BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig2953

Length=770
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011070403.1|  PREDICTED: uncharacterized protein LOC105156068    324   2e-105   Sesamum indicum [beniseed]
ref|XP_009775677.1|  PREDICTED: uncharacterized protein LOC104225551    322   2e-104   Nicotiana sylvestris
ref|XP_009589163.1|  PREDICTED: uncharacterized protein LOC104086569    317   7e-103   Nicotiana tomentosiformis
ref|XP_011081359.1|  PREDICTED: uncharacterized protein LOC105164409    313   5e-101   Sesamum indicum [beniseed]
emb|CBI34612.3|  unnamed protein product                                305   1e-98    Vitis vinifera
ref|XP_006343761.1|  PREDICTED: uncharacterized protein LOC102582708    306   2e-98    Solanum tuberosum [potatoes]
ref|XP_004245442.1|  PREDICTED: uncharacterized protein LOC101259469    305   3e-98    Solanum lycopersicum
ref|XP_002278777.1|  PREDICTED: uncharacterized protein LOC100247984    305   5e-98    Vitis vinifera
emb|CDP12249.1|  unnamed protein product                                301   1e-96    Coffea canephora [robusta coffee]
ref|XP_002317053.1|  hypothetical protein POPTR_0011s15470g             300   2e-96    
ref|XP_002300509.2|  hypothetical protein POPTR_0001s45410g             301   2e-96    
ref|XP_009344057.1|  PREDICTED: uncharacterized protein LOC103935948    300   5e-96    Pyrus x bretschneideri [bai li]
ref|XP_008245786.1|  PREDICTED: uncharacterized protein LOC103343932    300   8e-96    Prunus mume [ume]
ref|XP_011040605.1|  PREDICTED: uncharacterized protein LOC105136815    299   1e-95    Populus euphratica
ref|XP_007209198.1|  hypothetical protein PRUPE_ppa006451mg             298   1e-95    
ref|XP_008392651.1|  PREDICTED: uncharacterized protein LOC103454832    299   2e-95    Malus domestica [apple tree]
ref|XP_009348226.1|  PREDICTED: uncharacterized protein LOC103939842    298   6e-95    Pyrus x bretschneideri [bai li]
ref|XP_010267382.1|  PREDICTED: uncharacterized protein LOC104604645    298   8e-95    Nelumbo nucifera [Indian lotus]
ref|XP_002518934.1|  phosphatidylcholine transfer protein, putative     296   1e-94    Ricinus communis
ref|XP_004309518.1|  PREDICTED: uncharacterized protein LOC101297897    296   3e-94    Fragaria vesca subsp. vesca
ref|XP_012086635.1|  PREDICTED: uncharacterized protein LOC105645602    295   7e-94    Jatropha curcas
ref|XP_011038005.1|  PREDICTED: uncharacterized protein LOC105135031    294   1e-93    Populus euphratica
ref|XP_009360210.1|  PREDICTED: uncharacterized protein LOC103950711    294   1e-93    Pyrus x bretschneideri [bai li]
gb|KDO76778.1|  hypothetical protein CISIN_1g014046mg                   294   1e-93    Citrus sinensis [apfelsine]
ref|XP_010251494.1|  PREDICTED: uncharacterized protein LOC104593390    293   1e-93    Nelumbo nucifera [Indian lotus]
ref|XP_008346656.1|  PREDICTED: uncharacterized protein LOC103409627    293   3e-93    Malus domestica [apple tree]
ref|XP_006476268.1|  PREDICTED: uncharacterized protein LOC102627263    293   5e-93    Citrus sinensis [apfelsine]
ref|XP_006439191.1|  hypothetical protein CICLE_v10020224mg             292   6e-93    Citrus clementina [clementine]
ref|XP_007143962.1|  hypothetical protein PHAVU_007G117200g             290   2e-92    Phaseolus vulgaris [French bean]
ref|XP_010104915.1|  hypothetical protein L484_024117                   291   2e-92    Morus notabilis
gb|KHG16904.1|  StAR-related lipid transfer 7, mitochondrial            291   2e-92    Gossypium arboreum [tree cotton]
gb|KJB39548.1|  hypothetical protein B456_007G018700                    291   2e-92    Gossypium raimondii
gb|KHG30399.1|  StAR-related lipid transfer 7, mitochondrial            291   3e-92    Gossypium arboreum [tree cotton]
ref|XP_007039336.1|  Polyketide cyclase/dehydrase and lipid trans...    290   7e-92    
ref|XP_004146518.1|  PREDICTED: uncharacterized protein LOC101209389    289   1e-91    Cucumis sativus [cucumbers]
ref|XP_008437458.1|  PREDICTED: uncharacterized protein LOC103482874    288   2e-91    Cucumis melo [Oriental melon]
gb|ACU18380.1|  unknown                                                 281   2e-91    Glycine max [soybeans]
gb|KJB37444.1|  hypothetical protein B456_006G204800                    288   2e-91    Gossypium raimondii
ref|XP_010053047.1|  PREDICTED: uncharacterized protein LOC104441594    288   2e-91    Eucalyptus grandis [rose gum]
gb|KCW77296.1|  hypothetical protein EUGRSUZ_D01658                     288   3e-91    Eucalyptus grandis [rose gum]
ref|XP_004145876.1|  PREDICTED: uncharacterized protein LOC101209462    288   3e-91    Cucumis sativus [cucumbers]
ref|XP_006840600.1|  PREDICTED: uncharacterized protein LOC18430430     285   2e-90    Amborella trichopoda
ref|XP_010430621.1|  PREDICTED: phosphatidylcholine transfer protein    279   3e-90    Camelina sativa [gold-of-pleasure]
ref|XP_010056033.1|  PREDICTED: uncharacterized protein LOC104444124    283   4e-90    Eucalyptus grandis [rose gum]
ref|XP_009397003.1|  PREDICTED: uncharacterized protein LOC103981952    284   6e-90    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006606420.1|  PREDICTED: uncharacterized protein LOC100788121    283   1e-89    
gb|KHN14765.1|  StAR-related lipid transfer protein 7, mitochondrial    282   1e-89    Glycine soja [wild soybean]
ref|XP_002317804.2|  hypothetical protein POPTR_0012s02830g             282   2e-89    
ref|XP_006589231.1|  PREDICTED: uncharacterized protein LOC100810331    282   2e-89    Glycine max [soybeans]
ref|XP_006302371.1|  hypothetical protein CARUB_v10020442mg             281   3e-89    Capsella rubella
ref|XP_006376667.1|  hypothetical protein POPTR_0012s02830g             283   6e-89    
ref|XP_009382005.1|  PREDICTED: phosphatidylcholine transfer prot...    280   8e-89    Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO52781.1|  hypothetical protein CISIN_1g0167531mg                  278   9e-89    Citrus sinensis [apfelsine]
gb|KFK33976.1|  hypothetical protein AALP_AA5G086000                    280   1e-88    Arabis alpina [alpine rockcress]
ref|XP_002321959.2|  hypothetical protein POPTR_0015s00730g             280   1e-88    
ref|NP_176653.1|  membrane related protein CP5                          279   2e-88    Arabidopsis thaliana [mouse-ear cress]
gb|AFK33815.1|  unknown                                                 278   3e-88    Lotus japonicus
ref|XP_010920227.1|  PREDICTED: uncharacterized protein LOC105044130    279   4e-88    Elaeis guineensis
gb|AAM91533.1|  membrane related protein CP5, putative                  278   4e-88    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011003261.1|  PREDICTED: uncharacterized protein LOC105110...    279   8e-88    Populus euphratica
ref|XP_011003260.1|  PREDICTED: uncharacterized protein LOC105110...    279   9e-88    Populus euphratica
ref|XP_002886329.1|  hypothetical protein ARALYDRAFT_892929             277   9e-88    Arabidopsis lyrata subsp. lyrata
ref|XP_010473737.1|  PREDICTED: uncharacterized protein LOC104753141    278   9e-88    Camelina sativa [gold-of-pleasure]
ref|XP_006441237.1|  hypothetical protein CICLE_v10020581mg             277   1e-87    Citrus clementina [clementine]
ref|XP_010496633.1|  PREDICTED: uncharacterized protein LOC104773688    278   1e-87    Camelina sativa [gold-of-pleasure]
ref|XP_009413766.1|  PREDICTED: uncharacterized protein LOC103995005    277   1e-87    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004495515.1|  PREDICTED: uncharacterized protein LOC101494889    277   3e-87    Cicer arietinum [garbanzo]
ref|XP_006493201.1|  PREDICTED: uncharacterized protein LOC102612642    276   3e-87    Citrus sinensis [apfelsine]
ref|XP_009114221.1|  PREDICTED: uncharacterized protein LOC103839466    276   3e-87    Brassica rapa
ref|XP_011014759.1|  PREDICTED: uncharacterized protein LOC105118...    278   4e-87    Populus euphratica
ref|XP_011014758.1|  PREDICTED: uncharacterized protein LOC105118...    278   4e-87    Populus euphratica
emb|CDY17454.1|  BnaC09g20830D                                          275   5e-87    Brassica napus [oilseed rape]
ref|XP_004502755.1|  PREDICTED: uncharacterized protein LOC101512743    277   5e-87    Cicer arietinum [garbanzo]
ref|XP_011043689.1|  PREDICTED: uncharacterized protein LOC105139...    277   8e-87    Populus euphratica
ref|XP_011043688.1|  PREDICTED: uncharacterized protein LOC105139...    277   9e-87    Populus euphratica
ref|XP_008452046.1|  PREDICTED: uncharacterized protein LOC103493171    275   2e-86    Cucumis melo [Oriental melon]
ref|XP_010666130.1|  PREDICTED: uncharacterized protein LOC104883331    276   2e-86    Beta vulgaris subsp. vulgaris [field beet]
gb|EYU19436.1|  hypothetical protein MIMGU_mgv1a007177mg                275   2e-86    Erythranthe guttata [common monkey flower]
gb|EYU35617.1|  hypothetical protein MIMGU_mgv1a007464mg                274   3e-86    Erythranthe guttata [common monkey flower]
ref|XP_007039199.1|  Polyketide cyclase/dehydrase and lipid trans...    275   3e-86    
ref|XP_010934199.1|  PREDICTED: uncharacterized protein LOC105054408    275   4e-86    Elaeis guineensis
gb|KEH42916.1|  mammalian STARD2 lipid-binding START domain protein     273   4e-86    Medicago truncatula
ref|XP_010099429.1|  hypothetical protein L484_003253                   273   4e-86    
emb|CDY04099.1|  BnaA09g18770D                                          273   6e-86    
ref|XP_008785106.1|  PREDICTED: stAR-related lipid transfer prote...    273   9e-86    Phoenix dactylifera
ref|XP_007136439.1|  hypothetical protein PHAVU_009G045400g             272   6e-85    Phaseolus vulgaris [French bean]
ref|XP_003523319.1|  PREDICTED: uncharacterized protein LOC100785446    271   9e-85    Glycine max [soybeans]
ref|XP_003526760.1|  PREDICTED: uncharacterized protein LOC100802806    271   2e-84    Glycine max [soybeans]
gb|AGV54490.1|  StAR-related lipid transfer protein                     270   2e-84    Phaseolus vulgaris [French bean]
ref|XP_008778542.1|  PREDICTED: uncharacterized protein LOC103698325    269   4e-84    Phoenix dactylifera
ref|XP_006391589.1|  hypothetical protein EUTSA_v10023504mg             268   8e-84    Eutrema salsugineum [saltwater cress]
gb|AAL57201.1|AF355597_1  putative nodule membrane protein              267   3e-83    Medicago sativa [alfalfa]
ref|XP_010553581.1|  PREDICTED: uncharacterized protein LOC104823628    266   5e-83    Tarenaya hassleriana [spider flower]
ref|XP_011084568.1|  PREDICTED: uncharacterized protein LOC105166783    266   6e-83    Sesamum indicum [beniseed]
ref|XP_003602372.1|  StAR-related lipid transfer protein                266   7e-83    Medicago truncatula
gb|KHN23303.1|  StAR-related lipid transfer protein 7, mitochondrial    266   1e-82    Glycine soja [wild soybean]
ref|XP_006652076.1|  PREDICTED: uncharacterized protein LOC102712157    263   4e-82    Oryza brachyantha
ref|XP_004952047.1|  PREDICTED: uncharacterized protein LOC101765...    263   1e-81    Setaria italica
gb|EMS48425.1|  hypothetical protein TRIUR3_01630                       260   1e-81    Triticum urartu
ref|XP_003580301.1|  PREDICTED: uncharacterized protein LOC100841092    262   2e-81    Brachypodium distachyon [annual false brome]
gb|EMT15608.1|  hypothetical protein F775_30865                         261   3e-81    
ref|NP_001052066.1|  Os04g0119500                                       260   1e-80    
emb|CAG27307.1|  membrane related protein                               259   1e-80    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002453232.1|  hypothetical protein SORBIDRAFT_04g002070          260   1e-80    Sorghum bicolor [broomcorn]
emb|CAH65950.1|  H0716A07.8                                             258   3e-80    Oryza sativa [red rice]
ref|XP_002447442.1|  hypothetical protein SORBIDRAFT_06g001130          258   6e-80    Sorghum bicolor [broomcorn]
ref|XP_004952046.1|  PREDICTED: uncharacterized protein LOC101765...    261   2e-79    
ref|XP_010676932.1|  PREDICTED: uncharacterized protein LOC104892647    258   2e-79    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004977725.1|  PREDICTED: uncharacterized protein LOC101783053    265   5e-79    
dbj|BAJ95846.1|  predicted protein                                      255   7e-79    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001168384.1|  hypothetical protein                               255   7e-79    Zea mays [maize]
gb|EMS50172.1|  hypothetical protein TRIUR3_23911                       251   2e-78    Triticum urartu
ref|NP_001142221.1|  hypothetical protein                               254   3e-78    Zea mays [maize]
gb|AFW66620.1|  hypothetical protein ZEAMMB73_358635                    254   3e-78    
gb|EEC72388.1|  hypothetical protein OsI_05667                          253   7e-78    Oryza sativa Indica Group [Indian rice]
ref|XP_006648262.1|  PREDICTED: uncharacterized protein LOC102714348    250   1e-77    
ref|XP_008676876.1|  PREDICTED: hypothetical protein isoform X1         253   8e-77    
gb|ABK24392.1|  unknown                                                 249   3e-76    Picea sitchensis
gb|AAD28760.1|AF130253_1  membrane related protein CP5                  247   5e-76    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010544864.1|  PREDICTED: uncharacterized protein LOC104817383    247   2e-75    Tarenaya hassleriana [spider flower]
gb|ACG40939.1|  CP5                                                     246   3e-75    Zea mays [maize]
ref|NP_001148371.1|  CP5                                                246   4e-75    Zea mays [maize]
ref|XP_010233743.1|  PREDICTED: uncharacterized protein LOC100824806    246   4e-75    Brachypodium distachyon [annual false brome]
gb|KGN49968.1|  hypothetical protein Csa_5G146910                       245   7e-75    Cucumis sativus [cucumbers]
ref|XP_007220046.1|  hypothetical protein PRUPE_ppa026850mg             245   7e-75    
ref|XP_008661910.1|  PREDICTED: CP5 isoform X1                          245   7e-75    Zea mays [maize]
dbj|BAD07966.1|  putative membrane related protein CP5                  244   1e-74    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009757290.1|  PREDICTED: uncharacterized protein LOC104210169    244   2e-74    Nicotiana sylvestris
ref|XP_008234648.1|  PREDICTED: uncharacterized protein LOC103333...    244   3e-74    Prunus mume [ume]
ref|XP_009604590.1|  PREDICTED: phosphatidylcholine transfer prot...    240   3e-74    Nicotiana tomentosiformis
gb|KJB52500.1|  hypothetical protein B456_008G265200                    243   4e-74    Gossypium raimondii
gb|KCW46620.1|  hypothetical protein EUGRSUZ_K00428                     242   2e-73    Eucalyptus grandis [rose gum]
ref|XP_009798509.1|  PREDICTED: uncharacterized protein LOC104244732    241   2e-73    Nicotiana sylvestris
ref|XP_010035315.1|  PREDICTED: uncharacterized protein LOC104424552    242   2e-73    Eucalyptus grandis [rose gum]
