BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig2978

Length=832
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KJB41341.1|  hypothetical protein B456_007G099700                    388   9e-132   Gossypium raimondii
gb|KJB41339.1|  hypothetical protein B456_007G099700                    392   1e-131   Gossypium raimondii
gb|KJB41340.1|  hypothetical protein B456_007G099700                    390   2e-131   Gossypium raimondii
gb|KJB09813.1|  hypothetical protein B456_001G169100                    392   3e-130   Gossypium raimondii
ref|XP_007051789.1|  Signal peptide peptidase-like 4                    392   3e-130   Theobroma cacao [chocolate]
gb|KHG19371.1|  Signal peptide peptidase-like 2B                        392   5e-130   Gossypium arboreum [tree cotton]
gb|KJB41338.1|  hypothetical protein B456_007G099700                    391   1e-129   Gossypium raimondii
ref|XP_011092489.1|  PREDICTED: signal peptide peptidase-like 4 i...    387   5e-129   
emb|CDP08805.1|  unnamed protein product                                389   9e-129   Coffea canephora [robusta coffee]
gb|KJB41343.1|  hypothetical protein B456_007G099700                    388   1e-128   Gossypium raimondii
ref|XP_011092478.1|  PREDICTED: signal peptide peptidase-like 4 i...    388   2e-128   Sesamum indicum [beniseed]
gb|KJB24747.1|  hypothetical protein B456_004G158800                    384   5e-128   Gossypium raimondii
ref|XP_012083377.1|  PREDICTED: signal peptide peptidase-like 4 i...    381   8e-128   
ref|XP_010255329.1|  PREDICTED: signal peptide peptidase-like 4         384   3e-127   Nelumbo nucifera [Indian lotus]
gb|KJB24744.1|  hypothetical protein B456_004G158800                    384   7e-127   Gossypium raimondii
ref|XP_009340097.1|  PREDICTED: signal peptide peptidase-like 4         384   7e-127   Pyrus x bretschneideri [bai li]
gb|KJB24746.1|  hypothetical protein B456_004G158800                    384   8e-127   Gossypium raimondii
ref|XP_008458226.1|  PREDICTED: signal peptide peptidase-like 4         384   8e-127   Cucumis melo [Oriental melon]
ref|XP_011036451.1|  PREDICTED: signal peptide peptidase-like 4         383   9e-127   Populus euphratica
ref|XP_002274726.1|  PREDICTED: signal peptide peptidase-like 4         383   9e-127   Vitis vinifera
ref|XP_012083376.1|  PREDICTED: signal peptide peptidase-like 4 i...    384   1e-126   Jatropha curcas
ref|XP_004138500.1|  PREDICTED: signal peptide peptidase-like 4         383   1e-126   Cucumis sativus [cucumbers]
ref|XP_008340980.1|  PREDICTED: signal peptide peptidase-like 4 i...    383   1e-126   
ref|XP_008340922.1|  PREDICTED: signal peptide peptidase-like 4 i...    383   1e-126   
ref|XP_004306779.2|  PREDICTED: signal peptide peptidase-like 4         383   2e-126   Fragaria vesca subsp. vesca
gb|KDP28619.1|  hypothetical protein JCGZ_14390                         382   4e-126   Jatropha curcas
ref|XP_006375345.1|  hypothetical protein POPTR_0014s08110g             382   4e-126   Populus trichocarpa [western balsam poplar]
ref|XP_006445025.1|  hypothetical protein CICLE_v10019661mg             381   7e-126   Citrus clementina [clementine]
ref|XP_010053720.1|  PREDICTED: signal peptide peptidase-like 4 i...    381   9e-126   
ref|XP_010053719.1|  PREDICTED: signal peptide peptidase-like 4 i...    381   9e-126   Eucalyptus grandis [rose gum]
ref|XP_009367843.1|  PREDICTED: signal peptide peptidase-like 4 i...    380   1e-125   Pyrus x bretschneideri [bai li]
ref|XP_009367844.1|  PREDICTED: signal peptide peptidase-like 4 i...    380   2e-125   Pyrus x bretschneideri [bai li]
ref|XP_007219545.1|  hypothetical protein PRUPE_ppa003988mg             379   4e-125   Prunus persica
ref|XP_007139836.1|  hypothetical protein PHAVU_008G062100g             374   4e-125   Phaseolus vulgaris [French bean]
ref|XP_008232889.1|  PREDICTED: signal peptide peptidase-like 4         378   8e-125   Prunus mume [ume]
ref|XP_003552398.1|  PREDICTED: signal peptide peptidase-like 4-like    379   8e-125   Glycine max [soybeans]
gb|KHM99370.1|  Signal peptide peptidase-like 2B                        378   1e-124   Glycine soja [wild soybean]
ref|XP_011093137.1|  PREDICTED: signal peptide peptidase-like 4         378   1e-124   Sesamum indicum [beniseed]
ref|XP_003534560.1|  PREDICTED: signal peptide peptidase-like 4-like    377   2e-124   Glycine max [soybeans]
ref|XP_009784968.1|  PREDICTED: signal peptide peptidase-like 4         377   2e-124   Nicotiana sylvestris
ref|XP_008360707.1|  PREDICTED: signal peptide peptidase-like 2         376   2e-124   
ref|XP_002511870.1|  Minor histocompatibility antigen H13, putative     377   3e-124   Ricinus communis
gb|EYU32129.1|  hypothetical protein MIMGU_mgv1a004245mg                376   5e-124   Erythranthe guttata [common monkey flower]
ref|XP_007135086.1|  hypothetical protein PHAVU_010G099500g             376   8e-124   Phaseolus vulgaris [French bean]
ref|XP_009629841.1|  PREDICTED: signal peptide peptidase-like 4         375   1e-123   Nicotiana tomentosiformis
ref|XP_004510782.1|  PREDICTED: signal peptide peptidase-like 4-l...    375   1e-123   Cicer arietinum [garbanzo]
ref|XP_007139835.1|  hypothetical protein PHAVU_008G062100g             375   2e-123   Phaseolus vulgaris [French bean]
ref|XP_007040266.1|  Signal peptide peptidase-like 2 isoform 3          374   2e-123   
ref|XP_011023314.1|  PREDICTED: signal peptide peptidase-like 4         374   3e-123   Populus euphratica
ref|XP_009781593.1|  PREDICTED: signal peptide peptidase-like 4 i...    369   4e-123   Nicotiana sylvestris
gb|KEH18849.1|  signal peptide peptidase-like protein                   371   4e-123   Medicago truncatula
ref|XP_002301360.2|  hypothetical protein POPTR_0002s16180g             374   4e-123   
ref|XP_003528851.1|  PREDICTED: signal peptide peptidase-like 4-like    374   6e-123   Glycine max [soybeans]
ref|XP_007040264.1|  Signal peptide peptidase-like 2 isoform 1          374   6e-123   Theobroma cacao [chocolate]
ref|XP_009592079.1|  PREDICTED: signal peptide peptidase-like 4 i...    369   7e-123   Nicotiana tomentosiformis
ref|XP_006439532.1|  hypothetical protein CICLE_v10019598mg             373   8e-123   Citrus clementina [clementine]
ref|XP_008238915.1|  PREDICTED: signal peptide peptidase-like 2         373   9e-123   Prunus mume [ume]
ref|XP_006476550.1|  PREDICTED: signal peptide peptidase-like 2-like    373   1e-122   Citrus sinensis [apfelsine]
ref|XP_012086884.1|  PREDICTED: signal peptide peptidase-like 2         373   1e-122   Jatropha curcas
gb|KHG15007.1|  Signal peptide peptidase-like 2B                        373   2e-122   Gossypium arboreum [tree cotton]
ref|XP_007209873.1|  hypothetical protein PRUPE_ppa003858mg             372   2e-122   Prunus persica
ref|XP_003521881.1|  PREDICTED: signal peptide peptidase-like 4-like    372   4e-122   Glycine max [soybeans]
gb|AET02050.2|  signal peptide peptidase-like protein                   371   5e-122   Medicago truncatula
ref|XP_002509814.1|  Minor histocompatibility antigen H13, putative     371   7e-122   Ricinus communis
ref|XP_009781592.1|  PREDICTED: signal peptide peptidase-like 4 i...    370   1e-121   Nicotiana sylvestris
ref|XP_006339581.1|  PREDICTED: signal peptide peptidase-like 4-l...    369   1e-121   
gb|EYU35094.1|  hypothetical protein MIMGU_mgv1a009454mg                363   2e-121   Erythranthe guttata [common monkey flower]
ref|XP_009592078.1|  PREDICTED: signal peptide peptidase-like 4 i...    370   2e-121   Nicotiana tomentosiformis
ref|XP_006339580.1|  PREDICTED: signal peptide peptidase-like 4-l...    370   2e-121   Solanum tuberosum [potatoes]
ref|XP_002274996.2|  PREDICTED: signal peptide peptidase-like 2         370   3e-121   Vitis vinifera
gb|AAL14628.1|AF417575_1  growth-on protein GRO11                       369   5e-121   Euphorbia esula [wolf's milk]
ref|XP_010935855.1|  PREDICTED: signal peptide peptidase-like 4 i...    368   5e-121   
gb|KHG06309.1|  Signal peptide peptidase-like 2B                        369   5e-121   Gossypium arboreum [tree cotton]
gb|KJB20659.1|  hypothetical protein B456_003G158200                    369   6e-121   Gossypium raimondii
gb|KJB20661.1|  hypothetical protein B456_003G158200                    368   7e-121   Gossypium raimondii
ref|XP_010935854.1|  PREDICTED: signal peptide peptidase-like 4 i...    367   1e-120   Elaeis guineensis
gb|KHG25050.1|  Signal peptide peptidase-like 2B                        367   2e-120   Gossypium arboreum [tree cotton]
ref|XP_004229902.2|  PREDICTED: signal peptide peptidase-like 4         369   2e-120   Solanum lycopersicum
gb|KJB52137.1|  hypothetical protein B456_008G247500                    365   2e-120   Gossypium raimondii
gb|KJB52134.1|  hypothetical protein B456_008G247500                    367   3e-120   Gossypium raimondii
ref|XP_009346748.1|  PREDICTED: signal peptide peptidase-like 2         366   6e-120   Pyrus x bretschneideri [bai li]
ref|XP_009374989.1|  PREDICTED: signal peptide peptidase-like 2         366   6e-120   Pyrus x bretschneideri [bai li]
ref|XP_010089093.1|  Signal peptide peptidase-like 2B                   365   1e-119   
ref|XP_004298803.1|  PREDICTED: signal peptide peptidase-like 2         365   1e-119   Fragaria vesca subsp. vesca
ref|XP_010053243.1|  PREDICTED: signal peptide peptidase-like 2         365   2e-119   Eucalyptus grandis [rose gum]
gb|KEH23364.1|  signal peptide peptidase-like protein                   360   2e-119   Medicago truncatula
gb|EYU38342.1|  hypothetical protein MIMGU_mgv1a004184mg                364   4e-119   Erythranthe guttata [common monkey flower]
ref|XP_008338843.1|  PREDICTED: signal peptide peptidase-like 4         363   5e-119   
gb|ABN06072.1|  Protease-associated PA; Peptidase A22B, minor his...    362   6e-119   Medicago truncatula
ref|XP_003538333.1|  PREDICTED: signal peptide peptidase-like 2-like    363   9e-119   Glycine max [soybeans]
ref|XP_004245597.1|  PREDICTED: signal peptide peptidase-like 2         363   1e-118   Solanum lycopersicum
ref|XP_010544387.1|  PREDICTED: signal peptide peptidase-like 4         363   1e-118   Tarenaya hassleriana [spider flower]
ref|XP_009396168.1|  PREDICTED: signal peptide peptidase-like 4         362   1e-118   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002303595.2|  protease-associated domain-containing family...    362   1e-118   Populus trichocarpa [western balsam poplar]
ref|XP_009600060.1|  PREDICTED: signal peptide peptidase-like 2         362   2e-118   Nicotiana tomentosiformis
ref|XP_009780084.1|  PREDICTED: signal peptide peptidase-like 2         362   2e-118   Nicotiana sylvestris
gb|KHN42194.1|  Signal peptide peptidase-like 2B                        362   3e-118   Glycine soja [wild soybean]
ref|XP_006343972.1|  PREDICTED: signal peptide peptidase-like 2-like    362   3e-118   Solanum tuberosum [potatoes]
ref|XP_003623971.1|  Signal peptide peptidase-like 2B                   361   4e-118   Medicago truncatula
emb|CDP12034.1|  unnamed protein product                                355   4e-118   Coffea canephora [robusta coffee]
ref|XP_010545677.1|  PREDICTED: signal peptide peptidase-like 2         361   4e-118   Tarenaya hassleriana [spider flower]
ref|XP_010670265.1|  PREDICTED: signal peptide peptidase-like 4         361   5e-118   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010474771.1|  PREDICTED: signal peptide peptidase-like 4         361   5e-118   Camelina sativa [gold-of-pleasure]
ref|XP_004492745.1|  PREDICTED: signal peptide peptidase-like 4-like    360   9e-118   Cicer arietinum [garbanzo]
ref|NP_001030930.1|  signal peptide peptidase-like 4                    355   1e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011022676.1|  PREDICTED: signal peptide peptidase-like 2         359   3e-117   Populus euphratica
ref|XP_006827582.1|  PREDICTED: signal peptide peptidase-like 4         358   4e-117   Amborella trichopoda
ref|XP_009119715.1|  PREDICTED: signal peptide peptidase-like 4         358   4e-117   Brassica rapa
emb|CDX90049.1|  BnaA10g00330D                                          358   5e-117   
ref|XP_010326969.1|  PREDICTED: signal peptide peptidase-like 4 i...    353   7e-117   Solanum lycopersicum
ref|XP_010680813.1|  PREDICTED: signal peptide peptidase-like 2         358   7e-117   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAF01633.1|  hypothetical protein                                   348   9e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002887944.1|  protease-associated domain-containing protein      357   1e-116   
gb|KDO86179.1|  hypothetical protein CISIN_1g009437mg                   357   1e-116   Citrus sinensis [apfelsine]
ref|XP_006418441.1|  hypothetical protein EUTSA_v10007312mg             357   2e-116   Eutrema salsugineum [saltwater cress]
emb|CDY15163.1|  BnaC05g00420D                                          357   2e-116   Brassica napus [oilseed rape]
ref|NP_171671.2|  signal peptide peptidase-like 4                       357   3e-116   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002889358.1|  peptidase                                          357   3e-116   
ref|XP_003517469.1|  PREDICTED: signal peptide peptidase-like 2-like    356   5e-116   Glycine max [soybeans]
ref|XP_010480029.1|  PREDICTED: signal peptide peptidase-like 4 i...    355   5e-116   
gb|KFK42519.1|  hypothetical protein AALP_AA1G005000                    355   7e-116   Arabis alpina [alpine rockcress]
ref|XP_006364152.1|  PREDICTED: signal peptide peptidase-like 4-like    355   9e-116   Solanum tuberosum [potatoes]
ref|XP_003627574.1|  Signal peptide peptidase-like 2B                   356   9e-116   
ref|XP_011654737.1|  PREDICTED: signal peptide peptidase-like 2 i...    354   9e-116   Cucumis sativus [cucumbers]
ref|XP_006301088.1|  hypothetical protein CARUB_v10021480mg             355   1e-115   Capsella rubella
ref|XP_010480022.1|  PREDICTED: signal peptide peptidase-like 4 i...    355   1e-115   Camelina sativa [gold-of-pleasure]
ref|XP_008778907.1|  PREDICTED: signal peptide peptidase-like 4         355   1e-115   Phoenix dactylifera
emb|CDY38021.1|  BnaCnng08820D                                          355   1e-115   Brassica napus [oilseed rape]
emb|CDY45351.1|  BnaA09g12360D                                          355   1e-115   Brassica napus [oilseed rape]
ref|XP_011080942.1|  PREDICTED: signal peptide peptidase-like 2         355   1e-115   
dbj|BAD22919.1|  putative growth-on protein GRO10                       355   2e-115   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011029294.1|  PREDICTED: LOW QUALITY PROTEIN: signal pepti...    354   2e-115   Populus euphratica
ref|NP_001048565.1|  Os02g0823000                                       355   2e-115   
ref|XP_004248045.1|  PREDICTED: signal peptide peptidase-like 4 i...    354   2e-115   Solanum lycopersicum
ref|XP_006303940.1|  hypothetical protein CARUB_v10008675mg             355   3e-115   
ref|XP_009112759.1|  PREDICTED: signal peptide peptidase-like 2         354   3e-115   Brassica rapa
gb|AAL14629.1|AF417576_1  growth-on protein GRO10                       354   3e-115   Euphorbia esula [wolf's milk]
ref|XP_002299526.2|  protease-associated domain-containing family...    354   3e-115   
emb|CDY08318.1|  BnaC09g12780D                                          354   3e-115   Brassica napus [oilseed rape]
ref|XP_010418402.1|  PREDICTED: signal peptide peptidase-like 2 i...    354   3e-115   Camelina sativa [gold-of-pleasure]
ref|XP_010457099.1|  PREDICTED: signal peptide peptidase-like 4         355   3e-115   Camelina sativa [gold-of-pleasure]
ref|XP_007158507.1|  hypothetical protein PHAVU_002G158100g             354   3e-115   Phaseolus vulgaris [French bean]
gb|AAM63609.1|  growth-on protein GRO10                                 353   3e-115   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006391728.1|  hypothetical protein EUTSA_v10023402mg             353   4e-115   Eutrema salsugineum [saltwater cress]
ref|XP_004143899.1|  PREDICTED: signal peptide peptidase-like 2 i...    353   4e-115   Cucumis sativus [cucumbers]
gb|AAF78405.1|AC009273_11  ESTs gb|AA586244 and gb|T21200 come fr...    356   4e-115   Arabidopsis thaliana [mouse-ear cress]
gb|EAY88073.1|  hypothetical protein OsI_09503                          353   5e-115   Oryza sativa Indica Group [Indian rice]
ref|XP_010430474.1|  PREDICTED: signal peptide peptidase-like 2         353   6e-115   Camelina sativa [gold-of-pleasure]
ref|NP_564815.1|  signal peptide peptidase-like 2                       353   6e-115   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010473618.1|  PREDICTED: signal peptide peptidase-like 2         353   7e-115   Camelina sativa [gold-of-pleasure]
ref|XP_006648148.1|  PREDICTED: signal peptide peptidase-like 4-like    353   7e-115   Oryza brachyantha
gb|KHG08704.1|  Signal peptide peptidase-like 2B                        350   7e-115   Gossypium arboreum [tree cotton]
ref|XP_010418403.1|  PREDICTED: signal peptide peptidase-like 2 i...    353   8e-115   Camelina sativa [gold-of-pleasure]
ref|XP_008437291.1|  PREDICTED: signal peptide peptidase-like 2         352   2e-114   Cucumis melo [Oriental melon]
ref|XP_009118826.1|  PREDICTED: signal peptide peptidase-like 4         352   2e-114   Brassica rapa
gb|KFK30597.1|  hypothetical protein AALP_AA6G002300                    352   2e-114   Arabis alpina [alpine rockcress]
ref|XP_003570436.1|  PREDICTED: signal peptide peptidase-like 4         352   2e-114   Brachypodium distachyon [annual false brome]
ref|NP_974082.1|  signal peptide peptidase-like 2                       352   3e-114   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009420462.1|  PREDICTED: signal peptide peptidase-like 5 i...    349   1e-113   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009420460.1|  PREDICTED: signal peptide peptidase-like 5 i...    349   1e-113   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS56631.1|  Signal peptide peptidase-like 2B                        346   2e-113   Triticum urartu
ref|XP_002453071.1|  hypothetical protein SORBIDRAFT_04g037790          347   1e-112   Sorghum bicolor [broomcorn]
gb|AFW63934.1|  hypothetical protein ZEAMMB73_184308                    347   2e-112   
ref|XP_010940491.1|  PREDICTED: signal peptide peptidase-like 4         346   2e-112   Elaeis guineensis
gb|EMT12022.1|  Signal peptide peptidase-like 2B                        346   3e-112   
gb|AFW69665.2|  hypothetical protein ZEAMMB73_283504                    342   4e-112   
ref|NP_001058659.1|  Os06g0730900                                       346   4e-112   
ref|XP_008679146.1|  PREDICTED: signal peptide peptidase-like 4         348   5e-112   
ref|XP_004966574.1|  PREDICTED: signal peptide peptidase-like 5-like    345   5e-112   Setaria italica
gb|AFW69664.2|  hypothetical protein ZEAMMB73_283504                    343   1e-111   
ref|XP_004954446.1|  PREDICTED: signal peptide peptidase-like 4-like    343   3e-111   Setaria italica
gb|ACN30991.1|  unknown                                                 341   4e-111   Zea mays [maize]
ref|NP_001149009.1|  LOC100282629 precursor                             342   1e-110   Zea mays [maize]
ref|XP_010087957.1|  Signal peptide peptidase-like 2B                   340   2e-110   
emb|CAN62222.1|  hypothetical protein VITISV_022532                     339   4e-110   Vitis vinifera
gb|KEH26504.1|  signal peptide peptidase-like protein                   336   1e-109   Medicago truncatula
ref|XP_004506302.1|  PREDICTED: signal peptide peptidase-like 2-like    340   2e-109   
ref|XP_002439083.1|  hypothetical protein SORBIDRAFT_10g031280          338   3e-109   Sorghum bicolor [broomcorn]
ref|XP_010239116.1|  PREDICTED: signal peptide peptidase-like 5         338   5e-109   Brachypodium distachyon [annual false brome]
dbj|BAJ98049.1|  predicted protein                                      337   2e-108   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ96967.1|  predicted protein                                      337   2e-108   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK08187.1|  predicted protein                                      337   2e-108   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ97624.1|  predicted protein                                      337   2e-108   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KEH26503.1|  signal peptide peptidase-like protein                   335   5e-108   Medicago truncatula
gb|EMT21395.1|  Signal peptide peptidase-like 2B                        332   1e-106   
gb|ADE76315.1|  unknown                                                 331   2e-106   Picea sitchensis
ref|XP_006375344.1|  hypothetical protein POPTR_0014s08110g             329   7e-106   
gb|KJB52138.1|  hypothetical protein B456_008G247500                    326   2e-104   Gossypium raimondii
gb|KJB24745.1|  hypothetical protein B456_004G158800                    325   3e-104   Gossypium raimondii
gb|AAG52428.1|AC011622_16  unknown protein; 50290-46846                 316   9e-101   Arabidopsis thaliana [mouse-ear cress]
gb|AFK45400.1|  unknown                                                 303   3e-100   Lotus japonicus
gb|AFW69666.2|  hypothetical protein ZEAMMB73_283504                    309   2e-99    
gb|KJB41345.1|  hypothetical protein B456_007G099700                    311   3e-99    Gossypium raimondii
gb|EPS67175.1|  hypothetical protein M569_07601                         298   2e-95    Genlisea aurea
gb|EMS64986.1|  Signal peptide peptidase-like 2B                        295   7e-92    Triticum urartu
ref|XP_002970408.1|  hypothetical protein SELMODRAFT_93092              284   5e-88    
ref|XP_002982598.1|  hypothetical protein SELMODRAFT_179700             284   7e-88    
ref|XP_002978487.1|  hypothetical protein SELMODRAFT_176891             283   8e-88    
ref|XP_001751321.1|  predicted protein                                  283   1e-87    
ref|XP_002993338.1|  hypothetical protein SELMODRAFT_187400             283   1e-87    Selaginella moellendorffii
ref|XP_001768370.1|  predicted protein                                  281   2e-87    
ref|XP_001770668.1|  predicted protein                                  278   2e-85    
ref|XP_006445026.1|  hypothetical protein CICLE_v10019661mg             271   8e-84    
ref|XP_007033979.1|  Signal peptide peptidase family protein, exp...    265   1e-82    
ref|XP_001770310.1|  predicted protein                                  268   6e-82    
gb|EMT17072.1|  Signal peptide peptidase-like 2B                        262   7e-82    
gb|KJB30040.1|  hypothetical protein B456_005G128500                    266   8e-82    Gossypium raimondii
gb|KJB30042.1|  hypothetical protein B456_005G128500                    266   3e-81    Gossypium raimondii
gb|KJB30043.1|  hypothetical protein B456_005G128500                    266   3e-81    Gossypium raimondii
gb|KJB30038.1|  hypothetical protein B456_005G128500                    266   3e-81    Gossypium raimondii
ref|XP_007033978.1|  Signal peptide peptidase family protein, exp...    265   5e-81    
ref|XP_007040267.1|  Signal peptide peptidase-like 2 isoform 4          263   7e-81    
ref|XP_012066255.1|  PREDICTED: signal peptide peptidase-like 5         265   8e-81    Jatropha curcas
gb|KJB20660.1|  hypothetical protein B456_003G158200                    263   9e-81    Gossypium raimondii
ref|NP_001067797.1|  Os11g0433200                                       259   2e-80    
gb|AAX96394.1|  signal peptide peptidase, putative                      259   5e-80    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004979231.1|  PREDICTED: signal peptide peptidase-like 2-like    262   1e-79    Setaria italica
gb|KDO50535.1|  hypothetical protein CISIN_1g009527mg                   258   1e-79    Citrus sinensis [apfelsine]
ref|XP_010908619.1|  PREDICTED: signal peptide peptidase-like 2         255   2e-79    
emb|CDP10362.1|  unnamed protein product                                261   3e-79    Coffea canephora [robusta coffee]
ref|XP_009413504.1|  PREDICTED: signal peptide peptidase-like 2         261   3e-79    Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH21452.1|  signal peptide peptidase-like protein                   261   4e-79    Medicago truncatula
sp|Q53P98.1|SIPL2_ORYSJ  RecName: Full=Signal peptide peptidase-l...    260   6e-79    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002881886.1|  protease-associated domain-containing protein      260   8e-79    Arabidopsis lyrata subsp. lyrata
gb|ERN11882.1|  hypothetical protein AMTR_s00020p00178900               250   9e-79    Amborella trichopoda
gb|ABR16410.1|  unknown                                                 259   1e-78    Picea sitchensis
dbj|BAJ93677.1|  predicted protein                                      259   1e-78    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDO50533.1|  hypothetical protein CISIN_1g009527mg                   258   2e-78    Citrus sinensis [apfelsine]
gb|KGN45913.1|  hypothetical protein Csa_6G022250                       253   2e-78    Cucumis sativus [cucumbers]
tpg|DAA38909.1|  TPA: hypothetical protein ZEAMMB73_606524              258   2e-78    
ref|XP_002268575.1|  PREDICTED: signal peptide peptidase-like 2         258   3e-78    Vitis vinifera
ref|XP_008667367.1|  PREDICTED: uncharacterized protein LOC100217...    258   3e-78    
ref|XP_006663404.1|  PREDICTED: signal peptide peptidase-like 2-like    258   4e-78    Oryza brachyantha
ref|XP_007139105.1|  hypothetical protein PHAVU_008G001700g             258   4e-78    Phaseolus vulgaris [French bean]
gb|EYU32730.1|  hypothetical protein MIMGU_mgv1a004358mg                257   8e-78    Erythranthe guttata [common monkey flower]
ref|XP_009786573.1|  PREDICTED: signal peptide peptidase-like 3         257   8e-78    Nicotiana sylvestris
ref|XP_002446699.1|  hypothetical protein SORBIDRAFT_06g020770          257   9e-78    Sorghum bicolor [broomcorn]
ref|XP_003568960.1|  PREDICTED: signal peptide peptidase-like 2         257   9e-78    Brachypodium distachyon [annual false brome]
ref|XP_006443146.1|  hypothetical protein CICLE_v10019670mg             256   1e-77    Citrus clementina [clementine]
ref|XP_011073830.1|  PREDICTED: signal peptide peptidase-like 3         256   2e-77    Sesamum indicum [beniseed]
ref|XP_011042780.1|  PREDICTED: signal peptide peptidase-like 3 i...    256   2e-77    Populus euphratica
ref|XP_010245342.1|  PREDICTED: signal peptide peptidase-like 2 i...    256   2e-77    Nelumbo nucifera [Indian lotus]
gb|KHN24971.1|  Signal peptide peptidase-like 2B                        256   2e-77    Glycine soja [wild soybean]
ref|XP_011042779.1|  PREDICTED: signal peptide peptidase-like 3 i...    256   2e-77    Populus euphratica
ref|XP_003532320.1|  PREDICTED: signal peptide peptidase-like 3-like    256   2e-77    Glycine max [soybeans]
ref|XP_011042778.1|  PREDICTED: signal peptide peptidase-like 3 i...    256   2e-77    Populus euphratica
gb|KHN37259.1|  Signal peptide peptidase-like 2B                        254   3e-77    Glycine soja [wild soybean]
gb|ABK92483.1|  unknown                                                 256   3e-77    Populus trichocarpa [western balsam poplar]
ref|XP_010999996.1|  PREDICTED: signal peptide peptidase-like 3 i...    255   3e-77    Populus euphratica
ref|XP_002301641.1|  hypothetical protein POPTR_0002s23320g             255   4e-77    Populus trichocarpa [western balsam poplar]
ref|XP_010999995.1|  PREDICTED: signal peptide peptidase-like 3 i...    255   6e-77    Populus euphratica
gb|AFK41165.1|  unknown                                                 247   7e-77    Lotus japonicus
ref|XP_009615110.1|  PREDICTED: signal peptide peptidase-like 3         254   9e-77    Nicotiana tomentosiformis
ref|XP_006375513.1|  hypothetical protein POPTR_0014s14750g             254   1e-76    Populus trichocarpa [western balsam poplar]
ref|XP_003535798.1|  PREDICTED: signal peptide peptidase-like 5-l...    253   1e-76    Glycine max [soybeans]
ref|XP_011656473.1|  PREDICTED: signal peptide peptidase-like 5 i...    253   2e-76    Cucumis sativus [cucumbers]
ref|XP_011656474.1|  PREDICTED: signal peptide peptidase-like 5 i...    253   3e-76    Cucumis sativus [cucumbers]
ref|XP_006850301.2|  PREDICTED: signal peptide peptidase-like 2         253   3e-76    Amborella trichopoda
ref|XP_010927592.1|  PREDICTED: signal peptide peptidase-like 2         244   5e-76    
ref|XP_003552754.1|  PREDICTED: signal peptide peptidase-like 3-like    252   6e-76    Glycine max [soybeans]
ref|XP_006606946.1|  PREDICTED: signal peptide peptidase-like 2-like    251   6e-76    
gb|KHN12587.1|  Signal peptide peptidase-like 2B                        252   6e-76    Glycine soja [wild soybean]
ref|XP_007142608.1|  hypothetical protein PHAVU_007G001900g             251   8e-76    Phaseolus vulgaris [French bean]
ref|XP_008464342.1|  PREDICTED: signal peptide peptidase-like 5 i...    251   1e-75    Cucumis melo [Oriental melon]
ref|XP_008464341.1|  PREDICTED: signal peptide peptidase-like 5 i...    251   1e-75    Cucumis melo [Oriental melon]
gb|KHN27144.1|  Signal peptide peptidase-like 2B                        252   1e-75    Glycine soja [wild soybean]
dbj|BAE71293.1|  hypothetical protein                                   250   3e-75    Trifolium pratense [peavine clover]
emb|CDY53660.1|  BnaC04g52940D                                          243   3e-75    Brassica napus [oilseed rape]
gb|KCW59889.1|  hypothetical protein EUGRSUZ_H02617                     249   6e-75    Eucalyptus grandis [rose gum]
ref|XP_010023580.1|  PREDICTED: signal peptide peptidase-like 2         249   6e-75    Eucalyptus grandis [rose gum]
ref|XP_009383829.1|  PREDICTED: signal peptide peptidase-like 2         249   1e-74    Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB30041.1|  hypothetical protein B456_005G128500                    248   1e-74    Gossypium raimondii
ref|XP_006366711.1|  PREDICTED: signal peptide peptidase-like 5-like    248   2e-74    
gb|KJB71830.1|  hypothetical protein B456_011G143700                    248   2e-74    Gossypium raimondii
gb|KFK37150.1|  hypothetical protein AALP_AA4G219600                    248   3e-74    Arabis alpina [alpine rockcress]
ref|XP_011084161.1|  PREDICTED: signal peptide peptidase-like 5         247   8e-74    Sesamum indicum [beniseed]
ref|XP_009385471.1|  PREDICTED: signal peptide peptidase-like 2         246   8e-74    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008800997.1|  PREDICTED: signal peptide peptidase-like 2 i...    246   1e-73    Phoenix dactylifera
ref|XP_006411582.1|  hypothetical protein EUTSA_v10016479mg             246   1e-73    Eutrema salsugineum [saltwater cress]
ref|XP_009142907.1|  PREDICTED: signal peptide peptidase-like 3         246   1e-73    
ref|XP_010326931.1|  PREDICTED: signal peptide peptidase-like 2         245   2e-73    
emb|CDY53658.1|  BnaC04g52920D                                          246   2e-73    
ref|XP_004296701.1|  PREDICTED: signal peptide peptidase-like 3         246   2e-73    
ref|XP_010557058.1|  PREDICTED: signal peptide peptidase-like 5         245   3e-73    
ref|XP_006293936.1|  hypothetical protein CARUB_v10022926mg             245   4e-73    
gb|EMT00602.1|  Signal peptide peptidase-like 2B                        246   4e-73    
gb|KHG14688.1|  Signal peptide peptidase-like 2B                        244   5e-73    
ref|XP_009627420.1|  PREDICTED: signal peptide peptidase-like 5         244   5e-73    
ref|XP_010517860.1|  PREDICTED: signal peptide peptidase-like 3         244   5e-73    
gb|KEH44551.1|  signal peptide peptidase-like protein                   244   6e-73    
ref|XP_008381462.1|  PREDICTED: signal peptide peptidase-like 3         244   1e-72    
ref|NP_850383.2|  signal peptide peptidase-like 3                       243   2e-72    
ref|XP_010525673.1|  PREDICTED: signal peptide peptidase-like 3 i...    243   2e-72    
ref|XP_010525681.1|  PREDICTED: signal peptide peptidase-like 3 i...    243   2e-72    
ref|XP_010508474.1|  PREDICTED: signal peptide peptidase-like 3         243   2e-72    
ref|XP_008811653.1|  PREDICTED: signal peptide peptidase-like 2         243   2e-72    
ref|XP_004515578.1|  PREDICTED: signal peptide peptidase-like 2-like    243   3e-72    
ref|XP_006349892.1|  PREDICTED: signal peptide peptidase-like 5-like    242   5e-72    
ref|XP_004252973.1|  PREDICTED: signal peptide peptidase-like 5         242   5e-72    
ref|XP_009791643.1|  PREDICTED: signal peptide peptidase-like 5         240   2e-71    
ref|XP_010506164.1|  PREDICTED: signal peptide peptidase-like 3         241   2e-71    
ref|XP_008222677.1|  PREDICTED: signal peptide peptidase-like 3         240   3e-71    
ref|XP_007222318.1|  hypothetical protein PRUPE_ppa003955mg             240   3e-71    
ref|XP_004497418.1|  PREDICTED: signal peptide peptidase-like 5-l...    239   4e-71    
gb|KEH21454.1|  signal peptide peptidase-like protein                   238   5e-71    
ref|XP_002529686.1|  Minor histocompatibility antigen H13, putative     238   1e-70    
emb|CDY55505.1|  BnaA05g34420D                                          243   1e-70    
gb|KFK42916.1|  hypothetical protein AALP_AA1G054900                    238   2e-70    
gb|KJB41342.1|  hypothetical protein B456_007G099700                    234   7e-70    
emb|CDY63797.1|  BnaA08g31760D                                          236   9e-70    
ref|XP_002889569.1|  hypothetical protein ARALYDRAFT_887775             236   1e-69    
emb|CDX86551.1|  BnaC08g01520D                                          236   1e-69    
ref|NP_172073.2|  signal peptide peptidase-like 5                       235   2e-69    
ref|XP_006303960.1|  hypothetical protein CARUB_v10008828mg             235   2e-69    
ref|XP_006417984.1|  hypothetical protein EUTSA_v10007296mg             234   8e-69    
gb|KDO86181.1|  hypothetical protein CISIN_1g009437mg                   231   2e-68    
ref|XP_010485342.1|  PREDICTED: signal peptide peptidase-like 5         232   2e-68    
ref|XP_009111026.1|  PREDICTED: signal peptide peptidase-like 5 i...    232   3e-68    
ref|XP_009111025.1|  PREDICTED: signal peptide peptidase-like 5 i...    232   3e-68    
ref|XP_008800996.1|  PREDICTED: signal peptide peptidase-like 2 i...    233   3e-68    
ref|XP_008800995.1|  PREDICTED: signal peptide peptidase-like 2 i...    232   6e-68    
ref|XP_010457682.1|  PREDICTED: signal peptide peptidase-like 5         229   2e-67    
gb|ABK20980.1|  unknown                                                 217   3e-67    
ref|XP_010678201.1|  PREDICTED: signal peptide peptidase-like 3 i...    224   2e-66    
ref|XP_006439530.1|  hypothetical protein CICLE_v10019598mg             221   8e-66    
ref|XP_009339895.1|  PREDICTED: signal peptide peptidase-like 5 i...    225   2e-65    
ref|XP_010678199.1|  PREDICTED: signal peptide peptidase-like 3 i...    224   2e-65    
ref|XP_009339896.1|  PREDICTED: signal peptide peptidase-like 5 i...    225   2e-65    
ref|NP_001117235.1|  signal peptide peptidase-like 5                    223   4e-65    
ref|XP_008387696.1|  PREDICTED: signal peptide peptidase-like 5         224   5e-65    
gb|KDO76241.1|  hypothetical protein CISIN_1g009071mg                   221   5e-65    
gb|KDO76242.1|  hypothetical protein CISIN_1g009071mg                   221   8e-65    
ref|XP_006439531.1|  hypothetical protein CICLE_v10019598mg             221   1e-64    
gb|KEH23366.1|  signal peptide peptidase-like protein                   220   2e-64    
gb|EMT00604.1|  Signal peptide peptidase-like 2B                        219   5e-64    
ref|XP_010457100.1|  PREDICTED: signal peptide peptidase-like 4         204   2e-62    
ref|XP_007033980.1|  Signal peptide peptidase-like 3 isoform 3          211   5e-62    
gb|EEC72022.1|  hypothetical protein OsI_04902                          213   3e-61    
ref|NP_001045182.1|  Os01g0914700                                       213   3e-61    
ref|XP_003564908.1|  PREDICTED: signal peptide peptidase-like 3         213   4e-61    
gb|EPS63416.1|  hypothetical protein M569_11364                         204   1e-58    
gb|EPS71504.1|  hypothetical protein M569_03259                         194   2e-58    
ref|XP_010107210.1|  Signal peptide peptidase-like 2B                   206   7e-58    
gb|AAM14939.1|  unknown protein                                         203   3e-57    
gb|EMT32145.1|  Signal peptide peptidase-like 2B                        199   3e-57    
ref|XP_006645218.1|  PREDICTED: signal peptide peptidase-like 3-like    201   9e-57    
tpg|DAA56169.1|  TPA: hypothetical protein ZEAMMB73_340711              201   1e-56    
dbj|BAK06733.1|  predicted protein                                      201   1e-56    
gb|KDO50534.1|  hypothetical protein CISIN_1g009527mg                   199   7e-56    
emb|CDM85611.1|  unnamed protein product                                198   1e-55    
ref|XP_004971032.1|  PREDICTED: signal peptide peptidase-like 3-like    198   2e-55    
emb|CDY30380.1|  BnaA04g24810D                                          187   6e-52    
ref|XP_010678200.1|  PREDICTED: signal peptide peptidase-like 3 i...    181   3e-49    
gb|KEH21453.1|  signal peptide peptidase-like protein                   177   3e-48    
gb|KHG19074.1|  Signal peptide peptidase-like 2B                        175   6e-48    
ref|XP_006443145.1|  hypothetical protein CICLE_v10019670mg             176   1e-47    
gb|KEH21455.1|  signal peptide peptidase-like protein                   173   1e-46    
ref|XP_006589800.1|  PREDICTED: signal peptide peptidase-like 5-l...    169   3e-45    
ref|XP_010245343.1|  PREDICTED: signal peptide peptidase-like 2 i...    168   9e-45    
ref|XP_002456828.1|  hypothetical protein SORBIDRAFT_03g043640          168   2e-44    
ref|NP_001136880.1|  uncharacterized protein LOC100217036               158   3e-44    
ref|XP_004497419.1|  PREDICTED: signal peptide peptidase-like 5-l...    165   1e-43    
gb|EPS62800.1|  hypothetical protein M569_11991                         144   4e-39    
emb|CEF97502.1|  Peptidase A22B, signal peptide peptidase               150   5e-38    
ref|XP_001417194.1|  predicted protein                                  150   1e-37    
ref|XP_011670258.1|  PREDICTED: signal peptide peptidase-like 2B ...    149   1e-37    
ref|XP_010787671.1|  PREDICTED: signal peptide peptidase-like 2B        148   3e-37    
gb|ELT89507.1|  hypothetical protein CAPTEDRAFT_108818                  147   3e-37    
ref|XP_011670260.1|  PREDICTED: signal peptide peptidase-like 2B ...    147   4e-37    
gb|AGW24468.1|  signal peptide peptidase-like 2B                        136   1e-36    
ref|XP_007563874.1|  PREDICTED: signal peptide peptidase-like 2B ...    147   1e-36    
ref|XP_007563875.1|  PREDICTED: signal peptide peptidase-like 2B ...    146   1e-36    
ref|XP_010738292.1|  PREDICTED: signal peptide peptidase-like 2B        146   1e-36    
ref|NP_001072874.1|  signal peptide peptidase like 2B precursor         146   2e-36    
ref|XP_008432669.1|  PREDICTED: signal peptide peptidase-like 2B ...    145   2e-36    
ref|XP_004079509.1|  PREDICTED: signal peptide peptidase-like 2B ...    146   2e-36    
ref|XP_008432668.1|  PREDICTED: signal peptide peptidase-like 2B ...    145   2e-36    
ref|XP_005806333.1|  PREDICTED: signal peptide peptidase-like 2B-...    145   2e-36    
ref|XP_005806332.1|  PREDICTED: signal peptide peptidase-like 2B-...    145   3e-36    
ref|XP_011485391.1|  PREDICTED: signal peptide peptidase-like 2B ...    145   4e-36    
gb|EWM23412.1|  signal peptide peptidase- aspartyl protease family      146   6e-36    
ref|XP_001690418.1|  signal peptide peptidase-like protein              144   9e-36    
ref|XP_003975431.1|  PREDICTED: signal peptide peptidase-like 2B        144   9e-36    
ref|XP_008274016.1|  PREDICTED: signal peptide peptidase-like 2B        144   1e-35    
ref|XP_009524232.1|  hypothetical protein PHYSODRAFT_492490             144   1e-35    
ref|NP_001079884.1|  signal peptide peptidase like 2B                   144   1e-35    
ref|XP_006639908.1|  PREDICTED: signal peptide peptidase-like 2B-...    143   2e-35    
gb|KFM81224.1|  Signal peptide peptidase-like 2B                        143   2e-35    
emb|CBJ48823.1|  putative growth-on protein GRO10                       144   2e-35    
ref|XP_011422205.1|  PREDICTED: signal peptide peptidase-like 2B        139   3e-35    
gb|EDL89213.1|  similar to SPPL2b; presenilin-like protein 1, iso...    141   3e-35    
ref|XP_002165994.2|  PREDICTED: signal peptide peptidase-like 2B-...    142   3e-35    
gb|ETK87173.1|  hypothetical protein L915_08341                         143   4e-35    
ref|XP_008905303.1|  hypothetical protein PPTG_11861                    143   4e-35    
gb|ETL40594.1|  hypothetical protein L916_08267                         143   4e-35    
gb|ETI47204.1|  hypothetical protein F443_08503                         143   4e-35    
gb|ETL93740.1|  hypothetical protein L917_08168                         143   4e-35    
ref|XP_007236385.1|  PREDICTED: signal peptide peptidase-like 2B-...    142   7e-35    
ref|XP_006125593.1|  PREDICTED: signal peptide peptidase-like 2B ...    141   8e-35    
ref|XP_002131263.1|  PREDICTED: signal peptide peptidase-like 2B        141   8e-35    
ref|XP_007236386.1|  PREDICTED: signal peptide peptidase-like 2B-...    141   9e-35    
ref|XP_005494302.1|  PREDICTED: signal peptide peptidase-like 2B        141   1e-34    
ref|XP_008763337.1|  PREDICTED: signal peptide peptidase-like 2B ...    141   1e-34    
gb|ETO75923.1|  hypothetical protein F444_08569                         142   1e-34    
ref|XP_008763336.1|  PREDICTED: signal peptide peptidase-like 2B ...    141   1e-34    
ref|XP_006241010.1|  PREDICTED: signal peptide peptidase-like 2B ...    141   1e-34    
ref|XP_006241009.1|  PREDICTED: signal peptide peptidase-like 2B ...    141   1e-34    
ref|XP_005309364.1|  PREDICTED: signal peptide peptidase-like 2B ...    141   1e-34    
ref|XP_002952739.1|  hypothetical protein VOLCADRAFT_93422              143   1e-34    
ref|XP_006241014.1|  PREDICTED: signal peptide peptidase-like 2B ...    140   1e-34    
ref|XP_005359078.1|  PREDICTED: signal peptide peptidase-like 2B ...    141   1e-34    
ref|XP_008149030.1|  PREDICTED: signal peptide peptidase-like 2B        140   2e-34    
gb|ETP45080.1|  hypothetical protein F442_08445                         142   2e-34    
ref|NP_001014222.1|  signal peptide peptidase-like 2B precursor         140   2e-34    
ref|XP_009695726.1|  PREDICTED: signal peptide peptidase-like 2B        140   2e-34    
gb|KCW78080.1|  hypothetical protein EUGRSUZ_D02301                     139   2e-34    
dbj|BAC32878.1|  unnamed protein product                                138   2e-34    
ref|XP_005083466.1|  PREDICTED: signal peptide peptidase-like 2B        139   3e-34    
ref|NP_001038709.1|  signal peptide peptidase-like 2B isoform 2 p...    140   3e-34    
ref|XP_009095058.1|  PREDICTED: signal peptide peptidase-like 2B        140   3e-34    
ref|XP_006754162.1|  PREDICTED: signal peptide peptidase-like 2B ...    140   3e-34    
ref|XP_010889559.1|  PREDICTED: signal peptide peptidase-like 2B ...    139   3e-34    
ref|NP_001015067.1|  signal peptide peptidase-like 2B isoform 1 p...    139   3e-34    
gb|ELK37500.1|  Signal peptide peptidase-like 2B                        139   3e-34    
ref|XP_006754164.1|  PREDICTED: signal peptide peptidase-like 2B ...    139   4e-34    
ref|XP_006101215.1|  PREDICTED: signal peptide peptidase-like 2B ...    140   4e-34    
ref|XP_006754166.1|  PREDICTED: signal peptide peptidase-like 2B ...    139   4e-34    
ref|XP_008922502.1|  PREDICTED: signal peptide peptidase-like 2B        139   4e-34    
ref|XP_005060034.1|  PREDICTED: signal peptide peptidase-like 2B        140   4e-34    
ref|XP_006101214.1|  PREDICTED: signal peptide peptidase-like 2B ...    140   4e-34    
ref|XP_006101216.1|  PREDICTED: signal peptide peptidase-like 2B ...    139   4e-34    
ref|XP_006101219.1|  PREDICTED: signal peptide peptidase-like 2B ...    139   4e-34    
gb|EGV99543.1|  Signal peptide peptidase-like 2B                        138   4e-34    
ref|XP_005359079.1|  PREDICTED: signal peptide peptidase-like 2B ...    139   4e-34    
ref|XP_005309365.1|  PREDICTED: signal peptide peptidase-like 2B ...    139   5e-34    
ref|XP_007059693.1|  PREDICTED: signal peptide peptidase-like 2B        139   5e-34    
ref|XP_001633099.1|  predicted protein                                  139   5e-34    
gb|KFW81226.1|  Signal peptide peptidase-like 2B                        139   5e-34    
ref|XP_010173226.1|  PREDICTED: signal peptide peptidase-like 2B        139   5e-34    
gb|EDL31477.1|  RIKEN cDNA 3110056O03, isoform CRA_b                    138   5e-34    
ref|XP_010154939.1|  PREDICTED: signal peptide peptidase-like 2B        138   6e-34    
ref|XP_005427414.1|  PREDICTED: signal peptide peptidase-like 2B        139   6e-34    
ref|XP_005858893.1|  PREDICTED: signal peptide peptidase-like 2B-...    139   6e-34    
ref|XP_010889580.1|  PREDICTED: signal peptide peptidase-like 2B ...    139   6e-34    
ref|XP_006125594.1|  PREDICTED: signal peptide peptidase-like 2B ...    139   6e-34    
gb|KFQ33903.1|  Signal peptide peptidase-like 2B                        139   6e-34    
ref|XP_010020970.1|  PREDICTED: signal peptide peptidase-like 2B        139   6e-34    
gb|KFW09842.1|  Signal peptide peptidase-like 2B                        138   6e-34    
ref|XP_010633181.1|  PREDICTED: signal peptide peptidase-like 2B ...    139   7e-34    
ref|XP_010633180.1|  PREDICTED: signal peptide peptidase-like 2B ...    139   8e-34    
ref|XP_004688965.1|  PREDICTED: signal peptide peptidase-like 2B        138   8e-34    
ref|XP_006514273.1|  PREDICTED: signal peptide peptidase-like 2B ...    139   8e-34    
ref|XP_006514277.1|  PREDICTED: signal peptide peptidase-like 2B ...    138   9e-34    
ref|XP_010409756.1|  PREDICTED: signal peptide peptidase-like 2B ...    139   9e-34    
ref|XP_007614902.1|  PREDICTED: LOW QUALITY PROTEIN: signal pepti...    139   9e-34    
gb|KFO53582.1|  Signal peptide peptidase-like 2B                        139   9e-34    
ref|XP_008637984.1|  PREDICTED: signal peptide peptidase-like 2B        139   9e-34    
ref|XP_002189519.1|  PREDICTED: signal peptide peptidase-like 2B        139   1e-33    
ref|XP_005405961.1|  PREDICTED: signal peptide peptidase-like 2B ...    139   1e-33    
ref|XP_007641421.1|  PREDICTED: signal peptide peptidase-like 2B ...    138   1e-33    
ref|XP_007641424.1|  PREDICTED: signal peptide peptidase-like 2B ...    138   1e-33    
ref|XP_005405960.1|  PREDICTED: signal peptide peptidase-like 2B ...    138   1e-33    
dbj|BAE38734.1|  unnamed protein product                                138   1e-33    
ref|XP_005531425.1|  PREDICTED: signal peptide peptidase-like 2B        138   1e-33    
gb|KFW66375.1|  Signal peptide peptidase-like 2B                        138   1e-33    
ref|XP_006036788.1|  PREDICTED: signal peptide peptidase-like 2B        138   1e-33    
ref|XP_005949263.1|  PREDICTED: signal peptide peptidase-like 2A-...    138   1e-33    
ref|XP_009681922.1|  PREDICTED: signal peptide peptidase-like 2B ...    138   1e-33    
gb|AAH52094.1|  Similar to SPPL2b                                       137   1e-33    
ref|NP_780404.2|  signal peptide peptidase-like 2B precursor            138   1e-33    
ref|XP_006514272.1|  PREDICTED: signal peptide peptidase-like 2B ...    138   1e-33    
ref|XP_009474961.1|  PREDICTED: signal peptide peptidase-like 2B        138   1e-33    
gb|KFV73986.1|  Signal peptide peptidase-like 2B                        138   1e-33    
ref|XP_006514275.1|  PREDICTED: signal peptide peptidase-like 2B ...    137   1e-33    
ref|XP_002902661.1|  signal peptide peptidase-like, aspartyl prot...    139   1e-33    
ref|XP_006514276.1|  PREDICTED: signal peptide peptidase-like 2B ...    137   2e-33    
ref|XP_009637182.1|  PREDICTED: signal peptide peptidase-like 2B        138   2e-33    
ref|XP_006904133.1|  PREDICTED: signal peptide peptidase-like 2B ...    137   2e-33    
ref|XP_009681914.1|  PREDICTED: signal peptide peptidase-like 2B ...    138   2e-33    
ref|XP_005476649.1|  PREDICTED: signal peptide peptidase-like 2B-...    137   2e-33    
gb|KFQ92721.1|  Signal peptide peptidase-like 2B                        138   2e-33    
gb|KFP16034.1|  Signal peptide peptidase-like 2B                        138   2e-33    
ref|XP_004555399.1|  PREDICTED: signal peptide peptidase-like 2B-...    137   2e-33    
ref|XP_005729194.1|  PREDICTED: signal peptide peptidase-like 2B-...    137   2e-33    
ref|XP_010193478.1|  PREDICTED: signal peptide peptidase-like 2B        137   2e-33    
ref|XP_010140476.1|  PREDICTED: signal peptide peptidase-like 2B        137   2e-33    
gb|KGL74881.1|  Signal peptide peptidase-like 2B                        137   2e-33    
gb|EOB04250.1|  Signal peptide peptidase-like 2B                        137   2e-33    
ref|XP_010073526.1|  PREDICTED: signal peptide peptidase-like 2B        136   2e-33    
ref|XP_005235066.1|  PREDICTED: signal peptide peptidase-like 2B        137   2e-33    
ref|XP_009484620.1|  PREDICTED: signal peptide peptidase-like 2B        137   2e-33    
gb|KFO80695.1|  Signal peptide peptidase-like 2B                        137   2e-33    
gb|KFQ62959.1|  Signal peptide peptidase-like 2B                        137   2e-33    
gb|KFM01381.1|  Signal peptide peptidase-like 2B                        137   2e-33    
ref|XP_007641423.1|  PREDICTED: signal peptide peptidase-like 2B ...    137   2e-33    
ref|XP_006259428.1|  PREDICTED: signal peptide peptidase-like 2B ...    137   2e-33    
ref|XP_005015677.1|  PREDICTED: signal peptide peptidase-like 2B        137   3e-33    
gb|KFQ12064.1|  Signal peptide peptidase-like 2B                        137   3e-33    
ref|XP_009950116.1|  PREDICTED: signal peptide peptidase-like 2B        137   3e-33    
ref|XP_010306607.1|  PREDICTED: signal peptide peptidase-like 2B        137   3e-33    



