114   9e-26   
dbj|BAK03905.1|  predicted protein                                      115   9e-26   
emb|CBI34642.3|  unnamed protein product                                114   9e-26   
ref|XP_004982637.1|  PREDICTED: probable methyltransferase PMT18-...    114   1e-25   
ref|XP_010934594.1|  PREDICTED: probable methyltransferase PMT17        114   1e-25   
ref|XP_009350354.1|  PREDICTED: probable methyltransferase PMT18        114   1e-25   
ref|XP_004982638.1|  PREDICTED: probable methyltransferase PMT18-...    114   1e-25   
ref|XP_004306838.1|  PREDICTED: probable methyltransferase PMT15        114   1e-25   
gb|EEC67295.1|  hypothetical protein OsI_34283                          114   1e-25   
ref|XP_006421866.1|  hypothetical protein CICLE_v10004550mg             114   1e-25   
ref|XP_006352227.1|  PREDICTED: probable methyltransferase PMT18-...    114   1e-25   
gb|KHG13750.1|  hypothetical protein F383_08462                         114   1e-25   
ref|XP_009373681.1|  PREDICTED: probable methyltransferase PMT18        114   2e-25   
gb|EMT22301.1|  hypothetical protein F775_16518                         114   2e-25   
ref|XP_002982140.1|  hypothetical protein SELMODRAFT_115825             113   2e-25   
ref|XP_003574187.1|  PREDICTED: probable methyltransferase PMT17 ...    114   2e-25   
ref|XP_010693483.1|  PREDICTED: probable methyltransferase PMT15        114   2e-25   
ref|XP_003592303.1|  hypothetical protein MTR_1g101370                  114   2e-25   
ref|XP_009128712.1|  PREDICTED: probable methyltransferase PMT17        113   2e-25   
ref|XP_008378063.1|  PREDICTED: probable methyltransferase PMT18        113   2e-25   
ref|XP_010234899.1|  PREDICTED: probable methyltransferase PMT17 ...    113   3e-25   
ref|XP_006661944.1|  PREDICTED: probable methyltransferase PMT18-...    113   3e-25   
ref|NP_001065036.1|  Os10g0510400                                       113   3e-25   
ref|XP_004503565.1|  PREDICTED: probable methyltransferase PMT18-...    112   4e-25   
ref|XP_006476235.1|  PREDICTED: probable methyltransferase PMT18-...    112   4e-25   
ref|NP_191984.1|  putative methyltransferase PMT15                      112   4e-25   
gb|KDO76804.1|  hypothetical protein CISIN_1g006834mg                   112   4e-25   
emb|CDX94256.1|  BnaC02g29160D                                          112   4e-25   
ref|XP_009113612.1|  PREDICTED: probable methyltransferase PMT17        112   4e-25   
ref|XP_003557272.1|  PREDICTED: probable methyltransferase PMT17        112   4e-25   
ref|XP_009596889.1|  PREDICTED: probable methyltransferase PMT18        112   5e-25   
ref|XP_008348991.1|  PREDICTED: probable methyltransferase PMT18        112   5e-25   
gb|KFK31838.1|  hypothetical protein AALP_AA6G165000                    112   5e-25   
ref|XP_010056104.1|  PREDICTED: probable methyltransferase PMT18        112   5e-25   
ref|XP_002518966.1|  ATP binding protein, putative                      112   5e-25   
gb|KGN56551.1|  ATP binding protein                                     108   6e-25   
ref|XP_010278559.1|  PREDICTED: probable methyltransferase PMT15        112   6e-25   
ref|XP_009400717.1|  PREDICTED: probable methyltransferase PMT15        112   6e-25   
gb|KDO86014.1|  hypothetical protein CISIN_1g006633mg                   111   6e-25   
ref|XP_006490342.1|  PREDICTED: probable methyltransferase PMT15-...    112   6e-25   
ref|XP_012086580.1|  PREDICTED: probable methyltransferase PMT18 ...    112   7e-25   
ref|XP_012086579.1|  PREDICTED: probable methyltransferase PMT18 ...    112   7e-25   
gb|KJB18858.1|  hypothetical protein B456_003G072700                    111   7e-25   
emb|CDX99540.1|  BnaC09g24520D                                          111   8e-25   
ref|XP_009397639.1|  PREDICTED: probable methyltransferase PMT17        112   8e-25   
ref|XP_002269747.2|  PREDICTED: probable methyltransferase PMT15        112   8e-25   
ref|NP_001053603.1|  Os04g0570800                                       112   8e-25   
ref|XP_012086578.1|  PREDICTED: probable methyltransferase PMT18 ...    112   8e-25   
ref|XP_004244735.1|  PREDICTED: probable methyltransferase PMT18        112   9e-25   
emb|CDX99539.1|  BnaC09g24530D                                          111   1e-24   
gb|AAX94055.2|  dehydration-induced protein                             111   1e-24   
ref|XP_009801988.1|  PREDICTED: probable methyltransferase PMT15 ...    111   1e-24   
ref|XP_009801989.1|  PREDICTED: probable methyltransferase PMT15 ...    111   1e-24   
gb|KJB18848.1|  hypothetical protein B456_003G072700                    111   1e-24   
ref|XP_006445150.1|  hypothetical protein CICLE_v10019272mg             111   1e-24   
gb|KDO86012.1|  hypothetical protein CISIN_1g006633mg                   111   1e-24   
gb|KJB18860.1|  hypothetical protein B456_003G072700                    111   1e-24   
gb|ABO93008.1|  putative methyltransferase                              110   2e-24   
ref|XP_007038610.1|  S-adenosyl-L-methionine-dependent methyltran...    110   2e-24   
ref|XP_011091674.1|  PREDICTED: probable methyltransferase PMT15        110   2e-24   
ref|XP_008375441.1|  PREDICTED: probable methyltransferase PMT18        110   2e-24   
ref|XP_009360254.1|  PREDICTED: probable methyltransferase PMT18        110   2e-24   
ref|XP_010321993.1|  PREDICTED: probable methyltransferase PMT15 ...    110   3e-24   
ref|XP_004240739.1|  PREDICTED: probable methyltransferase PMT15 ...    110   3e-24   
ref|XP_004309222.1|  PREDICTED: probable methyltransferase PMT16        110   3e-24   
ref|XP_002279420.2|  PREDICTED: probable methyltransferase PMT15 ...    110   3e-24   
ref|NP_192782.1|  putative methyltransferase PMT17                      110   3e-24   
gb|EMS62160.1|  putative methyltransferase PMT17                        110   3e-24   
ref|XP_012083473.1|  PREDICTED: probable methyltransferase PMT15 ...    110   3e-24   
ref|XP_012083474.1|  PREDICTED: probable methyltransferase PMT15 ...    110   3e-24   
ref|XP_002966153.1|  hypothetical protein SELMODRAFT_143797             110   3e-24   
emb|CDP08881.1|  unnamed protein product                                110   3e-24   
ref|XP_009804054.1|  PREDICTED: probable methyltransferase PMT15        110   3e-24   
gb|EEC79826.1|  hypothetical protein OsI_21282                          110   3e-24   
gb|KHN01216.1|  Putative methyltransferase PMT2                         108   4e-24   
ref|NP_001056546.2|  Os06g0103900                                       110   4e-24   
ref|XP_003628358.1|  hypothetical protein MTR_8g055840                  108   4e-24   
emb|CDX84046.1|  BnaC08g07230D                                          109   5e-24   
emb|CDY44966.1|  BnaA08g06660D                                          109   5e-24   
ref|XP_010110846.1|  putative methyltransferase PMT18                   107   5e-24   
emb|CDP05238.1|  unnamed protein product                                109   6e-24   
ref|XP_009768341.1|  PREDICTED: probable methyltransferase PMT18        109   6e-24   
gb|KJB09868.1|  hypothetical protein B456_001G171500                    108   6e-24   
gb|EMS54302.1|  putative methyltransferase PMT17                        109   7e-24   
ref|XP_007152322.1|  hypothetical protein PHAVU_004G120000g             109   7e-24   
ref|XP_009626220.1|  PREDICTED: probable methyltransferase PMT15        109   8e-24   
ref|XP_010933874.1|  PREDICTED: probable methyltransferase PMT15        108   8e-24   
gb|KDO82913.1|  hypothetical protein CISIN_1g0105922mg                  107   9e-24   
ref|XP_011650766.1|  PREDICTED: probable methyltransferase PMT16        108   9e-24   
ref|XP_009629797.1|  PREDICTED: probable methyltransferase PMT15        108   9e-24   
gb|KDO82914.1|  hypothetical protein CISIN_1g0105922mg                  107   1e-23   
ref|XP_009610423.1|  PREDICTED: probable methyltransferase PMT15        108   1e-23   
ref|XP_007210288.1|  hypothetical protein PRUPE_ppa002760mg             108   1e-23   
gb|KJB09867.1|  hypothetical protein B456_001G171500                    108   1e-23   
gb|KJB41226.1|  hypothetical protein B456_007G095700                    108   1e-23   
ref|XP_006339462.1|  PREDICTED: probable methyltransferase PMT15-...    108   1e-23   
gb|KDO82910.1|  hypothetical protein CISIN_1g0105922mg                  107   1e-23   
ref|XP_002875017.1|  dehydration-responsive family protein              108   1e-23   
ref|XP_009770932.1|  PREDICTED: probable methyltransferase PMT15        108   2e-23   
ref|XP_002318832.2|  hypothetical protein POPTR_0012s13570g             107   2e-23   
ref|XP_003530522.1|  PREDICTED: probable methyltransferase PMT18-...    107   2e-23   
ref|XP_006396270.1|  hypothetical protein EUTSA_v10028512mg             107   3e-23   
ref|XP_002510829.1|  ATP binding protein, putative                      107   3e-23   
ref|NP_001148962.1|  ankyrin protein kinase-like                        107   3e-23   
ref|XP_008676538.1|  PREDICTED: ankyrin protein kinase-like isofo...    107   4e-23   
ref|XP_006286418.1|  hypothetical protein CARUB_v10003037mg             107   4e-23   
ref|XP_008239284.1|  PREDICTED: probable methyltransferase PMT18        107   4e-23   
emb|CBI31965.3|  unnamed protein product                                105   5e-23   
gb|EPS57356.1|  hypothetical protein M569_17462                         102   5e-23   
ref|XP_004496597.1|  PREDICTED: probable methyltransferase PMT16-...    106   6e-23   
ref|XP_002270920.1|  PREDICTED: probable methyltransferase PMT18 ...    106   6e-23   
ref|XP_002874627.1|  dehydration-responsive family protein              106   7e-23   
ref|XP_010660482.1|  PREDICTED: probable methyltransferase PMT18 ...    106   7e-23   
ref|XP_006415121.1|  hypothetical protein EUTSA_v10007044mg             106   7e-23   
ref|XP_002321888.2|  hypothetical protein POPTR_0015s13580g             105   1e-22   
ref|XP_010250929.1|  PREDICTED: probable methyltransferase PMT18        105   1e-22   
ref|XP_004499422.1|  PREDICTED: probable methyltransferase PMT2-l...    104   1e-22   
ref|XP_010455441.1|  PREDICTED: probable methyltransferase PMT17        105   1e-22   
ref|XP_008354467.1|  PREDICTED: probable methyltransferase PMT15        105   1e-22   
ref|XP_009399379.1|  PREDICTED: probable methyltransferase PMT15        105   1e-22   
ref|XP_010421961.1|  PREDICTED: probable methyltransferase PMT17        105   2e-22   
gb|KHG14191.1|  hypothetical protein F383_16741                         105   2e-22   
ref|XP_007051921.1|  S-adenosyl-L-methionine-dependent methyltran...    104   2e-22   
gb|KEH17380.1|  methyltransferase PMT16, putative                       104   2e-22   
ref|XP_010523726.1|  PREDICTED: probable methyltransferase PMT16        105   3e-22   
ref|XP_011030063.1|  PREDICTED: probable methyltransferase PMT15        104   3e-22   
ref|XP_009124372.1|  PREDICTED: probable methyltransferase PMT18        104   3e-22   
ref|XP_009349944.1|  PREDICTED: probable methyltransferase PMT15        104   3e-22   
ref|XP_003623835.1|  hypothetical protein MTR_7g076170                  104   3e-22   
gb|KEH17379.1|  methyltransferase PMT16, putative                       104   3e-22   
ref|XP_007051920.1|  S-adenosyl-L-methionine-dependent methyltran...    104   3e-22   
ref|XP_010919241.1|  PREDICTED: probable methyltransferase PMT15        103   5e-22   
emb|CDY18904.1|  BnaC04g04460D                                          103   6e-22   
ref|XP_003533625.1|  PREDICTED: probable methyltransferase PMT15-...    103   6e-22   
ref|XP_004229839.1|  PREDICTED: probable methyltransferase PMT15        103   6e-22   
ref|XP_011041603.1|  PREDICTED: probable methyltransferase PMT16        103   7e-22   
ref|XP_010559094.1|  PREDICTED: probable methyltransferase PMT16        103   7e-22   
ref|XP_008234471.1|  PREDICTED: probable methyltransferase PMT16        103   8e-22   
ref|XP_006293834.1|  hypothetical protein CARUB_v10022818mg             103   9e-22   
ref|XP_003533217.1|  PREDICTED: probable methyltransferase PMT16-...    103   9e-22   
ref|XP_004234366.1|  PREDICTED: probable methyltransferase PMT16        103   1e-21   
ref|XP_009107959.1|  PREDICTED: probable methyltransferase PMT18        103   1e-21   
ref|XP_003548213.1|  PREDICTED: probable methyltransferase PMT16-...    103   1e-21   
emb|CBI15236.3|  unnamed protein product                                102   1e-21   
ref|XP_007220207.1|  hypothetical protein PRUPE_ppa002720mg             102   1e-21   
ref|XP_002320758.2|  hypothetical protein POPTR_0014s07180g             102   1e-21   
ref|XP_008377156.1|  PREDICTED: probable methyltransferase PMT16        102   1e-21   
ref|XP_010255518.1|  PREDICTED: probable methyltransferase PMT15 ...    102   1e-21   
ref|XP_010035103.1|  PREDICTED: probable methyltransferase PMT15        102   2e-21   
ref|XP_002511797.1|  ATP binding protein, putative                      102   2e-21   
ref|XP_002880195.1|  dehydration-responsive family protein              102   2e-21   
gb|EMS46508.1|  putative methyltransferase PMT2                         101   2e-21   
ref|XP_010061323.1|  PREDICTED: probable methyltransferase PMT16        102   2e-21   
ref|XP_006653692.1|  PREDICTED: probable methyltransferase PMT15-...    102   2e-21   
ref|XP_008356816.1|  PREDICTED: probable methyltransferase PMT18        102   2e-21   
ref|XP_004976536.1|  PREDICTED: probable methyltransferase PMT15-...    102   2e-21   
gb|ABV72578.1|  dehydration-responsive family protein S51               102   2e-21   
emb|CDX74761.1|  BnaA05g05070D                                          102   3e-21   
gb|KFK37364.1|  hypothetical protein AALP_AA4G247100                    102   3e-21   
ref|XP_009143165.1|  PREDICTED: probable methyltransferase PMT16        102   3e-21   
ref|XP_006397756.1|  hypothetical protein EUTSA_v10001358mg             101   3e-21   
ref|XP_010506552.1|  PREDICTED: probable methyltransferase PMT16        101   3e-21   
ref|XP_006353348.1|  PREDICTED: probable methyltransferase PMT15-...    101   3e-21   
ref|XP_002452759.1|  hypothetical protein SORBIDRAFT_04g032010          101   4e-21   
ref|NP_182099.1|  putative methyltransferase PMT16                      101   4e-21   
ref|XP_008438092.1|  PREDICTED: probable methyltransferase PMT15        101   4e-21   
ref|XP_010508116.1|  PREDICTED: probable methyltransferase PMT16        101   4e-21   
ref|XP_010518192.1|  PREDICTED: probable methyltransferase PMT16        100   5e-21   
ref|XP_004515722.1|  PREDICTED: probable methyltransferase PMT16-...    100   7e-21   
gb|ACN78962.1|  methyltransferase                                       100   8e-21   
gb|AFW63361.1|  hypothetical protein ZEAMMB73_276336                  98.2    9e-21   
ref|XP_010540274.1|  PREDICTED: probable methyltransferase PMT15      99.8    1e-20   
ref|XP_011035186.1|  PREDICTED: probable methyltransferase PMT15 ...  99.8    1e-20   
gb|EEC73773.1|  hypothetical protein OsI_08448                        99.8    2e-20   
ref|NP_001047721.1|  Os02g0675700                                     99.8    2e-20   
ref|XP_009128495.1|  PREDICTED: probable methyltransferase PMT15      99.8    2e-20   
ref|XP_011035172.1|  PREDICTED: probable methyltransferase PMT15 ...  99.4    2e-20   
ref|XP_002891032.1|  dehydration-responsive family protein            99.4    2e-20   
gb|KEH18956.1|  methyltransferase                                     99.0    3e-20   
ref|XP_010501748.1|  PREDICTED: probable methyltransferase PMT18      98.2    3e-20   
ref|NP_564419.1|  putative methyltransferase PMT18                    99.0    3e-20   
emb|CDY54063.1|  BnaA02g36490D                                        98.6    3e-20   
gb|AAF97349.1|AC021045_6  Unknown Protein                             98.6    3e-20   
ref|XP_010461135.1|  PREDICTED: probable methyltransferase PMT18      98.6    4e-20   



>ref|XP_011071001.1| PREDICTED: probable methyltransferase PMT2 [Sesamum indicum]
Length=612

 Score =   295 bits (754),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 135/156 (87%), Positives = 144/156 (92%), Gaps = 0/156 (0%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MANK  SGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALE+TK+  +CNILP
Sbjct  1    MANKFNSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEMTKSGANCNILP  60

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +LNFETHHSG AG ID+S+SKV   KPCHPRYTDYTPCQDQRRAMTF R+NMIYRERHCP
Sbjct  61   NLNFETHHSGEAGIIDDSDSKVTVYKPCHPRYTDYTPCQDQRRAMTFPRENMIYRERHCP  120

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
             +E+KLHCLIPA KGYVTPFPWPKSRDYVPYANAPY
Sbjct  121  SQEEKLHCLIPASKGYVTPFPWPKSRDYVPYANAPY  156



>ref|XP_011075499.1| PREDICTED: probable methyltransferase PMT2 [Sesamum indicum]
Length=613

 Score =   293 bits (751),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 134/156 (86%), Positives = 143/156 (92%), Gaps = 0/156 (0%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MANK  SGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALE+TK+  DCNILP
Sbjct  1    MANKYNSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEMTKSGADCNILP  60

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +LNFETHH+G AG ID+S+SKV   KPC P+YTDYTPCQDQ RAMTF R+NMIYRERHCP
Sbjct  61   NLNFETHHAGEAGIIDDSDSKVTVYKPCDPKYTDYTPCQDQGRAMTFPRENMIYRERHCP  120

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P E+KLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY
Sbjct  121  PEEEKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  156



>gb|EYU28744.1| hypothetical protein MIMGU_mgv1a003087mg [Erythranthe guttata]
 gb|EYU28745.1| hypothetical protein MIMGU_mgv1a003087mg [Erythranthe guttata]
Length=609

 Score =   285 bits (728),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 129/156 (83%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MANK  SGD+RTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALE+TK+ ++CNILP
Sbjct  1    MANKFNSGDNRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEMTKSGENCNILP  60

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +LNFETHH G AG ID+ +SKV   KPCH RYTDYTPCQDQ RAMTF R+NMIYRERHCP
Sbjct  61   NLNFETHHGGEAGIIDDPDSKVTAFKPCHTRYTDYTPCQDQGRAMTFPRENMIYRERHCP  120

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P+ +KLHCLIPAP+GYVTPF WPKSRDYVPYANAPY
Sbjct  121  PQAEKLHCLIPAPEGYVTPFRWPKSRDYVPYANAPY  156



>emb|CDP00327.1| unnamed protein product [Coffea canephora]
Length=616

 Score =   284 bits (726),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 139/156 (89%), Gaps = 0/156 (0%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MANK+ +GDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTK    CN++P
Sbjct  1    MANKLNAGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKNGAACNVIP  60

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +LNFETHH G AG I++S+S VKEIKPC PRY DYTPCQDQ RAM F R+NM YRERHCP
Sbjct  61   NLNFETHHGGGAGMIEDSDSNVKEIKPCKPRYADYTPCQDQNRAMKFPRENMNYRERHCP  120

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P+E+KLHCLIPAP GYVTPF WPKSRDYVPYANAPY
Sbjct  121  PQEEKLHCLIPAPNGYVTPFRWPKSRDYVPYANAPY  156



>ref|XP_009626042.1| PREDICTED: probable methyltransferase PMT2 [Nicotiana tomentosiformis]
Length=613

 Score =   284 bits (726),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 132/157 (84%), Positives = 146/157 (93%), Gaps = 2/157 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTS-KDCNIL  322
            MANK +SGD+RTR+SVSIFIV GLCCFFYLLGAWQRSGFGKGDSIAL VTKT+ ++CNIL
Sbjct  1    MANK-SSGDNRTRTSVSIFIVTGLCCFFYLLGAWQRSGFGKGDSIALAVTKTAGENCNIL  59

Query  323  PSLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHC  502
            P+LNFET H G+AGSID+S ++VK  KPCHPRYTDYTPCQDQ+RAM F R+NMIYRERHC
Sbjct  60   PNLNFETRHGGQAGSIDDSGTEVKIFKPCHPRYTDYTPCQDQKRAMHFPRENMIYRERHC  119

Query  503  PPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            PP+EKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY
Sbjct  120  PPQEKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  156



>ref|XP_009793104.1| PREDICTED: probable methyltransferase PMT2 [Nicotiana sylvestris]
Length=613

 Score =   283 bits (724),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 147/157 (94%), Gaps = 2/157 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTS-KDCNIL  322
            MANK +SGD+RTR+SVSIFIV GLCCFFYLLGAWQRSGFGKGDSIAL VTKT+ ++CNIL
Sbjct  1    MANK-SSGDNRTRTSVSIFIVTGLCCFFYLLGAWQRSGFGKGDSIALAVTKTAGENCNIL  59

Query  323  PSLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHC  502
            P+LNFET H G+AGSID+S ++VK+ KPCHPRYTD+TPCQDQ+RAM F R+NMIYRERHC
Sbjct  60   PNLNFETRHGGQAGSIDDSGTEVKKFKPCHPRYTDHTPCQDQKRAMHFPRENMIYRERHC  119

Query  503  PPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            PP+EKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY
Sbjct  120  PPQEKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  156



>ref|XP_009761475.1| PREDICTED: probable methyltransferase PMT2 [Nicotiana sylvestris]
Length=611

 Score =   281 bits (718),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 146/157 (93%), Gaps = 2/157 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTS-KDCNIL  322
            MANK  +GD+RTR+SVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIAL VTKT+ ++C+IL
Sbjct  1    MANK-NAGDNRTRTSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALAVTKTAGENCDIL  59

Query  323  PSLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHC  502
            P+LNFET H+G AG  DESES+V+E+KPC P+YTDYTPCQDQ+RAMTF R+NM YRERHC
Sbjct  60   PNLNFETRHAGEAGGTDESESEVEELKPCDPQYTDYTPCQDQKRAMTFPRENMNYRERHC  119

Query  503  PPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            PP+E+KLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY
Sbjct  120  PPQEEKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  156



>ref|XP_008221626.1| PREDICTED: probable methyltransferase PMT2 [Prunus mume]
 ref|XP_008221627.1| PREDICTED: probable methyltransferase PMT2 [Prunus mume]
Length=616

 Score =   281 bits (718),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = +2

Query  161  TSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLNFE  340
            T+ D RTRSSV IFIVAGLCCFFY+LGAWQRSGFGKGDSIALE+TK   DCNI+PSL+FE
Sbjct  5    TNADGRTRSSVQIFIVAGLCCFFYILGAWQRSGFGKGDSIALEITKNGADCNIIPSLSFE  64

Query  341  THHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCPPREKK  520
            +HH+G AG IDESESK K  KPCHPRYTDYTPCQDQ+RAMTF R +M YRERHCPP E+K
Sbjct  65   SHHAGEAGKIDESESKPKVFKPCHPRYTDYTPCQDQKRAMTFPRDDMNYRERHCPPEEEK  124

Query  521  LHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            LHCLIPAPKGYVTPFPWPKSRDYVPYANAPY
Sbjct  125  LHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  155



>ref|XP_007222021.1| hypothetical protein PRUPE_ppa002971mg [Prunus persica]
 gb|EMJ23220.1| hypothetical protein PRUPE_ppa002971mg [Prunus persica]
Length=616

 Score =   280 bits (717),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = +2

Query  161  TSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLNFE  340
            T+ D RTRSSV IFIVAGLCCFFY+LGAWQRSGFGKGDSIALE+TK   DCNI+PSL+FE
Sbjct  5    TNSDGRTRSSVQIFIVAGLCCFFYILGAWQRSGFGKGDSIALEITKNGADCNIIPSLSFE  64

Query  341  THHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCPPREKK  520
            +HH+G AG IDESESK K  KPCHPRYTDYTPCQDQ+RAMTF R +M YRERHCPP E+K
Sbjct  65   SHHAGEAGKIDESESKPKVFKPCHPRYTDYTPCQDQKRAMTFPRDDMNYRERHCPPEEEK  124

Query  521  LHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            LHCLIPAPKGYVTPFPWPKSRDYVPYANAPY
Sbjct  125  LHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  155



>ref|XP_009624681.1| PREDICTED: probable methyltransferase PMT2 [Nicotiana tomentosiformis]
Length=611

 Score =   280 bits (717),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 145/157 (92%), Gaps = 2/157 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTS-KDCNIL  322
            MANK  +GD+RTR+SVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIAL VTKT+ ++C+IL
Sbjct  1    MANK-NAGDNRTRTSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALAVTKTAGENCDIL  59

Query  323  PSLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHC  502
            P+LNFET H+G AG  DESES+V+E+KPC P YTDYTPCQDQ+RAMTF R+NM YRERHC
Sbjct  60   PNLNFETRHAGEAGGTDESESEVEELKPCDPHYTDYTPCQDQKRAMTFPRENMNYRERHC  119

Query  503  PPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            PP+E+KLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY
Sbjct  120  PPQEEKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  156



>gb|EYU22422.1| hypothetical protein MIMGU_mgv1a003056mg [Erythranthe guttata]
Length=517

 Score =   277 bits (708),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 141/158 (89%), Gaps = 2/158 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MANK  SGD+RTR+SVSIFI+AGLCCFFYLLGAWQRSGFGKGDSIALE+TKTS +CNILP
Sbjct  1    MANKFNSGDNRTRNSVSIFIIAGLCCFFYLLGAWQRSGFGKGDSIALEITKTSTNCNILP  60

Query  326  SLNFETHHSGRAG--SIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERH  499
            +LNFETHH   AG  S  +S+SK    KPCH +YTDYTPCQDQRRAMTFSR++MIYRERH
Sbjct  61   NLNFETHHGNEAGIFSDSDSDSKPTVYKPCHKKYTDYTPCQDQRRAMTFSRESMIYRERH  120

Query  500  CPPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            CP ++ KLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY
Sbjct  121  CPLQKDKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  158



>ref|XP_006438677.1| hypothetical protein CICLE_v10030989mg [Citrus clementina]
 ref|XP_006483161.1| PREDICTED: probable methyltransferase PMT2-like [Citrus sinensis]
 gb|ESR51917.1| hypothetical protein CICLE_v10030989mg [Citrus clementina]
Length=610

 Score =   279 bits (714),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 126/156 (81%), Positives = 137/156 (88%), Gaps = 0/156 (0%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K  S D RTRSS+ IFIV GLCCFFY+LGAWQRSGFGKGDSIALE++K+  DCNI+P
Sbjct  1    MALKSNSSDGRTRSSIQIFIVVGLCCFFYILGAWQRSGFGKGDSIALEISKSGADCNIVP  60

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            SLNFETHH G   SI+ESESK K  +PCHPRYTDYTPCQDQRRAMTF R++M YRERHCP
Sbjct  61   SLNFETHHGGEVESINESESKPKVFEPCHPRYTDYTPCQDQRRAMTFPRESMNYRERHCP  120

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P E+KLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY
Sbjct  121  PEEEKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  156



>ref|XP_010089758.1| putative methyltransferase PMT2 [Morus notabilis]
 gb|EXB38334.1| putative methyltransferase PMT2 [Morus notabilis]
Length=611

 Score =   277 bits (709),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 123/156 (79%), Positives = 139/156 (89%), Gaps = 0/156 (0%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA+K +SGD RTRSS+ IFIVAGLCCFFY+LGAWQRSGFGKGDSIALE+TK+  +CN++ 
Sbjct  1    MASKTSSGDGRTRSSIQIFIVAGLCCFFYILGAWQRSGFGKGDSIALEITKSGAECNVVQ  60

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +L+F+THH G A SIDES+ + K  KPCH RYTDYTPCQDQRRAMTF R +MIYRERHCP
Sbjct  61   NLSFDTHHGGDARSIDESDMQTKVFKPCHSRYTDYTPCQDQRRAMTFPRNDMIYRERHCP  120

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P E+KLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY
Sbjct  121  PEEEKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  156



>ref|XP_006366703.1| PREDICTED: probable methyltransferase PMT2-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006366704.1| PREDICTED: probable methyltransferase PMT2-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006366705.1| PREDICTED: probable methyltransferase PMT2-like isoform X3 [Solanum 
tuberosum]
 ref|XP_006366706.1| PREDICTED: probable methyltransferase PMT2-like isoform X4 [Solanum 
tuberosum]
Length=612

 Score =   277 bits (708),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 143/156 (92%), Gaps = 1/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MANK + GD+RTR+SVSIFIVAGLCCFFYLLG+WQRSG GKGDSIAL VTK+ ++CNILP
Sbjct  1    MANK-SLGDNRTRTSVSIFIVAGLCCFFYLLGSWQRSGVGKGDSIALAVTKSGENCNILP  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +LNFET H G+AGSID+S ++VK+ KPC PRYTD+TPCQDQ+RAM F R+NMIYRERHCP
Sbjct  60   NLNFETRHGGQAGSIDDSGTEVKKFKPCRPRYTDHTPCQDQKRAMHFPRENMIYRERHCP  119

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P EKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY
Sbjct  120  PPEKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  155



>gb|EYU22421.1| hypothetical protein MIMGU_mgv1a003056mg [Erythranthe guttata]
Length=611

 Score =   276 bits (707),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 141/158 (89%), Gaps = 2/158 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MANK  SGD+RTR+SVSIFI+AGLCCFFYLLGAWQRSGFGKGDSIALE+TKTS +CNILP
Sbjct  1    MANKFNSGDNRTRNSVSIFIIAGLCCFFYLLGAWQRSGFGKGDSIALEITKTSTNCNILP  60

Query  326  SLNFETHHSGRAG--SIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERH  499
            +LNFETHH   AG  S  +S+SK    KPCH +YTDYTPCQDQRRAMTFSR++MIYRERH
Sbjct  61   NLNFETHHGNEAGIFSDSDSDSKPTVYKPCHKKYTDYTPCQDQRRAMTFSRESMIYRERH  120

Query  500  CPPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            CP ++ KLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY
Sbjct  121  CPLQKDKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  158



>ref|XP_012067633.1| PREDICTED: probable methyltransferase PMT2 isoform X2 [Jatropha 
curcas]
 gb|KDP41191.1| hypothetical protein JCGZ_15598 [Jatropha curcas]
Length=617

 Score =   275 bits (702),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 122/156 (78%), Positives = 136/156 (87%), Gaps = 0/156 (0%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K  S DSRTRSS+ IFIV GLCCFFY+LGAWQRSGFGK D++A+E+TK + DCN++P
Sbjct  1    MALKTNSADSRTRSSIQIFIVVGLCCFFYILGAWQRSGFGKADNLAMEITKNTGDCNLIP  60

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            SLNFETHH G   SI++SESK K  KPC PRYTDYTPCQDQRRAMTF R+NMIYRERHCP
Sbjct  61   SLNFETHHGGEIESINDSESKPKVFKPCKPRYTDYTPCQDQRRAMTFPRENMIYRERHCP  120

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P  +KLHCLIPAPKGYVTPFPWPKSRDYVP+ANAPY
Sbjct  121  PEGEKLHCLIPAPKGYVTPFPWPKSRDYVPFANAPY  156



>ref|XP_012067632.1| PREDICTED: probable methyltransferase PMT2 isoform X1 [Jatropha 
curcas]
Length=620

 Score =   275 bits (702),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 122/156 (78%), Positives = 136/156 (87%), Gaps = 0/156 (0%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K  S DSRTRSS+ IFIV GLCCFFY+LGAWQRSGFGK D++A+E+TK + DCN++P
Sbjct  1    MALKTNSADSRTRSSIQIFIVVGLCCFFYILGAWQRSGFGKADNLAMEITKNTGDCNLIP  60

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            SLNFETHH G   SI++SESK K  KPC PRYTDYTPCQDQRRAMTF R+NMIYRERHCP
Sbjct  61   SLNFETHHGGEIESINDSESKPKVFKPCKPRYTDYTPCQDQRRAMTFPRENMIYRERHCP  120

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P  +KLHCLIPAPKGYVTPFPWPKSRDYVP+ANAPY
Sbjct  121  PEGEKLHCLIPAPKGYVTPFPWPKSRDYVPFANAPY  156



>ref|XP_002522425.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF39917.1| ATP binding protein, putative [Ricinus communis]
Length=612

 Score =   273 bits (698),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 137/156 (88%), Gaps = 0/156 (0%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K  S D+RTRSS+ IFIV GLCCFFY+LGAWQRSGFGK D++A+E+TK + DCN++P
Sbjct  1    MALKTNSADNRTRSSIQIFIVVGLCCFFYILGAWQRSGFGKADNLAMEITKNTGDCNLVP  60

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            SLNFETHH G  G+I +SESK K  +PC  RYTDYTPCQDQRRAMTF R+NM+YRERHCP
Sbjct  61   SLNFETHHGGEIGTIRDSESKAKVFEPCKARYTDYTPCQDQRRAMTFPRENMMYRERHCP  120

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P+E+KLHCLIPAP+GYVTPFPWPKSRDYVPYANAPY
Sbjct  121  PQEEKLHCLIPAPEGYVTPFPWPKSRDYVPYANAPY  156



>gb|ABO92980.1| putative methyltransferase [Solanum tuberosum]
Length=612

 Score =   272 bits (695),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 144/157 (92%), Gaps = 3/157 (2%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTS-KDCNIL  322
            MA K  SGD+RTR+SVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIA+ VTKT+ ++C+IL
Sbjct  1    MAGK-NSGDNRTRTSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIAVAVTKTAGENCDIL  59

Query  323  PSLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHC  502
            P+LNFET H+G AG  DESE +V+E+KPC P+YTDYTPCQDQ+RAMTF R+NM YRERHC
Sbjct  60   PNLNFETRHAGEAGGTDESE-EVEELKPCDPQYTDYTPCQDQKRAMTFPRENMNYRERHC  118