dbj|BAJ94056.1|  predicted protein                                      242   3e-73    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009604589.1|  PREDICTED: uncharacterized protein LOC104099...    241   4e-73    Nicotiana tomentosiformis
ref|XP_008234647.1|  PREDICTED: uncharacterized protein LOC103333...    239   4e-72    Prunus mume [ume]
emb|CDP04991.1|  unnamed protein product                                238   6e-72    Coffea canephora [robusta coffee]
ref|XP_006347513.1|  PREDICTED: uncharacterized protein LOC102587815    237   1e-71    Solanum tuberosum [potatoes]
ref|XP_004235020.1|  PREDICTED: uncharacterized protein LOC101249155    235   5e-71    Solanum lycopersicum
ref|XP_008376819.1|  PREDICTED: uncharacterized protein LOC103439947    233   3e-70    Malus domestica [apple tree]
ref|XP_010527384.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    231   3e-69    
ref|XP_004307892.1|  PREDICTED: uncharacterized protein LOC101306175    230   8e-69    Fragaria vesca subsp. vesca
gb|AFW66617.1|  hypothetical protein ZEAMMB73_358635                    221   2e-68    
emb|CDY00704.1|  BnaC03g36880D                                          218   7e-64    
gb|EPS63012.1|  hypothetical protein M569_11775                         216   9e-64    Genlisea aurea
emb|CDY18307.1|  BnaC09g30570D                                          211   2e-63    Brassica napus [oilseed rape]
gb|KFK27030.1|  hypothetical protein AALP_AA8G325000                    216   2e-63    Arabis alpina [alpine rockcress]
dbj|BAB11579.1|  membrane related protein-like                          214   6e-63    Arabidopsis thaliana [mouse-ear cress]
emb|CDY71555.1|  BnaAnng37890D                                          210   7e-63    Brassica napus [oilseed rape]
gb|AAM65221.1|  membrane related protein-like                           214   1e-62    Arabidopsis thaliana [mouse-ear cress]
ref|NP_568805.1|  lipid-binding START domain-containing protein         214   1e-62    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009361280.1|  PREDICTED: uncharacterized protein LOC103951585    213   2e-62    Pyrus x bretschneideri [bai li]
ref|XP_009132450.1|  PREDICTED: uncharacterized protein LOC103857054    213   5e-62    Brassica rapa
gb|AFW69926.1|  hypothetical protein ZEAMMB73_637092                    211   2e-61    
ref|XP_008680976.1|  PREDICTED: uncharacterized protein LOC100191...    211   2e-61    
ref|XP_010442992.1|  PREDICTED: uncharacterized protein LOC104725938    211   3e-61    Camelina sativa [gold-of-pleasure]
ref|XP_010482825.1|  PREDICTED: uncharacterized protein LOC104761442    211   4e-61    Camelina sativa [gold-of-pleasure]
ref|XP_009119952.1|  PREDICTED: uncharacterized protein LOC103844879    209   8e-61    Brassica rapa
ref|XP_008786107.1|  PREDICTED: uncharacterized protein LOC103704...    209   1e-60    Phoenix dactylifera
ref|XP_008786105.1|  PREDICTED: uncharacterized protein LOC103704...    209   1e-60    Phoenix dactylifera
ref|XP_006401611.1|  hypothetical protein EUTSA_v10013518mg             209   1e-60    Eutrema salsugineum [saltwater cress]
ref|XP_006280456.1|  hypothetical protein CARUB_v10026389mg             209   1e-60    Capsella rubella
ref|XP_002866025.1|  hypothetical protein ARALYDRAFT_918536             208   2e-60    Arabidopsis lyrata subsp. lyrata
emb|CDY43837.1|  BnaC03g14700D                                          217   2e-60    Brassica napus [oilseed rape]
ref|XP_010923463.1|  PREDICTED: uncharacterized protein LOC105046548    206   2e-59    Elaeis guineensis
ref|XP_009409211.1|  PREDICTED: uncharacterized protein LOC103991461    203   2e-58    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002977388.1|  hypothetical protein SELMODRAFT_228472             202   3e-58    Selaginella moellendorffii
gb|KEH27365.1|  mammalian STARD2 lipid-binding START domain protein     199   3e-58    Medicago truncatula
ref|XP_002517011.1|  phosphatidylcholine transfer protein, putative     201   8e-58    Ricinus communis
ref|XP_002974969.1|  hypothetical protein SELMODRAFT_267823             199   3e-57    
emb|CBI26372.3|  unnamed protein product                                199   4e-57    Vitis vinifera
ref|XP_011073492.1|  PREDICTED: uncharacterized protein LOC105158432    200   5e-57    
ref|XP_003610788.1|  Membrane related protein-like protein              199   6e-57    Medicago truncatula
gb|AFK44283.1|  unknown                                                 199   6e-57    Medicago truncatula
gb|AFK35199.1|  unknown                                                 199   6e-57    Medicago truncatula
ref|XP_006838839.1|  PREDICTED: uncharacterized protein LOC18429490     199   8e-57    Amborella trichopoda
ref|XP_010650006.1|  PREDICTED: uncharacterized protein LOC100263172    198   1e-56    Vitis vinifera
gb|KHN35161.1|  StAR-related lipid transfer protein 7, mitochondrial    195   4e-56    Glycine soja [wild soybean]
ref|XP_004511397.1|  PREDICTED: stAR-related lipid transfer prote...    195   2e-55    Cicer arietinum [garbanzo]
ref|XP_003537648.1|  PREDICTED: stAR-related lipid transfer prote...    195   2e-55    Glycine max [soybeans]
ref|XP_003517561.1|  PREDICTED: stAR-related lipid transfer prote...    194   6e-55    Glycine max [soybeans]
ref|XP_008367202.1|  PREDICTED: phosphatidylcholine transfer prot...    190   9e-55    
ref|XP_010450029.1|  PREDICTED: uncharacterized protein LOC104732193    192   2e-54    Camelina sativa [gold-of-pleasure]
emb|CDY16287.1|  BnaC01g23220D                                          192   2e-54    Brassica napus [oilseed rape]
ref|XP_010087789.1|  hypothetical protein L484_016360                   192   2e-54    Morus notabilis
ref|XP_011029867.1|  PREDICTED: stAR-related lipid transfer prote...    192   2e-54    Populus euphratica
ref|XP_010440453.1|  PREDICTED: uncharacterized protein LOC104723752    192   2e-54    Camelina sativa [gold-of-pleasure]
ref|XP_006283754.1|  hypothetical protein CARUB_v10004845mg             192   3e-54    Capsella rubella
emb|CDY29739.1|  BnaA01g19270D                                          189   3e-54    Brassica napus [oilseed rape]
ref|XP_010228266.1|  PREDICTED: uncharacterized protein LOC100828...    192   5e-54    Brachypodium distachyon [annual false brome]
ref|XP_008805969.1|  PREDICTED: uncharacterized protein LOC103718779    191   5e-54    Phoenix dactylifera
ref|XP_003557464.1|  PREDICTED: uncharacterized protein LOC100828...    191   5e-54    Brachypodium distachyon [annual false brome]
ref|XP_004241025.1|  PREDICTED: uncharacterized protein LOC101253385    192   5e-54    Solanum lycopersicum
ref|XP_006414699.1|  hypothetical protein EUTSA_v10025252mg             191   6e-54    Eutrema salsugineum [saltwater cress]
ref|XP_008224419.1|  PREDICTED: uncharacterized protein LOC103324159    191   7e-54    Prunus mume [ume]
dbj|BAC83004.1|  putative membrane related protein CP5                  190   7e-54    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001059064.1|  Os07g0185200                                       190   8e-54    
ref|XP_010278112.1|  PREDICTED: stAR-related lipid transfer prote...    191   8e-54    Nelumbo nucifera [Indian lotus]
ref|XP_010274161.1|  PREDICTED: stAR-related lipid transfer prote...    191   9e-54    Nelumbo nucifera [Indian lotus]
ref|XP_012069777.1|  PREDICTED: uncharacterized protein LOC105632095    191   9e-54    Jatropha curcas
gb|EEE66698.1|  hypothetical protein OsJ_23361                          189   1e-53    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010936383.1|  PREDICTED: uncharacterized protein LOC105056016    190   1e-53    Elaeis guineensis
ref|NP_567433.1|  polyketide cyclase/dehydrase and lipid transpor...    190   1e-53    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006658340.1|  PREDICTED: uncharacterized protein LOC102707324    189   2e-53    
ref|XP_010435117.1|  PREDICTED: uncharacterized protein LOC104718985    189   2e-53    Camelina sativa [gold-of-pleasure]
ref|XP_009347795.1|  PREDICTED: stAR-related lipid transfer prote...    190   2e-53    Pyrus x bretschneideri [bai li]
gb|KFK32485.1|  hypothetical protein AALP_AA6G248600                    189   3e-53    Arabis alpina [alpine rockcress]
ref|XP_007222114.1|  hypothetical protein PRUPE_ppa005679mg             190   3e-53    Prunus persica
gb|EEC81632.1|  hypothetical protein OsI_25162                          189   4e-53    Oryza sativa Indica Group [Indian rice]
ref|XP_009148805.1|  PREDICTED: uncharacterized protein LOC103872218    189   5e-53    
ref|XP_009378796.1|  PREDICTED: stAR-related lipid transfer prote...    189   5e-53    Pyrus x bretschneideri [bai li]
tpg|DAA36543.1|  TPA: hypothetical protein ZEAMMB73_493286              184   5e-53    
ref|XP_002870309.1|  hypothetical protein ARALYDRAFT_493456             188   6e-53    Arabidopsis lyrata subsp. lyrata
ref|XP_008362030.1|  PREDICTED: uncharacterized protein LOC103425717    189   7e-53    
gb|KCW60440.1|  hypothetical protein EUGRSUZ_H03157                     188   7e-53    Eucalyptus grandis [rose gum]
ref|XP_010527394.1|  PREDICTED: uncharacterized protein LOC104804749    188   8e-53    Tarenaya hassleriana [spider flower]
emb|CDY62128.1|  BnaC08g47370D                                          188   1e-52    Brassica napus [oilseed rape]
emb|CDY14327.1|  BnaA10g07280D                                          186   1e-52    Brassica napus [oilseed rape]
ref|XP_002314649.1|  hypothetical protein POPTR_0010s08690g             187   1e-52    
emb|CDY47149.1|  BnaA08g05340D                                          187   1e-52    Brassica napus [oilseed rape]
ref|XP_006844764.2|  PREDICTED: uncharacterized protein LOC18434637     188   1e-52    
ref|XP_006350666.1|  PREDICTED: uncharacterized protein LOC102588037    187   3e-52    Solanum tuberosum [potatoes]
gb|KHG09152.1|  StAR-related lipid transfer 7, mitochondrial            187   3e-52    Gossypium arboreum [tree cotton]
gb|KJB12570.1|  hypothetical protein B456_002G024700                    187   4e-52    Gossypium raimondii
ref|XP_009757654.1|  PREDICTED: uncharacterized protein LOC104210451    187   4e-52    Nicotiana sylvestris
ref|XP_010532604.1|  PREDICTED: uncharacterized protein LOC104808596    187   5e-52    Tarenaya hassleriana [spider flower]
ref|XP_002312574.2|  hypothetical protein POPTR_0008s16250g             186   9e-52    
ref|XP_011030550.1|  PREDICTED: stAR-related lipid transfer prote...    185   1e-51    Populus euphratica
ref|XP_007034990.1|  Polyketide cyclase/dehydrase and lipid trans...    185   1e-51    
ref|NP_001030744.1|  polyketide cyclase/dehydrase and lipid trans...    184   1e-51    Arabidopsis thaliana [mouse-ear cress]
gb|KJB34524.1|  hypothetical protein B456_006G070300                    185   1e-51    Gossypium raimondii
ref|XP_009627905.1|  PREDICTED: uncharacterized protein LOC104118382    185   2e-51    Nicotiana tomentosiformis
ref|XP_007034988.1|  Polyketide cyclase/dehydrase and lipid trans...    185   2e-51    
ref|XP_007157092.1|  hypothetical protein PHAVU_002G042100g             184   2e-51    Phaseolus vulgaris [French bean]
ref|XP_007157091.1|  hypothetical protein PHAVU_002G042100g             184   2e-51    Phaseolus vulgaris [French bean]
gb|EYU19692.1|  hypothetical protein MIMGU_mgv1a0075022mg               176   3e-51    Erythranthe guttata [common monkey flower]
ref|XP_009408481.1|  PREDICTED: uncharacterized protein LOC103990913    184   3e-51    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002885543.1|  hypothetical protein ARALYDRAFT_319027             184   3e-51    Arabidopsis lyrata subsp. lyrata
ref|XP_009107776.1|  PREDICTED: uncharacterized protein LOC103833443    184   3e-51    Brassica rapa
ref|NP_566722.1|  polyketide cyclase/dehydrase and lipid transpor...    183   4e-51    Arabidopsis thaliana [mouse-ear cress]
gb|AAL07016.1|  unknown protein                                         183   4e-51    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001142403.1|  hypothetical protein                               184   5e-51    Zea mays [maize]
ref|XP_006297728.1|  hypothetical protein CARUB_v10013761mg             183   8e-51    Capsella rubella
ref|XP_009145238.1|  PREDICTED: uncharacterized protein LOC103868940    182   1e-50    Brassica rapa
ref|XP_007034987.1|  Polyketide cyclase/dehydrase and lipid trans...    185   1e-50    
dbj|BAJ97056.1|  predicted protein                                      182   1e-50    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006406092.1|  hypothetical protein EUTSA_v10020751mg             182   2e-50    Eutrema salsugineum [saltwater cress]
ref|XP_009108270.1|  PREDICTED: uncharacterized protein LOC103833...    181   2e-50    Brassica rapa
emb|CDY35496.1|  BnaA01g24160D                                          181   3e-50    Brassica napus [oilseed rape]
ref|XP_004289478.1|  PREDICTED: uncharacterized protein LOC101293443    182   3e-50    Fragaria vesca subsp. vesca
ref|XP_009108264.1|  PREDICTED: uncharacterized protein LOC103833...    181   3e-50    Brassica rapa
ref|XP_010466606.1|  PREDICTED: uncharacterized protein LOC104746781    181   5e-50    Camelina sativa [gold-of-pleasure]
gb|KHG25656.1|  StAR-related lipid transfer protein 7, mitochondrial    181   6e-50    Gossypium arboreum [tree cotton]
gb|KFK39597.1|  hypothetical protein AALP_AA3G264700                    180   8e-50    Arabis alpina [alpine rockcress]
emb|CDY63033.1|  BnaCnng41290D                                          180   1e-49    Brassica napus [oilseed rape]
gb|KDO45896.1|  hypothetical protein CISIN_1g013902mg                   179   2e-49    Citrus sinensis [apfelsine]
ref|XP_006489530.1|  PREDICTED: uncharacterized protein LOC102620401    179   2e-49    Citrus sinensis [apfelsine]
ref|XP_006420124.1|  hypothetical protein CICLE_v10005003mg             179   2e-49    Citrus clementina [clementine]
ref|XP_001776276.1|  predicted protein                                  179   3e-49    
ref|XP_004134093.1|  PREDICTED: uncharacterized protein LOC101216617    179   3e-49    Cucumis sativus [cucumbers]
ref|NP_001183196.1|  hypothetical protein                               177   9e-49    Zea mays [maize]
ref|XP_008438574.1|  PREDICTED: uncharacterized protein LOC103483641    177   1e-48    Cucumis melo [Oriental melon]
ref|XP_010667651.1|  PREDICTED: uncharacterized protein LOC104884663    177   1e-48    Beta vulgaris subsp. vulgaris [field beet]
gb|EYU32520.1|  hypothetical protein MIMGU_mgv1a005704mg                177   2e-48    Erythranthe guttata [common monkey flower]
emb|CDY10351.1|  BnaC05g29280D                                          169   3e-46    Brassica napus [oilseed rape]
ref|XP_001785300.1|  predicted protein                                  171   4e-46    
gb|ACJ84294.1|  unknown                                                 159   3e-45    Medicago truncatula