>gb|KJB41341.1| hypothetical protein B456_007G099700 [Gossypium raimondii]
Length=318

 Score =   388 bits (997),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 185/208 (89%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYRR+S A IGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYD+FWV
Sbjct  108  FCITFAVVWAVYRRISFAWIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDIFWV  167

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPR++DPWGGYSVIGFGDIILPGLLVAFS
Sbjct  168  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRIYDPWGGYSVIGFGDIILPGLLVAFS  227

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+KK+LR GYF+WAM AYGLGLL+TY+ALNLMDGHGQPALLYIVPF LGTF+TLG
Sbjct  228  LRYDWLTKKTLRAGYFIWAMTAYGLGLLVTYVALNLMDGHGQPALLYIVPFILGTFITLG  287

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD  208
            KKRGDLK LWT+G+P+RPCPHVQLQP +
Sbjct  288  KKRGDLKTLWTRGEPERPCPHVQLQPLE  315



>gb|KJB41339.1| hypothetical protein B456_007G099700 [Gossypium raimondii]
 gb|KJB41344.1| hypothetical protein B456_007G099700 [Gossypium raimondii]
Length=424

 Score =   392 bits (1006),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 185/208 (89%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYRR+S A IGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYD+FWV
Sbjct  214  FCITFAVVWAVYRRISFAWIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDIFWV  273

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPR++DPWGGYSVIGFGDIILPGLLVAFS
Sbjct  274  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRIYDPWGGYSVIGFGDIILPGLLVAFS  333

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+KK+LR GYF+WAM AYGLGLL+TY+ALNLMDGHGQPALLYIVPF LGTF+TLG
Sbjct  334  LRYDWLTKKTLRAGYFIWAMTAYGLGLLVTYVALNLMDGHGQPALLYIVPFILGTFITLG  393

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD  208
            KKRGDLK LWT+G+P+RPCPHVQLQP +
Sbjct  394  KKRGDLKTLWTRGEPERPCPHVQLQPLE  421



>gb|KJB41340.1| hypothetical protein B456_007G099700 [Gossypium raimondii]
Length=380

 Score =   390 bits (1001),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 185/208 (89%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYRR+S A IGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYD+FWV
Sbjct  170  FCITFAVVWAVYRRISFAWIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDIFWV  229

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPR++DPWGGYSVIGFGDIILPGLLVAFS
Sbjct  230  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRIYDPWGGYSVIGFGDIILPGLLVAFS  289

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+KK+LR GYF+WAM AYGLGLL+TY+ALNLMDGHGQPALLYIVPF LGTF+TLG
Sbjct  290  LRYDWLTKKTLRAGYFIWAMTAYGLGLLVTYVALNLMDGHGQPALLYIVPFILGTFITLG  349

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD  208
            KKRGDLK LWT+G+P+RPCPHVQLQP +
Sbjct  350  KKRGDLKTLWTRGEPERPCPHVQLQPLE  377



>gb|KJB09813.1| hypothetical protein B456_001G169100 [Gossypium raimondii]
 gb|KJB09814.1| hypothetical protein B456_001G169100 [Gossypium raimondii]
Length=538

 Score =   392 bits (1007),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 185/208 (89%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYRR+S A IGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYD+FWV
Sbjct  328  FCITFAVVWAVYRRISFAWIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDIFWV  387

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKWWFHESVMIVVARGDKSGEDGIP+LLKIPRMFDPWGGYSVIGFGDIILPGL+VAFS
Sbjct  388  FVSKWWFHESVMIVVARGDKSGEDGIPVLLKIPRMFDPWGGYSVIGFGDIILPGLIVAFS  447

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDW++KKSLR GYF+WAM AYGLGLL+TY+ALNLMDGHGQPALLYIVPFTLGT +TLG
Sbjct  448  LRYDWMTKKSLRAGYFVWAMTAYGLGLLVTYVALNLMDGHGQPALLYIVPFTLGTLITLG  507

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD  208
            KKRGDLK LWT+G+P+RPCPHVQLQP +
Sbjct  508  KKRGDLKTLWTRGEPERPCPHVQLQPLE  535



>ref|XP_007051789.1| Signal peptide peptidase-like 4 [Theobroma cacao]
 gb|EOX95946.1| Signal peptide peptidase-like 4 [Theobroma cacao]
Length=538

 Score =   392 bits (1007),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 184/206 (89%), Positives = 200/206 (97%), Gaps = 0/206 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYRR+S A IGQDILGIALIITVLQ+VR+PNLKVGTVLLGCAFLYD+FWV
Sbjct  329  FCIAFAVVWAVYRRISFAWIGQDILGIALIITVLQVVRIPNLKVGTVLLGCAFLYDIFWV  388

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS
Sbjct  389  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  448

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+KK+LR GYF+WAM AYG+GLL+TY+ALN+MDGHGQPALLYIVPFTLGTF+TLG
Sbjct  449  LRYDWLAKKNLRAGYFVWAMTAYGVGLLVTYVALNMMDGHGQPALLYIVPFTLGTFITLG  508

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQP  214
            KKRGDLK LWT+G+P+RPCPHVQLQP
Sbjct  509  KKRGDLKILWTRGEPERPCPHVQLQP  534



>gb|KHG19371.1| Signal peptide peptidase-like 2B [Gossypium arboreum]
Length=536

 Score =   392 bits (1006),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 185/208 (89%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYRR+S A IGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYD+FWV
Sbjct  326  FCITFAVVWAVYRRISFAWIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDIFWV  385

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGL+VAFS
Sbjct  386  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLVVAFS  445

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDW++KKS+R GYF+WAM AYGLGLL+TY+ALNLMDGHGQPALLYIVPFTLGT +TLG
Sbjct  446  LRYDWMTKKSVRAGYFVWAMTAYGLGLLVTYVALNLMDGHGQPALLYIVPFTLGTLITLG  505

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD  208
            KKRGDLK LWT+G+P+RPCPHVQLQP +
Sbjct  506  KKRGDLKTLWTRGEPERPCPHVQLQPLE  533



>gb|KJB41338.1| hypothetical protein B456_007G099700 [Gossypium raimondii]
Length=538

 Score =   391 bits (1004),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 185/208 (89%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYRR+S A IGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYD+FWV
Sbjct  328  FCITFAVVWAVYRRISFAWIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDIFWV  387

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPR++DPWGGYSVIGFGDIILPGLLVAFS
Sbjct  388  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRIYDPWGGYSVIGFGDIILPGLLVAFS  447

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+KK+LR GYF+WAM AYGLGLL+TY+ALNLMDGHGQPALLYIVPF LGTF+TLG
Sbjct  448  LRYDWLTKKTLRAGYFIWAMTAYGLGLLVTYVALNLMDGHGQPALLYIVPFILGTFITLG  507

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD  208
            KKRGDLK LWT+G+P+RPCPHVQLQP +
Sbjct  508  KKRGDLKTLWTRGEPERPCPHVQLQPLE  535



>ref|XP_011092489.1| PREDICTED: signal peptide peptidase-like 4 isoform X2 [Sesamum 
indicum]
Length=480

 Score =   387 bits (994),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 185/208 (89%), Positives = 197/208 (95%), Gaps = 0/208 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAV+R V+ A IGQDILGIALIITVLQIVRVPNLKVGTVLL CAFLYD+FWV
Sbjct  272  FCIAFAVLWAVFRSVNFAWIGQDILGIALIITVLQIVRVPNLKVGTVLLSCAFLYDIFWV  331

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKWWFH+SVMIVVARGD SGEDGIPMLLKIPRMFDPWGGYS+IGFGDIILPGLLVAFS
Sbjct  332  FVSKWWFHKSVMIVVARGDGSGEDGIPMLLKIPRMFDPWGGYSIIGFGDIILPGLLVAFS  391

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWLSKK L+ GYFLWAM+AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGT +TLG
Sbjct  392  LRYDWLSKKRLKEGYFLWAMLAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTLITLG  451

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD  208
            KKRGDLKHLWT+G+PDRPCPHVQLQ  D
Sbjct  452  KKRGDLKHLWTRGEPDRPCPHVQLQQDD  479



>emb|CDP08805.1| unnamed protein product [Coffea canephora]
Length=542

 Score =   389 bits (998),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 183/208 (88%), Positives = 199/208 (96%), Gaps = 0/208 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYRRVS A IGQDILGIALI+TVLQI+RVPNLKVGTVLL CAFLYD+FWV
Sbjct  335  FCIAFAVVWAVYRRVSFAWIGQDILGIALIVTVLQIIRVPNLKVGTVLLSCAFLYDIFWV  394

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKWWF ESVMIVVARGD+SGEDGIPMLLKIPRMFDPWGGYS+IGFGDIILPGLLVAFS
Sbjct  395  FVSKWWFKESVMIVVARGDRSGEDGIPMLLKIPRMFDPWGGYSIIGFGDIILPGLLVAFS  454

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWLSKK+LR GYFLWAM+AYGLGLLITY+ALN+MDGHGQPALLYIVPFTLGTFLTLG
Sbjct  455  LRYDWLSKKNLREGYFLWAMIAYGLGLLITYVALNMMDGHGQPALLYIVPFTLGTFLTLG  514

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD  208
            KKRGDLK+LWT+G+P+RPC HV+LQ  +
Sbjct  515  KKRGDLKNLWTRGEPERPCTHVELQQTE  542



>gb|KJB41343.1| hypothetical protein B456_007G099700 [Gossypium raimondii]
Length=538

 Score =   388 bits (996),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 183/208 (88%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYRR+S A IGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYD+FWV
Sbjct  328  FCITFAVVWAVYRRISFAWIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDIFWV  387

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKWWFHESVMIV  RGDKSGEDGIPMLLKIPR++DPWGGYSVIGFGDIILPGLLVAFS
Sbjct  388  FVSKWWFHESVMIVATRGDKSGEDGIPMLLKIPRIYDPWGGYSVIGFGDIILPGLLVAFS  447

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+KK+LR GYF+WAM AYGLGLL+TY+ALNLMDGHGQPALLYIVPF LGTF+TLG
Sbjct  448  LRYDWLTKKTLRAGYFIWAMTAYGLGLLVTYVALNLMDGHGQPALLYIVPFILGTFITLG  507

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD  208
            KKRGDLK LWT+G+P+RPCPHVQLQP +
Sbjct  508  KKRGDLKTLWTRGEPERPCPHVQLQPLE  535



>ref|XP_011092478.1| PREDICTED: signal peptide peptidase-like 4 isoform X1 [Sesamum 
indicum]
Length=540

 Score =   388 bits (996),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 185/208 (89%), Positives = 197/208 (95%), Gaps = 0/208 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAV+R V+ A IGQDILGIALIITVLQIVRVPNLKVGTVLL CAFLYD+FWV
Sbjct  332  FCIAFAVLWAVFRSVNFAWIGQDILGIALIITVLQIVRVPNLKVGTVLLSCAFLYDIFWV  391

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKWWFH+SVMIVVARGD SGEDGIPMLLKIPRMFDPWGGYS+IGFGDIILPGLLVAFS
Sbjct  392  FVSKWWFHKSVMIVVARGDGSGEDGIPMLLKIPRMFDPWGGYSIIGFGDIILPGLLVAFS  451

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWLSKK L+ GYFLWAM+AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGT +TLG
Sbjct  452  LRYDWLSKKRLKEGYFLWAMLAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTLITLG  511

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD  208
            KKRGDLKHLWT+G+PDRPCPHVQLQ  D
Sbjct  512  KKRGDLKHLWTRGEPDRPCPHVQLQQDD  539



>gb|KJB24747.1| hypothetical protein B456_004G158800 [Gossypium raimondii]
Length=468

 Score =   384 bits (987),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 182/206 (88%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYRR+S A IGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYD+FWV
Sbjct  258  FCIAFAVVWAVYRRISFAWIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDIFWV  317

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F SKW FHESVMIVVARGD+SGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS
Sbjct  318  FASKWLFHESVMIVVARGDRSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  377

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+  +LR GYF+WAM AYGLGLL+TY+ALNLMDGHGQPALLYIVPFTLGTF+TLG
Sbjct  378  LRYDWLANMNLRAGYFVWAMTAYGLGLLVTYVALNLMDGHGQPALLYIVPFTLGTFITLG  437

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQP  214
            KKRGDLK LWT+G+P+RPCPH+QLQP
Sbjct  438  KKRGDLKTLWTQGEPERPCPHLQLQP  463



>ref|XP_012083377.1| PREDICTED: signal peptide peptidase-like 4 isoform X2 [Jatropha 
curcas]
 ref|XP_012083378.1| PREDICTED: signal peptide peptidase-like 4 isoform X2 [Jatropha 
curcas]
Length=403

 Score =   381 bits (979),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 183/208 (88%), Positives = 196/208 (94%), Gaps = 0/208 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYRRVS A IGQDILGIALIITVLQIV VPNLKVGTVLL CAFLYD+FWV
Sbjct  189  FCIAFAVVWAVYRRVSFAWIGQDILGIALIITVLQIVHVPNLKVGTVLLSCAFLYDIFWV  248

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK WF ESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYS+IGFGDIILPGLLVAF+
Sbjct  249  FVSKLWFKESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSIIGFGDIILPGLLVAFA  308

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+KK+LR GYFLWAM AYGLGLLITY+ALN+MDGHGQPALLYIVPFTLGTFLTLG
Sbjct  309  LRYDWLTKKNLRAGYFLWAMTAYGLGLLITYVALNMMDGHGQPALLYIVPFTLGTFLTLG  368

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD  208
            KKRGDLK LWT+G+P+RPCPH+Q QP +
Sbjct  369  KKRGDLKALWTRGEPERPCPHIQFQPFE  396



>ref|XP_010255329.1| PREDICTED: signal peptide peptidase-like 4 [Nelumbo nucifera]
Length=538

 Score =   384 bits (987),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 183/208 (88%), Positives = 197/208 (95%), Gaps = 0/208 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYRR+S A IGQDILGIALIITVLQIVRVPNLKVGTVLL CAF+YD+FWV
Sbjct  331  FCIAFAVVWAVYRRISFAWIGQDILGIALIITVLQIVRVPNLKVGTVLLSCAFMYDIFWV  390

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK WFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYS+IGFGDI+LPGLL+AFS
Sbjct  391  FVSKKWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSIIGFGDILLPGLLIAFS  450

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+KK+LRTGYFLWAM+AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGTF TLG
Sbjct  451  LRYDWLAKKNLRTGYFLWAMVAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTFFTLG  510

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD  208
            KKRG+ K+LWT G+P RPCPHVQLQP  
Sbjct  511  KKRGEFKNLWTNGEPYRPCPHVQLQPTQ  538



>gb|KJB24744.1| hypothetical protein B456_004G158800 [Gossypium raimondii]
Length=537

 Score =   384 bits (985),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 182/206 (88%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYRR+S A IGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYD+FWV
Sbjct  327  FCIAFAVVWAVYRRISFAWIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDIFWV  386

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F SKW FHESVMIVVARGD+SGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS
Sbjct  387  FASKWLFHESVMIVVARGDRSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  446

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+  +LR GYF+WAM AYGLGLL+TY+ALNLMDGHGQPALLYIVPFTLGTF+TLG
Sbjct  447  LRYDWLANMNLRAGYFVWAMTAYGLGLLVTYVALNLMDGHGQPALLYIVPFTLGTFITLG  506

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQP  214
            KKRGDLK LWT+G+P+RPCPH+QLQP
Sbjct  507  KKRGDLKTLWTQGEPERPCPHLQLQP  532



>ref|XP_009340097.1| PREDICTED: signal peptide peptidase-like 4 [Pyrus x bretschneideri]
Length=537

 Score =   384 bits (985),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 182/208 (88%), Positives = 195/208 (94%), Gaps = 0/208 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYRR+S A IGQDILGIALIITVLQ+VR+PNLKVGTVLL CAFLYD+FWV
Sbjct  329  FCIAFAVLWAVYRRISFAWIGQDILGIALIITVLQLVRIPNLKVGTVLLSCAFLYDIFWV  388

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYS+IGFGDIILPGL+VAFS
Sbjct  389  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSIIGFGDIILPGLVVAFS  448

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ K LR GYFLWAM AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGTFLTLG
Sbjct  449  LRYDWLANKKLRAGYFLWAMTAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTFLTLG  508

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD  208
              RGDLK LWT+G+P+RPCPHV LQP+ 
Sbjct  509  HMRGDLKVLWTRGEPERPCPHVHLQPSS  536



>gb|KJB24746.1| hypothetical protein B456_004G158800 [Gossypium raimondii]
Length=535

 Score =   384 bits (985),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 182/206 (88%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYRR+S A IGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYD+FWV
Sbjct  325  FCIAFAVVWAVYRRISFAWIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDIFWV  384

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F SKW FHESVMIVVARGD+SGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS
Sbjct  385  FASKWLFHESVMIVVARGDRSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  444

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+  +LR GYF+WAM AYGLGLL+TY+ALNLMDGHGQPALLYIVPFTLGTF+TLG
Sbjct  445  LRYDWLANMNLRAGYFVWAMTAYGLGLLVTYVALNLMDGHGQPALLYIVPFTLGTFITLG  504

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQP  214
            KKRGDLK LWT+G+P+RPCPH+QLQP
Sbjct  505  KKRGDLKTLWTQGEPERPCPHLQLQP  530



>ref|XP_008458226.1| PREDICTED: signal peptide peptidase-like 4 [Cucumis melo]
Length=539

 Score =   384 bits (985),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 181/208 (87%), Positives = 195/208 (94%), Gaps = 0/208 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WA YR+ S A IGQDILGIALI+TVLQIVRVPNLKVGTVLL CAFLYD+FWV
Sbjct  330  FCISFAVLWACYRKKSFAWIGQDILGIALIVTVLQIVRVPNLKVGTVLLSCAFLYDIFWV  389

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYS+IGFGDIILPGLLVAFS
Sbjct  390  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSIIGFGDIILPGLLVAFS  449

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+KK LR GYF+WAM AYG GLLITY+ALNLMDGHGQPALLYIVPFTLGTFLTLG
Sbjct  450  LRYDWLAKKKLRAGYFVWAMTAYGTGLLITYVALNLMDGHGQPALLYIVPFTLGTFLTLG  509

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD  208
            K+R DLK LWT+G+P+RPCPH+QLQP+ 
Sbjct  510  KQRRDLKILWTRGEPERPCPHIQLQPSS  537



>ref|XP_011036451.1| PREDICTED: signal peptide peptidase-like 4 [Populus euphratica]
Length=538

 Score =   383 bits (984),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 183/206 (89%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAV+RRVS A IGQDILGIALIITVLQIVRVPNLKVGTVLL CAFLYD+FWV
Sbjct  329  FCIAFAVVWAVFRRVSFAWIGQDILGIALIITVLQIVRVPNLKVGTVLLSCAFLYDIFWV  388

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKWWF ESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYS+IGFGDIILPGLLVAFS
Sbjct  389  FVSKWWFKESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSIIGFGDIILPGLLVAFS  448

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+KK+LR GYFLWAM AYGLGLLITYLALN+MDGHGQPALLYIVPFTLGTFLTLG
Sbjct  449  LRYDWLAKKNLRAGYFLWAMTAYGLGLLITYLALNMMDGHGQPALLYIVPFTLGTFLTLG  508

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQP  214
            ++RGDLK LWT G+P+R CPH+Q QP
Sbjct  509  RQRGDLKTLWTMGEPERHCPHIQFQP  534



>ref|XP_002274726.1| PREDICTED: signal peptide peptidase-like 4 [Vitis vinifera]
 emb|CBI40384.3| unnamed protein product [Vitis vinifera]
Length=534

 Score =   383 bits (984),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 181/203 (89%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAV+RR++ A IGQDILGIALIITVLQIVRVPNLKVGTVLL CAFLYD+FWV
Sbjct  329  FCIAFAVVWAVFRRINFAWIGQDILGIALIITVLQIVRVPNLKVGTVLLSCAFLYDIFWV  388

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKWWF+ESVMIVVARGD+SGEDGIPMLLKIPRMFDPWGGYS+IGFGDIILPGLLVAFS
Sbjct  389  FVSKWWFNESVMIVVARGDRSGEDGIPMLLKIPRMFDPWGGYSIIGFGDIILPGLLVAFS  448

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+KKSLR GYF+WAM AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGTFL LG
Sbjct  449  LRYDWLAKKSLRAGYFVWAMTAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTFLALG  508

Query  291  KKRGDLKHLWTKGDPDRPCPHVQ  223
            KKRGDLK LWTKG+P+RPCPH+Q
Sbjct  509  KKRGDLKTLWTKGEPERPCPHIQ  531



>ref|XP_012083376.1| PREDICTED: signal peptide peptidase-like 4 isoform X1 [Jatropha 
curcas]
Length=542

 Score =   384 bits (985),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 183/206 (89%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYRRVS A IGQDILGIALIITVLQIV VPNLKVGTVLL CAFLYD+FWV
Sbjct  328  FCIAFAVVWAVYRRVSFAWIGQDILGIALIITVLQIVHVPNLKVGTVLLSCAFLYDIFWV  387

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK WF ESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYS+IGFGDIILPGLLVAF+
Sbjct  388  FVSKLWFKESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSIIGFGDIILPGLLVAFA  447

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+KK+LR GYFLWAM AYGLGLLITY+ALN+MDGHGQPALLYIVPFTLGTFLTLG
Sbjct  448  LRYDWLTKKNLRAGYFLWAMTAYGLGLLITYVALNMMDGHGQPALLYIVPFTLGTFLTLG  507

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQP  214
            KKRGDLK LWT+G+P+RPCPH+Q QP
Sbjct  508  KKRGDLKALWTRGEPERPCPHIQFQP  533



>ref|XP_004138500.1| PREDICTED: signal peptide peptidase-like 4 [Cucumis sativus]
 gb|KGN45662.1| hypothetical protein Csa_6G004530 [Cucumis sativus]
Length=539

 Score =   383 bits (984),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 181/208 (87%), Positives = 195/208 (94%), Gaps = 0/208 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WA YR+ S A IGQDILGIALI+TVLQIVRVPNLKVGTVLL CAFLYD+FWV
Sbjct  330  FCISFAVLWACYRKRSFAWIGQDILGIALIVTVLQIVRVPNLKVGTVLLSCAFLYDIFWV  389

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYS+IGFGDIILPGLLVAFS
Sbjct  390  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSIIGFGDIILPGLLVAFS  449

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+KK LR GYF+WAM AYG GLLITY+ALNLMDGHGQPALLYIVPFTLGTFLTLG
Sbjct  450  LRYDWLAKKKLRAGYFVWAMTAYGTGLLITYVALNLMDGHGQPALLYIVPFTLGTFLTLG  509

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD  208
            K+R DLK LWT+G+P+RPCPH+QLQP+ 
Sbjct  510  KQRRDLKILWTRGEPERPCPHIQLQPSS  537



>ref|XP_008340980.1| PREDICTED: signal peptide peptidase-like 4 isoform X2 [Malus 
domestica]
Length=537

 Score =   383 bits (983),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 182/206 (88%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYRR+S A IGQDILGIALIITVLQIVRVPNLKVGTVLL CAFLYD+FWV
Sbjct  327  FCIAFAVLWAVYRRISFAWIGQDILGIALIITVLQIVRVPNLKVGTVLLSCAFLYDIFWV  386

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYS+IGFGDIILPGL+VAFS
Sbjct  387  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSIIGFGDIILPGLVVAFS  446

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ K LR GYF+WAM AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGTF+TLG
Sbjct  447  LRYDWLANKKLRAGYFVWAMTAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTFITLG  506

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQP  214
              RGDLK LWT+G+P+RPCPHV LQP
Sbjct  507  HMRGDLKVLWTRGEPERPCPHVHLQP  532



>ref|XP_008340922.1| PREDICTED: signal peptide peptidase-like 4 isoform X1 [Malus 
domestica]
Length=539

 Score =   383 bits (983),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 182/206 (88%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYRR+S A IGQDILGIALIITVLQIVRVPNLKVGTVLL CAFLYD+FWV
Sbjct  329  FCIAFAVLWAVYRRISFAWIGQDILGIALIITVLQIVRVPNLKVGTVLLSCAFLYDIFWV  388

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYS+IGFGDIILPGL+VAFS
Sbjct  389  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSIIGFGDIILPGLVVAFS  448

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ K LR GYF+WAM AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGTF+TLG
Sbjct  449  LRYDWLANKKLRAGYFVWAMTAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTFITLG  508

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQP  214
              RGDLK LWT+G+P+RPCPHV LQP
Sbjct  509  HMRGDLKVLWTRGEPERPCPHVHLQP  534



>ref|XP_004306779.2| PREDICTED: signal peptide peptidase-like 4 [Fragaria vesca subsp. 
vesca]
Length=547

 Score =   383 bits (983),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 181/207 (87%), Positives = 197/207 (95%), Gaps = 0/207 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYRRVS A IGQDILGIALIITVLQI+RVPNLKVGTVLLGCAF YD+FWV
Sbjct  338  FCIAFAVVWAVYRRVSFAWIGQDILGIALIITVLQIIRVPNLKVGTVLLGCAFFYDIFWV  397

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYS+IGFGDIILPGL+VAFS
Sbjct  398  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSIIGFGDIILPGLVVAFS  457

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ K+LRTGYF+WAM AYG GLL+TY+ALNLMDGHGQPALLYIVPFTLGTFLTLG
Sbjct  458  LRYDWLTNKTLRTGYFVWAMTAYGAGLLVTYVALNLMDGHGQPALLYIVPFTLGTFLTLG  517

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPA  211
            + RGDLK LWT+G+P+RPCPHV+LQ +
Sbjct  518  QMRGDLKVLWTRGEPERPCPHVRLQSS  544



>gb|KDP28619.1| hypothetical protein JCGZ_14390 [Jatropha curcas]
Length=542

 Score =   382 bits (981),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 182/206 (88%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYRRVS A IGQDILGIALIITVLQIV VPNLKVGTVLL CAFLYD+FWV
Sbjct  328  FCIAFAVVWAVYRRVSFAWIGQDILGIALIITVLQIVHVPNLKVGTVLLSCAFLYDIFWV  387

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK WF ESVMIVV RGDKSGEDGIPMLLKIPRMFDPWGGYS+IGFGDIILPGLLVAF+
Sbjct  388  FVSKLWFKESVMIVVTRGDKSGEDGIPMLLKIPRMFDPWGGYSIIGFGDIILPGLLVAFA  447

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+KK+LR GYFLWAM AYGLGLLITY+ALN+MDGHGQPALLYIVPFTLGTFLTLG
Sbjct  448  LRYDWLTKKNLRAGYFLWAMTAYGLGLLITYVALNMMDGHGQPALLYIVPFTLGTFLTLG  507

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQP  214
            KKRGDLK LWT+G+P+RPCPH+Q QP
Sbjct  508  KKRGDLKALWTRGEPERPCPHIQFQP  533



>ref|XP_006375345.1| hypothetical protein POPTR_0014s08110g [Populus trichocarpa]
 gb|ERP53142.1| hypothetical protein POPTR_0014s08110g [Populus trichocarpa]
Length=539

 Score =   382 bits (980),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 182/206 (88%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAV+RRVS A IGQDILGI LIITVLQIVRVPNLKVGTVLL CAFLYD+FWV
Sbjct  329  FCIAFAVVWAVFRRVSFAWIGQDILGIVLIITVLQIVRVPNLKVGTVLLSCAFLYDIFWV  388

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKWWF ESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYS+IGFGDIILPGLLVAFS
Sbjct  389  FVSKWWFKESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSIIGFGDIILPGLLVAFS  448

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+KK+LR GYFLWAM AYGLGLLITYLALN+MDGHGQPALLYIVPFTLGTFLTLG
Sbjct  449  LRYDWLAKKNLRAGYFLWAMTAYGLGLLITYLALNMMDGHGQPALLYIVPFTLGTFLTLG  508

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQP  214
            ++RGDLK LWT G+P+R CPH+Q QP
Sbjct  509  RRRGDLKTLWTMGEPERHCPHIQFQP  534



>ref|XP_006445025.1| hypothetical protein CICLE_v10019661mg [Citrus clementina]
 ref|XP_006491110.1| PREDICTED: signal peptide peptidase-like 4-like [Citrus sinensis]
 gb|ESR58265.1| hypothetical protein CICLE_v10019661mg [Citrus clementina]
 gb|KDO86178.1| hypothetical protein CISIN_1g009437mg [Citrus sinensis]
Length=535

 Score =   381 bits (978),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 179/207 (86%), Positives = 197/207 (95%), Gaps = 0/207 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI F+V+WAVYRR+S A IGQDILGIAL+ITVLQIVRVPNLKVGTVLL CAFLYD+FWV
Sbjct  329  FCIAFSVVWAVYRRISFAWIGQDILGIALMITVLQIVRVPNLKVGTVLLSCAFLYDIFWV  388

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKWWFHESVMIVVARGD+SGEDGIPMLLKIPR+FDPWGGYSVIGFGDIILPGL+VAFS
Sbjct  389  FVSKWWFHESVMIVVARGDRSGEDGIPMLLKIPRLFDPWGGYSVIGFGDIILPGLIVAFS  448

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL KK+ R+GYF+WAM AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGTFLTLG
Sbjct  449  LRYDWLMKKNFRSGYFVWAMTAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTFLTLG  508

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPA  211
            KKRG+LK LWT+G+P+R CPH+QLQ +
Sbjct  509  KKRGELKTLWTRGEPERACPHIQLQSS  535



>ref|XP_010053720.1| PREDICTED: signal peptide peptidase-like 4 isoform X2 [Eucalyptus 
grandis]
Length=537

 Score =   381 bits (978),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 179/208 (86%), Positives = 197/208 (95%), Gaps = 0/208 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAV+RRVS A IGQDILGIALIITVLQI+R+PNLKVGTVLL CAFLYD+FWV
Sbjct  330  FCIAFAVLWAVFRRVSYAWIGQDILGIALIITVLQIIRLPNLKVGTVLLSCAFLYDIFWV  389

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPR+FDPWGGYS+IGFGDIILPGLLV FS
Sbjct  390  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRLFDPWGGYSIIGFGDIILPGLLVVFS  449

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYD L+KK +R GYFLWAM+AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGTFLTLG
Sbjct  450  LRYDMLAKKKIREGYFLWAMIAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTFLTLG  509

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD  208
            K+RGDL  LWT+G+P+RPCPH++LQP+ 
Sbjct  510  KQRGDLMTLWTRGEPERPCPHIRLQPSQ  537



>ref|XP_010053719.1| PREDICTED: signal peptide peptidase-like 4 isoform X1 [Eucalyptus 
grandis]
 gb|KCW78079.1| hypothetical protein EUGRSUZ_D02301 [Eucalyptus grandis]
Length=539

 Score =   381 bits (978),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 179/208 (86%), Positives = 197/208 (95%), Gaps = 0/208 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAV+RRVS A IGQDILGIALIITVLQI+R+PNLKVGTVLL CAFLYD+FWV
Sbjct  332  FCIAFAVLWAVFRRVSYAWIGQDILGIALIITVLQIIRLPNLKVGTVLLSCAFLYDIFWV  391

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPR+FDPWGGYS+IGFGDIILPGLLV FS
Sbjct  392  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRLFDPWGGYSIIGFGDIILPGLLVVFS  451

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYD L+KK +R GYFLWAM+AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGTFLTLG
Sbjct  452  LRYDMLAKKKIREGYFLWAMIAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTFLTLG  511

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD  208
            K+RGDL  LWT+G+P+RPCPH++LQP+ 
Sbjct  512  KQRGDLMTLWTRGEPERPCPHIRLQPSQ  539



>ref|XP_009367843.1| PREDICTED: signal peptide peptidase-like 4 isoform X1 [Pyrus 
x bretschneideri]
Length=539

 Score =   380 bits (977),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 181/206 (88%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYRR+S A IGQDILGIALIITVLQIVRVPNLKVGTVLL CAFLYD+FWV
Sbjct  329  FCIAFAVLWAVYRRISFAWIGQDILGIALIITVLQIVRVPNLKVGTVLLCCAFLYDIFWV  388

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYS+IGFGDIILPGL+VAFS
Sbjct  389  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSIIGFGDIILPGLVVAFS  448

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ K LR GYF+WAM AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGTF+TLG
Sbjct  449  LRYDWLANKKLRAGYFVWAMTAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTFITLG  508

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQP  214
              RGDLK LWT+G+P+RPCPHV L+P
Sbjct  509  HMRGDLKVLWTRGEPERPCPHVHLRP  534



>ref|XP_009367844.1| PREDICTED: signal peptide peptidase-like 4 isoform X2 [Pyrus 
x bretschneideri]
Length=537

 Score =   380 bits (976),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 181/206 (88%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYRR+S A IGQDILGIALIITVLQIVRVPNLKVGTVLL CAFLYD+FWV
Sbjct  327  FCIAFAVLWAVYRRISFAWIGQDILGIALIITVLQIVRVPNLKVGTVLLCCAFLYDIFWV  386

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYS+IGFGDIILPGL+VAFS
Sbjct  387  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSIIGFGDIILPGLVVAFS  446

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ K LR GYF+WAM AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGTF+TLG
Sbjct  447  LRYDWLANKKLRAGYFVWAMTAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTFITLG  506

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQP  214
              RGDLK LWT+G+P+RPCPHV L+P
Sbjct  507  HMRGDLKVLWTRGEPERPCPHVHLRP  532



>ref|XP_007219545.1| hypothetical protein PRUPE_ppa003988mg [Prunus persica]
 gb|EMJ20744.1| hypothetical protein PRUPE_ppa003988mg [Prunus persica]
Length=536

 Score =   379 bits (974),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 179/208 (86%), Positives = 194/208 (93%), Gaps = 0/208 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYRRVS A IGQDILGIALIITVLQIVRVPNLKVGT+LL CAFLYD+FWV
Sbjct  329  FCIAFAVVWAVYRRVSFAWIGQDILGIALIITVLQIVRVPNLKVGTILLSCAFLYDIFWV  388

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPR+FDPWGGYS+IGFGDII+PGL+VAFS
Sbjct  389  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRLFDPWGGYSIIGFGDIIIPGLVVAFS  448

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ K LR GYF+WAM AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGT LTL 
Sbjct  449  LRYDWLANKKLRAGYFVWAMTAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTLLTLA  508

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD  208
            + RGDLK LWT+G+P+RPCPHV LQP+ 
Sbjct  509  QMRGDLKVLWTRGEPERPCPHVHLQPSQ  536



>ref|XP_007139836.1| hypothetical protein PHAVU_008G062100g [Phaseolus vulgaris]
 gb|ESW11830.1| hypothetical protein PHAVU_008G062100g [Phaseolus vulgaris]
Length=399

 Score =   374 bits (961),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 178/203 (88%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCIVFAV+W VYR VS A +GQDILGI LIITVLQIVR+PNLKVGTVLL CAFLYD+FWV
Sbjct  190  FCIVFAVLWGVYRHVSFAWVGQDILGITLIITVLQIVRIPNLKVGTVLLSCAFLYDIFWV  249

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPR+FDPWGGYS+IGFGDIILPGLLVAFS
Sbjct  250  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRLFDPWGGYSIIGFGDIILPGLLVAFS  309

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+KK+LR GYFLWAM AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGTFL+LG
Sbjct  310  LRYDWLAKKNLRDGYFLWAMTAYGLGLLITYMALNLMDGHGQPALLYIVPFTLGTFLSLG  369