Query  503  PPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            PP+E+KLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY
Sbjct  119  PPQEEKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  155



>ref|XP_004238796.1| PREDICTED: probable methyltransferase PMT2 [Solanum lycopersicum]
 ref|XP_010320682.1| PREDICTED: probable methyltransferase PMT2 [Solanum lycopersicum]
Length=612

 Score =   271 bits (692),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 144/157 (92%), Gaps = 3/157 (2%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTS-KDCNIL  322
            MA K  SGD+RTR+SVSIFI+AGLCCFFYLLGAWQRSGFGKGDSIA+ VTKT+ ++C++L
Sbjct  1    MAGK-NSGDNRTRTSVSIFIIAGLCCFFYLLGAWQRSGFGKGDSIAVAVTKTAGENCDVL  59

Query  323  PSLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHC  502
            P+LNFET H+G AG  DESE +V+E+KPC P+YTDYTPCQDQ+RAMTF R+NM YRERHC
Sbjct  60   PNLNFETRHAGEAGGTDESE-EVEELKPCDPQYTDYTPCQDQKRAMTFPRENMNYRERHC  118

Query  503  PPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            PP+E+KLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY
Sbjct  119  PPQEEKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  155



>gb|AAT38682.2| Methyltransferase family protein, putative [Solanum demissum]
 gb|AAT38802.2| Methyltransferase family protein, putative [Solanum demissum]
Length=666

 Score =   271 bits (692),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 126/157 (80%), Positives = 144/157 (92%), Gaps = 3/157 (2%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTS-KDCNIL  322
            MA K  SGD+RTR+SVSIFI+AGLCCFFYLLGAWQRSGFGKGDSIA+ VTKT+ ++C+IL
Sbjct  1    MAGK-NSGDNRTRTSVSIFIIAGLCCFFYLLGAWQRSGFGKGDSIAVAVTKTAGENCDIL  59

Query  323  PSLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHC  502
            P+LNFET H+G AG  DESE +V+E+KPC P+YTDYTPCQDQ+RAMTF R+NM YRERHC
Sbjct  60   PNLNFETRHAGEAGGTDESE-EVEELKPCDPQYTDYTPCQDQKRAMTFPRENMNYRERHC  118

Query  503  PPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            PP+E+KLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY
Sbjct  119  PPQEEKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  155



>ref|XP_006366112.1| PREDICTED: probable methyltransferase PMT2-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006366113.1| PREDICTED: probable methyltransferase PMT2-like isoform X2 [Solanum 
tuberosum]
Length=612

 Score =   269 bits (687),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 143/157 (91%), Gaps = 3/157 (2%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTS-KDCNIL  322
            MA K  SGD+RTR+SVSIFI+AGLCCFFYLLGAWQRSGFGKGDSIA+ VTKT+ ++C+IL
Sbjct  1    MAGK-NSGDNRTRTSVSIFIIAGLCCFFYLLGAWQRSGFGKGDSIAVAVTKTAGENCDIL  59

Query  323  PSLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHC  502
            P+LNFET H+G AG  DE E +V+E+KPC P+YTDYTPCQDQ+RAMTF R+NM YRERHC
Sbjct  60   PNLNFETRHAGEAGGTDEPE-EVEELKPCDPQYTDYTPCQDQKRAMTFPRENMNYRERHC  118

Query  503  PPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            PP+E+KLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY
Sbjct  119  PPQEEKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  155



>ref|XP_010258374.1| PREDICTED: probable methyltransferase PMT2 [Nelumbo nucifera]
 ref|XP_010258376.1| PREDICTED: probable methyltransferase PMT2 [Nelumbo nucifera]
Length=617

 Score =   269 bits (688),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 123/156 (79%), Positives = 137/156 (88%), Gaps = 1/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K+ S D+RTRSSVSIFIV GLCCFFY+LGAWQ+SGFGKGDSIA+E+TK + DC++L 
Sbjct  1    MAMKMNSADNRTRSSVSIFIVVGLCCFFYILGAWQKSGFGKGDSIAVEITKQT-DCSVLS  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +LNFETHHSG AG ID+  SKV+  KPC  RYTDYTPCQDQ RAMTF R+NM YRERHCP
Sbjct  60   NLNFETHHSGEAGVIDDPGSKVEVFKPCDARYTDYTPCQDQMRAMTFPRENMNYRERHCP  119

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P E+KLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY
Sbjct  120  PEEEKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  155



>gb|KJB60758.1| hypothetical protein B456_009G324300 [Gossypium raimondii]
Length=392

 Score =   263 bits (671),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 132/156 (85%), Gaps = 1/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K  S D RTRS V IFIV GLCCFFY+LGAWQRSGFGKGDSIALE+TK   DCNI+P
Sbjct  1    MALKPNSPDGRTRSWVQIFIVFGLCCFFYILGAWQRSGFGKGDSIALEITKHGADCNIIP  60

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            SLNFETHH+G  G++ ESE K+K  +PC PRY DYTPCQDQ+RAMTF R NMIYRERHCP
Sbjct  61   SLNFETHHAGEVGNVGESE-KIKSFQPCPPRYVDYTPCQDQKRAMTFPRDNMIYRERHCP  119

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
              E+KLHCL+PAP GYVTPFPWPKSRDYVPYANAPY
Sbjct  120  REEEKLHCLVPAPTGYVTPFPWPKSRDYVPYANAPY  155



>gb|AAT38756.2| Putative methyltransferase family protein [Solanum demissum]
Length=828

 Score =   273 bits (698),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 146/160 (91%), Gaps = 3/160 (2%)
 Frame = +2

Query  137  RDSMANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTS-KDC  313
            R +MA K  SGD+RTR+SVSIFI+AGLCCFFYLLGAWQRSGFGKGDSIA+ +TKT+ ++C
Sbjct  122  RAAMAAK-NSGDNRTRTSVSIFIIAGLCCFFYLLGAWQRSGFGKGDSIAVAITKTAGENC  180

Query  314  NILPSLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRE  493
            +ILP+LNFET H+G AG  DESE +V+E+KPC P+YTDYTPCQDQ+RAMTF R+NM YRE
Sbjct  181  DILPNLNFETRHAGEAGGTDESE-EVEELKPCDPQYTDYTPCQDQKRAMTFPRENMNYRE  239

Query  494  RHCPPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            RHCPP+E+KLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY
Sbjct  240  RHCPPQEEKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  279



>gb|KJB80180.1| hypothetical protein B456_013G084900 [Gossypium raimondii]
 gb|KJB80181.1| hypothetical protein B456_013G084900 [Gossypium raimondii]
Length=616

 Score =   268 bits (686),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/156 (78%), Positives = 135/156 (87%), Gaps = 1/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K  S D+RTRSS+ IFIV GLCCFFY+LGAWQRSGFGKGDSIALE+TK S DC+I+P
Sbjct  1    MALKPNSTDTRTRSSIQIFIVVGLCCFFYILGAWQRSGFGKGDSIALEMTKHSADCSIVP  60

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +LNFETHH+G  G++DESE K K  +PCHPRY DYTPCQDQ RAMTF R NMIYRERHCP
Sbjct  61   TLNFETHHAGEVGNVDESE-KPKSFEPCHPRYVDYTPCQDQSRAMTFPRDNMIYRERHCP  119

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
              E+KLHCL+PAP GYVTPFPWPKSRDYVPYANAPY
Sbjct  120  REEEKLHCLVPAPNGYVTPFPWPKSRDYVPYANAPY  155



>ref|XP_007046111.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOY01943.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=616

 Score =   268 bits (685),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 133/156 (85%), Gaps = 1/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K  S D RTRSS+ IF+V GLCCFFY+LGAWQRSGFGKGDSIALE+TK   DCNILP
Sbjct  1    MALKPNSADGRTRSSIQIFVVVGLCCFFYILGAWQRSGFGKGDSIALEITKHGADCNILP  60

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            SLNFETHH+G  G++DESE K K  +PC PRY DYTPCQDQ+RAMTF R NMIYRERHCP
Sbjct  61   SLNFETHHAGEVGNVDESE-KSKSFEPCSPRYVDYTPCQDQKRAMTFPRDNMIYRERHCP  119

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
              E+KL CL+PAP+GYVTPFPWPKSRDYVPYANAPY
Sbjct  120  REEEKLQCLVPAPQGYVTPFPWPKSRDYVPYANAPY  155



>gb|KHG10506.1| hypothetical protein F383_11349 [Gossypium arboreum]
Length=616

 Score =   268 bits (685),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/156 (78%), Positives = 133/156 (85%), Gaps = 1/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K  S D RTRS V IFIV GLCCFFY+LGAWQRSGFGKGDSIALE+TK   DCNI+P
Sbjct  1    MALKPNSADGRTRSWVQIFIVFGLCCFFYILGAWQRSGFGKGDSIALEITKHGADCNIIP  60

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            SLNFETHH+G  G++ ESE K+K  +PC PRY DYTPCQDQ+RAMTF R NMIYRERHCP
Sbjct  61   SLNFETHHAGEVGNVGESE-KIKSFQPCPPRYVDYTPCQDQKRAMTFPRDNMIYRERHCP  119

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
              E+KLHCL+PAPKGYVTPFPWPKSRDYVPYANAPY
Sbjct  120  REEEKLHCLVPAPKGYVTPFPWPKSRDYVPYANAPY  155



>ref|XP_004297305.1| PREDICTED: probable methyltransferase PMT2 [Fragaria vesca subsp. 
vesca]
Length=607

 Score =   267 bits (683),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 136/156 (87%), Gaps = 1/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K T+ D RTR SV IFIVAGLCCFFY+LGAWQRSGFGKGDSIA+E+T+T  DC+++P
Sbjct  1    MATK-TNADGRTRGSVQIFIVAGLCCFFYILGAWQRSGFGKGDSIAVEITRTKADCSVIP  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +L+FE+HH+G  G IDES S+ K  +PCHPRYTDYTPCQDQ+RAMTF R +M YRERHCP
Sbjct  60   NLSFESHHAGEVGKIDESGSEAKVFEPCHPRYTDYTPCQDQKRAMTFPRDDMNYRERHCP  119

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P E+KLHCLIPAPKGYVTPF WPKSRDYVPYANAPY
Sbjct  120  PEEEKLHCLIPAPKGYVTPFSWPKSRDYVPYANAPY  155



>gb|AAT39937.2| Putative methyltransferase family protein [Solanum demissum]
Length=755

 Score =   271 bits (692),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 144/157 (92%), Gaps = 3/157 (2%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTS-KDCNIL  322
            MA K  SGD+RTR+SVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIA+ VTKT+ ++C+IL
Sbjct  1    MAGK-NSGDNRTRTSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIAVAVTKTAGENCDIL  59

Query  323  PSLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHC  502
            P+LNFET H+G AG  DESE +V+E+KPC P+YTDYTPCQDQ+RAMTF R+NM YRERHC
Sbjct  60   PNLNFETRHAGEAGGTDESE-EVEELKPCDPQYTDYTPCQDQKRAMTFPRENMNYRERHC  118

Query  503  PPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            PP+E+KLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY
Sbjct  119  PPQEEKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  155



>ref|XP_007153607.1| hypothetical protein PHAVU_003G049900g [Phaseolus vulgaris]
 ref|XP_007153608.1| hypothetical protein PHAVU_003G049900g [Phaseolus vulgaris]
 gb|ESW25601.1| hypothetical protein PHAVU_003G049900g [Phaseolus vulgaris]
 gb|ESW25602.1| hypothetical protein PHAVU_003G049900g [Phaseolus vulgaris]
Length=610

 Score =   266 bits (681),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = +2

Query  155  KVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLN  334
            K +S D RTRSSV I IV GLCCFFY+LGAWQRSGFGKGD IALE+TKT+++CNI+P+L+
Sbjct  3    KTSSADGRTRSSVQIIIVVGLCCFFYILGAWQRSGFGKGDGIALEITKTNEECNIVPNLS  62

Query  335  FETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCPPRE  514
            F++HH G  G IDE++SK K  KPC  RYTDYTPCQDQ+RAMTF R+NMIYRERHCPP E
Sbjct  63   FDSHHGGEVGEIDEADSKAKAFKPCAARYTDYTPCQDQKRAMTFPRENMIYRERHCPPEE  122

Query  515  KKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            +K  C+IPAPKGYVTPFPWPKSRDYVP+ANAPY
Sbjct  123  EKFQCMIPAPKGYVTPFPWPKSRDYVPFANAPY  155



>ref|XP_010527898.1| PREDICTED: probable methyltransferase PMT2 [Tarenaya hassleriana]
Length=615

 Score =   266 bits (681),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 131/156 (84%), Gaps = 0/156 (0%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K  S D+RTRSS+ IFIV GLCCFFY+LGAWQRSGFGKGDSIALE+TK S DCNI+P
Sbjct  1    MALKSASADNRTRSSMQIFIVFGLCCFFYILGAWQRSGFGKGDSIALEITKNSADCNIIP  60

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            SLNFETHH G   S DES+ + K  +PC  RYTDYTPCQD RRAMTF+R+NM YRERHCP
Sbjct  61   SLNFETHHGGEVSSTDESKLEEKAFEPCRSRYTDYTPCQDPRRAMTFTRENMFYRERHCP  120

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P  KKLHCLIPAP GYVTPF WPKSRDYVPYANAPY
Sbjct  121  PENKKLHCLIPAPNGYVTPFTWPKSRDYVPYANAPY  156



>gb|AAU90305.2| Methyltransferase, putative [Solanum tuberosum]
Length=718

 Score =   269 bits (687),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 126/157 (80%), Positives = 143/157 (91%), Gaps = 3/157 (2%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTS-KDCNIL  322
            MA K  SGD+RTR+SVSIFI+AGLCCFFYLLGAWQRSGFGKGDSIA  VTKT+ ++C+IL
Sbjct  1    MAGK-NSGDNRTRTSVSIFIIAGLCCFFYLLGAWQRSGFGKGDSIAEAVTKTAGENCDIL  59

Query  323  PSLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHC  502
            P+LNFET H+G AG  DESE +V+E+KPC P+YTDYTPCQDQ+RAMTF R+NM YRERHC
Sbjct  60   PNLNFETRHAGEAGGTDESE-EVEELKPCDPQYTDYTPCQDQKRAMTFPRENMNYRERHC  118

Query  503  PPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            PP+E+KLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY
Sbjct  119  PPQEEKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  155



>gb|KJB60755.1| hypothetical protein B456_009G324300 [Gossypium raimondii]
Length=514

 Score =   264 bits (674),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 132/156 (85%), Gaps = 1/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K  S D RTRS V IFIV GLCCFFY+LGAWQRSGFGKGDSIALE+TK   DCNI+P
Sbjct  1    MALKPNSPDGRTRSWVQIFIVFGLCCFFYILGAWQRSGFGKGDSIALEITKHGADCNIIP  60

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            SLNFETHH+G  G++ ESE K+K  +PC PRY DYTPCQDQ+RAMTF R NMIYRERHCP
Sbjct  61   SLNFETHHAGEVGNVGESE-KIKSFQPCPPRYVDYTPCQDQKRAMTFPRDNMIYRERHCP  119

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
              E+KLHCL+PAP GYVTPFPWPKSRDYVPYANAPY
Sbjct  120  REEEKLHCLVPAPTGYVTPFPWPKSRDYVPYANAPY  155



>ref|NP_001280936.1| uncharacterized protein LOC103402903 [Malus domestica]
 gb|AAF27920.1|AF220204_1 unknown [Malus domestica]
Length=608

 Score =   266 bits (680),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = +2

Query  161  TSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLNFE  340
             + D RTRSSV IFI AGLCCFFY+LGAWQRSGFGKGDSIAL +TK   DCNI+PSL+F+
Sbjct  5    ANADGRTRSSVQIFIAAGLCCFFYILGAWQRSGFGKGDSIALAITKNEADCNIIPSLSFD  64

Query  341  THHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCPPREKK  520
            + H+G  G+IDESESK K  +PCH RYTDYTPCQDQ+RAMTF R++M YRERHCPP E+K
Sbjct  65   SQHAGEVGNIDESESKPKVFEPCHHRYTDYTPCQDQKRAMTFPREDMNYRERHCPPEEEK  124

Query  521  LHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            LHCLIPAPKGYVTPFPWPKSRDYVPYANAPY
Sbjct  125  LHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  155



>gb|KJB60756.1| hypothetical protein B456_009G324300 [Gossypium raimondii]
Length=540

 Score =   263 bits (673),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 132/156 (85%), Gaps = 1/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K  S D RTRS V IFIV GLCCFFY+LGAWQRSGFGKGDSIALE+TK   DCNI+P
Sbjct  1    MALKPNSPDGRTRSWVQIFIVFGLCCFFYILGAWQRSGFGKGDSIALEITKHGADCNIIP  60

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            SLNFETHH+G  G++ ESE K+K  +PC PRY DYTPCQDQ+RAMTF R NMIYRERHCP
Sbjct  61   SLNFETHHAGEVGNVGESE-KIKSFQPCPPRYVDYTPCQDQKRAMTFPRDNMIYRERHCP  119

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
              E+KLHCL+PAP GYVTPFPWPKSRDYVPYANAPY
Sbjct  120  REEEKLHCLVPAPTGYVTPFPWPKSRDYVPYANAPY  155



>ref|XP_010257294.1| PREDICTED: probable methyltransferase PMT2 [Nelumbo nucifera]
Length=615

 Score =   265 bits (678),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/153 (79%), Positives = 135/153 (88%), Gaps = 2/153 (1%)
 Frame = +2

Query  155  KVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLN  334
            K+ S DSRTRSSVSIFIV GLCCFFY+LGAWQ+SGFGKGDSIA+E+TK + DC++L +LN
Sbjct  3    KINSADSRTRSSVSIFIVVGLCCFFYILGAWQKSGFGKGDSIAVEITKQT-DCSVLANLN  61

Query  335  FETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCPPRE  514
            FETHH+G AG ID+ +SK +  K C  RY DYTPCQDQRRAMTF RQNMIYRERHCPP E
Sbjct  62   FETHHTGEAGVIDD-QSKAEVFKSCGARYIDYTPCQDQRRAMTFPRQNMIYRERHCPPEE  120

Query  515  KKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            +KLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY
Sbjct  121  EKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  153



>ref|XP_006586024.1| PREDICTED: probable methyltransferase PMT2-like isoform X3 [Glycine 
max]
Length=534

 Score =   263 bits (671),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = +2

Query  155  KVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLN  334
            K +S D RTRSSV IFIV GLCCFFY+LGAWQRSGFGKGDSIALE+TKT+ +CNI+P+L+
Sbjct  3    KPSSADGRTRSSVQIFIVVGLCCFFYILGAWQRSGFGKGDSIALEITKTNTECNIVPNLS  62

Query  335  FETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCPPRE  514
            F++HH G     DE++SK K  +PC  RYTDYTPCQDQ+RAMTF R+NM+YRERHCPP E
Sbjct  63   FDSHHGGEVNEFDEADSKPKVFEPCAARYTDYTPCQDQKRAMTFPRENMVYRERHCPPEE  122

Query  515  KKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            +KL C+IPAPKGYVTPFPWPKSRDYVPYANAPY
Sbjct  123  EKLQCMIPAPKGYVTPFPWPKSRDYVPYANAPY  155



>gb|KDO76124.1| hypothetical protein CISIN_1g0367251mg, partial [Citrus sinensis]
Length=285

 Score =   255 bits (651),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 133/156 (85%), Gaps = 1/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K  SG++RTR S+S+FIV GLCCFFY+LGAWQRSGFGKGDSIALE+TK + DC+IL 
Sbjct  1    MATKGNSGENRTRGSMSLFIVVGLCCFFYILGAWQRSGFGKGDSIALEITKKT-DCSILS  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +LN+ETHH G AG++D+SES  +E KPC  RY DYTPCQDQ RAM F R+NM YRERHCP
Sbjct  60   NLNYETHHGGDAGTVDDSESNFQEFKPCDDRYIDYTPCQDQMRAMLFPRKNMNYRERHCP  119

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P ++KLHCLIPAPKGY TPF WPKSRDYVPYANAPY
Sbjct  120  PPDEKLHCLIPAPKGYATPFRWPKSRDYVPYANAPY  155



>ref|XP_004228376.1| PREDICTED: probable methyltransferase PMT2 [Solanum lycopersicum]
Length=612

 Score =   265 bits (676),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 139/156 (89%), Gaps = 1/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MANK + GD+RTR+SVSIFIVAGLC FFYLLG+WQRSG GKGDSIAL VT++ ++CNILP
Sbjct  1    MANK-SMGDNRTRTSVSIFIVAGLCFFFYLLGSWQRSGVGKGDSIALAVTRSGENCNILP  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +LNFET H G+AGSID+S ++VK+ KPC PRYTD+TPCQDQ+RAM   R+NMIYRERHCP
Sbjct  60   NLNFETRHGGQAGSIDDSGTEVKKFKPCRPRYTDHTPCQDQKRAMHLPRENMIYRERHCP  119

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P EKKL+CLIPAPKGYV PFPWPKSRDYVPY NAPY
Sbjct  120  PPEKKLNCLIPAPKGYVAPFPWPKSRDYVPYVNAPY  155



>gb|KJB60757.1| hypothetical protein B456_009G324300 [Gossypium raimondii]
Length=616

 Score =   265 bits (676),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 132/156 (85%), Gaps = 1/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K  S D RTRS V IFIV GLCCFFY+LGAWQRSGFGKGDSIALE+TK   DCNI+P
Sbjct  1    MALKPNSPDGRTRSWVQIFIVFGLCCFFYILGAWQRSGFGKGDSIALEITKHGADCNIIP  60

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            SLNFETHH+G  G++ ESE K+K  +PC PRY DYTPCQDQ+RAMTF R NMIYRERHCP
Sbjct  61   SLNFETHHAGEVGNVGESE-KIKSFQPCPPRYVDYTPCQDQKRAMTFPRDNMIYRERHCP  119

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
              E+KLHCL+PAP GYVTPFPWPKSRDYVPYANAPY
Sbjct  120  REEEKLHCLVPAPTGYVTPFPWPKSRDYVPYANAPY  155



>ref|XP_006602298.1| PREDICTED: probable methyltransferase PMT2-like [Glycine max]
Length=608

 Score =   264 bits (674),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 116/153 (76%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = +2

Query  155  KVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLN  334
            K +S D RTRSSV IFIV GLCCFFY+LGAWQRSGFGKGDSIALE+TKT  +CNI+P+L+
Sbjct  3    KPSSADGRTRSSVQIFIVVGLCCFFYILGAWQRSGFGKGDSIALEITKTKAECNIVPNLS  62

Query  335  FETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCPPRE  514
            F++HH G    IDE++SK K  +PC  RYTDYTPCQDQ+RAMTF R+NM+YRERHCPP E
Sbjct  63   FDSHHGGEVSEIDEADSKPKVFEPCAARYTDYTPCQDQKRAMTFPRENMVYRERHCPPEE  122

Query  515  KKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            +KL C+IPAPKGYVTPFPWPKSRDYVPYANAPY
Sbjct  123  EKLRCMIPAPKGYVTPFPWPKSRDYVPYANAPY  155



>gb|KHN17371.1| Putative methyltransferase PMT2 [Glycine soja]
Length=608

 Score =   264 bits (674),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 116/153 (76%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = +2

Query  155  KVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLN  334
            K +S D RTRSSV IFIV GLCCFFY+LGAWQRSGFGKGDSIALE+TKT  +CNI+P+L+
Sbjct  3    KPSSADGRTRSSVQIFIVVGLCCFFYILGAWQRSGFGKGDSIALEITKTKAECNIVPNLS  62

Query  335  FETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCPPRE  514
            F++HH G    IDE++SK K  +PC  RYTDYTPCQDQ+RAMTF R+NM+YRERHCPP E
Sbjct  63   FDSHHGGEVSEIDEADSKPKVFEPCAARYTDYTPCQDQKRAMTFPRENMVYRERHCPPEE  122

Query  515  KKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            +KL C+IPAPKGYVTPFPWPKSRDYVPYANAPY
Sbjct  123  EKLRCMIPAPKGYVTPFPWPKSRDYVPYANAPY  155



>gb|ACJ85858.1| unknown [Medicago truncatula]
Length=610

 Score =   264 bits (674),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = +2

Query  155  KVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLN  334
            K ++ D+RTRSSV IFIV GLCCFFY+LGAWQRSGFGKGDSIALE+TK + +C+++P+L+
Sbjct  3    KPSAADNRTRSSVQIFIVVGLCCFFYILGAWQRSGFGKGDSIALEITKNNAECDVVPNLS  62

Query  335  FETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCPPRE  514
            F++HH+G    IDES S  K  KPC  RYTDYTPCQDQRRAMTF R+NM YRERHCPP E
Sbjct  63   FDSHHAGEVSQIDESNSNTKVFKPCEARYTDYTPCQDQRRAMTFPRENMNYRERHCPPEE  122

Query  515  KKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            +KLHC+IPAPKGYVTPFPWPKSRDYVPYANAPY
Sbjct  123  EKLHCMIPAPKGYVTPFPWPKSRDYVPYANAPY  155



>ref|XP_003628357.1| hypothetical protein MTR_8g055840 [Medicago truncatula]
 gb|AET02833.1| methyltransferase PMT2-like protein [Medicago truncatula]
Length=610

 Score =   264 bits (674),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = +2

Query  155  KVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLN  334
            K ++ D+RTRSSV IFIV GLCCFFY+LGAWQRSGFGKGDSIALE+TK + +C+++P+L+
Sbjct  3    KPSAADNRTRSSVQIFIVVGLCCFFYILGAWQRSGFGKGDSIALEITKNNAECDVVPNLS  62

Query  335  FETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCPPRE  514
            F++HH+G    IDES S  K  KPC  RYTDYTPCQDQRRAMTF R+NM YRERHCPP E
Sbjct  63   FDSHHAGEVSQIDESNSNTKVFKPCEARYTDYTPCQDQRRAMTFPRENMNYRERHCPPEE  122

Query  515  KKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            +KLHC+IPAPKGYVTPFPWPKSRDYVPYANAPY
Sbjct  123  EKLHCMIPAPKGYVTPFPWPKSRDYVPYANAPY  155



>ref|XP_008339908.1| PREDICTED: probable methyltransferase PMT2 [Malus domestica]
Length=608

 Score =   263 bits (673),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = +2

Query  161  TSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLNFE  340
             + D RTRSSV IFI AGLCCFFY+LGAWQRSGFGKGDSIA  +TK   DCNI+PSL+F+
Sbjct  5    ANADGRTRSSVQIFIXAGLCCFFYILGAWQRSGFGKGDSIAXAITKNEADCNIIPSLSFD  64

Query  341  THHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCPPREKK  520
            + H+G  G+IDESESK K  +PCH RYTDYTPCQDQ+RAMTF R++M YRERHCPP E+K
Sbjct  65   SQHAGEVGNIDESESKPKVFEPCHHRYTDYTPCQDQKRAMTFPREDMNYRERHCPPEEEK  124

Query  521  LHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            LHCLIPAPKGYVTPFPWPKSRDYVPYANAPY
Sbjct  125  LHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  155



>ref|XP_003532062.1| PREDICTED: probable methyltransferase PMT2-like isoformX1 [Glycine 
max]
 ref|XP_003532063.1| PREDICTED: probable methyltransferase PMT2-like isoformX2 [Glycine 
max]
Length=608

 Score =   263 bits (672),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = +2

Query  155  KVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLN  334
            K +S D RTRSSV IFIV GLCCFFY+LGAWQRSGFGKGDSIALE+TKT+ +CNI+P+L+
Sbjct  3    KPSSADGRTRSSVQIFIVVGLCCFFYILGAWQRSGFGKGDSIALEITKTNTECNIVPNLS  62

Query  335  FETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCPPRE  514
            F++HH G     DE++SK K  +PC  RYTDYTPCQDQ+RAMTF R+NM+YRERHCPP E
Sbjct  63   FDSHHGGEVNEFDEADSKPKVFEPCAARYTDYTPCQDQKRAMTFPRENMVYRERHCPPEE  122

Query  515  KKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            +KL C+IPAPKGYVTPFPWPKSRDYVPYANAPY
Sbjct  123  EKLQCMIPAPKGYVTPFPWPKSRDYVPYANAPY  155



>ref|XP_004511207.1| PREDICTED: probable methyltransferase PMT2-like isoform X1 [Cicer 
arietinum]
 ref|XP_004511208.1| PREDICTED: probable methyltransferase PMT2-like isoform X2 [Cicer 
arietinum]
Length=610

 Score =   263 bits (671),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 135/153 (88%), Gaps = 0/153 (0%)
 Frame = +2

Query  155  KVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLN  334
            K +  D+RTRSSV IFIV GLCCFFY+LGAWQRSGFGKGDSIALE+TK + +C+++P+L+
Sbjct  3    KPSHADNRTRSSVQIFIVVGLCCFFYILGAWQRSGFGKGDSIALEITKHNAECDVVPNLS  62

Query  335  FETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCPPRE  514
            F++HH+G+   I+E++SK K  KPC  RYTDYTPCQDQRRAMTF R+NM YRERHCPP E
Sbjct  63   FDSHHAGKVSQINEADSKTKAFKPCKARYTDYTPCQDQRRAMTFPRENMNYRERHCPPEE  122

Query  515  KKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            +KLHC+IPAPKGYVTPFPWPKSRDYVPYANAPY
Sbjct  123  EKLHCMIPAPKGYVTPFPWPKSRDYVPYANAPY  155



>ref|XP_002273644.1| PREDICTED: probable methyltransferase PMT2 [Vitis vinifera]
Length=618

 Score =   262 bits (669),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 133/156 (85%), Gaps = 0/156 (0%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K+ S DSRTRSS+SIFIV GLCCFFY+LGAWQRSGFGKGDSIA+E+TK+  DC+I+ 
Sbjct  1    MATKIISADSRTRSSISIFIVVGLCCFFYILGAWQRSGFGKGDSIAVEMTKSGADCSIIS  60

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +LNFETHH G   + D+SESK K  KPC  +Y DYTPCQ Q+RAMTF R+NM+YRERHCP
Sbjct  61   NLNFETHHGGEPVTTDDSESKPKVFKPCRSKYIDYTPCQHQKRAMTFPRENMVYRERHCP  120

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
               +KLHCLIPAP+GYVTPFPWPKSRDYVPYANAPY
Sbjct  121  AENEKLHCLIPAPEGYVTPFPWPKSRDYVPYANAPY  156



>gb|KHG23981.1| hypothetical protein F383_09020 [Gossypium arboreum]
Length=616

 Score =   261 bits (668),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 133/156 (85%), Gaps = 1/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K  S D+RTRSS+ I IV GLCCFFY+LGAWQRSGFGKGDSIALE+TK S DC+I+P
Sbjct  1    MALKPISTDTRTRSSIQISIVVGLCCFFYILGAWQRSGFGKGDSIALEMTKHSADCSIVP  60

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +LNFETHH+G  G++DESE K K  +PC PRY DYTPCQDQ RAMTF R NMIYRERHCP
Sbjct  61   TLNFETHHAGEVGNVDESE-KPKSFEPCDPRYVDYTPCQDQSRAMTFPRDNMIYRERHCP  119

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
              E+KLHCL+PAP GYVTPFPWPKSRDYVPYANAPY
Sbjct  120  REEEKLHCLVPAPNGYVTPFPWPKSRDYVPYANAPY  155



>ref|XP_010552579.1| PREDICTED: probable methyltransferase PMT2 [Tarenaya hassleriana]
Length=615

 Score =   261 bits (667),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 137/156 (88%), Gaps = 2/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K +S DSRTRSS+ IF+V GLCCFFY+LGAWQRSGFGKGDSIALE+TK+  DCN++P
Sbjct  1    MALKSSSVDSRTRSSIQIFVVVGLCCFFYILGAWQRSGFGKGDSIALEMTKSGSDCNMVP  60

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            SL+FETHH+G   S++ES SK K  +PC  RYTDYTPCQDQRRAMTF R+NMIYRERHCP
Sbjct  61   SLSFETHHTGDL-SVEES-SKAKAFEPCDARYTDYTPCQDQRRAMTFPRENMIYRERHCP  118

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P E+KL+C+IPAP GYVTPFPWPKSRDYVPYANAPY
Sbjct  119  PEEEKLNCMIPAPNGYVTPFPWPKSRDYVPYANAPY  154



>ref|XP_010532828.1| PREDICTED: probable methyltransferase PMT2 [Tarenaya hassleriana]
Length=615

 Score =   260 bits (665),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 137/156 (88%), Gaps = 2/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K +S D++TRSSV IFIV GLCCFFY+LGAWQRSGFGKGDSIALE+TK+  DCN++P
Sbjct  1    MALKSSSVDNKTRSSVQIFIVVGLCCFFYILGAWQRSGFGKGDSIALEMTKSGIDCNLVP  60

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            SL+FETHHSG   ++DES SK +  +PC  R+TDYTPCQDQRRAMTF R+NMIYRERHCP
Sbjct  61   SLSFETHHSGDL-TVDES-SKPEAFEPCDARFTDYTPCQDQRRAMTFPRENMIYRERHCP  118

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P E+KLHCLIPAP GYVTPFPWPKSRDYVPYANAPY
Sbjct  119  PEEEKLHCLIPAPNGYVTPFPWPKSRDYVPYANAPY  154



>ref|XP_003518725.1| PREDICTED: probable methyltransferase PMT2-like [Glycine max]
Length=607

 Score =   259 bits (662),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = +2

Query  155  KVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLN  334
            K +S + RTRS V IFIV G+CCFFY+LGAWQRSGFGKGDSIALE+TK   DCN++P+L+
Sbjct  3    KPSSANGRTRSHVQIFIVVGMCCFFYILGAWQRSGFGKGDSIALEITKKGADCNVVPNLS  62

Query  335  FETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCPPRE  514
            F++HH G    IDE ESK K  +PC  RY DYTPCQDQRRAMTF R+NM YRERHCPP E
Sbjct  63   FDSHHGGEVSKIDEFESKSKVFEPCDARYIDYTPCQDQRRAMTFPRENMNYRERHCPPEE  122

Query  515  KKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            +KLHC+IPAPKGYVTPFPWPKSRDYVPYANAPY
Sbjct  123  EKLHCMIPAPKGYVTPFPWPKSRDYVPYANAPY  155



>ref|XP_003517972.1| PREDICTED: probable methyltransferase PMT2-like [Glycine max]
Length=607

 Score =   259 bits (662),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 128/153 (84%), Gaps = 0/153 (0%)
 Frame = +2

Query  155  KVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLN  334
            K +S D RTRS V IFIV GLCCFFY+LGAWQRSGFGKGDSIALE+TK   DCN++P+L+
Sbjct  3    KPSSADGRTRSHVQIFIVVGLCCFFYILGAWQRSGFGKGDSIALEITKKGADCNVVPNLS  62

Query  335  FETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCPPRE  514
            F++HH G    I E ESK K  +PC  RY DYTPCQDQRRAMTF R+NM YRERHCPP E
Sbjct  63   FDSHHGGEVSKIGEFESKSKVFEPCDSRYIDYTPCQDQRRAMTFPRENMNYRERHCPPEE  122