ref|XP_004955685.1|  PREDICTED: uncharacterized protein LOC101781535    165   4e-44    Setaria italica
ref|XP_002461562.1|  hypothetical protein SORBIDRAFT_02g004760          161   1e-42    Sorghum bicolor [broomcorn]
emb|CDO99168.1|  unnamed protein product                                161   2e-42    Coffea canephora [robusta coffee]
gb|ERN07498.1|  hypothetical protein AMTR_s00413p00010550               155   4e-42    Amborella trichopoda
gb|ERN06439.1|  hypothetical protein AMTR_s00016p00257910               150   8e-41    Amborella trichopoda
gb|EPS72938.1|  hypothetical protein M569_01819                         154   9e-40    Genlisea aurea
ref|XP_004298241.1|  PREDICTED: stAR-related lipid transfer prote...    140   1e-35    Fragaria vesca subsp. vesca
gb|KHG25655.1|  StAR-related lipid transfer protein 7, mitochondrial    142   2e-35    Gossypium arboreum [tree cotton]
gb|KGN56908.1|  hypothetical protein Csa_3G143000                       140   3e-35    Cucumis sativus [cucumbers]
emb|CDY10698.1|  BnaA05g16640D                                          139   3e-35    Brassica napus [oilseed rape]
ref|XP_008222300.1|  PREDICTED: uncharacterized protein LOC103322189    132   3e-34    
ref|NP_001130543.1|  uncharacterized protein LOC100191642               131   4e-34    
ref|XP_002453233.1|  hypothetical protein SORBIDRAFT_04g002075          123   6e-31    
gb|EMT19449.1|  hypothetical protein F775_07112                         126   2e-29    
ref|XP_009629658.1|  PREDICTED: uncharacterized protein LOC104119...    119   5e-29    
ref|XP_007224298.1|  hypothetical protein PRUPE_ppa019593mg             120   5e-28    
gb|KCW52276.1|  hypothetical protein EUGRSUZ_J01696                     119   1e-27    
emb|CAB10229.1|  hypothetical protein                                   119   2e-27    
ref|XP_010032787.1|  PREDICTED: uncharacterized protein LOC104422...    118   3e-27    
ref|XP_009353537.1|  PREDICTED: phosphatidylcholine transfer prot...    117   6e-27    
ref|XP_010032788.1|  PREDICTED: uncharacterized protein LOC104422...    117   8e-27    
ref|XP_008351117.1|  PREDICTED: uncharacterized protein LOC103414521    112   4e-26    
ref|XP_008390266.1|  PREDICTED: uncharacterized protein LOC103452546    112   3e-25    
dbj|BAD94091.1|  membrane related protein CP5                         95.1    3e-21    
ref|XP_009795915.1|  PREDICTED: uncharacterized protein LOC104242534  97.4    5e-21    
gb|ACF83845.1|  unknown                                               93.6    4e-20    
ref|XP_012092681.1|  PREDICTED: stAR-related lipid transfer prote...  94.7    3e-19    
ref|XP_002508562.1|  predicted protein                                96.3    4e-19    
ref|XP_009629656.1|  PREDICTED: uncharacterized protein LOC104119...  89.7    3e-18    
gb|AEW07874.1|  hypothetical protein 0_13567_01                       84.0    4e-17    
ref|XP_007135874.1|  hypothetical protein PHAVU_010G165300g           88.2    1e-16    
ref|XP_009135281.1|  PREDICTED: uncharacterized protein LOC103859496  88.2    1e-16    
emb|CDY51901.1|  BnaC03g73640D                                        88.2    1e-16    
emb|CDX82559.1|  BnaA03g32620D                                        87.8    1e-16    
gb|AFG59929.1|  hypothetical protein 0_13567_01                       82.8    1e-16    
gb|AFG59934.1|  hypothetical protein 0_13567_01                       82.8    2e-16    
ref|XP_006585684.1|  PREDICTED: uncharacterized protein LOC102661161  84.7    1e-15    
gb|KHN38110.1|  StAR-related lipid transfer protein 7, mitochondrial  84.7    1e-15    
ref|XP_006297836.1|  hypothetical protein CARUB_v10013871mg           84.7    2e-15    
ref|XP_010499904.1|  PREDICTED: stAR-related lipid transfer prote...  85.1    2e-15    
emb|CDY24223.1|  BnaC01g38030D                                        84.7    2e-15    
ref|XP_010499909.1|  PREDICTED: stAR-related lipid transfer prote...  84.7    2e-15    
ref|XP_001421847.1|  predicted protein                                85.5    2e-15    
ref|XP_010499897.1|  PREDICTED: stAR-related lipid transfer prote...  84.7    2e-15    
ref|XP_006582972.1|  PREDICTED: uncharacterized protein LOC102659...  84.0    2e-15    
ref|XP_006392582.1|  hypothetical protein EUTSA_v10011546mg           84.3    3e-15    
ref|XP_006392581.1|  hypothetical protein EUTSA_v10011546mg           84.0    3e-15    
ref|XP_004959002.1|  PREDICTED: uncharacterized protein LOC101786004  80.1    3e-15    
gb|KFK38640.1|  hypothetical protein AALP_AA3G141200                  84.0    3e-15    
ref|NP_566443.1|  polyketide cyclase/dehydrase and lipid transpor...  84.0    3e-15    
ref|NP_850574.1|  polyketide cyclase/dehydrase and lipid transpor...  83.6    4e-15    
gb|KFK35546.1|  hypothetical protein AALP_AA4G004800                  83.2    5e-15    
emb|CDY43377.1|  BnaA01g30080D                                        84.0    5e-15    
ref|NP_850573.1|  polyketide cyclase/dehydrase and lipid transpor...  83.6    5e-15    
dbj|BAC43323.1|  unknown protein                                      83.2    6e-15    
ref|XP_003083840.1|  putative membrane related protein CP5 (ISS)      83.6    7e-15    
ref|XP_010465108.1|  PREDICTED: uncharacterized protein LOC104745540  83.2    9e-15    
ref|XP_009147459.1|  PREDICTED: uncharacterized protein LOC103871005  82.0    1e-14    
ref|XP_009124707.1|  PREDICTED: phosphatidylcholine transfer protein  82.4    1e-14    
emb|CDY52914.1|  BnaA06g00040D                                        82.0    1e-14    
ref|XP_010462468.1|  PREDICTED: uncharacterized protein LOC104743041  82.0    1e-14    
ref|XP_006407266.1|  hypothetical protein EUTSA_v10020844mg           81.6    2e-14    
ref|XP_006305042.1|  hypothetical protein CARUB_v10009408mg           81.6    2e-14    
ref|XP_004952467.1|  PREDICTED: uncharacterized protein LOC101774356  81.6    2e-14    
ref|XP_010481201.1|  PREDICTED: uncharacterized protein LOC104760048  80.5    4e-14    
gb|EMT21662.1|  hypothetical protein F775_28432                       80.5    5e-14    
ref|XP_010501231.1|  PREDICTED: uncharacterized protein LOC104778...  80.5    6e-14    
ref|XP_010501230.1|  PREDICTED: uncharacterized protein LOC104778...  80.1    7e-14    
ref|XP_002452046.1|  hypothetical protein SORBIDRAFT_04g017500        80.1    7e-14    
gb|EMS46887.1|  hypothetical protein TRIUR3_11092                     80.1    7e-14    
ref|XP_004488913.1|  PREDICTED: phosphatidylcholine transfer prot...  78.6    8e-14    
dbj|BAK05713.1|  predicted protein                                    80.1    9e-14    
emb|CDY69376.1|  BnaCnng63240D                                        79.3    1e-13    
ref|XP_009622047.1|  PREDICTED: uncharacterized protein LOC104113550  79.0    1e-13    
ref|XP_004488912.1|  PREDICTED: phosphatidylcholine transfer prot...  78.6    1e-13    
ref|XP_010487051.1|  PREDICTED: stAR-related lipid transfer prote...  79.3    2e-13    
ref|XP_004488911.1|  PREDICTED: phosphatidylcholine transfer prot...  79.0    2e-13    
ref|XP_011651346.1|  PREDICTED: phosphatidylcholine transfer prot...  77.8    2e-13    
ref|NP_001276256.1|  uncharacterized protein LOC102659764             78.6    2e-13    
gb|ACJ84293.1|  unknown                                               76.6    3e-13    
ref|XP_010487050.1|  PREDICTED: stAR-related lipid transfer prote...  79.0    3e-13    
ref|XP_002965197.1|  hypothetical protein SELMODRAFT_167248           78.6    3e-13    
gb|EEE56964.1|  hypothetical protein OsJ_06676                        77.0    3e-13    
ref|XP_004145626.1|  PREDICTED: uncharacterized protein LOC101203...  78.2    4e-13    
ref|XP_009410229.1|  PREDICTED: uncharacterized protein LOC103992307  77.8    5e-13    
ref|NP_564705.1|  putative polyketide cyclase/dehydrase and lipid...  77.4    6e-13    
ref|XP_002962282.1|  hypothetical protein SELMODRAFT_270291           77.0    8e-13    
ref|XP_003604116.1|  StAR-related lipid transfer protein              76.6    9e-13    
ref|NP_001151176.1|  membrane related protein-like                    77.0    9e-13    
ref|XP_008461545.1|  PREDICTED: phosphatidylcholine transfer prot...  75.1    1e-12    
ref|XP_010449744.1|  PREDICTED: uncharacterized protein LOC104731...  76.6    1e-12    
ref|XP_002882805.1|  predicted protein                                77.4    1e-12    
ref|XP_008461544.1|  PREDICTED: phosphatidylcholine transfer prot...  75.5    2e-12    
ref|XP_008643790.1|  PREDICTED: membrane related protein-like iso...  76.3    2e-12    
ref|XP_011467513.1|  PREDICTED: uncharacterized protein LOC105352336  75.9    2e-12    
dbj|BAB01397.1|  protein kinase-like protein                          76.6    2e-12    
gb|EEC73136.1|  hypothetical protein OsI_07158                        75.9    2e-12    
ref|NP_001046822.1|  Os02g0468400                                     75.9    2e-12    
ref|XP_008461543.1|  PREDICTED: phosphatidylcholine transfer prot...  75.1    3e-12    
ref|XP_007217244.1|  hypothetical protein PRUPE_ppa006681mg           75.1    4e-12    
ref|XP_006850998.1|  PREDICTED: uncharacterized protein LOC18440797   74.7    5e-12    
ref|XP_010449745.1|  PREDICTED: phosphatidylcholine transfer prot...  73.2    7e-12    
ref|XP_001783843.1|  predicted protein                                73.6    7e-12    
ref|XP_007023604.1|  Polyketide cyclase/dehydrase and lipid trans...  73.2    8e-12    
ref|XP_009381603.1|  PREDICTED: stAR-related lipid transfer prote...  73.9    1e-11    
ref|XP_002513295.1|  phosphatidylcholine transfer protein, putative   73.2    1e-11    
ref|XP_007023603.1|  Polyketide cyclase/dehydrase and lipid trans...  73.2    2e-11    
ref|XP_002310347.2|  hypothetical protein POPTR_0007s15160g           72.8    2e-11    
ref|XP_010552381.1|  PREDICTED: uncharacterized protein LOC104822743  72.0    4e-11    
ref|XP_009592651.1|  PREDICTED: uncharacterized protein LOC104089...  72.0    5e-11    
emb|CBI18373.3|  unnamed protein product                              71.2    6e-11    
ref|XP_010927159.1|  PREDICTED: uncharacterized protein LOC105049...  71.2    7e-11    
ref|XP_008809077.1|  PREDICTED: uncharacterized protein LOC103720895  71.2    8e-11    
ref|XP_010655237.1|  PREDICTED: stAR-related lipid transfer prote...  71.2    8e-11    
ref|XP_010655238.1|  PREDICTED: uncharacterized protein LOC104880...  70.5    8e-11    
emb|CAN60973.1|  hypothetical protein VITISV_032052                   70.9    8e-11    
ref|XP_006342845.1|  PREDICTED: uncharacterized protein LOC102599...  70.9    1e-10    
ref|XP_006342844.1|  PREDICTED: uncharacterized protein LOC102599...  71.2    1e-10    
ref|XP_008228024.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  70.9    1e-10    
ref|XP_010927160.1|  PREDICTED: uncharacterized protein LOC105049...  70.9    1e-10    
ref|XP_006342846.1|  PREDICTED: uncharacterized protein LOC102599...  70.9    1e-10    
gb|AAF79332.1|AC002304_25  F14J16.24                                  70.5    2e-10    
ref|XP_009592652.1|  PREDICTED: phosphatidylcholine transfer prot...  69.7    2e-10    
ref|XP_003064175.1|  predicted protein                                70.1    2e-10    
ref|XP_009395876.1|  PREDICTED: uncharacterized protein LOC103981028  69.7    2e-10    
ref|XP_011031252.1|  PREDICTED: uncharacterized protein LOC105130441  69.7    2e-10    
ref|XP_004235496.1|  PREDICTED: uncharacterized protein LOC101261699  69.7    2e-10    
gb|AHZ34664.1|  responsive START protein                              69.7    2e-10    
ref|XP_009793255.1|  PREDICTED: uncharacterized protein LOC104240...  69.7    3e-10    
ref|XP_005649218.1|  Bet v1-like protein                              69.3    3e-10    
ref|XP_011012290.1|  PREDICTED: uncharacterized protein LOC105116568  69.3    3e-10    
ref|XP_006425180.1|  hypothetical protein CICLE_v10028538mg           69.3    3e-10    
ref|XP_006425181.1|  hypothetical protein CICLE_v10028538mg           69.3    3e-10    
ref|XP_006374733.1|  hypothetical protein POPTR_0014s00330g           69.3    3e-10    
gb|KJB56463.1|  hypothetical protein B456_009G120600                  68.6    5e-10    
gb|KHG09079.1|  StAR-related lipid transfer 7, mitochondrial          68.6    6e-10    
ref|XP_010696139.1|  PREDICTED: uncharacterized protein LOC104908693  68.6    6e-10    
ref|XP_008380443.1|  PREDICTED: uncharacterized protein LOC103443388  68.6    7e-10    
ref|XP_011011654.1|  PREDICTED: uncharacterized protein LOC105116...  68.2    7e-10    
gb|KDO67051.1|  hypothetical protein CISIN_1g015638mg                 68.2    7e-10    
ref|XP_006488604.1|  PREDICTED: uncharacterized protein LOC102619344  68.2    7e-10    
ref|XP_010063695.1|  PREDICTED: phosphatidylcholine transfer prot...  68.2    8e-10    
ref|XP_002894547.1|  hypothetical protein ARALYDRAFT_314809           68.2    8e-10    
gb|KJB29809.1|  hypothetical protein B456_005G119500                  68.2    8e-10    
ref|XP_012087290.1|  PREDICTED: uncharacterized protein LOC105646119  68.2    1e-09    
ref|XP_009346022.1|  PREDICTED: uncharacterized protein LOC103937788  67.4    2e-09    
ref|XP_010542534.1|  PREDICTED: uncharacterized protein LOC104815704  67.4    2e-09    
ref|XP_001703451.1|  lipid-binding START protein                      67.0    2e-09    
ref|XP_010252177.1|  PREDICTED: uncharacterized protein LOC104593...  67.0    2e-09    
ref|XP_010087070.1|  hypothetical protein L484_010442                 66.6    3e-09    
ref|XP_009793256.1|  PREDICTED: phosphatidylcholine transfer prot...  66.2    3e-09    
ref|XP_009344019.1|  PREDICTED: uncharacterized protein LOC103935922  66.2    4e-09    
ref|XP_007512533.1|  predicted protein                                65.9    7e-09    
tpg|DAA37645.1|  TPA: hypothetical protein ZEAMMB73_384005            63.9    9e-09    
ref|XP_011011655.1|  PREDICTED: uncharacterized protein LOC105116...  65.1    9e-09    
gb|EYU21188.1|  hypothetical protein MIMGU_mgv1a007377mg              63.9    2e-08    
ref|XP_010247187.1|  PREDICTED: uncharacterized protein LOC104590...  63.9    2e-08    
ref|XP_010247186.1|  PREDICTED: uncharacterized protein LOC104590...  63.9    2e-08    
ref|XP_008669370.1|  PREDICTED: uncharacterized protein LOC103646...  61.6    3e-08    
ref|XP_011072791.1|  PREDICTED: uncharacterized protein LOC105157944  63.5    3e-08    
ref|XP_008669369.1|  PREDICTED: uncharacterized protein LOC103646...  62.0    3e-08    
ref|XP_008669368.1|  PREDICTED: uncharacterized protein LOC103646...  61.6    4e-08    
gb|KDP25029.1|  hypothetical protein JCGZ_22564                       60.8    2e-07    
ref|XP_010065066.1|  PREDICTED: phosphatidylcholine transfer protein  57.4    3e-06    
gb|KIZ04898.1|  hypothetical protein MNEG_3055                        55.1    2e-05    
tpg|DAA49261.1|  TPA: hypothetical protein ZEAMMB73_648495            50.8    2e-04    
ref|XP_008664740.1|  PREDICTED: uncharacterized protein LOC103643351  49.3    4e-04    