Query  291  KKRGDLKHLWTKGDPDRPCPHVQ  223
            KKRG+LK LWT+G+P  PCPH+Q
Sbjct  370  KKRGELKVLWTRGEPKIPCPHIQ  392



>ref|XP_008232889.1| PREDICTED: signal peptide peptidase-like 4 [Prunus mume]
Length=535

 Score =   378 bits (971),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 179/208 (86%), Positives = 194/208 (93%), Gaps = 0/208 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYRRVS A IGQDILGIALIITVLQIVRVPNLKVGT+LL CAFLYD+FWV
Sbjct  328  FCIAFAVVWAVYRRVSFAWIGQDILGIALIITVLQIVRVPNLKVGTILLSCAFLYDIFWV  387

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPR+FDPWGGYS+IGFGDII+PGL+VAFS
Sbjct  388  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRLFDPWGGYSIIGFGDIIIPGLVVAFS  447

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ K LR GYF+WAM AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGT LTL 
Sbjct  448  LRYDWLANKKLRAGYFVWAMTAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTLLTLA  507

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD  208
            + RGDLK LWT+G+P+RPCPHV LQP+ 
Sbjct  508  QMRGDLKVLWTRGEPERPCPHVHLQPSQ  535



>ref|XP_003552398.1| PREDICTED: signal peptide peptidase-like 4-like [Glycine max]
Length=539

 Score =   379 bits (972),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 180/203 (89%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCIVFAV+W VYRRVS A IGQDILGI LIITVLQIVR+PNLKVGTVLL CAFLYD+FWV
Sbjct  330  FCIVFAVLWGVYRRVSFAWIGQDILGITLIITVLQIVRIPNLKVGTVLLSCAFLYDIFWV  389

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKWWFHESVMIVVARGD+SGEDGIPMLLKIPRMFDPWGGYS+IGFGDIILPGLLVAFS
Sbjct  390  FVSKWWFHESVMIVVARGDRSGEDGIPMLLKIPRMFDPWGGYSIIGFGDIILPGLLVAFS  449

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+KK+LR GYFLWAM AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGTFL+LG
Sbjct  450  LRYDWLAKKNLRDGYFLWAMTAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTFLSLG  509

Query  291  KKRGDLKHLWTKGDPDRPCPHVQ  223
            KKRG+LK LWT+G+P  PCPH+Q
Sbjct  510  KKRGELKVLWTRGEPKIPCPHIQ  532



>gb|KHM99370.1| Signal peptide peptidase-like 2B [Glycine soja]
Length=539

 Score =   378 bits (971),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 180/203 (89%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCIVFAV+W VYRRVS A IGQDILGI LIITVLQIVR+PNLKVGTVLL CAFLYD+FWV
Sbjct  330  FCIVFAVLWGVYRRVSFAWIGQDILGITLIITVLQIVRIPNLKVGTVLLSCAFLYDIFWV  389

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKWWFHESVMIVVARGD+SGEDGIPMLLKIPRMFDPWGGYS+IGFGDIILPGLLVAFS
Sbjct  390  FVSKWWFHESVMIVVARGDRSGEDGIPMLLKIPRMFDPWGGYSIIGFGDIILPGLLVAFS  449

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+KK+LR GYFLWAM AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGTFL+LG
Sbjct  450  LRYDWLAKKNLRDGYFLWAMTAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTFLSLG  509

Query  291  KKRGDLKHLWTKGDPDRPCPHVQ  223
            KKRG+LK LWT+G+P  PCPH+Q
Sbjct  510  KKRGELKVLWTRGEPKIPCPHIQ  532



>ref|XP_011093137.1| PREDICTED: signal peptide peptidase-like 4 [Sesamum indicum]
Length=540

 Score =   378 bits (970),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 179/205 (87%), Positives = 194/205 (95%), Gaps = 0/205 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCIVFAV+WAVYR VS A IGQDILGIALIITVLQIV+VPNLKVGTVLL CAFLYD+FWV
Sbjct  332  FCIVFAVLWAVYRSVSFAWIGQDILGIALIITVLQIVQVPNLKVGTVLLSCAFLYDIFWV  391

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKWWFH+SVMIVVARGD SGEDGIPMLLKIPR+FDPWGGYS+IGFGDIILPGLLVAFS
Sbjct  392  FVSKWWFHKSVMIVVARGDGSGEDGIPMLLKIPRLFDPWGGYSIIGFGDIILPGLLVAFS  451

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+KKSL+ GYFLWAM+AYGLGLL+TY+ALN+MDGHGQPALLYIVPFTLGT +TL 
Sbjct  452  LRYDWLAKKSLKAGYFLWAMLAYGLGLLVTYVALNMMDGHGQPALLYIVPFTLGTLITLA  511

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQ  217
             KRGDLKHLW +G+P RPCPHVQLQ
Sbjct  512  SKRGDLKHLWKRGEPYRPCPHVQLQ  536



>ref|XP_003534560.1| PREDICTED: signal peptide peptidase-like 4-like [Glycine max]
 gb|KHN29351.1| Signal peptide peptidase-like 2B [Glycine soja]
Length=539

 Score =   377 bits (969),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 179/203 (88%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCIVFAV+W +YRRVS A IGQDILGI LIITVLQIVR+PNLKVGTVLL CAFLYD+FWV
Sbjct  330  FCIVFAVLWGIYRRVSFAWIGQDILGITLIITVLQIVRIPNLKVGTVLLSCAFLYDIFWV  389

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKWWFHESVMIVVARGD+SGEDGIPMLLKIPRMFDPWGGYS+IGFGDIILPGLLVAFS
Sbjct  390  FVSKWWFHESVMIVVARGDRSGEDGIPMLLKIPRMFDPWGGYSIIGFGDIILPGLLVAFS  449

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+KK+LR GYFLWAM AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGTFL+LG
Sbjct  450  LRYDWLAKKNLRDGYFLWAMTAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTFLSLG  509

Query  291  KKRGDLKHLWTKGDPDRPCPHVQ  223
            KKRG+LK LWT+G+P  PCPH+Q
Sbjct  510  KKRGELKVLWTRGEPKIPCPHIQ  532



>ref|XP_009784968.1| PREDICTED: signal peptide peptidase-like 4 [Nicotiana sylvestris]
Length=535

 Score =   377 bits (969),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 182/206 (88%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCIVFAV+W VYRR+S A IGQDILGIALIITVLQIV+VPNLKVGTVLL CA LYDLFWV
Sbjct  329  FCIVFAVLWVVYRRISFAWIGQDILGIALIITVLQIVQVPNLKVGTVLLSCALLYDLFWV  388

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F+SK  FH+SVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYS+IGFGDIILPGLLVAFS
Sbjct  389  FLSKPLFHKSVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSIIGFGDIILPGLLVAFS  448

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL  K LR GYFLWAM AYGLGLL TY+ALNLMDGHGQPALLYIVPFTLGTFLTLG
Sbjct  449  LRYDWLCNKKLREGYFLWAMFAYGLGLLTTYVALNLMDGHGQPALLYIVPFTLGTFLTLG  508

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQP  214
            K+RGDLKHLWT+G+PDRPCPHV+LQP
Sbjct  509  KQRGDLKHLWTRGEPDRPCPHVRLQP  534



>ref|XP_008360707.1| PREDICTED: signal peptide peptidase-like 2 [Malus domestica]
 ref|XP_008367436.1| PREDICTED: signal peptide peptidase-like 2 [Malus domestica]
Length=511

 Score =   376 bits (966),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 178/214 (83%), Positives = 198/214 (93%), Gaps = 0/214 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI F+V+WAVYR +S A IGQDILGIALIITVLQIVR+PNLKVGTVLL CAFLYD+FWV
Sbjct  298  FCITFSVLWAVYRNISFAWIGQDILGIALIITVLQIVRIPNLKVGTVLLSCAFLYDIFWV  357

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK  FHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGG+S+IGFGDI+LPGLLVAFS
Sbjct  358  FVSKKLFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGFSIIGFGDILLPGLLVAFS  417

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ KSLR GYFLWAM+AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGT LTLG
Sbjct  418  LRYDWLANKSLRAGYFLWAMIAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTLLTLG  477

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD*VNTAK  190
            KKRGDL+ LW++G+P+RPCPH++L  +  VN +K
Sbjct  478  KKRGDLQILWSRGEPERPCPHIELGGSQEVNESK  511



>ref|XP_002511870.1| Minor histocompatibility antigen H13, putative [Ricinus communis]
 gb|EEF50539.1| Minor histocompatibility antigen H13, putative [Ricinus communis]
Length=538

 Score =   377 bits (967),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 180/206 (87%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYRRVS A IGQDILGI LIITVLQIV VPNLKVGTVLL CAFLYD+FWV
Sbjct  329  FCIAFAVVWAVYRRVSFAWIGQDILGITLIITVLQIVHVPNLKVGTVLLSCAFLYDIFWV  388

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK WF ESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYS+IGFGDIILPGLLVAF+
Sbjct  389  FVSKLWFKESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSIIGFGDIILPGLLVAFA  448

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+KK+LR GYFLWAM AYGLGLLITY+ALN+MDGHGQPALLYIVPFTLGTFLTLG
Sbjct  449  LRYDWLTKKNLRAGYFLWAMTAYGLGLLITYVALNMMDGHGQPALLYIVPFTLGTFLTLG  508

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQP  214
            KKRG+LK LWT+G P+RPCPH++ QP
Sbjct  509  KKRGELKALWTRGAPERPCPHIRFQP  534



>gb|EYU32129.1| hypothetical protein MIMGU_mgv1a004245mg [Erythranthe guttata]
Length=537

 Score =   376 bits (966),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 177/208 (85%), Positives = 195/208 (94%), Gaps = 0/208 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WA++R VS A IGQDILGIALIITVLQI+RVPNLKVG VLLGCAFLYD+FWV
Sbjct  329  FCISFAVLWALFRHVSFAWIGQDILGIALIITVLQIIRVPNLKVGAVLLGCAFLYDIFWV  388

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F+SK WFH+SVMIVVARGD SGEDGIPMLLKIPRMFDPWGGYS+IGFGDIILPGLLVAFS
Sbjct  389  FISKLWFHKSVMIVVARGDGSGEDGIPMLLKIPRMFDPWGGYSIIGFGDIILPGLLVAFS  448

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWLS KSL+ GYFLWAM+AYGLGLL+TY+ALN+MDGHGQPALLYIVPFTLGT +TL 
Sbjct  449  LRYDWLSNKSLKNGYFLWAMIAYGLGLLVTYIALNMMDGHGQPALLYIVPFTLGTLITLA  508

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD  208
            KKRGDLKHLWT+G+PDRPCPHVQL+  +
Sbjct  509  KKRGDLKHLWTRGEPDRPCPHVQLRQDE  536



>ref|XP_007135086.1| hypothetical protein PHAVU_010G099500g [Phaseolus vulgaris]
 gb|ESW07080.1| hypothetical protein PHAVU_010G099500g [Phaseolus vulgaris]
Length=541

 Score =   376 bits (965),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 180/203 (89%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCIVFAV+WAVYRR S A IGQDILGI LIITVLQIVR+PNLKVGTVLL CAFLYD+FWV
Sbjct  329  FCIVFAVVWAVYRRASWAWIGQDILGITLIITVLQIVRIPNLKVGTVLLSCAFLYDIFWV  388

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPR+FDPWGGYS+IGFGDIILPGLLVAFS
Sbjct  389  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRLFDPWGGYSIIGFGDIILPGLLVAFS  448

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+KK+LR GYFLWAM AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGTFL+LG
Sbjct  449  LRYDWLAKKNLRAGYFLWAMTAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTFLSLG  508

Query  291  KKRGDLKHLWTKGDPDRPCPHVQ  223
            KKRG+LK LWT+G P+RPC H+Q
Sbjct  509  KKRGELKILWTRGKPERPCCHIQ  531



>ref|XP_009629841.1| PREDICTED: signal peptide peptidase-like 4 [Nicotiana tomentosiformis]
Length=535

 Score =   375 bits (964),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 181/206 (88%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCIVFAV+WAVYR +S A IGQDILGIALIITVLQIV+VPNLKVGTVLL CA LYDLFWV
Sbjct  329  FCIVFAVLWAVYRHISFAWIGQDILGIALIITVLQIVQVPNLKVGTVLLSCALLYDLFWV  388

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F+SK  FH+SVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYS+IGFGDIILPGLLVAFS
Sbjct  389  FLSKPLFHKSVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSIIGFGDIILPGLLVAFS  448

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL  K LR GYFLWAM AYGLGLL TY+ALNLMDGHGQPALLYIVPFTLGTFLT+G
Sbjct  449  LRYDWLCNKKLREGYFLWAMFAYGLGLLTTYVALNLMDGHGQPALLYIVPFTLGTFLTVG  508

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQP  214
            K+RGDLKHLWT+G+PDRPCPHV+LQP
Sbjct  509  KQRGDLKHLWTRGEPDRPCPHVRLQP  534



>ref|XP_004510782.1| PREDICTED: signal peptide peptidase-like 4-like isoform X1 [Cicer 
arietinum]
Length=536

 Score =   375 bits (963),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 179/203 (88%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCIVFAV+WAV R  S A IGQDILGIALIITVLQIVR+PNLKVGTVLL C+FLYD+ WV
Sbjct  328  FCIVFAVVWAVKRHASCAWIGQDILGIALIITVLQIVRIPNLKVGTVLLSCSFLYDILWV  387

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYS+IGFGDIILPGLLVAFS
Sbjct  388  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSIIGFGDIILPGLLVAFS  447

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+KK+LR+GYF+WAM AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGTFL+LG
Sbjct  448  LRYDWLAKKNLRSGYFVWAMTAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTFLSLG  507

Query  291  KKRGDLKHLWTKGDPDRPCPHVQ  223
            KKRGDLK LWT+G+P+RPCPH Q
Sbjct  508  KKRGDLKILWTRGEPERPCPHNQ  530



>ref|XP_007139835.1| hypothetical protein PHAVU_008G062100g [Phaseolus vulgaris]
 gb|ESW11829.1| hypothetical protein PHAVU_008G062100g [Phaseolus vulgaris]
Length=539

 Score =   375 bits (962),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 178/203 (88%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCIVFAV+W VYR VS A +GQDILGI LIITVLQIVR+PNLKVGTVLL CAFLYD+FWV
Sbjct  330  FCIVFAVLWGVYRHVSFAWVGQDILGITLIITVLQIVRIPNLKVGTVLLSCAFLYDIFWV  389

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPR+FDPWGGYS+IGFGDIILPGLLVAFS
Sbjct  390  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRLFDPWGGYSIIGFGDIILPGLLVAFS  449

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+KK+LR GYFLWAM AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGTFL+LG
Sbjct  450  LRYDWLAKKNLRDGYFLWAMTAYGLGLLITYMALNLMDGHGQPALLYIVPFTLGTFLSLG  509

Query  291  KKRGDLKHLWTKGDPDRPCPHVQ  223
            KKRG+LK LWT+G+P  PCPH+Q
Sbjct  510  KKRGELKVLWTRGEPKIPCPHIQ  532



>ref|XP_007040266.1| Signal peptide peptidase-like 2 isoform 3 [Theobroma cacao]
 gb|EOY24767.1| Signal peptide peptidase-like 2 isoform 3 [Theobroma cacao]
Length=504

 Score =   374 bits (959),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 178/205 (87%), Positives = 193/205 (94%), Gaps = 0/205 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYR VS A IGQDILGIALIITVLQIV VPNLKVGTVLL CAFLYD+FWV
Sbjct  289  FCIAFAVVWAVYRNVSFAWIGQDILGIALIITVLQIVHVPNLKVGTVLLSCAFLYDIFWV  348

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK  FHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYS+IGFGDI+LPGLL+AFS
Sbjct  349  FVSKKLFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSIIGFGDILLPGLLIAFS  408

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ K+LR GYFLWAM AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGTFLTLG
Sbjct  409  LRYDWLANKTLRAGYFLWAMFAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTFLTLG  468

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQ  217
            +KRGDL+ LWT+G+P+RPCPH+QL+
Sbjct  469  RKRGDLRVLWTRGEPERPCPHIQLE  493



>ref|XP_011023314.1| PREDICTED: signal peptide peptidase-like 4 [Populus euphratica]
 ref|XP_011023315.1| PREDICTED: signal peptide peptidase-like 4 [Populus euphratica]
Length=537

 Score =   374 bits (961),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 178/207 (86%), Positives = 194/207 (94%), Gaps = 0/207 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAV+R +S A IGQDILGIALIITVLQIVRVPNLKVGT+LL CAFLYD+FWV
Sbjct  329  FCIAFAVVWAVFRSISFAWIGQDILGIALIITVLQIVRVPNLKVGTILLSCAFLYDIFWV  388

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKW F ESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYS+IGFGDIILPGLLVAFS
Sbjct  389  FVSKWLFKESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSIIGFGDIILPGLLVAFS  448

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+KK+LR GYFLWAM AYGLGLL+TY+ALN+MDGHGQPALLYIVPFTLGTFLTLG
Sbjct  449  LRYDWLAKKNLRAGYFLWAMTAYGLGLLVTYVALNMMDGHGQPALLYIVPFTLGTFLTLG  508

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPA  211
            K+RGDLK LWT G+P+RPC H+Q QP+
Sbjct  509  KQRGDLKALWTMGEPERPCRHMQFQPS  535



>ref|XP_009781593.1| PREDICTED: signal peptide peptidase-like 4 isoform X2 [Nicotiana 
sylvestris]
Length=397

 Score =   369 bits (948),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 175/208 (84%), Positives = 190/208 (91%), Gaps = 0/208 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FC+ FAVMW V+RRVS A IGQDILGI LIITVLQI+RVPNLKVGTVLL CAF YD+FWV
Sbjct  190  FCLAFAVMWVVFRRVSFAWIGQDILGIVLIITVLQIIRVPNLKVGTVLLTCAFFYDIFWV  249

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKW FH+SVMI VARGD SGEDGIPMLLKIPRMFDPWGGYS+IGFGDIILPGL+VAFS
Sbjct  250  FVSKWLFHKSVMIEVARGDNSGEDGIPMLLKIPRMFDPWGGYSIIGFGDIILPGLVVAFS  309

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL  KSLR GYFLW M+AYGLGL +TY+ALNLMDGHGQPALLYIVP TLGTFL LG
Sbjct  310  LRYDWLCNKSLRAGYFLWTMIAYGLGLFVTYVALNLMDGHGQPALLYIVPCTLGTFLMLG  369

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD  208
            KKRGDLKHLWT+G+PDRPCPH++LQP +
Sbjct  370  KKRGDLKHLWTRGEPDRPCPHIRLQPVE  397



>gb|KEH18849.1| signal peptide peptidase-like protein [Medicago truncatula]
Length=455

 Score =   371 bits (953),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 176/203 (87%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCIVFAV+WAV R+ S A IGQDILGIALIITVLQIVR+PNLKVGTVLL CAFLYD+ WV
Sbjct  244  FCIVFAVVWAVKRQASYAWIGQDILGIALIITVLQIVRIPNLKVGTVLLSCAFLYDILWV  303

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKWWFHESVMIVVARGDKSGEDGIPMLLK+PR+FDPWGGYS+IGFGDIILPGL+VAFS
Sbjct  304  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKLPRLFDPWGGYSIIGFGDIILPGLVVAFS  363

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+KK+LR GYF+WAM AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGTFL+LG
Sbjct  364  LRYDWLAKKNLRAGYFVWAMTAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTFLSLG  423

Query  291  KKRGDLKHLWTKGDPDRPCPHVQ  223
            KKRGDLK LWT+G+P+R CPH+Q
Sbjct  424  KKRGDLKILWTRGEPERHCPHIQ  446



>ref|XP_002301360.2| hypothetical protein POPTR_0002s16180g [Populus trichocarpa]
 gb|EEE80633.2| hypothetical protein POPTR_0002s16180g [Populus trichocarpa]
Length=528

 Score =   374 bits (959),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 178/207 (86%), Positives = 193/207 (93%), Gaps = 0/207 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAV+R +S A IGQDILGIALIITVLQIVRVPNLKVGT+LL CAFLYD+FWV
Sbjct  320  FCIAFAVVWAVFRSISFAWIGQDILGIALIITVLQIVRVPNLKVGTILLSCAFLYDIFWV  379

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKW F ESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYS+IGFGDIILPGLLVAFS
Sbjct  380  FVSKWLFKESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSIIGFGDIILPGLLVAFS  439

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL KK+LR GYFLWAM AYGLGLL+TY+ALN+MDGHGQPALLYIVPFTLGTFLTLG
Sbjct  440  LRYDWLVKKNLRAGYFLWAMTAYGLGLLVTYVALNMMDGHGQPALLYIVPFTLGTFLTLG  499

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPA  211
            K+RGDLK LWT G+P+RPC H+Q QP+
Sbjct  500  KQRGDLKALWTMGEPERPCRHIQFQPS  526



>ref|XP_003528851.1| PREDICTED: signal peptide peptidase-like 4-like [Glycine max]
 gb|KHN26959.1| Signal peptide peptidase-like 2B [Glycine soja]
Length=541

 Score =   374 bits (959),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 178/203 (88%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCIVFAV+WAVYRR S A IGQDILGI LIITVLQIVR+PNLKVGTVLL CAFLYD+FWV
Sbjct  329  FCIVFAVVWAVYRRASFAWIGQDILGITLIITVLQIVRIPNLKVGTVLLSCAFLYDIFWV  388

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK WFHESVMIVVARGDKSGEDGIPMLLKIPR+FDPWGGYS+IGFGDIILPGL+VAFS
Sbjct  389  FVSKRWFHESVMIVVARGDKSGEDGIPMLLKIPRLFDPWGGYSIIGFGDIILPGLIVAFS  448

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+KK+LR GYFLWAM AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGTFL+LG
Sbjct  449  LRYDWLAKKNLRAGYFLWAMSAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTFLSLG  508

Query  291  KKRGDLKHLWTKGDPDRPCPHVQ  223
            KKRG+LK LWT+G+P+R CPH+Q
Sbjct  509  KKRGELKILWTRGEPERHCPHIQ  531



>ref|XP_007040264.1| Signal peptide peptidase-like 2 isoform 1 [Theobroma cacao]
 ref|XP_007040265.1| Signal peptide peptidase-like 2 isoform 1 [Theobroma cacao]
 gb|EOY24765.1| Signal peptide peptidase-like 2 isoform 1 [Theobroma cacao]
 gb|EOY24766.1| Signal peptide peptidase-like 2 isoform 1 [Theobroma cacao]
Length=546

 Score =   374 bits (960),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 178/205 (87%), Positives = 193/205 (94%), Gaps = 0/205 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYR VS A IGQDILGIALIITVLQIV VPNLKVGTVLL CAFLYD+FWV
Sbjct  331  FCIAFAVVWAVYRNVSFAWIGQDILGIALIITVLQIVHVPNLKVGTVLLSCAFLYDIFWV  390

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK  FHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYS+IGFGDI+LPGLL+AFS
Sbjct  391  FVSKKLFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSIIGFGDILLPGLLIAFS  450

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ K+LR GYFLWAM AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGTFLTLG
Sbjct  451  LRYDWLANKTLRAGYFLWAMFAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTFLTLG  510

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQ  217
            +KRGDL+ LWT+G+P+RPCPH+QL+
Sbjct  511  RKRGDLRVLWTRGEPERPCPHIQLE  535



>ref|XP_009592079.1| PREDICTED: signal peptide peptidase-like 4 isoform X2 [Nicotiana 
tomentosiformis]
Length=397

 Score =   369 bits (946),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 175/208 (84%), Positives = 191/208 (92%), Gaps = 0/208 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FC+ FAVMWAV+RRVS A IGQDILGI LIITVLQI+RVPNLKVGTVLL CAF YD+FWV
Sbjct  190  FCLAFAVMWAVFRRVSFAWIGQDILGIVLIITVLQIIRVPNLKVGTVLLTCAFFYDIFWV  249

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKW FH+SVMI VARGD SGEDGIPMLLKIPRMFDPWGGYS+IGFGDIILPGL+VAFS
Sbjct  250  FVSKWLFHKSVMIEVARGDNSGEDGIPMLLKIPRMFDPWGGYSIIGFGDIILPGLVVAFS  309

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL  KSLR GYFLW M+AYGLGL +TY+ALNLMDGHGQPALLYIVP TLGTFL LG
Sbjct  310  LRYDWLCNKSLRAGYFLWTMIAYGLGLFVTYVALNLMDGHGQPALLYIVPCTLGTFLMLG  369

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD  208
            KKRG+LKHLWT+G+PDRPCPH++LQ A+
Sbjct  370  KKRGELKHLWTRGEPDRPCPHIRLQQAE  397



>ref|XP_006439532.1| hypothetical protein CICLE_v10019598mg [Citrus clementina]
 gb|ESR52772.1| hypothetical protein CICLE_v10019598mg [Citrus clementina]
 gb|KDO76238.1| hypothetical protein CISIN_1g009071mg [Citrus sinensis]
Length=544

 Score =   373 bits (958),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 177/214 (83%), Positives = 197/214 (92%), Gaps = 0/214 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WA+YR+VS A IGQDILGIALIITVLQIV +PNLKVGTVLL CAF+YD+FWV
Sbjct  331  FCIAFAVVWAIYRKVSFAWIGQDILGIALIITVLQIVHIPNLKVGTVLLSCAFMYDIFWV  390

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK  FHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYS+IGFGDI+LPGL++AFS
Sbjct  391  FVSKKLFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSIIGFGDILLPGLIIAFS  450

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ KSL+ GYFLWAM+AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGTFL LG
Sbjct  451  LRYDWLANKSLQAGYFLWAMLAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTFLALG  510

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD*VNTAK  190
            KKRGDL+ LWT+G+P+RPCPHV LQ +  +N  K
Sbjct  511  KKRGDLRVLWTRGEPERPCPHVHLQHSHELNVEK  544



>ref|XP_008238915.1| PREDICTED: signal peptide peptidase-like 2 [Prunus mume]
Length=544

 Score =   373 bits (958),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 176/214 (82%), Positives = 197/214 (92%), Gaps = 0/214 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAV+R +S A IGQDILGIALIITVLQIVR+PNLKVGTVLL CAFLYD+FWV
Sbjct  331  FCIAFAVLWAVFRNISFAWIGQDILGIALIITVLQIVRIPNLKVGTVLLSCAFLYDIFWV  390

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK  FHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGG+S+IGFGDI+LPGLLVAFS
Sbjct  391  FVSKKLFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGFSIIGFGDILLPGLLVAFS  450

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ K+LR GYFLWAMMAYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGTFLTLG
Sbjct  451  LRYDWLANKTLRAGYFLWAMMAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTFLTLG  510

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD*VNTAK  190
            KKRGDL+ LW +G+P+RPC H++L+ +  ++  K
Sbjct  511  KKRGDLQILWCRGEPERPCSHIKLEESQELDETK  544



>ref|XP_006476550.1| PREDICTED: signal peptide peptidase-like 2-like [Citrus sinensis]
Length=544

 Score =   373 bits (958),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 177/214 (83%), Positives = 197/214 (92%), Gaps = 0/214 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WA+YR+VS A IGQDILGIALIITVLQIV +PNLKVGTVLL CAF+YD+FWV
Sbjct  331  FCIAFAVVWAIYRKVSFAWIGQDILGIALIITVLQIVHIPNLKVGTVLLSCAFMYDIFWV  390

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK  FHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYS+IGFGDI+LPGL++AFS
Sbjct  391  FVSKKLFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSIIGFGDILLPGLIIAFS  450

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ KSL+ GYFLWAM+AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGTFL LG
Sbjct  451  LRYDWLANKSLQAGYFLWAMLAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTFLALG  510

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD*VNTAK  190
            KKRGDL+ LWT+G+P+RPCPHV LQ +  +N  K
Sbjct  511  KKRGDLRVLWTRGEPERPCPHVHLQHSHELNVEK  544



>ref|XP_012086884.1| PREDICTED: signal peptide peptidase-like 2 [Jatropha curcas]
 gb|KDP25425.1| hypothetical protein JCGZ_20581 [Jatropha curcas]
Length=544

 Score =   373 bits (958),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 178/214 (83%), Positives = 196/214 (92%), Gaps = 0/214 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYR VS A IGQDILGIALIITVLQIV VPNLKVGTVLL CAFLYD+FWV
Sbjct  331  FCIAFAVVWAVYRNVSFAWIGQDILGIALIITVLQIVHVPNLKVGTVLLSCAFLYDIFWV  390

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK +FHESVMIVVARGD+SGEDGIPMLLKIPRMFDPWGGYS+IGFGDI+LPGLL+AFS
Sbjct  391  FVSKKFFHESVMIVVARGDRSGEDGIPMLLKIPRMFDPWGGYSIIGFGDILLPGLLIAFS  450

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ KSLR GYFLWAM+AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGTFL LG
Sbjct  451  LRYDWLANKSLRAGYFLWAMIAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTFLALG  510

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD*VNTAK  190
            KKRGDL  LWT+G+P+RPCPH+ ++ +  +N  K
Sbjct  511  KKRGDLNVLWTRGEPERPCPHIHVEHSHELNLEK  544



>gb|KHG15007.1| Signal peptide peptidase-like 2B [Gossypium arboreum]
Length=553

 Score =   373 bits (957),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 182/224 (81%), Positives = 196/224 (88%), Gaps = 18/224 (8%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLK-----------------  703
            FCI FAV+WAVYRR+S A IGQDILGIALIITVLQIVRVPNLK                 
Sbjct  325  FCIAFAVVWAVYRRISFAWIGQDILGIALIITVLQIVRVPNLKASTLICFAFSTCYSGFL  384

Query  702  -VGTVLLGCAFLYDLFWVFVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGY  526
             VGTVLLGCAFLYD+FWVF SKW FHESVMIVVARGD+SGEDGIPMLLKIPRMFDPWGGY
Sbjct  385  HVGTVLLGCAFLYDIFWVFASKWLFHESVMIVVARGDRSGEDGIPMLLKIPRMFDPWGGY  444

Query  525  SVIGFGDIILPGLLVAFSLRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQ  346
            SVIGFGDIILPGLLVAFSLRYDWL+  +LR GYF+WAM AYGLGLL+TY+ALNLMDGHGQ
Sbjct  445  SVIGFGDIILPGLLVAFSLRYDWLANMNLRAGYFVWAMTAYGLGLLVTYVALNLMDGHGQ  504

Query  345  PALLYIVPFTLGTFLTLGKKRGDLKHLWTKGDPDRPCPHVQLQP  214
            PALLYIVPFTLGTF+TLGKKRGDLK LWT+G+P+RPCPH+QLQP
Sbjct  505  PALLYIVPFTLGTFITLGKKRGDLKTLWTQGEPERPCPHLQLQP  548



>ref|XP_007209873.1| hypothetical protein PRUPE_ppa003858mg [Prunus persica]
 gb|EMJ11072.1| hypothetical protein PRUPE_ppa003858mg [Prunus persica]
Length=544

 Score =   372 bits (955),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 175/214 (82%), Positives = 197/214 (92%), Gaps = 0/214 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAV+R +S A IGQDILGIALIITVLQIVR+PNLKVGTVLL CAFLYD+FWV
Sbjct  331  FCIAFAVLWAVFRNISFAWIGQDILGIALIITVLQIVRIPNLKVGTVLLSCAFLYDIFWV  390

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK  FHESVMIVVARGD+SGEDGIPMLLKIPRMFDPWGG+S+IGFGDI+LPGLLVAFS
Sbjct  391  FVSKKLFHESVMIVVARGDRSGEDGIPMLLKIPRMFDPWGGFSIIGFGDILLPGLLVAFS  450

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ K+LR GYFLWAMMAYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGTFLTLG
Sbjct  451  LRYDWLANKALRAGYFLWAMMAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTFLTLG  510

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD*VNTAK  190
            KKRGDL+ LW +G+P+RPC H++L+ +  ++  K
Sbjct  511  KKRGDLQILWCRGEPERPCSHIELEQSQELDETK  544



>ref|XP_003521881.1| PREDICTED: signal peptide peptidase-like 4-like [Glycine max]
Length=542

 Score =   372 bits (954),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 177/203 (87%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCIVFAV+WAVYR  S A IGQDILGI LIITVLQIVR+PNLKVGTVLL CAFLYD+FWV
Sbjct  330  FCIVFAVVWAVYRHASFAWIGQDILGITLIITVLQIVRIPNLKVGTVLLSCAFLYDIFWV  389

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK WFHESVMIVVARGDKSGEDGIPMLLKIPR+FDPWGGYS+IGFGDIILPGL+VAFS
Sbjct  390  FVSKRWFHESVMIVVARGDKSGEDGIPMLLKIPRLFDPWGGYSIIGFGDIILPGLIVAFS  449

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+KK+LR GYFLWAM AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGTFL+LG
Sbjct  450  LRYDWLAKKNLRAGYFLWAMTAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTFLSLG  509

Query  291  KKRGDLKHLWTKGDPDRPCPHVQ  223
            KKRG+LK LWT+G+P+R CPH+Q
Sbjct  510  KKRGELKILWTRGEPERHCPHIQ  532



>gb|AET02050.2| signal peptide peptidase-like protein [Medicago truncatula]
Length=541

 Score =   371 bits (953),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 176/203 (87%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCIVFAV+WAV R+ S A IGQDILGIALIITVLQIVR+PNLKVGTVLL CAFLYD+ WV
Sbjct  330  FCIVFAVVWAVKRQASYAWIGQDILGIALIITVLQIVRIPNLKVGTVLLSCAFLYDILWV  389

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKWWFHESVMIVVARGDKSGEDGIPMLLK+PR+FDPWGGYS+IGFGDIILPGL+VAFS
Sbjct  390  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKLPRLFDPWGGYSIIGFGDIILPGLVVAFS  449

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+KK+LR GYF+WAM AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGTFL+LG
Sbjct  450  LRYDWLAKKNLRAGYFVWAMTAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTFLSLG  509

Query  291  KKRGDLKHLWTKGDPDRPCPHVQ  223
            KKRGDLK LWT+G+P+R CPH+Q
Sbjct  510  KKRGDLKILWTRGEPERHCPHIQ  532



>ref|XP_002509814.1| Minor histocompatibility antigen H13, putative [Ricinus communis]
 gb|EEF51201.1| Minor histocompatibility antigen H13, putative [Ricinus communis]
Length=542

 Score =   371 bits (952),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 178/214 (83%), Positives = 195/214 (91%), Gaps = 0/214 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FC+ FAV+WAVYR VS + IGQDILGIALIITVLQIV VPNLKVGTVLL CAFLYD+FWV
Sbjct  329  FCLAFAVVWAVYRNVSFSWIGQDILGIALIITVLQIVHVPNLKVGTVLLSCAFLYDIFWV  388

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK  FHESVMIVVARGD+SGEDGIPMLLKIPRMFDPWGGYS+IGFGDI+LPGLL+AFS
Sbjct  389  FVSKKLFHESVMIVVARGDRSGEDGIPMLLKIPRMFDPWGGYSIIGFGDILLPGLLIAFS  448

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ KSLR GYFLWAM+AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGTFLTLG
Sbjct  449  LRYDWLANKSLRAGYFLWAMIAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTFLTLG  508

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD*VNTAK  190
            KKRGDL  LWT+G+P+RPCPH+ L+    +N  K
Sbjct  509  KKRGDLYVLWTRGEPERPCPHIHLEHCHELNLEK  542



>ref|XP_009781592.1| PREDICTED: signal peptide peptidase-like 4 isoform X1 [Nicotiana 
sylvestris]
Length=541

 Score =   370 bits (951),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 175/208 (84%), Positives = 190/208 (91%), Gaps = 0/208 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FC+ FAVMW V+RRVS A IGQDILGI LIITVLQI+RVPNLKVGTVLL CAF YD+FWV
Sbjct  334  FCLAFAVMWVVFRRVSFAWIGQDILGIVLIITVLQIIRVPNLKVGTVLLTCAFFYDIFWV  393

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKW FH+SVMI VARGD SGEDGIPMLLKIPRMFDPWGGYS+IGFGDIILPGL+VAFS
Sbjct  394  FVSKWLFHKSVMIEVARGDNSGEDGIPMLLKIPRMFDPWGGYSIIGFGDIILPGLVVAFS  453

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL  KSLR GYFLW M+AYGLGL +TY+ALNLMDGHGQPALLYIVP TLGTFL LG
Sbjct  454  LRYDWLCNKSLRAGYFLWTMIAYGLGLFVTYVALNLMDGHGQPALLYIVPCTLGTFLMLG  513

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD  208
            KKRGDLKHLWT+G+PDRPCPH++LQP +
Sbjct  514  KKRGDLKHLWTRGEPDRPCPHIRLQPVE  541



>ref|XP_006339581.1| PREDICTED: signal peptide peptidase-like 4-like isoform X2 [Solanum 
tuberosum]
Length=515

 Score =   369 bits (948),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 176/206 (85%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYR +S A IGQDILGIALIITVLQ+V++PNLKVGTVLL C+ LYDLFWV
Sbjct  309  FCIAFAVLWAVYRHISFAWIGQDILGIALIITVLQVVQIPNLKVGTVLLSCSLLYDLFWV  368

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F+SK  FH+SVMIVVARGDKSGEDGIPMLLKIPR+FDPW GYS+IGFGDIILPGLLVAFS
Sbjct  369  FLSKSLFHKSVMIVVARGDKSGEDGIPMLLKIPRLFDPWHGYSIIGFGDIILPGLLVAFS  428

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL  K LR GYFLWAM+AYGLGLL TY+ALNLMDGHGQPALLYIVPFTLGTFLTLG
Sbjct  429  LRYDWLCNKRLRDGYFLWAMLAYGLGLLTTYVALNLMDGHGQPALLYIVPFTLGTFLTLG  488

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQP  214
            K+RGDLKHLWT+G+PDRPCPHV+LQP
Sbjct  489  KQRGDLKHLWTRGEPDRPCPHVRLQP  514



>gb|EYU35094.1| hypothetical protein MIMGU_mgv1a009454mg [Erythranthe guttata]
Length=341

 Score =   363 bits (932),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 175/205 (85%), Positives = 190/205 (93%), Gaps = 0/205 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCIVFAV+WAVYR VS A IGQDILGIALIITVLQIVRVPNLKVGTVLL CAFLYD+FWV
Sbjct  133  FCIVFAVLWAVYRTVSFAWIGQDILGIALIITVLQIVRVPNLKVGTVLLSCAFLYDIFWV  192

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKWWFH+SVMIVVARGD SGEDGIPMLLKIPRMFDPWGGYS+IGFGDIILPGL+VAFS
Sbjct  193  FVSKWWFHKSVMIVVARGDGSGEDGIPMLLKIPRMFDPWGGYSIIGFGDIILPGLIVAFS  252

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYD+L K+S+R+GYFLWAM+AYGLGLL+TY+ALNLMDGHGQPALLYIVPFTLGT +TL 
Sbjct  253  LRYDFLCKRSVRSGYFLWAMIAYGLGLLVTYVALNLMDGHGQPALLYIVPFTLGTLITLA  312

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQ  217
              RGDLK LW +G P  PCPHV+LQ
Sbjct  313  NTRGDLKQLWHRGLPRTPCPHVRLQ  337



>ref|XP_009592078.1| PREDICTED: signal peptide peptidase-like 4 isoform X1 [Nicotiana 
tomentosiformis]
Length=540

 Score =   370 bits (949),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 175/208 (84%), Positives = 191/208 (92%), Gaps = 0/208 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FC+ FAVMWAV+RRVS A IGQDILGI LIITVLQI+RVPNLKVGTVLL CAF YD+FWV
Sbjct  333  FCLAFAVMWAVFRRVSFAWIGQDILGIVLIITVLQIIRVPNLKVGTVLLTCAFFYDIFWV  392

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKW FH+SVMI VARGD SGEDGIPMLLKIPRMFDPWGGYS+IGFGDIILPGL+VAFS
Sbjct  393  FVSKWLFHKSVMIEVARGDNSGEDGIPMLLKIPRMFDPWGGYSIIGFGDIILPGLVVAFS  452

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL  KSLR GYFLW M+AYGLGL +TY+ALNLMDGHGQPALLYIVP TLGTFL LG
Sbjct  453  LRYDWLCNKSLRAGYFLWTMIAYGLGLFVTYVALNLMDGHGQPALLYIVPCTLGTFLMLG  512

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD  208
            KKRG+LKHLWT+G+PDRPCPH++LQ A+
Sbjct  513  KKRGELKHLWTRGEPDRPCPHIRLQQAE  540



>ref|XP_006339580.1| PREDICTED: signal peptide peptidase-like 4-like isoform X1 [Solanum 
tuberosum]
Length=539

 Score =   370 bits (949),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 176/206 (85%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYR +S A IGQDILGIALIITVLQ+V++PNLKVGTVLL C+ LYDLFWV
Sbjct  333  FCIAFAVLWAVYRHISFAWIGQDILGIALIITVLQVVQIPNLKVGTVLLSCSLLYDLFWV  392

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F+SK  FH+SVMIVVARGDKSGEDGIPMLLKIPR+FDPW GYS+IGFGDIILPGLLVAFS
Sbjct  393  FLSKSLFHKSVMIVVARGDKSGEDGIPMLLKIPRLFDPWHGYSIIGFGDIILPGLLVAFS  452

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL  K LR GYFLWAM+AYGLGLL TY+ALNLMDGHGQPALLYIVPFTLGTFLTLG
Sbjct  453  LRYDWLCNKRLRDGYFLWAMLAYGLGLLTTYVALNLMDGHGQPALLYIVPFTLGTFLTLG  512

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQP  214
            K+RGDLKHLWT+G+PDRPCPHV+LQP
Sbjct  513  KQRGDLKHLWTRGEPDRPCPHVRLQP  538



>ref|XP_002274996.2| PREDICTED: signal peptide peptidase-like 2 [Vitis vinifera]
 emb|CBI34660.3| unnamed protein product [Vitis vinifera]
Length=548

 Score =   370 bits (949),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 176/205 (86%), Positives = 194/205 (95%), Gaps = 0/205 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYR VS A IGQDILGIALIITVLQIV +PNLKVGTVLL CAFLYD+FWV
Sbjct  331  FCITFAVVWAVYRDVSFAWIGQDILGIALIITVLQIVHIPNLKVGTVLLSCAFLYDIFWV  390

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK  FHESVMIVVARGD+SG+DGIPMLLKIPRMFDPWGGYS+IGFGDI+LPGLL+AFS
Sbjct  391  FVSKKLFHESVMIVVARGDRSGQDGIPMLLKIPRMFDPWGGYSIIGFGDILLPGLLIAFS  450

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+KK+++TGYFLWAM AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGTFLTLG
Sbjct  451  LRYDWLAKKNIQTGYFLWAMFAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTFLTLG  510

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQ  217
            +KRGDLK+LWT+G P+RPCPHVQ +
Sbjct  511  RKRGDLKNLWTRGVPERPCPHVQHE  535



>gb|AAL14628.1|AF417575_1 growth-on protein GRO11 [Euphorbia esula]
Length=538

 Score =   369 bits (946),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 177/207 (86%), Positives = 192/207 (93%), Gaps = 0/207 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCIVFAV+WA++RR S A IGQDILGIALIITVLQIV VPNLKVGTVLL CAFLYD+FWV
Sbjct  329  FCIVFAVIWAIHRRDSFAWIGQDILGIALIITVLQIVHVPNLKVGTVLLSCAFLYDIFWV  388

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK W  +SVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYS+IGFGDIILPGLLV F+
Sbjct  389  FVSKLWLKDSVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSIIGFGDIILPGLLVTFA  448

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+KK+LR GYFLWAM AYGLGLL+TY+ALNLMDGHGQPALLYIVPFTLGTFLTLG
Sbjct  449  LRYDWLTKKNLRAGYFLWAMTAYGLGLLVTYVALNLMDGHGQPALLYIVPFTLGTFLTLG  508

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPA  211
            K RG+LK LWT+G+PD PCPHVQLQ +
Sbjct  509  KTRGELKALWTRGEPDSPCPHVQLQSS  535



>ref|XP_010935855.1| PREDICTED: signal peptide peptidase-like 4 isoform X2 [Elaeis 
guineensis]
 ref|XP_010935857.1| PREDICTED: signal peptide peptidase-like 4 isoform X2 [Elaeis 
guineensis]
 ref|XP_010935858.1| PREDICTED: signal peptide peptidase-like 4 isoform X2 [Elaeis 
guineensis]
Length=524

 Score =   368 bits (945),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 172/203 (85%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYR +S A IGQDILGIALIITVLQIVRVPNLKVGTVLL CAFLYD+FWV
Sbjct  319  FCIAFAVVWAVYRSISFAWIGQDILGIALIITVLQIVRVPNLKVGTVLLSCAFLYDIFWV  378