Query  515  KKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            +KLHC+IPAPKGYVTPFPWPKSRDYVPYANAPY
Sbjct  123  EKLHCMIPAPKGYVTPFPWPKSRDYVPYANAPY  155



>ref|XP_008441700.1| PREDICTED: probable methyltransferase PMT2 [Cucumis melo]
 ref|XP_008441701.1| PREDICTED: probable methyltransferase PMT2 [Cucumis melo]
Length=616

 Score =   259 bits (662),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 134/156 (86%), Gaps = 1/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K +S D RTRSSV IFIV GLC FFY+LGAWQRSGFGKGDSIA+E+TK+  DCNI+ 
Sbjct  1    MAPKPSSADGRTRSSVQIFIVVGLCLFFYILGAWQRSGFGKGDSIAMEITKSGSDCNIVS  60

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +LNFETHH G A + ++SES++K  +PC  +YTDYTPCQDQRRAMTF R NMIYRERHCP
Sbjct  61   NLNFETHHGGEAET-NDSESQLKIFEPCDAQYTDYTPCQDQRRAMTFPRNNMIYRERHCP  119

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
              E+KLHCLIPAPKGYVTPFPWPKSRDYVP+ANAPY
Sbjct  120  AEEEKLHCLIPAPKGYVTPFPWPKSRDYVPFANAPY  155



>ref|XP_006415973.1| hypothetical protein EUTSA_v10007096mg [Eutrema salsugineum]
 gb|ESQ34326.1| hypothetical protein EUTSA_v10007096mg [Eutrema salsugineum]
Length=616

 Score =   259 bits (662),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 132/157 (84%), Gaps = 1/157 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K +SGD +TRSSV IFIV  LCCFFY+LGAWQRSGFGKGDSIALE+T +  DCNI+P
Sbjct  1    MALKSSSGDGKTRSSVQIFIVFSLCCFFYILGAWQRSGFGKGDSIALEMTNSGADCNIVP  60

Query  326  SLNFETHHSGRAGSIDESES-KVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHC  502
            SLNFETHH+G +  +  SE+ KVK  +PC  RYTDYTPCQDQRRAMTF R +MIYRERHC
Sbjct  61   SLNFETHHAGESSIVGASEAAKVKAFEPCDARYTDYTPCQDQRRAMTFPRDSMIYRERHC  120

Query  503  PPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
             P  +KLHCLIPAPKGYVTPF WPKSRDYVPYANAPY
Sbjct  121  APENEKLHCLIPAPKGYVTPFSWPKSRDYVPYANAPY  157



>ref|NP_849711.1| putative methyltransferase PMT2 [Arabidopsis thaliana]
 gb|AEE30750.1| putative methyltransferase PMT2 [Arabidopsis thaliana]
Length=506

 Score =   256 bits (654),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 131/157 (83%), Gaps = 1/157 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K +S D +TRSSV IFIV  LCCFFY+LGAWQRSGFGKGDSIALE+T +  DCNI+P
Sbjct  1    MALKSSSADGKTRSSVQIFIVFSLCCFFYILGAWQRSGFGKGDSIALEMTNSGADCNIVP  60

Query  326  SLNFETHHSGRAGSIDESES-KVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHC  502
            SLNFETHH+G +  +  SE+ KVK  +PC  RYTDYTPCQDQRRAMTF R +MIYRERHC
Sbjct  61   SLNFETHHAGESSLVGASEAAKVKAFEPCDGRYTDYTPCQDQRRAMTFPRDSMIYRERHC  120

Query  503  PPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
             P  +KLHCLIPAPKGYVTPF WPKSRDYVPYANAPY
Sbjct  121  APENEKLHCLIPAPKGYVTPFSWPKSRDYVPYANAPY  157



>ref|XP_011015217.1| PREDICTED: probable methyltransferase PMT2 [Populus euphratica]
 ref|XP_011015218.1| PREDICTED: probable methyltransferase PMT2 [Populus euphratica]
Length=617

 Score =   259 bits (661),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 133/156 (85%), Gaps = 0/156 (0%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K  SGD RTRSS+ IFIVAGLCCFFY+LGAWQRSGFGK D++A  + K+++DCNI+P
Sbjct  1    MALKSNSGDGRTRSSMQIFIVAGLCCFFYILGAWQRSGFGKADNLAERIIKSTEDCNIIP  60

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +L FETHH G  G  D+SESK K  +PC  R+TDYTPCQDQ RAMTF R+NMIYRERHCP
Sbjct  61   NLTFETHHGGDVGPNDDSESKSKIYQPCPSRFTDYTPCQDQSRAMTFPRENMIYRERHCP  120

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P+++KLHCLIPAPKGYV PFPWPKSRDYVP+ANAPY
Sbjct  121  PQQEKLHCLIPAPKGYVNPFPWPKSRDYVPFANAPY  156



>ref|XP_011021619.1| PREDICTED: probable methyltransferase PMT2 [Populus euphratica]
 ref|XP_011021621.1| PREDICTED: probable methyltransferase PMT2 [Populus euphratica]
Length=617

 Score =   259 bits (661),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 133/156 (85%), Gaps = 0/156 (0%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K  SGD RTRSS+ IFIVAGLCCFFY+LGAWQRSGFGK D++A  + K+++DCNI+P
Sbjct  1    MALKSNSGDGRTRSSMQIFIVAGLCCFFYILGAWQRSGFGKADNLAERIIKSTEDCNIIP  60

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +L FETHH G  G  D+SESK K  +PC  R+TDYTPCQDQ RAMTF R+NMIYRERHCP
Sbjct  61   NLTFETHHGGDVGPNDDSESKSKIYQPCPSRFTDYTPCQDQSRAMTFPRENMIYRERHCP  120

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P+++KLHCLIPAPKGYV PFPWPKSRDYVP+ANAPY
Sbjct  121  PQQEKLHCLIPAPKGYVNPFPWPKSRDYVPFANAPY  156



>ref|XP_007157631.1| hypothetical protein PHAVU_002G085900g [Phaseolus vulgaris]
 gb|ESW29625.1| hypothetical protein PHAVU_002G085900g [Phaseolus vulgaris]
Length=607

 Score =   258 bits (660),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 127/153 (83%), Gaps = 0/153 (0%)
 Frame = +2

Query  155  KVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLN  334
            K +SGD RTRSSV IFIV GLCCFFY+LGAWQRSGFGKGDSIALE+TK   DCNI P L+
Sbjct  3    KPSSGDGRTRSSVQIFIVVGLCCFFYMLGAWQRSGFGKGDSIALEITKKGSDCNIRPDLS  62

Query  335  FETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCPPRE  514
            F++HH G    IDE ESK K  +PC   + DYTPCQDQRRAMTF R+NM YRERHCPP E
Sbjct  63   FDSHHGGEVSRIDEFESKPKVFEPCSAHFIDYTPCQDQRRAMTFPRENMNYRERHCPPEE  122

Query  515  KKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            +KLHCLIPAPKGYVTPF WPKSRDYVPYANAPY
Sbjct  123  EKLHCLIPAPKGYVTPFSWPKSRDYVPYANAPY  155



>ref|XP_004490044.1| PREDICTED: probable methyltransferase PMT2-like isoform X1 [Cicer 
arietinum]
 ref|XP_004490045.1| PREDICTED: probable methyltransferase PMT2-like isoform X2 [Cicer 
arietinum]
Length=608

 Score =   258 bits (658),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 128/153 (84%), Gaps = 0/153 (0%)
 Frame = +2

Query  155  KVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLN  334
            K  S DSRTRSSV IFIV GLCCFFY+LGAWQRSGFGKGDS+ALE+TK   DC+I+ +L+
Sbjct  3    KPNSADSRTRSSVQIFIVVGLCCFFYILGAWQRSGFGKGDSLALEITKKGADCDIVSNLS  62

Query  335  FETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCPPRE  514
            F+THH G    ID  +SK K  KPC+ RYTDYTPCQDQR AMTFSR+NMIYRERHCP  E
Sbjct  63   FDTHHGGEVSKIDNVDSKPKVFKPCNVRYTDYTPCQDQRHAMTFSRENMIYRERHCPLEE  122

Query  515  KKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
             KLHCLIPAPKGYVTPF WPKSRDYVPYANAPY
Sbjct  123  DKLHCLIPAPKGYVTPFSWPKSRDYVPYANAPY  155



>ref|XP_002315803.2| hypothetical protein POPTR_0010s10420g [Populus trichocarpa]
 gb|EEF01974.2| hypothetical protein POPTR_0010s10420g [Populus trichocarpa]
Length=617

 Score =   258 bits (659),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 133/156 (85%), Gaps = 0/156 (0%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K +S D RTRSS+ IFIVAGLCCFFY+LGAWQRSGFGK D++A  + K+++DCNI+P
Sbjct  1    MALKSSSADGRTRSSMQIFIVAGLCCFFYILGAWQRSGFGKADNLAERIIKSTEDCNIIP  60

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +L FETHH G  G  D+SESK K  +PC  R+TDYTPCQDQ RAMTF R NMIYRERHCP
Sbjct  61   NLTFETHHGGDVGPDDDSESKSKIYQPCPSRFTDYTPCQDQSRAMTFPRDNMIYRERHCP  120

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P+++KLHCLIPAPKGYVTPFPWPKSRDYVP+ANAPY
Sbjct  121  PQQEKLHCLIPAPKGYVTPFPWPKSRDYVPFANAPY  156



>ref|XP_006303579.1| hypothetical protein CARUB_v10011097mg [Capsella rubella]
 gb|EOA36477.1| hypothetical protein CARUB_v10011097mg [Capsella rubella]
Length=616

 Score =   258 bits (658),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 132/157 (84%), Gaps = 1/157 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K +S D +TRSSV IFIV  LCCFFY+LGAWQRSGFGKGDSIALE+T +  DCNI+P
Sbjct  1    MAMKSSSADGKTRSSVQIFIVFSLCCFFYILGAWQRSGFGKGDSIALEMTNSGADCNIVP  60

Query  326  SLNFETHHSGRAGSIDESES-KVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHC  502
            SLNFETHH+G +  +  SE+ KVK  +PC  RYTDYTPCQDQRRAMTF R +MIYRERHC
Sbjct  61   SLNFETHHAGESSIVGASEAAKVKAFEPCDARYTDYTPCQDQRRAMTFPRDSMIYRERHC  120

Query  503  PPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
             P ++KLHCLIPAPKGYVTPF WPKSRDYVPYANAPY
Sbjct  121  APEKEKLHCLIPAPKGYVTPFSWPKSRDYVPYANAPY  157



>ref|XP_010460256.1| PREDICTED: probable methyltransferase PMT2 [Camelina sativa]
 ref|XP_010477804.1| PREDICTED: probable methyltransferase PMT2 [Camelina sativa]
Length=616

 Score =   258 bits (658),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 132/157 (84%), Gaps = 1/157 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K +S D +TRSSV IFIV  LCCFFY+LGAWQRSGFGKGDSIALE+T +  DCNI+P
Sbjct  1    MAMKSSSADGKTRSSVQIFIVFSLCCFFYILGAWQRSGFGKGDSIALEMTNSGADCNIVP  60

Query  326  SLNFETHHSGRAGSIDESES-KVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHC  502
            SLNFETHH+G +  +  SE+ KVK  +PC  RYTDYTPCQDQRRAMTF R +MIYRERHC
Sbjct  61   SLNFETHHAGESSIVGASEAAKVKAFEPCDARYTDYTPCQDQRRAMTFPRDSMIYRERHC  120

Query  503  PPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
             P ++KLHCLIPAPKGYVTPF WPKSRDYVPYANAPY
Sbjct  121  APEKEKLHCLIPAPKGYVTPFSWPKSRDYVPYANAPY  157



>ref|XP_006439601.1| hypothetical protein CICLE_v10019341mg [Citrus clementina]
 gb|ESR52841.1| hypothetical protein CICLE_v10019341mg [Citrus clementina]
Length=572

 Score =   256 bits (655),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 133/156 (85%), Gaps = 1/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K  SG++RTR S+S+FIV GLCCFFY+LGAWQRSGFGKGDSIALE+TK + DC+IL 
Sbjct  1    MATKGNSGENRTRGSMSLFIVVGLCCFFYILGAWQRSGFGKGDSIALEITKKT-DCSILS  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +LN+ETHH G AG++D+SES  +E KPC  RY DYTPCQDQ RAM F R+NM YRERHCP
Sbjct  60   NLNYETHHGGDAGTVDDSESNFQEFKPCDDRYIDYTPCQDQMRAMLFPRKNMNYRERHCP  119

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P ++KLHCLIPAPKGY TPF WPKSRDYVPYANAPY
Sbjct  120  PPDEKLHCLIPAPKGYATPFRWPKSRDYVPYANAPY  155



>ref|XP_004138921.1| PREDICTED: probable methyltransferase PMT2 [Cucumis sativus]
 ref|XP_011649048.1| PREDICTED: probable methyltransferase PMT2 [Cucumis sativus]
 gb|KGN61383.1| hypothetical protein Csa_2G108610 [Cucumis sativus]
Length=616

 Score =   258 bits (658),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 134/156 (86%), Gaps = 1/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K +S D RTRSSV IFIV GLC FFY+LGAWQRSGFGKGDSIA+E+TK+  DCNI+ 
Sbjct  1    MAPKPSSVDGRTRSSVQIFIVVGLCLFFYILGAWQRSGFGKGDSIAMEITKSGSDCNIVS  60

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +LNFETHH G A + ++SES+ K ++PC  +YTDYTPCQDQRRAMTF R NMIYRERHCP
Sbjct  61   NLNFETHHGGEAET-NDSESQSKILEPCDAQYTDYTPCQDQRRAMTFPRNNMIYRERHCP  119

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
              E+KLHCLIPAPKGYVTPFPWPKSRDYVP+ANAPY
Sbjct  120  AEEEKLHCLIPAPKGYVTPFPWPKSRDYVPFANAPY  155



>ref|XP_002311593.1| hypothetical protein POPTR_0008s14720g [Populus trichocarpa]
 gb|EEE88960.1| hypothetical protein POPTR_0008s14720g [Populus trichocarpa]
Length=615

 Score =   258 bits (658),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K +S D RTRSS+ IFIV GLCCFFY+LGAWQRSGFGK D++A+E+TK++ DCNI+P
Sbjct  1    MALKSSSADGRTRSSIQIFIVVGLCCFFYILGAWQRSGFGKADNLAMEITKSTGDCNIIP  60

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +LNFETHH G AGS D+S+SK K  +PCH R+TDYTPCQDQ+RAMTF R+NMIYRERHCP
Sbjct  61   NLNFETHHGGDAGSSDDSDSKPKTFQPCHSRFTDYTPCQDQKRAMTFPRENMIYRERHCP  120

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P+E+KLHCLIPAP+GYVTPFPWPKSRDYVP+ANAPY
Sbjct  121  PQEEKLHCLIPAPQGYVTPFPWPKSRDYVPFANAPY  156



>ref|XP_010498988.1| PREDICTED: probable methyltransferase PMT2 [Camelina sativa]
Length=616

 Score =   258 bits (658),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 132/157 (84%), Gaps = 1/157 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K +S D +TRSSV IFIV  LCCFFY+LGAWQRSGFGKGDSIALE+T +  DCNI+P
Sbjct  1    MAMKSSSADGKTRSSVQIFIVFSLCCFFYILGAWQRSGFGKGDSIALEMTNSGADCNIVP  60

Query  326  SLNFETHHSGRAGSIDESES-KVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHC  502
            SLNFETHH+G +  +  SE+ KVK  +PC  RYTDYTPCQDQRRAMTF R +MIYRERHC
Sbjct  61   SLNFETHHAGESSIVGASEAAKVKAFEPCDARYTDYTPCQDQRRAMTFPRDSMIYRERHC  120

Query  503  PPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
             P ++KLHCLIPAPKGYVTPF WPKSRDYVPYANAPY
Sbjct  121  APEKEKLHCLIPAPKGYVTPFSWPKSRDYVPYANAPY  157



>gb|AAD14491.1| Unknown protein [Arabidopsis thaliana]
Length=590

 Score =   256 bits (655),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 131/157 (83%), Gaps = 1/157 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K +S D +TRSSV IFIV  LCCFFY+LGAWQRSGFGKGDSIALE+T +  DCNI+P
Sbjct  1    MALKSSSADGKTRSSVQIFIVFSLCCFFYILGAWQRSGFGKGDSIALEMTNSGADCNIVP  60

Query  326  SLNFETHHSGRAGSIDESES-KVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHC  502
            SLNFETHH+G +  +  SE+ KVK  +PC  RYTDYTPCQDQRRAMTF R +MIYRERHC
Sbjct  61   SLNFETHHAGESSLVGASEAAKVKAFEPCDGRYTDYTPCQDQRRAMTFPRDSMIYRERHC  120

Query  503  PPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
             P  +KLHCLIPAPKGYVTPF WPKSRDYVPYANAPY
Sbjct  121  APENEKLHCLIPAPKGYVTPFSWPKSRDYVPYANAPY  157



>dbj|BAH19504.1| AT1G26850 [Arabidopsis thaliana]
Length=616

 Score =   257 bits (657),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 132/157 (84%), Gaps = 1/157 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K +S D +TRSSV IFIV  LCCFFY+LGAWQRSGFGKGDSIALE+T +  DCNI+P
Sbjct  1    MALKSSSADGKTRSSVQIFIVFSLCCFFYILGAWQRSGFGKGDSIALEMTNSGADCNIVP  60

Query  326  SLNFETHHSGRAGSIDESES-KVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHC  502
            SLNFETHH+G +  +  SE+ KVK  +PC  RYTDYTPCQDQRRAMTF R +MIYRERHC
Sbjct  61   SLNFETHHAGESSLVGASEAAKVKAFEPCDGRYTDYTPCQDQRRAMTFPRDSMIYRERHC  120

Query  503  PPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
             P+ +KLHCLIPAPKGYVTPF WPKSRDYVPYANAPY
Sbjct  121  APKNEKLHCLIPAPKGYVTPFSWPKSRDYVPYANAPY  157



>ref|XP_002893375.1| dehydration-responsive family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69634.1| dehydration-responsive family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=616

 Score =   257 bits (657),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 132/157 (84%), Gaps = 1/157 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K +S D +TRSSV IFIV  LCCFFY+LGAWQRSGFGKGDSIALE+T +  DCNI+P
Sbjct  1    MALKSSSADGKTRSSVQIFIVFSLCCFFYILGAWQRSGFGKGDSIALEMTNSGADCNIVP  60

Query  326  SLNFETHHSGRAGSIDESES-KVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHC  502
            SLNFETHH+G +  +  SE+ KVK  +PC  RYTDYTPCQDQRRAMTF R +MIYRERHC
Sbjct  61   SLNFETHHAGESSIVGASEAAKVKAFEPCDARYTDYTPCQDQRRAMTFPRDSMIYRERHC  120

Query  503  PPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
             P ++KLHCLIPAPKGYVTPF WPKSRDYVPYANAPY
Sbjct  121  APEKEKLHCLIPAPKGYVTPFSWPKSRDYVPYANAPY  157



>ref|XP_011027055.1| PREDICTED: probable methyltransferase PMT2 [Populus euphratica]
Length=615

 Score =   257 bits (656),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K +S D RTRSS+ IFIV GLCCFFY+LGAWQRSGFGK D++A+E+TK++ DCN++P
Sbjct  1    MALKSSSADGRTRSSIQIFIVVGLCCFFYILGAWQRSGFGKADNLAMEITKSTGDCNVIP  60

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +LNFETHH G AGS D+S+SK K  +PCH R+TDYTPCQDQ+RAMTF R+NMIYRERHCP
Sbjct  61   NLNFETHHGGDAGSSDDSDSKPKTFQPCHSRFTDYTPCQDQKRAMTFPRENMIYRERHCP  120

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P+E+KLHCLIPAP+GYVTPFPWPKSRDYVP+ANAPY
Sbjct  121  PQEEKLHCLIPAPQGYVTPFPWPKSRDYVPFANAPY  156



>ref|XP_011025778.1| PREDICTED: probable methyltransferase PMT2 [Populus euphratica]
 ref|XP_011025787.1| PREDICTED: probable methyltransferase PMT2 [Populus euphratica]
Length=615

 Score =   257 bits (656),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K +S D RTRSS+ IFIV GLCCFFY+LGAWQRSGFGK D++A+E+TK++ DCN++P
Sbjct  1    MALKSSSADGRTRSSIQIFIVVGLCCFFYILGAWQRSGFGKADNLAMEITKSTGDCNVIP  60

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +LNFETHH G AGS D+S+SK K  +PCH R+TDYTPCQDQ+RAMTF R+NMIYRERHCP
Sbjct  61   NLNFETHHGGDAGSSDDSDSKPKTFQPCHSRFTDYTPCQDQKRAMTFPRENMIYRERHCP  120

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P+E+KLHCLIPAP+GYVTPFPWPKSRDYVP+ANAPY
Sbjct  121  PQEEKLHCLIPAPQGYVTPFPWPKSRDYVPFANAPY  156



>ref|XP_006476610.1| PREDICTED: probable methyltransferase PMT2-like isoform X1 [Citrus 
sinensis]
 ref|XP_006476611.1| PREDICTED: probable methyltransferase PMT2-like isoform X2 [Citrus 
sinensis]
Length=613

 Score =   257 bits (656),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 133/156 (85%), Gaps = 1/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K  SG++RTR S+S+FIV GLCCFFY+LGAWQRSGFGKGDSIALE+TK + DC+IL 
Sbjct  1    MATKGNSGENRTRGSMSLFIVVGLCCFFYILGAWQRSGFGKGDSIALEITKKT-DCSILS  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +LN+ETHH G AG++D+SES  +E KPC  RY DYTPCQDQ RAM F R+NM YRERHCP
Sbjct  60   NLNYETHHGGDAGTVDDSESNFQEFKPCDDRYIDYTPCQDQMRAMLFPRKNMNYRERHCP  119

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P ++KLHCLIPAPKGY TPF WPKSRDYVPYANAPY
Sbjct  120  PPDEKLHCLIPAPKGYATPFRWPKSRDYVPYANAPY  155



>ref|XP_008389474.1| PREDICTED: probable methyltransferase PMT2 [Malus domestica]
Length=606

 Score =   256 bits (655),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 131/151 (87%), Gaps = 2/151 (1%)
 Frame = +2

Query  161  TSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLNFE  340
             + D RTRSSV IFIVAGLCCFFY+LGAWQRSGFGKGDSIALE+TK   DC+I+PSL F+
Sbjct  5    ANADGRTRSSVQIFIVAGLCCFFYILGAWQRSGFGKGDSIALEITKNGADCSIIPSLTFD  64

Query  341  THHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCPPREKK  520
            +HH+G AG+IDES+ KV E  PC   YTDYTPCQDQ+RAMTF R++M YRERHCP  E+K
Sbjct  65   SHHAGEAGNIDESKPKVFE--PCQHSYTDYTPCQDQKRAMTFPREDMNYRERHCPREEEK  122

Query  521  LHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            LHCLIPAPKGYVTPFPWPKSRDYVPYANAPY
Sbjct  123  LHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  153



>ref|XP_006439600.1| hypothetical protein CICLE_v10019341mg [Citrus clementina]
 gb|ESR52840.1| hypothetical protein CICLE_v10019341mg [Citrus clementina]
Length=613

 Score =   256 bits (655),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 133/156 (85%), Gaps = 1/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K  SG++RTR S+S+FIV GLCCFFY+LGAWQRSGFGKGDSIALE+TK + DC+IL 
Sbjct  1    MATKGNSGENRTRGSMSLFIVVGLCCFFYILGAWQRSGFGKGDSIALEITKKT-DCSILS  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +LN+ETHH G AG++D+SES  +E KPC  RY DYTPCQDQ RAM F R+NM YRERHCP
Sbjct  60   NLNYETHHGGDAGTVDDSESNFQEFKPCDDRYIDYTPCQDQMRAMLFPRKNMNYRERHCP  119

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P ++KLHCLIPAPKGY TPF WPKSRDYVPYANAPY
Sbjct  120  PPDEKLHCLIPAPKGYATPFRWPKSRDYVPYANAPY  155



>ref|NP_564265.1| putative methyltransferase PMT2 [Arabidopsis thaliana]
 ref|NP_849710.1| putative methyltransferase PMT2 [Arabidopsis thaliana]
 sp|B9DFI7.2|PMT2_ARATH RecName: Full=Probable methyltransferase PMT2 [Arabidopsis thaliana]
 gb|AAK59830.1| At1g26850/T2P11_4 [Arabidopsis thaliana]
 gb|AAN18206.1| At1g26850/T2P11_4 [Arabidopsis thaliana]
 gb|AEE30749.1| putative methyltransferase PMT2 [Arabidopsis thaliana]
 gb|AEE30751.1| putative methyltransferase PMT2 [Arabidopsis thaliana]
Length=616

 Score =   256 bits (655),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 131/157 (83%), Gaps = 1/157 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K +S D +TRSSV IFIV  LCCFFY+LGAWQRSGFGKGDSIALE+T +  DCNI+P
Sbjct  1    MALKSSSADGKTRSSVQIFIVFSLCCFFYILGAWQRSGFGKGDSIALEMTNSGADCNIVP  60

Query  326  SLNFETHHSGRAGSIDESES-KVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHC  502
            SLNFETHH+G +  +  SE+ KVK  +PC  RYTDYTPCQDQRRAMTF R +MIYRERHC
Sbjct  61   SLNFETHHAGESSLVGASEAAKVKAFEPCDGRYTDYTPCQDQRRAMTFPRDSMIYRERHC  120

Query  503  PPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
             P  +KLHCLIPAPKGYVTPF WPKSRDYVPYANAPY
Sbjct  121  APENEKLHCLIPAPKGYVTPFSWPKSRDYVPYANAPY  157



>ref|XP_003613748.1| hypothetical protein MTR_5g040360 [Medicago truncatula]
 gb|AES96706.1| methyltransferase PMT2-like protein [Medicago truncatula]
Length=609

 Score =   255 bits (651),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/156 (75%), Positives = 129/156 (83%), Gaps = 1/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA   +SG SRTRS V IFIV GLCCFFY+LGAWQR+GFGKGD + LEVTK    C+I+P
Sbjct  1    MAKPSSSG-SRTRSFVQIFIVVGLCCFFYILGAWQRTGFGKGDLLQLEVTKKGAGCDIVP  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +L+F++HH G  G IDE +SK K  KPC  RY DYTPC DQRRAMTFSRQNMIYRERHCP
Sbjct  60   NLSFDSHHGGEVGKIDEVDSKPKVFKPCKARYIDYTPCHDQRRAMTFSRQNMIYRERHCP  119

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
              E+KLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY
Sbjct  120  REEEKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  155



>ref|XP_009360348.1| PREDICTED: probable methyltransferase PMT2 [Pyrus x bretschneideri]
Length=606

 Score =   255 bits (651),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 131/151 (87%), Gaps = 2/151 (1%)
 Frame = +2

Query  161  TSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLNFE  340
             + D RTRSSV IFIVAGLCCFFY+LGAWQRSGFGKGDSIALE+TK   DC+I+PSL F+
Sbjct  5    ANADGRTRSSVQIFIVAGLCCFFYILGAWQRSGFGKGDSIALEITKNGADCSIIPSLTFD  64

Query  341  THHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCPPREKK  520
            +HH+G AG+ID+S+ KV E  PCH  Y DYTPCQDQ+RAMTF R++M YRERHCP  E+K
Sbjct  65   SHHAGEAGNIDDSKPKVFE--PCHHSYADYTPCQDQKRAMTFPREDMNYRERHCPREEEK  122

Query  521  LHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            LHCLIPAPKGYVTPFPWPKSRD+VPYANAPY
Sbjct  123  LHCLIPAPKGYVTPFPWPKSRDFVPYANAPY  153



>ref|XP_008239959.1| PREDICTED: probable methyltransferase PMT2 [Prunus mume]
Length=611

 Score =   254 bits (648),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 132/156 (85%), Gaps = 5/156 (3%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K  SGD+R+RSSVS+FIVAGLCCFFY+LGAWQRSGFGKGDSIALE+TK + DC+IL 
Sbjct  1    MATKGNSGDNRSRSSVSVFIVAGLCCFFYILGAWQRSGFGKGDSIALEITKQT-DCSILS  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +LN+ETHH G    ID+SE  V E KPC   Y DYTPCQDQ RAMTF R+NM YRERHCP
Sbjct  60   NLNYETHHVG----IDDSEGVVNEFKPCSDHYIDYTPCQDQMRAMTFPRENMNYRERHCP  115

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P E+KLHCLIPAPKGYVTPF WP+SRDYVPYANAPY
Sbjct  116  PDEEKLHCLIPAPKGYVTPFRWPQSRDYVPYANAPY  151



>gb|EPS59468.1| hypothetical protein M569_15338, partial [Genlisea aurea]
Length=611

 Score =   253 bits (646),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 131/157 (83%), Gaps = 1/157 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MANK  SGDS+ RS +SIFIVAGLC FF+LLGAWQRSGFGKGD IALE+TK+  +CNILP
Sbjct  3    MANKYNSGDSKARSPLSIFIVAGLCFFFFLLGAWQRSGFGKGDRIALEMTKSGANCNILP  62

Query  326  SLNFETHHSGRAGSIDESESK-VKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHC  502
            +LNFETHH G AG I++S+S  V    PC  +YTDYTPCQDQ RAMTFSR+NMIYRERHC
Sbjct  63   NLNFETHHGGEAGIIEDSDSTTVTAYMPCDVQYTDYTPCQDQGRAMTFSRENMIYRERHC  122

Query  503  PPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            PP   KL CLIPAP+GYV PF WPKSRDYVP+ANAPY
Sbjct  123  PPEGDKLRCLIPAPEGYVAPFRWPKSRDYVPFANAPY  159



>ref|XP_009103114.1| PREDICTED: probable methyltransferase PMT2 [Brassica rapa]
Length=614

 Score =   252 bits (644),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/156 (75%), Positives = 130/156 (83%), Gaps = 1/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K TS D +TRSSV IFIV  LCCFFY+LGAWQRSGFGKGDSIAL++T +  DCNI+P
Sbjct  1    MALKSTSADGKTRSSVQIFIVFSLCCFFYILGAWQRSGFGKGDSIALQMTNSGADCNIVP  60

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            SLNFETHH+G + SI  S +KVK  +PC  RYTDYTPCQDQRRAMTF R +MIYRERHC 
Sbjct  61   SLNFETHHAGES-SIVGSSTKVKAFEPCDARYTDYTPCQDQRRAMTFPRDSMIYRERHCV  119

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P  +KL CL+PAPKGYVTPF WPKSRDYVPYANAPY
Sbjct  120  PESEKLRCLVPAPKGYVTPFSWPKSRDYVPYANAPY  155



>ref|XP_009782774.1| PREDICTED: probable methyltransferase PMT2 [Nicotiana sylvestris]
 ref|XP_009782775.1| PREDICTED: probable methyltransferase PMT2 [Nicotiana sylvestris]
 ref|XP_009782776.1| PREDICTED: probable methyltransferase PMT2 [Nicotiana sylvestris]
Length=617

 Score =   252 bits (644),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 132/157 (84%), Gaps = 1/157 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVS-IFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNIL  322
            MA K   GD+R+RS +S +FIVAGLCCFFYLLG WQ+SGFGKGDSIALE+TK ++DC IL
Sbjct  1    MATKGNPGDNRSRSPLSSLFIVAGLCCFFYLLGVWQKSGFGKGDSIALEITKKAEDCGIL  60

Query  323  PSLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHC  502
            P+L +ETHH  ++ S D+   ++KEI+PC  +Y DYTPC DQ RAMTF R+NM YRERHC
Sbjct  61   PNLEYETHHGNQSSSFDDPNQEIKEIEPCAEQYVDYTPCHDQMRAMTFPRENMNYRERHC  120

Query  503  PPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            PP E+KLHCLIPAPKGYVTPFPWPKSRDYVP+ANAPY
Sbjct  121  PPEEEKLHCLIPAPKGYVTPFPWPKSRDYVPFANAPY  157



>ref|XP_009115418.1| PREDICTED: probable methyltransferase PMT2 [Brassica rapa]
Length=614

 Score =   251 bits (642),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 130/156 (83%), Gaps = 1/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K +S D++TRSSV IFIV  LCCFFY+LGAWQRSGFGKGDSIALE+T +  DCNI+P
Sbjct  1    MAIKSSSADNKTRSSVQIFIVFSLCCFFYILGAWQRSGFGKGDSIALEMTNSGADCNIVP  60

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            SLNFETHH+G + SI  S +KVK  +PC   YTDYTPCQDQRRAMTF R +MIYRERHC 
Sbjct  61   SLNFETHHAGES-SISGSSAKVKTFEPCDALYTDYTPCQDQRRAMTFPRDSMIYRERHCA  119

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P  +KL CL+PAPKGYVTPF WPKSRDYVPYANAPY
Sbjct  120  PESEKLRCLVPAPKGYVTPFSWPKSRDYVPYANAPY  155



>emb|CDY16198.1| BnaA09g29320D [Brassica napus]
Length=606

 Score =   251 bits (641),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 130/156 (83%), Gaps = 1/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K +S D++TRSSV IFIV  LCCFFY+LGAWQRSGFGKGDSIALE+T +  DCNI+P
Sbjct  1    MAIKSSSADNKTRSSVQIFIVFSLCCFFYILGAWQRSGFGKGDSIALEMTNSGADCNIVP  60

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            SLNFETHH+G + SI  S +KVK  +PC   YTDYTPCQDQRRAMTF R +MIYRERHC 
Sbjct  61   SLNFETHHAGES-SISGSSAKVKTFEPCDALYTDYTPCQDQRRAMTFPRDSMIYRERHCA  119

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P  +KL CL+PAPKGYVTPF WPKSRDYVPYANAPY
Sbjct  120  PESEKLRCLVPAPKGYVTPFSWPKSRDYVPYANAPY  155



>ref|XP_007210881.1| hypothetical protein PRUPE_ppa003018mg [Prunus persica]
 gb|EMJ12080.1| hypothetical protein PRUPE_ppa003018mg [Prunus persica]
Length=611

 Score =   251 bits (641),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 117/156 (75%), Positives = 132/156 (85%), Gaps = 5/156 (3%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K  SGD+R+RSS+S+FIVAGLCCFFY+LGAWQRSGFGKGDSIALE+TK + DC+IL 
Sbjct  1    MATKGNSGDNRSRSSMSVFIVAGLCCFFYILGAWQRSGFGKGDSIALEITKQT-DCSILS  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +LN+ETHH G    ID+SE  V E KPC   Y DYTPCQDQ RAMTF R++M YRERHCP
Sbjct  60   NLNYETHHVG----IDDSEGVVNEFKPCSDHYIDYTPCQDQMRAMTFPREDMNYRERHCP  115

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P E+KLHCLIPAPKGYVTPF WP+SRDYVPYANAPY
Sbjct  116  PDEEKLHCLIPAPKGYVTPFRWPQSRDYVPYANAPY  151



>gb|EPS60507.1| hypothetical protein M569_14296, partial [Genlisea aurea]
Length=589