>ref|XP_011070403.1| PREDICTED: uncharacterized protein LOC105156068 [Sesamum indicum]
Length=428

 Score =   324 bits (830),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 156/193 (81%), Positives = 171/193 (89%), Gaps = 1/193 (1%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKRDGQMT  593
            SDREYIIGRRIW+SGQTYYCVTKGVP + VPR++KPRRVDLYYSSWCIR   SKRDG++T
Sbjct  236  SDREYIIGRRIWESGQTYYCVTKGVPCSSVPRRNKPRRVDLYYSSWCIRAAESKRDGRLT  295

Query  592  ACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQI  413
            ACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRA+ APLSRSACMAQI
Sbjct  296  ACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRASGAPLSRSACMAQI  355

Query  412  NTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKAL  233
            NTK   D L SLE R   SEAE   S DKP+GR IP++LVVGGA+ALAC+IDRGLLTKA+
Sbjct  356  NTKFMVDSLESLESRSGASEAEPLASVDKPSGRGIPRVLVVGGAIALACTIDRGLLTKAV  415

Query  232  IFGVARRFAGFGK  194
            +FGVARRFA  G+
Sbjct  416  LFGVARRFARIGR  428



>ref|XP_009775677.1| PREDICTED: uncharacterized protein LOC104225551 [Nicotiana sylvestris]
Length=422

 Score =   322 bits (824),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 154/195 (79%), Positives = 173/195 (89%), Gaps = 1/195 (1%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKRDGQMT  593
            SDREYIIGRRIW+SG+TYYCVTKGVP + VPR++KPRRVDLYYSSWCIR   SKRDG+MT
Sbjct  228  SDREYIIGRRIWESGRTYYCVTKGVPCSSVPRRNKPRRVDLYYSSWCIRAAESKRDGRMT  287

Query  592  ACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQI  413
            ACEVLLFH+EDMGIPWEIAKLGVRQGMWGAV+KIDPGLRAYQ+HRA+E P+SRSA +AQ+
Sbjct  288  ACEVLLFHYEDMGIPWEIAKLGVRQGMWGAVRKIDPGLRAYQQHRASEVPISRSAFLAQV  347

Query  412  NTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKAL  233
            NTKV  D+LRSL  R  +SE E   S +KP  RNIPK LV+GGAVALACS+DRGLLTKA+
Sbjct  348  NTKVDIDNLRSLGSRTNLSEIEPEDSYEKPARRNIPKFLVIGGAVALACSLDRGLLTKAV  407

Query  232  IFGVARRFAGFGKRL  188
            IFGVARRFAG GKRL
Sbjct  408  IFGVARRFAGIGKRL  422



>ref|XP_009589163.1| PREDICTED: uncharacterized protein LOC104086569 [Nicotiana tomentosiformis]
Length=419

 Score =   317 bits (813),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 153/195 (78%), Positives = 171/195 (88%), Gaps = 1/195 (1%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKRDGQMT  593
            SDREYIIGRRIW+SG+TYYCVTKGVP + VPR++KPRRVDLYYSSWCIR   SKRDG MT
Sbjct  225  SDREYIIGRRIWESGRTYYCVTKGVPCSSVPRRNKPRRVDLYYSSWCIRAAESKRDGLMT  284

Query  592  ACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQI  413
            ACEVLLFH+EDMGIPWEIAKLGVRQGMWGAV+KIDPGLRAYQK RA+E P+SRSA +AQ+
Sbjct  285  ACEVLLFHYEDMGIPWEIAKLGVRQGMWGAVRKIDPGLRAYQKQRASEVPISRSAFLAQV  344

Query  412  NTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKAL  233
            NTKV  D+LRSL  R  +SE E   S +KP  RNIP+ LV+GGAVALACS+DRGLLTKA+
Sbjct  345  NTKVDIDNLRSLGSRAILSEIEPEDSYEKPARRNIPRFLVIGGAVALACSLDRGLLTKAV  404

Query  232  IFGVARRFAGFGKRL  188
            IFGVARRFAG GKRL
Sbjct  405  IFGVARRFAGIGKRL  419



>ref|XP_011081359.1| PREDICTED: uncharacterized protein LOC105164409 [Sesamum indicum]
Length=430

 Score =   313 bits (801),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 151/195 (77%), Positives = 170/195 (87%), Gaps = 1/195 (1%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKRDGQMT  593
            SDREYIIGRRIW SG+TYYCVTKGVP + VPR++KPRRVDLYYSSWCIRP  SKRD ++T
Sbjct  236  SDREYIIGRRIWASGRTYYCVTKGVPCSSVPRRNKPRRVDLYYSSWCIRPAESKRDRRLT  295

Query  592  ACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQI  413
            ACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLR+YQKHRA+ +PLS    MAQI
Sbjct  296  ACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRSYQKHRASGSPLSHCGFMAQI  355

Query  412  NTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKAL  233
            NTKV+ + L S E   + SE E  GS+DKP+GR IPK+LVVGGA+ALAC+IDRGLLTKA+
Sbjct  356  NTKVSPELLESQESTSSASEVEPIGSADKPSGRGIPKMLVVGGAIALACTIDRGLLTKAV  415

Query  232  IFGVARRFAGFGKRL  188
            IFGVARRFA  G+RL
Sbjct  416  IFGVARRFANMGRRL  430



>emb|CBI34612.3| unnamed protein product [Vitis vinifera]
Length=384

 Score =   305 bits (782),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 154/197 (78%), Positives = 170/197 (86%), Gaps = 3/197 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREY+IGRRIW+SG++YYCVTKGVP + VPR++KPRRVDLYYSSWCIR   SKR DGQ+
Sbjct  188  SDREYMIGRRIWESGRSYYCVTKGVPCSSVPRRNKPRRVDLYYSSWCIRAVESKRGDGQL  247

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKK+DPGLRAYQK R + A LSR A MAQ
Sbjct  248  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKVDPGLRAYQKERGSGAALSRYAFMAQ  307

Query  415  INTKVTTDDLRSLE-LRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTK  239
            INTKV+ D LRSLE      SE E  GSS+KP GRNIPKLLVVGGA+ALACS+DRGLLTK
Sbjct  308  INTKVSADYLRSLESTNNDSSEVETFGSSEKPMGRNIPKLLVVGGAIALACSLDRGLLTK  367

Query  238  ALIFGVARRFAGFGKRL  188
            A+IFGVAR FA  G+RL
Sbjct  368  AVIFGVARSFARIGRRL  384



>ref|XP_006343761.1| PREDICTED: uncharacterized protein LOC102582708 [Solanum tuberosum]
Length=409

 Score =   306 bits (783),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 148/195 (76%), Positives = 168/195 (86%), Gaps = 1/195 (1%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKRDGQMT  593
            SDREYIIGRRIW+SG+TYYCVTK VP + V R++KPRRVDLYYSSW IR   SKRDG+MT
Sbjct  215  SDREYIIGRRIWESGRTYYCVTKSVPCSSVLRRNKPRRVDLYYSSWFIRAAESKRDGRMT  274

Query  592  ACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQI  413
            ACEVLLFH+EDMGIPWEIAKLGVRQGMWGAV+KIDPGLRAYQKHRA+  P+SR A MAQ+
Sbjct  275  ACEVLLFHYEDMGIPWEIAKLGVRQGMWGAVRKIDPGLRAYQKHRASGDPISRCAFMAQV  334

Query  412  NTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKAL  233
            NTKV  ++LRS+     +SE E   S +KP GRNIP+ LVVGGA+ALACS+DRGLLTKA+
Sbjct  335  NTKVDIENLRSMGSETNLSEIEPEDSPEKPAGRNIPRFLVVGGAIALACSLDRGLLTKAV  394

Query  232  IFGVARRFAGFGKRL  188
            IFGVARRFAG GKRL
Sbjct  395  IFGVARRFAGIGKRL  409



>ref|XP_004245442.1| PREDICTED: uncharacterized protein LOC101259469 [Solanum lycopersicum]
Length=409

 Score =   305 bits (781),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 148/195 (76%), Positives = 168/195 (86%), Gaps = 1/195 (1%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKRDGQMT  593
            SDREYIIGRRIW+SG+TYYCVTKGVP   VPR++KPRRVDLYYSSW IR   SKRDG+MT
Sbjct  215  SDREYIIGRRIWESGRTYYCVTKGVPCPSVPRRNKPRRVDLYYSSWFIRAAESKRDGRMT  274

Query  592  ACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQI  413
            ACEVLLFH+EDMGIPWEIAKLGVRQGMWGAV+KIDPGLRAYQ+HRA+  P+SR A MAQ+
Sbjct  275  ACEVLLFHYEDMGIPWEIAKLGVRQGMWGAVRKIDPGLRAYQRHRASGDPISRCAFMAQV  334

Query  412  NTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKAL  233
            NTKV  ++LRS+     +SE E   S +KP GR IP+ LVVGGA+ALACS+DRGLLTKA+
Sbjct  335  NTKVDIENLRSMGSETYLSEIEREDSPEKPAGRIIPRFLVVGGAIALACSLDRGLLTKAV  394

Query  232  IFGVARRFAGFGKRL  188
            IFGVARRFAG GKRL
Sbjct  395  IFGVARRFAGIGKRL  409



>ref|XP_002278777.1| PREDICTED: uncharacterized protein LOC100247984 [Vitis vinifera]
Length=438

 Score =   305 bits (782),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 154/197 (78%), Positives = 170/197 (86%), Gaps = 3/197 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREY+IGRRIW+SG++YYCVTKGVP + VPR++KPRRVDLYYSSWCIR   SKR DGQ+
Sbjct  242  SDREYMIGRRIWESGRSYYCVTKGVPCSSVPRRNKPRRVDLYYSSWCIRAVESKRGDGQL  301

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKK+DPGLRAYQK R + A LSR A MAQ
Sbjct  302  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKVDPGLRAYQKERGSGAALSRYAFMAQ  361

Query  415  INTKVTTDDLRSLE-LRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTK  239
            INTKV+ D LRSLE      SE E  GSS+KP GRNIPKLLVVGGA+ALACS+DRGLLTK
Sbjct  362  INTKVSADYLRSLESTNNDSSEVETFGSSEKPMGRNIPKLLVVGGAIALACSLDRGLLTK  421

Query  238  ALIFGVARRFAGFGKRL  188
            A+IFGVAR FA  G+RL
Sbjct  422  AVIFGVARSFARIGRRL  438



>emb|CDP12249.1| unnamed protein product [Coffea canephora]
Length=438

 Score =   301 bits (772),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/195 (74%), Positives = 164/195 (84%), Gaps = 1/195 (1%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSSWCIRPGASKRDGQMT  593
            SDREYI+ RRIW+SG TYYCVTKGVPN  +PR+ KPRRVDLYYSSWCIR   S+R  Q+T
Sbjct  244  SDREYIMARRIWRSGNTYYCVTKGVPNSAIPRRQKPRRVDLYYSSWCIRAVESRRGDQLT  303

Query  592  ACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQI  413
            ACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDP LRAYQK RA+  PLSR A +AQI
Sbjct  304  ACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPALRAYQKQRASGVPLSRCAFLAQI  363

Query  412  NTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKAL  233
            N+KV+ D LR LE   ++SE E   S +KP+GRN+PK LVVGGA+ALAC++DRGLLTKA+
Sbjct  364  NSKVSVDYLRWLESTSSLSEVETLASPEKPSGRNLPKYLVVGGAIALACTLDRGLLTKAV  423

Query  232  IFGVARRFAGFGKRL  188
            IFGVARRF   GK+L
Sbjct  424  IFGVARRFVKMGKQL  438



>ref|XP_002317053.1| hypothetical protein POPTR_0011s15470g [Populus trichocarpa]
 gb|EEE97665.1| hypothetical protein POPTR_0011s15470g [Populus trichocarpa]
Length=398

 Score =   300 bits (769),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 147/191 (77%), Positives = 168/191 (88%), Gaps = 3/191 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW+SG+ YYCVTKGVP + VPR++KPRRVDLYYSSWCIR   SKR DG++
Sbjct  203  SDREYIIGRRIWESGRLYYCVTKGVPCSSVPRRNKPRRVDLYYSSWCIRAVESKRGDGEL  262

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEV+LFHHEDMGIPWEIAKLGVRQGMWGAVKK++PGLRAYQKHRA+ APLSRSA MAQ
Sbjct  263  TACEVMLFHHEDMGIPWEIAKLGVRQGMWGAVKKLEPGLRAYQKHRASAAPLSRSAFMAQ  322

Query  415  INTKVTTDDLRSLELRRT-MSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTK  239
            INTKV+ D LRSLE   +  SE E   +S+KP G N+PK LV+GGAVALAC+++RGLLTK
Sbjct  323  INTKVSADYLRSLETSISDSSEIEIRETSEKPVGHNVPKFLVIGGAVALACTLERGLLTK  382

Query  238  ALIFGVARRFA  206
            ALIFGVAR+FA
Sbjct  383  ALIFGVARKFA  393



>ref|XP_002300509.2| hypothetical protein POPTR_0001s45410g [Populus trichocarpa]
 gb|EEE85314.2| hypothetical protein POPTR_0001s45410g [Populus trichocarpa]
Length=435

 Score =   301 bits (771),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 151/198 (76%), Positives = 171/198 (86%), Gaps = 5/198 (3%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW+SG+ YYCVTKGVP + VPR++KPRRVDLYYSSWCIR   SKR DGQ+
Sbjct  239  SDREYIIGRRIWESGRMYYCVTKGVPCSSVPRRNKPRRVDLYYSSWCIRAVESKRGDGQL  298

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEV+LFHHEDMGIPWEIAKLGVRQGMWGAVKKI+PGLRAYQKHRA+ APLSRSA MAQ
Sbjct  299  TACEVMLFHHEDMGIPWEIAKLGVRQGMWGAVKKIEPGLRAYQKHRASAAPLSRSAFMAQ  358

Query  415  INTKVTTDDLRSLELRRT--MSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLT  242
            INT+V+ D LRSLE R +  M E E+  + +K  G NIPK LV+GGAVALAC++DRGL T
Sbjct  359  INTEVSADYLRSLESRTSSDMLEIESQETPEKRVGNNIPKFLVIGGAVALACTLDRGLAT  418

Query  241  KALIFGVARRFAGFGKRL  188
            KALIFGVARRFA  G+R+
Sbjct  419  KALIFGVARRFA-IGRRM  435



>ref|XP_009344057.1| PREDICTED: uncharacterized protein LOC103935948 [Pyrus x bretschneideri]
Length=440

 Score =   300 bits (769),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 149/200 (75%), Positives = 172/200 (86%), Gaps = 6/200 (3%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREY+IGRRIW+SG+TYYCVTKGVP+  VPR+ KPRRVDLYYSSWCIR   SKR DGQ+
Sbjct  241  SDREYLIGRRIWESGRTYYCVTKGVPSSAVPRRDKPRRVDLYYSSWCIRAVESKRGDGQL  300

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACE+LL+HHEDMGIPWE+AKLGVRQGMWGAVKKI+PGLRAYQK RA+EAPLSR A MAQ
Sbjct  301  TACEILLYHHEDMGIPWELAKLGVRQGMWGAVKKIEPGLRAYQKERASEAPLSRCAYMAQ  360

Query  415  INTKVTTDDLRSLEL----RRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGL  248
            INTKV+ D LRS+E        + ++E   SSDKP G++IPKLLVVGGA+A+ACS+DRGL
Sbjct  361  INTKVSADYLRSVENSMGDSMVVEKSEKLDSSDKPEGKSIPKLLVVGGAIAIACSLDRGL  420

Query  247  LTKALIFGVARRFAGFGKRL  188
            LTKA+IFGVARRFA  G+R 
Sbjct  421  LTKAVIFGVARRFAKIGRRF  440



>ref|XP_008245786.1| PREDICTED: uncharacterized protein LOC103343932 [Prunus mume]
Length=435

 Score =   300 bits (767),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 152/198 (77%), Positives = 174/198 (88%), Gaps = 4/198 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREY+IGRRIW+SG++YYCVTKGVP + VPR+ KPRRVDLYYSSWCIR   SKR DGQ+
Sbjct  238  SDREYLIGRRIWESGRSYYCVTKGVPCSSVPRRDKPRRVDLYYSSWCIRAVESKRGDGQL  297

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKI+PGLR YQK RA++APLSR A MAQ
Sbjct  298  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIEPGLRVYQKERASKAPLSRCAYMAQ  357

Query  415  INTKVTTDDLRSLELRRTMSEA-EASGSSD-KPTGRNIPKLLVVGGAVALACSIDRGLLT  242
            INTKV+ D LRS+E   + + A E SGSS+ KP G++IPKLLVVGGA+ALACS+DRGLLT
Sbjct  358  INTKVSADYLRSVENSTSDTMAIEKSGSSEKKPEGKSIPKLLVVGGAIALACSLDRGLLT  417