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK WFHESVMIVVARGD++GEDG+PMLLKIPRMFDPWGG+S+IGFGDI+LPGLL+AFS
Sbjct  379  FVSKRWFHESVMIVVARGDRTGEDGVPMLLKIPRMFDPWGGFSIIGFGDILLPGLLIAFS  438

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDW +KK+LR GYFLW+M+AYG GLLITY+ALNLMDGHGQPALLYIVPFTLGTFLTLG
Sbjct  439  LRYDWAAKKNLRAGYFLWSMVAYGSGLLITYVALNLMDGHGQPALLYIVPFTLGTFLTLG  498

Query  291  KKRGDLKHLWTKGDPDRPCPHVQ  223
            +KRG+LKHLW KG+P+R CPH+Q
Sbjct  499  RKRGELKHLWIKGEPERICPHIQ  521



>gb|KHG06309.1| Signal peptide peptidase-like 2B [Gossypium arboreum]
Length=547

 Score =   369 bits (947),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 175/205 (85%), Positives = 193/205 (94%), Gaps = 0/205 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYR VS A IGQDILGIAL+ITVLQIV VPNLKVGTVLL CAFLYD+FWV
Sbjct  331  FCIAFAVVWAVYRNVSFAWIGQDILGIALMITVLQIVHVPNLKVGTVLLSCAFLYDIFWV  390

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK  FHESVMIVVARGD+SGEDGIPMLLKIPRMFDPWGGYS+IGFGDI+LPGLL+ FS
Sbjct  391  FVSKKLFHESVMIVVARGDRSGEDGIPMLLKIPRMFDPWGGYSIIGFGDILLPGLLITFS  450

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ K+LR GYFLWAM+AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGTFLTLG
Sbjct  451  LRYDWLANKTLRAGYFLWAMIAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTFLTLG  510

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQ  217
            KKRGDL+ LWT+G+P+RPCPH++L+
Sbjct  511  KKRGDLRVLWTRGEPERPCPHIRLE  535



>gb|KJB20659.1| hypothetical protein B456_003G158200 [Gossypium raimondii]
Length=546

 Score =   369 bits (946),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 176/205 (86%), Positives = 193/205 (94%), Gaps = 0/205 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYR VS A IGQDILGIALIITVLQIV VPNLKVGTVLL CAFLYD+FWV
Sbjct  331  FCIAFAVVWAVYRNVSFAWIGQDILGIALIITVLQIVHVPNLKVGTVLLSCAFLYDIFWV  390

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK  FHESVMIVVARGDKSG+DGIPMLLKIPRMFDPWGGYS+IGFGDI+LPGLLVAFS
Sbjct  391  FVSKKLFHESVMIVVARGDKSGQDGIPMLLKIPRMFDPWGGYSIIGFGDILLPGLLVAFS  450

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ KSLR GYF+WAM+AYGLGLL+TY+ALNLMDGHGQPALLYIVPFTLGTFLTLG
Sbjct  451  LRYDWLANKSLRAGYFVWAMIAYGLGLLVTYVALNLMDGHGQPALLYIVPFTLGTFLTLG  510

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQ  217
            +KRGDL+ LWT G+P+RPCPH++L+
Sbjct  511  RKRGDLRILWTSGEPERPCPHIRLE  535



>gb|KJB20661.1| hypothetical protein B456_003G158200 [Gossypium raimondii]
Length=542

 Score =   368 bits (945),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 176/205 (86%), Positives = 193/205 (94%), Gaps = 0/205 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYR VS A IGQDILGIALIITVLQIV VPNLKVGTVLL CAFLYD+FWV
Sbjct  327  FCIAFAVVWAVYRNVSFAWIGQDILGIALIITVLQIVHVPNLKVGTVLLSCAFLYDIFWV  386

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK  FHESVMIVVARGDKSG+DGIPMLLKIPRMFDPWGGYS+IGFGDI+LPGLLVAFS
Sbjct  387  FVSKKLFHESVMIVVARGDKSGQDGIPMLLKIPRMFDPWGGYSIIGFGDILLPGLLVAFS  446

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ KSLR GYF+WAM+AYGLGLL+TY+ALNLMDGHGQPALLYIVPFTLGTFLTLG
Sbjct  447  LRYDWLANKSLRAGYFVWAMIAYGLGLLVTYVALNLMDGHGQPALLYIVPFTLGTFLTLG  506

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQ  217
            +KRGDL+ LWT G+P+RPCPH++L+
Sbjct  507  RKRGDLRILWTSGEPERPCPHIRLE  531



>ref|XP_010935854.1| PREDICTED: signal peptide peptidase-like 4 isoform X1 [Elaeis 
guineensis]
Length=531

 Score =   367 bits (943),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 172/203 (85%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYR +S A IGQDILGIALIITVLQIVRVPNLKVGTVLL CAFLYD+FWV
Sbjct  326  FCIAFAVVWAVYRSISFAWIGQDILGIALIITVLQIVRVPNLKVGTVLLSCAFLYDIFWV  385

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK WFHESVMIVVARGD++GEDG+PMLLKIPRMFDPWGG+S+IGFGDI+LPGLL+AFS
Sbjct  386  FVSKRWFHESVMIVVARGDRTGEDGVPMLLKIPRMFDPWGGFSIIGFGDILLPGLLIAFS  445

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDW +KK+LR GYFLW+M+AYG GLLITY+ALNLMDGHGQPALLYIVPFTLGTFLTLG
Sbjct  446  LRYDWAAKKNLRAGYFLWSMVAYGSGLLITYVALNLMDGHGQPALLYIVPFTLGTFLTLG  505

Query  291  KKRGDLKHLWTKGDPDRPCPHVQ  223
            +KRG+LKHLW KG+P+R CPH+Q
Sbjct  506  RKRGELKHLWIKGEPERICPHIQ  528



>gb|KHG25050.1| Signal peptide peptidase-like 2B [Gossypium arboreum]
Length=546

 Score =   367 bits (943),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 176/205 (86%), Positives = 192/205 (94%), Gaps = 0/205 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYR VS A IGQDILGIALIITVLQIV VPNLKVGTVLL CAFLYD+FWV
Sbjct  331  FCIAFAVVWAVYRNVSFAWIGQDILGIALIITVLQIVHVPNLKVGTVLLSCAFLYDIFWV  390

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK  FHESVMIVVARGDKSG+DGIPMLLKIPRMFDPWGGYS+IGFGDI+LPGLLVAFS
Sbjct  391  FVSKKLFHESVMIVVARGDKSGQDGIPMLLKIPRMFDPWGGYSIIGFGDILLPGLLVAFS  450

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ KSLR GYF+WAM+AYGLGLL+TY+ALNLMDGHGQPALLYIVPFTLGTFLTLG
Sbjct  451  LRYDWLANKSLRAGYFVWAMIAYGLGLLVTYVALNLMDGHGQPALLYIVPFTLGTFLTLG  510

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQ  217
            +KRGDL+ LWT G+P+RPCPH+ L+
Sbjct  511  RKRGDLRILWTSGEPERPCPHILLE  535



>ref|XP_004229902.2| PREDICTED: signal peptide peptidase-like 4 [Solanum lycopersicum]
Length=596

 Score =   369 bits (947),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 175/206 (85%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYR +S A IGQDILGIALIITVLQ+V++PNLKVGTVLL C+ LYDLFWV
Sbjct  390  FCIAFAVLWAVYRHISFAWIGQDILGIALIITVLQVVQIPNLKVGTVLLSCSLLYDLFWV  449

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F+SK  FH+SVMIVVARGDK+GEDGIPMLLKIPR+FDPW GYS+IGFGDIILPGLLVAFS
Sbjct  450  FLSKSLFHKSVMIVVARGDKTGEDGIPMLLKIPRLFDPWHGYSIIGFGDIILPGLLVAFS  509

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL  K LR GYFLWAM+AYGLGLL TY+ALNLMDGHGQPALLYIVPFTLGTFLTLG
Sbjct  510  LRYDWLCNKKLRDGYFLWAMLAYGLGLLTTYVALNLMDGHGQPALLYIVPFTLGTFLTLG  569

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQP  214
            K+RGDLKHLWT+G+PDRPCPHV+LQP
Sbjct  570  KQRGDLKHLWTRGEPDRPCPHVRLQP  595



>gb|KJB52137.1| hypothetical protein B456_008G247500 [Gossypium raimondii]
Length=464

 Score =   365 bits (936),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 175/205 (85%), Positives = 192/205 (94%), Gaps = 0/205 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYR VS A IGQDILGIALIITVLQIV VPNLKVGTVLL CAFLYD+FWV
Sbjct  248  FCIAFAVVWAVYRNVSFAWIGQDILGIALIITVLQIVHVPNLKVGTVLLSCAFLYDIFWV  307

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK  FHESVMIVVARGD+SGEDGIPMLLKIPRMFDPWGGYS+IGFGDI+LPGLL+ FS
Sbjct  308  FVSKKLFHESVMIVVARGDRSGEDGIPMLLKIPRMFDPWGGYSIIGFGDILLPGLLITFS  367

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ K+LR GYFLWAM+AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGTFLTLG
Sbjct  368  LRYDWLANKTLRAGYFLWAMIAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTFLTLG  427

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQ  217
            KKR DL+ LWT+G+P+RPCPH++L+
Sbjct  428  KKRRDLRVLWTRGEPERPCPHIRLE  452



>gb|KJB52134.1| hypothetical protein B456_008G247500 [Gossypium raimondii]
Length=547

 Score =   367 bits (942),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 175/205 (85%), Positives = 192/205 (94%), Gaps = 0/205 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYR VS A IGQDILGIALIITVLQIV VPNLKVGTVLL CAFLYD+FWV
Sbjct  331  FCIAFAVVWAVYRNVSFAWIGQDILGIALIITVLQIVHVPNLKVGTVLLSCAFLYDIFWV  390

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK  FHESVMIVVARGD+SGEDGIPMLLKIPRMFDPWGGYS+IGFGDI+LPGLL+ FS
Sbjct  391  FVSKKLFHESVMIVVARGDRSGEDGIPMLLKIPRMFDPWGGYSIIGFGDILLPGLLITFS  450

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ K+LR GYFLWAM+AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGTFLTLG
Sbjct  451  LRYDWLANKTLRAGYFLWAMIAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTFLTLG  510

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQ  217
            KKR DL+ LWT+G+P+RPCPH++L+
Sbjct  511  KKRRDLRVLWTRGEPERPCPHIRLE  535



>ref|XP_009346748.1| PREDICTED: signal peptide peptidase-like 2 [Pyrus x bretschneideri]
Length=543

 Score =   366 bits (939),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 174/211 (82%), Positives = 196/211 (93%), Gaps = 0/211 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+W VYR +S A IGQDILGIALIITVLQIVR+PNLKVGTVLL CAFLYD+FWV
Sbjct  332  FCITFAVLWGVYRNLSFAWIGQDILGIALIITVLQIVRIPNLKVGTVLLSCAFLYDIFWV  391

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK  FHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGG+S+IGFGDI+LPGLLVAFS
Sbjct  392  FVSKKLFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGFSIIGFGDILLPGLLVAFS  451

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ K+LR+GYF+WAM+AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGT LTLG
Sbjct  452  LRYDWLANKTLRSGYFIWAMIAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTLLTLG  511

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD*VN  199
            KKRGDL+ LW++G+P+ PCPH++L+ +  VN
Sbjct  512  KKRGDLQILWSRGEPEWPCPHIELEGSHEVN  542



>ref|XP_009374989.1| PREDICTED: signal peptide peptidase-like 2 [Pyrus x bretschneideri]
Length=543

 Score =   366 bits (939),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 174/211 (82%), Positives = 195/211 (92%), Gaps = 0/211 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+W VYR +S A IGQDILGIALIITVLQIVR+PNLKVGTVLL CAFLYD+FWV
Sbjct  332  FCITFAVLWGVYRNLSFAWIGQDILGIALIITVLQIVRIPNLKVGTVLLSCAFLYDIFWV  391

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK  FHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGG+S+IGFGDI+LPGLLVAFS
Sbjct  392  FVSKKLFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGFSIIGFGDILLPGLLVAFS  451

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ K+LR GYF+WAM+AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGT LTLG
Sbjct  452  LRYDWLANKTLRAGYFIWAMIAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTLLTLG  511

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD*VN  199
            KKRGDL+ LW++G+P+ PCPH++L+ +  VN
Sbjct  512  KKRGDLQILWSRGEPEWPCPHIELEGSHEVN  542



>ref|XP_010089093.1| Signal peptide peptidase-like 2B [Morus notabilis]
 gb|EXB37340.1| Signal peptide peptidase-like 2B [Morus notabilis]
Length=543

 Score =   365 bits (938),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 174/214 (81%), Positives = 191/214 (89%), Gaps = 0/214 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI F+V+WA +R +S A IGQDILGIALIITVLQIVR+PNLKVGTVLL CAFLYD+FWV
Sbjct  330  FCIAFSVLWAAFRDISFAWIGQDILGIALIITVLQIVRIPNLKVGTVLLSCAFLYDIFWV  389

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK  FHESVMIVVARGD SGEDGIPMLLKIPRMFDPWGGYS+IGFGDI+LPGL+VAFS
Sbjct  390  FVSKRLFHESVMIVVARGDNSGEDGIPMLLKIPRMFDPWGGYSIIGFGDILLPGLVVAFS  449

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ K+LR GYF WAM AYG GLLITY+ALNLMDGHGQPALLYIVPFTLGTFLTLG
Sbjct  450  LRYDWLANKTLRAGYFFWAMFAYGFGLLITYVALNLMDGHGQPALLYIVPFTLGTFLTLG  509

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD*VNTAK  190
            KKRGDL  LW+KG+P+RPCPHV+LQ    +   K
Sbjct  510  KKRGDLGTLWSKGEPERPCPHVRLQECQELEEDK  543



>ref|XP_004298803.1| PREDICTED: signal peptide peptidase-like 2 [Fragaria vesca subsp. 
vesca]
 ref|XP_011463895.1| PREDICTED: signal peptide peptidase-like 2 [Fragaria vesca subsp. 
vesca]
Length=543

 Score =   365 bits (937),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 175/205 (85%), Positives = 192/205 (94%), Gaps = 0/205 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAV+R +S A IGQDILGIALIITVLQIVR+PNLKVGTVLL CAFLYD+FWV
Sbjct  331  FCIAFAVLWAVFRTISFAWIGQDILGIALIITVLQIVRIPNLKVGTVLLSCAFLYDIFWV  390

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK  FHESVMIVVARGD+SGEDGIPMLLKIPRMFDPWGGYS+IGFGDI+LPGLLVAFS
Sbjct  391  FVSKKVFHESVMIVVARGDRSGEDGIPMLLKIPRMFDPWGGYSIIGFGDILLPGLLVAFS  450

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ KSLR GYFLWAM+AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGT LTLG
Sbjct  451  LRYDWLASKSLRAGYFLWAMIAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTLLTLG  510

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQ  217
            KKRGDL  LW++G+P+R CPHV+L+
Sbjct  511  KKRGDLPILWSRGEPERLCPHVRLE  535



>ref|XP_010053243.1| PREDICTED: signal peptide peptidase-like 2 [Eucalyptus grandis]
 gb|KCW77498.1| hypothetical protein EUGRSUZ_D01835 [Eucalyptus grandis]
Length=545

 Score =   365 bits (936),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 173/211 (82%), Positives = 195/211 (92%), Gaps = 0/211 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYR  + A IGQDILGIALIITVLQIVR+PNLKVGTVLL CAFLYD+FWV
Sbjct  332  FCIAFAVVWAVYRNTNFAWIGQDILGIALIITVLQIVRIPNLKVGTVLLSCAFLYDIFWV  391

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK  F ESVMIVVARGD+SGEDGIPMLLKIPRMFDPWGGYS+IGFGDI+LPGL+VAFS
Sbjct  392  FVSKKLFKESVMIVVARGDRSGEDGIPMLLKIPRMFDPWGGYSIIGFGDILLPGLVVAFS  451

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ K+LR GYFLWAM+AYGLGLL+TY+ALNLMDGHGQPALLYIVPFTLGTFL LG
Sbjct  452  LRYDWLANKNLRAGYFLWAMLAYGLGLLVTYVALNLMDGHGQPALLYIVPFTLGTFLALG  511

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD*VN  199
            ++RGDLK LWT+G+P+RPCPHV+L  ++ V+
Sbjct  512  RRRGDLKVLWTRGEPERPCPHVRLHSSEEVD  542



>gb|KEH23364.1| signal peptide peptidase-like protein [Medicago truncatula]
Length=399

 Score =   360 bits (923),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 176/210 (84%), Positives = 192/210 (91%), Gaps = 2/210 (1%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+W V RRVS A IGQDILGIALIITVLQIV++PNLKVGTVLL CAFLYD+FWV
Sbjct  189  FCIAFAVVWGVERRVSYAWIGQDILGIALIITVLQIVQIPNLKVGTVLLSCAFLYDIFWV  248

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK  FHESVMIVVARGDKSGEDGIPMLLKIPR+FDPWGGYSVIGFGDIILPGLLVAFS
Sbjct  249  FVSKLIFHESVMIVVARGDKSGEDGIPMLLKIPRLFDPWGGYSVIGFGDIILPGLLVAFS  308

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+K++LR+GYFLW M AYGLGLL+TY+ALNLMDGHGQPALLYIVPFTLGTFL+LG
Sbjct  309  LRYDWLAKRNLRSGYFLWTMSAYGLGLLVTYIALNLMDGHGQPALLYIVPFTLGTFLSLG  368

Query  291  KKRGDLKHLWTKGDPDRPCPHVQL--QPAD  208
            KKRG+L+ LWT+G P  PCPH+Q   QP D
Sbjct  369  KKRGELEILWTRGMPKMPCPHIQENHQPVD  398



>gb|EYU38342.1| hypothetical protein MIMGU_mgv1a004184mg [Erythranthe guttata]
Length=540

 Score =   364 bits (934),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 176/205 (86%), Positives = 191/205 (93%), Gaps = 0/205 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYR VS A IGQDILGIALIITVLQIVR+PNLKVGTVLL CAF+YD+FWV
Sbjct  330  FCIAFAVVWAVYRDVSFAWIGQDILGIALIITVLQIVRIPNLKVGTVLLSCAFIYDIFWV  389

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK  F ESVMIVVARGD+SGEDGIPMLLKIPR+FDPWGGYS+IGFGDI+LPGLLVAFS
Sbjct  390  FVSKKLFKESVMIVVARGDRSGEDGIPMLLKIPRLFDPWGGYSIIGFGDILLPGLLVAFS  449

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ KSLR GYFLWAM AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGTFL LG
Sbjct  450  LRYDWLANKSLRAGYFLWAMFAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTFLALG  509

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQ  217
            +KRGDLK LWT+G+PDR CPHV+L+
Sbjct  510  RKRGDLKILWTRGEPDRVCPHVRLE  534



>ref|XP_008338843.1| PREDICTED: signal peptide peptidase-like 4 [Malus domestica]
Length=535

 Score =   363 bits (932),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 174/208 (84%), Positives = 185/208 (89%), Gaps = 0/208 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FC  FA  WAVY         QDILGIALIITVLQ+VR+PNLKVGTVLL CAFLYD+FWV
Sbjct  327  FCXXFAXXWAVYXXXXFXWXXQDILGIALIITVLQLVRIPNLKVGTVLLSCAFLYDIFWV  386

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYS+IGFGDIILPGL+VAFS
Sbjct  387  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSIIGFGDIILPGLVVAFS  446

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ K LR GYFLWAM AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGTFLTLG
Sbjct  447  LRYDWLANKKLRAGYFLWAMTAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTFLTLG  506

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD  208
              RGDLK LWT+G+P+RPCPHV LQP+ 
Sbjct  507  HMRGDLKVLWTRGEPERPCPHVHLQPSS  534



>gb|ABN06072.1| Protease-associated PA; Peptidase A22B, minor histocompatibility 
antigen H13 [Medicago truncatula]
Length=492

 Score =   362 bits (928),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 176/210 (84%), Positives = 192/210 (91%), Gaps = 2/210 (1%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+W V RRVS A IGQDILGIALIITVLQIV++PNLKVGTVLL CAFLYD+FWV
Sbjct  282  FCIAFAVVWGVERRVSYAWIGQDILGIALIITVLQIVQIPNLKVGTVLLSCAFLYDIFWV  341

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK  FHESVMIVVARGDKSGEDGIPMLLKIPR+FDPWGGYSVIGFGDIILPGLLVAFS
Sbjct  342  FVSKLIFHESVMIVVARGDKSGEDGIPMLLKIPRLFDPWGGYSVIGFGDIILPGLLVAFS  401

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+K++LR+GYFLW M AYGLGLL+TY+ALNLMDGHGQPALLYIVPFTLGTFL+LG
Sbjct  402  LRYDWLAKRNLRSGYFLWTMSAYGLGLLVTYIALNLMDGHGQPALLYIVPFTLGTFLSLG  461

Query  291  KKRGDLKHLWTKGDPDRPCPHVQL--QPAD  208
            KKRG+L+ LWT+G P  PCPH+Q   QP D
Sbjct  462  KKRGELEILWTRGMPKMPCPHIQENHQPVD  491



>ref|XP_003538333.1| PREDICTED: signal peptide peptidase-like 2-like [Glycine max]
 gb|KHN35026.1| Signal peptide peptidase-like 2B [Glycine soja]
Length=543

 Score =   363 bits (932),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 171/205 (83%), Positives = 191/205 (93%), Gaps = 0/205 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYR VS A IGQDILGIALIITVLQIV VPNLKVGTVLLGCAF+YD+FWV
Sbjct  331  FCITFAVLWAVYRNVSFAWIGQDILGIALIITVLQIVHVPNLKVGTVLLGCAFIYDIFWV  390

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK +F ESVMIVVARGD+SGEDGIPMLLK PR+FDPWGGYS+IGFGDI+LPG+LVAFS
Sbjct  391  FVSKKFFKESVMIVVARGDRSGEDGIPMLLKFPRIFDPWGGYSIIGFGDILLPGMLVAFS  450

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ KSLR+GYFLWAM+AYG GLLITY+ALNLMDGHGQPALLYIVPFTLGT +TLG
Sbjct  451  LRYDWLANKSLRSGYFLWAMVAYGFGLLITYVALNLMDGHGQPALLYIVPFTLGTLMTLG  510

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQ  217
            +KRGDL+ LWT G+P+ PCPH++LQ
Sbjct  511  RKRGDLRVLWTSGEPETPCPHIRLQ  535



>ref|XP_004245597.1| PREDICTED: signal peptide peptidase-like 2 [Solanum lycopersicum]
Length=544

 Score =   363 bits (931),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 174/211 (82%), Positives = 194/211 (92%), Gaps = 0/211 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WA+YR  S   IGQDILGIALIITVLQIVR+PNLKVG+VLLGCAF+YD+FWV
Sbjct  331  FCITFAVVWAMYRNSSFGWIGQDILGIALIITVLQIVRIPNLKVGSVLLGCAFIYDIFWV  390

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F S+  FHESVMIVVARGDKSGEDGIPMLLKIPR+FDPWGGYS+IGFGDI+LPGLLVAFS
Sbjct  391  FASQSLFHESVMIVVARGDKSGEDGIPMLLKIPRLFDPWGGYSIIGFGDILLPGLLVAFS  450

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+KK+LR GYFLWAM+AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGTFL LG
Sbjct  451  LRYDWLAKKNLRAGYFLWAMIAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTFLMLG  510

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD*VN  199
            +KRGDLK LWTKG+P+R CPHV+L+  +  N
Sbjct  511  RKRGDLKILWTKGEPERVCPHVRLESIEESN  541



>ref|XP_010544387.1| PREDICTED: signal peptide peptidase-like 4 [Tarenaya hassleriana]
Length=539

 Score =   363 bits (931),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 173/208 (83%), Positives = 190/208 (91%), Gaps = 0/208 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYR VS A IGQDILGI+LIITVLQIVRVPNLKVG VLL CAF+YD+FWV
Sbjct  331  FCITFAVVWAVYRDVSFAWIGQDILGISLIITVLQIVRVPNLKVGFVLLSCAFMYDIFWV  390

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKWWF ESVMIVVARGD+SGEDGIPMLLKIPRMFDPWGGYS+IGFGDIILPGLLV F+
Sbjct  391  FVSKWWFRESVMIVVARGDRSGEDGIPMLLKIPRMFDPWGGYSIIGFGDIILPGLLVTFA  450

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ KSL++GYF+ AM AYG GLL+TY+ALNLMDGHGQPALLYIVPFTLGT + LG
Sbjct  451  LRYDWLANKSLKSGYFVGAMTAYGFGLLVTYVALNLMDGHGQPALLYIVPFTLGTLILLG  510

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD  208
             KRGDLK LWT G+PDRPCPHV+LQP+ 
Sbjct  511  HKRGDLKTLWTIGEPDRPCPHVRLQPSQ  538



>ref|XP_009396168.1| PREDICTED: signal peptide peptidase-like 4 [Musa acuminata subsp. 
malaccensis]
Length=531

 Score =   362 bits (930),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 172/203 (85%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCIVFAV+WAVYRRVS A IGQDILGIALIITVLQIVRVPNLKVGTVLL CAFLYD+FWV
Sbjct  326  FCIVFAVVWAVYRRVSFAWIGQDILGIALIITVLQIVRVPNLKVGTVLLSCAFLYDIFWV  385

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F+SK WFHESVMIVVARGD++ EDG+PMLLKIPR+FDPWGGYS+IGFGDI+LPGLL+AFS
Sbjct  386  FISKSWFHESVMIVVARGDRTAEDGVPMLLKIPRLFDPWGGYSIIGFGDILLPGLLIAFS  445

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDW +KKSLR GYFLW+M+AYG GLLITY+ALNLMDGHGQPALLYIVPFTLGTFL LG
Sbjct  446  LRYDWAAKKSLRAGYFLWSMVAYGSGLLITYVALNLMDGHGQPALLYIVPFTLGTFLALG  505

Query  291  KKRGDLKHLWTKGDPDRPCPHVQ  223
            +KRG+L +LWT+G+P R CPHVQ
Sbjct  506  RKRGELINLWTQGEPPRVCPHVQ  528



>ref|XP_002303595.2| protease-associated domain-containing family protein [Populus 
trichocarpa]
 gb|EEE78574.2| protease-associated domain-containing family protein [Populus 
trichocarpa]
Length=539

 Score =   362 bits (930),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 174/208 (84%), Positives = 192/208 (92%), Gaps = 0/208 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYR VS A IGQDILGIALIITVLQIV VPNLKVGTVLL CAFLYD+FWV
Sbjct  329  FCIAFAVVWAVYRTVSFAWIGQDILGIALIITVLQIVHVPNLKVGTVLLSCAFLYDIFWV  388

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK  FHESVMIVVARGD+SGEDGIPMLLKIPR+FDPWGGYS+IGFGDI+LPGLL+AFS
Sbjct  389  FVSKKVFHESVMIVVARGDRSGEDGIPMLLKIPRLFDPWGGYSIIGFGDILLPGLLIAFS  448

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ KSLR GYF WAM+AYGLGLL+TY+ALNLMDGHGQPALLYIVPFTLGTFL LG
Sbjct  449  LRYDWLATKSLRAGYFPWAMLAYGLGLLVTYVALNLMDGHGQPALLYIVPFTLGTFLALG  508

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD  208
            KKRGDL+ LWT+G+P+ PC HV+LQ ++
Sbjct  509  KKRGDLRVLWTQGEPETPCSHVRLQHSE  536



>ref|XP_009600060.1| PREDICTED: signal peptide peptidase-like 2 [Nicotiana tomentosiformis]
Length=543

 Score =   362 bits (929),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 173/208 (83%), Positives = 191/208 (92%), Gaps = 0/208 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYR  S   IGQDILGI LIITVLQIVR+PNLKVGTVLLGCAF+YD+FWV
Sbjct  333  FCITFAVVWAVYRNSSFGWIGQDILGITLIITVLQIVRIPNLKVGTVLLGCAFIYDIFWV  392

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F S+  FHESVMIVVARGDKSGEDGIPMLLKIPR+FDPWGGYS+IGFGDI+LPGLLVAFS
Sbjct  393  FASQRLFHESVMIVVARGDKSGEDGIPMLLKIPRLFDPWGGYSIIGFGDILLPGLLVAFS  452

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+KK+LR GYFLWAM+AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGTFL LG
Sbjct  453  LRYDWLAKKNLRAGYFLWAMIAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTFLMLG  512

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD  208
             KRGDLK LWTKG+P+R CPH++L+  +
Sbjct  513  TKRGDLKILWTKGEPERVCPHIRLESKE  540



>ref|XP_009780084.1| PREDICTED: signal peptide peptidase-like 2 [Nicotiana sylvestris]
Length=546

 Score =   362 bits (929),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 173/208 (83%), Positives = 191/208 (92%), Gaps = 0/208 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYR  S   IGQDILGI LIITVLQIVR+PNLKVGTVLLGCAF+YD+FWV
Sbjct  333  FCITFAVVWAVYRNSSFGWIGQDILGITLIITVLQIVRIPNLKVGTVLLGCAFIYDIFWV  392

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F S+  FHESVMIVVARGDKSGEDGIPMLLKIPR+FDPWGGYS+IGFGDI+LPGLLVAFS
Sbjct  393  FASQRLFHESVMIVVARGDKSGEDGIPMLLKIPRLFDPWGGYSIIGFGDILLPGLLVAFS  452

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+KK+LR GYFLWAM+AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGTFL LG
Sbjct  453  LRYDWLAKKNLRAGYFLWAMIAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTFLILG  512

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD  208
             KRGDLK LWTKG+P+R CPH++L+  +
Sbjct  513  TKRGDLKILWTKGEPERVCPHIRLESKE  540



>gb|KHN42194.1| Signal peptide peptidase-like 2B [Glycine soja]
Length=555

 Score =   362 bits (930),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 177/216 (82%), Positives = 192/216 (89%), Gaps = 13/216 (6%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCIVFAV+WAVYR  S A IGQDILGI LIITVLQIVR+PNLKVGTVLL CAFLYD+FWV
Sbjct  330  FCIVFAVVWAVYRHASFAWIGQDILGITLIITVLQIVRIPNLKVGTVLLSCAFLYDIFWV  389

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK WFHESVMIVVARGDKSGEDGIPMLLKIPR+FDPWGGYS+IGFGDIILPGL+VAFS
Sbjct  390  FVSKRWFHESVMIVVARGDKSGEDGIPMLLKIPRLFDPWGGYSIIGFGDIILPGLIVAFS  449

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTL-------  313
            LRYDWL+KK+LR GYFLWAM AYGLGLLITY+ALNLMDGHGQPALLYIVPFTL       
Sbjct  450  LRYDWLAKKNLRAGYFLWAMTAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGKYCMTL  509

Query  312  ------GTFLTLGKKRGDLKHLWTKGDPDRPCPHVQ  223
                  GTFL+LGKKRG+LK LWT+G+P+R CPH+Q
Sbjct  510  KSGPFSGTFLSLGKKRGELKILWTRGEPERHCPHIQ  545



>ref|XP_006343972.1| PREDICTED: signal peptide peptidase-like 2-like [Solanum tuberosum]
Length=544

 Score =   362 bits (928),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 174/204 (85%), Positives = 190/204 (93%), Gaps = 0/204 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYR  S   IGQDILGIALIITVLQIVR+PNLKVG+VLLGCAF+YD+FWV
Sbjct  331  FCITFAVVWAVYRNSSFGWIGQDILGIALIITVLQIVRIPNLKVGSVLLGCAFIYDIFWV  390

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F S+  FHESVMIVVARGDKSGEDGIPMLLKIPR+FDPWGGYS+IGFGDI+LPGLLVAFS
Sbjct  391  FASQSLFHESVMIVVARGDKSGEDGIPMLLKIPRLFDPWGGYSIIGFGDILLPGLLVAFS  450

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+KK+LR GYFLWAM+AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGTFL LG
Sbjct  451  LRYDWLAKKNLRAGYFLWAMIAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTFLMLG  510

Query  291  KKRGDLKHLWTKGDPDRPCPHVQL  220
            +KRGDLK LWTKG+P+R CPHV L
Sbjct  511  RKRGDLKILWTKGEPERVCPHVCL  534



>ref|XP_003623971.1| Signal peptide peptidase-like 2B [Medicago truncatula]
 gb|AES80189.1| signal peptide peptidase-like protein [Medicago truncatula]
Length=537

 Score =   361 bits (927),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 176/210 (84%), Positives = 192/210 (91%), Gaps = 2/210 (1%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+W V RRVS A IGQDILGIALIITVLQIV++PNLKVGTVLL CAFLYD+FWV
Sbjct  327  FCIAFAVVWGVERRVSYAWIGQDILGIALIITVLQIVQIPNLKVGTVLLSCAFLYDIFWV  386

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK  FHESVMIVVARGDKSGEDGIPMLLKIPR+FDPWGGYSVIGFGDIILPGLLVAFS
Sbjct  387  FVSKLIFHESVMIVVARGDKSGEDGIPMLLKIPRLFDPWGGYSVIGFGDIILPGLLVAFS  446

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+K++LR+GYFLW M AYGLGLL+TY+ALNLMDGHGQPALLYIVPFTLGTFL+LG
Sbjct  447  LRYDWLAKRNLRSGYFLWTMSAYGLGLLVTYIALNLMDGHGQPALLYIVPFTLGTFLSLG  506

Query  291  KKRGDLKHLWTKGDPDRPCPHVQL--QPAD  208
            KKRG+L+ LWT+G P  PCPH+Q   QP D
Sbjct  507  KKRGELEILWTRGMPKMPCPHIQENHQPVD  536



>emb|CDP12034.1| unnamed protein product [Coffea canephora]
Length=368

 Score =   355 bits (912),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 172/205 (84%), Positives = 188/205 (92%), Gaps = 0/205 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYR  S   IGQDILGIALIITV+QIVRVPNLKVGTVLL CAFLYD+FWV
Sbjct  160  FCIAFAVIWAVYRNASFGWIGQDILGIALIITVIQIVRVPNLKVGTVLLSCAFLYDIFWV  219

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK  FHESVMIVVARGD+SGEDGIPMLLKIPR+FDPWGG+S+IGFGDI+LPGLL+AFS
Sbjct  220  FVSKSLFHESVMIVVARGDRSGEDGIPMLLKIPRLFDPWGGFSIIGFGDILLPGLLIAFS  279

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYD L+KK+LR GYFLWAM AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGTF+ LG
Sbjct  280  LRYDCLAKKNLRAGYFLWAMFAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTFIALG  339

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQ  217
            K RGDLK LWTKG+P+R CPHV L+
Sbjct  340  KMRGDLKILWTKGEPERVCPHVGLE  364



>ref|XP_010545677.1| PREDICTED: signal peptide peptidase-like 2 [Tarenaya hassleriana]
Length=545

 Score =   361 bits (927),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 169/205 (82%), Positives = 191/205 (93%), Gaps = 0/205 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCIVF+V+WA+YR VS A IGQ+ILGIALIITVLQIV VPNLKVGTVLL CAFLYD+FWV
Sbjct  330  FCIVFSVLWAIYRDVSFAWIGQNILGIALIITVLQIVHVPNLKVGTVLLSCAFLYDIFWV  389

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F+SK  FHESVMIVVARGD+SGEDGIPMLLKIPRMFDPWGGYS+IGFGDI+LPGLL+AFS
Sbjct  390  FISKKLFHESVMIVVARGDRSGEDGIPMLLKIPRMFDPWGGYSIIGFGDILLPGLLIAFS  449

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ K+LRTGYF+WA+ AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGT +TL 
Sbjct  450  LRYDWLANKTLRTGYFIWAVTAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTLITLS  509

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQ  217
            +KRGD   LWTKG+P+RPCPH++L+
Sbjct  510  RKRGDFNVLWTKGEPERPCPHIRLE  534



>ref|XP_010670265.1| PREDICTED: signal peptide peptidase-like 4 [Beta vulgaris subsp. 
vulgaris]
Length=536

 Score =   361 bits (926),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 172/208 (83%), Positives = 189/208 (91%), Gaps = 0/208 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI+ +V+W VYRR   A IGQDILGIALI+TVLQIVRVPNLKVGTVLL CAF YD+FWV
Sbjct  329  FCILCSVLWGVYRREPYAWIGQDILGIALILTVLQIVRVPNLKVGTVLLSCAFFYDIFWV  388

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK  FHESVMIVVARGD SGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGL++AFS
Sbjct  389  FVSKSIFHESVMIVVARGDNSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLVIAFS  448

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL  K +R GYFLW M AYGLGLL+TY+ALNLMDGHGQPALLYIVPFTLGTFLTLG
Sbjct  449  LRYDWLGNKKIRAGYFLWGMTAYGLGLLVTYVALNLMDGHGQPALLYIVPFTLGTFLTLG  508

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD  208
            +KRG+LK+LWT+G+PDRPCPHV+L P+ 
Sbjct  509  RKRGELKNLWTRGEPDRPCPHVRLPPSQ  536



>ref|XP_010474771.1| PREDICTED: signal peptide peptidase-like 4 [Camelina sativa]
Length=541

 Score =   361 bits (926),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 171/208 (82%), Positives = 186/208 (89%), Gaps = 0/208 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAV R+ S A IGQDILGI+LIITVLQIVRVPNLKVG VLL CAF+YD+FWV
Sbjct  332  FCITFAVIWAVKRQYSFAWIGQDILGISLIITVLQIVRVPNLKVGFVLLSCAFMYDIFWV  391

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKWWF ESVMIVVARGD+SGEDGIPMLLKIPRMFDPWGGYS+IGFGDIILPGLLV F+
Sbjct  392  FVSKWWFRESVMIVVARGDRSGEDGIPMLLKIPRMFDPWGGYSIIGFGDIILPGLLVTFA  451

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ K L++GYFLW M AYGLGLLITY+ALNLMDGHGQPALLYIVPF LGT   LG
Sbjct  452  LRYDWLANKKLKSGYFLWTMSAYGLGLLITYIALNLMDGHGQPALLYIVPFILGTLFVLG  511

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD  208
             KRGDLK LWT G+P+RPCPHV+LQP  
Sbjct  512  HKRGDLKTLWTTGEPERPCPHVRLQPQS  539



>ref|XP_004492745.1| PREDICTED: signal peptide peptidase-like 4-like [Cicer arietinum]
Length=545

 Score =   360 bits (925),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 173/203 (85%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+W V R  S A IGQDILGIALIITVLQIV +PNLKVGTVLL CAFLYD+FWV
Sbjct  335  FCIAFAVLWGVKRHASFAWIGQDILGIALIITVLQIVHIPNLKVGTVLLSCAFLYDIFWV  394

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK WFHESVMIVVARGDKSGEDGIPMLLKIPR++DPWGGYSVIGFGDIILPGLLVAFS
Sbjct  395  FVSKCWFHESVMIVVARGDKSGEDGIPMLLKIPRLYDPWGGYSVIGFGDIILPGLLVAFS  454

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL K++LR+GYFLWAM AYGLGLL+TY+ALNLMDGHGQPALLYIVPFTLGTFL+LG
Sbjct  455  LRYDWLVKRNLRSGYFLWAMGAYGLGLLVTYIALNLMDGHGQPALLYIVPFTLGTFLSLG  514

Query  291  KKRGDLKHLWTKGDPDRPCPHVQ  223
            KKRG+LK LWT+G P  PCPH+Q
Sbjct  515  KKRGELKILWTRGQPKMPCPHIQ  537



>ref|NP_001030930.1| signal peptide peptidase-like 4 [Arabidopsis thaliana]
 gb|AEE27318.1| signal peptide peptidase-like 4 [Arabidopsis thaliana]
Length=398

 Score =   355 bits (912),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 171/208 (82%), Positives = 184/208 (88%), Gaps = 0/208 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV WAV R+ S A IGQDILGI+LIITVLQIVRVPNLKVG VLL CAF+YD+FWV
Sbjct  190  FCIAFAVFWAVKRQYSYAWIGQDILGISLIITVLQIVRVPNLKVGFVLLSCAFMYDIFWV  249

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKWWF ESVMIVVARGD+SGEDGIPMLLKIPRMFDPWGGYS+IGFGDIILPGLLV F+
Sbjct  250  FVSKWWFRESVMIVVARGDRSGEDGIPMLLKIPRMFDPWGGYSIIGFGDIILPGLLVTFA  309

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ K L++GYFL  M AYGLGLLITY+ALNLMDGHGQPALLYIVPF LGT   LG
Sbjct  310  LRYDWLANKRLKSGYFLGTMSAYGLGLLITYIALNLMDGHGQPALLYIVPFILGTLFVLG  369

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD  208
             KRGDLK LWT G+PDRPCPHV+LQP  
Sbjct  370  HKRGDLKTLWTTGEPDRPCPHVRLQPQS  397



>ref|XP_011022676.1| PREDICTED: signal peptide peptidase-like 2 [Populus euphratica]
Length=541

 Score =   359 bits (921),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 173/208 (83%), Positives = 188/208 (90%), Gaps = 0/208 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV WAVYR VS A IGQDILGIALIITVLQIV VPNLKVGTVLL CAFLYD+FWV
Sbjct  331  FCIAFAVAWAVYRTVSFAWIGQDILGIALIITVLQIVHVPNLKVGTVLLSCAFLYDIFWV  390

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK  FHESVMIVVARGD+SGEDGIPMLLKIPR+FDPWGGYS+IGFGDI+LPGLL+AFS
Sbjct  391  FVSKKLFHESVMIVVARGDRSGEDGIPMLLKIPRLFDPWGGYSIIGFGDILLPGLLIAFS  450

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ KSLR GYF WAM AYGLGLL+TY+ALNLMDGHGQPALLYIVPFTLGTFL LG
Sbjct  451  LRYDWLATKSLRAGYFPWAMFAYGLGLLVTYVALNLMDGHGQPALLYIVPFTLGTFLALG  510

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD  208
            KKRGDL+ LWT+G+P+ PC H +LQ  +
Sbjct  511  KKRGDLRVLWTQGEPETPCSHFRLQHGE  538



>ref|XP_006827582.1| PREDICTED: signal peptide peptidase-like 4 [Amborella trichopoda]
 gb|ERM94998.1| hypothetical protein AMTR_s00009p00232070 [Amborella trichopoda]
Length=531

 Score =   358 bits (920),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 167/203 (82%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYRR+S A IGQDILGIALI TVLQIVR+PNLKV TVLL CAFLYD+FWV
Sbjct  327  FCIAFAVIWAVYRRISFAWIGQDILGIALITTVLQIVRIPNLKVATVLLSCAFLYDIFWV  386

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVS  WFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGG+S+IGFGDI+LPGLL+AF+
Sbjct  387  FVSPRWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGFSIIGFGDILLPGLLIAFT  446

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDW +KK+LR GYFLW+M+AYG GLL+TY+ALNLMDG+GQPALLYIVPFTLGT L+LG
Sbjct  447  LRYDWAAKKNLRAGYFLWSMIAYGFGLLVTYIALNLMDGNGQPALLYIVPFTLGTVLSLG  506

Query  291  KKRGDLKHLWTKGDPDRPCPHVQ  223
            +KRG+L++LWTKG+PDR CPH+Q
Sbjct  507  RKRGELQNLWTKGEPDRVCPHIQ  529



>ref|XP_009119715.1| PREDICTED: signal peptide peptidase-like 4 [Brassica rapa]
Length=540

 Score =   358 bits (920),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 172/208 (83%), Positives = 188/208 (90%), Gaps = 0/208 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCIV AV+WAVYR+ S A IGQDILGI+LIITVLQIVRVPNLKVG VLL CAF+YD+FWV
Sbjct  333  FCIVSAVIWAVYRQYSFAWIGQDILGISLIITVLQIVRVPNLKVGVVLLSCAFMYDIFWV  392

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKWWF ESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYS+IGFGDIILPGLLV F+
Sbjct  393  FVSKWWFRESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSIIGFGDIILPGLLVTFA  452

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ K L++GYFL AM AYGLGLLITY+ALNLMDGHGQPALLYIVPF LGT + LG
Sbjct  453  LRYDWLANKKLKSGYFLGAMSAYGLGLLITYIALNLMDGHGQPALLYIVPFILGTLIVLG  512

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD  208
             KRGDL+ LWT G+P+RPCPHV+LQP  
Sbjct  513  HKRGDLETLWTTGEPERPCPHVRLQPQS  540



>emb|CDX90049.1| BnaA10g00330D [Brassica napus]
Length=540

 Score =   358 bits (920),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 172/206 (83%), Positives = 188/206 (91%), Gaps = 0/206 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCIV AV+WAVYR+ S A IGQDILGI+LIITVLQIVRVPNLKVG VLL CAF+YD+FWV
Sbjct  333  FCIVSAVIWAVYRQYSFAWIGQDILGISLIITVLQIVRVPNLKVGVVLLSCAFMYDIFWV  392