 Score =   250 bits (638),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 129/156 (83%), Gaps = 0/156 (0%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K   G+SRTRSS SIFIV GLCCFFYLLGAWQ+SG+GKGDSIAL VTK+  +CN++ 
Sbjct  1    MAIKFHHGESRTRSSASIFIVGGLCCFFYLLGAWQKSGYGKGDSIALAVTKSRANCNVVK  60

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +L+FETHH   +G+ +++ S     KPCH RYTDYTPCQDQ RAMTF R+NMIYRERHCP
Sbjct  61   TLDFETHHGDGSGTTEDAASSRTVYKPCHSRYTDYTPCQDQSRAMTFPRENMIYRERHCP  120

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
              E KLHCLIPAP+GYVTPF WPKSRDYVP+ANAPY
Sbjct  121  SEENKLHCLIPAPRGYVTPFQWPKSRDYVPFANAPY  156



>ref|XP_010551538.1| PREDICTED: probable methyltransferase PMT2 isoform X2 [Tarenaya 
hassleriana]
Length=571

 Score =   249 bits (635),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 131/157 (83%), Gaps = 2/157 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVT-KTSKDCNIL  322
            MA K +S D++TRSS+ IFIV GLCCFFY+LGAWQRSGFGKGDSIALE+T KT  DC ++
Sbjct  1    MALKSSSVDNKTRSSIQIFIVVGLCCFFYILGAWQRSGFGKGDSIALEMTTKTGSDCGVV  60

Query  323  PSLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHC  502
            PSL+FET HS    SI ES SK +  +PC  RYTDYTPCQDQRRAMTF R+NMIYRERHC
Sbjct  61   PSLSFETRHSSDL-SIGESLSKAEAFEPCDARYTDYTPCQDQRRAMTFPRENMIYRERHC  119

Query  503  PPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P  E+KL CLIPAP GYVTPFPWPKSRDYVPYANAPY
Sbjct  120  PSEEQKLRCLIPAPNGYVTPFPWPKSRDYVPYANAPY  156



>ref|XP_009591906.1| PREDICTED: probable methyltransferase PMT2 [Nicotiana tomentosiformis]
 ref|XP_009591908.1| PREDICTED: probable methyltransferase PMT2 [Nicotiana tomentosiformis]
Length=617

 Score =   249 bits (636),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 131/157 (83%), Gaps = 1/157 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVS-IFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNIL  322
            MA K   GD+R+RS +S +FIVAGLCCFFYLLG WQRSGFGKGDSIALE+TK ++DC IL
Sbjct  1    MATKGNPGDNRSRSPLSSLFIVAGLCCFFYLLGVWQRSGFGKGDSIALEITKKAEDCGIL  60

Query  323  PSLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHC  502
            P+L +ETHH  ++ S D+   ++K+I+PC  +Y DYTPC DQ RAMTF R+NM YRERHC
Sbjct  61   PNLEYETHHGNQSSSFDDPNQEIKQIEPCAEQYVDYTPCHDQMRAMTFPRENMNYRERHC  120

Query  503  PPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            PP E+KLHCLIPAPKGYVTPF WPKSRDYVP+ANAPY
Sbjct  121  PPEEEKLHCLIPAPKGYVTPFQWPKSRDYVPFANAPY  157



>ref|XP_010551537.1| PREDICTED: probable methyltransferase PMT2 isoform X1 [Tarenaya 
hassleriana]
Length=618

 Score =   249 bits (636),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 131/157 (83%), Gaps = 2/157 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVT-KTSKDCNIL  322
            MA K +S D++TRSS+ IFIV GLCCFFY+LGAWQRSGFGKGDSIALE+T KT  DC ++
Sbjct  1    MALKSSSVDNKTRSSIQIFIVVGLCCFFYILGAWQRSGFGKGDSIALEMTTKTGSDCGVV  60

Query  323  PSLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHC  502
            PSL+FET HS    SI ES SK +  +PC  RYTDYTPCQDQRRAMTF R+NMIYRERHC
Sbjct  61   PSLSFETRHSSDL-SIGESLSKAEAFEPCDARYTDYTPCQDQRRAMTFPRENMIYRERHC  119

Query  503  PPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P  E+KL CLIPAP GYVTPFPWPKSRDYVPYANAPY
Sbjct  120  PSEEQKLRCLIPAPNGYVTPFPWPKSRDYVPYANAPY  156



>emb|CDY40268.1| BnaA07g09320D [Brassica napus]
Length=606

 Score =   248 bits (634),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 130/156 (83%), Gaps = 1/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K +S D +TRSSV IF+V  LCCFFY+LGAWQRSGFGKGDSIAL++T +  DC+I+P
Sbjct  1    MALKSSSADGKTRSSVQIFVVFSLCCFFYILGAWQRSGFGKGDSIALQMTNSGADCDIVP  60

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            SLNFETHH+G + SI  S +KVK  +PC  RYTDYTPCQDQRRAMTF R +MIYRERHC 
Sbjct  61   SLNFETHHAGES-SIVGSSTKVKAFEPCDARYTDYTPCQDQRRAMTFPRDSMIYRERHCV  119

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P  +KL CL+PAPKGYVTPF WPKSRDYVPYANAPY
Sbjct  120  PESEKLRCLVPAPKGYVTPFSWPKSRDYVPYANAPY  155



>ref|XP_010683197.1| PREDICTED: probable methyltransferase PMT2 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010683199.1| PREDICTED: probable methyltransferase PMT2 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010683200.1| PREDICTED: probable methyltransferase PMT2 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010683201.1| PREDICTED: probable methyltransferase PMT2 [Beta vulgaris subsp. 
vulgaris]
Length=610

 Score =   247 bits (631),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 129/156 (83%), Gaps = 2/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MANK T GDSR RSS+SIFI+ GLC FFYLLGAWQRSGFGKGDSIA+E+TK+  DC +L 
Sbjct  1    MANK-THGDSRARSSISIFIIVGLCGFFYLLGAWQRSGFGKGDSIAMEITKSGADCAVLS  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +L+FETHH G   + D + S  K   PC  +YTDYTPCQDQ+RAM F R NM+YRERHCP
Sbjct  60   NLSFETHHGGEIKTGDSAIS-TKVFPPCKEKYTDYTPCQDQKRAMMFPRDNMVYRERHCP  118

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
             +E+KLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY
Sbjct  119  TQEEKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  154



>ref|XP_007037318.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOY21819.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=615

 Score =   246 bits (629),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 129/156 (83%), Gaps = 1/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K  +G+ +TRSSVSIFIV GLCCFF++LGAWQRSGFGKGD IA E+T+ + DC+IL 
Sbjct  1    MATKGNTGELKTRSSVSIFIVVGLCCFFFILGAWQRSGFGKGDRIASEITRQT-DCSILS  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +LN+ETHH G   +ID S+S  K+ +PC  +Y DYTPCQDQ RAM F R+NM YRERHCP
Sbjct  60   NLNYETHHGGDTATIDGSDSAAKDFQPCDDKYVDYTPCQDQMRAMMFPRENMNYRERHCP  119

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P E+KLHCL+PAPKGY TPFPWPKSRDYVP+ANAPY
Sbjct  120  PEEEKLHCLVPAPKGYATPFPWPKSRDYVPFANAPY  155



>ref|XP_010937119.1| PREDICTED: probable methyltransferase PMT2 isoform X1 [Elaeis 
guineensis]
Length=617

 Score =   246 bits (628),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 131/156 (84%), Gaps = 2/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K  + D+RTRSS+SIFIV G+CCFFY+LGAWQRSGFGKGDSIA+E+TK + DC ILP
Sbjct  1    MAMKGNAADNRTRSSISIFIVIGMCCFFYVLGAWQRSGFGKGDSIAVEITKQT-DCTILP  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +L+++THH  RA +++E  SK +  +PC  RY DYTPCQDQ+RAMTF R NM YRERHCP
Sbjct  60   NLSYDTHHD-RASNLEELGSKAEIFEPCDDRYIDYTPCQDQKRAMTFPRANMEYRERHCP  118

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P E+KLHCLIPAPKGYV PFPWPKSRDYVPYAN PY
Sbjct  119  PEEEKLHCLIPAPKGYVAPFPWPKSRDYVPYANVPY  154



>ref|XP_010937120.1| PREDICTED: probable methyltransferase PMT2 isoform X2 [Elaeis 
guineensis]
Length=616

 Score =   246 bits (628),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 131/156 (84%), Gaps = 2/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K  + D+RTRSS+SIFIV G+CCFFY+LGAWQRSGFGKGDSIA+E+TK + DC ILP
Sbjct  1    MAMKGNAADNRTRSSISIFIVIGMCCFFYVLGAWQRSGFGKGDSIAVEITKQT-DCTILP  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +L+++THH  RA +++E  SK +  +PC  RY DYTPCQDQ+RAMTF R NM YRERHCP
Sbjct  60   NLSYDTHHD-RASNLEELGSKAEIFEPCDDRYIDYTPCQDQKRAMTFPRANMEYRERHCP  118

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P E+KLHCLIPAPKGYV PFPWPKSRDYVPYAN PY
Sbjct  119  PEEEKLHCLIPAPKGYVAPFPWPKSRDYVPYANVPY  154



>ref|XP_009390921.1| PREDICTED: probable methyltransferase PMT2 [Musa acuminata subsp. 
malaccensis]
Length=617

 Score =   245 bits (625),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 129/156 (83%), Gaps = 1/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K +SG+ RTRSS++I IV GLCCFFY+LGAWQRSGFG+GDSIAL+VT+ + +C I P
Sbjct  1    MAIKSSSGEGRTRSSLTIIIVVGLCCFFYVLGAWQRSGFGRGDSIALQVTQQT-ECTISP  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +LNFETHH G     D  +S VK  + CH RYTDYTPCQDQ+RAMTF R+NMIYRERHCP
Sbjct  60   NLNFETHHGGSGSLSDLGDSVVKTFEACHDRYTDYTPCQDQKRAMTFPRENMIYRERHCP  119

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
              ++KL+CLIPAPKGYV PFPWPKSRDYVPYAN PY
Sbjct  120  LDKEKLYCLIPAPKGYVAPFPWPKSRDYVPYANVPY  155



>ref|XP_008356626.1| PREDICTED: probable methyltransferase PMT2 [Malus domestica]
Length=611

 Score =   244 bits (624),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 130/156 (83%), Gaps = 5/156 (3%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K  SGD+R+RSS+SI IVAGLCCFFY+LGAWQRSGFGKGDSIA+E+T+ + DC+IL 
Sbjct  1    MATKGNSGDNRSRSSMSIVIVAGLCCFFYILGAWQRSGFGKGDSIAVEITRQT-DCSILS  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +LN+ETH  G    ID+SE  VKE K C  RY DYTPCQDQ RAMTF R+ M YRERHCP
Sbjct  60   NLNYETHRGG----IDDSEGVVKEFKSCGNRYIDYTPCQDQMRAMTFPREXMNYRERHCP  115

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P E+KLHCLIPAPKGYVTPF WP+SRDYVPYANAPY
Sbjct  116  PEEEKLHCLIPAPKGYVTPFRWPQSRDYVPYANAPY  151



>ref|XP_008351840.1| PREDICTED: probable methyltransferase PMT2 [Malus domestica]
Length=221

 Score =   233 bits (594),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 126/156 (81%), Gaps = 7/156 (4%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K  SGD+R+RSS+SI +VAGLCCFFY+LG WQRSGFGKGDSIA+++T +  DC+IL 
Sbjct  1    MATKGNSGDNRSRSSMSIVVVAGLCCFFYILGVWQRSGFGKGDSIAMDIT-SHTDCSILS  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            SL   THHSG     D SE  VKE K C  RY DYTPCQDQ RAMTF R+NM YRERHCP
Sbjct  60   SL--VTHHSG----TDGSEGVVKEFKSCGSRYIDYTPCQDQMRAMTFPRENMNYRERHCP  113

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P E+KLHCLIPAPKGYVTPF WP+SRDYVPYANAPY
Sbjct  114  PEEEKLHCLIPAPKGYVTPFRWPQSRDYVPYANAPY  149



>ref|XP_009380165.1| PREDICTED: probable methyltransferase PMT2 [Musa acuminata subsp. 
malaccensis]
Length=617

 Score =   244 bits (623),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 126/156 (81%), Gaps = 1/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K  SG+ RTRSS+SI IV GLCCFFY+LGAWQ+SGFGKGDSIAL+VTK + +C   P
Sbjct  1    MAIKSNSGEGRTRSSLSIIIVVGLCCFFYILGAWQKSGFGKGDSIALQVTKQT-ECTNSP  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +LNFETHH G     D  +S+ K  KPC   YTDYTPCQDQ RAMTF R+NMIYRERHCP
Sbjct  60   NLNFETHHGGSGSLKDIGDSEAKTFKPCGDTYTDYTPCQDQGRAMTFPRENMIYRERHCP  119

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P E+KL+CLIPAPKGYV PFPWPKSRDYVPYAN PY
Sbjct  120  PDEEKLYCLIPAPKGYVAPFPWPKSRDYVPYANVPY  155



>ref|XP_009369302.1| PREDICTED: probable methyltransferase PMT2 [Pyrus x bretschneideri]
Length=611

 Score =   243 bits (621),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 128/156 (82%), Gaps = 5/156 (3%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K  SGD+R+RSS+SI IVAGLCCFFY+LGAWQRSGFGKGDSIA+E+T+ + DC+IL 
Sbjct  1    MATKGNSGDNRSRSSMSIVIVAGLCCFFYILGAWQRSGFGKGDSIAVEITRQT-DCSILS  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +LN+ETH  G    ID SE   KE K C  RY DYTPCQDQ RAMTF R+NM YRERHCP
Sbjct  60   NLNYETHRGG----IDNSEGVGKEFKSCGDRYIDYTPCQDQMRAMTFPRENMNYRERHCP  115

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P E KLHCLIPAPKGYVTPF WP+SRDYVPYANAPY
Sbjct  116  PEEGKLHCLIPAPKGYVTPFRWPQSRDYVPYANAPY  151



>ref|XP_002511570.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF52172.1| ATP binding protein, putative [Ricinus communis]
Length=613

 Score =   243 bits (620),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 128/156 (82%), Gaps = 3/156 (2%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K  SGD +TRSS SIFIV GLCCFFY+LGAWQRSGFGKGDSIALE+TK +  C+IL 
Sbjct  1    MATKGNSGDHKTRSSFSIFIVVGLCCFFYVLGAWQRSGFGKGDSIALEITKQTH-CSILN  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +LN++T  SG AG +D S ++VKE KPC  +  DYTPCQDQ RAMTF R NM YRERHCP
Sbjct  60   NLNYQT--SGDAGIVDGSGAEVKEFKPCDDKLADYTPCQDQMRAMTFPRDNMNYRERHCP  117

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P E+KLHCLIPAPKGY  PFPWPKSRDYVPYANAPY
Sbjct  118  PDEEKLHCLIPAPKGYANPFPWPKSRDYVPYANAPY  153



>ref|XP_008781841.1| PREDICTED: probable methyltransferase PMT2 [Phoenix dactylifera]
Length=616

 Score =   243 bits (619),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 129/156 (83%), Gaps = 2/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K  + D RTRSS+SI IV GLCCFFY+LG WQRSGFGKGD IA ++T+ + +C I P
Sbjct  1    MALKGNAADGRTRSSMSIIIVVGLCCFFYVLGVWQRSGFGKGDRIAAQITEQT-ECAISP  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +LNFETHHSG  G  ++ +S+VK  +PC+ RYTDYTPCQDQRRAMTF R NMIYRERHCP
Sbjct  60   NLNFETHHSG-GGVPNDDDSEVKTFEPCNDRYTDYTPCQDQRRAMTFPRDNMIYRERHCP  118

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P ++KL+CLIPAPKGYV PFPWPKSRDYVPYAN PY
Sbjct  119  PEQEKLYCLIPAPKGYVAPFPWPKSRDYVPYANVPY  154



>ref|XP_009772034.1| PREDICTED: probable methyltransferase PMT2 [Nicotiana sylvestris]
 ref|XP_009772035.1| PREDICTED: probable methyltransferase PMT2 [Nicotiana sylvestris]
Length=615

 Score =   243 bits (619),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 106/156 (68%), Positives = 130/156 (83%), Gaps = 0/156 (0%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K   GD+R+R  + IF+V GLCCFFYLLGAWQRSGFGKGDSIAL++TK ++DC+IL 
Sbjct  1    MAIKGNPGDNRSRGPLPIFVVVGLCCFFYLLGAWQRSGFGKGDSIALQMTKKAEDCSILS  60

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +L +ETHH  ++G +D+ + +VK+ +PC  +Y DYTPC DQ RAMTF R+NM YRERHCP
Sbjct  61   NLEYETHHGDQSGMVDDPKLEVKQFEPCGEQYVDYTPCHDQMRAMTFPRENMNYRERHCP  120

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P E+KLHCLIPAPKGYVTPF WPKSRDYVP+ANAP+
Sbjct  121  PEEEKLHCLIPAPKGYVTPFQWPKSRDYVPFANAPH  156



>ref|XP_006354784.1| PREDICTED: probable methyltransferase PMT2-like [Solanum tuberosum]
Length=615

 Score =   242 bits (618),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 130/157 (83%), Gaps = 1/157 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSV-SIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNIL  322
            MA K   GD+R++SS+ S+ IVA LCCFFY+LG WQRSGFGKGDSIALE+TK ++DC IL
Sbjct  1    MATKGNPGDNRSKSSLPSLLIVAALCCFFYVLGVWQRSGFGKGDSIALEITKKAEDCGIL  60

Query  323  PSLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHC  502
            P+L +ETHH  ++ S D+ +  VKEI+PC  +Y DYTPC DQ RAMTF R+NM YRERHC
Sbjct  61   PNLEYETHHGNQSTSFDDPKQDVKEIEPCGEQYIDYTPCHDQMRAMTFPRENMNYRERHC  120

Query  503  PPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            PP E+KLHCLIPAPKGYVTPF WPKSRDYVP+ANAP+
Sbjct  121  PPDEEKLHCLIPAPKGYVTPFSWPKSRDYVPFANAPH  157



>ref|XP_009595709.1| PREDICTED: probable methyltransferase PMT2 [Nicotiana tomentosiformis]
 ref|XP_009595710.1| PREDICTED: probable methyltransferase PMT2 [Nicotiana tomentosiformis]
Length=615

 Score =   242 bits (617),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 130/156 (83%), Gaps = 0/156 (0%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K   GD+R+R  + IF+V GLCCFFYLLGAWQRSGFGKGDSIAL++T  ++DC+IL 
Sbjct  1    MAIKGNPGDNRSRGPLPIFVVVGLCCFFYLLGAWQRSGFGKGDSIALQMTNKAEDCSILS  60

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +L +ETHH  ++G++D+ + +VK+ +PC  +Y DYTPC DQ RAMTF R+NM YRERHCP
Sbjct  61   NLEYETHHGDQSGTVDDPKLEVKQFEPCGEQYVDYTPCHDQMRAMTFPRENMNYRERHCP  120

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P E+KLHCLIPAPKGYVTPF WPKSRDYVP+ANAP+
Sbjct  121  PEEEKLHCLIPAPKGYVTPFQWPKSRDYVPFANAPH  156



>ref|XP_010275323.1| PREDICTED: probable methyltransferase PMT14 [Nelumbo nucifera]
Length=613

 Score =   241 bits (615),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 108/156 (69%), Positives = 128/156 (82%), Gaps = 1/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            M +K+ SG SRTRS  SIFIV GLCCFFY+LGAWQ+SGFGKGDSIALE+TK + DC+IL 
Sbjct  1    MGSKLNSGSSRTRSPASIFIVVGLCCFFYILGAWQKSGFGKGDSIALEITKQT-DCSILS  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +LNFETHH+     +D S++K +  +PC  +YTDYTPCQ+Q RAM F R+NMIYRERHCP
Sbjct  60   NLNFETHHNDVGEIVDPSDTKAEVFEPCDVKYTDYTPCQEQNRAMAFPRENMIYRERHCP  119

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P ++KL CLIPAP GY+TPFPWPKSRDYV YAN PY
Sbjct  120  PEDEKLRCLIPAPNGYMTPFPWPKSRDYVHYANVPY  155



>ref|XP_002275852.1| PREDICTED: probable methyltransferase PMT2 [Vitis vinifera]
 ref|XP_010663379.1| PREDICTED: probable methyltransferase PMT2 [Vitis vinifera]
Length=610

 Score =   241 bits (614),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 128/156 (82%), Gaps = 7/156 (4%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K  + +S+TRSS+SIF+V GLCCFFY+LGAWQRSGFGKGDSIA+EVTK + DC+IL 
Sbjct  1    MAKKGNAAESKTRSSISIFVVLGLCCFFYILGAWQRSGFGKGDSIAIEVTKQT-DCSILS  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +LNFETHH   AG+I +      + KPC  +Y DYTPCQDQ RAMTF R++M YRERHCP
Sbjct  60   NLNFETHHKDEAGTIGD------QFKPCDAQYIDYTPCQDQDRAMTFPREDMNYRERHCP  113

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P  +KLHCLIPAPKGY TPFPWPKSRDYVP+ANAPY
Sbjct  114  PEGEKLHCLIPAPKGYATPFPWPKSRDYVPFANAPY  149



>emb|CAN60192.1| hypothetical protein VITISV_038569 [Vitis vinifera]
Length=605

 Score =   240 bits (613),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 128/156 (82%), Gaps = 7/156 (4%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K  + +S+TRSS+SIF+V GLCCFFY+LGAWQRSGFGKGDSIA+EVTK + DC+IL 
Sbjct  1    MAKKGNAAESKTRSSISIFVVLGLCCFFYILGAWQRSGFGKGDSIAIEVTKQT-DCSILS  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +LNFETHH   AG+I +      + KPC  +Y DYTPCQDQ RAMTF R++M YRERHCP
Sbjct  60   NLNFETHHKDEAGTIGD------QFKPCDAQYIDYTPCQDQDRAMTFPREDMNYRERHCP  113

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P  +KLHCLIPAPKGY TPFPWPKSRDYVP+ANAPY
Sbjct  114  PEGEKLHCLIPAPKGYATPFPWPKSRDYVPFANAPY  149



>ref|XP_004299370.1| PREDICTED: probable methyltransferase PMT2 [Fragaria vesca subsp. 
vesca]
Length=607

 Score =   240 bits (613),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 129/156 (83%), Gaps = 8/156 (5%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K  SGD+R+RSS+S+FIVAGLCCFFY+LGAWQRSGFGKGDSIA+E+T+ + DC+IL 
Sbjct  2    MATKGNSGDNRSRSSMSVFIVAGLCCFFYILGAWQRSGFGKGDSIAVEITRQT-DCSILS  60

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +LN+ETHH      IDE    VKE KPC  RY DYTPCQDQ RAMTF R NM YRERHCP
Sbjct  61   TLNYETHHG-----IDEG--PVKEFKPCPNRYIDYTPCQDQLRAMTFPRDNMNYRERHCP  113

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
              E+KLHCLIPAPKGYVTPF WP+SRDYVPYANAPY
Sbjct  114  REEEKLHCLIPAPKGYVTPFRWPQSRDYVPYANAPY  149



>ref|XP_010919849.1| PREDICTED: probable methyltransferase PMT2 [Elaeis guineensis]
Length=613

 Score =   240 bits (613),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 126/156 (81%), Gaps = 2/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K  + D RTRSS+SI IV GLCCFFY+LGAWQRSG G+GDSIAL VTK + DC  LP
Sbjct  1    MALKGNAADGRTRSSMSIIIVIGLCCFFYVLGAWQRSGIGRGDSIALMVTKET-DCTTLP  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +LNFETHHSG   S++ SE KVK  +PC   YTDY+PCQDQ RAM F R+NM YRERHCP
Sbjct  60   NLNFETHHSGGV-SLEPSELKVKVFEPCDVHYTDYSPCQDQNRAMKFPRENMAYRERHCP  118

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P  +KLHCLIPAP+GYVTPFPWPKSRDYVPYAN PY
Sbjct  119  PGNEKLHCLIPAPEGYVTPFPWPKSRDYVPYANVPY  154



>ref|XP_006364604.1| PREDICTED: probable methyltransferase PMT2-like [Solanum tuberosum]
Length=616

 Score =   239 bits (611),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 127/156 (81%), Gaps = 0/156 (0%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K   GD+R+R   SIFIVAGLCCFFYL+G WQR GF KGDS AL++TK ++DC+IL 
Sbjct  1    MAIKGNPGDNRSRGPASIFIVAGLCCFFYLIGVWQRGGFVKGDSKALQITKRAEDCSILS  60

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +L +ETHH  + G +D+ + K+K+ +PC  +Y DYTPC DQ RAMTF R+NM YRERHCP
Sbjct  61   NLEYETHHGDQHGLVDDPKLKIKQFEPCGEQYVDYTPCHDQMRAMTFPRENMNYRERHCP  120

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P E+KLHCLIPAPKGY+TPFPWPKSRDYVPYANAP+
Sbjct  121  PEEEKLHCLIPAPKGYITPFPWPKSRDYVPYANAPH  156



>ref|XP_012080258.1| PREDICTED: probable methyltransferase PMT2 isoform X2 [Jatropha 
curcas]
 gb|KDP31241.1| hypothetical protein JCGZ_11617 [Jatropha curcas]
Length=613

 Score =   239 bits (611),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 128/156 (82%), Gaps = 3/156 (2%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K  SGD +TRSSVSIFIV GLC FFY+LGAWQRSGFGKGDSIA  +TK +  C+IL 
Sbjct  1    MATKGNSGDHKTRSSVSIFIVVGLCGFFYILGAWQRSGFGKGDSIAWVITKQTH-CSILN  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +LN++T  SG AG +D S  +V+EIKPC  +Y DYTPCQDQ RAMTF R+NM YRERHCP
Sbjct  60   NLNYQT--SGDAGIVDSSGEEVQEIKPCDDKYIDYTPCQDQMRAMTFPRENMNYRERHCP  117

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P E+KLHCL+PAPKGY  PFPWPKSRDYVPYANAPY
Sbjct  118  PEEEKLHCLVPAPKGYANPFPWPKSRDYVPYANAPY  153



>ref|XP_010066916.1| PREDICTED: probable methyltransferase PMT2 [Eucalyptus grandis]
 ref|XP_010066917.1| PREDICTED: probable methyltransferase PMT2 [Eucalyptus grandis]
 gb|KCW64965.1| hypothetical protein EUGRSUZ_G02508 [Eucalyptus grandis]
Length=615

 Score =   239 bits (611),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 122/151 (81%), Gaps = 1/151 (1%)
 Frame = +2

Query  161  TSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLNFE  340
             S D RTR+S+ I IVAGLC FFY LGAWQRSGFGKGDSIAL +T +  DC++  +LNFE
Sbjct  5    NSADGRTRTSIQILIVAGLCLFFYALGAWQRSGFGKGDSIALAITNSGADCDVASNLNFE  64

Query  341  THHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCPPREKK  520
            THH G + +  ESE K K  +PC   +TDYTPCQDQ+RAMTF R+NM YRERHCPP  +K
Sbjct  65   THHGGESETSGESE-KAKVFEPCKSHFTDYTPCQDQKRAMTFPRENMNYRERHCPPEGEK  123

Query  521  LHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            LHCLIPAPKGYVTPFPWPKSRDYVPYANAPY
Sbjct  124  LHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  154



>ref|XP_012080255.1| PREDICTED: probable methyltransferase PMT2 isoform X1 [Jatropha 
curcas]
 ref|XP_012080256.1| PREDICTED: probable methyltransferase PMT2 isoform X1 [Jatropha 
curcas]
 ref|XP_012080257.1| PREDICTED: probable methyltransferase PMT2 isoform X1 [Jatropha 
curcas]
Length=617

 Score =   239 bits (611),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 128/156 (82%), Gaps = 3/156 (2%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K  SGD +TRSSVSIFIV GLC FFY+LGAWQRSGFGKGDSIA  +TK +  C+IL 
Sbjct  1    MATKGNSGDHKTRSSVSIFIVVGLCGFFYILGAWQRSGFGKGDSIAWVITKQTH-CSILN  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +LN++T  SG AG +D S  +V+EIKPC  +Y DYTPCQDQ RAMTF R+NM YRERHCP
Sbjct  60   NLNYQT--SGDAGIVDSSGEEVQEIKPCDDKYIDYTPCQDQMRAMTFPRENMNYRERHCP  117

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P E+KLHCL+PAPKGY  PFPWPKSRDYVPYANAPY
Sbjct  118  PEEEKLHCLVPAPKGYANPFPWPKSRDYVPYANAPY  153



>emb|CDY45006.1| BnaCnng12360D [Brassica napus]
Length=605

 Score =   238 bits (608),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 127/150 (85%), Gaps = 3/150 (2%)
 Frame = +2

Query  170  DSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSK--DCNILPSLNFET  343
            D++TRSSV IFIV  LCCFFY+LGAWQRSGFGKGDSIALE+T ++   DCNI+PSLNFET
Sbjct  6    DNKTRSSVQIFIVFSLCCFFYILGAWQRSGFGKGDSIALEMTNSASAADCNIVPSLNFET  65

Query  344  HHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCPPREKKL  523
            HH+G + ++  S +KVK  +PC  RYTDYTPC DQ+RAMTF R++MIYRERHC P  +KL
Sbjct  66   HHAGESSALVAS-TKVKTFEPCSARYTDYTPCHDQKRAMTFPRESMIYRERHCVPENEKL  124

Query  524  HCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
             CL+PAPKGYVTPF WPKSRDYVPYANAPY
Sbjct  125  RCLVPAPKGYVTPFSWPKSRDYVPYANAPY  154



>ref|XP_006660624.1| PREDICTED: probable methyltransferase PMT2-like [Oryza brachyantha]
Length=616

 Score =   238 bits (608),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 131/156 (84%), Gaps = 2/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA KV+S D+RTRS+VS+ IV G+CCFFY+LGAWQ+SGFGKGDSIALE+TK + DC ILP
Sbjct  1    MAVKVSSADNRTRSTVSLCIVIGMCCFFYILGAWQKSGFGKGDSIALEITKRT-DCTILP  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +L+F+THHS +A S D   S VK+ KPC  RYTDYTPCQDQ RAM F R+NM YRERHCP
Sbjct  60   NLSFDTHHSKKASSGDLV-SPVKKFKPCADRYTDYTPCQDQNRAMKFPRENMNYRERHCP  118

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P+++KL CLIP PKGYV PFPWPKSRDYVP+AN PY
Sbjct  119  PQKEKLRCLIPPPKGYVAPFPWPKSRDYVPFANCPY  154



>gb|EPS64080.1| hypothetical protein M569_10695, partial [Genlisea aurea]
Length=606

 Score =   237 bits (604),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 123/154 (80%), Gaps = 3/154 (2%)
 Frame = +2

Query  155  KVTSGDSRTRSS-VSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSL  331
            K   G+SR RSS VSIFIV GLCCFFYLLGAWQ+SG+GKGD+IAL VTK+  DC +L + 
Sbjct  3    KFHHGESRARSSSVSIFIVGGLCCFFYLLGAWQKSGYGKGDAIALAVTKSETDCILLQNH  62

Query  332  NFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCPPR  511
            N ET HSG  G +++    V   KPCH RYTDYTPCQDQ RAMTF R+NMIYRERHCPP 
Sbjct  63   NLETQHSGEGGIVEDLPKTV--YKPCHSRYTDYTPCQDQARAMTFPRENMIYRERHCPPE  120

Query  512  EKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
              KLHCLIPAPKGYVTPF WPKSRDYVP+ANAPY
Sbjct  121  GDKLHCLIPAPKGYVTPFQWPKSRDYVPFANAPY  154



>emb|CDY46435.1| BnaA08g19950D [Brassica napus]
Length=603

 Score =   236 bits (603),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 125/150 (83%), Gaps = 5/150 (3%)
 Frame = +2

Query  170  DSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSK--DCNILPSLNFET  343
            D++TRSSV IFIV  LCCFFY+LGAWQRSGFGKGDSIALE+T ++   DCNI+PSLNFET
Sbjct  6    DNKTRSSVQIFIVFSLCCFFYILGAWQRSGFGKGDSIALEMTNSASAADCNIVPSLNFET  65

Query  344  HHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCPPREKKL  523
            HH+G +     S +KVK  +PC  RYTDYTPC DQ+RAMTF R++MIYRERHC P  +KL
Sbjct  66   HHAGESSI---SSAKVKAFEPCAARYTDYTPCHDQKRAMTFPRESMIYRERHCVPENEKL  122

Query  524  HCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
             CL+PAPKGYVTPF WPKSRDYVPYANAPY
Sbjct  123  RCLVPAPKGYVTPFSWPKSRDYVPYANAPY  152



>ref|XP_006827213.1| PREDICTED: probable methyltransferase PMT2 [Amborella trichopoda]
 ref|XP_011622152.1| PREDICTED: probable methyltransferase PMT2 [Amborella trichopoda]
 ref|XP_011622157.1| PREDICTED: probable methyltransferase PMT2 [Amborella trichopoda]
 ref|XP_011622159.1| PREDICTED: probable methyltransferase PMT2 [Amborella trichopoda]
 ref|XP_011622161.1| PREDICTED: probable methyltransferase PMT2 [Amborella trichopoda]
 gb|ERM94450.1| hypothetical protein AMTR_s00010p00259630 [Amborella trichopoda]
Length=614

 Score =   237 bits (604),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/156 (69%), Positives = 125/156 (80%), Gaps = 1/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            M +K    +SRTRSS+SIFIV GLCCFFY+LG WQ+SGFGKGDSIA+++T +  +CN++P
Sbjct  1    MGSKFNPSESRTRSSISIFIVVGLCCFFYILGVWQKSGFGKGDSIAMQIT-SQTECNVMP  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +L+FETHH     + D  ESK K  +PC  RY DYTPCQDQRRAMTF R+NMIYRERHCP
Sbjct  60   NLSFETHHGDAGITKDLFESKPKVFEPCDARYIDYTPCQDQRRAMTFPRENMIYRERHCP  119

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
              E+ L CLIPAPKGYVTPF WPKSRDYVPYAN PY
Sbjct  120  TDEETLDCLIPAPKGYVTPFQWPKSRDYVPYANVPY  155



>ref|XP_004241578.1| PREDICTED: probable methyltransferase PMT2 [Solanum lycopersicum]
Length=615

 Score =   236 bits (603),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 104/157 (66%), Positives = 128/157 (82%), Gaps = 1/157 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSV-SIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNIL  322
            MA K   GD+R +S + S+ ++A LCCFFY+LG W+RSGFGKGDSIALE+TK ++DC IL
Sbjct  1    MATKGNPGDNRNKSFLPSLLVIAALCCFFYVLGVWKRSGFGKGDSIALEITKKAEDCGIL  60

Query  323  PSLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHC  502
            P+L +ETHH  ++ S D+ +  VKEI+PC  +Y DYTPC DQ RAMTF R+NM YRERHC
Sbjct  61   PNLEYETHHGNQSTSFDDPKQDVKEIEPCGEQYIDYTPCHDQMRAMTFPRENMNYRERHC  120