Query  241  KALIFGVARRFAGFGKRL  188
            KA+IFGVARRFA  G++L
Sbjct  418  KAVIFGVARRFANIGRKL  435



>ref|XP_011040605.1| PREDICTED: uncharacterized protein LOC105136815 [Populus euphratica]
Length=427

 Score =   299 bits (765),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 168/191 (88%), Gaps = 3/191 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW+SG+ YYCVTKGVP + VPR++KPRRVDLYYSSWCIR   SKR DG++
Sbjct  233  SDREYIIGRRIWESGRLYYCVTKGVPCSSVPRRNKPRRVDLYYSSWCIRAVESKRGDGEL  292

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEV+LFHHEDMGIPWEIAKLGVRQGMWGAVKK++PGLRAYQKHRA+ APLSRSA MAQ
Sbjct  293  SACEVMLFHHEDMGIPWEIAKLGVRQGMWGAVKKLEPGLRAYQKHRASAAPLSRSAFMAQ  352

Query  415  INTKVTTDDLRSLELRRT-MSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTK  239
            INTKV+ D LRSLE   +  SE E   +S+KP G N+PK LV+GGAVALAC+++RGLLTK
Sbjct  353  INTKVSADYLRSLETSISDSSEIEIRETSEKPVGHNVPKFLVIGGAVALACTLERGLLTK  412

Query  238  ALIFGVARRFA  206
            ALIFGVAR+FA
Sbjct  413  ALIFGVARKFA  423



>ref|XP_007209198.1| hypothetical protein PRUPE_ppa006451mg [Prunus persica]
 gb|EMJ10397.1| hypothetical protein PRUPE_ppa006451mg [Prunus persica]
Length=411

 Score =   298 bits (764),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 151/198 (76%), Positives = 174/198 (88%), Gaps = 4/198 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREY+IGRRIW+SG++YYCVTKGVP + VPR+ KPRRVDLYYSSWCIR   SKR DGQ+
Sbjct  214  SDREYLIGRRIWESGRSYYCVTKGVPCSSVPRRDKPRRVDLYYSSWCIRAVESKRGDGQL  273

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKI+PGLR YQK R+++APLSR A MAQ
Sbjct  274  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIEPGLRVYQKERSSKAPLSRCAYMAQ  333

Query  415  INTKVTTDDLRSLELRRTMSEA-EASGSSD-KPTGRNIPKLLVVGGAVALACSIDRGLLT  242
            INTKV+ D LRS+E   + + A E SGSS+ KP G++IPKLLVVGGA+ALACS+DRGLLT
Sbjct  334  INTKVSADYLRSVENSTSDTMAIEKSGSSEKKPEGKSIPKLLVVGGAIALACSLDRGLLT  393

Query  241  KALIFGVARRFAGFGKRL  188
            KA+IFGVARRFA  G++L
Sbjct  394  KAVIFGVARRFANIGRKL  411



>ref|XP_008392651.1| PREDICTED: uncharacterized protein LOC103454832 [Malus domestica]
Length=440

 Score =   299 bits (765),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 148/200 (74%), Positives = 172/200 (86%), Gaps = 6/200 (3%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREY+IGRRIW++G+TYYCVTKGVP+  VPR+ KPRRVDLYYSSWCIR   SKR DGQ+
Sbjct  241  SDREYLIGRRIWEAGRTYYCVTKGVPSSAVPRRDKPRRVDLYYSSWCIRAVESKRGDGQL  300

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACE+LL+HHEDMGIPWE+AKLGVRQGMWGAVKKI+PGLRAYQK RA+EAPLSR A MAQ
Sbjct  301  TACEILLYHHEDMGIPWELAKLGVRQGMWGAVKKIEPGLRAYQKERASEAPLSRCAYMAQ  360

Query  415  INTKVTTDDLRSLELRR----TMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGL  248
            INTKV+ D LRS+E        + +++   SSDKP G++IPKLLVVGGA+ALACS+DRGL
Sbjct  361  INTKVSADYLRSVENSTGDSMVVEKSDKLDSSDKPEGKSIPKLLVVGGAIALACSLDRGL  420

Query  247  LTKALIFGVARRFAGFGKRL  188
            LTKA+IFGVARRFA  G+R 
Sbjct  421  LTKAVIFGVARRFAKIGRRF  440



>ref|XP_009348226.1| PREDICTED: uncharacterized protein LOC103939842 [Pyrus x bretschneideri]
 ref|XP_009348228.1| PREDICTED: uncharacterized protein LOC103939851 [Pyrus x bretschneideri]
Length=440

 Score =   298 bits (762),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 149/200 (75%), Positives = 171/200 (86%), Gaps = 6/200 (3%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREY+IGRRIW+SG+TYYCVTKGVP+  VPR+ KPRRVDLYYSSWCIR   SKR DGQ+
Sbjct  241  SDREYLIGRRIWESGRTYYCVTKGVPSSAVPRRDKPRRVDLYYSSWCIRAVESKRGDGQL  300

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACE+LL+HHEDMGIPWE+AKLGVRQGMWGAVKKI+PGLRAYQK RA+EA LSR A MAQ
Sbjct  301  TACEILLYHHEDMGIPWELAKLGVRQGMWGAVKKIEPGLRAYQKERASEALLSRCAYMAQ  360

Query  415  INTKVTTDDLRSLELRR----TMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGL  248
            INTKV+ D LRS+E        + ++E   SSDKP G++IPKLLVVGGA+ALACS+DRGL
Sbjct  361  INTKVSADYLRSIENSTGDSMVVEKSEKLDSSDKPEGKSIPKLLVVGGAIALACSLDRGL  420

Query  247  LTKALIFGVARRFAGFGKRL  188
            LTKA+IFGVARRFA  G+R 
Sbjct  421  LTKAVIFGVARRFAKIGRRF  440



>ref|XP_010267382.1| PREDICTED: uncharacterized protein LOC104604645 [Nelumbo nucifera]
Length=449

 Score =   298 bits (762),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 148/195 (76%), Positives = 166/195 (85%), Gaps = 2/195 (1%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW+SG++YYCVTKGVP + VPR++KPRRVDLYYSSW IR   SKR DGQM
Sbjct  253  SDREYIIGRRIWQSGRSYYCVTKGVPCSSVPRRNKPRRVDLYYSSWFIRAVESKRGDGQM  312

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKI+PGLRAYQK RA+ +PLS  A MAQ
Sbjct  313  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIEPGLRAYQKDRASGSPLSHCAFMAQ  372

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            +NTK+  + LRSLE      EAE   SSDKP GR+IPKLL +GGAVALAC++D+GLLTKA
Sbjct  373  MNTKINPEYLRSLETTSDSPEAEIINSSDKPLGRSIPKLLFIGGAVALACTLDQGLLTKA  432

Query  235  LIFGVARRFAGFGKR  191
            +IFGVARRFA  G R
Sbjct  433  VIFGVARRFAKIGSR  447



>ref|XP_002518934.1| phosphatidylcholine transfer protein, putative [Ricinus communis]
 gb|EEF43467.1| phosphatidylcholine transfer protein, putative [Ricinus communis]
Length=428

 Score =   296 bits (759),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 150/196 (77%), Positives = 167/196 (85%), Gaps = 2/196 (1%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW+SG+ YYCVTKGVP + VPR++KPRRVDLYYSSWCIR   SKR DGQ+
Sbjct  233  SDREYIIGRRIWESGRLYYCVTKGVPCSSVPRRNKPRRVDLYYSSWCIRAVESKRGDGQL  292

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEVLLFHHEDMGIPWEIAKLG+RQGMWGAVKKIDPGLRAYQKHRA   PLSR A MAQ
Sbjct  293  SACEVLLFHHEDMGIPWEIAKLGIRQGMWGAVKKIDPGLRAYQKHRAAGGPLSRCAFMAQ  352

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            INTKV++D LRSLE   + S    S  S K  G NIP+LLVVGGA+ALAC++DRGLLTKA
Sbjct  353  INTKVSSDYLRSLESNASYSSEVESDDSSKKPGGNIPRLLVVGGAIALACTLDRGLLTKA  412

Query  235  LIFGVARRFAGFGKRL  188
            +IFGVARRFA  G+RL
Sbjct  413  VIFGVARRFAKIGRRL  428



>ref|XP_004309518.1| PREDICTED: uncharacterized protein LOC101297897 [Fragaria vesca 
subsp. vesca]
Length=438

 Score =   296 bits (757),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 148/197 (75%), Positives = 169/197 (86%), Gaps = 3/197 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDR+Y+IGRRIW+SG++YYCVTKGVP+  VPR+ KPRRVDLYYSSWCIR   SKR DGQ+
Sbjct  242  SDRDYMIGRRIWESGRSYYCVTKGVPSSAVPRRDKPRRVDLYYSSWCIRAVESKRGDGQL  301

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            T+CEV+LFHHEDMGIPWEIAKLGVRQGMWGAVKKI+PGLR YQK RA +APLSR A MAQ
Sbjct  302  TSCEVILFHHEDMGIPWEIAKLGVRQGMWGAVKKIEPGLRLYQKERAAKAPLSRCAKMAQ  361

Query  415  INTKVTTDDLRSLELRRTMS-EAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTK  239
            INTKV+ D LRS+E     S E E S S++KP GRNIPK L+VGGA+ LACS+DRGLLTK
Sbjct  362  INTKVSADYLRSVENSTKDSMEVEISDSAEKPVGRNIPKALIVGGALVLACSLDRGLLTK  421

Query  238  ALIFGVARRFAGFGKRL  188
            A+IFGVARRFA  G+RL
Sbjct  422  AVIFGVARRFAKIGRRL  438



>ref|XP_012086635.1| PREDICTED: uncharacterized protein LOC105645602 [Jatropha curcas]
 gb|KDP25225.1| hypothetical protein JCGZ_20381 [Jatropha curcas]
Length=428

 Score =   295 bits (754),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 147/196 (75%), Positives = 165/196 (84%), Gaps = 2/196 (1%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW+SG+ YYCVTKGVP   VPR++KPRRVDLYYSSWC+R   SKR DGQ+
Sbjct  233  SDREYIIGRRIWESGRLYYCVTKGVPCMSVPRRNKPRRVDLYYSSWCVRAVESKRGDGQL  292

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKI+PGLRAYQK RA   PLSR A MAQ
Sbjct  293  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIEPGLRAYQKQRAAGDPLSRCAFMAQ  352

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            INTKV+ D LRSLE     S   A+  S K +G NIP++LV+GGA+ALAC++DRGLLTKA
Sbjct  353  INTKVSADYLRSLESNANSSLEAATQDSSKKSGGNIPRMLVLGGAIALACTLDRGLLTKA  412

Query  235  LIFGVARRFAGFGKRL  188
            +IFGVARRFA  G+RL
Sbjct  413  VIFGVARRFAKIGRRL  428



>ref|XP_011038005.1| PREDICTED: uncharacterized protein LOC105135031 [Populus euphratica]
Length=433

 Score =   294 bits (753),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 149/197 (76%), Positives = 168/197 (85%), Gaps = 4/197 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW+S + YYCVTKGVP + VPR++KPRRVDLYYSSWCIR   SKR DGQ+
Sbjct  238  SDREYIIGRRIWESDRLYYCVTKGVPCSSVPRRNKPRRVDLYYSSWCIRAVESKRGDGQL  297

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEV+LFHHEDMGIPWEIAKLGVRQGMWGAVKKI+PGLRAYQK RA+ APLSRSA MAQ
Sbjct  298  TACEVMLFHHEDMGIPWEIAKLGVRQGMWGAVKKIEPGLRAYQKQRASAAPLSRSAFMAQ  357

Query  415  INTKVTTDDLRSLELRRT-MSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTK  239
            INTKV+ D LRSLE R + M E E+  + +K    NIPK LV+GGAVALAC++DRGL TK
Sbjct  358  INTKVSADYLRSLESRTSDMLEIESQETPEKRVRNNIPKFLVIGGAVALACTLDRGLATK  417

Query  238  ALIFGVARRFAGFGKRL  188
            ALIFGVARRFA  G+R+
Sbjct  418  ALIFGVARRFA-IGRRM  433



>ref|XP_009360210.1| PREDICTED: uncharacterized protein LOC103950711 [Pyrus x bretschneideri]
Length=438

 Score =   294 bits (753),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 143/200 (72%), Positives = 171/200 (86%), Gaps = 6/200 (3%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREY+IGRRIW+SG+TYYCVTKGVP+  VPR+ KPRRVDLYYSSWCIR   S+R DGQ+
Sbjct  239  SDREYLIGRRIWESGRTYYCVTKGVPSSAVPRREKPRRVDLYYSSWCIRAVESRRGDGQL  298

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACE+LL+HHEDMGIPWEIAK GVRQGMWG VKKI+PGLRAYQK RA++APLSR A MAQ
Sbjct  299  TACEILLYHHEDMGIPWEIAKFGVRQGMWGTVKKIEPGLRAYQKERASKAPLSRCAYMAQ  358

Query  415  INTKVTTDDLRSLELRRT----MSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGL  248
            INTKV+ D LRS+E   +    + +++ S SS+KP G+ IPK+L++GGA+ALACS+DRGL
Sbjct  359  INTKVSADYLRSVENSTSDSMALEKSDKSDSSEKPEGKTIPKILIIGGAIALACSLDRGL  418

Query  247  LTKALIFGVARRFAGFGKRL  188
            LTKA+IFGVARRFA  G+R 
Sbjct  419  LTKAVIFGVARRFAKIGRRF  438



>gb|KDO76778.1| hypothetical protein CISIN_1g014046mg [Citrus sinensis]
Length=432

 Score =   294 bits (752),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 147/197 (75%), Positives = 168/197 (85%), Gaps = 3/197 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW+SG++YYCVTKGVP   VPR++KP+RVDL+YSSW IR   S+R DGQ+
Sbjct  236  SDREYIIGRRIWESGRSYYCVTKGVPYTSVPRRNKPKRVDLFYSSWYIRAVESRRGDGQL  295

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEV+LFHHEDMGIPWEIAKLGVRQGMWGAVKK DP LRAY K RA+ A LSR A MAQ
Sbjct  296  TACEVILFHHEDMGIPWEIAKLGVRQGMWGAVKKFDPALRAYVKERASGASLSRCAYMAQ  355

Query  415  INTKVTTDDLRSLE-LRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTK  239
            INTKV+ D LR+L+     +S  EAS SS+KP GRNIPKLL+VGGA+ALACSID+GLLTK
Sbjct  356  INTKVSADYLRTLQNCTNDLSVVEASDSSEKPGGRNIPKLLIVGGAIALACSIDKGLLTK  415

Query  238  ALIFGVARRFAGFGKRL  188
            A+IFGVARRFA  G+RL
Sbjct  416  AVIFGVARRFAKIGRRL  432



>ref|XP_010251494.1| PREDICTED: uncharacterized protein LOC104593390 [Nelumbo nucifera]
Length=424

 Score =   293 bits (751),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 146/196 (74%), Positives = 162/196 (83%), Gaps = 2/196 (1%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW+SG  YYCVTKGVP   VPR++KPRRVDLYYSSW IR   SKR DGQ+
Sbjct  229  SDREYIIGRRIWESGNAYYCVTKGVPCPSVPRRNKPRRVDLYYSSWIIRAVESKRGDGQL  288

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEVLLFHHEDMGIPWE+AKLGVR GMWGAVKKIDPGLRAYQK+RA  +PLS  A MAQ
Sbjct  289  TACEVLLFHHEDMGIPWEVAKLGVRHGMWGAVKKIDPGLRAYQKNRAAGSPLSHGALMAQ  348

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            INTK+  D  RSLE     +E +   SS+KP GRNIPKLLVVGGAV +A ++DRGLLTKA
Sbjct  349  INTKINVDYFRSLETTGDSTEVKTIDSSEKPLGRNIPKLLVVGGAVLVAFTLDRGLLTKA  408

Query  235  LIFGVARRFAGFGKRL  188
            +IFGVARRFA  G+RL
Sbjct  409  VIFGVARRFANIGRRL  424



>ref|XP_008346656.1| PREDICTED: uncharacterized protein LOC103409627 [Malus domestica]
Length=438