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKWWF ESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYS+IGFGDIILPGLLV F+
Sbjct  393  FVSKWWFRESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSIIGFGDIILPGLLVTFA  452

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ K L++GYFL AM AYGLGLLITY+ALNLMDGHGQPALLYIVPF LGT + LG
Sbjct  453  LRYDWLANKKLKSGYFLGAMSAYGLGLLITYIALNLMDGHGQPALLYIVPFILGTLIVLG  512

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQP  214
             KRGDL+ LWT G+P+RPCPHV+LQP
Sbjct  513  HKRGDLETLWTTGEPERPCPHVRLQP  538



>ref|XP_010326969.1| PREDICTED: signal peptide peptidase-like 4 isoform X2 [Solanum 
lycopersicum]
Length=397

 Score =   353 bits (906),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 170/208 (82%), Positives = 186/208 (89%), Gaps = 0/208 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FC+ FA+MWAV+R VS A IGQDILG+ALIITVLQI+RVPNLKVGTVLL CAF YD+FWV
Sbjct  190  FCLAFAIMWAVFRHVSFAWIGQDILGMALIITVLQIIRVPNLKVGTVLLTCAFFYDIFWV  249

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKW FH+SVMI VARG KSGE+GIPMLLKIPR+ DPWGGYS+IGFGDIILPGLLVAFS
Sbjct  250  FVSKWVFHKSVMIEVARGYKSGEEGIPMLLKIPRICDPWGGYSIIGFGDIILPGLLVAFS  309

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL KKSLR GYFLW M AYGLGL  TY+ALNLMDGHGQPALLYIVP TLGTFL L 
Sbjct  310  LRYDWLCKKSLRAGYFLWTMTAYGLGLFATYVALNLMDGHGQPALLYIVPSTLGTFLMLS  369

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD  208
             KRG+LKHLWT+G+P R CPH+QLQPA+
Sbjct  370  AKRGELKHLWTRGEPYRICPHIQLQPAE  397



>ref|XP_010680813.1| PREDICTED: signal peptide peptidase-like 2 [Beta vulgaris subsp. 
vulgaris]
Length=535

 Score =   358 bits (918),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 169/208 (81%), Positives = 187/208 (90%), Gaps = 0/208 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+W VYR +  A IGQD+LGIALI+TV+QIVR+PNLKVGTVLL CA LYDLFWV
Sbjct  322  FCITFAVLWGVYRDLHFAWIGQDVLGIALILTVIQIVRIPNLKVGTVLLSCALLYDLFWV  381

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F+SK  FHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYS+IGFGDI+LPGLL+AFS
Sbjct  382  FLSKKLFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSIIGFGDILLPGLLIAFS  441

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+KK+LR GYFLW M+AYGLGL ITY+ALNLMDGHGQPALLYIVPFTLGT   LG
Sbjct  442  LRYDWLAKKNLRAGYFLWTMIAYGLGLFITYVALNLMDGHGQPALLYIVPFTLGTLFMLG  501

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD  208
            +KRGDLK LWT G+PDRPC H+ LQ +D
Sbjct  502  RKRGDLKKLWTTGEPDRPCSHMHLQMSD  529



>dbj|BAF01633.1| hypothetical protein [Arabidopsis thaliana]
Length=269

 Score =   348 bits (893),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 171/201 (85%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCIVFAV+WAVYR  S A IGQD+LGIALIITVLQIV VPNLKVGTVLL CAFLYD+FWV
Sbjct  59   FCIVFAVLWAVYRVHSFAWIGQDVLGIALIITVLQIVHVPNLKVGTVLLSCAFLYDIFWV  118

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK  FHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYS+IGFGDI+LPGLL+AF+
Sbjct  119  FVSKKLFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSIIGFGDILLPGLLIAFA  178

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ K+LRTGYF+WAM+AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGT LTL 
Sbjct  179  LRYDWLANKTLRTGYFIWAMVAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTMLTLA  238

Query  291  KKRGDLKHLWTKGDPDRPCPH  229
            +KR DL  LWTKG+P+R CPH
Sbjct  239  RKRDDLWILWTKGEPERACPH  259



>ref|XP_002887944.1| protease-associated domain-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH64203.1| protease-associated domain-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=540

 Score =   357 bits (917),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 174/209 (83%), Positives = 192/209 (92%), Gaps = 1/209 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCIVFAV+WAVYR  S A IGQD+LGIALIITVLQIV VPNLKVGTVLL CAFLYD+FWV
Sbjct  330  FCIVFAVLWAVYRVHSFAWIGQDVLGIALIITVLQIVHVPNLKVGTVLLSCAFLYDIFWV  389

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK  FHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYS+IGFGDI+LPGLL+AF+
Sbjct  390  FVSKKLFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSIIGFGDILLPGLLIAFA  449

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ K+LRTGYF+WAM+AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGT +TL 
Sbjct  450  LRYDWLANKTLRTGYFIWAMVAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTMVTLA  509

Query  291  KKRGDLKHLWTKGDPDRPCP-HVQLQPAD  208
            +KRGDL  LWTKG+P+R CP HV+L+P  
Sbjct  510  RKRGDLWILWTKGEPERACPHHVRLEPCS  538



>gb|KDO86179.1| hypothetical protein CISIN_1g009437mg [Citrus sinensis]
Length=525

 Score =   357 bits (916),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 170/207 (82%), Positives = 187/207 (90%), Gaps = 10/207 (5%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI F+V+WAVYRR+S A IGQDIL          IVRVPNLKVGTVLL CAFLYD+FWV
Sbjct  329  FCIAFSVVWAVYRRISFAWIGQDIL----------IVRVPNLKVGTVLLSCAFLYDIFWV  378

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKWWFHESVMIVVARGD+SGEDGIPMLLKIPR+FDPWGGYSVIGFGDIILPGL+VAFS
Sbjct  379  FVSKWWFHESVMIVVARGDRSGEDGIPMLLKIPRLFDPWGGYSVIGFGDIILPGLIVAFS  438

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL KK+ R+GYF+WAM AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGTFLTLG
Sbjct  439  LRYDWLMKKNFRSGYFVWAMTAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTFLTLG  498

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPA  211
            KKRG+LK LWT+G+P+R CPH+QLQ +
Sbjct  499  KKRGELKTLWTRGEPERACPHIQLQSS  525



>ref|XP_006418441.1| hypothetical protein EUTSA_v10007312mg [Eutrema salsugineum]
 gb|ESQ36794.1| hypothetical protein EUTSA_v10007312mg [Eutrema salsugineum]
Length=538

 Score =   357 bits (916),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 169/208 (81%), Positives = 185/208 (89%), Gaps = 0/208 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV WAV R+ S A IGQDILGI+LIITVLQIVRVPNLKVG VLL CAF+YD+FWV
Sbjct  331  FCIAFAVTWAVCRQNSLAWIGQDILGISLIITVLQIVRVPNLKVGVVLLSCAFMYDIFWV  390

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKWWF ESVMIVVARGD+SGEDGIPMLLKIPRMFDPWGGYS+IGFGDIILPGLLV F+
Sbjct  391  FVSKWWFRESVMIVVARGDRSGEDGIPMLLKIPRMFDPWGGYSIIGFGDIILPGLLVTFA  450

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ K L++GYFL  M AYGLGLL+TY+ALNLMDGHGQPALLYIVPF LGT + LG
Sbjct  451  LRYDWLANKRLKSGYFLGTMSAYGLGLLVTYIALNLMDGHGQPALLYIVPFILGTLIVLG  510

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD  208
             KRGDLK LWT G+P+RPCPHV+LQP  
Sbjct  511  HKRGDLKTLWTTGEPERPCPHVRLQPQS  538



>emb|CDY15163.1| BnaC05g00420D [Brassica napus]
Length=540

 Score =   357 bits (916),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 171/206 (83%), Positives = 187/206 (91%), Gaps = 0/206 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCIV AV+WAVYR+ S A IGQDILGI+LIITVLQIVRVPNLKVG VLL CAF+YD+FWV
Sbjct  333  FCIVSAVIWAVYRQYSFAWIGQDILGISLIITVLQIVRVPNLKVGVVLLSCAFMYDIFWV  392

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKWWF ESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYS+IGFGDIILPGLLV F+
Sbjct  393  FVSKWWFRESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSIIGFGDIILPGLLVTFA  452

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ K L++GYFL AM AYGLGLLITY+ALNLMDGHGQPALLYIVPF LGT + LG
Sbjct  453  LRYDWLANKKLKSGYFLGAMSAYGLGLLITYIALNLMDGHGQPALLYIVPFILGTLIVLG  512

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQP  214
             KRGDL+ LWT G+P+RPCPH +LQP
Sbjct  513  HKRGDLETLWTTGEPERPCPHARLQP  538



>ref|NP_171671.2| signal peptide peptidase-like 4 [Arabidopsis thaliana]
 sp|Q0WMJ8.1|SIPL4_ARATH RecName: Full=Signal peptide peptidase-like 4; Short=AtSPPL4; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAF01653.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE27317.1| signal peptide peptidase-like 4 [Arabidopsis thaliana]
Length=540

 Score =   357 bits (915),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 171/208 (82%), Positives = 184/208 (88%), Gaps = 0/208 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV WAV R+ S A IGQDILGI+LIITVLQIVRVPNLKVG VLL CAF+YD+FWV
Sbjct  332  FCIAFAVFWAVKRQYSYAWIGQDILGISLIITVLQIVRVPNLKVGFVLLSCAFMYDIFWV  391

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKWWF ESVMIVVARGD+SGEDGIPMLLKIPRMFDPWGGYS+IGFGDIILPGLLV F+
Sbjct  392  FVSKWWFRESVMIVVARGDRSGEDGIPMLLKIPRMFDPWGGYSIIGFGDIILPGLLVTFA  451

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ K L++GYFL  M AYGLGLLITY+ALNLMDGHGQPALLYIVPF LGT   LG
Sbjct  452  LRYDWLANKRLKSGYFLGTMSAYGLGLLITYIALNLMDGHGQPALLYIVPFILGTLFVLG  511

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD  208
             KRGDLK LWT G+PDRPCPHV+LQP  
Sbjct  512  HKRGDLKTLWTTGEPDRPCPHVRLQPQS  539



>ref|XP_002889358.1| peptidase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65617.1| peptidase [Arabidopsis lyrata subsp. lyrata]
Length=540

 Score =   357 bits (915),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 171/208 (82%), Positives = 184/208 (88%), Gaps = 0/208 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV WAV R+ S A IGQDILGI+LIITVLQIVRVPNLKVG VLL CAF+YD+FWV
Sbjct  332  FCIAFAVFWAVKRQYSYAWIGQDILGISLIITVLQIVRVPNLKVGFVLLSCAFMYDIFWV  391

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKWWF ESVMIVVARGD+SGEDGIPMLLKIPRMFDPWGGYS+IGFGDIILPGLLV F+
Sbjct  392  FVSKWWFRESVMIVVARGDRSGEDGIPMLLKIPRMFDPWGGYSIIGFGDIILPGLLVTFA  451

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ K L++GYFL  M AYGLGLLITY+ALNLMDGHGQPALLYIVPF LGT   LG
Sbjct  452  LRYDWLANKRLKSGYFLGTMSAYGLGLLITYIALNLMDGHGQPALLYIVPFILGTLFVLG  511

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD  208
             KRGDLK LWT G+PDRPCPHV+LQP  
Sbjct  512  HKRGDLKTLWTTGEPDRPCPHVRLQPQS  539



>ref|XP_003517469.1| PREDICTED: signal peptide peptidase-like 2-like [Glycine max]
 gb|KHN25696.1| Signal peptide peptidase-like 2B [Glycine soja]
Length=543

 Score =   356 bits (913),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 188/204 (92%), Gaps = 0/204 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI F+++WAVYR  S A IGQDILGI LIITVLQIV VPNLKVGTVLLGCAF+YD+FWV
Sbjct  331  FCITFSILWAVYRNESFAWIGQDILGITLIITVLQIVHVPNLKVGTVLLGCAFIYDIFWV  390

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK +F ESVMIVVARGD+SGEDGIPMLLK PR+FDPWGGYS+IGFGDI+LPG+LVAFS
Sbjct  391  FVSKKFFKESVMIVVARGDRSGEDGIPMLLKFPRIFDPWGGYSIIGFGDILLPGMLVAFS  450

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ KSLR+GYFLWAM AYG GLL+TY+ALNLMDGHGQPALLYIVPFTLGT +TLG
Sbjct  451  LRYDWLANKSLRSGYFLWAMFAYGFGLLVTYVALNLMDGHGQPALLYIVPFTLGTLMTLG  510

Query  291  KKRGDLKHLWTKGDPDRPCPHVQL  220
            +KRGDL+ LWT G+P+RPCPH++L
Sbjct  511  RKRGDLRVLWTSGEPERPCPHIRL  534



>ref|XP_010480029.1| PREDICTED: signal peptide peptidase-like 4 isoform X2 [Camelina 
sativa]
Length=516

 Score =   355 bits (911),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 169/206 (82%), Positives = 185/206 (90%), Gaps = 0/206 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAV R+ S A IGQDILGI+LIITVLQIVRVPNLKVG VLL CAF+YD+FWV
Sbjct  307  FCITFAVIWAVKRQYSFAWIGQDILGISLIITVLQIVRVPNLKVGFVLLSCAFMYDIFWV  366

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKWWF ESVMIVVARGD+SGEDGIPMLLKIPRMFDPWGGYS+IGFGDIILPGLLV F+
Sbjct  367  FVSKWWFRESVMIVVARGDRSGEDGIPMLLKIPRMFDPWGGYSIIGFGDIILPGLLVTFA  426

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ K L++GYFL  M AYGLGLLITY+ALNLMDGHGQPALLYIVPF LGT   LG
Sbjct  427  LRYDWLANKRLKSGYFLGTMSAYGLGLLITYIALNLMDGHGQPALLYIVPFILGTLFVLG  486

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQP  214
             KRG+LK LWT G+P+RPCPHV+LQP
Sbjct  487  HKRGELKTLWTTGEPERPCPHVRLQP  512



>gb|KFK42519.1| hypothetical protein AALP_AA1G005000 [Arabis alpina]
Length=537

 Score =   355 bits (912),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 186/206 (90%), Gaps = 0/206 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAVMWAV R+   A IGQDILGI+LI+TVLQIV VPNLKVG VLL CAF+YD+FWV
Sbjct  330  FCITFAVMWAVKRQFPYAWIGQDILGISLIMTVLQIVHVPNLKVGFVLLSCAFMYDIFWV  389

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKWWF ESVMIVVARGD+SGEDGIPMLLKIPRMFDPWGGYS+IGFGDIILPGLLVAF+
Sbjct  390  FVSKWWFRESVMIVVARGDRSGEDGIPMLLKIPRMFDPWGGYSIIGFGDIILPGLLVAFA  449

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ K L++GYFL AM AYGLGLLITY+ALNLMDGHGQPALLYIVPF LGT + LG
Sbjct  450  LRYDWLANKKLKSGYFLGAMSAYGLGLLITYIALNLMDGHGQPALLYIVPFILGTLMVLG  509

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQP  214
             KRGDLK LWT G+P+RPCPHV+LQP
Sbjct  510  HKRGDLKTLWTTGEPERPCPHVRLQP  535



>ref|XP_006364152.1| PREDICTED: signal peptide peptidase-like 4-like [Solanum tuberosum]
Length=542

 Score =   355 bits (912),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 171/208 (82%), Positives = 185/208 (89%), Gaps = 0/208 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FC+ FAVMWAV+R VS A IGQDILG+ALIITVLQI+RVPNLKVGTVLL CAF YD+FWV
Sbjct  335  FCLAFAVMWAVFRHVSFAWIGQDILGMALIITVLQIIRVPNLKVGTVLLTCAFFYDIFWV  394

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKW FH+SVMI VARG KSGE+GIPMLLKIPR+ DPWGGYS+IGFGDIILPGLLVAFS
Sbjct  395  FVSKWVFHKSVMIEVARGYKSGEEGIPMLLKIPRICDPWGGYSIIGFGDIILPGLLVAFS  454

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL KKSLR GYFLW M AYGLGL  TY+ALNLMDGHGQPALLYIVP TLGTFL L 
Sbjct  455  LRYDWLCKKSLRAGYFLWTMTAYGLGLFATYVALNLMDGHGQPALLYIVPATLGTFLMLA  514

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD  208
             KRG+LKHLWT+G+P R CPH QLQPA+
Sbjct  515  AKRGELKHLWTRGEPYRTCPHTQLQPAE  542



>ref|XP_003627574.1| Signal peptide peptidase-like 2B [Medicago truncatula]
Length=573

 Score =   356 bits (914),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 176/235 (75%), Positives = 193/235 (82%), Gaps = 32/235 (14%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDIL--------------------------------GIA  748
            FCIVFAV+WAV R+ S A IGQDIL                                GIA
Sbjct  330  FCIVFAVVWAVKRQASYAWIGQDILVRIVILLSLYLLVKKNHRLLILLSIFLMTVIQGIA  389

Query  747  LIITVLQIVRVPNLKVGTVLLGCAFLYDLFWVFVSKWWFHESVMIVVARGDKSGEDGIPM  568
            LIITVLQIVR+PNLKVGTVLL CAFLYD+ WVFVSKWWFHESVMIVVARGDKSGEDGIPM
Sbjct  390  LIITVLQIVRIPNLKVGTVLLSCAFLYDILWVFVSKWWFHESVMIVVARGDKSGEDGIPM  449

Query  567  LLKIPRMFDPWGGYSVIGFGDIILPGLLVAFSLRYDWLSKKSLRTGYFLWAMMAYGLGLL  388
            LLK+PR+FDPWGGYS+IGFGDIILPGL+VAFSLRYDWL+KK+LR GYF+WAM AYGLGLL
Sbjct  450  LLKLPRLFDPWGGYSIIGFGDIILPGLVVAFSLRYDWLAKKNLRAGYFVWAMTAYGLGLL  509

Query  387  ITYLALNLMDGHGQPALLYIVPFTLGTFLTLGKKRGDLKHLWTKGDPDRPCPHVQ  223
            ITY+ALNLMDGHGQPALLYIVPFTLGTFL+LGKKRGDLK LWT+G+P+R CPH+Q
Sbjct  510  ITYVALNLMDGHGQPALLYIVPFTLGTFLSLGKKRGDLKILWTRGEPERHCPHIQ  564



>ref|XP_011654737.1| PREDICTED: signal peptide peptidase-like 2 isoform X2 [Cucumis 
sativus]
Length=514

 Score =   354 bits (909),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 175/214 (82%), Positives = 189/214 (88%), Gaps = 0/214 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYR VS A IGQD+LGIALIITVLQIV +PNLKVGTVLL CAFLYD+FWV
Sbjct  301  FCIAFAVVWAVYRNVSFAWIGQDVLGIALIITVLQIVHIPNLKVGTVLLSCAFLYDIFWV  360

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK  F+ESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYS+IGFGDI+LPGL+VAFS
Sbjct  361  FVSKKVFNESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSIIGFGDILLPGLVVAFS  420

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ KSLR GYFL AM+AYG GLLITY+ALNLMDGHGQPALLYIVPFTLGT LTLG
Sbjct  421  LRYDWLANKSLRVGYFLPAMLAYGSGLLITYVALNLMDGHGQPALLYIVPFTLGTLLTLG  480

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD*VNTAK  190
            KKRGDL  LWTKG+P R CPH  L   D ++  K
Sbjct  481  KKRGDLGILWTKGEPQRVCPHAHLLINDDLSDEK  514



>ref|XP_006301088.1| hypothetical protein CARUB_v10021480mg [Capsella rubella]
 gb|EOA33986.1| hypothetical protein CARUB_v10021480mg [Capsella rubella]
Length=539

 Score =   355 bits (911),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 171/201 (85%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCIVFAV+WAVYR  S A IGQD+LGIALIITVLQIV VPNLKVGTVLL CAF YD+FWV
Sbjct  330  FCIVFAVLWAVYRVTSFAWIGQDVLGIALIITVLQIVHVPNLKVGTVLLSCAFFYDIFWV  389

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK  FHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYS+IGFGDI+LPGLL+AF+
Sbjct  390  FVSKKLFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSIIGFGDILLPGLLIAFA  449

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ K+LRTGYF+WAM+AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGT LTL 
Sbjct  450  LRYDWLANKTLRTGYFIWAMVAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTMLTLA  509

Query  291  KKRGDLKHLWTKGDPDRPCPH  229
            +KRGDL  LWTKG+P+R CPH
Sbjct  510  RKRGDLWILWTKGEPERACPH  530



>ref|XP_010480022.1| PREDICTED: signal peptide peptidase-like 4 isoform X1 [Camelina 
sativa]
Length=541

 Score =   355 bits (911),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 169/206 (82%), Positives = 185/206 (90%), Gaps = 0/206 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAV R+ S A IGQDILGI+LIITVLQIVRVPNLKVG VLL CAF+YD+FWV
Sbjct  332  FCITFAVIWAVKRQYSFAWIGQDILGISLIITVLQIVRVPNLKVGFVLLSCAFMYDIFWV  391

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKWWF ESVMIVVARGD+SGEDGIPMLLKIPRMFDPWGGYS+IGFGDIILPGLLV F+
Sbjct  392  FVSKWWFRESVMIVVARGDRSGEDGIPMLLKIPRMFDPWGGYSIIGFGDIILPGLLVTFA  451

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ K L++GYFL  M AYGLGLLITY+ALNLMDGHGQPALLYIVPF LGT   LG
Sbjct  452  LRYDWLANKRLKSGYFLGTMSAYGLGLLITYIALNLMDGHGQPALLYIVPFILGTLFVLG  511

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQP  214
             KRG+LK LWT G+P+RPCPHV+LQP
Sbjct  512  HKRGELKTLWTTGEPERPCPHVRLQP  537



>ref|XP_008778907.1| PREDICTED: signal peptide peptidase-like 4 [Phoenix dactylifera]
Length=534

 Score =   355 bits (910),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 167/203 (82%), Positives = 188/203 (93%), Gaps = 0/203 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVY  +S A IGQDILGIALIITVLQIVR+PNLKVGTVLL CAFLYD+FWV
Sbjct  329  FCIAFAVVWAVYHSLSYAWIGQDILGIALIITVLQIVRIPNLKVGTVLLSCAFLYDIFWV  388

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F SK WFHESVMIVVARGD++G+DG+PMLLKIPRMFDPWGGYS+IGFGDIILPGLL+ FS
Sbjct  389  FASKRWFHESVMIVVARGDRTGDDGVPMLLKIPRMFDPWGGYSIIGFGDIILPGLLIVFS  448

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYD+ +KK+LR GYFLWAM+AYG GLLITY+ALNLMDGHGQPALLYIVPFTLGTFL LG
Sbjct  449  LRYDFAAKKTLRAGYFLWAMVAYGSGLLITYVALNLMDGHGQPALLYIVPFTLGTFLALG  508

Query  291  KKRGDLKHLWTKGDPDRPCPHVQ  223
            +KRG+L++LWTKG+P R CPH+Q
Sbjct  509  RKRGELENLWTKGEPKRICPHIQ  531



>emb|CDY38021.1| BnaCnng08820D [Brassica napus]
Length=540

 Score =   355 bits (911),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 169/205 (82%), Positives = 183/205 (89%), Gaps = 0/205 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
             CIV AV+WAVYR+   A IGQDILGI+LIITVLQIVRVPNLKVG VLL C F+YD+FWV
Sbjct  333  LCIVSAVIWAVYRQYPFAWIGQDILGISLIITVLQIVRVPNLKVGVVLLSCGFMYDIFWV  392

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKWWF ESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYS+IGFGDIILPGLLV F+
Sbjct  393  FVSKWWFRESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSIIGFGDIILPGLLVTFA  452

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ K L++GYFLW M AYGLGLLITY+ALNLMDGHGQPALLYIVPF LGT   LG
Sbjct  453  LRYDWLANKRLKSGYFLWTMSAYGLGLLITYIALNLMDGHGQPALLYIVPFILGTLTVLG  512

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQ  217
             KRGDLK LWT G+P+RPCPHV+LQ
Sbjct  513  HKRGDLKTLWTTGEPERPCPHVRLQ  537



>emb|CDY45351.1| BnaA09g12360D [Brassica napus]
Length=539

 Score =   355 bits (911),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 171/201 (85%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCIVFAV+WAVYR  S A IGQD+LGIALIITVLQIV VPNLKVGTVLL CAFLYD+FWV
Sbjct  330  FCIVFAVLWAVYRERSLAWIGQDVLGIALIITVLQIVHVPNLKVGTVLLSCAFLYDIFWV  389

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK  FHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYS+IGFGDI+LPGLL+AF+
Sbjct  390  FVSKKLFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSIIGFGDILLPGLLIAFA  449

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ K+LRTGYF+WAM+AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGT LTL 
Sbjct  450  LRYDWLANKTLRTGYFIWAMVAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTMLTLA  509

Query  291  KKRGDLKHLWTKGDPDRPCPH  229
            +KR DL  LWTKG+P+R CPH
Sbjct  510  RKRDDLWILWTKGEPERACPH  530



>ref|XP_011080942.1| PREDICTED: signal peptide peptidase-like 2 [Sesamum indicum]
Length=542

 Score =   355 bits (910),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 172/208 (83%), Positives = 188/208 (90%), Gaps = 0/208 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI  AV+WAVYR VS A IGQDILGIALIITVLQIVR+PNLKV TVLL CAF+YD+FWV
Sbjct  332  FCIALAVVWAVYRNVSFAWIGQDILGIALIITVLQIVRIPNLKVATVLLSCAFIYDIFWV  391

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F+SK  F ESVMIVVARGD+SGEDGIPMLLKIPR+FDPWGGYS+IGFGDI+LPGLLVAFS
Sbjct  392  FLSKKLFKESVMIVVARGDRSGEDGIPMLLKIPRLFDPWGGYSIIGFGDILLPGLLVAFS  451

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ KSLR GYFLWAM AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGTFL LG
Sbjct  452  LRYDWLANKSLRAGYFLWAMFAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTFLALG  511

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD  208
            +KRG+LK LWT+G+P R CPHV L+ A 
Sbjct  512  RKRGELKVLWTRGEPLRVCPHVLLESAQ  539



>dbj|BAD22919.1| putative growth-on protein GRO10 [Oryza sativa Japonica Group]
 gb|EEE58070.1| hypothetical protein OsJ_08929 [Oryza sativa Japonica Group]
Length=538

 Score =   355 bits (910),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 160/207 (77%), Positives = 195/207 (94%), Gaps = 0/207 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCIVFAV+WAVYRR++ A IGQDILGIALI+TV+QIVR+PNLKVG+VLL C+FLYD+FWV
Sbjct  321  FCIVFAVIWAVYRRMTYAWIGQDILGIALIVTVIQIVRIPNLKVGSVLLSCSFLYDIFWV  380

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F+SK WFHESVMIVVARGDK+ EDG+PMLLKIPRMFDPWGG+S+IGFGDI+LPGLL+AF+
Sbjct  381  FISKMWFHESVMIVVARGDKTDEDGVPMLLKIPRMFDPWGGFSIIGFGDILLPGLLIAFA  440

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDW +KK+L++GYFLW+M+AYG GL+ITY+ALNLMDGHGQPALLYIVPFTLGTF+ LG
Sbjct  441  LRYDWAAKKTLQSGYFLWSMVAYGSGLMITYVALNLMDGHGQPALLYIVPFTLGTFIALG  500

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPA  211
            +KRG+L++LWT+G P+R C H+ +QP+
Sbjct  501  RKRGELRNLWTRGQPERVCTHMHMQPS  527



>ref|XP_011029294.1| PREDICTED: LOW QUALITY PROTEIN: signal peptide peptidase-like 
2 [Populus euphratica]
Length=523

 Score =   354 bits (908),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 170/214 (79%), Positives = 192/214 (90%), Gaps = 0/214 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FC+ FAV+WA++R +S A IGQDILGIALI+TVLQIV VPNLKVGTVLL CAFLYD+FWV
Sbjct  310  FCLAFAVVWAMHRNLSFAWIGQDILGIALIVTVLQIVHVPNLKVGTVLLSCAFLYDIFWV  369

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK  FHESVMIVVARGD+SGE+GIPMLLKIPR+FDPWGGYS+IGFGDI+LPGLL+AFS
Sbjct  370  FVSKKLFHESVMIVVARGDRSGENGIPMLLKIPRLFDPWGGYSIIGFGDILLPGLLIAFS  429

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDW + KSL  GYFLWAM+AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGTFLTLG
Sbjct  430  LRYDWAANKSLCAGYFLWAMLAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTFLTLG  489

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD*VNTAK  190
             KRGDL  LW +G+P RPCPHV LQ +  +++ K
Sbjct  490  XKRGDLIVLWAQGEPQRPCPHVLLQRSQQLDSEK  523



>ref|NP_001048565.1| Os02g0823000 [Oryza sativa Japonica Group]
 sp|Q0DWA9.1|SIPL4_ORYSJ RecName: Full=Signal peptide peptidase-like 4; Short=OsSPPL4; 
Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAF10479.1| Os02g0823000 [Oryza sativa Japonica Group]
 dbj|BAH00778.1| unnamed protein product [Oryza sativa Japonica Group]
Length=545

 Score =   355 bits (910),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 160/207 (77%), Positives = 195/207 (94%), Gaps = 0/207 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCIVFAV+WAVYRR++ A IGQDILGIALI+TV+QIVR+PNLKVG+VLL C+FLYD+FWV
Sbjct  328  FCIVFAVIWAVYRRMTYAWIGQDILGIALIVTVIQIVRIPNLKVGSVLLSCSFLYDIFWV  387

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F+SK WFHESVMIVVARGDK+ EDG+PMLLKIPRMFDPWGG+S+IGFGDI+LPGLL+AF+
Sbjct  388  FISKMWFHESVMIVVARGDKTDEDGVPMLLKIPRMFDPWGGFSIIGFGDILLPGLLIAFA  447

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDW +KK+L++GYFLW+M+AYG GL+ITY+ALNLMDGHGQPALLYIVPFTLGTF+ LG
Sbjct  448  LRYDWAAKKTLQSGYFLWSMVAYGSGLMITYVALNLMDGHGQPALLYIVPFTLGTFIALG  507

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPA  211
            +KRG+L++LWT+G P+R C H+ +QP+
Sbjct  508  RKRGELRNLWTRGQPERVCTHMHMQPS  534



>ref|XP_004248045.1| PREDICTED: signal peptide peptidase-like 4 isoform X1 [Solanum 
lycopersicum]
Length=542

 Score =   354 bits (909),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 170/208 (82%), Positives = 186/208 (89%), Gaps = 0/208 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FC+ FA+MWAV+R VS A IGQDILG+ALIITVLQI+RVPNLKVGTVLL CAF YD+FWV
Sbjct  335  FCLAFAIMWAVFRHVSFAWIGQDILGMALIITVLQIIRVPNLKVGTVLLTCAFFYDIFWV  394

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKW FH+SVMI VARG KSGE+GIPMLLKIPR+ DPWGGYS+IGFGDIILPGLLVAFS
Sbjct  395  FVSKWVFHKSVMIEVARGYKSGEEGIPMLLKIPRICDPWGGYSIIGFGDIILPGLLVAFS  454

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL KKSLR GYFLW M AYGLGL  TY+ALNLMDGHGQPALLYIVP TLGTFL L 
Sbjct  455  LRYDWLCKKSLRAGYFLWTMTAYGLGLFATYVALNLMDGHGQPALLYIVPSTLGTFLMLS  514

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD  208
             KRG+LKHLWT+G+P R CPH+QLQPA+
Sbjct  515  AKRGELKHLWTRGEPYRICPHIQLQPAE  542



>ref|XP_006303940.1| hypothetical protein CARUB_v10008675mg, partial [Capsella rubella]
 gb|EOA36838.1| hypothetical protein CARUB_v10008675mg, partial [Capsella rubella]
Length=583

 Score =   355 bits (912),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 169/206 (82%), Positives = 185/206 (90%), Gaps = 0/206 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FC+ FAV+WAV R+ S A IGQDILGI+LIITVLQIVRVPNLKVG VLL CAF+YD+FWV
Sbjct  375  FCLAFAVLWAVKRQYSFAWIGQDILGISLIITVLQIVRVPNLKVGFVLLSCAFMYDIFWV  434

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKWWF ESVMIVVARGD+SGEDGIPMLLKIPRMFDPWGGYS+IGFGDIILPGLLV F+
Sbjct  435  FVSKWWFRESVMIVVARGDRSGEDGIPMLLKIPRMFDPWGGYSIIGFGDIILPGLLVTFA  494

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ K L++GYFL  M AYGLGLLITY+ALNLMDGHGQPALLYIVPF LGT   LG
Sbjct  495  LRYDWLANKRLKSGYFLGTMSAYGLGLLITYIALNLMDGHGQPALLYIVPFILGTLFVLG  554

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQP  214
             KRGDLK LWT G+P+RPCPHV+LQP
Sbjct  555  HKRGDLKTLWTTGEPERPCPHVRLQP  580



>ref|XP_009112759.1| PREDICTED: signal peptide peptidase-like 2 [Brassica rapa]
Length=539

 Score =   354 bits (908),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 171/201 (85%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCIVFAV+WAVYR  S A IGQD+LGIALIITVLQIV VPNLKVGTVLL CAFLYD+FWV
Sbjct  330  FCIVFAVLWAVYRERSLAWIGQDVLGIALIITVLQIVHVPNLKVGTVLLSCAFLYDIFWV  389

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK  FHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYS+IGFGDI+LPGLL+AF+
Sbjct  390  FVSKKLFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSIIGFGDILLPGLLIAFA  449

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ K+LRTGYF+WAM+AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGT LTL 
Sbjct  450  LRYDWLANKTLRTGYFIWAMVAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTMLTLA  509

Query  291  KKRGDLKHLWTKGDPDRPCPH  229
            +KR DL  LWTKG+P+R CPH
Sbjct  510  RKRDDLWILWTKGEPERACPH  530



>gb|AAL14629.1|AF417576_1 growth-on protein GRO10 [Euphorbia esula]
Length=537

 Score =   354 bits (908),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 171/201 (85%), Positives = 184/201 (92%), Gaps = 0/201 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYR VS A IGQDILGIALIITVLQIV VPNLKVGTVLL CAFLYD+FWV
Sbjct  328  FCITFAVVWAVYRNVSFAWIGQDILGIALIITVLQIVHVPNLKVGTVLLSCAFLYDIFWV  387

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK  F ESVMIVVARGD+SGEDGIPMLLKIPRMFDPWGGYS+IGFGDI+LPGLL+AF+
Sbjct  388  FVSKKLFKESVMIVVARGDRSGEDGIPMLLKIPRMFDPWGGYSIIGFGDILLPGLLIAFA  447

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ KSLR GYFLWAM+AYGLGLLITY+ALNLMDGH QPALLYIVPFTLGTFL LG
Sbjct  448  LRYDWLANKSLRAGYFLWAMIAYGLGLLITYVALNLMDGHDQPALLYIVPFTLGTFLALG  507

Query  291  KKRGDLKHLWTKGDPDRPCPH  229
            KK GDL  LWT+G+P+R CPH
Sbjct  508  KKNGDLNVLWTRGEPERACPH  528



>ref|XP_002299526.2| protease-associated domain-containing family protein [Populus 
trichocarpa]
 gb|EEE84331.2| protease-associated domain-containing family protein [Populus 
trichocarpa]
Length=541

 Score =   354 bits (908),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 170/205 (83%), Positives = 186/205 (91%), Gaps = 0/205 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FA  WA++R +S A IGQD LGIALIITVLQIV VPNLKVGTVLL CAFLYD+FWV
Sbjct  331  FCIAFAAGWAMHRNLSFAWIGQDTLGIALIITVLQIVHVPNLKVGTVLLSCAFLYDIFWV  390

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK  FHESVMIVVARGD+SGEDGIPMLLKIPR+FDPWGGYS+IGFGDI+LPGLL+AFS
Sbjct  391  FVSKKLFHESVMIVVARGDRSGEDGIPMLLKIPRLFDPWGGYSIIGFGDILLPGLLIAFS  450

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDW + KSL  GYF WAM+AYGLGLL+TY+ALNLMDGHGQPALLYIVPFTLGTFLTLG
Sbjct  451  LRYDWSANKSLCAGYFPWAMLAYGLGLLVTYVALNLMDGHGQPALLYIVPFTLGTFLTLG  510

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQ  217
            KKRGDL+ LWT+G+P RPCPHV LQ
Sbjct  511  KKRGDLRVLWTQGEPQRPCPHVLLQ  535



>emb|CDY08318.1| BnaC09g12780D [Brassica napus]
Length=539

 Score =   354 bits (908),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 169/201 (84%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI+FAV+WAVYR  S A IGQD+LGIAL+ITVLQIV VPNLKVGTVLL CAFLYD+FWV
Sbjct  330  FCIIFAVLWAVYRERSLAWIGQDVLGIALVITVLQIVHVPNLKVGTVLLSCAFLYDIFWV  389

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK  FHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYS+IGFGDI+LPGLL+AF+
Sbjct  390  FVSKKLFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSIIGFGDILLPGLLIAFA  449

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ K+LRTGYF+WAM+AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGT LTL 
Sbjct  450  LRYDWLANKTLRTGYFIWAMVAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTMLTLA  509

Query  291  KKRGDLKHLWTKGDPDRPCPH  229
            +KR DL  LWTKG+P+R CPH
Sbjct  510  RKRDDLWILWTKGEPERACPH  530



>ref|XP_010418402.1| PREDICTED: signal peptide peptidase-like 2 isoform X1 [Camelina 
sativa]
Length=540

 Score =   354 bits (908),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 171/201 (85%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCIVFAV+WAVYR  S A IGQD+LGIALIITVLQIV VPNLKVGTVLL CAFLYD+FWV
Sbjct  331  FCIVFAVLWAVYRVASFAWIGQDVLGIALIITVLQIVHVPNLKVGTVLLSCAFLYDIFWV  390

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK  FHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYS+IGFGDI+LPGLL+AF+
Sbjct  391  FVSKKLFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSIIGFGDILLPGLLIAFA  450

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ K+LRTGYF+WAM+AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGT LTL 
Sbjct  451  LRYDWLANKTLRTGYFIWAMVAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTMLTLA  510

Query  291  KKRGDLKHLWTKGDPDRPCPH  229
            +KR DL  LWTKG+P+R CPH
Sbjct  511  RKRDDLWILWTKGEPERACPH  531



>ref|XP_010457099.1| PREDICTED: signal peptide peptidase-like 4 [Camelina sativa]
Length=577

 Score =   355 bits (911),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 169/206 (82%), Positives = 185/206 (90%), Gaps = 0/206 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAV R+ S A IGQDILGI+LIITVLQIVRVPNLKVG VLL CAF+YD+FWV
Sbjct  368  FCITFAVIWAVKRQYSFAWIGQDILGISLIITVLQIVRVPNLKVGFVLLSCAFMYDIFWV  427

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKWWF ESVMIVVARGD+SGEDGIPMLLKIPRMFDPWGGYS+IGFGDIILPGLLV F+
Sbjct  428  FVSKWWFRESVMIVVARGDRSGEDGIPMLLKIPRMFDPWGGYSIIGFGDIILPGLLVTFA  487

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ K L++GYFL  M AYGLGLLITY+ALNLMDGHGQPALLYIVPF LGT   LG
Sbjct  488  LRYDWLANKRLKSGYFLGTMSAYGLGLLITYIALNLMDGHGQPALLYIVPFILGTLFVLG  547

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQP  214
             KRG+LK LWT G+P+RPCPHV+LQP
Sbjct  548  HKRGELKTLWTTGEPERPCPHVRLQP  573



>ref|XP_007158507.1| hypothetical protein PHAVU_002G158100g [Phaseolus vulgaris]
 gb|ESW30501.1| hypothetical protein PHAVU_002G158100g [Phaseolus vulgaris]
Length=543

 Score =   354 bits (908),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 168/205 (82%), Positives = 186/205 (91%), Gaps = 0/205 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FC  FAV+WAVYR  S A I QDILGIALIITVLQIV VPNLKVGTVL+GCAF+YD+FWV
Sbjct  331  FCTTFAVLWAVYRNNSFAWICQDILGIALIITVLQIVHVPNLKVGTVLIGCAFIYDIFWV  390

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK +F ESVMIVVARGD+SGEDGIPMLLK PR+FDPWGGYS+IGFGDI+LPG+LVAFS
Sbjct  391  FVSKKFFKESVMIVVARGDRSGEDGIPMLLKFPRIFDPWGGYSIIGFGDILLPGMLVAFS  450

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ KSLR GYFLWAM AYG GLLITY+ALNLMDGHGQPALLYIVPFTLGT +TLG
Sbjct  451  LRYDWLANKSLRGGYFLWAMCAYGFGLLITYVALNLMDGHGQPALLYIVPFTLGTLMTLG  510

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQ  217
            +KRGDLK LWT G+P +PCPH++LQ
Sbjct  511  QKRGDLKGLWTSGEPQKPCPHLRLQ  535



>gb|AAM63609.1| growth-on protein GRO10 [Arabidopsis thaliana]
Length=540

 Score =   353 bits (907),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 171/201 (85%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCIVFAV+WAVYR  S A IGQD+LGIALIITVLQIV VPNLKVGTVLL CAFLYD+FWV
Sbjct  330  FCIVFAVLWAVYRVHSFAWIGQDVLGIALIITVLQIVHVPNLKVGTVLLSCAFLYDIFWV  389

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK  FHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYS+IGFGDI+LPGLL+AF+
Sbjct  390  FVSKKLFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSIIGFGDILLPGLLIAFA  449

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ K+LRTGYF+WAM+AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGT LTL 
Sbjct  450  LRYDWLANKTLRTGYFIWAMVAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTMLTLA  509

Query  291  KKRGDLKHLWTKGDPDRPCPH  229
            +KR DL  LWTKG+P+R CPH
Sbjct  510  RKRDDLWILWTKGEPERACPH  530



>ref|XP_006391728.1| hypothetical protein EUTSA_v10023402mg [Eutrema salsugineum]
 gb|ESQ29014.1| hypothetical protein EUTSA_v10023402mg [Eutrema salsugineum]
Length=540

 Score =   353 bits (907),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 170/201 (85%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCIVFAV+WAVYR  S A IGQD+LGIALIITVLQIV VPNLKVGTVLL C+FLYD+FWV
Sbjct  330  FCIVFAVLWAVYRNRSFAWIGQDVLGIALIITVLQIVHVPNLKVGTVLLSCSFLYDIFWV  389

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK  FHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYS+IGFGDI+LPGLL+AF+
Sbjct  390  FVSKKLFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSIIGFGDILLPGLLIAFA  449

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ K+LRTGYF+WAM+AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGT LTL 
Sbjct  450  LRYDWLANKTLRTGYFIWAMVAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTMLTLA  509

Query  291  KKRGDLKHLWTKGDPDRPCPH  229
            +KR DL  LWTKG+P+R CPH
Sbjct  510  RKRDDLWILWTKGEPERACPH  530



>ref|XP_004143899.1| PREDICTED: signal peptide peptidase-like 2 isoform X1 [Cucumis 
sativus]
 gb|KGN50088.1| hypothetical protein Csa_5G153030 [Cucumis sativus]
Length=545

 Score =   353 bits (907),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 175/214 (82%), Positives = 189/214 (88%), Gaps = 0/214 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYR VS A IGQD+LGIALIITVLQIV +PNLKVGTVLL CAFLYD+FWV
Sbjct  332  FCIAFAVVWAVYRNVSFAWIGQDVLGIALIITVLQIVHIPNLKVGTVLLSCAFLYDIFWV  391

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK  F+ESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYS+IGFGDI+LPGL+VAFS
Sbjct  392  FVSKKVFNESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSIIGFGDILLPGLVVAFS  451

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ KSLR GYFL AM+AYG GLLITY+ALNLMDGHGQPALLYIVPFTLGT LTLG
Sbjct  452  LRYDWLANKSLRVGYFLPAMLAYGSGLLITYVALNLMDGHGQPALLYIVPFTLGTLLTLG  511

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD*VNTAK  190
            KKRGDL  LWTKG+P R CPH  L   D ++  K
Sbjct  512  KKRGDLGILWTKGEPQRVCPHAHLLINDDLSDEK  545



>gb|AAF78405.1|AC009273_11 ESTs gb|AA586244 and gb|T21200 come from this gene [Arabidopsis 
thaliana]
Length=613

 Score =   356 bits (913),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 171/208 (82%), Positives = 184/208 (88%), Gaps = 0/208 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV WAV R+ S A IGQDILGI+LIITVLQIVRVPNLKVG VLL CAF+YD+FWV
Sbjct  405  FCIAFAVFWAVKRQYSYAWIGQDILGISLIITVLQIVRVPNLKVGFVLLSCAFMYDIFWV  464