Query  503  PPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            PP E+KLHCL+PAPKGYVTPF WPKSRDYVP+ANAP+
Sbjct  121  PPDEEKLHCLVPAPKGYVTPFSWPKSRDYVPFANAPH  157



>gb|KHN12213.1| Putative methyltransferase PMT2 [Glycine soja]
Length=585

 Score =   235 bits (600),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  215  LCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLNFETHHSGRAGSIDESESKVK  394
            +CCFFY+LGAWQRSGFGKGDSIALE+TK   DCN++P+L+F++HH G    IDE ESK K
Sbjct  1    MCCFFYILGAWQRSGFGKGDSIALEITKKGADCNVVPNLSFDSHHGGEVSKIDEFESKSK  60

Query  395  EIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCPPREKKLHCLIPAPKGYVTPFPWP  574
              +PC  RY DYTPCQDQRRAMTF R+NM YRERHCPP E+KLHC+IPAPKGYVTPFPWP
Sbjct  61   VFEPCDARYIDYTPCQDQRRAMTFPRENMNYRERHCPPEEEKLHCMIPAPKGYVTPFPWP  120

Query  575  KSRDYVPYANAPY  613
            KS DYVPYANAPY
Sbjct  121  KSHDYVPYANAPY  133



>ref|XP_004956815.1| PREDICTED: probable methyltransferase PMT2-like isoform X1 [Setaria 
italica]
 ref|XP_004956816.1| PREDICTED: probable methyltransferase PMT2-like isoform X2 [Setaria 
italica]
Length=615

 Score =   236 bits (601),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 128/156 (82%), Gaps = 1/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K +S D+RTRS+VSI IV G+CCFFY+LGAWQ+SGFGKGDSIALE+TK + DC ILP
Sbjct  1    MAVKASSTDNRTRSTVSICIVIGMCCFFYILGAWQKSGFGKGDSIALEITKRT-DCTILP  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +L+F+THHS    S  +    VK+ KPC  R+TDYTPCQDQ RAM F R+NM YRERHCP
Sbjct  60   NLSFDTHHSKAGSSSSDLVLPVKKFKPCPDRFTDYTPCQDQNRAMKFPRENMNYRERHCP  119

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P+++KLHCLIP PKGYV PFPWPKSRDYVP+AN PY
Sbjct  120  PQKEKLHCLIPPPKGYVAPFPWPKSRDYVPFANCPY  155



>ref|XP_004235979.1| PREDICTED: probable methyltransferase PMT2 [Solanum lycopersicum]
Length=616

 Score =   235 bits (600),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 101/156 (65%), Positives = 125/156 (80%), Gaps = 0/156 (0%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K   GD R+R   SIFIVAGLCCFFY++G WQR GF KGD  +L++TK ++DC+IL 
Sbjct  1    MAIKGNPGDKRSRGPASIFIVAGLCCFFYVIGVWQRGGFAKGDGKSLQITKKAEDCSILS  60

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +L +ETHH  + G +D+ + K+K+ +PC  +Y DYTPC DQ RAMTF R+NM YRERHCP
Sbjct  61   NLEYETHHGDQHGLVDDPKLKIKQFEPCGEQYVDYTPCHDQMRAMTFPRENMNYRERHCP  120

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P E+KLHCLIPAPKGY+TPFPWPKSR+YVPYANAP+
Sbjct  121  PEEEKLHCLIPAPKGYITPFPWPKSREYVPYANAPH  156



>ref|NP_001146334.1| uncharacterized protein LOC100279910 [Zea mays]
 gb|ACL53711.1| unknown [Zea mays]
Length=357

 Score =   228 bits (582),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 127/156 (81%), Gaps = 1/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K +S D+RTRS+VS+ IV G+CCFFY+LGAWQ+SGFGKGDSIALEVTK + DC ++P
Sbjct  1    MALKASSSDNRTRSTVSLCIVIGMCCFFYILGAWQKSGFGKGDSIALEVTKRT-DCTVVP  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +L+F+THHS  +G+     S  K+ KPC   YTDYTPCQDQ RAM F R+NM YRERHCP
Sbjct  60   NLSFDTHHSKASGNSSSLVSPSKKFKPCPDLYTDYTPCQDQNRAMKFPRENMNYRERHCP  119

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
             +++KLHCL+P PKGYV PFPWPKSRDYVP+AN PY
Sbjct  120  AQKEKLHCLVPPPKGYVAPFPWPKSRDYVPFANCPY  155



>ref|XP_009110047.1| PREDICTED: probable methyltransferase PMT2 [Brassica rapa]
Length=611

 Score =   235 bits (599),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 124/150 (83%), Gaps = 5/150 (3%)
 Frame = +2

Query  170  DSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSK--DCNILPSLNFET  343
            D++TRSSV I IV  LCCFFY+LGAWQRSGFGKGDSIALE+T ++   DCNI+PSLNFET
Sbjct  6    DNKTRSSVQILIVFSLCCFFYILGAWQRSGFGKGDSIALEMTNSASAADCNIVPSLNFET  65

Query  344  HHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCPPREKKL  523
            HH+G +     S +KVK  +PC  RYTDYTPC DQ+RAMTF R++MIYRERHC P  +KL
Sbjct  66   HHAGESSI---SSAKVKAFEPCAARYTDYTPCHDQKRAMTFPRESMIYRERHCVPENEKL  122

Query  524  HCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
             CL+PAPKGYVTPF WPKSRDYVPYANAPY
Sbjct  123  RCLVPAPKGYVTPFSWPKSRDYVPYANAPY  152



>ref|XP_002282093.2| PREDICTED: probable methyltransferase PMT14 [Vitis vinifera]
 ref|XP_010663982.1| PREDICTED: probable methyltransferase PMT14 [Vitis vinifera]
 ref|XP_010663986.1| PREDICTED: probable methyltransferase PMT14 [Vitis vinifera]
Length=611

 Score =   234 bits (598),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 126/156 (81%), Gaps = 2/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            M +K     +RTRS VSIFIV GLCCFFY+LGAWQRSGFGKGDSIALE+TK + DCNI+ 
Sbjct  1    MGSKHNPSGNRTRSPVSIFIVIGLCCFFYILGAWQRSGFGKGDSIALEITKQT-DCNIIS  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +LNFETHH+    SI+ S+ KV+  KPC  +YTDYTPCQ+Q RAM F R+NMIYRERHCP
Sbjct  60   NLNFETHHN-NVDSIEPSQLKVEVFKPCDDKYTDYTPCQEQDRAMKFPRENMIYRERHCP  118

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
              E+KLHCLIPAPKGY TPFPWPK RDYV YAN P+
Sbjct  119  EEEEKLHCLIPAPKGYKTPFPWPKGRDYVHYANVPH  154



>ref|XP_008393149.1| PREDICTED: probable methyltransferase PMT2 [Malus domestica]
Length=609

 Score =   234 bits (597),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 126/156 (81%), Gaps = 7/156 (4%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K  SGD+R+RSS+SI +VAGLCCFFY+LG WQRSGFGKGDSIA+++T +  DC+IL 
Sbjct  1    MATKGNSGDNRSRSSMSIVVVAGLCCFFYILGVWQRSGFGKGDSIAMDIT-SHTDCSILS  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            SL   THHSG     D SE  VKE K C  RY DYTPCQDQ RAMTF R+NM YRERHCP
Sbjct  60   SL--VTHHSG----TDGSEGVVKEFKSCGSRYIDYTPCQDQMRAMTFPRENMNYRERHCP  113

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P E+KLHCLIPAPKGYVTPF WP+SRDYVPYANAPY
Sbjct  114  PEEEKLHCLIPAPKGYVTPFRWPQSRDYVPYANAPY  149



>gb|EMS49438.1| putative methyltransferase PMT2 [Triticum urartu]
Length=614

 Score =   234 bits (597),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 129/156 (83%), Gaps = 2/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K    D+RTRS+VSI IV GLCCFFY+LGAWQ+SGFGKGDSIALE+TK + DC ILP
Sbjct  1    MAVKGGPADNRTRSTVSICIVIGLCCFFYILGAWQKSGFGKGDSIALEITKRT-DCTILP  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +L+F+THHS + GS  +  S VK+ KPC  R+TDYTPCQDQ RAM F R+NM YRERHCP
Sbjct  60   NLSFDTHHS-KQGSSGDLVSPVKKFKPCPDRFTDYTPCQDQNRAMKFPRENMNYRERHCP  118

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P+++KLHCL+P PKGYV PFPWPKSRDYVP+AN PY
Sbjct  119  PQKEKLHCLVPPPKGYVAPFPWPKSRDYVPFANCPY  154



>ref|XP_009413462.1| PREDICTED: probable methyltransferase PMT2 [Musa acuminata subsp. 
malaccensis]
Length=615

 Score =   234 bits (597),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/156 (68%), Positives = 123/156 (79%), Gaps = 1/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K+  G+ RTR+S+S+ +V GLCCFFY+LGAWQRSGFGKGDSIAL++TK +  C  + 
Sbjct  1    MAPKINHGEGRTRNSLSLIVVIGLCCFFYVLGAWQRSGFGKGDSIALQITKQTA-CTDIQ  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +LNFETHHSG     D  +S+ K  +PC  RYTDYTPC DQ RAMT+ R NMIYRERHCP
Sbjct  60   NLNFETHHSGLGSLSDLGDSETKTFEPCDDRYTDYTPCHDQNRAMTYPRDNMIYRERHCP  119

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
              E+KL CLIPAPKGYV PFPWPKSRDYVPYAN PY
Sbjct  120  SDEEKLDCLIPAPKGYVAPFPWPKSRDYVPYANVPY  155



>ref|XP_003578117.1| PREDICTED: probable methyltransferase PMT2 [Brachypodium distachyon]
Length=614

 Score =   234 bits (596),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/156 (69%), Positives = 131/156 (84%), Gaps = 2/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K  SG++RTR++VSI IV G+CCFFY+LGAWQ+SGFGKGDSIALE+TK + DC +LP
Sbjct  1    MAMKGVSGENRTRTTVSICIVIGMCCFFYILGAWQKSGFGKGDSIALEITKRT-DCTMLP  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +L+F+THHS + GS  +  S VK+ KPC  R+TDYTPCQDQ RAM F R+NM YRERHCP
Sbjct  60   NLSFDTHHS-KEGSSSDLVSPVKKFKPCPDRFTDYTPCQDQNRAMKFPRENMNYRERHCP  118

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P+++KLHCL+P PKGYV PFPWPKSRD+VP+AN PY
Sbjct  119  PQKEKLHCLVPPPKGYVAPFPWPKSRDFVPFANCPY  154



>gb|EMT27426.1| hypothetical protein F775_29617 [Aegilops tauschii]
Length=614

 Score =   233 bits (594),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 128/156 (82%), Gaps = 2/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K    D+RTRS VSI IV GLCCFFY+LGAWQ+SGFGKGDSIALE+TK + DC ILP
Sbjct  1    MAVKGGPADNRTRSIVSICIVIGLCCFFYILGAWQKSGFGKGDSIALEITKRT-DCTILP  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +L+F+THHS + GS  +  S VK+ KPC  R+TDYTPCQDQ RAM F R+NM YRERHCP
Sbjct  60   NLSFDTHHS-KQGSSGDLVSPVKKFKPCPDRFTDYTPCQDQNRAMKFPRENMNYRERHCP  118

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P+++KLHCL+P PKGYV PFPWPKSRDYVP+AN PY
Sbjct  119  PQKEKLHCLVPPPKGYVAPFPWPKSRDYVPFANCPY  154



>ref|XP_010917038.1| PREDICTED: probable methyltransferase PMT2 [Elaeis guineensis]
Length=616

 Score =   233 bits (594),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 108/156 (69%), Positives = 125/156 (80%), Gaps = 2/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K  + D RTRS++SI IV GLCCFFY+LG WQRSGFGKGD IA ++T+ + +C I  
Sbjct  1    MALKGNATDGRTRSTMSIIIVVGLCCFFYVLGVWQRSGFGKGDRIAAQITEQT-ECAIPS  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +LNFETHHSG  G  +  +S+VK  +PC   YTDYTPCQDQRRAMTF R NMIYRERHCP
Sbjct  60   NLNFETHHSG-GGVPNGDDSEVKTFEPCDDHYTDYTPCQDQRRAMTFPRDNMIYRERHCP  118

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P ++KL+CLIPAPKGYV PFPWPKSRDYVPYAN PY
Sbjct  119  PEQEKLYCLIPAPKGYVAPFPWPKSRDYVPYANVPY  154



>ref|XP_004499421.1| PREDICTED: probable methyltransferase PMT2-like isoform X1 [Cicer 
arietinum]
Length=606

 Score =   232 bits (591),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 124/157 (79%), Gaps = 2/157 (1%)
 Frame = +2

Query  146  MANKVTSGDSRT-RSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNIL  322
            MA K   GD+R  +  +SIFIV GLC FFY+LG WQRSGFGKGDSIA+E+TK + DC++L
Sbjct  1    MATKGNPGDNRNNKGPMSIFIVVGLCGFFYILGLWQRSGFGKGDSIAVEITKHT-DCSVL  59

Query  323  PSLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHC  502
              LN+ETHH   AG+ D+ + +VKE KPC   + DYTPC DQ RAMTF R+NM YRERHC
Sbjct  60   SDLNYETHHDSDAGTPDDLDEQVKEFKPCDDHFIDYTPCHDQARAMTFPRENMNYRERHC  119

Query  503  PPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            PP E+KLHCLI APKGY TPFPWPKSRDYVPYANAPY
Sbjct  120  PPDEEKLHCLIAAPKGYATPFPWPKSRDYVPYANAPY  156



>gb|KHN21848.1| Putative methyltransferase PMT2 [Glycine soja]
Length=606

 Score =   231 bits (589),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 105/157 (67%), Positives = 127/157 (81%), Gaps = 2/157 (1%)
 Frame = +2

Query  146  MANKVTSGDSRT-RSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNIL  322
            M  K   GD+R  RSS+SIFI+ GLC FFY+LG WQRSGFGKGDSIA+E+TK + DC++L
Sbjct  1    MVTKGNPGDNRNNRSSLSIFIIVGLCGFFYILGLWQRSGFGKGDSIAVEITKHT-DCSVL  59

Query  323  PSLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHC  502
              LN+ETHH   +G+ + S+++V+E KPC  RY DYTPC DQ RAMTF R+NM YRERHC
Sbjct  60   SDLNYETHHDDDSGTPNSSDTQVREFKPCDDRYIDYTPCHDQARAMTFPRENMAYRERHC  119

Query  503  PPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            PP ++KL+CLIPAP+GY TPF WPKSRDYVPYANAPY
Sbjct  120  PPDDEKLYCLIPAPRGYSTPFSWPKSRDYVPYANAPY  156



>ref|XP_003523024.1| PREDICTED: probable methyltransferase PMT2-like isoform X1 [Glycine 
max]
Length=606

 Score =   231 bits (589),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 105/157 (67%), Positives = 127/157 (81%), Gaps = 2/157 (1%)
 Frame = +2

Query  146  MANKVTSGDSRT-RSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNIL  322
            M  K   GD+R  RSS+SIFI+ GLC FFY+LG WQRSGFGKGDSIA+E+TK + DC++L
Sbjct  1    MVTKGNPGDNRNNRSSLSIFIIVGLCGFFYILGLWQRSGFGKGDSIAVEITKHT-DCSVL  59

Query  323  PSLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHC  502
              LN+ETHH   +G+ + S+++V+E KPC  RY DYTPC DQ RAMTF R+NM YRERHC
Sbjct  60   SDLNYETHHDDDSGTPNSSDTQVREFKPCDDRYIDYTPCHDQARAMTFPRENMAYRERHC  119

Query  503  PPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            PP ++KL+CLIPAP+GY TPF WPKSRDYVPYANAPY
Sbjct  120  PPDDEKLYCLIPAPRGYSTPFSWPKSRDYVPYANAPY  156



>ref|XP_008784684.1| PREDICTED: probable methyltransferase PMT2 [Phoenix dactylifera]
Length=612

 Score =   231 bits (588),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/156 (69%), Positives = 122/156 (78%), Gaps = 2/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA  +++ D RTRSS+SI IV GLCCFFY+LGAWQRSG G+GDSIAL VT+ + DC  LP
Sbjct  2    MAPNMSTTDHRTRSSMSIIIVVGLCCFFYVLGAWQRSGIGRGDSIALRVTRET-DCTTLP  60

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +L FETHHSG   S++ SE  VK  +PC   Y DYTPCQDQ RAM F R+NM YRERHCP
Sbjct  61   NLKFETHHSGGV-SLEPSELNVKVFEPCGVHYIDYTPCQDQNRAMQFPRENMAYRERHCP  119

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
               +KLHCLIPAPKGY TPFPWPKSRDYVPYAN PY
Sbjct  120  LENEKLHCLIPAPKGYATPFPWPKSRDYVPYANVPY  155



>ref|XP_010091504.1| putative methyltransferase PMT2 [Morus notabilis]
 gb|EXB44674.1| putative methyltransferase PMT2 [Morus notabilis]
Length=613

 Score =   230 bits (586),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 107/156 (69%), Positives = 125/156 (80%), Gaps = 3/156 (2%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K +S D+R R+S+SIFI+AGLCCFFY+LGAWQRSG GKGD IA  V + + DC++L 
Sbjct  1    MAKKGSSIDNRRRNSMSIFIIAGLCCFFYILGAWQRSGSGKGDRIADLVNRQT-DCSVLS  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +LN+ETHH    GS D  E  V+E KPC  +Y DYTPCQDQ RAM F R+NMIYRERHCP
Sbjct  60   NLNYETHHGNDVGSDDSEE--VEEFKPCKAQYIDYTPCQDQTRAMRFPRENMIYRERHCP  117

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P E+KL CL+PAP GYVTPFPWPKSRDYVP+ANAPY
Sbjct  118  PEEEKLRCLVPAPAGYVTPFPWPKSRDYVPFANAPY  153



>ref|XP_008651354.1| PREDICTED: uncharacterized protein LOC100279910 isoform X1 [Zea 
mays]
 tpg|DAA61440.1| TPA: ankyrin protein kinase-like protein [Zea mays]
Length=615

 Score =   230 bits (586),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 127/156 (81%), Gaps = 1/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K +S D+RTRS+VS+ IV G+CCFFY+LGAWQ+SGFGKGDSIALEVTK + DC ++P
Sbjct  1    MALKASSSDNRTRSTVSLCIVIGMCCFFYILGAWQKSGFGKGDSIALEVTKRT-DCTVVP  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +L+F+THHS  +G+     S  K+ KPC   YTDYTPCQDQ RAM F R+NM YRERHCP
Sbjct  60   NLSFDTHHSKASGNSSSLVSPSKKFKPCPDLYTDYTPCQDQNRAMKFPRENMNYRERHCP  119

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
             +++KLHCL+P PKGYV PFPWPKSRDYVP+AN PY
Sbjct  120  AQKEKLHCLVPPPKGYVAPFPWPKSRDYVPFANCPY  155



>ref|NP_001152470.1| ankyrin protein kinase-like [Zea mays]
 gb|ACG47777.1| ankyrin protein kinase-like [Zea mays]
Length=615

 Score =   230 bits (586),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 127/156 (81%), Gaps = 1/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K +S D+RTRS+VS+ IV G+CCFFY+LGAWQ+SGFGKGDSIALEVTK + DC ++P
Sbjct  1    MALKASSSDNRTRSTVSLCIVIGMCCFFYILGAWQKSGFGKGDSIALEVTKRT-DCTVVP  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +L+F+THHS  +G+     S  K+ KPC   YTDYTPCQDQ RAM F R+NM YRERHCP
Sbjct  60   NLSFDTHHSKASGNSSSLVSPSKKFKPCPDLYTDYTPCQDQNRAMKFPRENMNYRERHCP  119

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
             +++KLHCL+P PKGYV PFPWPKSRDYVP+AN PY
Sbjct  120  AQKEKLHCLVPPPKGYVAPFPWPKSRDYVPFANCPY  155



>gb|KEH33485.1| methyltransferase PMT2-like protein [Medicago truncatula]
Length=606

 Score =   229 bits (585),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 106/157 (68%), Positives = 123/157 (78%), Gaps = 2/157 (1%)
 Frame = +2

Query  146  MANKVTSGDSRT-RSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNIL  322
            MA K   GD+R  +  +SIFIV  LC FFY+LG WQRSGFGKGDSIA+E+TK + DC++L
Sbjct  1    MATKGNPGDNRNNKGPLSIFIVVALCGFFYILGLWQRSGFGKGDSIAVEITKHT-DCSVL  59

Query  323  PSLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHC  502
              LN+ETHH   AG+ D+ + +VKE KPC   Y DYTPC DQ RAMTF R+NM YRERHC
Sbjct  60   SDLNYETHHDNDAGTPDDVDEQVKEFKPCDDSYIDYTPCHDQARAMTFPRENMNYRERHC  119

Query  503  PPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            PP E+KLHCLI APKGY TPFPWPKSRDYVP+ANAPY
Sbjct  120  PPEEEKLHCLIAAPKGYSTPFPWPKSRDYVPFANAPY  156



>gb|KJB08228.1| hypothetical protein B456_001G071800 [Gossypium raimondii]
Length=617

 Score =   229 bits (584),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 103/156 (66%), Positives = 121/156 (78%), Gaps = 1/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K  SG+ ++RSS SIFIV GLCCFFY+LGAWQRSGFGKGD IA  +TK + DC+++ 
Sbjct  1    MAIKGNSGELKSRSSASIFIVIGLCCFFYILGAWQRSGFGKGDKIASAITKQT-DCSVIS  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +LN+ETHH     + D S+   KE   CH +Y DYTPCQDQ RAM F R NMIYRERHCP
Sbjct  60   NLNYETHHGDDVVTADGSDKAAKEFPSCHAKYVDYTPCQDQMRAMKFPRDNMIYRERHCP  119

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
              ++KL CLIPAPKGY TPFPWP+SRDYVP+ANAPY
Sbjct  120  TEDEKLQCLIPAPKGYATPFPWPQSRDYVPFANAPY  155



>ref|NP_001063174.1| Os09g0415700 [Oryza sativa Japonica Group]
 dbj|BAD28913.1| dehydration-responsive protein-like [Oryza sativa Japonica Group]
 dbj|BAD29253.1| dehydration-responsive protein-like [Oryza sativa Japonica Group]
 dbj|BAF25088.1| Os09g0415700 [Oryza sativa Japonica Group]
 gb|EAZ44732.1| hypothetical protein OsJ_29364 [Oryza sativa Japonica Group]
Length=616

 Score =   229 bits (584),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/156 (69%), Positives = 128/156 (82%), Gaps = 2/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K +S D+RTRS+VS+ IV G+CCFFY+LGAWQ+SGFGKGDSIALE+TK + DC ILP
Sbjct  1    MAVKASSADNRTRSTVSLCIVIGMCCFFYILGAWQKSGFGKGDSIALEITKRT-DCTILP  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +L+F+TH + +A   D   S  K+ KPC  RYTDYTPCQDQ RAM F R+NM YRERHCP
Sbjct  60   NLSFDTHLAKQARPRDLV-SPAKKFKPCPDRYTDYTPCQDQNRAMKFPRENMNYRERHCP  118

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P+++KLHCLIP PKGYV PFPWPKSRDYVP+AN PY
Sbjct  119  PQKEKLHCLIPPPKGYVAPFPWPKSRDYVPFANCPY  154



>emb|CDP12320.1| unnamed protein product [Coffea canephora]
Length=1044

 Score =   233 bits (593),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 107/156 (69%), Positives = 126/156 (81%), Gaps = 2/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            M  K   GDSR + SVS+FIVAGLCC F+LLGAWQRSG GKGD+IA E+TK +K C+IL 
Sbjct  1    MVTKGNPGDSRNKRSVSMFIVAGLCCVFFLLGAWQRSGSGKGDNIAYEITKKAKACSILG  60

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +L FETHH  +A  +++S  +VKE KPC  +Y DYTPCQDQ RAMTF R++M YRERHCP
Sbjct  61   NLEFETHHGNKA--VNDSMLEVKEYKPCDDQYIDYTPCQDQARAMTFPREDMNYRERHCP  118

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
              ++KLHCLIPAPKGYVTPF WPKSRDYVPYANAP+
Sbjct  119  SEQEKLHCLIPAPKGYVTPFRWPKSRDYVPYANAPH  154



>gb|KJB08229.1| hypothetical protein B456_001G071800 [Gossypium raimondii]
Length=655

 Score =   229 bits (583),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 103/156 (66%), Positives = 121/156 (78%), Gaps = 1/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K  SG+ ++RSS SIFIV GLCCFFY+LGAWQRSGFGKGD IA  +TK + DC+++ 
Sbjct  1    MAIKGNSGELKSRSSASIFIVIGLCCFFYILGAWQRSGFGKGDKIASAITKQT-DCSVIS  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +LN+ETHH     + D S+   KE   CH +Y DYTPCQDQ RAM F R NMIYRERHCP
Sbjct  60   NLNYETHHGDDVVTADGSDKAAKEFPSCHAKYVDYTPCQDQMRAMKFPRDNMIYRERHCP  119

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
              ++KL CLIPAPKGY TPFPWP+SRDYVP+ANAPY
Sbjct  120  TEDEKLQCLIPAPKGYATPFPWPQSRDYVPFANAPY  155



>gb|EAZ09099.1| hypothetical protein OsI_31366 [Oryza sativa Indica Group]
Length=616

 Score =   227 bits (578),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 107/156 (69%), Positives = 127/156 (81%), Gaps = 2/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K +S D+RTRS+VS+ IV G+CCFFY+LGAWQ+SGFGKGDSIALE+TK + DC ILP
Sbjct  1    MAVKASSADNRTRSTVSLCIVIGMCCFFYILGAWQKSGFGKGDSIALEITKRT-DCTILP  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +L+F+TH + +A   D      K+ KPC  RYTDYTPCQDQ RAM F R+NM YRERHCP
Sbjct  60   NLSFDTHLAKQARPRDLVLP-AKKFKPCPDRYTDYTPCQDQNRAMKFPRENMNYRERHCP  118

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P+++KLHCLIP PKGYV PFPWPKSRDYVP+AN PY
Sbjct  119  PQKEKLHCLIPPPKGYVAPFPWPKSRDYVPFANCPY  154



>ref|XP_010668105.1| PREDICTED: probable methyltransferase PMT2 [Beta vulgaris subsp. 
vulgaris]
Length=605

 Score =   226 bits (577),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 125/159 (79%), Gaps = 13/159 (8%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            M  K ++GD +TRS +SIFIV GLCCFF+LLG+WQRSGFGKGD IA ++TK + DC+IL 
Sbjct  1    MGTKGSNGDYKTRSPLSIFIVIGLCCFFFLLGSWQRSGFGKGDRIAAQITKQT-DCSILT  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIK---PCHPRYTDYTPCQDQRRAMTFSRQNMIYRER  496
             LNFETHH          E+ +KE+K   PC  R+ DYTPCQDQ RAMT+ R+NM YRER
Sbjct  60   DLNFETHHG---------ENLIKEVKRFDPCPDRFIDYTPCQDQGRAMTYPRENMNYRER  110

Query  497  HCPPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            HCPP E+KL CL+PAPKGYVTPFPWPKSRDYVPYANAPY
Sbjct  111  HCPPEEEKLRCLVPAPKGYVTPFPWPKSRDYVPYANAPY  149



>emb|CDP12957.1| unnamed protein product [Coffea canephora]
Length=612

 Score =   226 bits (576),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/156 (67%), Positives = 123/156 (79%), Gaps = 2/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA+K     SR RS VSIF+V GLCCFFYLLG WQ+SGFGKGD +A+E+TK + DC + P
Sbjct  1    MASKHHLLGSRGRSPVSIFVVLGLCCFFYLLGTWQKSGFGKGDRLAMEITKRT-DCTVFP  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +L+FE+HH  +   ++ SE K K I+PC  RYTDYTPCQ+Q RAMTF R+NMIYRERHCP
Sbjct  60   ALDFESHHK-QEPPVESSEPKAKVIEPCDVRYTDYTPCQEQDRAMTFPRENMIYRERHCP  118

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P E+KLHCLIPAP G+ TPFPWPK RDYV YAN PY
Sbjct  119  PTEEKLHCLIPAPNGWTTPFPWPKGRDYVHYANVPY  154



>ref|XP_004986789.1| PREDICTED: probable methyltransferase PMT2-like [Setaria italica]
Length=606

 Score =   226 bits (575),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 124/155 (80%), Gaps = 3/155 (2%)
 Frame = +2

Query  149  ANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPS  328
             +++  GD RTRS+++I IV GLCCFFY+LGAWQ+SG G+GDSIAL V + + DC ILP+
Sbjct  3    GSRMNPGDRRTRSTMTIVIVMGLCCFFYILGAWQKSGTGRGDSIALRVNQET-DCTILPN  61

Query  329  LNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCPP  508
            L+FETHHS    +     +KV  I+PCH RY+DYTPCQDQ RAM F R+NM YRERHCP 
Sbjct  62   LHFETHHSLSGANPLIMTNKV--IEPCHIRYSDYTPCQDQNRAMAFPRENMTYRERHCPA  119

Query  509  REKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
              +KLHCLIPAPKGYVTPFPWPKSRDYVP+ANAPY
Sbjct  120  ENEKLHCLIPAPKGYVTPFPWPKSRDYVPFANAPY  154



>ref|XP_008229546.1| PREDICTED: probable methyltransferase PMT14 [Prunus mume]
 ref|XP_008229547.1| PREDICTED: probable methyltransferase PMT14 [Prunus mume]
 ref|XP_008229548.1| PREDICTED: probable methyltransferase PMT14 [Prunus mume]
Length=612

 Score =   226 bits (575),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/156 (67%), Positives = 120/156 (77%), Gaps = 1/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            M +K  S  +RTRS++SIF+V  LCCFFYLLGAWQ+SGFGKGDSIA  VTK +   N+  
Sbjct  1    MKSKHNSSGNRTRSTISIFVVIALCCFFYLLGAWQKSGFGKGDSIAFPVTKQTDCSNVFT  60

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
             LNFETHH+     ++ SE K KE KPC  +Y DYTPCQ+Q RAM F R+NMIYRERHCP
Sbjct  61   DLNFETHHNIEE-IVEPSEPKAKEFKPCDVKYADYTPCQEQDRAMKFPRENMIYRERHCP  119

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P E+KLHCLIPA KGY+TPFPWPK RDYV YAN PY
Sbjct  120  PEEEKLHCLIPARKGYMTPFPWPKGRDYVHYANVPY  155



>ref|XP_008373611.1| PREDICTED: probable methyltransferase PMT14 [Malus domestica]
Length=383

 Score =   220 bits (560),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 122/160 (76%), Gaps = 6/160 (4%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            M +K  S  +RTRS++S+F+V  LCCFFYLLGAWQ+SGFGKGD IA +VTK  KDCN+ P
Sbjct  1    MGSKHNSSGNRTRSTLSVFVVISLCCFFYLLGAWQKSGFGKGDKIAFQVTK-QKDCNVFP  59

Query  326  SLN----FETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRE  493
             LN    FE+HHS     ++  E K KE KPC  +Y DYTPCQ+Q RAM F R++M+YRE
Sbjct  60   DLNSDLNFESHHS-IVEMVEPYEPKAKEFKPCDVKYADYTPCQEQDRAMKFPREDMVYRE  118

Query  494  RHCPPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            RHCPP E+KLHCLIPA +GY+TPFPWPK RDYV YAN PY
Sbjct  119  RHCPPEEEKLHCLIPAREGYMTPFPWPKGRDYVHYANVPY  158



>ref|NP_001065447.2| Os10g0569300 [Oryza sativa Japonica Group]
 gb|ABB48009.1| Methyltransferase, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAG92980.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF27284.2| Os10g0569300 [Oryza sativa Japonica Group]
Length=605

 Score =   225 bits (574),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 122/155 (79%), Gaps = 3/155 (2%)
 Frame = +2

Query  149  ANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPS  328
             +++  GD RTRS++SI IV  LCCFFY+LGAWQ+SG G+GDSIAL VTK + DC ILP+
Sbjct  3    GSRMNPGDRRTRSTMSIVIVMSLCCFFYILGAWQKSGTGRGDSIALRVTKET-DCTILPN  61

Query  329  LNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCPP  508
            L+FETHHS   G ++      K  +PCH RY+DYTPCQDQ RAM F R+NM YRERHCP 
Sbjct  62   LHFETHHS--LGGVNPLVMTDKVFEPCHIRYSDYTPCQDQNRAMNFPRENMNYRERHCPT  119

Query  509  REKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
              KKL CLIPAPKGYVTPFPWPKSRDYVPYANAPY
Sbjct  120  ETKKLRCLIPAPKGYVTPFPWPKSRDYVPYANAPY  154



>ref|XP_006662085.1| PREDICTED: probable methyltransferase PMT2-like [Oryza brachyantha]
Length=605

 Score =   225 bits (574),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 122/155 (79%), Gaps = 3/155 (2%)
 Frame = +2

Query  149  ANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPS  328
             +++  GD RTRS+++I IV  LCCFFY+LGAWQ+SG G+GDSIAL VTK + DC ILP+
Sbjct  3    GSRMNPGDRRTRSTMTIVIVMSLCCFFYILGAWQKSGTGRGDSIALRVTKET-DCTILPN  61

Query  329  LNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCPP  508
            L+FETHHS   G ++      K  +PCH RY DYTPCQDQ RAMTF R+NM YRERHCP 
Sbjct  62   LHFETHHS--LGGVNPLVMTNKVFEPCHIRYIDYTPCQDQNRAMTFPRENMNYRERHCPA  119

Query  509  REKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
              +KL CLIPAPKGYVTPFPWPKSRDYVPYANAPY
Sbjct  120  ENEKLRCLIPAPKGYVTPFPWPKSRDYVPYANAPY  154



>ref|XP_008362975.1| PREDICTED: probable methyltransferase PMT14 [Malus domestica]
Length=537

 Score =   224 bits (570),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 121/160 (76%), Gaps = 6/160 (4%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            M  K  S  +RTRS++SIF+V  LCCFFYLLGAWQ+SGFGKGD IA +VTK  KDCN+  
Sbjct  1    MGPKHNSSGNRTRSTLSIFVVISLCCFFYLLGAWQKSGFGKGDKIAFQVTK-QKDCNVFA  59

Query  326  SLN----FETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRE  493
             LN    FETHH+     ++ SE K KE KPCH +Y DYTPCQ+Q RAM F R+NMIYRE
Sbjct  60   ELNSDLNFETHHN-VVEIVEPSEPKAKEFKPCHVKYADYTPCQEQDRAMKFPRENMIYRE  118

Query  494  RHCPPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            RHCPP E+KLHCLIPA +GY+TPFPWPK RDYV Y N PY
Sbjct  119  RHCPPEEEKLHCLIPAREGYMTPFPWPKGRDYVHYGNVPY  158



>ref|XP_007138189.1| hypothetical protein PHAVU_009G187900g [Phaseolus vulgaris]
 gb|ESW10183.1| hypothetical protein PHAVU_009G187900g [Phaseolus vulgaris]
Length=607