 Score =   293 bits (750),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 145/200 (73%), Positives = 170/200 (85%), Gaps = 6/200 (3%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREY+IGRRIW+SG+TYYCVTKGVP+  VPR+ KP+RVDLYYSSWCIR   SKR DGQ+
Sbjct  239  SDREYLIGRRIWESGRTYYCVTKGVPSSAVPRREKPKRVDLYYSSWCIRAVESKRGDGQL  298

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACE+LL+HHEDMGIPWEIAK GVRQGMWG VKKI+PGLRAYQK RA++APLSR A MAQ
Sbjct  299  TACEILLYHHEDMGIPWEIAKFGVRQGMWGTVKKIEPGLRAYQKERASKAPLSRCAYMAQ  358

Query  415  INTKVTTDDLRSLELRRTMSEA----EASGSSDKPTGRNIPKLLVVGGAVALACSIDRGL  248
            INTKV+ D LRS+E   + S A    + S SS+KP G+ IPK+L++GGA+ALACS+DRGL
Sbjct  359  INTKVSADYLRSVENSTSDSMAVEKSDKSDSSEKPEGKTIPKILLIGGAIALACSLDRGL  418

Query  247  LTKALIFGVARRFAGFGKRL  188
            LTKA+IFGVARRFA  G+R 
Sbjct  419  LTKAVIFGVARRFAKIGRRF  438



>ref|XP_006476268.1| PREDICTED: uncharacterized protein LOC102627263 [Citrus sinensis]
Length=432

 Score =   293 bits (749),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 146/197 (74%), Positives = 168/197 (85%), Gaps = 3/197 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW+SG++YYCVTKGVP   +PR++KP+RVDL+YSSW IR   S+R DGQ+
Sbjct  236  SDREYIIGRRIWESGRSYYCVTKGVPYTSMPRRNKPKRVDLFYSSWYIRAVESRRGDGQL  295

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEV+LFHHEDMGIPWEIAKLGVRQGMWGAVKK DP LRAY K RA+ A LSR A MAQ
Sbjct  296  TACEVILFHHEDMGIPWEIAKLGVRQGMWGAVKKFDPALRAYVKERASGASLSRCAYMAQ  355

Query  415  INTKVTTDDLRSLE-LRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTK  239
            INTKV+ D LR+L+     +S  EAS SS+KP GRNIPKLL+VGGA+ALACSID+GLLTK
Sbjct  356  INTKVSADYLRTLQNCTNDLSVVEASDSSEKPGGRNIPKLLIVGGAIALACSIDKGLLTK  415

Query  238  ALIFGVARRFAGFGKRL  188
            A+IFGVARRFA  G+RL
Sbjct  416  AVIFGVARRFAKIGRRL  432



>ref|XP_006439191.1| hypothetical protein CICLE_v10020224mg [Citrus clementina]
 gb|ESR52431.1| hypothetical protein CICLE_v10020224mg [Citrus clementina]
Length=432

 Score =   292 bits (748),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 146/197 (74%), Positives = 167/197 (85%), Gaps = 3/197 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW+SG++YYCVTKGVP   VPR++KP+RVDL+YSSW IR   S+R DGQ+
Sbjct  236  SDREYIIGRRIWESGRSYYCVTKGVPYTSVPRRNKPKRVDLFYSSWYIRAVESRRGDGQL  295

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEV+LFHHEDMGIPWEIAKLGVRQGMWGAVKK DP L AY K RA+ A LSR A MAQ
Sbjct  296  TACEVILFHHEDMGIPWEIAKLGVRQGMWGAVKKFDPALHAYMKERASGASLSRCAYMAQ  355

Query  415  INTKVTTDDLRSLE-LRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTK  239
            INTKV+ D LR+L+     +S  EAS SS+KP GRNIPKLL+VGGA+ALACSID+GLLTK
Sbjct  356  INTKVSADYLRTLQNCTNDLSVVEASDSSEKPGGRNIPKLLIVGGAIALACSIDKGLLTK  415

Query  238  ALIFGVARRFAGFGKRL  188
            A+IFGVARRFA  G+RL
Sbjct  416  AVIFGVARRFAKIGRRL  432



>ref|XP_007143962.1| hypothetical protein PHAVU_007G117200g [Phaseolus vulgaris]
 gb|ESW15956.1| hypothetical protein PHAVU_007G117200g [Phaseolus vulgaris]
Length=396

 Score =   290 bits (742),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 140/196 (71%), Positives = 162/196 (83%), Gaps = 2/196 (1%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKRDGQMT  593
            SDREYIIGRRIW + Q YYCVTKGVP   +PR +KP+RVDL+YSSWCIR   S++DGQ+T
Sbjct  201  SDREYIIGRRIWDAAQIYYCVTKGVPCPSMPRHNKPKRVDLFYSSWCIRAVKSRKDGQLT  260

Query  592  ACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQI  413
            +CE+LLFHHEDMGIPWEIAKLGVRQGMWGAVKK DPGLR Y+K RA+  PLS  A  A I
Sbjct  261  SCEILLFHHEDMGIPWEIAKLGVRQGMWGAVKKFDPGLRTYEKQRASGVPLSPCARAANI  320

Query  412  NTKVTTDDLRSLELRRT-MSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            NTK++ D LRSLE   T + E E   SSDKP GRNIPKLL+VGGA+ALAC++D+GLLTKA
Sbjct  321  NTKISVDYLRSLENTTTDLLEIENQDSSDKPVGRNIPKLLIVGGAIALACTLDQGLLTKA  380

Query  235  LIFGVARRFAGFGKRL  188
            +IFGVARRFA  G+RL
Sbjct  381  VIFGVARRFAKMGRRL  396



>ref|XP_010104915.1| hypothetical protein L484_024117 [Morus notabilis]
 gb|EXC02151.1| hypothetical protein L484_024117 [Morus notabilis]
Length=440

 Score =   291 bits (746),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 149/196 (76%), Positives = 164/196 (84%), Gaps = 3/196 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREY+IGRRIW+SG++YYCVTKGVP N VPR++KPRRVDLYYSSWCIR   S+R DGQ+
Sbjct  243  SDREYLIGRRIWESGRSYYCVTKGVPYNSVPRRNKPRRVDLYYSSWCIRAVESRRGDGQL  302

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEVLLFHHEDMGIPWEIAKLGV+QGMWGAVKKIDPGLR YQK RA+ A LSR A MAQ
Sbjct  303  TACEVLLFHHEDMGIPWEIAKLGVKQGMWGAVKKIDPGLRKYQKERASGASLSRCAFMAQ  362

Query  415  INTKVTTDDLRSLELRRTMSEA-EASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTK  239
            INTKV+ D LRSLE     S   E   SS K  G+NIPKLLVVGGAV LACS+DRGLLTK
Sbjct  363  INTKVSADYLRSLEDDSEESTGIERPNSSGKQEGKNIPKLLVVGGAVLLACSLDRGLLTK  422

Query  238  ALIFGVARRFAGFGKR  191
            A+IFG+ARRFA  G R
Sbjct  423  AVIFGIARRFANIGGR  438



>gb|KHG16904.1| StAR-related lipid transfer 7, mitochondrial [Gossypium arboreum]
Length=433

 Score =   291 bits (744),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 143/197 (73%), Positives = 163/197 (83%), Gaps = 3/197 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREY+ GRRIW+SG+ YYCVTKGVP   VPR++KPRRVDLYYSSW IR   S++ DGQ+
Sbjct  237  SDREYVFGRRIWESGRAYYCVTKGVPYASVPRKNKPRRVDLYYSSWLIRAVESRKGDGQL  296

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEVLLFHHEDMGIPW+IAK+GVRQGMWG VKKIDPGLRAYQK R +   LS  A MAQ
Sbjct  297  TACEVLLFHHEDMGIPWKIAKVGVRQGMWGTVKKIDPGLRAYQKERTSGNTLSHCAFMAQ  356

Query  415  INTKVTTDDLRSLELRRT-MSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTK  239
            IN+K++ D LRS E +    SE E   SS+KP+G+NIPKLLVVGGA+ALACS DRGLLTK
Sbjct  357  INSKISADYLRSFESKSNDSSELETHNSSEKPSGKNIPKLLVVGGAIALACSFDRGLLTK  416

Query  238  ALIFGVARRFAGFGKRL  188
            A+IFGVARRFA  GKRL
Sbjct  417  AVIFGVARRFANIGKRL  433



>gb|KJB39548.1| hypothetical protein B456_007G018700 [Gossypium raimondii]
Length=433

 Score =   291 bits (744),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 143/197 (73%), Positives = 163/197 (83%), Gaps = 3/197 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREY+ GRRIW+SG+ YYCVTKGVP   VPR++KPRRVDLYYSSW IR   S++ DGQ+
Sbjct  237  SDREYVFGRRIWESGRAYYCVTKGVPYGSVPRKNKPRRVDLYYSSWLIRAVESRKGDGQL  296

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEVLLFHHEDMGIPW+IAK+GVRQGMWG VKKIDPGLRAYQK R +   LS  A MAQ
Sbjct  297  TACEVLLFHHEDMGIPWKIAKVGVRQGMWGTVKKIDPGLRAYQKERTSGNTLSHCAFMAQ  356

Query  415  INTKVTTDDLRSLELRRT-MSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTK  239
            IN+K++ D LRS E +    SE E   SS+KP+G+NIPKLLVVGGA+ALACS DRGLLTK
Sbjct  357  INSKISADYLRSFESKSNDSSELETHNSSEKPSGKNIPKLLVVGGAIALACSFDRGLLTK  416

Query  238  ALIFGVARRFAGFGKRL  188
            A+IFGVARRFA  GKRL
Sbjct  417  AVIFGVARRFANIGKRL  433



>gb|KHG30399.1| StAR-related lipid transfer 7, mitochondrial [Gossypium arboreum]
Length=436

 Score =   291 bits (744),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 144/197 (73%), Positives = 163/197 (83%), Gaps = 3/197 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREY+IGRRIW  G+TYYCVTKGVP   +PR++KPRRVDLYYSSWCIR   S++ DGQ+
Sbjct  240  SDREYLIGRRIWSCGRTYYCVTKGVPYPSIPRKTKPRRVDLYYSSWCIRAAESRKGDGQL  299

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEVLLFHHE+MGIPWEIAKLGV+ GMWG V+KIDPGLRAYQ  RA+ APLS SA MAQ
Sbjct  300  TACEVLLFHHENMGIPWEIAKLGVKLGMWGTVRKIDPGLRAYQTERASGAPLSHSASMAQ  359

Query  415  INTKVTTDDLRSLELRRT-MSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTK  239
            INTKVT D LRSLE      SE E   SS+KP   NIPKL+VVGGA+A+AC +DRGLLTK
Sbjct  360  INTKVTQDYLRSLESNSNDSSELETHNSSEKPGKNNIPKLVVVGGAIAVACILDRGLLTK  419

Query  238  ALIFGVARRFAGFGKRL  188
            A+IFGVARRFA  G+RL
Sbjct  420  AVIFGVARRFAKIGRRL  436



>ref|XP_007039336.1| Polyketide cyclase/dehydrase and lipid transport superfamily 
protein [Theobroma cacao]
 gb|EOY23837.1| Polyketide cyclase/dehydrase and lipid transport superfamily 
protein [Theobroma cacao]
Length=433

 Score =   290 bits (741),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 149/197 (76%), Positives = 167/197 (85%), Gaps = 3/197 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREY+IGRRIW+SG+ YYCVTKGVP   VPR++KPRRVDLYYSSWCIR   S++ DGQ+
Sbjct  237  SDREYVIGRRIWESGRFYYCVTKGVPYASVPRKNKPRRVDLYYSSWCIRAVESRKGDGQL  296

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQK RA+ APLS  A MAQ
Sbjct  297  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKERASGAPLSHCAFMAQ  356

Query  415  INTKVTTDDLRSLELRRTMSEAEAS-GSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTK  239
            IN KV+ D LRSLE   + S    +   S+KP GRNIPKLLV+GGA+ALACS+DRGLLTK
Sbjct  357  INAKVSADYLRSLESNSSDSSELETHNKSEKPLGRNIPKLLVIGGAIALACSLDRGLLTK  416

Query  238  ALIFGVARRFAGFGKRL  188
            A+IFGVARRFA  G+RL
Sbjct  417  AVIFGVARRFAKIGRRL  433



>ref|XP_004146518.1| PREDICTED: uncharacterized protein LOC101209389 [Cucumis sativus]
 gb|KGN53329.1| Phosphatidylcholine transfer protein [Cucumis sativus]
Length=432

 Score =   289 bits (739),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 141/199 (71%), Positives = 167/199 (84%), Gaps = 5/199 (3%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW++G++YYCVTK VP + VPR++KPRRVDLYYSSWCIR   SK+ DGQ+
Sbjct  234  SDREYIIGRRIWEAGRSYYCVTKSVPCSSVPRRNKPRRVDLYYSSWCIRAVESKKGDGQL  293

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEV+LFH+EDMGIPWEIAKLGVRQGMWG VKKIDPGLRAYQK RA+ + +   A MAQ
Sbjct  294  TACEVILFHYEDMGIPWEIAKLGVRQGMWGTVKKIDPGLRAYQKERASSSDIPHCAFMAQ  353

Query  415  INTKVTTDDLRSLE---LRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLL  245
            INTKV  D LRSLE      ++ +  +S SS+KP G+NIPKLLVVGGA+ALAC+IDRGLL
Sbjct  354  INTKVNVDYLRSLENSSHNDSLEDQSSSKSSEKPVGKNIPKLLVVGGAIALACTIDRGLL  413

Query  244  TKALIFGVARRFAGFGKRL  188
            TKA+IFG+ R+FA  G+RL
Sbjct  414  TKAVIFGIGRQFAKIGRRL  432



>ref|XP_008437458.1| PREDICTED: uncharacterized protein LOC103482874 [Cucumis melo]
Length=427

 Score =   288 bits (738),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 141/197 (72%), Positives = 163/197 (83%), Gaps = 4/197 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREY+IGRRIW+SGQ+YYCVTKGVP + +PRQ+KP+RVDLYYSSWCIR   S++ +GQM
Sbjct  231  SDREYVIGRRIWESGQSYYCVTKGVPCSSIPRQNKPKRVDLYYSSWCIRAVESRKGNGQM  290

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDP LRAYQKHRATEAPLS SA MA 
Sbjct  291  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPALRAYQKHRATEAPLSNSALMAN  350

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSS--DKPTGRNIPKLLVVGGAVALACSIDRGLLT  242
            INTK++ D LR  E     S    +     +KP  +N+ KLL+VGGA+ALACS+D GLLT
Sbjct  351  INTKISIDYLRCSEDASDDSSDNKTLEEPLEKPARKNLSKLLIVGGAIALACSLDHGLLT  410

Query  241  KALIFGVARRFAGFGKR  191
            KA++FGVARRF+  GKR
Sbjct  411  KAVVFGVARRFSNIGKR  427



>gb|ACU18380.1| unknown [Glycine max]
Length=210

 Score =   281 bits (718),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/195 (70%), Positives = 160/195 (82%), Gaps = 2/195 (1%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKRDGQMT  593
            SDREYIIGRRIW +G+ YYCVTKGVP   +PR +KP+RVDL+YSSWCIR   S++D Q+T
Sbjct  14   SDREYIIGRRIWDAGRIYYCVTKGVPCPSMPRHNKPKRVDLFYSSWCIRAVKSRKDDQLT  73

Query  592  ACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQI  413
            +CEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKK DPGLR Y+K R +  PLS  A  A+I
Sbjct  74   SCEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKFDPGLRTYEKQRVSGTPLSPCARAAKI  133

Query  412  NTKVTTDDLRSLELRRT-MSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            NTKVT D +RSLE   + + E E   SSDKP GRNIPKLL+VGGA+ALAC++D+GLLTKA
Sbjct  134  NTKVTMDYVRSLENTTSDLLETENQDSSDKPGGRNIPKLLIVGGAIALACTLDQGLLTKA  193

Query  235  LIFGVARRFAGFGKR  191
            +IFGVAR+FA  G R
Sbjct  194  VIFGVARKFAKMGGR  208



>gb|KJB37444.1| hypothetical protein B456_006G204800 [Gossypium raimondii]
 gb|KJB37445.1| hypothetical protein B456_006G204800 [Gossypium raimondii]
Length=436

 Score =   288 bits (738),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 143/197 (73%), Positives = 162/197 (82%), Gaps = 3/197 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREY+IGRRIW  G+TYYCVTKGVP   +PR++KPRRVDLYYSSWCIR   S++ DGQ+
Sbjct  240  SDREYLIGRRIWSCGRTYYCVTKGVPYPSIPRKTKPRRVDLYYSSWCIRAAESRKGDGQL  299