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKWWF ESVMIVVARGD+SGEDGIPMLLKIPRMFDPWGGYS+IGFGDIILPGLLV F+
Sbjct  465  FVSKWWFRESVMIVVARGDRSGEDGIPMLLKIPRMFDPWGGYSIIGFGDIILPGLLVTFA  524

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ K L++GYFL  M AYGLGLLITY+ALNLMDGHGQPALLYIVPF LGT   LG
Sbjct  525  LRYDWLANKRLKSGYFLGTMSAYGLGLLITYIALNLMDGHGQPALLYIVPFILGTLFVLG  584

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD  208
             KRGDLK LWT G+PDRPCPHV+LQP  
Sbjct  585  HKRGDLKTLWTTGEPDRPCPHVRLQPQS  612



>gb|EAY88073.1| hypothetical protein OsI_09503 [Oryza sativa Indica Group]
Length=541

 Score =   353 bits (906),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 160/206 (78%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCIVFAV+WAVYRR++ A IGQDILGIALI+TV+QIVR+PNLKVG+VLL C+FLYD+FWV
Sbjct  321  FCIVFAVIWAVYRRMTYAWIGQDILGIALIVTVIQIVRIPNLKVGSVLLSCSFLYDIFWV  380

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F+SK WFHESVMIVVARGDK+ EDG+PMLLKIPRMFDPWGG+S+IGFGDI+LPGLL+AF+
Sbjct  381  FISKMWFHESVMIVVARGDKTDEDGVPMLLKIPRMFDPWGGFSIIGFGDILLPGLLIAFA  440

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDW +KK+L++GYFLW+M+AYG GL+ITY+ALNLMDGHGQPALLYIVPFTLGTF+ LG
Sbjct  441  LRYDWAAKKTLQSGYFLWSMVAYGSGLMITYVALNLMDGHGQPALLYIVPFTLGTFIALG  500

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQP  214
            +KRG+L++LWT+G P+R C H+ +QP
Sbjct  501  RKRGELRNLWTRGQPERVCTHMHMQP  526



>ref|XP_010430474.1| PREDICTED: signal peptide peptidase-like 2 [Camelina sativa]
Length=541

 Score =   353 bits (906),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 171/201 (85%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCIVFAV+WAVYR  S A IGQD+LGIALIITVLQIV VPNLKVGTVLL CAFLYD+FWV
Sbjct  332  FCIVFAVLWAVYRVNSFAWIGQDVLGIALIITVLQIVHVPNLKVGTVLLSCAFLYDIFWV  391

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK  FHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYS+IGFGDI+LPGLL+AF+
Sbjct  392  FVSKKLFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSIIGFGDILLPGLLIAFA  451

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ K+LRTGYF+WAM+AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGT LTL 
Sbjct  452  LRYDWLANKTLRTGYFIWAMVAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTMLTLA  511

Query  291  KKRGDLKHLWTKGDPDRPCPH  229
            +KR DL  LWTKG+P+R CPH
Sbjct  512  RKRDDLWILWTKGEPERACPH  532



>ref|NP_564815.1| signal peptide peptidase-like 2 [Arabidopsis thaliana]
 sp|Q8W469.1|SIPL2_ARATH RecName: Full=Signal peptide peptidase-like 2; Short=AtSPPL2; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAL32885.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP68334.1| At1g63690 [Arabidopsis thaliana]
 gb|AEE34134.1| signal peptide peptidase-like 2 [Arabidopsis thaliana]
Length=540

 Score =   353 bits (906),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 171/201 (85%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCIVFAV+WAVYR  S A IGQD+LGIALIITVLQIV VPNLKVGTVLL CAFLYD+FWV
Sbjct  330  FCIVFAVLWAVYRVHSFAWIGQDVLGIALIITVLQIVHVPNLKVGTVLLSCAFLYDIFWV  389

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK  FHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYS+IGFGDI+LPGLL+AF+
Sbjct  390  FVSKKLFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSIIGFGDILLPGLLIAFA  449

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ K+LRTGYF+WAM+AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGT LTL 
Sbjct  450  LRYDWLANKTLRTGYFIWAMVAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTMLTLA  509

Query  291  KKRGDLKHLWTKGDPDRPCPH  229
            +KR DL  LWTKG+P+R CPH
Sbjct  510  RKRDDLWILWTKGEPERACPH  530



>ref|XP_010473618.1| PREDICTED: signal peptide peptidase-like 2 [Camelina sativa]
Length=540

 Score =   353 bits (906),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 171/201 (85%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCIVFAV+WAVYR  S A IGQD+LGIALIITVLQIV VPNLKVGTVLL CAFLYD+FWV
Sbjct  331  FCIVFAVLWAVYRVNSFAWIGQDVLGIALIITVLQIVHVPNLKVGTVLLSCAFLYDIFWV  390

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK  FHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYS+IGFGDI+LPGLL+AF+
Sbjct  391  FVSKKLFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSIIGFGDILLPGLLIAFA  450

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ K+LRTGYF+WAM+AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGT LTL 
Sbjct  451  LRYDWLANKTLRTGYFIWAMVAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTMLTLA  510

Query  291  KKRGDLKHLWTKGDPDRPCPH  229
            +KR DL  LWTKG+P+R CPH
Sbjct  511  RKRDDLWILWTKGEPERACPH  531



>ref|XP_006648148.1| PREDICTED: signal peptide peptidase-like 4-like [Oryza brachyantha]
Length=544

 Score =   353 bits (906),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 159/206 (77%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FC+VFAV+WAVYRR++ A IGQDILGIALI+TV+QIVR+PNLKVG+VLL C+FLYD+FWV
Sbjct  328  FCVVFAVIWAVYRRMTYAWIGQDILGIALIVTVIQIVRIPNLKVGSVLLSCSFLYDIFWV  387

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F+SK WFHESVMIVVARGDK+ EDG+PMLLKIPRMFDPWGG+S+IGFGDI+LPGLL+AF+
Sbjct  388  FISKMWFHESVMIVVARGDKTDEDGVPMLLKIPRMFDPWGGFSIIGFGDILLPGLLIAFA  447

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDW +KK+L++GYFLW+M+AYG GL+ITY+ALNLMDGHGQPALLYIVPFTLGTF+ LG
Sbjct  448  LRYDWAAKKTLQSGYFLWSMVAYGSGLMITYVALNLMDGHGQPALLYIVPFTLGTFIALG  507

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQP  214
            +KRG+L++LWT+G P+R C H+ +QP
Sbjct  508  RKRGELRNLWTRGQPERVCTHMHMQP  533



>gb|KHG08704.1| Signal peptide peptidase-like 2B [Gossypium arboreum]
Length=471

 Score =   350 bits (899),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 165/185 (89%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = -2

Query  762  ILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWVFVSKWWFHESVMIVVARGDKSGE  583
            + GIALIITVLQIVRVPNLKVGTVLLGCAFLYD+FWVFVSKWWFHESVMIVVARGDKSGE
Sbjct  284  VEGIALIITVLQIVRVPNLKVGTVLLGCAFLYDIFWVFVSKWWFHESVMIVVARGDKSGE  343

Query  582  DGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFSLRYDWLSKKSLRTGYFLWAMMAY  403
            DGIPMLLKIPR++DPWGGYSVIGFGDIILPGLLVAFSLRYDWL+KK+LR GYF+WAM AY
Sbjct  344  DGIPMLLKIPRIYDPWGGYSVIGFGDIILPGLLVAFSLRYDWLTKKTLRVGYFIWAMTAY  403

Query  402  GLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLGKKRGDLKHLWTKGDPDRPCPHVQ  223
            GLGLL+TY+ALNLMDGHGQPALLYIVPF LGTF+TLGKKRGDLK LWT+G+P+RPCPHVQ
Sbjct  404  GLGLLVTYVALNLMDGHGQPALLYIVPFILGTFITLGKKRGDLKTLWTRGEPERPCPHVQ  463

Query  222  LQPAD  208
            LQP +
Sbjct  464  LQPLE  468



>ref|XP_010418403.1| PREDICTED: signal peptide peptidase-like 2 isoform X2 [Camelina 
sativa]
 ref|XP_010418404.1| PREDICTED: signal peptide peptidase-like 2 isoform X3 [Camelina 
sativa]
Length=540

 Score =   353 bits (905),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 171/201 (85%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCIVFAV+WAVYR  S A IGQD+LGIALIITVLQIV VPNLKVGTVLL CAFLYD+FWV
Sbjct  331  FCIVFAVLWAVYRVNSFAWIGQDVLGIALIITVLQIVHVPNLKVGTVLLSCAFLYDIFWV  390

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK  FHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYS+IGFGDI+LPGLL+AF+
Sbjct  391  FVSKKLFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSIIGFGDILLPGLLIAFA  450

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ K+LRTGYF+WAM+AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGT LTL 
Sbjct  451  LRYDWLANKTLRTGYFIWAMVAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTMLTLA  510

Query  291  KKRGDLKHLWTKGDPDRPCPH  229
            +KR DL  LWTKG+P+R CPH
Sbjct  511  RKRDDLWILWTKGEPERACPH  531



>ref|XP_008437291.1| PREDICTED: signal peptide peptidase-like 2 [Cucumis melo]
 ref|XP_008437292.1| PREDICTED: signal peptide peptidase-like 2 [Cucumis melo]
Length=545

 Score =   352 bits (903),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 174/214 (81%), Positives = 189/214 (88%), Gaps = 0/214 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYR VS A IGQD+LGIALIITVLQIV +PNLKVGTVLL CAFLYD+FWV
Sbjct  332  FCIAFAVVWAVYRNVSFAWIGQDVLGIALIITVLQIVHIPNLKVGTVLLSCAFLYDIFWV  391

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK  F+ESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYS+IGFGDI+LPGL+VAFS
Sbjct  392  FVSKKVFNESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSIIGFGDILLPGLVVAFS  451

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ KSLR GYFL AM+AYG GLLITY+ALNLMDGHGQPALLYIVPFTLGT L LG
Sbjct  452  LRYDWLANKSLRVGYFLPAMLAYGSGLLITYVALNLMDGHGQPALLYIVPFTLGTLLILG  511

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD*VNTAK  190
            KKRGDL  LWTKG+P+R CPH  L   D ++  K
Sbjct  512  KKRGDLGILWTKGEPERVCPHAHLLINDDLSEEK  545



>ref|XP_009118826.1| PREDICTED: signal peptide peptidase-like 4 [Brassica rapa]
Length=539

 Score =   352 bits (903),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 168/205 (82%), Positives = 183/205 (89%), Gaps = 0/205 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCIV AV+WAVYR+   A IGQDILGI+LI+TVLQIVRVPNLKVG VLL C F+YD+FWV
Sbjct  332  FCIVSAVIWAVYRQYPFAWIGQDILGISLIVTVLQIVRVPNLKVGVVLLSCGFMYDIFWV  391

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKWWF ESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYS+IGFGDIILPGLLV F+
Sbjct  392  FVSKWWFRESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSIIGFGDIILPGLLVTFA  451

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ K L++GYFL  M AYGLGLLITY+ALNLMDGHGQPALLYIVPF LGT   LG
Sbjct  452  LRYDWLANKRLKSGYFLGTMSAYGLGLLITYIALNLMDGHGQPALLYIVPFILGTLTVLG  511

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQ  217
             KRGDLK LWT G+P+RPCPHV+LQ
Sbjct  512  HKRGDLKTLWTTGEPERPCPHVRLQ  536



>gb|KFK30597.1| hypothetical protein AALP_AA6G002300 [Arabis alpina]
Length=532

 Score =   352 bits (902),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 169/201 (84%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCIVFAV+WAVYR  S A IGQD+LGIALIITVLQIV VPNLKVGTVLL CAFLYD+FWV
Sbjct  323  FCIVFAVLWAVYRDRSIAWIGQDVLGIALIITVLQIVHVPNLKVGTVLLSCAFLYDIFWV  382

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK  FHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYS+IGFGDI+LPGLL+AF+
Sbjct  383  FVSKKLFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSIIGFGDILLPGLLLAFA  442

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ K+LRTGYF+WAM+AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGT LTL 
Sbjct  443  LRYDWLANKTLRTGYFIWAMVAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTMLTLA  502

Query  291  KKRGDLKHLWTKGDPDRPCPH  229
            +KR D+  LWT+G+P+R CPH
Sbjct  503  RKRNDIWILWTRGEPERACPH  523



>ref|XP_003570436.1| PREDICTED: signal peptide peptidase-like 4 [Brachypodium distachyon]
Length=546

 Score =   352 bits (902),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 166/216 (77%), Positives = 195/216 (90%), Gaps = 1/216 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCIV AV+WAVYRR   A IGQD+LGIALI+TV+QIVR+PNLKVG+VLLGC+FLYD+FWV
Sbjct  330  FCIVIAVIWAVYRRQPYAWIGQDVLGIALIVTVIQIVRIPNLKVGSVLLGCSFLYDIFWV  389

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F+SK WFHESVMIVVARGDK+ EDG+PMLLKIPRMFDPWGGYS+IGFGDI+LPGLLVAF+
Sbjct  390  FISKMWFHESVMIVVARGDKTDEDGVPMLLKIPRMFDPWGGYSIIGFGDILLPGLLVAFA  449

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDW +KK+L++GYFLW+M+AYG GLLITY+ALNLMDGHGQPALLYIVPFTLGTF++LG
Sbjct  450  LRYDWAAKKTLQSGYFLWSMVAYGSGLLITYVALNLMDGHGQPALLYIVPFTLGTFISLG  509

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD*VNTAKRT  184
            KKRG+L++LWT+G P R C H Q  P+   +TA  T
Sbjct  510  KKRGELRNLWTRGQPPRICTHTQ-HPSKESSTAAVT  544



>ref|NP_974082.1| signal peptide peptidase-like 2 [Arabidopsis thaliana]
 gb|AEE34133.1| signal peptide peptidase-like 2 [Arabidopsis thaliana]
Length=540

 Score =   352 bits (902),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 170/201 (85%), Positives = 185/201 (92%), Gaps = 0/201 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCIVFAV+WAVYR  S A IGQD+LGIALIITVLQIV VPNLKVGTVLL CAFLYD+FWV
Sbjct  330  FCIVFAVLWAVYRVHSFAWIGQDVLGIALIITVLQIVHVPNLKVGTVLLSCAFLYDIFWV  389

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK  FHESVMIVV RGDKSGEDGIPMLLKIPRMFDPWGGYS+IGFGDI+LPGLL+AF+
Sbjct  390  FVSKKLFHESVMIVVTRGDKSGEDGIPMLLKIPRMFDPWGGYSIIGFGDILLPGLLIAFA  449

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ K+LRTGYF+WAM+AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGT LTL 
Sbjct  450  LRYDWLANKTLRTGYFIWAMVAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTMLTLA  509

Query  291  KKRGDLKHLWTKGDPDRPCPH  229
            +KR DL  LWTKG+P+R CPH
Sbjct  510  RKRDDLWILWTKGEPERACPH  530



>ref|XP_009420462.1| PREDICTED: signal peptide peptidase-like 5 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=530

 Score =   349 bits (896),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 163/202 (81%), Positives = 187/202 (93%), Gaps = 0/202 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FC+ FAV+WAVYRR+S A IGQD+LGIALIITVLQIVRVPNLKVG VLL CAFLYD+FWV
Sbjct  324  FCVAFAVLWAVYRRISFAWIGQDVLGIALIITVLQIVRVPNLKVGMVLLSCAFLYDIFWV  383

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK WFHESVMIVVARGD++ EDG+PMLLKIPRMFDPWGGYS+IGFGDI+LPGLL+AFS
Sbjct  384  FVSKRWFHESVMIVVARGDRTAEDGVPMLLKIPRMFDPWGGYSIIGFGDILLPGLLIAFS  443

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDW ++K+L+ GYFLW+M+AYG GLLITY+ALNLMDGHGQPALLYIVPFTLGT LTLG
Sbjct  444  LRYDWAARKNLQAGYFLWSMVAYGSGLLITYVALNLMDGHGQPALLYIVPFTLGTLLTLG  503

Query  291  KKRGDLKHLWTKGDPDRPCPHV  226
             KR +L +L+TKG+P+R CPH+
Sbjct  504  WKRAELTNLFTKGEPERVCPHI  525



>ref|XP_009420460.1| PREDICTED: signal peptide peptidase-like 5 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=532

 Score =   349 bits (896),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 163/202 (81%), Positives = 187/202 (93%), Gaps = 0/202 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FC+ FAV+WAVYRR+S A IGQD+LGIALIITVLQIVRVPNLKVG VLL CAFLYD+FWV
Sbjct  326  FCVAFAVLWAVYRRISFAWIGQDVLGIALIITVLQIVRVPNLKVGMVLLSCAFLYDIFWV  385

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK WFHESVMIVVARGD++ EDG+PMLLKIPRMFDPWGGYS+IGFGDI+LPGLL+AFS
Sbjct  386  FVSKRWFHESVMIVVARGDRTAEDGVPMLLKIPRMFDPWGGYSIIGFGDILLPGLLIAFS  445

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDW ++K+L+ GYFLW+M+AYG GLLITY+ALNLMDGHGQPALLYIVPFTLGT LTLG
Sbjct  446  LRYDWAARKNLQAGYFLWSMVAYGSGLLITYVALNLMDGHGQPALLYIVPFTLGTLLTLG  505

Query  291  KKRGDLKHLWTKGDPDRPCPHV  226
             KR +L +L+TKG+P+R CPH+
Sbjct  506  WKRAELTNLFTKGEPERVCPHI  527



>gb|EMS56631.1| Signal peptide peptidase-like 2B [Triticum urartu]
Length=460

 Score =   346 bits (888),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 161/215 (75%), Positives = 191/215 (89%), Gaps = 0/215 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCIV AV+WAVYRR+  A IGQD+LGIALI+TV+QIVR+PNLKVG+VLLGC+FLYD+FWV
Sbjct  242  FCIVSAVLWAVYRRMPYAWIGQDVLGIALIVTVIQIVRIPNLKVGSVLLGCSFLYDIFWV  301

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F+SK  FHESVMIVVARGD + EDG+PMLLKIPRMFDPWGGYS+IGFGDI+LPGLLVAF+
Sbjct  302  FISKMLFHESVMIVVARGDNTDEDGVPMLLKIPRMFDPWGGYSIIGFGDILLPGLLVAFA  361

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDW ++K+L++GYFLW+M+AYG GLLITY+ALNLMDGHGQPALLYIVPFTLGTF++LG
Sbjct  362  LRYDWAARKTLQSGYFLWSMVAYGSGLLITYVALNLMDGHGQPALLYIVPFTLGTFISLG  421

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD*VNTAKR  187
            KKRG+L++LW KG P R C H    P D  ++A  
Sbjct  422  KKRGELRNLWMKGQPPRVCTHSHPPPKDSADSAAH  456



>ref|XP_002453071.1| hypothetical protein SORBIDRAFT_04g037790 [Sorghum bicolor]
 gb|EES06047.1| hypothetical protein SORBIDRAFT_04g037790 [Sorghum bicolor]
Length=547

 Score =   347 bits (891),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 161/207 (78%), Positives = 188/207 (91%), Gaps = 0/207 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCIVFAV+W VYRR+S A IGQDILGI LI+TV+QIVR+PNLKVG+ LL CAFLYD+FWV
Sbjct  329  FCIVFAVLWGVYRRLSFAWIGQDILGITLIVTVIQIVRIPNLKVGSALLSCAFLYDIFWV  388

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F+SK  FHESVMIVVARGDK+ EDG+PMLLKIPRMFDPWGGYS+IGFGDI+LPGLLVAF+
Sbjct  389  FISKMIFHESVMIVVARGDKTDEDGVPMLLKIPRMFDPWGGYSIIGFGDILLPGLLVAFA  448

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDW +KK+L++GYFLW+M+AYG GLLITY+ALNLMDGHGQPALLYIVPFT+GTFL LG
Sbjct  449  LRYDWAAKKTLQSGYFLWSMVAYGSGLLITYVALNLMDGHGQPALLYIVPFTIGTFLALG  508

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPA  211
             KRG+L++LWTKG P+R C H+   P+
Sbjct  509  MKRGELRNLWTKGQPERVCTHMHTHPS  535



>gb|AFW63934.1| hypothetical protein ZEAMMB73_184308 [Zea mays]
Length=545

 Score =   347 bits (890),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 161/208 (77%), Positives = 188/208 (90%), Gaps = 0/208 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI+FAV+W VYRR+  A IGQDILGI LI+TV+QIVR+PNLKVG+ LLGCAFLYD+FWV
Sbjct  329  FCILFAVLWGVYRRLPYAWIGQDILGITLIVTVIQIVRIPNLKVGSALLGCAFLYDIFWV  388

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F+SK  FHESVMIVVARGDK+ EDG+PMLLKIPRMFDPWGGYS+IGFGDI+LPGLLVAF+
Sbjct  389  FISKMLFHESVMIVVARGDKTDEDGVPMLLKIPRMFDPWGGYSIIGFGDILLPGLLVAFA  448

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDW +KK+L++GYFLW+M+AYG GLLITY+ALNLMDGHGQPALLYIVPFT+GTFL LG
Sbjct  449  LRYDWAAKKTLQSGYFLWSMVAYGSGLLITYVALNLMDGHGQPALLYIVPFTIGTFLALG  508

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD  208
             KRG+L++LWTKG P+R C H+   P D
Sbjct  509  MKRGELRNLWTKGQPERVCTHMHPSPKD  536



>ref|XP_010940491.1| PREDICTED: signal peptide peptidase-like 4 [Elaeis guineensis]
Length=534

 Score =   346 bits (888),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 163/203 (80%), Positives = 185/203 (91%), Gaps = 0/203 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FA +WAVY  +S A IGQDILGIALIITVLQIVRVPNLKVGTVLL CAFLYD+FWV
Sbjct  329  FCIAFAAVWAVYHTLSYAWIGQDILGIALIITVLQIVRVPNLKVGTVLLCCAFLYDIFWV  388

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F SK WFHESVMIVVARGD++ EDG+PMLLKIPRMFDPWGG+S+IGFGDIILPGLL+ FS
Sbjct  389  FASKRWFHESVMIVVARGDRTDEDGVPMLLKIPRMFDPWGGFSIIGFGDIILPGLLIVFS  448

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYD+ +KK+LR GYFLW+M+AYG GLLITY+ALNLMDGHGQPALLYIVPF LGTFL LG
Sbjct  449  LRYDFAAKKNLRAGYFLWSMVAYGSGLLITYVALNLMDGHGQPALLYIVPFLLGTFLALG  508

Query  291  KKRGDLKHLWTKGDPDRPCPHVQ  223
            +KRG+L +LWT+G+P+R CPH+Q
Sbjct  509  RKRGELGNLWTRGEPERICPHIQ  531



>gb|EMT12022.1| Signal peptide peptidase-like 2B [Aegilops tauschii]
Length=532

 Score =   346 bits (887),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 161/213 (76%), Positives = 191/213 (90%), Gaps = 0/213 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCIV AV+WAVYRR+  A IGQD+LGIALI+TV+QIVR+PNLKVG+VLLGC+FLYD+FWV
Sbjct  314  FCIVSAVLWAVYRRMPYAWIGQDVLGIALIVTVIQIVRIPNLKVGSVLLGCSFLYDIFWV  373

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F+SK  FHESVMIVVARGD + EDG+PMLLKIPRMFDPWGGYS+IGFGDI+LPGLLVAF+
Sbjct  374  FISKMLFHESVMIVVARGDNTDEDGVPMLLKIPRMFDPWGGYSIIGFGDILLPGLLVAFA  433

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDW ++K+L++GYFLW+M+AYG GLLITY+ALNLMDGHGQPALLYIVPFTLGTF++LG
Sbjct  434  LRYDWAARKTLQSGYFLWSMVAYGSGLLITYVALNLMDGHGQPALLYIVPFTLGTFISLG  493

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD*VNTA  193
            KKRG+L++LW KG P R C H    P D  ++A
Sbjct  494  KKRGELRNLWMKGQPPRVCTHSHPPPKDSADSA  526



>gb|AFW69665.2| hypothetical protein ZEAMMB73_283504 [Zea mays]
Length=425

 Score =   342 bits (877),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 160/204 (78%), Positives = 188/204 (92%), Gaps = 0/204 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FC+ FAV+WAV+R++  A IGQDILGIALI+TV+QIVRVPNLKVG+VLLGCAFLYD+FWV
Sbjct  214  FCVAFAVVWAVFRQLPFAWIGQDILGIALIVTVIQIVRVPNLKVGSVLLGCAFLYDIFWV  273

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F+SK WFHESVMIVVARGDK+ EDG+PMLLKIPRMFDPWGGYS+IGFGDI+LPGLLVAFS
Sbjct  274  FISKRWFHESVMIVVARGDKTDEDGVPMLLKIPRMFDPWGGYSIIGFGDILLPGLLVAFS  333

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYD+ +KK LR+GYFLWAM+AYG GLLITY+ALNLMDGHGQPALLYIVPFTLGT + LG
Sbjct  334  LRYDFSAKKGLRSGYFLWAMVAYGSGLLITYVALNLMDGHGQPALLYIVPFTLGTLIALG  393

Query  291  KKRGDLKHLWTKGDPDRPCPHVQL  220
             KRG+L++LW +G+P+R C H+ +
Sbjct  394  WKRGELQNLWARGEPERVCTHMHM  417



>ref|NP_001058659.1| Os06g0730900 [Oryza sativa Japonica Group]
 sp|Q5Z413.1|SIPL5_ORYSJ RecName: Full=Signal peptide peptidase-like 5; Short=OsSPPL5; 
Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAD62128.1| putative growth-on protein GRO10 [Oryza sativa Japonica Group]
 dbj|BAD62487.1| putative growth-on protein GRO10 [Oryza sativa Japonica Group]
 dbj|BAF20573.1| Os06g0730900 [Oryza sativa Japonica Group]
 dbj|BAG88222.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89399.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC81358.1| hypothetical protein OsI_24551 [Oryza sativa Indica Group]
 gb|EEE66404.1| hypothetical protein OsJ_22746 [Oryza sativa Japonica Group]
Length=542

 Score =   346 bits (887),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 165/207 (80%), Positives = 190/207 (92%), Gaps = 1/207 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCIVFAV+WAV+R  + A IGQDILGIALIITV+QIVRVPNLKVG+VLL CAF YD+FWV
Sbjct  327  FCIVFAVLWAVHRHFTYAWIGQDILGIALIITVIQIVRVPNLKVGSVLLSCAFFYDIFWV  386

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK WFHESVMIVVARGDK+ EDG+PMLLKIPRMFDPWGGYS+IGFGDI+LPGLLVAF+
Sbjct  387  FVSKRWFHESVMIVVARGDKTDEDGVPMLLKIPRMFDPWGGYSIIGFGDILLPGLLVAFA  446

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDW +KKSL+TGYFLW+M+AYG GLLITY+ALNLMDGHGQPALLYIVPFTLG  ++LG
Sbjct  447  LRYDWAAKKSLQTGYFLWSMVAYGSGLLITYVALNLMDGHGQPALLYIVPFTLGALISLG  506

Query  291  KKRGDLKHLWTKGDPDRPCP-HVQLQP  214
             KRG+L +LW+KG+P+R CP H+ +QP
Sbjct  507  WKRGELWNLWSKGEPERVCPHHMHMQP  533



>ref|XP_008679146.1| PREDICTED: signal peptide peptidase-like 4 [Zea mays]
Length=619

 Score =   348 bits (893),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 161/208 (77%), Positives = 188/208 (90%), Gaps = 0/208 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI+FAV+W VYRR+  A IGQDILGI LI+TV+QIVR+PNLKVG+ LLGCAFLYD+FWV
Sbjct  403  FCILFAVLWGVYRRLPYAWIGQDILGITLIVTVIQIVRIPNLKVGSALLGCAFLYDIFWV  462

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F+SK  FHESVMIVVARGDK+ EDG+PMLLKIPRMFDPWGGYS+IGFGDI+LPGLLVAF+
Sbjct  463  FISKMLFHESVMIVVARGDKTDEDGVPMLLKIPRMFDPWGGYSIIGFGDILLPGLLVAFA  522

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDW +KK+L++GYFLW+M+AYG GLLITY+ALNLMDGHGQPALLYIVPFT+GTFL LG
Sbjct  523  LRYDWAAKKTLQSGYFLWSMVAYGSGLLITYVALNLMDGHGQPALLYIVPFTIGTFLALG  582

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD  208
             KRG+L++LWTKG P+R C H+   P D
Sbjct  583  MKRGELRNLWTKGQPERVCTHMHPSPKD  610



>ref|XP_004966574.1| PREDICTED: signal peptide peptidase-like 5-like [Setaria italica]
Length=536

 Score =   345 bits (886),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 163/204 (80%), Positives = 189/204 (93%), Gaps = 0/204 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAV+R+ S A IGQDILGIALI+TV+QIVRVPNLKVG+VLL CAFLYD+FWV
Sbjct  325  FCIAFAVLWAVFRQASFAWIGQDILGIALIVTVIQIVRVPNLKVGSVLLSCAFLYDIFWV  384

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK WFHESVMIVVARGDK+ EDG+PMLLKIPRMFDPWGGYS+IGFGDI+LPGLLVAF+
Sbjct  385  FVSKRWFHESVMIVVARGDKTDEDGVPMLLKIPRMFDPWGGYSIIGFGDILLPGLLVAFA  444

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYD+++KKSL++GYFLW+M+AYG GLLITY+ALNLMDGHGQPALLYIVPFTLGT + LG
Sbjct  445  LRYDFVAKKSLQSGYFLWSMVAYGSGLLITYVALNLMDGHGQPALLYIVPFTLGTLIALG  504

Query  291  KKRGDLKHLWTKGDPDRPCPHVQL  220
             KRG+L++LW KG+PDR C H+ L
Sbjct  505  WKRGELRNLWVKGEPDRVCTHMHL  528



>gb|AFW69664.2| hypothetical protein ZEAMMB73_283504 [Zea mays]
Length=486

 Score =   343 bits (879),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 160/204 (78%), Positives = 188/204 (92%), Gaps = 0/204 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FC+ FAV+WAV+R++  A IGQDILGIALI+TV+QIVRVPNLKVG+VLLGCAFLYD+FWV
Sbjct  275  FCVAFAVVWAVFRQLPFAWIGQDILGIALIVTVIQIVRVPNLKVGSVLLGCAFLYDIFWV  334

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F+SK WFHESVMIVVARGDK+ EDG+PMLLKIPRMFDPWGGYS+IGFGDI+LPGLLVAFS
Sbjct  335  FISKRWFHESVMIVVARGDKTDEDGVPMLLKIPRMFDPWGGYSIIGFGDILLPGLLVAFS  394

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYD+ +KK LR+GYFLWAM+AYG GLLITY+ALNLMDGHGQPALLYIVPFTLGT + LG
Sbjct  395  LRYDFSAKKGLRSGYFLWAMVAYGSGLLITYVALNLMDGHGQPALLYIVPFTLGTLIALG  454

Query  291  KKRGDLKHLWTKGDPDRPCPHVQL  220
             KRG+L++LW +G+P+R C H+ +
Sbjct  455  WKRGELQNLWARGEPERVCTHMHM  478



>ref|XP_004954446.1| PREDICTED: signal peptide peptidase-like 4-like [Setaria italica]
Length=541

 Score =   343 bits (881),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 159/208 (76%), Positives = 185/208 (89%), Gaps = 0/208 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCIVFAV+W VYRR   A IGQDILGI LI+TV+QIVR+PNLKVG+ LL CAFLYD+FWV
Sbjct  326  FCIVFAVLWGVYRRWRYAWIGQDILGITLIVTVIQIVRIPNLKVGSALLSCAFLYDIFWV  385

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F+SK  FHESVMIVVARGDK+ EDG+PMLLKIPRMFDPWGGYS+IGFGDI+LPGLL+AF+
Sbjct  386  FISKMLFHESVMIVVARGDKTDEDGVPMLLKIPRMFDPWGGYSIIGFGDILLPGLLIAFA  445

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDW +KK+L++GYFLW+M+AYG GLLITY+ALNLMDGHGQPALLYIVPFT+GTFL LG
Sbjct  446  LRYDWAAKKTLQSGYFLWSMVAYGSGLLITYVALNLMDGHGQPALLYIVPFTIGTFLALG  505

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD  208
             KRG+L++LWT+G P+R C H    P D
Sbjct  506  LKRGELRNLWTRGQPERACTHTHPSPKD  533



>gb|ACN30991.1| unknown [Zea mays]
Length=475

 Score =   341 bits (875),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 160/204 (78%), Positives = 188/204 (92%), Gaps = 0/204 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FC+ FAV+WAV+R++  A IGQDILGIALI+TV+QIVRVPNLKVG+VLLGCAFLYD+FWV
Sbjct  264  FCVAFAVVWAVFRQLPFAWIGQDILGIALIVTVIQIVRVPNLKVGSVLLGCAFLYDIFWV  323

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F+SK WFHESVMIVVARGDK+ EDG+PMLLKIPRMFDPWGGYS+IGFGDI+LPGLLVAFS
Sbjct  324  FISKRWFHESVMIVVARGDKTDEDGVPMLLKIPRMFDPWGGYSIIGFGDILLPGLLVAFS  383

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYD+ +KK LR+GYFLWAM+AYG GLLITY+ALNLMDGHGQPALLYIVPFTLGT + LG
Sbjct  384  LRYDFSAKKGLRSGYFLWAMVAYGSGLLITYVALNLMDGHGQPALLYIVPFTLGTLIALG  443

Query  291  KKRGDLKHLWTKGDPDRPCPHVQL  220
             KRG+L++LW +G+P+R C H+ +
Sbjct  444  WKRGELQNLWARGEPERVCTHMHM  467



>ref|NP_001149009.1| LOC100282629 precursor [Zea mays]
 gb|ACF86425.1| unknown [Zea mays]
 gb|ACG33797.1| signal peptide peptidase-like 2B [Zea mays]
Length=536

 Score =   342 bits (877),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 160/204 (78%), Positives = 188/204 (92%), Gaps = 0/204 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FC+ FAV+WAV+R++  A IGQDILGIALI+TV+QIVRVPNLKVG+VLLGCAFLYD+FWV
Sbjct  325  FCVAFAVVWAVFRQLPFAWIGQDILGIALIVTVIQIVRVPNLKVGSVLLGCAFLYDIFWV  384

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F+SK WFHESVMIVVARGDK+ EDG+PMLLKIPRMFDPWGGYS+IGFGDI+LPGLLVAFS
Sbjct  385  FISKRWFHESVMIVVARGDKTDEDGVPMLLKIPRMFDPWGGYSIIGFGDILLPGLLVAFS  444

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYD+ +KK LR+GYFLWAM+AYG GLLITY+ALNLMDGHGQPALLYIVPFTLGT + LG
Sbjct  445  LRYDFSAKKGLRSGYFLWAMVAYGSGLLITYVALNLMDGHGQPALLYIVPFTLGTLIALG  504

Query  291  KKRGDLKHLWTKGDPDRPCPHVQL  220
             KRG+L++LW +G+P+R C H+ +
Sbjct  505  WKRGELQNLWARGEPERVCTHMHM  528



>ref|XP_010087957.1| Signal peptide peptidase-like 2B [Morus notabilis]
 gb|EXB30879.1| Signal peptide peptidase-like 2B [Morus notabilis]
Length=476

 Score =   340 bits (871),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 158/185 (85%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -2

Query  762  ILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWVFVSKWWFHESVMIVVARGDKSGE  583
            + GIALIITVLQIVR+PNLKVGTVLL CAF+YD+FWVFVSKWWFHESVMIVVARGDKSGE
Sbjct  286  VEGIALIITVLQIVRIPNLKVGTVLLSCAFMYDIFWVFVSKWWFHESVMIVVARGDKSGE  345

Query  582  DGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFSLRYDWLSKKSLRTGYFLWAMMAY  403
            DGIPMLLKIPRMFDPWGGYS+IGFGDIILPGL+VAFSLR+DWL+ K LR GYF+WAM AY
Sbjct  346  DGIPMLLKIPRMFDPWGGYSIIGFGDIILPGLVVAFSLRFDWLANKKLRAGYFVWAMSAY  405

Query  402  GLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLGKKRGDLKHLWTKGDPDRPCPHVQ  223
            GLGLLITY+ALNLMDGHGQPALLYIVPFTLG FLTLGKKRGDLK LW +G+P+RPCPHV+
Sbjct  406  GLGLLITYVALNLMDGHGQPALLYIVPFTLGPFLTLGKKRGDLKILWIRGEPERPCPHVK  465

Query  222  LQPAD  208
            ++P +
Sbjct  466  VEPYE  470



>emb|CAN62222.1| hypothetical protein VITISV_022532 [Vitis vinifera]
Length=489

 Score =   339 bits (869),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 163/203 (80%), Positives = 177/203 (87%), Gaps = 18/203 (9%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAV+RR++ A IGQDIL                  VGTVLL CAFLYD+FWV
Sbjct  302  FCIAFAVVWAVFRRINFAWIGQDIL------------------VGTVLLSCAFLYDIFWV  343

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKWWF+ESVMIVVARGD+SGEDGIPMLLKIPRMFDPWGGYS+IGFGDIILPGLLVAFS
Sbjct  344  FVSKWWFNESVMIVVARGDRSGEDGIPMLLKIPRMFDPWGGYSIIGFGDIILPGLLVAFS  403

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+KKSLR GYF+WAM AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGTFL LG
Sbjct  404  LRYDWLAKKSLRAGYFVWAMTAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTFLALG  463

Query  291  KKRGDLKHLWTKGDPDRPCPHVQ  223
            KKRGDLK LWTKG+P+RPCPH+Q
Sbjct  464  KKRGDLKTLWTKGEPERPCPHIQ  486



>gb|KEH26504.1| signal peptide peptidase-like protein [Medicago truncatula]
Length=435

 Score =   336 bits (862),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 162/217 (75%), Positives = 185/217 (85%), Gaps = 5/217 (2%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV WAVYR  S + IGQDILGI LIITVLQIV V NLKVGTVLL C+ LYDLFWV
Sbjct  223  FCITFAVFWAVYRDKSFSWIGQDILGITLIITVLQIVHVSNLKVGTVLLSCSLLYDLFWV  282

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK +F ESVMIVVARGD+SGEDGIPMLLK PR+ DPWGGYS+IGFGDI+LPG+LVAFS
Sbjct  283  FVSKKFFKESVMIVVARGDRSGEDGIPMLLKFPRILDPWGGYSIIGFGDILLPGMLVAFS  342

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+KK+L +GYFLWAM+AYG GLLITY+ALNLMDGHGQPALLYIVPFTLGT + L 
Sbjct  343  LRYDWLAKKTLVSGYFLWAMLAYGFGLLITYVALNLMDGHGQPALLYIVPFTLGTIIALA  402

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD*VNTAKRTP  181
            +KRG+LK LW  G+P+R CPH++L      N+ + +P
Sbjct  403  QKRGELKILWKSGEPERFCPHIRLH-----NSGESSP  434



>ref|XP_004506302.1| PREDICTED: signal peptide peptidase-like 2-like [Cicer arietinum]
Length=570

 Score =   340 bits (872),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 162/201 (81%), Positives = 181/201 (90%), Gaps = 0/201 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FA+ WA+YR  S A IGQDILGIALIITVLQIV VPNLKVGTVLL C+ +YDLFWV
Sbjct  334  FCITFAIFWALYRDKSFAWIGQDILGIALIITVLQIVHVPNLKVGTVLLSCSLIYDLFWV  393

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F SK +F+ESVMIVVARGD+SGEDGIPMLLK PR+FDPWGGYS+IGFGDI+LPG+LVAFS
Sbjct  394  FASKKFFNESVMIVVARGDRSGEDGIPMLLKFPRIFDPWGGYSIIGFGDILLPGMLVAFS  453

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+KKSL +GYFLWAM AYG GL +TY+ALNLMDGHGQPALLYIVPFTLGTFL LG
Sbjct  454  LRYDWLAKKSLVSGYFLWAMFAYGFGLFVTYVALNLMDGHGQPALLYIVPFTLGTFLALG  513

Query  291  KKRGDLKHLWTKGDPDRPCPH  229
            +KRG+LK LWT G+P+R CPH
Sbjct  514  RKRGELKVLWTIGEPERFCPH  534



>ref|XP_002439083.1| hypothetical protein SORBIDRAFT_10g031280 [Sorghum bicolor]
 gb|EER90450.1| hypothetical protein SORBIDRAFT_10g031280 [Sorghum bicolor]
Length=536

 Score =   338 bits (868),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 158/204 (77%), Positives = 186/204 (91%), Gaps = 0/204 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FC+ FAV+WAV+R++  A IGQDILGIALI+TV+QIVRVPNLKVG+VLL CAFLYD+FWV
Sbjct  325  FCVAFAVLWAVFRQLPFAWIGQDILGIALIVTVIQIVRVPNLKVGSVLLSCAFLYDIFWV  384

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F+SK WFHESVMIVVARGDK+ EDG+PMLLKIPRMFDPWGGYS+IGFGDI+LPGLLVAF+
Sbjct  385  FISKRWFHESVMIVVARGDKTDEDGVPMLLKIPRMFDPWGGYSIIGFGDILLPGLLVAFA  444

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYD+ +KK  R+GYFLWAM+AYG GLLITY+ALNLMDGHGQPALLYIVPFTLGT + LG
Sbjct  445  LRYDFSAKKGFRSGYFLWAMVAYGSGLLITYVALNLMDGHGQPALLYIVPFTLGTLIALG  504

Query  291  KKRGDLKHLWTKGDPDRPCPHVQL  220
             KRG+L +LWT+G+P+R C H+ +
Sbjct  505  WKRGELPNLWTRGEPERVCTHMHM  528



>ref|XP_010239116.1| PREDICTED: signal peptide peptidase-like 5 [Brachypodium distachyon]
Length=548

 Score =   338 bits (867),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 158/205 (77%), Positives = 186/205 (91%), Gaps = 0/205 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCIVFAV+WAV+R+ + A IGQDILGIALI+TV+QIVRVPNLKVG+VLL CAFLYD+FWV
Sbjct  325  FCIVFAVLWAVFRQFAYAWIGQDILGIALIVTVIQIVRVPNLKVGSVLLSCAFLYDIFWV  384

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK WFHESVMI VARGD++ EDG+PMLLKIPR+FDPWGGYS+IGFGDI+LPGLLVAF+
Sbjct  385  FVSKRWFHESVMIAVARGDRTDEDGVPMLLKIPRLFDPWGGYSIIGFGDILLPGLLVAFA  444

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDW +KKSLR+GYFLW+ +AYG GLLITY+ALNLMDGHGQPALLYIVPFTLGT + LG
Sbjct  445  LRYDWTAKKSLRSGYFLWSALAYGTGLLITYVALNLMDGHGQPALLYIVPFTLGTLILLG  504

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQ  217
             KR +L++LW KG+P+R C H+ + 
Sbjct  505  WKRRELRNLWFKGEPERVCTHMHMN  529



>dbj|BAJ98049.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=554

 Score =   337 bits (864),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 162/214 (76%), Positives = 188/214 (88%), Gaps = 6/214 (3%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FC+VFAV+WA+YR+   A IGQDILGIALI+TV+QIVRVPNLKVG+VLL CAFLYD+FWV
Sbjct  326  FCVVFAVLWAIYRQFPYAWIGQDILGIALIVTVIQIVRVPNLKVGSVLLSCAFLYDIFWV  385

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK  FHESVMI VARGD + EDG+PMLLKIPRMFDPWGGYS+IGFGDI+LPGL+VAF+
Sbjct  386  FVSKSLFHESVMIAVARGDNTDEDGVPMLLKIPRMFDPWGGYSIIGFGDILLPGLVVAFA  445

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDW +KKS+R+GYFLW+  AYG GLLITY+ALNLMDGHGQPALLYIVPFTLGT ++LG
Sbjct  446  LRYDWAAKKSMRSGYFLWSASAYGTGLLITYVALNLMDGHGQPALLYIVPFTLGTLISLG  505

Query  291  KKRGDLKHLWTKGDPDRPCPH---VQLQ---PAD  208
             KRG+L++LW KG+PDR C H   VQ+    PAD
Sbjct  506  WKRGELRNLWLKGEPDRVCTHQGYVQMAKPPPAD  539



>dbj|BAJ96967.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=554

 Score =   337 bits (864),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 162/214 (76%), Positives = 188/214 (88%), Gaps = 6/214 (3%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FC+VFAV+WA+YR+   A IGQDILGIALI+TV+QIVRVPNLKVG+VLL CAFLYD+FWV
Sbjct  326  FCVVFAVLWAIYRQFPYAWIGQDILGIALIVTVIQIVRVPNLKVGSVLLSCAFLYDIFWV  385

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK  FHESVMI VARGD + EDG+PMLLKIPRMFDPWGGYS+IGFGDI+LPGL+VAF+
Sbjct  386  FVSKSLFHESVMIAVARGDNTDEDGVPMLLKIPRMFDPWGGYSIIGFGDILLPGLVVAFA  445