 Score =   225 bits (574),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 105/157 (67%), Positives = 121/157 (77%), Gaps = 2/157 (1%)
 Frame = +2

Query  146  MANKVTSGDSRT-RSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNIL  322
            M  K   GD+R  RS +SIFIV GLC FFY+LG WQRSGFGKGDSIA+E+TK + DC++L
Sbjct  1    MVTKGNPGDNRNNRSPLSIFIVVGLCGFFYILGLWQRSGFGKGDSIAVEITKHT-DCSVL  59

Query  323  PSLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHC  502
              LN+ETHH     + D S+++VKE KPC   Y DYTPC DQ RAM F R+NM YRERHC
Sbjct  60   SDLNYETHHDDDVETSDGSDTQVKEFKPCDDHYIDYTPCHDQMRAMKFPRENMAYRERHC  119

Query  503  PPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
             P E+KLHCLIPAP+GY TPFPWP SRDYVPYANAPY
Sbjct  120  FPDEEKLHCLIPAPRGYSTPFPWPMSRDYVPYANAPY  156



>ref|XP_006368452.1| hypothetical protein POPTR_0001s02930g [Populus trichocarpa]
 gb|ERP65021.1| hypothetical protein POPTR_0001s02930g [Populus trichocarpa]
Length=612

 Score =   225 bits (574),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 104/156 (67%), Positives = 122/156 (78%), Gaps = 2/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            M  K +S   +TR+S+SIF+V  LCC FY+LGAWQ+SGFGKGD IA+++TK + DCNI  
Sbjct  1    MGTKHSSMGFKTRNSLSIFVVICLCCLFYILGAWQKSGFGKGDGIAVQMTKKT-DCNIFT  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
             LNFETHH+     I+ S+ K K  KPCH +YTDYTPCQ+Q RAM F R+NMIYRERHCP
Sbjct  60   ELNFETHHN-YVEIIEPSQPKAKVFKPCHVKYTDYTPCQEQDRAMKFPRENMIYRERHCP  118

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P E+KLHCLIPAPKGY TPFPWPK RDYV YAN PY
Sbjct  119  PEEEKLHCLIPAPKGYKTPFPWPKGRDYVRYANVPY  154



>ref|XP_002317981.2| hypothetical protein POPTR_0012s07080g [Populus trichocarpa]
 gb|EEE96201.2| hypothetical protein POPTR_0012s07080g [Populus trichocarpa]
Length=610

 Score =   225 bits (573),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 105/157 (67%), Positives = 127/157 (81%), Gaps = 5/157 (3%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSV-SIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNIL  322
            MA K  SGD ++ +S+ SIF++AGLCCFFY+LGAWQRSGFGKGD+IALE++K + DC++ 
Sbjct  1    MATKGNSGDRKSNNSLFSIFVIAGLCCFFYILGAWQRSGFGKGDNIALEISKQT-DCSVF  59

Query  323  PSLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHC  502
             +LN++   SG AG ID+  ++VKE KPC  +Y DYTPCQDQ RAMTF R NMIYRERHC
Sbjct  60   NNLNYQ--KSGDAGMIDDG-AQVKEFKPCEDKYIDYTPCQDQMRAMTFPRDNMIYRERHC  116

Query  503  PPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            PP  +KL CLIPAPKGY  PFPWPKSRDYVP+ NAPY
Sbjct  117  PPDNEKLPCLIPAPKGYANPFPWPKSRDYVPFVNAPY  153



>ref|XP_002460211.1| hypothetical protein SORBIDRAFT_02g024670 [Sorghum bicolor]
 gb|EER96732.1| hypothetical protein SORBIDRAFT_02g024670 [Sorghum bicolor]
Length=618

 Score =   225 bits (573),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 126/159 (79%), Gaps = 4/159 (3%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K +SG++RTRS+V + IV G+CCFFY+LGAWQ+SGFGKGDSIALEVTK + DC +LP
Sbjct  1    MALKASSGENRTRSTVFLCIVIGMCCFFYILGAWQKSGFGKGDSIALEVTKRT-DCTVLP  59

Query  326  SLNFETHHSGRAGSIDESESK---VKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRER  496
            +L+F+THHS  A     S+      K+ KPC  RYTDYTPCQDQ RAM F R NM YRER
Sbjct  60   NLSFDTHHSKPASDSSSSDLVVSPAKKFKPCADRYTDYTPCQDQNRAMKFPRDNMNYRER  119

Query  497  HCPPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            HCP +++KLHCLIP PKGYV PFPWPKSRDYVP+AN PY
Sbjct  120  HCPAQKEKLHCLIPPPKGYVAPFPWPKSRDYVPFANCPY  158



>ref|XP_003574364.1| PREDICTED: probable methyltransferase PMT2 [Brachypodium distachyon]
Length=604

 Score =   224 bits (572),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 122/155 (79%), Gaps = 3/155 (2%)
 Frame = +2

Query  149  ANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPS  328
             +++  GD RTRS +S+ IV  LC FFY+LGAWQ+SG G+GDSIAL VTK + DC ILP+
Sbjct  3    GSRMNPGDHRTRSVMSVLIVMSLCGFFYILGAWQKSGTGRGDSIALRVTKET-DCTILPN  61

Query  329  LNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCPP  508
            L+FETHHS   G ++      K I PCH RY+DYTPCQDQ RAMTF R+NM YRERHCP 
Sbjct  62   LHFETHHS--RGGVNPLVMNSKVIAPCHIRYSDYTPCQDQSRAMTFPRENMTYRERHCPV  119

Query  509  REKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
              +KLHCLIPAPKGYVTPFPWPKSR+YVPYANAPY
Sbjct  120  DNEKLHCLIPAPKGYVTPFPWPKSREYVPYANAPY  154



>ref|XP_007039581.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOY24082.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=612

 Score =   224 bits (572),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 106/156 (68%), Positives = 122/156 (78%), Gaps = 2/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA+K  +  +RTRS +SIF V GLCCFFY+LGAWQRSGFGKGDSIALEVTK + DCNI  
Sbjct  1    MASKHNTSGNRTRSPLSIFAVIGLCCFFYILGAWQRSGFGKGDSIALEVTKQT-DCNIFT  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +LNFETHH+     ++ S+ K    KPC  +YTDYTPCQ+Q  AM F R NMIYRERHCP
Sbjct  60   NLNFETHHND-VEIVEHSKPKAVVFKPCDLKYTDYTPCQEQDHAMKFPRDNMIYRERHCP  118

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
              E+KLHCLIPAPKGY+TPF WPKSRDYV YAN P+
Sbjct  119  AEEEKLHCLIPAPKGYMTPFEWPKSRDYVHYANVPH  154



>ref|XP_009371899.1| PREDICTED: probable methyltransferase PMT14 isoform X2 [Pyrus 
x bretschneideri]
Length=615

 Score =   224 bits (570),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/160 (65%), Positives = 122/160 (76%), Gaps = 6/160 (4%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            M +K  S  +RTRS++S+F+V  LCCFFYLLGAWQRSGFGKGD IA +VTK  KDCN+ P
Sbjct  1    MGSKHNSSGNRTRSTLSVFVVISLCCFFYLLGAWQRSGFGKGDKIAFQVTK-QKDCNVFP  59

Query  326  SLN----FETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRE  493
             LN    FE+HHS     ++  E K KE KPC  +Y DYTPCQ+Q RAM F R+NM+YRE
Sbjct  60   DLNSDLNFESHHS-IVEIVEPYEPKAKEFKPCDVKYADYTPCQEQDRAMKFPRENMVYRE  118

Query  494  RHCPPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            RHCPP E+KLHCLIPA +GY+TPFPWPK RDYV YAN PY
Sbjct  119  RHCPPEEEKLHCLIPAREGYMTPFPWPKGRDYVHYANVPY  158



>ref|XP_009371893.1| PREDICTED: probable methyltransferase PMT14 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009371894.1| PREDICTED: probable methyltransferase PMT14 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009371895.1| PREDICTED: probable methyltransferase PMT14 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009371896.1| PREDICTED: probable methyltransferase PMT14 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009371897.1| PREDICTED: probable methyltransferase PMT14 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009371898.1| PREDICTED: probable methyltransferase PMT14 isoform X1 [Pyrus 
x bretschneideri]
Length=616

 Score =   224 bits (570),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/160 (65%), Positives = 122/160 (76%), Gaps = 6/160 (4%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            M +K  S  +RTRS++S+F+V  LCCFFYLLGAWQRSGFGKGD IA +VTK  KDCN+ P
Sbjct  1    MGSKHNSSGNRTRSTLSVFVVISLCCFFYLLGAWQRSGFGKGDKIAFQVTK-QKDCNVFP  59

Query  326  SLN----FETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRE  493
             LN    FE+HHS     ++  E K KE KPC  +Y DYTPCQ+Q RAM F R+NM+YRE
Sbjct  60   DLNSDLNFESHHS-IVEIVEPYEPKAKEFKPCDVKYADYTPCQEQDRAMKFPRENMVYRE  118

Query  494  RHCPPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            RHCPP E+KLHCLIPA +GY+TPFPWPK RDYV YAN PY
Sbjct  119  RHCPPEEEKLHCLIPAREGYMTPFPWPKGRDYVHYANVPY  158



>ref|XP_010029626.1| PREDICTED: probable methyltransferase PMT2 isoform X2 [Eucalyptus 
grandis]
Length=538

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/156 (65%), Positives = 121/156 (78%), Gaps = 1/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K    + R+RSS+ IF++  LCC FY+LGAWQRSGFGKGDSIALEVTK + DC++L 
Sbjct  1    MAYKGIPNERRSRSSMPIFVIVALCCAFYILGAWQRSGFGKGDSIALEVTKQA-DCSVLS  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +L +ET     A   D+S++ +KE KPC  +Y DYTPCQDQ RAM F R+NM YRERHCP
Sbjct  60   NLQYETQEIRDARVTDDSDTDIKEFKPCDDQYIDYTPCQDQMRAMMFPRENMNYRERHCP  119

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
              E KL CL+PAPKGYVTPFPWPKSRDYVP+ANAPY
Sbjct  120  TEEGKLRCLVPAPKGYVTPFPWPKSRDYVPFANAPY  155



>ref|XP_006385609.1| hypothetical protein POPTR_0003s08590g [Populus trichocarpa]
 gb|ERP63406.1| hypothetical protein POPTR_0003s08590g [Populus trichocarpa]
Length=612

 Score =   223 bits (568),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 104/156 (67%), Positives = 121/156 (78%), Gaps = 2/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            M NK  S   +TRS +SIFIV  LCCFFY+LGAWQ+SGFGKGD IA++++K + DC I P
Sbjct  1    MGNKHNSAGFKTRSPLSIFIVICLCCFFYILGAWQKSGFGKGDGIAVQMSKQT-DCQIFP  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
             LNFETHH+     I+ S+ K K  KPC  +YTDYTPCQ+Q RAMTF R+NMIYRERHCP
Sbjct  60   DLNFETHHND-VEIIEPSKPKAKVFKPCDVKYTDYTPCQEQDRAMTFPRENMIYRERHCP  118

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
              E+KLHCLIPAPKGY TPFPWPK RDYV YAN P+
Sbjct  119  REEEKLHCLIPAPKGYTTPFPWPKGRDYVHYANVPH  154



>gb|KJB51712.1| hypothetical protein B456_008G228900 [Gossypium raimondii]
Length=529

 Score =   221 bits (563),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 104/156 (67%), Positives = 122/156 (78%), Gaps = 2/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            M +K     ++ RS +SIF V GLCCFFY+LGAWQRSGFGKGDSIALEVTK + DC+I  
Sbjct  1    MVSKHNPSGNKKRSPLSIFAVIGLCCFFYILGAWQRSGFGKGDSIALEVTKQA-DCSIFT  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +LNFETHH+     ++ S+ K +  KPC  +YTDYTPCQ+Q RAM F R NMIYRERHCP
Sbjct  60   NLNFETHHND-VEIVEPSKPKAQVFKPCDVKYTDYTPCQEQDRAMKFPRDNMIYRERHCP  118

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P E+KLHCLIPAPKGY+TPF WPKSRDYV YAN P+
Sbjct  119  PEEEKLHCLIPAPKGYMTPFEWPKSRDYVHYANVPH  154



>ref|XP_010029610.1| PREDICTED: probable methyltransferase PMT2 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010029618.1| PREDICTED: probable methyltransferase PMT2 isoform X1 [Eucalyptus 
grandis]
 gb|KCW83590.1| hypothetical protein EUGRSUZ_B00481 [Eucalyptus grandis]
Length=614

 Score =   223 bits (567),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 102/156 (65%), Positives = 121/156 (78%), Gaps = 1/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K    + R+RSS+ IF++  LCC FY+LGAWQRSGFGKGDSIALEVTK + DC++L 
Sbjct  1    MAYKGIPNERRSRSSMPIFVIVALCCAFYILGAWQRSGFGKGDSIALEVTKQA-DCSVLS  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +L +ET     A   D+S++ +KE KPC  +Y DYTPCQDQ RAM F R+NM YRERHCP
Sbjct  60   NLQYETQEIRDARVTDDSDTDIKEFKPCDDQYIDYTPCQDQMRAMMFPRENMNYRERHCP  119

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
              E KL CL+PAPKGYVTPFPWPKSRDYVP+ANAPY
Sbjct  120  TEEGKLRCLVPAPKGYVTPFPWPKSRDYVPFANAPY  155



>ref|XP_002528760.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF33582.1| ATP binding protein, putative [Ricinus communis]
Length=612

 Score =   222 bits (565),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 121/156 (78%), Gaps = 2/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            M +K+    +RTRS +SIFIV  LCCFFY+LGAWQ+SGFGKGDSIA EVTK + DCNI P
Sbjct  1    MGSKLNPTGNRTRSPLSIFIVFCLCCFFYVLGAWQKSGFGKGDSIAFEVTKQT-DCNIFP  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
             LNFE  H+     I  S+ K +  KPC  +YTDYTPCQ+Q RAM FSR+NMIYRERHCP
Sbjct  60   ELNFEPRHN-IVEIIQPSKPKAEVFKPCDVKYTDYTPCQEQDRAMKFSRENMIYRERHCP  118

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P E+KLHCLIPAP+GY TPFPWPK RDYV +AN PY
Sbjct  119  PEEEKLHCLIPAPEGYKTPFPWPKGRDYVHFANVPY  154



>ref|XP_009393699.1| PREDICTED: probable methyltransferase PMT2 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=617

 Score =   222 bits (565),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 108/156 (69%), Positives = 130/156 (83%), Gaps = 2/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K  + D+RTRSSVSIFI+  +CCFFY+LGAWQ+SGFGKGDSIA+E+TK + DC ILP
Sbjct  1    MAVKGNAADNRTRSSVSIFIIISMCCFFYILGAWQKSGFGKGDSIAIEITKQT-DCTILP  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +L+FETHHS R+   D+  ++V+  +PCH RY DYTPCQDQ RAM F R+NM YRERHCP
Sbjct  60   NLSFETHHS-RSDFGDDIGAEVRTFEPCHERYRDYTPCQDQNRAMLFPRENMNYRERHCP  118

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P E+KL+CLIPAP+GYV PFPWPKSRD+VPYAN PY
Sbjct  119  PEEEKLYCLIPAPEGYVAPFPWPKSRDFVPYANVPY  154



>ref|XP_009393700.1| PREDICTED: probable methyltransferase PMT2 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=616

 Score =   222 bits (565),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 108/156 (69%), Positives = 130/156 (83%), Gaps = 2/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K  + D+RTRSSVSIFI+  +CCFFY+LGAWQ+SGFGKGDSIA+E+TK + DC ILP
Sbjct  1    MAVKGNAADNRTRSSVSIFIIISMCCFFYILGAWQKSGFGKGDSIAIEITKQT-DCTILP  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +L+FETHHS R+   D+  ++V+  +PCH RY DYTPCQDQ RAM F R+NM YRERHCP
Sbjct  60   NLSFETHHS-RSDFGDDIGAEVRTFEPCHERYRDYTPCQDQNRAMLFPRENMNYRERHCP  118

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P E+KL+CLIPAP+GYV PFPWPKSRD+VPYAN PY
Sbjct  119  PEEEKLYCLIPAPEGYVAPFPWPKSRDFVPYANVPY  154



>gb|KJB51709.1| hypothetical protein B456_008G228900 [Gossypium raimondii]
 gb|KJB51710.1| hypothetical protein B456_008G228900 [Gossypium raimondii]
 gb|KJB51711.1| hypothetical protein B456_008G228900 [Gossypium raimondii]
Length=613

 Score =   221 bits (564),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/156 (67%), Positives = 122/156 (78%), Gaps = 2/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            M +K     ++ RS +SIF V GLCCFFY+LGAWQRSGFGKGDSIALEVTK + DC+I  
Sbjct  1    MVSKHNPSGNKKRSPLSIFAVIGLCCFFYILGAWQRSGFGKGDSIALEVTKQA-DCSIFT  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +LNFETHH+     ++ S+ K +  KPC  +YTDYTPCQ+Q RAM F R NMIYRERHCP
Sbjct  60   NLNFETHHND-VEIVEPSKPKAQVFKPCDVKYTDYTPCQEQDRAMKFPRDNMIYRERHCP  118

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P E+KLHCLIPAPKGY+TPF WPKSRDYV YAN P+
Sbjct  119  PEEEKLHCLIPAPKGYMTPFEWPKSRDYVHYANVPH  154



>gb|KHG27439.1| hypothetical protein F383_15139 [Gossypium arboreum]
Length=643

 Score =   221 bits (564),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/156 (67%), Positives = 122/156 (78%), Gaps = 2/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            M +K     ++ RS +SIF V GLCCFFY+LGAWQRSGFGKGDSIALEVTK + DC+I  
Sbjct  1    MVSKHNPSGNKKRSPLSIFAVIGLCCFFYILGAWQRSGFGKGDSIALEVTKQA-DCSIFT  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +LNFETHH+     ++ S+ K +  KPC  +YTDYTPCQ+Q RAM F R NMIYRERHCP
Sbjct  60   NLNFETHHND-VEIVEPSKPKAQVFKPCDVKYTDYTPCQEQDRAMKFPRDNMIYRERHCP  118

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P E+KLHCLIPAPKGY+TPF WPKSRDYV YAN P+
Sbjct  119  PEEEKLHCLIPAPKGYMTPFEWPKSRDYVHYANVPH  154



>dbj|BAJ85549.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=670

 Score =   221 bits (564),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/148 (70%), Positives = 119/148 (80%), Gaps = 3/148 (2%)
 Frame = +2

Query  170  DSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLNFETHH  349
            D RTRS +S+ IV GLC FFY+LGAWQ+SG G+GDSIAL VTK + DC ILP+L+FETHH
Sbjct  74   DRRTRSIMSVVIVMGLCGFFYILGAWQKSGTGRGDSIALRVTKET-DCTILPNLHFETHH  132

Query  350  SGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCPPREKKLHC  529
            S     ++      K  KPC+ RY+DYTPCQDQ RAMTF R NMIYRERHCP + +KLHC
Sbjct  133  S--MDGVNPLTMNNKVFKPCNIRYSDYTPCQDQNRAMTFPRGNMIYRERHCPAKNEKLHC  190

Query  530  LIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            LIPAPKGYVTPFPWPKSR+YVPYANAPY
Sbjct  191  LIPAPKGYVTPFPWPKSREYVPYANAPY  218



>ref|XP_008658538.1| PREDICTED: probable methyltransferase PMT2 [Zea mays]
 ref|XP_008658539.1| PREDICTED: probable methyltransferase PMT2 [Zea mays]
Length=604

 Score =   220 bits (560),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 122/155 (79%), Gaps = 3/155 (2%)
 Frame = +2

Query  149  ANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPS  328
             +++  GD RTRS+++I IV GL CFFY+LGAWQ+SG G+GDSIAL V + + DC ILP+
Sbjct  3    GSRMNPGDRRTRSTMTIVIVMGLSCFFYILGAWQKSGTGRGDSIALRVNQET-DCTILPN  61

Query  329  LNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCPP  508
            L+FETHH+    +     +K+  I+PCH RY+DYTPCQDQ RAM F RQNM YRERHCP 
Sbjct  62   LHFETHHTISGANPLIMSNKM--IEPCHIRYSDYTPCQDQNRAMAFPRQNMTYRERHCPV  119

Query  509  REKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
              +KLHCLIPAPKGYVTPF WPKSRDYVPYANAPY
Sbjct  120  ENEKLHCLIPAPKGYVTPFSWPKSRDYVPYANAPY  154



>ref|XP_011018634.1| PREDICTED: probable methyltransferase PMT14 isoform X2 [Populus 
euphratica]
Length=513

 Score =   218 bits (555),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 101/156 (65%), Positives = 121/156 (78%), Gaps = 2/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            M  K +S   +T+S +SIFIV  LCC FY+LGAWQ+SGFGKGD +A+++TK + DCNI  
Sbjct  1    MGTKHSSMGFKTQSPLSIFIVICLCCLFYILGAWQKSGFGKGDGLAVQMTKKT-DCNIFT  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
             LNFETHH+     I+ S+ + K  KPCH +YTDYTPCQ+Q RAM F R+NMIYRERHCP
Sbjct  60   ELNFETHHN-YVEIIEPSQPEAKIFKPCHVKYTDYTPCQEQDRAMKFPRENMIYRERHCP  118

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P E+KLHCLIPAPKGY TPFPWPK RDYV YAN P+
Sbjct  119  PEEEKLHCLIPAPKGYKTPFPWPKGRDYVHYANVPH  154



>ref|XP_004508998.1| PREDICTED: probable methyltransferase PMT14-like [Cicer arietinum]
Length=611

 Score =   220 bits (560),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 99/156 (63%), Positives = 121/156 (78%), Gaps = 1/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            M +K  +  ++TR  +SIF V  LCC FYLLGAWQRSG GKGDS+AL+V K   DCN++P
Sbjct  1    MGSKSAALGNKTRRPLSIFAVIALCCLFYLLGAWQRSGSGKGDSLALKVNKLQTDCNVVP  60

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +L+FE HH+    +++ SE K K  K C  +YTDYTPCQ+Q RAM+F R+NMIYRERHCP
Sbjct  61   NLSFEPHHN-YVETVESSEPKAKAFKACDVKYTDYTPCQEQDRAMSFPRENMIYRERHCP  119

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P E+KLHCLIPAP+GY +PFPWPKSRDYV YAN PY
Sbjct  120  PVEEKLHCLIPAPEGYTSPFPWPKSRDYVYYANVPY  155



>emb|CAH18000.1| Ankyrin protein kinase-like [Poa pratensis]
Length=613

 Score =   219 bits (559),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 126/156 (81%), Gaps = 3/156 (2%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K    +SRTRS+VSI IV G+C FFY+LGAWQ+SGFGKGDSIALE+TK + DC ILP
Sbjct  1    MAMKGGPAESRTRSTVSICIVVGMCVFFYILGAWQKSGFGKGDSIALEITKRT-DCTILP  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
             ++++THHS + GS  +  S VK+ KPC  R+TDYTPCQDQ RAM F R+NM YRERHCP
Sbjct  60   -ISYDTHHS-KKGSSGDLVSPVKKFKPCPDRFTDYTPCQDQNRAMKFPRENMNYRERHCP  117

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
             +++KLHCL+P PKGYV PFPWPKSRDYVP+AN PY
Sbjct  118  LQKEKLHCLVPPPKGYVAPFPWPKSRDYVPFANCPY  153



>gb|KDO43765.1| hypothetical protein CISIN_1g038698mg, partial [Citrus sinensis]
Length=283

 Score =   211 bits (536),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 118/154 (77%), Gaps = 2/154 (1%)
 Frame = +2

Query  152  NKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSL  331
             K  S  SRTRS +SI IV  LC FFY+LGAWQ+SGFGKGD+IA ++TK + DCNI   L
Sbjct  2    GKHNSSGSRTRSPLSILIVIVLCGFFYMLGAWQKSGFGKGDTIASQITKQA-DCNIFTDL  60

Query  332  NFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCPPR  511
            +FETHH+     ++ SE K K  KPC  +Y+DYTPCQ+Q RAM F R+NM YRERHCPP 
Sbjct  61   SFETHHN-DVEIVEPSEPKAKVFKPCDVKYSDYTPCQEQDRAMKFPRENMTYRERHCPPE  119

Query  512  EKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            ++KLHCLIPAPKGY+TPFPWPK RDYV YAN P+
Sbjct  120  DEKLHCLIPAPKGYMTPFPWPKGRDYVHYANVPH  153



>ref|XP_011018632.1| PREDICTED: probable methyltransferase PMT14 isoform X1 [Populus 
euphratica]
 ref|XP_011018633.1| PREDICTED: probable methyltransferase PMT14 isoform X1 [Populus 
euphratica]
Length=612

 Score =   218 bits (556),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/156 (65%), Positives = 121/156 (78%), Gaps = 2/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            M  K +S   +T+S +SIFIV  LCC FY+LGAWQ+SGFGKGD +A+++TK + DCNI  
Sbjct  1    MGTKHSSMGFKTQSPLSIFIVICLCCLFYILGAWQKSGFGKGDGLAVQMTKKT-DCNIFT  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
             LNFETHH+     I+ S+ + K  KPCH +YTDYTPCQ+Q RAM F R+NMIYRERHCP
Sbjct  60   ELNFETHHN-YVEIIEPSQPEAKIFKPCHVKYTDYTPCQEQDRAMKFPRENMIYRERHCP  118

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P E+KLHCLIPAPKGY TPFPWPK RDYV YAN P+
Sbjct  119  PEEEKLHCLIPAPKGYKTPFPWPKGRDYVHYANVPH  154



>ref|XP_003524439.1| PREDICTED: probable methyltransferase PMT14-like isoform X1 [Glycine 
max]
 ref|XP_006579671.1| PREDICTED: probable methyltransferase PMT14-like isoform X2 [Glycine 
max]
Length=613

 Score =   218 bits (555),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/156 (63%), Positives = 118/156 (76%), Gaps = 1/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            M +K  +   R R  +SIF V GLCCFFYLLGAWQRSG GKGD++AL+V     DC +LP
Sbjct  1    MGSKTNASGHRARRPLSIFAVLGLCCFFYLLGAWQRSGSGKGDNLALKVNNLMTDCTVLP  60

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +L+FE+HH+     ++ +E K KE KPC  +YTDYTPCQ+Q RAMTF R+NMIYRERHCP
Sbjct  61   NLSFESHHND-VEIVEPAEPKAKEFKPCDVKYTDYTPCQEQDRAMTFPRENMIYRERHCP  119

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
              ++KL CLIPAP+GY TPFPWPKSRDY  YAN PY
Sbjct  120  AEKEKLRCLIPAPEGYTTPFPWPKSRDYAYYANVPY  155



>ref|XP_007210880.1| hypothetical protein PRUPE_ppa003016mg [Prunus persica]
 gb|EMJ12079.1| hypothetical protein PRUPE_ppa003016mg [Prunus persica]
Length=612

 Score =   218 bits (555),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/156 (65%), Positives = 119/156 (76%), Gaps = 1/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            M +K  S  +RTRS++SIF+V  LCCFFYLLGAW++SGFGK DSIA  VTK +   N+  
Sbjct  1    MKSKHNSPGNRTRSTISIFVVIALCCFFYLLGAWEKSGFGKRDSIAFPVTKQTDCSNVFT  60

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +LNFETHH+     ++ SE K K  KPC  +Y DYTPCQ+Q RAM F R+NMIYRERHCP
Sbjct  61   NLNFETHHNMEE-IVEPSEPKAKVFKPCDVKYADYTPCQEQDRAMKFPRENMIYRERHCP  119

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P E+KLHCLIPA KGY+TPFPWPK RDYV YAN PY
Sbjct  120  PEEEKLHCLIPARKGYMTPFPWPKGRDYVHYANVPY  155



>ref|XP_010110495.1| putative methyltransferase PMT14 [Morus notabilis]
 gb|EXC26713.1| putative methyltransferase PMT14 [Morus notabilis]
Length=612

 Score =   218 bits (554),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 103/156 (66%), Positives = 123/156 (79%), Gaps = 3/156 (2%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            M +K  S  S+ RS +SIF+V GLCC FYLLGAWQ+SGFGKGDSIALE+TK + DCNI+ 
Sbjct  1    MGSKHASPGSK-RSPLSIFVVLGLCCLFYLLGAWQKSGFGKGDSIALEITKQT-DCNIVN  58

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
             L+FE+HH+   G I  SE K K  KPC  ++TDYTPCQ+Q +AM F R+NMIYRERHCP
Sbjct  59   DLDFESHHND-VGIIAPSEPKTKFFKPCDVKFTDYTPCQEQDQAMKFPRENMIYRERHCP  117

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P+E+KLHCLIPAP+GY  PF WPKSRDYV YAN P+
Sbjct  118  PQEEKLHCLIPAPEGYTIPFQWPKSRDYVYYANVPF  153



>ref|XP_007155749.1| hypothetical protein PHAVU_003G228500g [Phaseolus vulgaris]
 gb|ESW27743.1| hypothetical protein PHAVU_003G228500g [Phaseolus vulgaris]
Length=613

 Score =   217 bits (553),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 100/156 (64%), Positives = 116/156 (74%), Gaps = 1/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            M +K      R R  +SIF V GLCCFFYLLGAWQRSG GKGD++AL+V K   DC +LP
Sbjct  1    MGSKTNPSGHRARRPLSIFAVLGLCCFFYLLGAWQRSGSGKGDNLALKVNKLMTDCTVLP  60

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +L+FE+HH+     ++ SE K K  KPC  +Y DYTPCQ+Q RAMTF R+NMIYRERHCP
Sbjct  61   NLSFESHHND-VEIVEPSEPKAKVFKPCDVKYRDYTPCQEQDRAMTFPRENMIYRERHCP  119

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
              E+KL CLIPAPKGY TPFPWPKSRDY  YAN PY
Sbjct  120  AEEEKLRCLIPAPKGYTTPFPWPKSRDYAYYANVPY  155



>ref|XP_011013091.1| PREDICTED: probable methyltransferase PMT2 [Populus euphratica]
Length=610

 Score =   217 bits (553),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 102/157 (65%), Positives = 126/157 (80%), Gaps = 5/157 (3%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSV-SIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNIL  322
            MA K  SGD ++ +S+ SIF++AGLCCFFY+LGAW+RSG GKGD+IALE++K + DC++ 
Sbjct  1    MATKGNSGDRKSNNSLFSIFMIAGLCCFFYILGAWRRSGVGKGDNIALEISKQT-DCSVF  59

Query  323  PSLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHC  502
             +LN++   SG AG ID+  ++VKE KPC  +Y DYTPCQDQ RAMTF R NMIYRERHC
Sbjct  60   NNLNYQ--KSGDAGMIDDG-AQVKEFKPCEDKYIDYTPCQDQMRAMTFPRDNMIYRERHC  116

Query  503  PPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P   +KL CLIPAPKGY +PFPWPKSRDYVP+ NAPY
Sbjct  117  PSDNEKLPCLIPAPKGYASPFPWPKSRDYVPFVNAPY  153



>ref|XP_008448741.1| PREDICTED: probable methyltransferase PMT14 [Cucumis melo]
Length=613

 Score =   217 bits (552),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 100/156 (64%), Positives = 119/156 (76%), Gaps = 3/156 (2%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            M +K     +R R  +S+F V GLC FFY+LGAWQRSGFGKGDSIA+E+T+ S +CN + 
Sbjct  1    MGSKHNLPANRNRGPISLFAVIGLCLFFYILGAWQRSGFGKGDSIAMEITRLS-NCNTVK  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
             LNFETHHS     ++ +E K K  KPC  +YTDYTPCQ+Q RAM F R+NMIYRERHCP
Sbjct  60   DLNFETHHSIEI--VESTEPKTKVFKPCDKKYTDYTPCQEQDRAMKFPRENMIYRERHCP  117

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
              ++KLHCLIPAPKGY+TPFPWPK RDYV YAN PY
Sbjct  118  AVDEKLHCLIPAPKGYMTPFPWPKGRDYVHYANVPY  153



>ref|XP_004300275.1| PREDICTED: probable methyltransferase PMT14 [Fragaria vesca subsp. 
vesca]
Length=608

 Score =   216 bits (550),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 100/157 (64%), Positives = 121/157 (77%), Gaps = 3/157 (2%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            M +K     +RTR ++S+F+V  LCCFFYLLGAWQ+SGFGKGD IA EV + + DCN+  
Sbjct  1    MGSKQNPPGNRTRRTLSMFVVIALCCFFYLLGAWQKSGFGKGDKIAFEVPRHT-DCNVFG  59

Query  326  S-LNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHC  502
            S LNFE HH+     I+ SE KV+E KPC P+Y DYTPCQ+Q RAM F R+NM+YRERHC
Sbjct  60   SNLNFEPHHND-VEIIEHSEPKVEEFKPCDPKYRDYTPCQEQDRAMKFPRENMVYRERHC  118

Query  503  PPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P  E+KLHCLIPAP+GY+TPFPWPKSRDY  +AN PY
Sbjct  119  PTEEEKLHCLIPAPEGYITPFPWPKSRDYAHFANVPY  155



>ref|XP_012089660.1| PREDICTED: probable methyltransferase PMT14 [Jatropha curcas]
 gb|KDP22915.1| hypothetical protein JCGZ_01776 [Jatropha curcas]
Length=612

 Score =   216 bits (549),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/156 (66%), Positives = 118/156 (76%), Gaps = 2/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            M +K     SR+R  +SIFIV  LCCFFY+LGAWQ+SGFGKGDSIA +VTK + DC I P
Sbjct  1    MGSKHNPPGSRSRGPLSIFIVFCLCCFFYVLGAWQKSGFGKGDSIAFQVTKQT-DCKIFP  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
             LNFE  H+     I+ S+ K    KPC  +YTDYTPCQ+Q RAM F R+NMIYRERHCP
Sbjct  60   DLNFEPRHN-TVEIIEPSKPKTVVFKPCDVKYTDYTPCQEQDRAMKFPRENMIYRERHCP  118

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P E+KLHCLIPAPKGY+TPFPWPK RDYV YAN PY
Sbjct  119  PEEEKLHCLIPAPKGYMTPFPWPKGRDYVHYANVPY  154



>gb|ACU17089.1| unknown [Glycine max]
Length=213

 Score =   205 bits (521),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 111/156 (71%), Gaps = 1/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            M +K  +   R R  +SIF V GLCCFFYLLGAWQRSG GK D +AL+V      C +LP
Sbjct  1    MGSKTNASGYRARRPLSIFAVLGLCCFFYLLGAWQRSGSGKADKLALKVNNLMTGCTVLP  60

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +L+FE+HHS     +     K K  KPC  +YTDYTPCQ+Q +AM F R+NMIYRERHCP
Sbjct  61   NLSFESHHSD-VEIVRPDVLKAKAFKPCDMKYTDYTPCQEQDQAMKFPRENMIYRERHCP  119