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEVLLFHHE+MGIPWEIAKLGV+ GMWG V+KIDPGLRAYQ  RA+ APLS SA MAQ
Sbjct  300  TACEVLLFHHENMGIPWEIAKLGVKLGMWGTVRKIDPGLRAYQTERASGAPLSHSASMAQ  359

Query  415  INTKVTTDDLRSLELRRT-MSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTK  239
            INTKVT D L SLE      SE E   SS+KP   NIPKL+VVGGA+A+AC +DRGLLTK
Sbjct  360  INTKVTQDYLTSLESNSNDSSELETHNSSEKPGKNNIPKLVVVGGAIAVACILDRGLLTK  419

Query  238  ALIFGVARRFAGFGKRL  188
            A+IFGVARRFA  G+RL
Sbjct  420  AVIFGVARRFAKIGRRL  436



>ref|XP_010053047.1| PREDICTED: uncharacterized protein LOC104441594 [Eucalyptus grandis]
 gb|KCW77297.1| hypothetical protein EUGRSUZ_D01658 [Eucalyptus grandis]
Length=432

 Score =   288 bits (738),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 142/196 (72%), Positives = 166/196 (85%), Gaps = 2/196 (1%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPNDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQMT  593
            SDREYIIGRRIW+SG+ YYCVTKGVPN VPR++KPRRVDLYYSSWCIR   SK+ DGQ++
Sbjct  237  SDREYIIGRRIWESGRQYYCVTKGVPNSVPRRNKPRRVDLYYSSWCIRAVESKKGDGQLS  296

Query  592  ACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQI  413
            ACEVLLFH+EDMGIPWEIAKLGVRQGMWGAVKKI+PGLRAYQK R++ + LSR A MAQI
Sbjct  297  ACEVLLFHYEDMGIPWEIAKLGVRQGMWGAVKKIEPGLRAYQKQRSSGSQLSRCAFMAQI  356

Query  412  NTKVTTDDLRSLE-LRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            NTK++ D L+SLE      SE E   SS++   +NIPK LV+GGA+ LACS+DRGLLTKA
Sbjct  357  NTKISMDYLQSLEGTVSNSSEIERCDSSEQHPRKNIPKALVIGGAIVLACSLDRGLLTKA  416

Query  235  LIFGVARRFAGFGKRL  188
            +IFGVARRFA  G++L
Sbjct  417  VIFGVARRFAKMGRKL  432



>gb|KCW77296.1| hypothetical protein EUGRSUZ_D01658 [Eucalyptus grandis]
Length=433

 Score =   288 bits (737),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 142/197 (72%), Positives = 166/197 (84%), Gaps = 3/197 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPNDVPRQSKPRRVDLYYSSWCIRPG--ASKRDGQM  596
            SDREYIIGRRIW+SG+ YYCVTKGVPN VPR++KPRRVDLYYSSWCIR G  + K DGQ+
Sbjct  237  SDREYIIGRRIWESGRQYYCVTKGVPNSVPRRNKPRRVDLYYSSWCIRAGIESKKGDGQL  296

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEVLLFH+EDMGIPWEIAKLGVRQGMWGAVKKI+PGLRAYQK R++ + LSR A MAQ
Sbjct  297  SACEVLLFHYEDMGIPWEIAKLGVRQGMWGAVKKIEPGLRAYQKQRSSGSQLSRCAFMAQ  356

Query  415  INTKVTTDDLRSLE-LRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTK  239
            INTK++ D L+SLE      SE E   SS++   +NIPK LV+GGA+ LACS+DRGLLTK
Sbjct  357  INTKISMDYLQSLEGTVSNSSEIERCDSSEQHPRKNIPKALVIGGAIVLACSLDRGLLTK  416

Query  238  ALIFGVARRFAGFGKRL  188
            A+IFGVARRFA  G++L
Sbjct  417  AVIFGVARRFAKMGRKL  433



>ref|XP_004145876.1| PREDICTED: uncharacterized protein LOC101209462 [Cucumis sativus]
Length=427

 Score =   288 bits (737),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 139/197 (71%), Positives = 163/197 (83%), Gaps = 4/197 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREY+IGRRIW+SGQ+YYCVTKG+P + +PRQ+KP+RVDLYYSSWCIR   S++ + Q+
Sbjct  231  SDREYVIGRRIWESGQSYYCVTKGIPCSSIPRQNKPKRVDLYYSSWCIRAVESRKGNSQL  290

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDP LR+YQKHRATEAPLS  A MA 
Sbjct  291  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPALRSYQKHRATEAPLSNCALMAN  350

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSS--DKPTGRNIPKLLVVGGAVALACSIDRGLLT  242
            INTKV+ D LR  E     S    +     +KP G+N+PKLL+VGGA+ALACS+D GLLT
Sbjct  351  INTKVSIDYLRCSEDASDDSSDNKALEEPLEKPAGKNLPKLLIVGGAIALACSLDHGLLT  410

Query  241  KALIFGVARRFAGFGKR  191
            KA++FGVARRF+  GKR
Sbjct  411  KAVVFGVARRFSNIGKR  427



>ref|XP_006840600.1| PREDICTED: uncharacterized protein LOC18430430 [Amborella trichopoda]
 gb|ERN02275.1| hypothetical protein AMTR_s00084p00028620 [Amborella trichopoda]
Length=410

 Score =   285 bits (729),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 142/195 (73%), Positives = 160/195 (82%), Gaps = 3/195 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKRDGQMT  593
            SDREY+IGRRIW+SG++YYCVTKGVP   +PR++KPRRVDLYYSSWCIR   SKRDGQ+T
Sbjct  218  SDREYMIGRRIWESGRSYYCVTKGVPYASLPRRNKPRRVDLYYSSWCIRAVESKRDGQLT  277

Query  592  ACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQI  413
            ACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKI+PGLRAYQ  R + A LS  A MAQI
Sbjct  278  ACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIEPGLRAYQAARKSGAQLSHCAFMAQI  337

Query  412  NTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKAL  233
              K+    L SLE      + +   S +KP GRNIPKLL+VGGAVALACS+DRGLLTKA+
Sbjct  338  INKIDATYLASLESESL--DTDIQSSEEKPWGRNIPKLLIVGGAVALACSLDRGLLTKAV  395

Query  232  IFGVARRFAGFGKRL  188
            IFGVARRF  FG+RL
Sbjct  396  IFGVARRFGKFGRRL  410



>ref|XP_010430621.1| PREDICTED: phosphatidylcholine transfer protein [Camelina sativa]
Length=236

 Score =   279 bits (713),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 140/196 (71%), Positives = 164/196 (84%), Gaps = 8/196 (4%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW +G+ +YC+TKGV    VPRQ+KPRRVDLYYSSWCIR   SKR DG+M
Sbjct  47   SDREYIIGRRIWDAGRVFYCITKGVQYPSVPRQNKPRRVDLYYSSWCIRAVESKRGDGEM  106

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            T+CEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKI+PGLRAYQ+ +A  A LS SA MAQ
Sbjct  107  TSCEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIEPGLRAYQRAKAAGAGLSPSASMAQ  166

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            INTKV+ ++     +    S AE +G  +KPTG+NIPK+LVVGGA+ALAC++D+GLLTKA
Sbjct  167  INTKVSAEEF----MNERDSIAEVTG--EKPTGKNIPKILVVGGAIALACTLDKGLLTKA  220

Query  235  LIFGVARRFAGFGKRL  188
            +IFGVARRFA  GKR+
Sbjct  221  VIFGVARRFARMGKRM  236



>ref|XP_010056033.1| PREDICTED: uncharacterized protein LOC104444124 [Eucalyptus grandis]
 gb|KCW72612.1| hypothetical protein EUGRSUZ_E01072 [Eucalyptus grandis]
Length=382

 Score =   283 bits (725),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 144/197 (73%), Positives = 163/197 (83%), Gaps = 7/197 (4%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW+SG++YYCVTKGVP + VPRQ+KPRRVDLYYSSWCIR   S+R DGQ+
Sbjct  189  SDREYIIGRRIWESGRSYYCVTKGVPCSSVPRQNKPRRVDLYYSSWCIRAVESRRGDGQL  248

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLR YQK RA EAP SR A +AQ
Sbjct  249  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRKYQKERALEAPRSRCAFLAQ  308

Query  415  INTKVTTDDLRSLEL--RRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLT  242
            INTKV+ D L+SLE   +   SE EA     KP    +P+LL+VGGA+ALACS+DRGL T
Sbjct  309  INTKVSPDYLKSLESSGKEDPSETEAHDEPRKPL---VPRLLLVGGAIALACSLDRGLFT  365

Query  241  KALIFGVARRFAGFGKR  191
            KA++FGVARRF   G+R
Sbjct  366  KAVVFGVARRFGNAGRR  382



>ref|XP_009397003.1| PREDICTED: uncharacterized protein LOC103981952 [Musa acuminata 
subsp. malaccensis]
Length=409

 Score =   284 bits (726),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 140/195 (72%), Positives = 154/195 (79%), Gaps = 1/195 (1%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKRDGQMT  593
            SDREYIIGRRIW+S ++YYCVTKGVP + VPR +KPRRVDLYYSSWCIRP ASKRDGQMT
Sbjct  215  SDREYIIGRRIWQSDRSYYCVTKGVPCSSVPRHNKPRRVDLYYSSWCIRPVASKRDGQMT  274

Query  592  ACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQI  413
            ACEVLLFHHEDMGIPWEIAKLGVRQGMWG VKK++PG RAYQ  R +  P+SRS+ MAQI
Sbjct  275  ACEVLLFHHEDMGIPWEIAKLGVRQGMWGCVKKVEPGFRAYQIARTSNEPVSRSSSMAQI  334

Query  412  NTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKAL  233
             TK   D LRS E     S         K    NIPK LVVGGAVALAC++D GL+TKA+
Sbjct  335  TTKFDADHLRSFEDNPVSSSDVVEVEKQKHWACNIPKFLVVGGAVALACTLDHGLVTKAV  394

Query  232  IFGVARRFAGFGKRL  188
            IFGVARRFA  GKRL
Sbjct  395  IFGVARRFAKPGKRL  409



>ref|XP_006606420.1| PREDICTED: uncharacterized protein LOC100788121 [Glycine max]
 gb|KHN04990.1| StAR-related lipid transfer protein 7, mitochondrial [Glycine 
soja]
Length=392

 Score =   283 bits (723),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 138/195 (71%), Positives = 160/195 (82%), Gaps = 2/195 (1%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKRDGQMT  593
            SDREYIIGRRIW +G+ YYCVTKGVP   +PR +KP+RVDL+YSSWCIR   S++D Q+T
Sbjct  196  SDREYIIGRRIWDAGRIYYCVTKGVPCPSMPRHNKPKRVDLFYSSWCIRAVKSRKDDQLT  255

Query  592  ACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQI  413
            +CEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKK DPGLR Y+K R +  PLS  A  A+I
Sbjct  256  SCEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKFDPGLRTYEKQRVSGTPLSPCARAAKI  315

Query  412  NTKVTTDDLRSLELRRT-MSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            NTKVT D +RSLE   + + E E   SSDKP GRNIPKLL+VGGA+ALAC++D+GLLTKA
Sbjct  316  NTKVTMDYVRSLENTTSDLLETENQDSSDKPGGRNIPKLLIVGGAIALACTLDQGLLTKA  375

Query  235  LIFGVARRFAGFGKR  191
            +IFGVARRFA  G R
Sbjct  376  VIFGVARRFAKMGGR  390



>gb|KHN14765.1| StAR-related lipid transfer protein 7, mitochondrial [Glycine 
soja]
Length=379

 Score =   282 bits (722),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 142/199 (71%), Positives = 164/199 (82%), Gaps = 7/199 (4%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKRDGQMT  593
            SDREYIIGRRIW +G+ YYCVTKGVP   +PR +KP+RVDL+YSSWCIR   S++D Q+T
Sbjct  183  SDREYIIGRRIWDAGRIYYCVTKGVPCPSMPRHNKPKRVDLFYSSWCIRAVKSRKDDQLT  242

Query  592  ACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQI  413
            +CEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKK DPGLR Y+K RA+   LS  A  A+I
Sbjct  243  SCEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKFDPGLRTYEKQRASGTALSPCARAAKI  302

Query  412  NTKVTTDDLRSLELRRTMS---EAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLT  242
            NTKVT D++RSLE   T+S   E E   SSDKP GRNIPKLL+VGGA+ALAC++D+GLLT
Sbjct  303  NTKVTMDNVRSLE--NTISDLLETENQDSSDKPGGRNIPKLLIVGGAIALACTLDQGLLT  360

Query  241  KALIFGVARRFAGF-GKRL  188
            KA+IFGVARRFA   GKRL
Sbjct  361  KAVIFGVARRFAKMGGKRL  379



>ref|XP_002317804.2| hypothetical protein POPTR_0012s02830g [Populus trichocarpa]
 gb|EEE96024.2| hypothetical protein POPTR_0012s02830g [Populus trichocarpa]
Length=402

 Score =   282 bits (722),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 140/195 (72%), Positives = 160/195 (82%), Gaps = 3/195 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW+SG++Y+CVTKGVP + VPR+ KPRRVDLYYSSWCIR   S+R DGQ+
Sbjct  199  SDREYIIGRRIWESGRSYFCVTKGVPCSSVPRRDKPRRVDLYYSSWCIRAVESRRGDGQL  258

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEVLLFHHEDMGIPWEIAKLGVRQGMWG VKKI+PGLRAYQK RA+ A LSR A MAQ
Sbjct  259  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGTVKKIEPGLRAYQKARASGAELSRPAFMAQ  318

Query  415  INTKVTTDDLRSLELRRTMSEAE-ASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTK  239
            +NTK+  + LRSL     +SE E A+ +S+K  GRNIPKLL+ GGA+ LACS DRGLLTK
Sbjct  319  VNTKINPELLRSLGGDENLSENEAATTTSEKSLGRNIPKLLIFGGAIILACSFDRGLLTK  378

Query  238  ALIFGVARRFAGFGK  194
            A IF V RRF   G+
Sbjct  379  AFIFNVGRRFGNMGR  393



>ref|XP_006589231.1| PREDICTED: uncharacterized protein LOC100810331 [Glycine max]
Length=398

 Score =   282 bits (722),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 142/199 (71%), Positives = 164/199 (82%), Gaps = 7/199 (4%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKRDGQMT  593
            SDREYIIGRRIW +G+ YYCVTKGVP   +PR +KP+RVDL+YSSWCIR   S++D Q+T
Sbjct  202  SDREYIIGRRIWDAGRIYYCVTKGVPCPSMPRHNKPKRVDLFYSSWCIRAVKSRKDDQLT  261

Query  592  ACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQI  413
            +CEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKK DPGLR Y+K RA+   LS  A  A+I
Sbjct  262  SCEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKFDPGLRTYEKQRASGTALSPCARAAKI  321

Query  412  NTKVTTDDLRSLELRRTMS---EAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLT  242
            NTKVT D++RSLE   T+S   E E   SSDKP GRNIPKLL+VGGA+ALAC++D+GLLT
Sbjct  322  NTKVTMDNVRSLE--NTISDLLETENQDSSDKPGGRNIPKLLIVGGAIALACTLDQGLLT  379

Query  241  KALIFGVARRFAGF-GKRL  188
            KA+IFGVARRFA   GKRL
Sbjct  380  KAVIFGVARRFAKMGGKRL  398



>ref|XP_006302371.1| hypothetical protein CARUB_v10020442mg [Capsella rubella]
 gb|EOA35269.1| hypothetical protein CARUB_v10020442mg [Capsella rubella]
Length=388

 Score =   281 bits (719),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 141/196 (72%), Positives = 163/196 (83%), Gaps = 8/196 (4%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW +G+ YYC+TKGVP   VPRQ+KPRRVDLYYSSWCIR   SKR DG+ 
Sbjct  199  SDREYIIGRRIWDAGRVYYCITKGVPYPSVPRQNKPRRVDLYYSSWCIRAVESKRGDGET  258

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKI+PGLRAYQ+ +   A LS SA MAQ
Sbjct  259  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIEPGLRAYQRDKTAGAGLSPSASMAQ  318

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            INTKV+ ++     +    S AE +G  +KPTG+NIPK+LVVGGA+ALAC++D+GLLTKA
Sbjct  319  INTKVSAEEF----MNERDSIAEVTG--EKPTGKNIPKILVVGGAIALACTLDKGLLTKA  372