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDW +KKS+R+GYFLW+  AYG GLLITY+ALNLMDGHGQPALLYIVPFTLGT ++LG
Sbjct  446  LRYDWAAKKSMRSGYFLWSASAYGTGLLITYVALNLMDGHGQPALLYIVPFTLGTLISLG  505

Query  291  KKRGDLKHLWTKGDPDRPCPH---VQLQ---PAD  208
             KRG+L++LW KG+PDR C H   VQ+    PAD
Sbjct  506  WKRGELRNLWLKGEPDRVCTHQGYVQMAKPPPAD  539



>dbj|BAK08187.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=554

 Score =   337 bits (863),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 162/214 (76%), Positives = 188/214 (88%), Gaps = 6/214 (3%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FC+VFAV+WA+YR+   A IGQDILGIALI+TV+QIVRVPNLKVG+VLL CAFLYD+FWV
Sbjct  326  FCVVFAVLWAIYRQFPYAWIGQDILGIALIVTVIQIVRVPNLKVGSVLLSCAFLYDIFWV  385

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK  FHESVMI VARGD + EDG+PMLLKIPRMFDPWGGYS+IGFGDI+LPGL+VAF+
Sbjct  386  FVSKSLFHESVMIAVARGDNTDEDGVPMLLKIPRMFDPWGGYSIIGFGDILLPGLVVAFA  445

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDW +KKS+R+GYFLW+  AYG GLLITY+ALNLMDGHGQPALLYIVPFTLGT ++LG
Sbjct  446  LRYDWAAKKSMRSGYFLWSASAYGTGLLITYVALNLMDGHGQPALLYIVPFTLGTLISLG  505

Query  291  KKRGDLKHLWTKGDPDRPCPH---VQLQ---PAD  208
             KRG+L++LW KG+PDR C H   VQ+    PAD
Sbjct  506  WKRGELRNLWLKGEPDRVCTHQGYVQMAKPPPAD  539



>dbj|BAJ97624.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=554

 Score =   337 bits (863),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 162/214 (76%), Positives = 188/214 (88%), Gaps = 6/214 (3%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FC+VFAV+WA+YR+   A IGQDILGIALI+TV+QIVRVPNLKVG+VLL CAFLYD+FWV
Sbjct  326  FCVVFAVLWAIYRQFPYAWIGQDILGIALIVTVIQIVRVPNLKVGSVLLSCAFLYDIFWV  385

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK  FHESVMI VARGD + EDG+PMLLKIPRMFDPWGGYS+IGFGDI+LPGL+VAF+
Sbjct  386  FVSKSLFHESVMIAVARGDNTDEDGVPMLLKIPRMFDPWGGYSIIGFGDILLPGLVVAFA  445

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDW +KKS+R+GYFLW+  AYG GLLITY+ALNLMDGHGQPALLYIVPFTLGT ++LG
Sbjct  446  LRYDWAAKKSMRSGYFLWSASAYGTGLLITYVALNLMDGHGQPALLYIVPFTLGTLISLG  505

Query  291  KKRGDLKHLWTKGDPDRPCPH---VQLQ---PAD  208
             KRG+L++LW KG+PDR C H   VQ+    PAD
Sbjct  506  WKRGELRNLWLKGEPDRVCTHQGYVQMAKPPPAD  539



>gb|KEH26503.1| signal peptide peptidase-like protein [Medicago truncatula]
Length=543

 Score =   335 bits (860),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 162/217 (75%), Positives = 185/217 (85%), Gaps = 5/217 (2%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV WAVYR  S + IGQDILGI LIITVLQIV V NLKVGTVLL C+ LYDLFWV
Sbjct  331  FCITFAVFWAVYRDKSFSWIGQDILGITLIITVLQIVHVSNLKVGTVLLSCSLLYDLFWV  390

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK +F ESVMIVVARGD+SGEDGIPMLLK PR+ DPWGGYS+IGFGDI+LPG+LVAFS
Sbjct  391  FVSKKFFKESVMIVVARGDRSGEDGIPMLLKFPRILDPWGGYSIIGFGDILLPGMLVAFS  450

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+KK+L +GYFLWAM+AYG GLLITY+ALNLMDGHGQPALLYIVPFTLGT + L 
Sbjct  451  LRYDWLAKKTLVSGYFLWAMLAYGFGLLITYVALNLMDGHGQPALLYIVPFTLGTIIALA  510

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD*VNTAKRTP  181
            +KRG+LK LW  G+P+R CPH++L      N+ + +P
Sbjct  511  QKRGELKILWKSGEPERFCPHIRLH-----NSGESSP  542



>gb|EMT21395.1| Signal peptide peptidase-like 2B [Aegilops tauschii]
Length=549

 Score =   332 bits (851),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 155/201 (77%), Positives = 179/201 (89%), Gaps = 0/201 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FC+VFAV+WA+YR+   A I QDILGIALI+TV+QIVRVPNLKVG+VLL CAFLYD+FWV
Sbjct  326  FCVVFAVLWAIYRQFPYAWIAQDILGIALIVTVIQIVRVPNLKVGSVLLSCAFLYDIFWV  385

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK  FHESVMI VARGD + EDG+PMLLKIPRMFDPWGGYS+IGFGDI+LPGL+VAF+
Sbjct  386  FVSKSLFHESVMIAVARGDNTDEDGVPMLLKIPRMFDPWGGYSIIGFGDILLPGLVVAFA  445

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            +RYDW  KKSLR GYFLW+  AYG GLLITY+ALNLMDGHGQPALLYIVPFTLGT ++LG
Sbjct  446  MRYDWAGKKSLRCGYFLWSASAYGTGLLITYVALNLMDGHGQPALLYIVPFTLGTLMSLG  505

Query  291  KKRGDLKHLWTKGDPDRPCPH  229
             KRG+L++LW KG+P+R C H
Sbjct  506  WKRGELRNLWFKGEPERVCTH  526



>gb|ADE76315.1| unknown [Picea sitchensis]
Length=537

 Score =   331 bits (849),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 158/202 (78%), Positives = 180/202 (89%), Gaps = 0/202 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYRR+S A IGQDILGI LIITVLQIVR+PN+KV  VLL CAFLYD+FWV
Sbjct  330  FCITFAVVWAVYRRISFAWIGQDILGITLIITVLQIVRLPNVKVSAVLLSCAFLYDIFWV  389

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVS   FHESVMIVVARGDKSGEDGIPMLLKIPR++DPWGGYS+IGFGDI+LPGLL+AF+
Sbjct  390  FVSPKLFHESVMIVVARGDKSGEDGIPMLLKIPRLYDPWGGYSIIGFGDILLPGLLIAFA  449

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDW +KKSL+ GYFLW+M+ YG GL +TY+ALNLMDG+GQPALLYIVP TLGT LTLG
Sbjct  450  LRYDWAAKKSLQGGYFLWSMIGYGFGLFMTYVALNLMDGNGQPALLYIVPCTLGTVLTLG  509

Query  291  KKRGDLKHLWTKGDPDRPCPHV  226
              RG+L +LW+KG+P  PCPHV
Sbjct  510  WLRGELSNLWSKGEPQMPCPHV  531



>ref|XP_006375344.1| hypothetical protein POPTR_0014s08110g [Populus trichocarpa]
 gb|ERP53141.1| hypothetical protein POPTR_0014s08110g [Populus trichocarpa]
Length=504

 Score =   329 bits (843),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 159/176 (90%), Positives = 167/176 (95%), Gaps = 0/176 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAV+RRVS A IGQDILGI LIITVLQIVRVPNLKVGTVLL CAFLYD+FWV
Sbjct  329  FCIAFAVVWAVFRRVSFAWIGQDILGIVLIITVLQIVRVPNLKVGTVLLSCAFLYDIFWV  388

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKWWF ESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYS+IGFGDIILPGLLVAFS
Sbjct  389  FVSKWWFKESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSIIGFGDIILPGLLVAFS  448

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTF  304
            LRYDWL+KK+LR GYFLWAM AYGLGLLITYLALN+MDGHGQPALLYIVPFTLG +
Sbjct  449  LRYDWLAKKNLRAGYFLWAMTAYGLGLLITYLALNMMDGHGQPALLYIVPFTLGKY  504



>gb|KJB52138.1| hypothetical protein B456_008G247500 [Gossypium raimondii]
Length=529

 Score =   326 bits (835),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 158/205 (77%), Positives = 175/205 (85%), Gaps = 18/205 (9%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYR VS A IGQDIL                  VGTVLL CAFLYD+FWV
Sbjct  331  FCIAFAVVWAVYRNVSFAWIGQDIL------------------VGTVLLSCAFLYDIFWV  372

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK  FHESVMIVVARGD+SGEDGIPMLLKIPRMFDPWGGYS+IGFGDI+LPGLL+ FS
Sbjct  373  FVSKKLFHESVMIVVARGDRSGEDGIPMLLKIPRMFDPWGGYSIIGFGDILLPGLLITFS  432

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+ K+LR GYFLWAM+AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLGTFLTLG
Sbjct  433  LRYDWLANKTLRAGYFLWAMIAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTFLTLG  492

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQ  217
            KKR DL+ LWT+G+P+RPCPH++L+
Sbjct  493  KKRRDLRVLWTRGEPERPCPHIRLE  517



>gb|KJB24745.1| hypothetical protein B456_004G158800 [Gossypium raimondii]
Length=511

 Score =   325 bits (832),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 160/184 (87%), Positives = 170/184 (92%), Gaps = 1/184 (1%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYRR+S A IGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYD+FWV
Sbjct  327  FCIAFAVVWAVYRRISFAWIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDIFWV  386

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F SKW FHESVMIVVARGD+SGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS
Sbjct  387  FASKWLFHESVMIVVARGDRSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  446

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFL-TL  295
            LRYDWL+  +LR GYF+WAM AYGLGLL+TY+ALNLMDGHGQPALLYIVPFTLG  L  +
Sbjct  447  LRYDWLANMNLRAGYFVWAMTAYGLGLLVTYVALNLMDGHGQPALLYIVPFTLGKDLYYI  506

Query  294  GKKR  283
            GKK 
Sbjct  507  GKKE  510



>gb|AAG52428.1|AC011622_16 unknown protein; 50290-46846 [Arabidopsis thaliana]
Length=519

 Score =   316 bits (809),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 153/174 (88%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCIVFAV+WAVYR  S A IGQD+LGIALIITVLQIV VPNLKVGTVLL CAFLYD+FWV
Sbjct  330  FCIVFAVLWAVYRVHSFAWIGQDVLGIALIITVLQIVHVPNLKVGTVLLSCAFLYDIFWV  389

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK  FHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYS+IGFGDI+LPGLL+AF+
Sbjct  390  FVSKKLFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSIIGFGDILLPGLLIAFA  449

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLG  310
            LRYDWL+ K+LRTGYF+WAM+AYGLGLLITY+ALNLMDGHGQPALLYIVPFTLG
Sbjct  450  LRYDWLANKTLRTGYFIWAMVAYGLGLLITYVALNLMDGHGQPALLYIVPFTLG  503



>gb|AFK45400.1| unknown [Lotus japonicus]
Length=182

 Score =   303 bits (776),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 165/182 (91%), Gaps = 0/182 (0%)
 Frame = -2

Query  741  ITVLQIVRVPNLKVGTVLLGCAFLYDLFWVFVSKWWFHESVMIVVARGDKSGEDGIPMLL  562
            +TVLQIV VPNLKVGTVLL CAF+YD+FWVF+S  +F +SVMIVVARGD SGEDGIPMLL
Sbjct  1    MTVLQIVHVPNLKVGTVLLSCAFIYDIFWVFISTKFFKKSVMIVVARGDGSGEDGIPMLL  60

Query  561  KIPRMFDPWGGYSVIGFGDIILPGLLVAFSLRYDWLSKKSLRTGYFLWAMMAYGLGLLIT  382
            K PR+FDPWGGYS+IGFGDI+LPG+LVAFSLRYDWL  K+LR+GYFLWAM AYG GLLIT
Sbjct  61   KFPRIFDPWGGYSIIGFGDILLPGMLVAFSLRYDWLVNKNLRSGYFLWAMFAYGFGLLIT  120

Query  381  YLALNLMDGHGQPALLYIVPFTLGTFLTLGKKRGDLKHLWTKGDPDRPCPHVQLQPAD*V  202
            Y+ALNLMDGHGQPALLYIVPFTLGTF+ LGKKRGDL+ LWT+G+P+RPCPH++LQ ++  
Sbjct  121  YVALNLMDGHGQPALLYIVPFTLGTFMALGKKRGDLRLLWTRGEPERPCPHIRLQHSEEF  180

Query  201  NT  196
             T
Sbjct  181  TT  182



>gb|AFW69666.2| hypothetical protein ZEAMMB73_283504 [Zea mays]
Length=412

 Score =   309 bits (791),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 146/175 (83%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FC+ FAV+WAV+R++  A IGQDILGIALI+TV+QIVRVPNLKVG+VLLGCAFLYD+FWV
Sbjct  214  FCVAFAVVWAVFRQLPFAWIGQDILGIALIVTVIQIVRVPNLKVGSVLLGCAFLYDIFWV  273

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F+SK WFHESVMIVVARGDK+ EDG+PMLLKIPRMFDPWGGYS+IGFGDI+LPGLLVAFS
Sbjct  274  FISKRWFHESVMIVVARGDKTDEDGVPMLLKIPRMFDPWGGYSIIGFGDILLPGLLVAFS  333

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGT  307
            LRYD+ +KK LR+GYFLWAM+AYG GLLITY+ALNLMDGHGQPALLYIVPFTLG 
Sbjct  334  LRYDFSAKKGLRSGYFLWAMVAYGSGLLITYVALNLMDGHGQPALLYIVPFTLGN  388



>gb|KJB41345.1| hypothetical protein B456_007G099700 [Gossypium raimondii]
Length=507

 Score =   311 bits (798),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 155/208 (75%), Positives = 169/208 (81%), Gaps = 31/208 (15%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYRR+S A IGQDILGIALIITVLQIVRVPNLKV                
Sbjct  328  FCITFAVVWAVYRRISFAWIGQDILGIALIITVLQIVRVPNLKV----------------  371

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
                           ARGDKSGEDGIPMLLKIPR++DPWGGYSVIGFGDIILPGLLVAFS
Sbjct  372  ---------------ARGDKSGEDGIPMLLKIPRIYDPWGGYSVIGFGDIILPGLLVAFS  416

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWL+KK+LR GYF+WAM AYGLGLL+TY+ALNLMDGHGQPALLYIVPF LGTF+TLG
Sbjct  417  LRYDWLTKKTLRAGYFIWAMTAYGLGLLVTYVALNLMDGHGQPALLYIVPFILGTFITLG  476

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD  208
            KKRGDLK LWT+G+P+RPCPHVQLQP +
Sbjct  477  KKRGDLKTLWTRGEPERPCPHVQLQPLE  504



>gb|EPS67175.1| hypothetical protein M569_07601, partial [Genlisea aurea]
Length=395

 Score =   298 bits (764),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 171/206 (83%), Gaps = 1/206 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FC+ FAV WAV+R  S A IGQDILGIALI+TVLQI+RVPNLKVGT LL CAF+YD+FWV
Sbjct  190  FCLAFAVSWAVFRHASFAWIGQDILGIALIMTVLQIIRVPNLKVGTFLLTCAFVYDIFWV  249

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F+S W F  SVM+VVA GD + EDGIPMLLK PR+FDPWGGYS+IGFGDIILPGL++AFS
Sbjct  250  FISTWLFKTSVMLVVALGDGTEEDGIPMLLKFPRIFDPWGGYSIIGFGDIILPGLVIAFS  309

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDWLSK +LRTGYF+WAM++YGL L +TY AL +MDG GQPALLYIVP  LG  + +G
Sbjct  310  LRYDWLSKNTLRTGYFIWAMVSYGLALSVTYAALLMMDGSGQPALLYIVPMMLGALIMVG  369

Query  291  KKRGDLKHLWTKGDPDR-PCPHVQLQ  217
             K+G++  LW +G+P++  C H++ Q
Sbjct  370  MKKGEVGRLWKQGEPEKLVCLHMESQ  395



>gb|EMS64986.1| Signal peptide peptidase-like 2B [Triticum urartu]
Length=605

 Score =   295 bits (756),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 143/201 (71%), Positives = 166/201 (83%), Gaps = 17/201 (8%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FC+VFAV+WA+YR+   A I QDILGIALI+TV+QIVRVPNLKVG+VLL CAFLYD+FWV
Sbjct  384  FCVVFAVLWAIYRQFPYAWIAQDILGIALIVTVIQIVRVPNLKVGSVLLSCAFLYDIFWV  443

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK  FHESVMI                  IPRMFDPWGGYS+IGFGDI+LPGL+VAF+
Sbjct  444  FVSKSLFHESVMIA-----------------IPRMFDPWGGYSIIGFGDILLPGLVVAFA  486

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDW +KKSLR+GYFLW+  AYG GLLITY+ALNLMDGHGQPALLYIVPFTLGT ++LG
Sbjct  487  LRYDWAAKKSLRSGYFLWSASAYGTGLLITYVALNLMDGHGQPALLYIVPFTLGTLMSLG  546

Query  291  KKRGDLKHLWTKGDPDRPCPH  229
             KRG+L++LW KG+P+R C H
Sbjct  547  WKRGELRNLWFKGEPERVCTH  567



>ref|XP_002970408.1| hypothetical protein SELMODRAFT_93092 [Selaginella moellendorffii]
 gb|EFJ28538.1| hypothetical protein SELMODRAFT_93092 [Selaginella moellendorffii]
Length=549

 Score =   284 bits (726),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 132/194 (68%), Positives = 167/194 (86%), Gaps = 0/194 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYR V+ A I QDILGIALI+TVLQIV +PN+KV T LLGCAF YD+FW+
Sbjct  343  FCITFAVLWAVYRHVNFAWIAQDILGIALIVTVLQIVHLPNIKVSTFLLGCAFFYDIFWI  402

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F+S + F +SVMIVVARGDK+  +GIPM+LK+P ++DPWGGYS+IGFGDI+LPGLL++F+
Sbjct  403  FISPFIFKQSVMIVVARGDKTAGEGIPMVLKVPLIYDPWGGYSIIGFGDILLPGLLISFA  462

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LR+D +++KSLR GYFLW+++ YGLGL +T +ALN+M GHGQPALLYIVP TLGT + LG
Sbjct  463  LRFDTVTRKSLREGYFLWSIIGYGLGLFLTDVALNVMHGHGQPALLYIVPCTLGTIVALG  522

Query  291  KKRGDLKHLWTKGD  250
             +RG+L  LW+KGD
Sbjct  523  WRRGELGSLWSKGD  536



>ref|XP_002982598.1| hypothetical protein SELMODRAFT_179700 [Selaginella moellendorffii]
 gb|EFJ16351.1| hypothetical protein SELMODRAFT_179700 [Selaginella moellendorffii]
Length=552

 Score =   284 bits (726),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 161/193 (83%), Gaps = 0/193 (0%)
 Frame = -2

Query  828  CIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWVF  649
            C+ F+V+WAVYR    A +GQD+LG+ALI+TVLQ+VR+PN+KV TVLL CAFLYD+FWVF
Sbjct  345  CVAFSVLWAVYRHAHVAWVGQDVLGVALILTVLQVVRLPNIKVSTVLLSCAFLYDIFWVF  404

Query  648  VSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFSL  469
            +S + F ESVMIVVARGDKSG + IPMLL++PR +DPWGGYS+IGFGDI+LPGLLV+F+L
Sbjct  405  ISPYIFKESVMIVVARGDKSGGESIPMLLRVPRFYDPWGGYSIIGFGDILLPGLLVSFTL  464

Query  468  RYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLGK  289
            R+DW +KKSL  GYFLW  + YGLGL++TY+ALNLMDGHGQPALLYIVP TLG  + LG 
Sbjct  465  RFDWANKKSLSGGYFLWTTVGYGLGLMLTYVALNLMDGHGQPALLYIVPCTLGIVVLLGW  524

Query  288  KRGDLKHLWTKGD  250
             R +L  LW   D
Sbjct  525  IRKELGALWNNKD  537



>ref|XP_002978487.1| hypothetical protein SELMODRAFT_176891 [Selaginella moellendorffii]
 gb|EFJ20473.1| hypothetical protein SELMODRAFT_176891 [Selaginella moellendorffii]
Length=549

 Score =   283 bits (725),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 132/194 (68%), Positives = 167/194 (86%), Gaps = 0/194 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYR V+ A I QDILGIALI+TVLQIV +PN+KV T LLGCAF YD+FW+
Sbjct  343  FCITFAVLWAVYRHVNFAWIAQDILGIALIVTVLQIVHLPNIKVSTFLLGCAFFYDIFWI  402

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F+S + F +SVMIVVARGDK+  +GIPM+LK+P ++DPWGGYS+IGFGDI+LPGLL++F+
Sbjct  403  FISPFIFKQSVMIVVARGDKTAGEGIPMVLKVPLIYDPWGGYSIIGFGDILLPGLLISFA  462

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LR+D +++KSLR GYFLW+++ YGLGL +T +ALN+M GHGQPALLYIVP TLGT + LG
Sbjct  463  LRFDTVTRKSLRDGYFLWSIIGYGLGLFLTDVALNVMHGHGQPALLYIVPCTLGTIVALG  522

Query  291  KKRGDLKHLWTKGD  250
             +RG+L  LW+KGD
Sbjct  523  WRRGELGSLWSKGD  536



>ref|XP_001751321.1| predicted protein [Physcomitrella patens]
 gb|EDQ83638.1| predicted protein [Physcomitrella patens]
Length=552

 Score =   283 bits (724),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 139/195 (71%), Positives = 166/195 (85%), Gaps = 1/195 (1%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FC+ F+V+W V+R  S A IGQD+LG+ALI+TVLQIVR+PN+KV  +LLGCAFLYD+FWV
Sbjct  337  FCLAFSVVWGVFRLNSYAWIGQDVLGMALILTVLQIVRLPNIKVAAILLGCAFLYDVFWV  396

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F+S  +FHESVMIVVARGDKS  +GIPMLLK+PR++DPWGGYS+IGFGDI+LPGLLV+F 
Sbjct  397  FISPTFFHESVMIVVARGDKSDGEGIPMLLKVPRLYDPWGGYSIIGFGDILLPGLLVSFC  456

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTL-GTFLTL  295
            LRYDW ++KSL  GYFLW+ + YGLGL ITY+ALN M+G GQPALLYIVP TL GT L L
Sbjct  457  LRYDWTARKSLFRGYFLWSTVGYGLGLFITYVALNAMNGSGQPALLYIVPCTLAGTVLLL  516

Query  294  GKKRGDLKHLWTKGD  250
            G  RG+LK LW KGD
Sbjct  517  GWWRGELKSLWFKGD  531



>ref|XP_002993338.1| hypothetical protein SELMODRAFT_187400 [Selaginella moellendorffii]
 gb|EFJ05600.1| hypothetical protein SELMODRAFT_187400 [Selaginella moellendorffii]
Length=539

 Score =   283 bits (723),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 161/193 (83%), Gaps = 0/193 (0%)
 Frame = -2

Query  828  CIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWVF  649
            C+ F+V+WAVYR    A +GQD+LG+ALI+TVLQ+VR+PN+KV TVLL CAFLYD+FWVF
Sbjct  332  CVAFSVIWAVYRHAHVAWVGQDVLGVALILTVLQVVRLPNIKVSTVLLSCAFLYDIFWVF  391

Query  648  VSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFSL  469
            +S + F ESVMIVVARGDKSG + IPMLL++PR +DPWGGYS+IGFGDI+LPGLLV+F+L
Sbjct  392  ISPYIFKESVMIVVARGDKSGGESIPMLLRVPRFYDPWGGYSIIGFGDILLPGLLVSFTL  451

Query  468  RYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLGK  289
            R+DW +KKSL  GYFLW  + YGLGL++TY+ALNLMDGHGQPALLYIVP TLG  + LG 
Sbjct  452  RFDWANKKSLSGGYFLWTTVGYGLGLMLTYVALNLMDGHGQPALLYIVPCTLGIVVLLGW  511

Query  288  KRGDLKHLWTKGD  250
             R +L  LW   D
Sbjct  512  IRKELGALWNNKD  524



>ref|XP_001768370.1| predicted protein [Physcomitrella patens]
 gb|EDQ66732.1| predicted protein [Physcomitrella patens]
Length=521

 Score =   281 bits (720),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 136/194 (70%), Positives = 162/194 (84%), Gaps = 0/194 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FC+ F+V W  +R  S A IGQDILG+ALI+TVLQIV +PN+KV T+LL CAFLYD+FWV
Sbjct  318  FCLTFSVGWGYFRLSSYAWIGQDILGVALILTVLQIVHLPNIKVSTILLSCAFLYDVFWV  377

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F+S   FHESVMIVVARGDK   +GIPMLLK+PR++DPWGGYS+IGFGDI+LPGLL++F 
Sbjct  378  FISPKIFHESVMIVVARGDKGDGEGIPMLLKVPRLYDPWGGYSIIGFGDILLPGLLISFC  437

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDW+++KSL  GYFLWA + YGLGL +TY+ALN M+G GQPALLYIVP TLGT L LG
Sbjct  438  LRYDWIARKSLLRGYFLWATVGYGLGLFLTYVALNAMNGSGQPALLYIVPCTLGTVLLLG  497

Query  291  KKRGDLKHLWTKGD  250
              RG+LK LW KGD
Sbjct  498  WWRGELKSLWFKGD  511



>ref|XP_001770668.1| predicted protein [Physcomitrella patens]
 gb|EDQ64492.1| predicted protein [Physcomitrella patens]
Length=553

 Score =   278 bits (710),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 138/194 (71%), Positives = 162/194 (84%), Gaps = 0/194 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            F  +FA +W VYR +S A IGQD LGI+LI++VLQIVR+PN+KV  VLLG AF+YD+FWV
Sbjct  340  FAFLFASLWGVYRNLSFAWIGQDALGISLILSVLQIVRIPNIKVSAVLLGAAFIYDIFWV  399

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVS   F ESVMIVVARGDKS  +GIPMLLK+PR++DPWGGYS+IGFGDI+LPGLLV+F 
Sbjct  400  FVSPLIFDESVMIVVARGDKSNGEGIPMLLKVPRLYDPWGGYSIIGFGDILLPGLLVSFC  459

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDW+SKKSL  GYFLW  + YGLGL  TY+ALNLM G+GQPALLYIVP TLGT L LG
Sbjct  460  LRYDWVSKKSLFNGYFLWTSVGYGLGLFWTYVALNLMVGNGQPALLYIVPCTLGTVLFLG  519

Query  291  KKRGDLKHLWTKGD  250
              RG+L+ LWTKG+
Sbjct  520  WWRGELRSLWTKGE  533



>ref|XP_006445026.1| hypothetical protein CICLE_v10019661mg [Citrus clementina]
 gb|ESR58266.1| hypothetical protein CICLE_v10019661mg [Citrus clementina]
 gb|KDO86180.1| hypothetical protein CISIN_1g009437mg [Citrus sinensis]
Length=497

 Score =   271 bits (694),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 140/147 (95%), Gaps = 0/147 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI F+V+WAVYRR+S A IGQDILGIAL+ITVLQIVRVPNLKVGTVLL CAFLYD+FWV
Sbjct  329  FCIAFSVVWAVYRRISFAWIGQDILGIALMITVLQIVRVPNLKVGTVLLSCAFLYDIFWV  388

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSKWWFHESVMIVVARGD+SGEDGIPMLLKIPR+FDPWGGYSVIGFGDIILPGL+VAFS
Sbjct  389  FVSKWWFHESVMIVVARGDRSGEDGIPMLLKIPRLFDPWGGYSVIGFGDIILPGLIVAFS  448

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGL  391
            LRYDWL KK+ R+GYF+WAM AYGLG+
Sbjct  449  LRYDWLMKKNFRSGYFVWAMTAYGLGM  475



>ref|XP_007033979.1| Signal peptide peptidase family protein, expressed isoform 2 
[Theobroma cacao]
 gb|EOY04905.1| Signal peptide peptidase family protein, expressed isoform 2 
[Theobroma cacao]
Length=389

 Score =   265 bits (677),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/191 (65%), Positives = 153/191 (80%), Gaps = 0/191 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FC+ FAV+WAV+RR S + +GQDILGI L+ITVLQ+ R+PN+KV TVLL CAF+YD+FWV
Sbjct  184  FCVTFAVVWAVHRRASYSWVGQDILGICLMITVLQLARLPNIKVATVLLCCAFVYDIFWV  243

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F+S   FH+SVMI VARGD SG + IPMLL++PR+FDPWGGY +IGFGDI+ PGLLVAF+
Sbjct  244  FLSPLIFHQSVMIAVARGDNSGGESIPMLLRVPRVFDPWGGYDMIGFGDILFPGLLVAFA  303

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
             RYD  +KK L  GYF+W ++ YG GL  TYL L LM+GHGQPALLY+VP TLG  + LG
Sbjct  304  FRYDKENKKHLANGYFVWLIIGYGFGLFFTYLGLYLMNGHGQPALLYLVPCTLGVAVILG  363

Query  291  KKRGDLKHLWT  259
              RG+LK LW 
Sbjct  364  LVRGELKGLWN  374



>ref|XP_001770310.1| predicted protein [Physcomitrella patens]
 gb|EDQ64800.1| predicted protein [Physcomitrella patens]
Length=547

 Score =   268 bits (685),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 160/198 (81%), Gaps = 0/198 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            F ++FAV+W +YR  S A IGQD+LGI+LI++VLQ+VR+PN+KV TVLL  AF+YD+FWV
Sbjct  332  FSLLFAVLWGIYRNHSYAWIGQDVLGISLILSVLQVVRLPNIKVSTVLLSAAFIYDIFWV  391

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F+S   F ESVMIVVARGDK+  +GIPMLLK+PR+FDPWGGYS+IGFGDI+LPGLLV+F 
Sbjct  392  FISPLIFDESVMIVVARGDKTNGEGIPMLLKVPRLFDPWGGYSIIGFGDILLPGLLVSFC  451

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
            LRYDW +KK L  GYFLW  + YGLGL  TY+AL LM+G+GQPALLYIVP TLGT   LG
Sbjct  452  LRYDWSTKKRLFNGYFLWTAVGYGLGLFWTYIALILMNGNGQPALLYIVPCTLGTVFLLG  511

Query  291  KKRGDLKHLWTKGDPDRP  238
              RG+L  LW KG+   P
Sbjct  512  WWRGELITLWNKGEQVPP  529



>gb|EMT17072.1| Signal peptide peptidase-like 2B [Aegilops tauschii]
Length=357

 Score =   262 bits (670),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = -2

Query  759  LGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWVFVSKWWFHESVMIVVARGDKSGED  580
            LGIALI+TV+QIVR+PNLKV +VLLGC+FLYD+FWVF+SK  FHESVMIVVARGD + ED
Sbjct  121  LGIALIVTVIQIVRIPNLKVESVLLGCSFLYDIFWVFISKMLFHESVMIVVARGDNTDED  180

Query  579  GIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFSLRYDWLSKKSLRTGYFLWAMMAYG  400
            G+PMLLKIPRMFDPW GYS+IGFGDI+LPGLLVAF+LRYDW ++K+L++GYFLW+M+AYG
Sbjct  181  GVPMLLKIPRMFDPWDGYSIIGFGDILLPGLLVAFALRYDWAARKTLQSGYFLWSMVAYG  240

Query  399  LGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLGKKRGD  277
             GLLITY+ALNLMDGHGQPALLYIVPF LG+  T     G 
Sbjct  241  SGLLITYIALNLMDGHGQPALLYIVPFMLGSLWTPENHGGS  281



>gb|KJB30040.1| hypothetical protein B456_005G128500 [Gossypium raimondii]
Length=487

 Score =   266 bits (680),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 127/190 (67%), Positives = 153/190 (81%), Gaps = 0/190 (0%)
 Frame = -2

Query  828  CIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWVF  649
            C++FAV+WAV RR S + +GQDILGI L+ITVLQ+ R+PN+KV TVLL CAF+YD+FWVF
Sbjct  282  CLIFAVVWAVNRRESYSWVGQDILGICLMITVLQLARLPNIKVATVLLCCAFVYDIFWVF  341

Query  648  VSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFSL  469
            +S   FH+SVMIVVARGD SG + IPMLL++PR FDPWGGY +IGFGDI+ PGLLVAF+ 
Sbjct  342  LSPLIFHQSVMIVVARGDNSGGESIPMLLRVPRAFDPWGGYDMIGFGDILFPGLLVAFAF  401

Query  468  RYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLGK  289
            RYD   KK L +GYFLW ++ YG GLL TYL L LM+GHGQPALLY+VP TLG  + LG 
Sbjct  402  RYDKAYKKHLASGYFLWLIIGYGFGLLFTYLGLYLMNGHGQPALLYLVPCTLGVTVILGL  461

Query  288  KRGDLKHLWT  259
             RG+LK LW 
Sbjct  462  VRGELKELWN  471



>gb|KJB30042.1| hypothetical protein B456_005G128500 [Gossypium raimondii]
Length=534

 Score =   266 bits (680),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/190 (67%), Positives = 153/190 (81%), Gaps = 0/190 (0%)
 Frame = -2

Query  828  CIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWVF  649
            C++FAV+WAV RR S + +GQDILGI L+ITVLQ+ R+PN+KV TVLL CAF+YD+FWVF
Sbjct  329  CLIFAVVWAVNRRESYSWVGQDILGICLMITVLQLARLPNIKVATVLLCCAFVYDIFWVF  388

Query  648  VSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFSL  469
            +S   FH+SVMIVVARGD SG + IPMLL++PR FDPWGGY +IGFGDI+ PGLLVAF+ 
Sbjct  389  LSPLIFHQSVMIVVARGDNSGGESIPMLLRVPRAFDPWGGYDMIGFGDILFPGLLVAFAF  448

Query  468  RYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLGK  289
            RYD   KK L +GYFLW ++ YG GLL TYL L LM+GHGQPALLY+VP TLG  + LG 
Sbjct  449  RYDKAYKKHLASGYFLWLIIGYGFGLLFTYLGLYLMNGHGQPALLYLVPCTLGVTVILGL  508

Query  288  KRGDLKHLWT  259
             RG+LK LW 
Sbjct  509  VRGELKELWN  518



>gb|KJB30043.1| hypothetical protein B456_005G128500 [Gossypium raimondii]
Length=538

 Score =   266 bits (680),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/190 (67%), Positives = 153/190 (81%), Gaps = 0/190 (0%)
 Frame = -2

Query  828  CIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWVF  649
            C++FAV+WAV RR S + +GQDILGI L+ITVLQ+ R+PN+KV TVLL CAF+YD+FWVF
Sbjct  333  CLIFAVVWAVNRRESYSWVGQDILGICLMITVLQLARLPNIKVATVLLCCAFVYDIFWVF  392

Query  648  VSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFSL  469
            +S   FH+SVMIVVARGD SG + IPMLL++PR FDPWGGY +IGFGDI+ PGLLVAF+ 
Sbjct  393  LSPLIFHQSVMIVVARGDNSGGESIPMLLRVPRAFDPWGGYDMIGFGDILFPGLLVAFAF  452

Query  468  RYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLGK  289
            RYD   KK L +GYFLW ++ YG GLL TYL L LM+GHGQPALLY+VP TLG  + LG 
Sbjct  453  RYDKAYKKHLASGYFLWLIIGYGFGLLFTYLGLYLMNGHGQPALLYLVPCTLGVTVILGL  512

Query  288  KRGDLKHLWT  259
             RG+LK LW 
Sbjct  513  VRGELKELWN  522



>gb|KJB30038.1| hypothetical protein B456_005G128500 [Gossypium raimondii]
 gb|KJB30039.1| hypothetical protein B456_005G128500 [Gossypium raimondii]
Length=537

 Score =   266 bits (680),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/190 (67%), Positives = 153/190 (81%), Gaps = 0/190 (0%)
 Frame = -2

Query  828  CIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWVF  649
            C++FAV+WAV RR S + +GQDILGI L+ITVLQ+ R+PN+KV TVLL CAF+YD+FWVF
Sbjct  332  CLIFAVVWAVNRRESYSWVGQDILGICLMITVLQLARLPNIKVATVLLCCAFVYDIFWVF  391

Query  648  VSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFSL  469
            +S   FH+SVMIVVARGD SG + IPMLL++PR FDPWGGY +IGFGDI+ PGLLVAF+ 
Sbjct  392  LSPLIFHQSVMIVVARGDNSGGESIPMLLRVPRAFDPWGGYDMIGFGDILFPGLLVAFAF  451

Query  468  RYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLGK  289
            RYD   KK L +GYFLW ++ YG GLL TYL L LM+GHGQPALLY+VP TLG  + LG 
Sbjct  452  RYDKAYKKHLASGYFLWLIIGYGFGLLFTYLGLYLMNGHGQPALLYLVPCTLGVTVILGL  511

Query  288  KRGDLKHLWT  259
             RG+LK LW 
Sbjct  512  VRGELKELWN  521



>ref|XP_007033978.1| Signal peptide peptidase family protein, expressed isoform 1 
[Theobroma cacao]
 gb|EOY04904.1| Signal peptide peptidase family protein, expressed isoform 1 
[Theobroma cacao]
Length=537

 Score =   265 bits (678),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 125/191 (65%), Positives = 153/191 (80%), Gaps = 0/191 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FC+ FAV+WAV+RR S + +GQDILGI L+ITVLQ+ R+PN+KV TVLL CAF+YD+FWV
Sbjct  332  FCVTFAVVWAVHRRASYSWVGQDILGICLMITVLQLARLPNIKVATVLLCCAFVYDIFWV  391

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F+S   FH+SVMI VARGD SG + IPMLL++PR+FDPWGGY +IGFGDI+ PGLLVAF+
Sbjct  392  FLSPLIFHQSVMIAVARGDNSGGESIPMLLRVPRVFDPWGGYDMIGFGDILFPGLLVAFA  451

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
             RYD  +KK L  GYF+W ++ YG GL  TYL L LM+GHGQPALLY+VP TLG  + LG
Sbjct  452  FRYDKENKKHLANGYFVWLIIGYGFGLFFTYLGLYLMNGHGQPALLYLVPCTLGVAVILG  511

Query  291  KKRGDLKHLWT  259
              RG+LK LW 
Sbjct  512  LVRGELKGLWN  522



>ref|XP_007040267.1| Signal peptide peptidase-like 2 isoform 4 [Theobroma cacao]
 gb|EOY24768.1| Signal peptide peptidase-like 2 isoform 4 [Theobroma cacao]
Length=479

 Score =   263 bits (673),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYR VS A IGQDILGIALIITVLQIV VPNLKVGTVLL CAFLYD+FWV
Sbjct  331  FCIAFAVVWAVYRNVSFAWIGQDILGIALIITVLQIVHVPNLKVGTVLLSCAFLYDIFWV  390

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK  FHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYS+IGFGDI+LPGLL+AFS
Sbjct  391  FVSKKLFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSIIGFGDILLPGLLIAFS  450

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLG  394
            LRYDWL+ K+LR GYFLWAM AYGLG
Sbjct  451  LRYDWLANKTLRAGYFLWAMFAYGLG  476



>ref|XP_012066255.1| PREDICTED: signal peptide peptidase-like 5 [Jatropha curcas]
 gb|KDP42881.1| hypothetical protein JCGZ_23823 [Jatropha curcas]
Length=533

 Score =   265 bits (677),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 127/197 (64%), Positives = 154/197 (78%), Gaps = 1/197 (1%)
 Frame = -2

Query  828  CIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWVF  649
            C++ AV W VYRR S + IGQD LGI L+ITVLQ+ R+PN+KV  VLL CAF+YD+FWVF
Sbjct  330  CLILAVFWIVYRRTSYSWIGQDFLGICLMITVLQVARLPNIKVAAVLLCCAFVYDIFWVF  389

Query  648  VSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFSL  469
            +S   FH+SVMIVVARGD SG + IPMLL+IPR  DPWGGY +IGFGDI+ PGLLV+FS 
Sbjct  390  LSPIIFHQSVMIVVARGDNSGGESIPMLLRIPRFTDPWGGYDMIGFGDILFPGLLVSFSR  449

Query  468  RYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLGK  289
            RYD  +KK+L TGYFLW +  YG GL +TYL L +M+GHGQPALLY+VP TLG  + LG 
Sbjct  450  RYDNATKKTLSTGYFLWLISGYGFGLFLTYLGLYIMNGHGQPALLYLVPCTLGICVILGM  509

Query  288  KRGDLKHLWTKGDPDRP  238
             RG++K LW+  DPD P
Sbjct  510  LRGEIKDLWSY-DPDAP  525



>gb|KJB20660.1| hypothetical protein B456_003G158200 [Gossypium raimondii]
Length=478

 Score =   263 bits (672),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV+WAVYR VS A IGQDILGIALIITVLQIV VPNLKVGTVLL CAFLYD+FWV
Sbjct  331  FCIAFAVVWAVYRNVSFAWIGQDILGIALIITVLQIVHVPNLKVGTVLLSCAFLYDIFWV  390

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            FVSK  FHESVMIVVARGDKSG+DGIPMLLKIPRMFDPWGGYS+IGFGDI+LPGLLVAFS
Sbjct  391  FVSKKLFHESVMIVVARGDKSGQDGIPMLLKIPRMFDPWGGYSIIGFGDILLPGLLVAFS  450

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGL  391
            LRYDWL+ KSLR GYF+WAM+AYGLG+
Sbjct  451  LRYDWLANKSLRAGYFVWAMIAYGLGM  477



>ref|NP_001067797.1| Os11g0433200 [Oryza sativa Japonica Group]
 dbj|BAF28160.1| Os11g0433200, partial [Oryza sativa Japonica Group]
Length=361

 Score =   259 bits (661),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 150/193 (78%), Gaps = 1/193 (1%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FC +FA++WAVYR  S A IGQDILGI L+ITVLQ+ R+PN++V + LL  AF+YD+FWV
Sbjct  159  FCTIFAILWAVYRHASFAWIGQDILGICLMITVLQMARLPNIRVASALLSAAFVYDVFWV  218

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F+S   FHESVMI VARGD SGE  IPMLL+IPR FDPWGGY +IGFGDII PGLLVAFS
Sbjct  219  FISPLIFHESVMIAVARGDNSGE-AIPMLLRIPRFFDPWGGYDMIGFGDIIFPGLLVAFS  277

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
             R+D  SK+ L  GYFLW  + Y +GL +TYLAL LMDGHGQPALLY+VP TLG  + LG
Sbjct  278  YRFDRASKRGLFNGYFLWLTVGYAVGLFLTYLALFLMDGHGQPALLYLVPCTLGLIVILG  337

Query  291  KKRGDLKHLWTKG  253
              RG+L  LW  G
Sbjct  338  WFRGELHDLWNYG  350



>gb|AAX96394.1| signal peptide peptidase, putative [Oryza sativa Japonica Group]
Length=390

 Score =   259 bits (661),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 150/193 (78%), Gaps = 1/193 (1%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FC +FA++WAVYR  S A IGQDILGI L+ITVLQ+ R+PN++V + LL  AF+YD+FWV
Sbjct  188  FCTIFAILWAVYRHASFAWIGQDILGICLMITVLQMARLPNIRVASALLSAAFVYDVFWV  247

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F+S   FHESVMI VARGD SGE  IPMLL+IPR FDPWGGY +IGFGDII PGLLVAFS
Sbjct  248  FISPLIFHESVMIAVARGDNSGE-AIPMLLRIPRFFDPWGGYDMIGFGDIIFPGLLVAFS  306

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
             R+D  SK+ L  GYFLW  + Y +GL +TYLAL LMDGHGQPALLY+VP TLG  + LG
Sbjct  307  YRFDRASKRGLFNGYFLWLTVGYAVGLFLTYLALFLMDGHGQPALLYLVPCTLGLIVILG  366

Query  291  KKRGDLKHLWTKG  253
              RG+L  LW  G
Sbjct  367  WFRGELHDLWNYG  379



>ref|XP_004979231.1| PREDICTED: signal peptide peptidase-like 2-like [Setaria italica]
Length=534

 Score =   262 bits (669),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 150/193 (78%), Gaps = 1/193 (1%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FC+VFA++WAVYR  S A IGQDILGI L+ITVLQ+ R+PN++V + LL  AF+YD+FWV
Sbjct  332  FCVVFAILWAVYRHASFAWIGQDILGICLMITVLQMARLPNIRVASALLSAAFVYDIFWV  391

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F+S   FHESVMI VARGD +GE  IPMLL+IPR FDPWGGY +IGFGDII PGLLVAFS
Sbjct  392  FISPLIFHESVMIAVARGDNTGES-IPMLLRIPRFFDPWGGYDMIGFGDIIFPGLLVAFS  450