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
              ++KLHCLIPAP+GY TPFPWPKSRDY  YAN PY
Sbjct  120  AEKEKLHCLIPAPEGYTTPFPWPKSRDYAYYANVPY  155



>gb|ACB54686.1| methyltransferase [Nicotiana benthamiana]
Length=617

 Score =   214 bits (544),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 100/158 (63%), Positives = 119/158 (75%), Gaps = 3/158 (2%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA+K  +  +RTR  +SI IV GLCCFFYL+G WQ+SG GKGD +AL VT+ + DCNI P
Sbjct  1    MASKYHASSNRTRRPISILIVIGLCCFFYLIGVWQKSGSGKGDKLALAVTEQTADCNIFP  60

Query  326  --SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERH  499
              +L+FE+HH+     I+ SE K K  K C  +YTDYTPCQ+Q RAMTF R+NMIYRERH
Sbjct  61   PSTLDFESHHN-YVEMIESSEPKTKVYKSCDAKYTDYTPCQEQDRAMTFPRENMIYRERH  119

Query  500  CPPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            CPP ++KL CLI APKGY TPFPWPKSRDY  YAN PY
Sbjct  120  CPPDDEKLRCLILAPKGYTTPFPWPKSRDYAYYANVPY  157



>ref|XP_009587333.1| PREDICTED: probable methyltransferase PMT14 [Nicotiana tomentosiformis]
Length=617

 Score =   214 bits (544),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 100/158 (63%), Positives = 119/158 (75%), Gaps = 3/158 (2%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA+K  +  +RTR  +SI IV GLCCFFYL+G WQ+SG GKGD +AL VT+ + DCNI P
Sbjct  1    MASKYHAPSNRTRRPISILIVIGLCCFFYLIGVWQKSGSGKGDKLALAVTEQTADCNIFP  60

Query  326  --SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERH  499
              +L+FE+HH+     I+ SE K K  K C  +YTDYTPCQ+Q RAMTF R+NMIYRERH
Sbjct  61   PSTLDFESHHN-YVEMIESSEPKTKVFKSCEAKYTDYTPCQEQDRAMTFPRENMIYRERH  119

Query  500  CPPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            CPP ++KL CLI APKGY TPFPWPKSRDY  YAN PY
Sbjct  120  CPPDDEKLRCLILAPKGYTTPFPWPKSRDYAYYANVPY  157



>ref|XP_011032031.1| PREDICTED: probable methyltransferase PMT14 [Populus euphratica]
 ref|XP_011032032.1| PREDICTED: probable methyltransferase PMT14 [Populus euphratica]
Length=612

 Score =   213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/156 (64%), Positives = 118/156 (76%), Gaps = 2/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            M NK  S   +TRS +SIFIV  LCCFFY+LGAWQ+SGFGKGD IA++++K + DC I P
Sbjct  1    MGNKHNSAGFKTRSPLSIFIVICLCCFFYILGAWQKSGFGKGDGIAVQMSKQT-DCQIFP  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
             LNFETHH+     I+ S+ K K  KPC  +YTDY PCQ++ RAM F R+NMIYRERHCP
Sbjct  60   DLNFETHHND-VEIIEPSKPKAKVFKPCDVKYTDYPPCQEKDRAMKFPRENMIYRERHCP  118

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
              E+KL CLIPAPKGY TPFPWPK RDYV YAN P+
Sbjct  119  REEEKLRCLIPAPKGYTTPFPWPKGRDYVHYANVPH  154



>gb|EAZ17038.1| hypothetical protein OsJ_32528 [Oryza sativa Japonica Group]
Length=589

 Score =   213 bits (541),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 112/141 (79%), Gaps = 3/141 (2%)
 Frame = +2

Query  191  VSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLNFETHHSGRAGSI  370
            +SI IV  LCCFFY+LGAWQ+SG G+GDSIAL VTK + DC ILP+L+FETHHS   G +
Sbjct  1    MSIVIVMSLCCFFYILGAWQKSGTGRGDSIALRVTKET-DCTILPNLHFETHHS--LGGV  57

Query  371  DESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCPPREKKLHCLIPAPKG  550
            +      K  +PCH RY+DYTPCQDQ RAM F R+NM YRERHCP   KKL CLIPAPKG
Sbjct  58   NPLVMTDKVFEPCHIRYSDYTPCQDQNRAMNFPRENMNYRERHCPTETKKLRCLIPAPKG  117

Query  551  YVTPFPWPKSRDYVPYANAPY  613
            YVTPFPWPKSRDYVPYANAPY
Sbjct  118  YVTPFPWPKSRDYVPYANAPY  138



>ref|XP_004150171.1| PREDICTED: probable methyltransferase PMT14 [Cucumis sativus]
 gb|KGN55796.1| hypothetical protein Csa_3G016410 [Cucumis sativus]
Length=614

 Score =   213 bits (542),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 98/156 (63%), Positives = 119/156 (76%), Gaps = 3/156 (2%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            M +K     +R R  +S+F V GLC FFY+LGAWQRSGFGKGDSIA+E+T+ S +CN + 
Sbjct  1    MGSKHNLPANRNRGPISLFAVIGLCLFFYILGAWQRSGFGKGDSIAMEITRLS-NCNTVK  59

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
             LNFETHHS     ++ +E K K  KPC  ++TDYTPCQ+Q RAM F R++MIYRERHCP
Sbjct  60   DLNFETHHSIEI--VESTEPKAKVFKPCDKKFTDYTPCQEQDRAMRFPRESMIYRERHCP  117

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
              ++KLHCLIPAPKGY+TPFPWPK RDYV YAN PY
Sbjct  118  AVDEKLHCLIPAPKGYMTPFPWPKGRDYVHYANVPY  153



>ref|XP_009793368.1| PREDICTED: probable methyltransferase PMT14 [Nicotiana sylvestris]
Length=617

 Score =   213 bits (541),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 100/158 (63%), Positives = 119/158 (75%), Gaps = 3/158 (2%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA+K  +  +RTR  +SI IV GLCCFFYL+G WQ+SG GKGD +AL VT+ + DCNI P
Sbjct  1    MASKYHAPSNRTRRPISILIVIGLCCFFYLIGVWQKSGSGKGDKLALAVTEQTADCNIFP  60

Query  326  --SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERH  499
              +L+FE+HH+     I+ SE K K  K C  +YTDYTPCQ+Q RAMTF R+NMIYRERH
Sbjct  61   PSTLDFESHHN-YVEMIESSEPKTKVYKSCDAKYTDYTPCQEQDRAMTFPRENMIYRERH  119

Query  500  CPPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            CPP ++KL CLI APKGY TPFPWPKSRDY  YAN PY
Sbjct  120  CPPDDEKLRCLILAPKGYTTPFPWPKSRDYAYYANVPY  157



>gb|KCW77891.1| hypothetical protein EUGRSUZ_D02155 [Eucalyptus grandis]
Length=535

 Score =   211 bits (536),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 119/157 (76%), Gaps = 3/157 (2%)
 Frame = +2

Query  143  SMANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNIL  322
            ++ N   SG+ RTR  VS+F+  GLCCFFYL G WQ+SGFGKGDSIALE+TK + DCN+ 
Sbjct  2    AIKNNNPSGN-RTRKPVSVFVAIGLCCFFYLFGTWQKSGFGKGDSIALEITKHT-DCNVF  59

Query  323  PSLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHC  502
              L+FE+HH+         + K++  KPC  +YTDYTPCQ+Q RAMTF R+NMIYRERHC
Sbjct  60   TKLDFESHHN-YVEIAQPPKQKIEAFKPCDVKYTDYTPCQEQDRAMTFPRENMIYRERHC  118

Query  503  PPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            PP ++KL CL+PAP+GY TPFPWPKSRDY  YAN PY
Sbjct  119  PPDDEKLRCLVPAPQGYKTPFPWPKSRDYAHYANVPY  155



>gb|EAY79581.1| hypothetical protein OsI_34717 [Oryza sativa Indica Group]
Length=589

 Score =   211 bits (538),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 112/141 (79%), Gaps = 3/141 (2%)
 Frame = +2

Query  191  VSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLNFETHHSGRAGSI  370
            +SI IV  LCCFFY+LGAWQ+SG G+GDSIAL VTK + DC ILP+L+FETHHS   G +
Sbjct  1    MSIVIVMSLCCFFYILGAWQKSGTGRGDSIALRVTKET-DCTILPNLHFETHHS--LGGV  57

Query  371  DESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCPPREKKLHCLIPAPKG  550
            +      K  +PCH RY+DYTPCQDQ RAM F R+NM YRERHCP   +KL CLIPAPKG
Sbjct  58   NPLVMTDKVFEPCHIRYSDYTPCQDQNRAMNFPRENMNYRERHCPTETEKLRCLIPAPKG  117

Query  551  YVTPFPWPKSRDYVPYANAPY  613
            YVTPFPWPKSRDYVPYANAPY
Sbjct  118  YVTPFPWPKSRDYVPYANAPY  138



>ref|NP_001050233.1| Os03g0379100 [Oryza sativa Japonica Group]
 gb|AAL58254.1|AC084762_28 hypothetical protein [Oryza sativa Japonica Group]
 gb|ABF96247.1| Methyltransferase, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12147.1| Os03g0379100 [Oryza sativa Japonica Group]
 gb|EAZ27118.1| hypothetical protein OsJ_11050 [Oryza sativa Japonica Group]
 gb|EEC75363.1| hypothetical protein OsI_11805 [Oryza sativa Indica Group]
Length=611

 Score =   212 bits (539),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 118/151 (78%), Gaps = 1/151 (1%)
 Frame = +2

Query  161  TSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLNFE  340
            +S +SRTR++VS+ ++ GLC FFYLLG WQRSGFG+GDSIA  V + +K C +LP+LNFE
Sbjct  4    SSTESRTRTTVSVVVLFGLCSFFYLLGVWQRSGFGRGDSIAAVVNEQTK-CVVLPNLNFE  62

Query  341  THHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCPPREKK  520
            THHS      D   ++VK  +PC  +YTDYTPC++Q+RAMTF R NMIYRERHCPP + K
Sbjct  63   THHSASDLPNDTGSTEVKTFEPCDAQYTDYTPCEEQKRAMTFPRDNMIYRERHCPPEKDK  122

Query  521  LHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            L+CL+PAPKGY  PF WPKSRDYV YAN P+
Sbjct  123  LYCLVPAPKGYAAPFHWPKSRDYVHYANIPH  153



>ref|XP_006436790.1| hypothetical protein CICLE_v10030990mg [Citrus clementina]
 ref|XP_006485402.1| PREDICTED: probable methyltransferase PMT14-like isoform X1 [Citrus 
sinensis]
 ref|XP_006485403.1| PREDICTED: probable methyltransferase PMT14-like isoform X2 [Citrus 
sinensis]
 gb|ESR50030.1| hypothetical protein CICLE_v10030990mg [Citrus clementina]
Length=609

 Score =   212 bits (539),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 118/154 (77%), Gaps = 2/154 (1%)
 Frame = +2

Query  152  NKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSL  331
             K  S  SRTRS +SI IV  LC FFY+LGAWQ+SGFGKGD+IA ++TK + DCNI   L
Sbjct  2    GKHNSSGSRTRSPLSILIVIVLCGFFYMLGAWQKSGFGKGDTIASQITKQA-DCNIFTDL  60

Query  332  NFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCPPR  511
            +FETHH+     ++ SE K K  KPC  +Y+DYTPCQ+Q RAM F R+NM YRERHCPP 
Sbjct  61   SFETHHND-VEIVEPSEPKAKVFKPCDVKYSDYTPCQEQDRAMKFPRENMTYRERHCPPE  119

Query  512  EKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            ++KLHCLIPAPKGY+TPFPWPK RDYV YAN P+
Sbjct  120  DEKLHCLIPAPKGYMTPFPWPKGRDYVHYANVPH  153



>ref|XP_006650137.1| PREDICTED: probable methyltransferase PMT2-like [Oryza brachyantha]
Length=611

 Score =   211 bits (537),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 117/151 (77%), Gaps = 1/151 (1%)
 Frame = +2

Query  161  TSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLNFE  340
            +S +SRTR++  + +V GLC FFYLLG WQRSGFG+GDSIA  V + +K C +LP+LNFE
Sbjct  4    SSTESRTRTTAFVVVVFGLCSFFYLLGVWQRSGFGRGDSIAAVVNEQTK-CVVLPNLNFE  62

Query  341  THHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCPPREKK  520
            THHS      D   ++VK  KPC  +YTDYTPC++Q+RAMTF R NMIYRERHCPP ++K
Sbjct  63   THHSASDLPNDTGSNEVKSFKPCDAQYTDYTPCEEQKRAMTFPRDNMIYRERHCPPEKEK  122

Query  521  LHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            L+CL+PAPKGY  PF WPKSRDYV YAN P+
Sbjct  123  LNCLVPAPKGYAAPFQWPKSRDYVHYANIPH  153



>ref|XP_010053567.1| PREDICTED: probable methyltransferase PMT14 [Eucalyptus grandis]
 ref|XP_010053568.1| PREDICTED: probable methyltransferase PMT14 [Eucalyptus grandis]
 gb|KCW77890.1| hypothetical protein EUGRSUZ_D02155 [Eucalyptus grandis]
Length=613

 Score =   211 bits (536),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 119/157 (76%), Gaps = 3/157 (2%)
 Frame = +2

Query  143  SMANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNIL  322
            ++ N   SG+ RTR  VS+F+  GLCCFFYL G WQ+SGFGKGDSIALE+TK + DCN+ 
Sbjct  2    AIKNNNPSGN-RTRKPVSVFVAIGLCCFFYLFGTWQKSGFGKGDSIALEITKHT-DCNVF  59

Query  323  PSLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHC  502
              L+FE+HH+         + K++  KPC  +YTDYTPCQ+Q RAMTF R+NMIYRERHC
Sbjct  60   TKLDFESHHN-YVEIAQPPKQKIEAFKPCDVKYTDYTPCQEQDRAMTFPRENMIYRERHC  118

Query  503  PPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            PP ++KL CL+PAP+GY TPFPWPKSRDY  YAN PY
Sbjct  119  PPDDEKLRCLVPAPQGYKTPFPWPKSRDYAHYANVPY  155



>gb|ACA66248.1| putative methyltransferase [Nicotiana benthamiana]
Length=617

 Score =   210 bits (535),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 99/158 (63%), Positives = 118/158 (75%), Gaps = 3/158 (2%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA+K  +  +RTR  +SI IV GLCCFFYL+  WQ+SG GKGD +AL VT+ + DCNI P
Sbjct  1    MASKYHASSNRTRRPISILIVIGLCCFFYLIMVWQKSGSGKGDKLALAVTEQTADCNIFP  60

Query  326  --SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERH  499
              +L+FE+HH+     I+ SE K K  K C  +YTDYTPCQ+Q RAMTF R+NMIYRERH
Sbjct  61   PSTLDFESHHN-YVEMIESSEPKTKVYKSCDAKYTDYTPCQEQDRAMTFPRENMIYRERH  119

Query  500  CPPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            CPP ++KL CLI APKGY TPFPWPKSRDY  YAN PY
Sbjct  120  CPPDDEKLRCLILAPKGYTTPFPWPKSRDYAYYANVPY  157



>gb|EMT05545.1| hypothetical protein F775_20122 [Aegilops tauschii]
Length=612

 Score =   209 bits (531),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 97/156 (62%), Positives = 118/156 (76%), Gaps = 3/156 (2%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA  +T  + +TR+++ + +V GLC FFYLLG WQRSGFG+GDSIA  V + +K C  LP
Sbjct  1    MARSLT--EKKTRTALFVLVVFGLCSFFYLLGVWQRSGFGRGDSIAAVVNEQTK-CLKLP  57

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +LNFETHHS      D   S+VK  +PC   YTDYTPC++Q+RAMTF R +MIYRERHCP
Sbjct  58   NLNFETHHSASDLPNDTFSSQVKTFEPCDAEYTDYTPCEEQKRAMTFPRDHMIYRERHCP  117

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P  +KL+CLIPAPKGYV PFPWPKSRDYV YAN P+
Sbjct  118  PENEKLYCLIPAPKGYVAPFPWPKSRDYVSYANVPH  153



>gb|EYU33038.1| hypothetical protein MIMGU_mgv1a004747mg [Erythranthe guttata]
Length=512

 Score =   206 bits (525),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 118/158 (75%), Gaps = 2/158 (1%)
 Frame = +2

Query  146  MANKV-TSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCN-I  319
            MA+K+  S   + RS +S+F+V GLCCFFYLLG WQRSGFGKGD+ A+E+ K   +CN +
Sbjct  1    MASKIHASSGIKGRSRLSLFVVIGLCCFFYLLGVWQRSGFGKGDNYAIEINKQQANCNEV  60

Query  320  LPSLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERH  499
             PSL+FE+HH+  A      E K K  KPC  +YTDYTPCQ+Q RAM F R++M+YRERH
Sbjct  61   SPSLDFESHHNYVAPVHSSEEPKSKVFKPCDVKYTDYTPCQEQDRAMKFPREDMVYRERH  120

Query  500  CPPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            CPP+ +KL CLIPAP GY +PF WPKSRDYV Y+N P+
Sbjct  121  CPPQNEKLQCLIPAPNGYTSPFAWPKSRDYVYYSNVPF  158



>ref|XP_010449513.1| PREDICTED: probable methyltransferase PMT14 [Camelina sativa]
Length=625

 Score =   208 bits (529),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/149 (62%), Positives = 119/149 (80%), Gaps = 1/149 (1%)
 Frame = +2

Query  167  GDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLNFETH  346
            G++R+RS++S+ +V GLCCFFYLLGAWQ+SGFGKGDSIA+E+TK ++  +I+  L+FE H
Sbjct  9    GNNRSRSTLSLLVVVGLCCFFYLLGAWQKSGFGKGDSIAMEITKQAQCTDIVTELDFEPH  68

Query  347  HSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCPPREKKLH  526
            H+      ++++ K    KPC  +  DYTPCQ+Q RAM F R+NMIYRERHCPP  +KL 
Sbjct  69   HN-TVKIPEKADPKPVSFKPCDVKLKDYTPCQEQDRAMKFPRENMIYRERHCPPDNEKLR  127

Query  527  CLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            CLIPAPKGY+TPFPWPKSRDYV YANAP+
Sbjct  128  CLIPAPKGYMTPFPWPKSRDYVHYANAPF  156



>ref|XP_010439911.1| PREDICTED: probable methyltransferase PMT14 [Camelina sativa]
Length=625

 Score =   207 bits (527),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/149 (62%), Positives = 118/149 (79%), Gaps = 1/149 (1%)
 Frame = +2

Query  167  GDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLNFETH  346
            G++R+RS++S+ +V GLCCFFYLLGAWQ+SGFGKGDSIA+E+TK ++  +I+  L+FE H
Sbjct  9    GNNRSRSTLSLLVVVGLCCFFYLLGAWQKSGFGKGDSIAMEITKQAQCTDIVTELDFEPH  68

Query  347  HSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCPPREKKLH  526
            H+       +++ K    KPC  +  DYTPCQ+Q RAM F R+NMIYRERHCPP  +KL 
Sbjct  69   HN-TVKIPQKADPKPVSFKPCDVKLKDYTPCQEQDRAMKFPRENMIYRERHCPPDNEKLR  127

Query  527  CLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            CLIPAPKGY+TPFPWPKSRDYV YANAP+
Sbjct  128  CLIPAPKGYMTPFPWPKSRDYVHYANAPF  156



>ref|XP_003557818.1| PREDICTED: probable methyltransferase PMT2 [Brachypodium distachyon]
Length=611

 Score =   207 bits (527),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 115/148 (78%), Gaps = 1/148 (1%)
 Frame = +2

Query  170  DSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLNFETHH  349
            +++TR+ + + +V GLC FFYLLG WQRSGFG+GDSIA  V + +K C  LP+LNFETHH
Sbjct  7    ENKTRTILFVVVVFGLCSFFYLLGVWQRSGFGRGDSIAAVVNEQTK-CVRLPNLNFETHH  65

Query  350  SGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCPPREKKLHC  529
            S        +  +VK  +PCH  YTDYTPC++Q+RAMTF R NMIYRERHCPP ++KL+C
Sbjct  66   SASDLPNYTASYEVKSFEPCHAEYTDYTPCEEQKRAMTFPRDNMIYRERHCPPEKEKLYC  125

Query  530  LIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            LIPAPKGYV PFPWPKSRDYV YAN P+
Sbjct  126  LIPAPKGYVAPFPWPKSRDYVFYANVPH  153



>ref|XP_010434585.1| PREDICTED: probable methyltransferase PMT14 [Camelina sativa]
Length=625

 Score =   207 bits (527),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 93/149 (62%), Positives = 118/149 (79%), Gaps = 1/149 (1%)
 Frame = +2

Query  167  GDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLNFETH  346
            G++R+RS++S+ +V GLCCFFYLLGAWQ+SGFGKGDSIA+E+TK ++  +I+  L+FE H
Sbjct  9    GNNRSRSTLSLLVVVGLCCFFYLLGAWQKSGFGKGDSIAMEITKQAQCTDIVTELDFEPH  68

Query  347  HSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCPPREKKLH  526
            H+       +++ K    KPC  +  DYTPCQ+Q RAM F R+NMIYRERHCPP  +KL 
Sbjct  69   HN-TVKIPQKADPKPVSFKPCDVKLKDYTPCQEQDRAMKFPRENMIYRERHCPPDNEKLR  127

Query  527  CLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            CLIPAPKGY+TPFPWPKSRDYV YANAP+
Sbjct  128  CLIPAPKGYMTPFPWPKSRDYVHYANAPF  156



>ref|XP_006414159.1| hypothetical protein EUTSA_v10024685mg [Eutrema salsugineum]
 gb|ESQ55612.1| hypothetical protein EUTSA_v10024685mg [Eutrema salsugineum]
Length=623

 Score =   206 bits (525),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 117/149 (79%), Gaps = 0/149 (0%)
 Frame = +2

Query  167  GDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLNFETH  346
            G++R+RSS+S+ +V GLCCFFYLLGAWQ+SGFGKGDSIA+E+TK ++  +++  L+F+ H
Sbjct  9    GNNRSRSSLSLIVVIGLCCFFYLLGAWQKSGFGKGDSIAMEITKQAQCTDVVTELDFKPH  68

Query  347  HSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCPPREKKLH  526
            H+        ++ K    KPC  +  DYTPCQ+Q RAM F R+NMIYRERHCPP  +KL 
Sbjct  69   HNTVKIPERLADPKPVSFKPCDVKLKDYTPCQEQDRAMKFPRENMIYRERHCPPENEKLR  128

Query  527  CLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            CL+PAPKGY+TPFPWPKSRDYV YANAP+
Sbjct  129  CLVPAPKGYMTPFPWPKSRDYVHYANAPF  157



>ref|XP_006600888.1| PREDICTED: probable methyltransferase PMT14 isoform X1 [Glycine 
max]
 ref|XP_006600889.1| PREDICTED: probable methyltransferase PMT14 isoform X2 [Glycine 
max]
 gb|KHN01668.1| Putative methyltransferase PMT14 [Glycine soja]
Length=613

 Score =   206 bits (523),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 111/156 (71%), Gaps = 1/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            M +K  +   R R  +SIF V GLCCFFYLLGAWQRSG GK D +AL+V      C +LP
Sbjct  1    MGSKTNASGYRARRPLSIFAVLGLCCFFYLLGAWQRSGSGKADKLALKVNNLMTGCTVLP  60

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +L+FE+HHS     +     K K  KPC  +YTDYTPCQ+Q +AM F R+NMIYRERHCP
Sbjct  61   NLSFESHHSD-VEIVRPDVLKAKAFKPCDMKYTDYTPCQEQDQAMKFPRENMIYRERHCP  119

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
              ++KLHCLIPAP+GY TPFPWPKSRDY  YAN PY
Sbjct  120  AEKEKLHCLIPAPEGYTTPFPWPKSRDYAYYANVPY  155



>ref|NP_193537.2| putative methyltransferase PMT14 [Arabidopsis thaliana]
 sp|Q94EJ6.1|PMTE_ARATH RecName: Full=Probable methyltransferase PMT14 [Arabidopsis thaliana]
 gb|AAK95250.1|AF410264_1 AT4g18030/T6K21_210 [Arabidopsis thaliana]
 gb|AAN64540.1| At4g18030/T6K21_210 [Arabidopsis thaliana]
 gb|AEE83986.1| putative methyltransferase PMT14 [Arabidopsis thaliana]
Length=621

 Score =   206 bits (524),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 118/149 (79%), Gaps = 1/149 (1%)
 Frame = +2

Query  167  GDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLNFETH  346
            G++R+RS++S+ +V GLCCFFYLLGAWQ+SGFGKGDSIA+E+TK ++  +I+  L+FE H
Sbjct  9    GNNRSRSTLSLLVVVGLCCFFYLLGAWQKSGFGKGDSIAMEITKQAQCTDIVTDLDFEPH  68

Query  347  HSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCPPREKKLH  526
            H+       +++ K    KPC  +  DYTPCQ+Q RAM F R+NMIYRERHCPP  +KL 
Sbjct  69   HN-TVKIPHKADPKPVSFKPCDVKLKDYTPCQEQDRAMKFPRENMIYRERHCPPDNEKLR  127

Query  527  CLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            CL+PAPKGY+TPFPWPKSRDYV YANAP+
Sbjct  128  CLVPAPKGYMTPFPWPKSRDYVHYANAPF  156



>dbj|BAH19630.1| AT4G18030 [Arabidopsis thaliana]
Length=621

 Score =   206 bits (524),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 118/149 (79%), Gaps = 1/149 (1%)
 Frame = +2

Query  167  GDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLNFETH  346
            G++R+RS++S+ +V GLCCFFYLLGAWQ+SGFGKGDSIA+E+TK ++  +I+  L+FE H
Sbjct  9    GNNRSRSTLSLLVVVGLCCFFYLLGAWQKSGFGKGDSIAMEITKQAQCTDIVTDLDFEPH  68

Query  347  HSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCPPREKKLH  526
            H+       +++ K    KPC  +  DYTPCQ+Q RAM F R+NMIYRERHCPP  +KL 
Sbjct  69   HN-TVKIPHKADPKPVSFKPCDVKLKDYTPCQEQDRAMKFPRENMIYRERHCPPDNEKLR  127

Query  527  CLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            CL+PAPKGY+TPFPWPKSRDYV YANAP+
Sbjct  128  CLVPAPKGYMTPFPWPKSRDYVHYANAPF  156



>emb|CAA17146.1| putative protein [Arabidopsis thaliana]
 emb|CAB78805.1| putative protein [Arabidopsis thaliana]
Length=629

 Score =   206 bits (524),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 118/149 (79%), Gaps = 1/149 (1%)
 Frame = +2

Query  167  GDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLNFETH  346
            G++R+RS++S+ +V GLCCFFYLLGAWQ+SGFGKGDSIA+E+TK ++  +I+  L+FE H
Sbjct  9    GNNRSRSTLSLLVVVGLCCFFYLLGAWQKSGFGKGDSIAMEITKQAQCTDIVTDLDFEPH  68

Query  347  HSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCPPREKKLH  526
            H+       +++ K    KPC  +  DYTPCQ+Q RAM F R+NMIYRERHCPP  +KL 
Sbjct  69   HN-TVKIPHKADPKPVSFKPCDVKLKDYTPCQEQDRAMKFPRENMIYRERHCPPDNEKLR  127

Query  527  CLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            CL+PAPKGY+TPFPWPKSRDYV YANAP+
Sbjct  128  CLVPAPKGYMTPFPWPKSRDYVHYANAPF  156



>ref|XP_002868016.1| dehydration-responsive family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44275.1| dehydration-responsive family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=624

 Score =   206 bits (523),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 118/149 (79%), Gaps = 1/149 (1%)
 Frame = +2

Query  167  GDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLNFETH  346
            G++R+RS++S+ +V GLCCFFYLLGAWQ+SGFGKGDSIA+E+TK ++  +I+  L+FE H
Sbjct  9    GNNRSRSTLSLLVVVGLCCFFYLLGAWQKSGFGKGDSIAMEITKQAQCTDIVTDLDFEPH  68

Query  347  HSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCPPREKKLH  526
            H+       +++ K    KPC  +  DYTPCQ+Q RAM F R+NMIYRERHCPP  +KL 
Sbjct  69   HN-TVKIPRKADPKPVSFKPCDVKLKDYTPCQEQDRAMKFPRENMIYRERHCPPDNEKLR  127

Query  527  CLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            CL+PAPKGY+TPFPWPKSRDYV YANAP+
Sbjct  128  CLVPAPKGYMTPFPWPKSRDYVHYANAPF  156



>ref|XP_010695192.1| PREDICTED: probable methyltransferase PMT14 [Beta vulgaris subsp. 
vulgaris]
Length=612

 Score =   206 bits (523),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 114/149 (77%), Gaps = 3/149 (2%)
 Frame = +2

Query  173  SRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSK--DCNILPSLNFETH  346
             R+R S+SIFIV GLCCF YLLG+WQ+SGFGKGDSIA+ V+K ++  DC++   L+FE H
Sbjct  7    GRSRGSMSIFIVLGLCCFCYLLGSWQKSGFGKGDSIAMRVSKVAELADCDVKTDLDFEPH  66

Query  347  HSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCPPREKKLH  526
            H    G+ +  E  VK+ K C  +Y DYTPCQ+Q RAM F R+NMIYRERHCPP+E+KL 
Sbjct  67   HK-FVGTFESREVIVKKYKACDVKYKDYTPCQEQDRAMKFPRENMIYRERHCPPQEEKLR  125

Query  527  CLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            CLIPAP GY TPFPWPKSRDY  YAN PY
Sbjct  126  CLIPAPVGYTTPFPWPKSRDYAYYANVPY  154



>ref|XP_010559283.1| PREDICTED: probable methyltransferase PMT14 [Tarenaya hassleriana]
 ref|XP_010559284.1| PREDICTED: probable methyltransferase PMT14 [Tarenaya hassleriana]
Length=614

 Score =   205 bits (521),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 118/156 (76%), Gaps = 1/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            M +K     +R+RSS+SI +V GLCCFFYLLGAWQRSGFGKGDSIA+E+TK ++  +I+ 
Sbjct  1    MGSKHNQPGNRSRSSLSIIVVIGLCCFFYLLGAWQRSGFGKGDSIAMEITKQAQCTDIVT  60

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
             L+FE HH+        ++ +    KPC  ++ DYTPCQ+Q RAM F R+NMIYRERHCP
Sbjct  61   DLDFEPHHN-TVEIPQTAKPRPIVFKPCDVKHKDYTPCQEQDRAMKFPRENMIYRERHCP  119

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P  +KL CL+PAPKGY+TPFPWPKSRDYV YAN P+
Sbjct  120  PENEKLRCLVPAPKGYMTPFPWPKSRDYVHYANVPF  155



>ref|XP_010529126.1| PREDICTED: probable methyltransferase PMT14 [Tarenaya hassleriana]
 ref|XP_010529127.1| PREDICTED: probable methyltransferase PMT14 [Tarenaya hassleriana]
Length=614

 Score =   204 bits (518),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 117/156 (75%), Gaps = 1/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            M +K     +R+RS +S+  V GLCCFFYLLGAWQ+SGFGKGDSIA+E+TK ++  +I+ 
Sbjct  1    MGSKHNPPGNRSRSPLSLIAVIGLCCFFYLLGAWQKSGFGKGDSIAMEITKQAQCTDIVT  60

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
             L+FE HH+ +      ++ K    KPC  +Y DYTPCQ+Q RAM F R+NMIYRERHCP
Sbjct  61   DLDFEPHHN-KVEIPQTAKPKPVVFKPCDVKYKDYTPCQEQDRAMKFPRENMIYRERHCP  119

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P  +KLHCLIPAPKGY+TPFPWPK RDYV YAN P+
Sbjct  120  PENEKLHCLIPAPKGYMTPFPWPKCRDYVHYANVPF  155



>ref|XP_006283339.1| hypothetical protein CARUB_v10004377mg [Capsella rubella]
 gb|EOA16237.1| hypothetical protein CARUB_v10004377mg [Capsella rubella]
Length=626

 Score =   204 bits (518),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 117/149 (79%), Gaps = 1/149 (1%)
 Frame = +2

Query  167  GDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLNFETH  346
            G++R+RS++S+ +V GLCCFFYLLGAWQ+SGFGKGDSIA+E+TK ++  +I+  L+FE H
Sbjct  9    GNNRSRSTLSLLVVVGLCCFFYLLGAWQKSGFGKGDSIAMEITKQAQCTDIVTELDFEPH  68

Query  347  HSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCPPREKKLH  526
            H+       +++ K    K C  +  DYTPCQ+Q RAM F R+NMIYRERHCPP  +KL 
Sbjct  69   HN-TVKIPHKADPKPVSFKACDVKLKDYTPCQEQDRAMKFLRENMIYRERHCPPDNEKLR  127

Query  527  CLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            CL+PAPKGY+TPFPWPKSRDYV YANAP+
Sbjct  128  CLVPAPKGYMTPFPWPKSRDYVHYANAPF  156



>ref|XP_004245869.1| PREDICTED: probable methyltransferase PMT14 [Solanum lycopersicum]
Length=616

 Score =   203 bits (517),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 117/158 (74%), Gaps = 3/158 (2%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA+K     +RTR  +SI IV GLCCF YL+G WQ+SG GKGD +AL+VT+ + DCN+ P
Sbjct  1    MASKYHGPINRTRRPISILIVIGLCCFCYLIGIWQKSGSGKGDKLALQVTEQTADCNVFP  60

Query  326  --SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERH  499
              +L+FE+HH+    +++ SE  VK  K C  +YTDYTPC +Q RAM F R++MIYRERH
Sbjct  61   QTTLDFESHHN-YVETVETSELTVKRFKSCEAKYTDYTPCHEQDRAMKFPREDMIYRERH  119

Query  500  CPPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            CPP ++KL CLI APKGY TPFPWPKSRDY  YAN PY
Sbjct  120  CPPDDEKLRCLILAPKGYTTPFPWPKSRDYAYYANVPY  157



>ref|XP_009131372.1| PREDICTED: probable methyltransferase PMT14 [Brassica rapa]
Length=620

 Score =   203 bits (516),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 114/146 (78%), Gaps = 0/146 (0%)
 Frame = +2

Query  176  RTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLNFETHHSG  355
            R+RSS+S+ +V GLCCFFYLLGAWQ+SGFGKGDSIA+E+TK ++  +++  L+F+ HH+ 
Sbjct  9    RSRSSLSLILVVGLCCFFYLLGAWQKSGFGKGDSIAMEITKQAQCTDVVTDLDFKPHHNT  68

Query  356  RAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCPPREKKLHCLI  535
                   ++ K    KPC  +  DYTPCQ+Q RAM F R+NMIYRERHCPP  +KL CL+
Sbjct  69   VKIPERLADPKPVSFKPCDVKLKDYTPCQEQDRAMKFPRENMIYRERHCPPENEKLRCLV  128

Query  536  PAPKGYVTPFPWPKSRDYVPYANAPY  613
            PAPKGY+TPFPWPKSRDYV YANAP+
Sbjct  129  PAPKGYMTPFPWPKSRDYVHYANAPF  154



>emb|CDX78823.1| BnaA01g08900D [Brassica napus]
Length=620

 Score =   203 bits (516),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 114/146 (78%), Gaps = 0/146 (0%)
 Frame = +2

Query  176  RTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLNFETHHSG  355
            R+RSS+S+ +V GLCCFFYLLGAWQ+SGFGKGDSIA+E+TK ++  +++  L+F+ HH+ 
Sbjct  9    RSRSSLSLILVVGLCCFFYLLGAWQKSGFGKGDSIAMEITKQAQCTDVVTDLDFKPHHNT  68

Query  356  RAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCPPREKKLHCLI  535
                   ++ K    KPC  +  DYTPCQ+Q RAM F R+NMIYRERHCPP  +KL CL+
Sbjct  69   VKIPERLADPKPVSFKPCDVKLKDYTPCQEQDRAMKFPRENMIYRERHCPPENEKLRCLV  128

Query  536  PAPKGYVTPFPWPKSRDYVPYANAPY  613
            PAPKGY+TPFPWPKSRDYV YANAP+
Sbjct  129  PAPKGYMTPFPWPKSRDYVHYANAPF  154



>ref|XP_006358580.1| PREDICTED: probable methyltransferase PMT14-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006358581.1| PREDICTED: probable methyltransferase PMT14-like isoform X2 [Solanum 
tuberosum]
Length=616

 Score =   201 bits (512),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 93/158 (59%), Positives = 116/158 (73%), Gaps = 3/158 (2%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA+K     +RTR  +SI IV GLCCF YL+G WQ+SG GKGD +AL+VT+ + DCN+ P
Sbjct  1    MASKYHGPINRTRRPISILIVIGLCCFCYLIGIWQKSGSGKGDKLALQVTEQTADCNVFP  60

Query  326  --SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERH  499
              +L+FE+HH+    +++ SE   K  K C  +YTDYTPC +Q RAM F R++MIYRERH
Sbjct  61   QTTLDFESHHN-YVETVETSELTTKRFKSCEAKYTDYTPCHEQDRAMKFPREDMIYRERH  119

Query  500  CPPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            CPP ++KL CLI APKGY TPFPWPKSRDY  YAN PY
Sbjct  120  CPPDDEKLRCLILAPKGYTTPFPWPKSRDYAYYANVPY  157



>gb|KEH31563.1| methyltransferase PMT14-like protein, putative [Medicago truncatula]
Length=1599

 Score =   206 bits (523),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 114/158 (72%), Gaps = 3/158 (2%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTK--TSKDCNI  319
            M +K     +R R  +SIF V  LCC FYLLG WQ SG GKGDS+AL+V K   + DCNI
Sbjct  1    MGSKNALPGNRARRPLSIFAVLALCCLFYLLGTWQSSGSGKGDSLALKVNKMQATTDCNI  60

Query  320  LPSLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERH  499
            +P+LNFE  H      +++SE K K  K C  +Y DYTPCQ+Q RAMTF R+NMIYRERH
Sbjct  61   VPNLNFEPQHK-YVEIVEQSEPKAKMFKACDVKYADYTPCQEQDRAMTFPRENMIYRERH  119

Query  500  CPPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            CPP+E+KL CLIPAP+GY TPFPWPKSRDY  YAN PY
Sbjct  120  CPPQEEKLRCLIPAPEGYTTPFPWPKSRDYAYYANVPY  157



>ref|XP_004984213.1| PREDICTED: probable methyltransferase PMT2-like isoform X2 [Setaria 
italica]
Length=611

 Score =   200 bits (509),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 116/156 (74%), Gaps = 3/156 (2%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA  +T  ++RTR+++ + +V GLC FFYLLGAWQRSG G GD I   V + +K C  LP
Sbjct  1    MARSLT--ENRTRNTLIVVVVFGLCSFFYLLGAWQRSGSGGGDRIQNWVNEQTK-CAQLP  57

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +LNFETHH       D   SK+K  +PC  +YTDYTPC++Q+RAMTF R NMIYRERHCP
Sbjct  58   NLNFETHHRASDLPNDTGSSKIKPFEPCDEQYTDYTPCEEQKRAMTFPRDNMIYRERHCP  117

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P ++KL+CLIPAP GYV PF WPKSRD+VPYAN P+
Sbjct  118  PDKEKLYCLIPAPNGYVAPFRWPKSRDFVPYANVPH  153



>ref|XP_004984212.1| PREDICTED: probable methyltransferase PMT2-like isoform X1 [Setaria 
italica]
Length=619

 Score =   200 bits (508),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 116/156 (74%), Gaps = 3/156 (2%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA  +T  ++RTR+++ + +V GLC FFYLLGAWQRSG G GD I   V + +K C  LP
Sbjct  9    MARSLT--ENRTRNTLIVVVVFGLCSFFYLLGAWQRSGSGGGDRIQNWVNEQTK-CAQLP  65

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +LNFETHH       D   SK+K  +PC  +YTDYTPC++Q+RAMTF R NMIYRERHCP
Sbjct  66   NLNFETHHRASDLPNDTGSSKIKPFEPCDEQYTDYTPCEEQKRAMTFPRDNMIYRERHCP  125

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P ++KL+CLIPAP GYV PF WPKSRD+VPYAN P+
Sbjct  126  PDKEKLYCLIPAPNGYVAPFRWPKSRDFVPYANVPH  161



>ref|XP_008659999.1| PREDICTED: probable methyltransferase PMT2 isoform X1 [Zea mays]
Length=611

 Score =   199 bits (506),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 117/156 (75%), Gaps = 3/156 (2%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA  +T  ++RTR+++ + +V GLC FFYLLGAWQ+SG G GD I   V + +K C  LP
Sbjct  1    MARNLT--ENRTRNTLIVIVVFGLCSFFYLLGAWQKSGSGGGDRIQNWVNEQTK-CAQLP  57

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +L+FETHHS      D   SK++  KPC  +YTDYTPC++Q+RAMTF R NMIYRERHCP
Sbjct  58   NLSFETHHSASNLPNDTGSSKIEPFKPCDEQYTDYTPCEEQKRAMTFPRDNMIYRERHCP  117

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P ++KL+CLIPAPKGYV PF WPK RD+VPYAN P+
Sbjct  118  PDKEKLYCLIPAPKGYVAPFRWPKGRDFVPYANVPH  153



>gb|AFW87980.1| hypothetical protein ZEAMMB73_653302 [Zea mays]
Length=594

 Score =   199 bits (506),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 117/156 (75%), Gaps = 3/156 (2%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA  +T  ++RTR+++ + +V GLC FFYLLGAWQ+SG G GD I   V + +K C  LP
Sbjct  1    MARNLT--ENRTRNTLIVIVVFGLCSFFYLLGAWQKSGSGGGDRIQNWVNEQTK-CAQLP  57

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +L+FETHHS      D   SK++  KPC  +YTDYTPC++Q+RAMTF R NMIYRERHCP
Sbjct  58   NLSFETHHSASNLPNDTGSSKIEPFKPCDEQYTDYTPCEEQKRAMTFPRDNMIYRERHCP  117

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P ++KL+CLIPAPKGYV PF WPK RD+VPYAN P+
Sbjct  118  PDKEKLYCLIPAPKGYVAPFRWPKGRDFVPYANVPH  153



>ref|XP_002467784.1| hypothetical protein SORBIDRAFT_01g034010 [Sorghum bicolor]
 gb|EER94782.1| hypothetical protein SORBIDRAFT_01g034010 [Sorghum bicolor]
Length=610

 Score =   197 bits (502),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 116/156 (74%), Gaps = 3/156 (2%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA  +T  ++RTR+++ + ++ GLC FFYLLGAWQ+SG G GD     V +  K C  LP
Sbjct  1    MARNLT--ENRTRNTLIVIVILGLCSFFYLLGAWQKSGSGGGDKTHQWVIEQMK-CAQLP  57

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +L+FETHHS      D   SK++  KPC  +YTDYTPC++Q+RAM+F R NMIYRERHCP
Sbjct  58   NLSFETHHSASNLPNDTGSSKIEPFKPCDEQYTDYTPCEEQKRAMSFPRDNMIYRERHCP  117

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
              ++KLHCLIPAPKGYVTPF WPKSRD+VPYAN P+
Sbjct  118  LDKEKLHCLIPAPKGYVTPFRWPKSRDFVPYANVPH  153



>ref|XP_008656343.1| PREDICTED: probable methyltransferase PMT2 [Zea mays]
Length=613

 Score =   197 bits (501),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 115/156 (74%), Gaps = 3/156 (2%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA  +T  D+RTR+++ + ++ GLC FFYLLG WQ+SG G GD I   V + +K C  LP
Sbjct  1    MARNLT--DNRTRNTLVMIVIFGLCSFFYLLGVWQKSGSGGGDGIQTWVNEQTK-CAQLP  57

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +L+FETHHS      D   SK++  KPC  +YTDYTPC++Q RAMTF R NMIYRERHCP
Sbjct  58   NLSFETHHSASNLLNDTDNSKIEPFKPCDEQYTDYTPCEEQSRAMTFPRDNMIYRERHCP  117

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P ++KL+CLIPAPKGYV PF WPKSRD+V YAN P+
Sbjct  118  PDKEKLYCLIPAPKGYVAPFRWPKSRDFVHYANVPH  153



>ref|XP_006280182.1| hypothetical protein CARUB_v10026086mg [Capsella rubella]
 ref|XP_006280183.1| hypothetical protein CARUB_v10026086mg [Capsella rubella]
 gb|EOA13080.1| hypothetical protein CARUB_v10026086mg [Capsella rubella]
 gb|EOA13081.1| hypothetical protein CARUB_v10026086mg [Capsella rubella]
Length=622

 Score =   194 bits (494),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 110/154 (71%), Gaps = 8/154 (5%)
 Frame = +2

Query  170  DSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCN-----ILPSLN  334
            ++ TR+  ++ IV GLCCFFYLLGAWQ+SGFGKGD I +EVTK ++  N     I+  L+
Sbjct  10   NNSTRTLFTLIIVTGLCCFFYLLGAWQKSGFGKGDGIVMEVTKQAQCTNVTVTDIVKDLD  69

Query  335  FETHHSGRAGSIDE-SESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCPPR  511
            FE HH  R   I E +  K    KPC  +Y DYTPCQ+Q RAM F R NMIYRERHCPP 
Sbjct  70   FEPHH--RTVKIPERANPKAVVFKPCDVKYKDYTPCQEQYRAMKFPRDNMIYRERHCPPE  127

Query  512  EKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
             +KL CLIPAPKGY TPFPWPKSRDYV YAN P+
Sbjct  128  NEKLRCLIPAPKGYKTPFPWPKSRDYVHYANVPF  161



>ref|XP_010481446.1| PREDICTED: probable methyltransferase PMT14 [Camelina sativa]
Length=618

 Score =   191 bits (484),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 109/152 (72%), Gaps = 6/152 (4%)
 Frame = +2

Query  170  DSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCN---ILPSLNFE  340
            ++ TR+  ++ IV GLCCFFYLLG+WQRSGFGKG  I +EVTK  +  N   I+  L+FE
Sbjct  10   NNSTRTLFTLIIVIGLCCFFYLLGSWQRSGFGKGRGIVMEVTKQEQCTNVTDIVTKLDFE  69

Query  341  THHSGRAGSIDE-SESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCPPREK  517
             HH  R   I E +  K    KPC  +Y DYTPCQ+Q RAM F R+NMIYRERHCPP  +
Sbjct  70   PHH--RTVQIPERANPKPVVFKPCDVKYKDYTPCQEQNRAMKFPRENMIYRERHCPPESE  127

Query  518  KLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            KL CL+PAPKGY TPFPWPKSRDYV YAN P+
Sbjct  128  KLRCLVPAPKGYKTPFPWPKSRDYVHYANVPF  159



>ref|XP_008229550.1| PREDICTED: LOW QUALITY PROTEIN: probable methyltransferase PMT14 
[Prunus mume]
Length=519

 Score =   187 bits (476),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 111/156 (71%), Gaps = 8/156 (5%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            M +K  S  +RTRS++SIF+V  LCCFFYLLG W++SGFGKGDSIA  VTK +   N+  
Sbjct  1    MESKHNSSGNRTRSTISIFVVIALCCFFYLLGTWKKSGFGKGDSIAFPVTKQTDCSNVFT  60

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +LNFETHH+     ++ SE K KE KPC  +Y DYTPCQ+Q RA+ F       RERHCP
Sbjct  61   NLNFETHHNIEE-IVEPSEPKAKEFKPCDVKYADYTPCQEQDRAIKFP------RERHCP  113

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            P E+KLH +IPA K  +TPFPWPK RDYV YAN PY
Sbjct  114  PEEEKLHIVIPAIKD-MTPFPWPKGRDYVHYANVPY  148



>ref|XP_010494834.1| PREDICTED: probable methyltransferase PMT14 [Camelina sativa]
Length=621

 Score =   187 bits (476),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 108/152 (71%), Gaps = 6/152 (4%)
 Frame = +2

Query  170  DSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCN---ILPSLNFE  340
            ++ TR+  ++ IV GLCCFFYLLG+WQRSGFGKG  + +EV K  +  N   I+  L+FE
Sbjct  10   NNSTRTLFTLIIVIGLCCFFYLLGSWQRSGFGKGGGVVMEVAKQVQCTNVTHIVTKLDFE  69

Query  341  THHSGRAGSIDE-SESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCPPREK  517
             HH  R   I E +  K    KPC  +Y DYTPCQ+Q RAM F R+NMIYRERHCPP  +
Sbjct  70   PHH--RTVKIPERANPKPVVFKPCDVKYKDYTPCQEQNRAMKFPRENMIYRERHCPPVSE  127

Query  518  KLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            KL CL+PAPKGY TPFPWPKSRDYV YAN P+
Sbjct  128  KLRCLVPAPKGYKTPFPWPKSRDYVHYANVPF  159



>gb|AAL86466.1|AC077693_5 hypothetical protein [Oryza sativa Japonica Group]
Length=686

 Score =   188 bits (477),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 99/125 (79%), Gaps = 3/125 (2%)
 Frame = +2

Query  239  GAWQRSGFGKGDSIALEVTKTSKDCNILPSLNFETHHSGRAGSIDESESKVKEIKPCHPR  418
            GAWQ+SG G+GDSIAL VTK + DC ILP+L+FETHHS   G ++      K  +PCH R
Sbjct  114  GAWQKSGTGRGDSIALRVTKET-DCTILPNLHFETHHS--LGGVNPLVMTDKVFEPCHIR  170

Query  419  YTDYTPCQDQRRAMTFSRQNMIYRERHCPPREKKLHCLIPAPKGYVTPFPWPKSRDYVPY  598
            Y+DYTPCQDQ RAM F R+NM YRERHCP   KKL CLIPAPKGYVTPFPWPKSRDYVPY
Sbjct  171  YSDYTPCQDQNRAMNFPRENMNYRERHCPTETKKLRCLIPAPKGYVTPFPWPKSRDYVPY  230

Query  599  ANAPY  613
            ANAPY
Sbjct  231  ANAPY  235



>gb|EEC68449.1| hypothetical protein OsI_36659 [Oryza sativa Indica Group]
Length=596

 Score =   183 bits (465),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 106/150 (71%), Gaps = 1/150 (1%)
 Frame = +2

Query  164  SGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLNFET  343
            S ++R RS +++ +  GLCCFFYLLGAWQRSG+GKGDSIA+ V + +  C  +  L+FET
Sbjct  9    SAENRGRSPLAMVVAVGLCCFFYLLGAWQRSGYGKGDSIAMAVNRQTAACGGV-GLSFET  67

Query  344  HHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCPPREKKL  523
            HH G     +   +   E   C     D+TPC DQ RAM F R+NM+YRERHCP   ++L
Sbjct  68   HHGGAGVENETMAAPAPEFAACAAAMADHTPCHDQERAMRFPRENMVYRERHCPGDGERL  127

Query  524  HCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
             CL+PAP GYVTPFPWP+SRDYVP+ANAPY
Sbjct  128  RCLVPAPPGYVTPFPWPRSRDYVPFANAPY  157



>ref|XP_009114343.1| PREDICTED: probable methyltransferase PMT14 [Brassica rapa]
Length=624

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 108/161 (67%), Gaps = 6/161 (4%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDS-IALEVTKTSKDC---  313
            MA+   +     R+ +SI IV GLCCFFYLLGAWQR+GFGKG   I LE       C   
Sbjct  3    MASSKNTPPVNNRTRISITIVTGLCCFFYLLGAWQRNGFGKGGGVITLEAVTKQAQCTNT  62

Query  314  -NILPSLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYR  490
             +I+ +L+FE HH         + +K    KPC  ++ DYTPC +Q+RAM F R+NM+YR
Sbjct  63   TDIVTNLDFEPHHK-TIKIPQRANTKPIMFKPCDVKFKDYTPCHEQKRAMRFPRENMVYR  121

Query  491  ERHCPPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            ERHCPP  +KL CLIPAPKGY+TPFPWPKSRDYV YAN P+
Sbjct  122  ERHCPPENEKLRCLIPAPKGYMTPFPWPKSRDYVHYANVPF  162



>ref|NP_001068227.1| Os11g0601600 [Oryza sativa Japonica Group]
 gb|ABA94590.1| Methyltransferase, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF28590.1| Os11g0601600 [Oryza sativa Japonica Group]
Length=652

 Score =   182 bits (463),  Expect = 4e-50, Method: Composition-based stats.
 Identities = 84/150 (56%), Positives = 106/150 (71%), Gaps = 1/150 (1%)
 Frame = +2

Query  164  SGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLNFET  343
            S ++R RS +++ +  GLCCFFYLLGAWQRSG+GKGDSIA+ V + +  C  +  L+FET
Sbjct  9    SAENRGRSPLAMVVAVGLCCFFYLLGAWQRSGYGKGDSIAMAVNRQTAACGGV-GLSFET  67

Query  344  HHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCPPREKKL  523
            HH G     +   +   E   C     D+TPC DQ RAM F R+NM+YRERHCP   ++L
Sbjct  68   HHGGAGVENETMAAPAPEFAACAAAMADHTPCHDQERAMRFPRENMVYRERHCPGDGERL  127

Query  524  HCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
             CL+PAP GYVTPFPWP+SRDYVP+ANAPY
Sbjct  128  RCLVPAPPGYVTPFPWPRSRDYVPFANAPY  157



>emb|CDY35169.1| BnaA09g18060D [Brassica napus]
Length=725

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 106/161 (66%), Gaps = 6/161 (4%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDS-IALEVTKTSKDC---  313
            MA+   +     R+ +SI IV GLCCFFYLLGAWQR+GFGKG   I LE       C   
Sbjct  102  MASSKNTPPVNNRTRISITIVTGLCCFFYLLGAWQRNGFGKGGGVITLEAVTKQAQCTNT  161

Query  314  -NILPSLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYR  490
             +I+ +L+FE HH         +  K    KPC  ++ DYTPC +Q+RAM F R+NM+YR
Sbjct  162  TDIVANLDFEPHHK-TIKIPHRANPKPIMFKPCDVKFKDYTPCHEQKRAMRFPRENMVYR  220

Query  491  ERHCPPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            ERHCPP  +KL CLIPAPKGY TPFPWPKSRDYV YAN P+
Sbjct  221  ERHCPPENEKLRCLIPAPKGYTTPFPWPKSRDYVHYANVPF  261



>ref|XP_002449806.1| hypothetical protein SORBIDRAFT_05g023610 [Sorghum bicolor]
 gb|EES08794.1| hypothetical protein SORBIDRAFT_05g023610 [Sorghum bicolor]
Length=609

 Score =   179 bits (455),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 109/167 (65%), Gaps = 15/167 (9%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSK----DC  313
            MANK +SG    RS +S+ +   LCCFFY+LGAWQRSG+GKGD IA  VT+ +       
Sbjct  1    MANKASSG---ARSPLSLVVAMALCCFFYVLGAWQRSGYGKGDRIAAAVTRQTACGDGSA  57

Query  314  NILPSLNFETHHSGRAGSIDES-------ESKVKEIKPCHPRYTDYTPCQDQRRAMTFSR  472
             +    +FETHH G AG I+ S       ++      PC     D+TPC DQ RAM F R
Sbjct  58   AVAAEHSFETHHGGAAG-INASTSLPFSADAPPPTFPPCAAALADHTPCHDQDRAMKFPR  116

Query  473  QNMIYRERHCPPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            +NM+YRERHCP    +L CL+PAP GYVTPFPWP+SRDYVP+ANAPY
Sbjct  117  KNMVYRERHCPADGDRLRCLVPAPPGYVTPFPWPRSRDYVPFANAPY  163



>emb|CDY03207.1| BnaC09g19490D [Brassica napus]
Length=622

 Score =   179 bits (455),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 105/161 (65%), Gaps = 6/161 (4%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDS-IALEVTKTSKDC---  313
            MA+   +     R+ +SI IV GLCCFFYLLGAWQR+GFGKG   I LE       C   
Sbjct  3    MASSKNTPPVNNRTRISITIVTGLCCFFYLLGAWQRNGFGKGGGVITLEAVTKQAQCTNT  62

Query  314  -NILPSLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYR  490
             +I+ +L+FE HH         +  K    KPC  +Y DYTPC +Q+RAM F R+NM+YR
Sbjct  63   TDIVTNLDFEPHHK-TIKIPQRANPKPIMFKPCDVKYKDYTPCHEQKRAMRFPRENMVYR  121

Query  491  ERHCPPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            ERHC P  +KL CLIPAPKGY TPFPWPKSRDYV YAN P+
Sbjct  122  ERHCQPENEKLRCLIPAPKGYTTPFPWPKSRDYVHYANVPF  162



>ref|XP_004979626.1| PREDICTED: probable methyltransferase PMT2-like [Setaria italica]
Length=626

 Score =   179 bits (455),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 109/163 (67%), Gaps = 11/163 (7%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTK--TSKDCNI  319
            MANK +SG    RS +S+ +   LCCFFY+LGAWQRSG+GKGDSIA  V +         
Sbjct  1    MANKGSSG---ARSPLSLVVAMALCCFFYVLGAWQRSGYGKGDSIAAAVNRQAACGGDAA  57

Query  320  LPSLNFETHHSGRAGSIDESESKVK----EIKPCHPRYTDYTPCQDQRRAMTFSRQNMIY  487
               L+FETH SG A +ID + S       E  PC     D+TPC DQ RAM F R+NM+Y
Sbjct  58   AAGLSFETHRSGDA-AIDTNASAATGAGPEFPPCAAALADHTPCHDQDRAMKFPRKNMVY  116

Query  488  RERHCPP-REKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            RERHCP   + +L CL+PAP GYVTPFPWPKSRDYVP+ANAPY
Sbjct  117  RERHCPAGADDRLRCLVPAPPGYVTPFPWPKSRDYVPFANAPY  159



>tpg|DAA42264.1| TPA: methyltransferase isoform 1 [Zea mays]
 tpg|DAA42265.1| TPA: methyltransferase isoform 2 [Zea mays]
Length=628

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 110/163 (67%), Gaps = 11/163 (7%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MANK  SG    RS +++ +   LCCFFY+LGAWQRSG+GKGD IA  V++ +   ++  
Sbjct  1    MANKAVSG---ARSPLNLVVAMALCCFFYVLGAWQRSGYGKGDRIAAAVSRQTACGDVAA  57

Query  326  SLNFETHHSGRAGSIDESES-------KVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMI  484
             L+FETHH G AG+I+ S S             PC     D+TPC  Q RAM F R+NM+
Sbjct  58   GLSFETHHGG-AGAINASSSLPFGADAAPPAFAPCAAALADHTPCHHQDRAMKFPRKNMV  116

Query  485  YRERHCPPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            YRERHCP   ++L CL+PAP GYVTPFPWP+SRDYVP+ANAPY
Sbjct  117  YRERHCPSDGERLRCLVPAPPGYVTPFPWPRSRDYVPFANAPY  159



>ref|XP_008668148.1| PREDICTED: methyltransferase isoform X1 [Zea mays]
Length=658

 Score =   177 bits (450),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 110/163 (67%), Gaps = 11/163 (7%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MANK  SG    RS +++ +   LCCFFY+LGAWQRSG+GKGD IA  V++ +   ++  
Sbjct  1    MANKAVSG---ARSPLNLVVAMALCCFFYVLGAWQRSGYGKGDRIAAAVSRQTACGDVAA  57

Query  326  SLNFETHHSGRAGSIDESES-------KVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMI  484
             L+FETHH G AG+I+ S S             PC     D+TPC  Q RAM F R+NM+
Sbjct  58   GLSFETHHGG-AGAINASSSLPFGADAAPPAFAPCAAALADHTPCHHQDRAMKFPRKNMV  116

Query  485  YRERHCPPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            YRERHCP   ++L CL+PAP GYVTPFPWP+SRDYVP+ANAPY
Sbjct  117  YRERHCPSDGERLRCLVPAPPGYVTPFPWPRSRDYVPFANAPY  159



>ref|NP_001152056.1| methyltransferase [Zea mays]
 gb|ACG45571.1| methyltransferase [Zea mays]
Length=628

 Score =   173 bits (439),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 87/163 (53%), Positives = 108/163 (66%), Gaps = 11/163 (7%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MANK  SG    RS ++  +   LCCF Y+LGAWQRSG+GKGD IA  V++ +   ++  
Sbjct  1    MANKAVSG---ARSPLNXVVAMALCCFXYVLGAWQRSGYGKGDRIAAAVSRQTACGDVAA  57

Query  326  SLNFETHHSGRAGSIDESES-------KVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMI  484
             L+FETHH G AG+I+ S S             PC     D+TPC  Q RAM F R+NM+
Sbjct  58   GLSFETHHGG-AGAINASSSLPFGADAAPPAFAPCAAALADHTPCHHQDRAMKFPRKNMV  116

Query  485  YRERHCPPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            YRERHCP   ++L CL+PAP GYVTPFPWP+SRDYVP+ANAPY
Sbjct  117  YRERHCPSDGERLRCLVPAPPGYVTPFPWPRSRDYVPFANAPY  159



>gb|KHN30834.1| Putative methyltransferase PMT2 [Glycine soja]
Length=526

 Score =   167 bits (424),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 95/127 (75%), Gaps = 2/127 (2%)
 Frame = +2

Query  146  MANKVTSGDSRT-RSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNIL  322
            M  K   GD++  RSS+SIFI+ GLC FFY+LG WQRSGFGKGDSIA+E+TK + DC +L
Sbjct  1    MVTKGNPGDNKNNRSSLSIFIIVGLCGFFYILGLWQRSGFGKGDSIAVEITKRT-DCIVL  59

Query  323  PSLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHC  502
              LN+ETHH   +G+ +   ++VKE KPC  RY DYTPC DQ RAMTF R NM YRERHC
Sbjct  60   SDLNYETHHDDNSGTPNGFGAQVKEFKPCDDRYIDYTPCHDQARAMTFPRDNMAYRERHC  119

Query  503  PPREKKL  523
            PP E+KL
Sbjct  120  PPDEEKL  126



>gb|KHN29896.1| Putative methyltransferase PMT2 [Glycine soja]
Length=308

 Score =   160 bits (405),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 98/156 (63%), Gaps = 2/156 (1%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            M +K  +   R R  +SIF V  L CFFYLLGAWQ +G GKGD++ L+V     D  +LP
Sbjct  1    MGSKTNASSYRGRRPLSIFSVLSLRCFFYLLGAWQGNGSGKGDNLTLKVNNLMTDRTVLP  60

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCP  505
            +L+FE+H S     +     K K  KPC  +YTDYTPCQ Q + M F R+NMIYRERHC 
Sbjct  61   NLSFESHGSD-VEIVKLDVLKDKAFKPCDMKYTDYTPCQVQDQ-MKFPRENMIYRERHCT  118

Query  506  PREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
               +KLHCLIPA KG  T  PWPKS DY  Y N PY
Sbjct  119  SENEKLHCLIPAHKGSTTHVPWPKSHDYAYYDNVPY  154



>tpg|DAA45571.1| TPA: hypothetical protein ZEAMMB73_269534 [Zea mays]
Length=587

 Score =   157 bits (397),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 89/121 (74%), Gaps = 1/121 (1%)
 Frame = +2

Query  251  RSGFGKGDSIALEVTKTSKDCNILPSLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDY  430
            +SG G GD I   V + +K C  LP+L+FETHHS      D   SK++  KPC  +YTDY
Sbjct  56   KSGSGGGDGIQTWVNEQTK-CAQLPNLSFETHHSASNLLNDTDNSKIEPFKPCDEQYTDY  114

Query  431  TPCQDQRRAMTFSRQNMIYRERHCPPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAP  610
            TPC++Q RAMTF R NMIYRERHCPP ++KL+CLIPAPKGYV PF WPKSRD+V YAN P
Sbjct  115  TPCEEQSRAMTFPRDNMIYRERHCPPDKEKLYCLIPAPKGYVAPFRWPKSRDFVHYANVP  174

Query  611  Y  613
            +
Sbjct  175  H  175



>gb|EYU35839.1| hypothetical protein MIMGU_mgv1a0064512mg, partial [Erythranthe 
guttata]
Length=400

 Score =   154 bits (390),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 96/158 (61%), Gaps = 13/158 (8%)
 Frame = +2

Query  146  MANKVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILP  325
            MA K   GD + R S+S+ I+A LC F YLLG WQ+SG GKGDSIALEV   +++CNIL 
Sbjct  1    MAIKRYRGDRKNRRSISLLIIAALCGFLYLLGVWQKSGSGKGDSIALEVMNNAENCNILS  60

Query  326  SLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQ--RRAMTFSRQNMIYRERH  499
             L  + H S    +        +  +PC  +Y DYTPC  Q  R  + F       RER+
Sbjct  61   HLQIKIHQSNVFYNFQP-----QFFEPCEDKYVDYTPCHGQKIRGVVQFP------RERN  109

Query  500  CPPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            CP  E KL CL+P PKGYV PF WPKSR +VPY NAPY
Sbjct  110  CPRGEYKLRCLVPPPKGYVEPFRWPKSRSFVPYVNAPY  147



>gb|KHN21029.1| Putative methyltransferase PMT14 [Glycine soja]
Length=561

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 81/102 (79%), Gaps = 1/102 (1%)
 Frame = +2

Query  308  DCNILPSLNFETHHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIY  487
            DC +LP+L+FE+HH+     ++ +E K KE KPC  +YTDYTPCQ+Q RAMTF R+NMIY
Sbjct  3    DCTVLPNLSFESHHND-VEIVEPAEPKAKEFKPCDVKYTDYTPCQEQDRAMTFPRENMIY  61

Query  488  RERHCPPREKKLHCLIPAPKGYVTPFPWPKSRDYVPYANAPY  613
            RERHCP  ++KL CLIPAP+GY TPFPWPKSRDY  YAN PY
Sbjct  62   RERHCPAEKEKLRCLIPAPEGYTTPFPWPKSRDYAYYANVPY  103



>ref|XP_001760613.1| predicted protein [Physcomitrella patens]
 gb|EDQ74688.1| predicted protein [Physcomitrella patens]
Length=629

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 95/147 (65%), Gaps = 5/147 (3%)
 Frame = +2

Query  173  SRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLNFETHHS  352
            +R R    + +V GLCCFFY LG+WQ  G     +++ + T      ++  +L+F  HH 
Sbjct  15   ARRRRITWLLVVVGLCCFFYTLGSWQNGGTA---ALSDKATNAKACGSVTTALDFGAHH-  70

Query  353  GRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCPPREKKLHCL  532
            G A + ++  SK+++  PC  +Y++ TPC+D +RA+ F R+ + YRERHCP +++ L CL
Sbjct  71   GLASTTNDG-SKIEQFSPCDMKYSEVTPCEDPQRALKFPREKLEYRERHCPEKDELLRCL  129

Query  533  IPAPKGYVTPFPWPKSRDYVPYANAPY  613
            +PAP GY  PFPWPKSRDY  YAN P+
Sbjct  130  VPAPPGYKNPFPWPKSRDYAWYANTPH  156



>gb|EAY81488.1| hypothetical protein OsI_36661 [Oryza sativa Indica Group]
Length=638

 Score =   140 bits (354),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 65/129 (50%), Positives = 84/129 (65%), Gaps = 1/129 (1%)
 Frame = +2

Query  164  SGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLNFET  343
            S ++R RS +++    GLCCFFYLLGAWQRSG+GKGDSIA+ V + +  C  +  L+FET
Sbjct  9    SPENRGRSPLAMVFAVGLCCFFYLLGAWQRSGYGKGDSIAMPVNRQTAACGGV-GLSFET  67

Query  344  HHSGRAGSIDESESKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCPPREKKL  523
            HH G     +   +   E   C     D+TPC DQ RAM F R+NM+YRERHCP   ++L
Sbjct  68   HHGGAGVENETMAAPAPEFAACAAAMADHTPCHDQERAMRFPRENMVYRERHCPGDGERL  127

Query  524  HCLIPAPKG  550
             CL+PAP G
Sbjct  128  RCLVPAPPG  136



>ref|XP_001778231.1| predicted protein [Physcomitrella patens]
 gb|EDQ56898.1| predicted protein [Physcomitrella patens]
Length=602

 Score =   136 bits (343),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 85/137 (62%), Gaps = 5/137 (4%)
 Frame = +2

Query  206  VAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSK-DCNILPSLNFETHHSGRAGSIDESE  382
            VAGLCCFFY+LG+WQ S       I+ E  K ++  C +   L+F  HHS       ES 
Sbjct  4    VAGLCCFFYILGSWQNSA-NDLRLISFEDQKVARLPCKLPGGLDFSAHHSSLNS---ESG  59

Query  383  SKVKEIKPCHPRYTDYTPCQDQRRAMTFSRQNMIYRERHCPPREKKLHCLIPAPKGYVTP  562
            S     +PC  +Y++YTPC+D  R++ F R  +IYRERHCP  ++ L CLIPAP GY  P
Sbjct  60   SNYTTFEPCDMKYSEYTPCEDTERSLKFPRDKLIYRERHCPKEDELLQCLIPAPAGYRNP  119

Query  563  FPWPKSRDYVPYANAPY  613
             PWP+SRDY  +AN P+
Sbjct  120  LPWPQSRDYTWFANTPH  136



>gb|AFK36214.1| unknown [Lotus japonicus]
Length=86

 Score =   126 bits (317),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +2

Query  155  KVTSGDSRTRSSVSIFIVAGLCCFFYLLGAWQRSGFGKGDSIALEVTKTSKDCNILPSLN  334
            K +S DSRTRSSV IFIV GLCCFFY+LGAWQRSGFGKGDS+ALE+TK   DCNI+P+L+
Sbjct  3    KPSSADSRTRSSVQIFIVVGLCCFFYILGAWQRSGFGKGDSVALEITKKGADCNIVPNLS  62

Query  335  FETHHSGRAGSIDESESKVKEIKP  406
            F++HH+G    IDE +SK K  +P
Sbjct  63   FDSHHAGEVSKIDEVDSKPKVFEP  86



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 889770574917