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
             R+D  SKK +  GYFLW    Y +GL +TYLAL LMDGHGQPALLY+VP TLG  + LG
Sbjct  451  YRFDRASKKGILNGYFLWLTGGYAVGLFLTYLALFLMDGHGQPALLYLVPCTLGLIVLLG  510

Query  291  KKRGDLKHLWTKG  253
              RGDL  LW  G
Sbjct  511  WVRGDLHDLWNYG  523



>gb|KDO50535.1| hypothetical protein CISIN_1g009527mg [Citrus sinensis]
Length=393

 Score =   258 bits (658),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 153/198 (77%), Gaps = 5/198 (3%)
 Frame = -2

Query  816  AVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWVFVSKW  637
            AV+WAV R+ S + +GQDILGI L+ITVLQ+ R+PN+KV +VLL CAF+YD+FWVFVS  
Sbjct  193  AVVWAVRRQASYSWVGQDILGICLMITVLQMARLPNIKVASVLLCCAFVYDIFWVFVSPL  252

Query  636  WFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFSLRYDW  457
             FHESVMI VARGD SG + IPMLL+IPR+FDPWGGY +IGFGDI+ PGLL+ F+ RYD 
Sbjct  253  IFHESVMIAVARGDNSGGESIPMLLRIPRLFDPWGGYDMIGFGDILFPGLLICFAFRYDK  312

Query  456  LSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLGKKRGD  277
             +KK +  GYFLW ++ YG GL +TYL L LM+GHGQPALLY+VP TLG  + LG  RG+
Sbjct  313  ENKKGVVKGYFLWLIIGYGFGLFLTYLGLYLMNGHGQPALLYLVPCTLGLTVILGLARGE  372

Query  276  LKHLWT-----KGDPDRP  238
            LKHLW        D +RP
Sbjct  373  LKHLWDYSREPSSDMNRP  390



>ref|XP_010908619.1| PREDICTED: signal peptide peptidase-like 2 [Elaeis guineensis]
Length=335

 Score =   255 bits (652),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/193 (64%), Positives = 145/193 (75%), Gaps = 0/193 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FC  FA++WA  +  S A I QDILGI L+ITVLQ+ R+PN+KV + LL CAF+YD+FWV
Sbjct  132  FCAAFAILWAANQHASYAWICQDILGICLMITVLQMARLPNIKVASALLSCAFVYDIFWV  191

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F+S   FHESVMI VARGD SG + IPMLL++PR FDPWGGY +IGFGDI+ PGLLVAFS
Sbjct  192  FISPLIFHESVMIAVARGDNSGGESIPMLLRMPRFFDPWGGYDMIGFGDILFPGLLVAFS  251

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
             RYD  +KK    GYFLW  + Y  GL +TYLAL LMDGHGQPALLY+VP TLG  + LG
Sbjct  252  YRYDRANKKGTLNGYFLWLTLGYAFGLFLTYLALYLMDGHGQPALLYLVPCTLGLIVILG  311

Query  291  KKRGDLKHLWTKG  253
              RG+L  LW  G
Sbjct  312  WVRGELNDLWNYG  324



>emb|CDP10362.1| unnamed protein product [Coffea canephora]
Length=542

 Score =   261 bits (666),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 124/204 (61%), Positives = 154/204 (75%), Gaps = 6/204 (3%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FC+ FA+ WA  R+ S + IGQDILGI L+ITVLQ+ ++PN+KV TVLL CAFLYD+FWV
Sbjct  332  FCLAFAIFWAANRKASYSWIGQDILGICLMITVLQLAQLPNIKVATVLLCCAFLYDIFWV  391

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F+S + FH+SVMI VA+GDK+G + IPMLL+IPR FDPWGGY++IGFGDI+ PGLLV+F+
Sbjct  392  FLSPYIFHDSVMIAVAQGDKAGGESIPMLLRIPRFFDPWGGYNMIGFGDILFPGLLVSFA  451

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
             R+D   KK+ R GYFLW  + Y  GL  TYL L LMDGHGQPALLY+VP TLG  + LG
Sbjct  452  HRFDKAKKKTGRNGYFLWLAIGYACGLFFTYLGLYLMDGHGQPALLYLVPCTLGLCVILG  511

Query  291  KKRGDLKHLW------TKGDPDRP  238
              RG+L+ LW      T  D  +P
Sbjct  512  LVRGELRELWSYDGDSTSTDSTQP  535



>ref|XP_009413504.1| PREDICTED: signal peptide peptidase-like 2 [Musa acuminata subsp. 
malaccensis]
Length=543

 Score =   261 bits (666),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 125/193 (65%), Positives = 147/193 (76%), Gaps = 0/193 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FC  FA++WA  +  S + IGQDILGI L+ITVLQ+VR+PN+KV + LL CAF+YD+FWV
Sbjct  339  FCAAFAILWAANQHASYSWIGQDILGICLMITVLQMVRLPNIKVASALLSCAFVYDVFWV  398

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F+S   FHESVMI VARGD SG + IPMLL+IPR FDPWGGY +IGFGDI+ PGLLVAFS
Sbjct  399  FISPLIFHESVMIAVARGDNSGGEAIPMLLRIPRFFDPWGGYDMIGFGDILFPGLLVAFS  458

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
             RY+   KK +  GYFLW  + Y  GL +TYLAL LMDGHGQPALLY+VP TLG  + LG
Sbjct  459  YRYERSKKKGILNGYFLWLTIGYAFGLFLTYLALYLMDGHGQPALLYLVPCTLGLTIILG  518

Query  291  KKRGDLKHLWTKG  253
              RGDL  LW  G
Sbjct  519  WLRGDLNDLWNYG  531



>gb|KEH21452.1| signal peptide peptidase-like protein [Medicago truncatula]
Length=540

 Score =   261 bits (666),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 126/208 (61%), Positives = 156/208 (75%), Gaps = 4/208 (2%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FC+ FAV WA  R  S + IGQD LGI L+ITVLQ+ ++PN+KV TVLL CAF YD+FWV
Sbjct  334  FCLAFAVFWAATRHESYSWIGQDTLGICLMITVLQLAQLPNIKVATVLLSCAFAYDIFWV  393

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F+S   FHESVMI VARGDK+G + IPMLL+ PR+FD WGGY +IGFGDII PGLLV+F+
Sbjct  394  FISPLIFHESVMIAVARGDKAGGEAIPMLLRFPRLFDTWGGYDMIGFGDIIFPGLLVSFA  453

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
             R+D  +KK +  GYFLW ++ YG+GL+ TYL L LMDG+GQPALLY+VP TLG F+ LG
Sbjct  454  HRFDKDNKKGVLNGYFLWLVIGYGIGLVFTYLGLYLMDGNGQPALLYLVPCTLGVFIILG  513

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPAD  208
              RG+LK LW  G      P +  +P+D
Sbjct  514  CVRGELKSLWNYGTD----PSLSTEPSD  537



>sp|Q53P98.1|SIPL2_ORYSJ RecName: Full=Signal peptide peptidase-like 2; Short=OsSPPL2; 
Flags: Precursor [Oryza sativa Japonica Group]
 gb|AAX92993.1| signal peptide peptidase, putative [Oryza sativa Japonica Group]
 gb|ABA93124.1| signal peptide peptidase family protein, expressed [Oryza sativa 
Japonica Group]
 gb|ABG22469.1| signal peptide peptidase family protein, expressed [Oryza sativa 
Japonica Group]
 gb|EEC68091.1| hypothetical protein OsI_35966 [Oryza sativa Indica Group]
 gb|EEE52048.1| hypothetical protein OsJ_33780 [Oryza sativa Japonica Group]
Length=534

 Score =   260 bits (664),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 150/193 (78%), Gaps = 1/193 (1%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FC +FA++WAVYR  S A IGQDILGI L+ITVLQ+ R+PN++V + LL  AF+YD+FWV
Sbjct  332  FCTIFAILWAVYRHASFAWIGQDILGICLMITVLQMARLPNIRVASALLSAAFVYDVFWV  391

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F+S   FHESVMI VARGD SGE  IPMLL+IPR FDPWGGY +IGFGDII PGLLVAFS
Sbjct  392  FISPLIFHESVMIAVARGDNSGE-AIPMLLRIPRFFDPWGGYDMIGFGDIIFPGLLVAFS  450

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
             R+D  SK+ L  GYFLW  + Y +GL +TYLAL LMDGHGQPALLY+VP TLG  + LG
Sbjct  451  YRFDRASKRGLFNGYFLWLTVGYAVGLFLTYLALFLMDGHGQPALLYLVPCTLGLIVILG  510

Query  291  KKRGDLKHLWTKG  253
              RG+L  LW  G
Sbjct  511  WFRGELHDLWNYG  523



>ref|XP_002881886.1| protease-associated domain-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH58145.1| protease-associated domain-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=541

 Score =   260 bits (664),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 122/205 (60%), Positives = 153/205 (75%), Gaps = 1/205 (0%)
 Frame = -2

Query  828  CIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWVF  649
            C+ FAV W + R  S + +GQDILGI L+IT LQ+VR+PN+KV +VLL CAF+YD+FWVF
Sbjct  334  CLAFAVFWFIERHTSYSWVGQDILGICLMITALQVVRLPNIKVASVLLCCAFVYDIFWVF  393

Query  648  VSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFSL  469
            +S   FHESVMIVVA+GD S  + IPMLL+IPR FDPWGGY +IGFGDI+ PGLL++F+ 
Sbjct  394  ISPLIFHESVMIVVAQGDSSSGESIPMLLRIPRFFDPWGGYDMIGFGDILFPGLLISFAS  453

Query  468  RYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLGK  289
            RYD + K+ +  GYFLW  + YG+GLL+TY+ L LMDGHGQPALLY+VP TLG  + LG 
Sbjct  454  RYDKIKKRVISNGYFLWLTIGYGIGLLLTYVGLYLMDGHGQPALLYVVPCTLGLAVILGL  513

Query  288  KRGDLKHLWTKGDPDRPCPHVQLQP  214
             RG+LK LW  G  +    H    P
Sbjct  514  VRGELKELWNHGSEESES-HTTEDP  537



>gb|ERN11882.1| hypothetical protein AMTR_s00020p00178900 [Amborella trichopoda]
Length=241

 Score =   250 bits (639),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 123/197 (62%), Positives = 152/197 (77%), Gaps = 2/197 (1%)
 Frame = -2

Query  828  CIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWVF  649
            C+VF++ WA  +  S A IGQDILGI+L+ TVLQ+ R+PN+K+ +V L CAF+YD+FWVF
Sbjct  40   CMVFSIFWAANQHASYAWIGQDILGISLMTTVLQMARLPNIKIASVFLSCAFVYDIFWVF  99

Query  648  VSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFSL  469
            +S   FHESVMIVVARGD SGE  IPMLLKIPR FDPWGGY +IGFGDI+ PGLL++F+ 
Sbjct  100  ISPLIFHESVMIVVARGDSSGES-IPMLLKIPRFFDPWGGYDMIGFGDILFPGLLISFAF  158

Query  468  RYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLGK  289
            RYD   KK +  GYFLW ++ YG+GL ITY+AL LMDGHGQPALLY+VP TLG  + LG 
Sbjct  159  RYDRYKKKGILNGYFLWLVIGYGIGLFITYVALYLMDGHGQPALLYLVPCTLGLIIVLGW  218

Query  288  KRGDLKHLWTKGDPDRP  238
             + +L+ LW  G   RP
Sbjct  219  LKKELEDLWDFG-ASRP  234



>gb|ABR16410.1| unknown [Picea sitchensis]
Length=539

 Score =   259 bits (662),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 130/207 (63%), Positives = 157/207 (76%), Gaps = 0/207 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV WA  +  S A I QD+LGI+L+ITVLQI R+PN+KV  VLL CAF+YD+FWV
Sbjct  333  FCIAFAVTWAANQHASYAWICQDVLGISLMITVLQIARLPNIKVAAVLLSCAFVYDIFWV  392

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F+S + FHESVMIVVARGDKSG + IPMLL+IP + DPWGGY +IGFGDI+LPGLLVAF+
Sbjct  393  FISPFLFHESVMIVVARGDKSGGESIPMLLRIPHILDPWGGYDMIGFGDILLPGLLVAFA  452

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
             RYD  +KKSL  GYFLW+ + YG GL +TY+AL+LMDGHGQPALLY+VP TLG  L L 
Sbjct  453  ARYDRSTKKSLWNGYFLWSTIGYGFGLFLTYVALHLMDGHGQPALLYLVPCTLGLILILA  512

Query  291  KKRGDLKHLWTKGDPDRPCPHVQLQPA  211
              R + K LW   +   P P  ++  A
Sbjct  513  LLRREFKDLWVYEERAGPKPQDEILQA  539



>dbj|BAJ93677.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=534

 Score =   259 bits (661),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 127/193 (66%), Positives = 150/193 (78%), Gaps = 1/193 (1%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FC+VFA++WA+YR  S A IGQDILGI L+ITVLQ+ R+PN++V + LL  AF+YD+FWV
Sbjct  333  FCMVFAILWAIYRHSSFAWIGQDILGICLMITVLQMARLPNIRVASALLSAAFVYDIFWV  392

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F+S   FHESVMI VA GD SGE  IPMLL+IPR FDPWGGY +IGFGDII PGLLVAFS
Sbjct  393  FISPLIFHESVMIAVASGDSSGET-IPMLLRIPRFFDPWGGYDMIGFGDIIFPGLLVAFS  451

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
             R+D   KK +  GYFLW  + Y +GL +TYLAL LMDGHGQPALLY+VP TLG  + LG
Sbjct  452  YRFDRAGKKGILNGYFLWLTVGYAVGLFLTYLALFLMDGHGQPALLYLVPCTLGLIVVLG  511

Query  291  KKRGDLKHLWTKG  253
              RG+L HLW  G
Sbjct  512  WIRGELPHLWNYG  524



>gb|KDO50533.1| hypothetical protein CISIN_1g009527mg [Citrus sinensis]
Length=532

 Score =   258 bits (660),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 153/198 (77%), Gaps = 5/198 (3%)
 Frame = -2

Query  816  AVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWVFVSKW  637
            AV+WAV R+ S + +GQDILGI L+ITVLQ+ R+PN+KV +VLL CAF+YD+FWVFVS  
Sbjct  332  AVVWAVRRQASYSWVGQDILGICLMITVLQMARLPNIKVASVLLCCAFVYDIFWVFVSPL  391

Query  636  WFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFSLRYDW  457
             FHESVMI VARGD SG + IPMLL+IPR+FDPWGGY +IGFGDI+ PGLL+ F+ RYD 
Sbjct  392  IFHESVMIAVARGDNSGGESIPMLLRIPRLFDPWGGYDMIGFGDILFPGLLICFAFRYDK  451

Query  456  LSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLGKKRGD  277
             +KK +  GYFLW ++ YG GL +TYL L LM+GHGQPALLY+VP TLG  + LG  RG+
Sbjct  452  ENKKGVVKGYFLWLIIGYGFGLFLTYLGLYLMNGHGQPALLYLVPCTLGLTVILGLARGE  511

Query  276  LKHLWT-----KGDPDRP  238
            LKHLW        D +RP
Sbjct  512  LKHLWDYSREPSSDMNRP  529



>gb|KGN45913.1| hypothetical protein Csa_6G022250 [Cucumis sativus]
Length=336

 Score =   253 bits (645),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/195 (62%), Positives = 148/195 (76%), Gaps = 0/195 (0%)
 Frame = -2

Query  828  CIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWVF  649
            CI FAV+WA+ R  S + IGQ+ILGI L+ITVLQ+ R+PN+KV TVLL CAF+YD+FWVF
Sbjct  132  CITFAVVWALNRHASYSWIGQNILGICLMITVLQMTRLPNIKVATVLLCCAFIYDIFWVF  191

Query  648  VSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFSL  469
            +S   FHESVMI VARGD SG + IPMLL++PR FDPWGG+ +IGFGDI+ PGLLV+F+ 
Sbjct  192  ISPVIFHESVMIAVARGDNSGGESIPMLLRVPRTFDPWGGFDMIGFGDILFPGLLVSFTR  251

Query  468  RYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLGK  289
            R+D   KKS    YF W ++ YG GL +TYL L  M+GHGQPALLY+VP TLG  + LG 
Sbjct  252  RFDKAQKKSKCNAYFPWLLVGYGTGLFLTYLGLYFMNGHGQPALLYLVPCTLGVTVVLGF  311

Query  288  KRGDLKHLWTKGDPD  244
             RG+LK LW  G  +
Sbjct  312  IRGELKQLWNYGTEN  326



>tpg|DAA38909.1| TPA: hypothetical protein ZEAMMB73_606524 [Zea mays]
Length=534

 Score =   258 bits (660),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/193 (65%), Positives = 151/193 (78%), Gaps = 1/193 (1%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FC VFA++WAVYR  S A IGQD+LGI L+ITVLQ+ R+PN+KV + LL  AF+YD+FWV
Sbjct  332  FCAVFAILWAVYRHASFAWIGQDVLGICLMITVLQMARLPNIKVASALLSAAFVYDIFWV  391

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F+S   FHESVMI VARGD +GE  IPMLL+IPR FDPWGGY +IGFGDII PGLLV FS
Sbjct  392  FISPLIFHESVMIAVARGDNTGES-IPMLLRIPRFFDPWGGYDMIGFGDIIFPGLLVGFS  450

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
             R+D  ++K + +GYFLW ++ Y +GL ITYLAL LMDGHGQPALLY+VP TLG  + LG
Sbjct  451  YRFDRANRKGVLSGYFLWLIVGYAVGLFITYLALFLMDGHGQPALLYLVPCTLGVIVILG  510

Query  291  KKRGDLKHLWTKG  253
              RG+L  LW  G
Sbjct  511  WLRGELYELWNFG  523



>ref|XP_002268575.1| PREDICTED: signal peptide peptidase-like 2 [Vitis vinifera]
 emb|CBI39454.3| unnamed protein product [Vitis vinifera]
Length=533

 Score =   258 bits (659),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 119/193 (62%), Positives = 151/193 (78%), Gaps = 0/193 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FC+ FA+ WA+ R+ S + IGQD+LGI+L+ITVLQI R+PN+KV +VLL CAF+YD+FWV
Sbjct  327  FCLSFAIAWAITRKASFSWIGQDVLGISLMITVLQIARLPNIKVASVLLCCAFVYDIFWV  386

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F+S   F +SVMI VARGD SG + IPMLL++PR FDPWGGY +IGFGDI+ PGLL++F+
Sbjct  387  FISPVIFKDSVMIAVARGDNSGGESIPMLLRVPRFFDPWGGYDMIGFGDILFPGLLISFA  446

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
             R+D  +K+ +  GYFLW  + YG GLL TYL L LM+GHGQPALLY+VP TLG  + LG
Sbjct  447  FRFDKTNKRGMTNGYFLWLAIGYGCGLLFTYLGLYLMNGHGQPALLYLVPCTLGVTIILG  506

Query  291  KKRGDLKHLWTKG  253
              RG+L HLW  G
Sbjct  507  LMRGELGHLWEHG  519



>ref|XP_008667367.1| PREDICTED: uncharacterized protein LOC100217036 isoform X1 [Zea 
mays]
 gb|ACL54604.1| unknown [Zea mays]
 tpg|DAA38910.1| TPA: hypothetical protein ZEAMMB73_606524 [Zea mays]
Length=534

 Score =   258 bits (659),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 126/193 (65%), Positives = 151/193 (78%), Gaps = 1/193 (1%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FC VFA++WAVYR  S A IGQD+LGI L+ITVLQ+ R+PN+KV + LL  AF+YD+FWV
Sbjct  332  FCAVFAILWAVYRHASFAWIGQDVLGICLMITVLQMARLPNIKVASALLSAAFVYDIFWV  391

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F+S   FHESVMI VARGD +GE  IPMLL+IPR FDPWGGY +IGFGDII PGLLV FS
Sbjct  392  FISPLIFHESVMIAVARGDNTGES-IPMLLRIPRFFDPWGGYDMIGFGDIIFPGLLVGFS  450

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
             R+D  ++K + +GYFLW ++ Y +GL ITYLAL LMDGHGQPALLY+VP TLG  + LG
Sbjct  451  YRFDRANRKGVLSGYFLWLIVGYAVGLFITYLALFLMDGHGQPALLYLVPCTLGVIVILG  510

Query  291  KKRGDLKHLWTKG  253
              RG+L  LW  G
Sbjct  511  WLRGELYELWNFG  523



>ref|XP_006663404.1| PREDICTED: signal peptide peptidase-like 2-like [Oryza brachyantha]
Length=534

 Score =   258 bits (658),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 148/193 (77%), Gaps = 1/193 (1%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FC VFA++WAVYR  S A IGQD LGI L+ITVLQ+ R+PN++V + LL  AF+YD+FWV
Sbjct  332  FCTVFAILWAVYRHTSFAWIGQDTLGICLMITVLQMARLPNIRVASALLSAAFVYDVFWV  391

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F+S   FHESVMI VARGD SGE  IPMLL+IPR FDPWGGY +IGFGDII PGLLVAFS
Sbjct  392  FISPLIFHESVMIAVARGDNSGES-IPMLLRIPRFFDPWGGYDMIGFGDIIFPGLLVAFS  450

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
             R+D   KK L  GYFLW  + Y +GL +TYLAL LMDGHGQPALLY+VP TLG  + LG
Sbjct  451  YRFDRACKKGLFNGYFLWLTVGYAVGLFLTYLALFLMDGHGQPALLYLVPCTLGLIVILG  510

Query  291  KKRGDLKHLWTKG  253
              RG+L  LW  G
Sbjct  511  WLRGELHDLWNYG  523



>ref|XP_007139105.1| hypothetical protein PHAVU_008G001700g [Phaseolus vulgaris]
 gb|ESW11099.1| hypothetical protein PHAVU_008G001700g [Phaseolus vulgaris]
Length=532

 Score =   258 bits (658),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 122/205 (60%), Positives = 157/205 (77%), Gaps = 1/205 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FC+ FA+ WA  R+ S + +GQDILGI L+ITVLQ+ R+PN+KV TVLL CAF+YD+FWV
Sbjct  328  FCVAFAIFWAATRQESYSWVGQDILGICLMITVLQLARLPNIKVATVLLCCAFVYDIFWV  387

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F+S   FHESVMI VARGDK+G + IPMLL+ PR+FDPWGGY +IGFGDI+ PGLLV+F+
Sbjct  388  FISPVIFHESVMIAVARGDKAGGEAIPMLLRFPRLFDPWGGYDMIGFGDILFPGLLVSFA  447

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
             R+D  +++ L  GYFLW ++ YG+GL+ TYL L LM+G+GQPALLY+VP TLG  + LG
Sbjct  448  HRFDKDNRRGLSNGYFLWLVIGYGIGLVFTYLGLYLMNGNGQPALLYLVPCTLGVTVILG  507

Query  291  KKRGDLKHLWTKG-DPDRPCPHVQL  220
              RG+LK LW  G D      H ++
Sbjct  508  CIRGELKSLWNYGTDASLSAEHSEV  532



>gb|EYU32730.1| hypothetical protein MIMGU_mgv1a004358mg [Erythranthe guttata]
Length=531

 Score =   257 bits (656),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 121/192 (63%), Positives = 155/192 (81%), Gaps = 0/192 (0%)
 Frame = -2

Query  828  CIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWVF  649
            C+VFAV+WA  R+ S + IGQD+LGI +++TVLQ+ ++PN+KV TVLL CAFLYD+FWVF
Sbjct  328  CLVFAVVWAANRKASYSWIGQDVLGICMMLTVLQLAQLPNIKVATVLLCCAFLYDIFWVF  387

Query  648  VSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFSL  469
            +S + FH+SVMI VARGDKSG + IPMLL++PR+ DP+ GY++IGFGDI+ PGLLV+FS 
Sbjct  388  LSPYIFHDSVMIAVARGDKSGGESIPMLLRVPRIADPYEGYNMIGFGDILFPGLLVSFSF  447

Query  468  RYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLGK  289
            R+D  +KK +  GYFL+  + YGLGL  TYL L LMDGHGQPALLY+VP TLGT + LG 
Sbjct  448  RFDKANKKRILNGYFLFLTIGYGLGLAFTYLGLYLMDGHGQPALLYLVPCTLGTCVVLGW  507

Query  288  KRGDLKHLWTKG  253
             RG+LK LW+ G
Sbjct  508  IRGELKQLWSYG  519



>ref|XP_009786573.1| PREDICTED: signal peptide peptidase-like 3 [Nicotiana sylvestris]
Length=528

 Score =   257 bits (656),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 119/190 (63%), Positives = 152/190 (80%), Gaps = 0/190 (0%)
 Frame = -2

Query  828  CIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWVF  649
            C+ FA+ WA  R+ S + IGQDILGI L+ITVLQ+ ++PN+KV TVLL CAFLYD+FWVF
Sbjct  323  CVAFAIFWAATRKASYSWIGQDILGICLMITVLQLAQLPNIKVATVLLCCAFLYDIFWVF  382

Query  648  VSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFSL  469
            +S   FH+SVMI VARGDK+G + IPMLL++PR+ DP+GGY +IGFGDI+ PGLLV F+ 
Sbjct  383  LSPAIFHDSVMIAVARGDKAGGESIPMLLRVPRVSDPYGGYDMIGFGDILFPGLLVCFAF  442

Query  468  RYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLGK  289
            R+D   +K +R GY+LW ++ YG+GLL TYL L LM+GHGQPALLY+VP TLGT++ LG 
Sbjct  443  RFDKARRKGVRNGYYLWMIVGYGIGLLFTYLGLYLMNGHGQPALLYLVPCTLGTYVVLGL  502

Query  288  KRGDLKHLWT  259
             RG+LK LW 
Sbjct  503  VRGELKDLWN  512



>ref|XP_002446699.1| hypothetical protein SORBIDRAFT_06g020770 [Sorghum bicolor]
 gb|EES11027.1| hypothetical protein SORBIDRAFT_06g020770 [Sorghum bicolor]
Length=534

 Score =   257 bits (656),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 125/193 (65%), Positives = 151/193 (78%), Gaps = 1/193 (1%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FC+VFA++WAVYR  S A IGQD+LGI L+ITVLQ+ R+PN+KV + LL  AF+YD+FWV
Sbjct  332  FCVVFAILWAVYRHASFAWIGQDVLGICLMITVLQMARLPNIKVASALLSAAFVYDVFWV  391

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F+S   F+ESVMI VARGD +GE  IPMLL+IPR FDPWGGY +IGFGDII PGLLVAFS
Sbjct  392  FISPLIFNESVMIAVARGDNTGES-IPMLLRIPRFFDPWGGYDMIGFGDIIFPGLLVAFS  450

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
             R+D  ++K +  GYFLW ++ Y +GL ITYLAL LMDG GQPALLY+VP TLG  + LG
Sbjct  451  YRFDRATRKGVLNGYFLWLIVGYAVGLFITYLALFLMDGQGQPALLYLVPCTLGVIVILG  510

Query  291  KKRGDLKHLWTKG  253
              RG+L  LW  G
Sbjct  511  WLRGELHELWNYG  523



>ref|XP_003568960.1| PREDICTED: signal peptide peptidase-like 2 [Brachypodium distachyon]
Length=530

 Score =   257 bits (656),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 127/197 (64%), Positives = 150/197 (76%), Gaps = 1/197 (1%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FC VFA++WAVYR  S A IGQDILGI L+ITVLQ+ R+PN++V + LL  AF+YD+FWV
Sbjct  330  FCTVFAILWAVYRHSSFAWIGQDILGICLMITVLQMARLPNIRVASALLSAAFVYDIFWV  389

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F+S   FHESVMI VARGD SGE  IPMLL+IPR FDPWGGY ++GFGDII PGLLVAFS
Sbjct  390  FISPLLFHESVMIAVARGDNSGET-IPMLLRIPRFFDPWGGYDMLGFGDIIFPGLLVAFS  448

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
             R+D   KK +  GYFLW  + Y +GL +TYLAL LMDGHGQPALLY+VP TLG  + LG
Sbjct  449  YRFDRAGKKGVLNGYFLWLTVGYAVGLFLTYLALFLMDGHGQPALLYLVPCTLGLIVVLG  508

Query  291  KKRGDLKHLWTKGDPDR  241
              RG+L  LW  G  + 
Sbjct  509  WIRGELPLLWNYGRSEN  525



>ref|XP_006443146.1| hypothetical protein CICLE_v10019670mg [Citrus clementina]
 ref|XP_006478885.1| PREDICTED: signal peptide peptidase-like 5-like [Citrus sinensis]
 gb|ESR56386.1| hypothetical protein CICLE_v10019670mg [Citrus clementina]
Length=532

 Score =   256 bits (655),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 152/198 (77%), Gaps = 5/198 (3%)
 Frame = -2

Query  816  AVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWVFVSKW  637
            AV+WAV R+ S + +GQDILGI L+ITVLQ+ R+PN+KV +VLL CAF+YD+FWVFVS  
Sbjct  332  AVVWAVRRQASYSWVGQDILGICLMITVLQMARLPNIKVASVLLCCAFVYDIFWVFVSPL  391

Query  636  WFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFSLRYDW  457
             FHESVMI VARGD S  + IPMLL+IPR+FDPWGGY +IGFGDI+ PGLL+ F+ RYD 
Sbjct  392  IFHESVMIAVARGDNSSGESIPMLLRIPRLFDPWGGYDMIGFGDILFPGLLICFAFRYDK  451

Query  456  LSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLGKKRGD  277
             +KK +  GYFLW ++ YG GL +TYL L LM+GHGQPALLY+VP TLG  + LG  RG+
Sbjct  452  ENKKGVVKGYFLWLIIGYGFGLFLTYLGLYLMNGHGQPALLYLVPCTLGLTVILGLARGE  511

Query  276  LKHLWT-----KGDPDRP  238
            LKHLW        D +RP
Sbjct  512  LKHLWDYSREPSSDMNRP  529



>ref|XP_011073830.1| PREDICTED: signal peptide peptidase-like 3 [Sesamum indicum]
Length=538

 Score =   256 bits (655),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/193 (62%), Positives = 156/193 (81%), Gaps = 0/193 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
             C+VFA++WA  R+ S + +GQDILGI ++ITVLQ+ ++PN+KV TVLL CAFLYD+FWV
Sbjct  333  LCLVFAIVWAAERKSSYSWVGQDILGICMMITVLQLAQLPNIKVATVLLCCAFLYDIFWV  392

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F+S + FH+SVMI VA GDKSG + IPMLL++PR+ DP+ GY++IGFGDI+ PGLLV+F+
Sbjct  393  FLSPFIFHDSVMIAVAEGDKSGGESIPMLLRVPRLADPYYGYNMIGFGDILFPGLLVSFA  452

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
             R+D  +KK++  GYFLW  + YG+GLL TYL L LMDGHGQPALLY+VP TLGT + LG
Sbjct  453  FRFDKANKKTVLHGYFLWLTIGYGVGLLFTYLGLYLMDGHGQPALLYLVPCTLGTCVVLG  512

Query  291  KKRGDLKHLWTKG  253
              RG+LK LW+ G
Sbjct  513  YIRGELKQLWSYG  525



>ref|XP_011042780.1| PREDICTED: signal peptide peptidase-like 3 isoform X3 [Populus 
euphratica]
Length=549

 Score =   256 bits (655),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/195 (63%), Positives = 150/195 (77%), Gaps = 0/195 (0%)
 Frame = -2

Query  828  CIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWVF  649
            C+VFA++WA+ R+ S +  GQDILGI L+ITVLQ+ R+PN+KV TVLL CAF+YD+FWVF
Sbjct  344  CVVFAIVWAINRQASYSWAGQDILGICLMITVLQVARLPNIKVATVLLCCAFVYDIFWVF  403

Query  648  VSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFSL  469
            +S   FH+SVMI VARGD SG + IPMLL+IPR  D WGGY +IGFGDI+ PGLLV+F+ 
Sbjct  404  LSPIIFHQSVMIAVARGDNSGGETIPMLLRIPRFADEWGGYDMIGFGDILFPGLLVSFAF  463

Query  468  RYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLGK  289
            RYD  +KK +  GYFLW  + YG+GL +TYL L LMDGHGQPALLY+VP TLG  + LG 
Sbjct  464  RYDKANKKGIAKGYFLWLTIGYGVGLFLTYLGLYLMDGHGQPALLYLVPCTLGLCILLGL  523

Query  288  KRGDLKHLWTKGDPD  244
             RG+LK LW     D
Sbjct  524  VRGELKDLWNYSSED  538



>ref|XP_010245342.1| PREDICTED: signal peptide peptidase-like 2 isoform X1 [Nelumbo 
nucifera]
Length=543

 Score =   256 bits (655),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/196 (62%), Positives = 150/196 (77%), Gaps = 0/196 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FCI FAV WAV ++ S A IGQD+L I L+++VLQ  R+PN+KV +VLL CAF YD+FWV
Sbjct  332  FCIAFAVFWAVKQQASYAWIGQDVLAICLMLSVLQTARLPNIKVSSVLLCCAFFYDIFWV  391

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F+S   FHESVMI VARG  SG   IP+LL+IPR FDPWGGY+++GFGD++ PGLL++F+
Sbjct  392  FLSPLIFHESVMIAVARGSHSGGVAIPLLLRIPRYFDPWGGYNMVGFGDVLFPGLLISFT  451

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
             RYD  +KKS   GYFLW M+ YG GL +TYL L LMDGHGQPALLY+VP TLG  + LG
Sbjct  452  YRYDKSTKKSTLNGYFLWVMIGYGTGLFLTYLGLYLMDGHGQPALLYLVPCTLGLTVVLG  511

Query  291  KKRGDLKHLWTKGDPD  244
              RG+LK LW+ G  +
Sbjct  512  XLRGELKSLWSYGTDE  527



>gb|KHN24971.1| Signal peptide peptidase-like 2B [Glycine soja]
Length=530

 Score =   256 bits (653),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/193 (61%), Positives = 153/193 (79%), Gaps = 0/193 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FC+ FA+ WA  R+ S + IGQDILGI L+ITVLQ+ R+PN+KV TVLL CAF+YD+FWV
Sbjct  324  FCVAFAIFWAATRQESYSWIGQDILGICLMITVLQLARLPNIKVATVLLCCAFVYDIFWV  383

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F+S   FHESVMI VARGDK+G + IPMLL+ PR+FDPWGGY +IGFGDI+ PGLL++F+
Sbjct  384  FISPVIFHESVMIAVARGDKAGGEAIPMLLRFPRLFDPWGGYDMIGFGDILFPGLLISFA  443

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
             R+D  +++    GYFLW ++ YG+GL++TY+ L LM+G+GQPALLY+VP TLG  + LG
Sbjct  444  HRFDKDNRRGASNGYFLWLVVGYGIGLVLTYMGLYLMNGNGQPALLYLVPCTLGVTVILG  503

Query  291  KKRGDLKHLWTKG  253
              RG+LK LW  G
Sbjct  504  CIRGELKSLWNYG  516



>ref|XP_011042779.1| PREDICTED: signal peptide peptidase-like 3 isoform X2 [Populus 
euphratica]
Length=552

 Score =   256 bits (655),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/195 (63%), Positives = 150/195 (77%), Gaps = 0/195 (0%)
 Frame = -2

Query  828  CIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWVF  649
            C+VFA++WA+ R+ S +  GQDILGI L+ITVLQ+ R+PN+KV TVLL CAF+YD+FWVF
Sbjct  335  CVVFAIVWAINRQASYSWAGQDILGICLMITVLQVARLPNIKVATVLLCCAFVYDIFWVF  394

Query  648  VSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFSL  469
            +S   FH+SVMI VARGD SG + IPMLL+IPR  D WGGY +IGFGDI+ PGLLV+F+ 
Sbjct  395  LSPIIFHQSVMIAVARGDNSGGETIPMLLRIPRFADEWGGYDMIGFGDILFPGLLVSFAF  454

Query  468  RYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLGK  289
            RYD  +KK +  GYFLW  + YG+GL +TYL L LMDGHGQPALLY+VP TLG  + LG 
Sbjct  455  RYDKANKKGIAKGYFLWLTIGYGVGLFLTYLGLYLMDGHGQPALLYLVPCTLGLCILLGL  514

Query  288  KRGDLKHLWTKGDPD  244
             RG+LK LW     D
Sbjct  515  VRGELKDLWNYSSED  529



>ref|XP_003532320.1| PREDICTED: signal peptide peptidase-like 3-like [Glycine max]
Length=530

 Score =   256 bits (653),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/193 (61%), Positives = 153/193 (79%), Gaps = 0/193 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FC+ FA+ WA  R+ S + IGQDILGI L+ITVLQ+ R+PN+KV TVLL CAF+YD+FWV
Sbjct  324  FCVAFAIFWAATRQESYSWIGQDILGICLMITVLQLARLPNIKVATVLLCCAFVYDIFWV  383

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F+S   FHESVMI VARGDK+G + IPMLL+ PR+FDPWGGY +IGFGDI+ PGLL++F+
Sbjct  384  FISPVIFHESVMIAVARGDKAGGEAIPMLLRFPRLFDPWGGYDMIGFGDILFPGLLISFA  443

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
             R+D  +++    GYFLW ++ YG+GL++TY+ L LM+G+GQPALLY+VP TLG  + LG
Sbjct  444  HRFDKDNRRGASNGYFLWLVVGYGIGLVLTYMGLYLMNGNGQPALLYLVPCTLGVTVILG  503

Query  291  KKRGDLKHLWTKG  253
              RG+LK LW  G
Sbjct  504  CIRGELKSLWNYG  516



>ref|XP_011042778.1| PREDICTED: signal peptide peptidase-like 3 isoform X1 [Populus 
euphratica]
Length=561

 Score =   256 bits (655),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/195 (63%), Positives = 150/195 (77%), Gaps = 0/195 (0%)
 Frame = -2

Query  828  CIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWVF  649
            C+VFA++WA+ R+ S +  GQDILGI L+ITVLQ+ R+PN+KV TVLL CAF+YD+FWVF
Sbjct  344  CVVFAIVWAINRQASYSWAGQDILGICLMITVLQVARLPNIKVATVLLCCAFVYDIFWVF  403

Query  648  VSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFSL  469
            +S   FH+SVMI VARGD SG + IPMLL+IPR  D WGGY +IGFGDI+ PGLLV+F+ 
Sbjct  404  LSPIIFHQSVMIAVARGDNSGGETIPMLLRIPRFADEWGGYDMIGFGDILFPGLLVSFAF  463

Query  468  RYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLGK  289
            RYD  +KK +  GYFLW  + YG+GL +TYL L LMDGHGQPALLY+VP TLG  + LG 
Sbjct  464  RYDKANKKGIAKGYFLWLTIGYGVGLFLTYLGLYLMDGHGQPALLYLVPCTLGLCILLGL  523

Query  288  KRGDLKHLWTKGDPD  244
             RG+LK LW     D
Sbjct  524  VRGELKDLWNYSSED  538



>gb|KHN37259.1| Signal peptide peptidase-like 2B [Glycine soja]
Length=469

 Score =   254 bits (648),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 118/191 (62%), Positives = 151/191 (79%), Gaps = 0/191 (0%)
 Frame = -2

Query  831  FCIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWV  652
            FC++FAV+W   RR S +  GQD LGI L+ITVLQ+ R+PN+KV TVLL CAF+YD+FWV
Sbjct  263  FCVIFAVVWVATRRESFSWFGQDALGIGLMITVLQLARLPNIKVATVLLCCAFVYDIFWV  322

Query  651  FVSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFS  472
            F+S   F +SVMI VARGDK+G + IPMLL+ PR+ DPWGGY +IGFGDI+ PGLLV+F+
Sbjct  323  FISPVIFQKSVMITVARGDKAGGEAIPMLLRFPRLSDPWGGYDMIGFGDILFPGLLVSFT  382

Query  471  LRYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLG  292
             R+D  +KK + +GYFLW ++ YG GL  TYL L +M+GHGQPALLY+VP TLG  + LG
Sbjct  383  RRFDKANKKGVVSGYFLWLVVGYGFGLFFTYLGLYMMNGHGQPALLYLVPCTLGVTVVLG  442

Query  291  KKRGDLKHLWT  259
             KRG+LK+LW+
Sbjct  443  CKRGELKYLWS  453



>gb|ABK92483.1| unknown [Populus trichocarpa]
Length=540

 Score =   256 bits (653),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 121/195 (62%), Positives = 149/195 (76%), Gaps = 0/195 (0%)
 Frame = -2

Query  828  CIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWVF  649
            C+VF+ +WA+ R+ S +  GQDILGI L+ITVLQ+ R+PN+KV TVLL CAF+YD+FWVF
Sbjct  336  CVVFSTVWAINRQASYSWAGQDILGICLMITVLQVARLPNIKVATVLLCCAFVYDIFWVF  395

Query  648  VSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFSL  469
            +S   FH+SVMI VARGD SG + IPMLL+IPR  D WGGY +IGFGDI+ PGLLV+F+ 
Sbjct  396  LSPIIFHQSVMIAVARGDNSGGETIPMLLRIPRFADEWGGYDMIGFGDILFPGLLVSFAF  455

Query  468  RYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLGK  289
            RYD  +KK +  GYFLW  + YG+GL +TYL L LMDGHGQPALLY+VP TLG  + LG 
Sbjct  456  RYDKANKKGIANGYFLWLTIGYGVGLFLTYLGLYLMDGHGQPALLYLVPCTLGLCILLGL  515

Query  288  KRGDLKHLWTKGDPD  244
             RG+LK LW     D
Sbjct  516  VRGELKDLWNYSSED  530



>ref|XP_010999996.1| PREDICTED: signal peptide peptidase-like 3 isoform X2 [Populus 
euphratica]
Length=527

 Score =   255 bits (652),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/195 (61%), Positives = 149/195 (76%), Gaps = 0/195 (0%)
 Frame = -2

Query  828  CIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWVF  649
            C+ FA+ WA  R+ S +  GQDILGI L+ITVLQ+ R+PN+KV TVLL CAF+YD+FWVF
Sbjct  323  CVAFAIFWATNRQASYSWAGQDILGICLMITVLQVARLPNIKVATVLLCCAFVYDIFWVF  382

Query  648  VSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFSL  469
            +S   FH+SVMI VARGD SG + IPMLL+IPR  DPWGGY +IGFGDI+ PGLLV+F+ 
Sbjct  383  LSPIIFHQSVMIAVARGDNSGGETIPMLLRIPRFADPWGGYDMIGFGDILFPGLLVSFTF  442

Query  468  RYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLGK  289
            RYD  +KK +  GYF+W  + YG+GL +TYL L LM+GHGQPALLY+VP TLGT + L  
Sbjct  443  RYDKTNKKGIANGYFIWLTVGYGVGLFLTYLGLYLMNGHGQPALLYLVPCTLGTCVLLAL  502

Query  288  KRGDLKHLWTKGDPD  244
             RG+LK+LW     +
Sbjct  503  VRGELKNLWNYSSEE  517



>ref|XP_002301641.1| hypothetical protein POPTR_0002s23320g [Populus trichocarpa]
 gb|EEE80914.1| hypothetical protein POPTR_0002s23320g [Populus trichocarpa]
Length=540

 Score =   255 bits (652),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 121/195 (62%), Positives = 149/195 (76%), Gaps = 0/195 (0%)
 Frame = -2

Query  828  CIVFAVMWAVYRRVSXAXIGQDILGIALIITVLQIVRVPNLKVGTVLLGCAFLYDLFWVF  649
            C+VF+ +WA+ R+ S +  GQDILGI L+ITVLQ+ R+PN+KV TVLL CAF+YD+FWVF
Sbjct  336  CVVFSTVWAINRQASYSWAGQDILGICLMITVLQVARLPNIKVATVLLCCAFVYDIFWVF  395

Query  648  VSKWWFHESVMIVVARGDKSGEDGIPMLLKIPRMFDPWGGYSVIGFGDIILPGLLVAFSL  469
            +S   FH+SVMI VARGD SG + IPMLL+IPR  D WGGY +IGFGDI+ PGLLV+F+ 
Sbjct  396  LSPIIFHQSVMIAVARGDNSGGETIPMLLRIPRFADEWGGYDMIGFGDILFPGLLVSFAF  455

Query  468  RYDWLSKKSLRTGYFLWAMMAYGLGLLITYLALNLMDGHGQPALLYIVPFTLGTFLTLGK  289
            RYD  +KK +  GYFLW  + YG+GL +TYL L LMDGHGQPALLY+VP TLG  + LG 
Sbjct  456  RYDKANKKGIANGYFLWLTIGYGVGLFLTYLGLYLMDGHGQPALLYLVPCTLGLCILLGL  515

Query  288  KRGDLKHLWTKGDPD  244
             RG+LK LW     D
Sbjct  516  VRGELKDLWNYSSED  530



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1793589148520