Query  235  LIFGVARRFAGFGKRL  188
            +IFGVARRFA  GKR+
Sbjct  373  VIFGVARRFARIGKRM  388



>ref|XP_006376667.1| hypothetical protein POPTR_0012s02830g [Populus trichocarpa]
 gb|ERP54464.1| hypothetical protein POPTR_0012s02830g [Populus trichocarpa]
Length=453

 Score =   283 bits (723),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 140/195 (72%), Positives = 160/195 (82%), Gaps = 3/195 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW+SG++Y+CVTKGVP + VPR+ KPRRVDLYYSSWCIR   S+R DGQ+
Sbjct  250  SDREYIIGRRIWESGRSYFCVTKGVPCSSVPRRDKPRRVDLYYSSWCIRAVESRRGDGQL  309

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEVLLFHHEDMGIPWEIAKLGVRQGMWG VKKI+PGLRAYQK RA+ A LSR A MAQ
Sbjct  310  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGTVKKIEPGLRAYQKARASGAELSRPAFMAQ  369

Query  415  INTKVTTDDLRSLELRRTMSEAE-ASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTK  239
            +NTK+  + LRSL     +SE E A+ +S+K  GRNIPKLL+ GGA+ LACS DRGLLTK
Sbjct  370  VNTKINPELLRSLGGDENLSENEAATTTSEKSLGRNIPKLLIFGGAIILACSFDRGLLTK  429

Query  238  ALIFGVARRFAGFGK  194
            A IF V RRF   G+
Sbjct  430  AFIFNVGRRFGNMGR  444



>ref|XP_009382005.1| PREDICTED: phosphatidylcholine transfer protein-like [Musa acuminata 
subsp. malaccensis]
Length=396

 Score =   280 bits (717),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 137/195 (70%), Positives = 158/195 (81%), Gaps = 2/195 (1%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKRDGQMT  593
            SDREYIIGRRIW+SG+TYYC+TKG+P  D+PR++KPRRVDLYYSSWCIRP  SKRDGQMT
Sbjct  203  SDREYIIGRRIWESGRTYYCITKGIPCLDIPRRNKPRRVDLYYSSWCIRPAESKRDGQMT  262

Query  592  ACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQI  413
            ACEVLLFHHEDMGIPWEIAKLGVRQGMWG VKKI+PGLRAYQ  R T  P SR   MAQI
Sbjct  263  ACEVLLFHHEDMGIPWEIAKLGVRQGMWGCVKKIEPGLRAYQAARRTNKPPSRFVFMAQI  322

Query  412  NTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKAL  233
            N+K+  + LRS E+    S AE   +  +    +IPK+L+VGGAVA+A ++D GLLTKA+
Sbjct  323  NSKIDAEQLRSFEISSDAS-AEIVEAEKQNLACSIPKILLVGGAVAMAYTLDHGLLTKAV  381

Query  232  IFGVARRFAGFGKRL  188
            IFGV RRFA  GKRL
Sbjct  382  IFGVVRRFAKIGKRL  396



>gb|KDO52781.1| hypothetical protein CISIN_1g0167531mg, partial [Citrus sinensis]
Length=314

 Score =   278 bits (710),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 137/196 (70%), Positives = 159/196 (81%), Gaps = 2/196 (1%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIWK+G  YYCVTKGVP N VPR+ KPRRVDL YSSWCIRP  S+R +GQ+
Sbjct  119  SDREYIIGRRIWKAGTDYYCVTKGVPCNSVPRRDKPRRVDLCYSSWCIRPVESRRGNGQL  178

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEV+LFHHEDMGIP EIAKLG+RQGMWGAVKKI+PGLR YQK RA+ APLS+ A MAQ
Sbjct  179  TACEVILFHHEDMGIPREIAKLGIRQGMWGAVKKIEPGLRVYQKQRASGAPLSQPAFMAQ  238

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            INTKV    LR+LE    +S+ E   +SD+P  RNI KL+++GGA+ LACS++ GLL KA
Sbjct  239  INTKVDPSYLRALEGVEDLSKTEVVAASDRPLDRNISKLIILGGAIVLACSLNGGLLPKA  298

Query  235  LIFGVARRFAGFGKRL  188
             IFGVARRF   GK+L
Sbjct  299  FIFGVARRFGNMGKKL  314



>gb|KFK33976.1| hypothetical protein AALP_AA5G086000 [Arabis alpina]
Length=398

 Score =   280 bits (717),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 140/196 (71%), Positives = 165/196 (84%), Gaps = 7/196 (4%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREY+IGRRIW +G+ +YC+TKGV    +PRQSKPRRVDLYYSSWCIR   SKR DGQM
Sbjct  208  SDREYVIGRRIWDAGRVFYCITKGVQYPSLPRQSKPRRVDLYYSSWCIRAVESKRGDGQM  267

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            T+CEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKI+PGLRAYQ+ RA  A LS SA +AQ
Sbjct  268  TSCEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIEPGLRAYQRARAAGAGLSPSATLAQ  327

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            INTKV+ ++  +    R ++  E SG  +KPTG+NIPK+LVVGGA+ALAC++D+GLLTKA
Sbjct  328  INTKVSVEEFMN---ERDLTADEVSG--EKPTGKNIPKILVVGGAIALACTLDKGLLTKA  382

Query  235  LIFGVARRFAGFGKRL  188
            +IFGVARRFA  GKR+
Sbjct  383  VIFGVARRFARMGKRM  398



>ref|XP_002321959.2| hypothetical protein POPTR_0015s00730g [Populus trichocarpa]
 gb|EEF06086.2| hypothetical protein POPTR_0015s00730g [Populus trichocarpa]
Length=405

 Score =   280 bits (716),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 157/194 (81%), Gaps = 2/194 (1%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW+SG++YYCVTKGVP+  VPR+ KPRRVDLYYSSWCIR   S++ DGQ+
Sbjct  203  SDREYIIGRRIWESGRSYYCVTKGVPSSSVPRRDKPRRVDLYYSSWCIRAVESRKGDGQL  262

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            T+CEVLLFHHEDMGIPWEIAKLGVR GMWG VKKI+PGLRAYQ+ RA+   LSR A MAQ
Sbjct  263  TSCEVLLFHHEDMGIPWEIAKLGVRHGMWGTVKKIEPGLRAYQRTRASGVTLSRPAFMAQ  322

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            INTK+  + LRSL     +SE EA+ + +K  GRNIPKLL+VGGA+AL C  DRGLLTKA
Sbjct  323  INTKINPELLRSLGDDEDLSETEAATAPEKSLGRNIPKLLIVGGAIALLCGFDRGLLTKA  382

Query  235  LIFGVARRFAGFGK  194
             IF V RRF   GK
Sbjct  383  FIFSVGRRFGNMGK  396



>ref|NP_176653.1| membrane related protein CP5 [Arabidopsis thaliana]
 gb|AAD38248.1|AC006193_4 Putative membrane related protein [Arabidopsis thaliana]
 gb|AEE34278.1| membrane related protein CP5 [Arabidopsis thaliana]
Length=385

 Score =   279 bits (713),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 140/196 (71%), Positives = 163/196 (83%), Gaps = 8/196 (4%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW +G+ +YC+TKGV    VPRQ+KPRRVDLYYSSWCIR   SKR DG+M
Sbjct  196  SDREYIIGRRIWDAGRVFYCITKGVQYPSVPRQNKPRRVDLYYSSWCIRAVESKRGDGEM  255

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            T+CEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKI+PGLRAYQ+ +A  A LS SA MA 
Sbjct  256  TSCEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIEPGLRAYQRAKAAGAGLSPSAIMAH  315

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            INTKV+ ++     +    S AE +G  DKPTG+NIPK+LVVGGA+ALAC++D+GLLTKA
Sbjct  316  INTKVSAEEF----MNERGSIAEVTG--DKPTGKNIPKILVVGGAIALACTLDKGLLTKA  369

Query  235  LIFGVARRFAGFGKRL  188
            +IFGVARRFA  GKR+
Sbjct  370  VIFGVARRFARMGKRM  385



>gb|AFK33815.1| unknown [Lotus japonicus]
Length=356

 Score =   278 bits (711),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 133/194 (69%), Positives = 162/194 (84%), Gaps = 2/194 (1%)
 Frame = -2

Query  766  DREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQMT  593
            DREYIIGRRIW+ G++YYCVTKG+    +P++ KPRRVD+YYSSWCIR   S R +GQ+T
Sbjct  163  DREYIIGRRIWECGRSYYCVTKGIDCPSMPKRDKPRRVDVYYSSWCIRAVESNRGNGQLT  222

Query  592  ACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQI  413
            ACEVLLFHHE+MGIPWEIAKLGVR+GMWG V+KI+PGLRAYQ+ RA  APLSR+A MAQ+
Sbjct  223  ACEVLLFHHEEMGIPWEIAKLGVRKGMWGMVQKIEPGLRAYQEARAAGAPLSRAAFMAQV  282

Query  412  NTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKAL  233
            NTK++ D L+S+      SE E + ++DKP G NIPK+LV+GGAVALACS+DRGL+TK +
Sbjct  283  NTKISPDYLQSIGTTENSSETENAVATDKPQGVNIPKMLVIGGAVALACSLDRGLVTKYV  342

Query  232  IFGVARRFAGFGKR  191
            IFGVARRFA  GKR
Sbjct  343  IFGVARRFANLGKR  356



>ref|XP_010920227.1| PREDICTED: uncharacterized protein LOC105044130 [Elaeis guineensis]
Length=419

 Score =   279 bits (714),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 140/196 (71%), Positives = 156/196 (80%), Gaps = 2/196 (1%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW+SG+TYYCVTKGVP   VPR+ KPRRVDLYYSSWCIR   S R DGQ+
Sbjct  224  SDREYIIGRRIWESGRTYYCVTKGVPFPSVPRRKKPRRVDLYYSSWCIRAVESSRGDGQL  283

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEVLLFHHEDMGIPWEIAKLGVRQGMWG VK+I+PGLRAYQ  R ++ PLSR A MAQ
Sbjct  284  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGCVKRIEPGLRAYQIARRSQEPLSRCAFMAQ  343

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            INTK  +DDLR+ E+    +         K    NIPK LV+GGAVALACS+D GLLTKA
Sbjct  344  INTKFDSDDLRTSEVSTCSTSEVVEAEKQKNWTENIPKFLVIGGAVALACSLDHGLLTKA  403

Query  235  LIFGVARRFAGFGKRL  188
            +IFGVARRFA  G+RL
Sbjct  404  VIFGVARRFARPGRRL  419



>gb|AAM91533.1| membrane related protein CP5, putative [Arabidopsis thaliana]
 gb|AAN15331.1| membrane related protein CP5, putative [Arabidopsis thaliana]
Length=385

 Score =   278 bits (711),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 138/196 (70%), Positives = 164/196 (84%), Gaps = 8/196 (4%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW +G+ +YC+TKGV    VPRQ+KPRRVDLYYSSWCIR   SKR DG+M
Sbjct  196  SDREYIIGRRIWDAGRVFYCITKGVQYPSVPRQNKPRRVDLYYSSWCIRAVESKRGDGEM  255

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            T+CEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKI+PGLRAYQ+ +A  A LS SA MA 
Sbjct  256  TSCEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIEPGLRAYQRAKAAGAGLSPSAIMAH  315

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            INTKV+ ++   +  R +++E     + DKPTG+NIPK+LVVGGA+ALAC++D+GLLTKA
Sbjct  316  INTKVSAEEF--MNERGSIAEV----TEDKPTGKNIPKILVVGGAIALACTLDKGLLTKA  369

Query  235  LIFGVARRFAGFGKRL  188
            +IFGVARRFA  GKR+
Sbjct  370  VIFGVARRFARMGKRM  385



>ref|XP_011003261.1| PREDICTED: uncharacterized protein LOC105110056 isoform X2 [Populus 
euphratica]
Length=429

 Score =   279 bits (713),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 136/195 (70%), Positives = 157/195 (81%), Gaps = 2/195 (1%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW+SG++YYCVTKGVP+  VPR+ KPRRVDLYYSSWCIR   S++ DGQ+
Sbjct  227  SDREYIIGRRIWESGRSYYCVTKGVPSSSVPRRDKPRRVDLYYSSWCIRAVESRKGDGQL  286

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEVLLFHHEDMGIPWEIAKLGVR GMWG VKK++PGL AYQ+ RA+   LSR A MAQ
Sbjct  287  TACEVLLFHHEDMGIPWEIAKLGVRHGMWGTVKKVEPGLHAYQRTRASGVTLSRPAFMAQ  346

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            INTK+  + LRSL     +SE EA+ + +K  GRNIPKLL+VGGA+ALAC  D+GLLTKA
Sbjct  347  INTKINPELLRSLGDDEGLSETEAATAPEKSLGRNIPKLLIVGGAIALACGFDKGLLTKA  406

Query  235  LIFGVARRFAGFGKR  191
             IF V RRF   GK 
Sbjct  407  FIFSVGRRFGNMGKN  421



>ref|XP_011003260.1| PREDICTED: uncharacterized protein LOC105110056 isoform X1 [Populus 
euphratica]
Length=430

 Score =   279 bits (713),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 136/195 (70%), Positives = 157/195 (81%), Gaps = 2/195 (1%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW+SG++YYCVTKGVP+  VPR+ KPRRVDLYYSSWCIR   S++ DGQ+
Sbjct  228  SDREYIIGRRIWESGRSYYCVTKGVPSSSVPRRDKPRRVDLYYSSWCIRAVESRKGDGQL  287

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEVLLFHHEDMGIPWEIAKLGVR GMWG VKK++PGL AYQ+ RA+   LSR A MAQ
Sbjct  288  TACEVLLFHHEDMGIPWEIAKLGVRHGMWGTVKKVEPGLHAYQRTRASGVTLSRPAFMAQ  347

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            INTK+  + LRSL     +SE EA+ + +K  GRNIPKLL+VGGA+ALAC  D+GLLTKA
Sbjct  348  INTKINPELLRSLGDDEGLSETEAATAPEKSLGRNIPKLLIVGGAIALACGFDKGLLTKA  407

Query  235  LIFGVARRFAGFGKR  191
             IF V RRF   GK 
Sbjct  408  FIFSVGRRFGNMGKN  422



>ref|XP_002886329.1| hypothetical protein ARALYDRAFT_892929 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62588.1| hypothetical protein ARALYDRAFT_892929 [Arabidopsis lyrata subsp. 
lyrata]
Length=383

 Score =   277 bits (709),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 140/196 (71%), Positives = 163/196 (83%), Gaps = 8/196 (4%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW +G+ +YCVTKGV    VPRQ+KPRRVDLYYSSWCIR   SKR DG+M
Sbjct  194  SDREYIIGRRIWDAGRVFYCVTKGVQYPSVPRQNKPRRVDLYYSSWCIRAVESKRGDGEM  253

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            T+CEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKI+PGLRAYQ+ +A  A LS SA MA 
Sbjct  254  TSCEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIEPGLRAYQRAKAAGAGLSPSAIMAH  313

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            INTKV+ ++     +    S AE +G  +KPTG+NIPK+LVVGGA+ALAC++D+GLLTKA
Sbjct  314  INTKVSAEEF----MNERDSIAEITG--EKPTGKNIPKILVVGGAIALACTLDKGLLTKA  367

Query  235  LIFGVARRFAGFGKRL  188
            +IFGVARRFA  GKR+
Sbjct  368  VIFGVARRFARMGKRM  383



>ref|XP_010473737.1| PREDICTED: uncharacterized protein LOC104753141 [Camelina sativa]
Length=396

 Score =   278 bits (710),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 139/196 (71%), Positives = 163/196 (83%), Gaps = 8/196 (4%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW +G+ +YC+TKGV    VPRQ+KPRRVDLYYSSWCIR   SKR DG+M
Sbjct  207  SDREYIIGRRIWDAGRVFYCITKGVQYPSVPRQNKPRRVDLYYSSWCIRAVESKRGDGEM  266

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            T+CEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKI+PGLRAYQ+ +A  A LS SA MAQ
Sbjct  267  TSCEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIEPGLRAYQRAKAAGAGLSPSASMAQ  326

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            INTKV+ ++     +    S  E +G  +KPTG+NIPK+LVVGGA+ALAC++D+GLLTKA
Sbjct  327  INTKVSAEEF----MNERDSIVEVTG--EKPTGKNIPKILVVGGAIALACTLDKGLLTKA  380

Query  235  LIFGVARRFAGFGKRL  188
            +IFGVARRFA  GKR+
Sbjct  381  VIFGVARRFARMGKRM  396



>ref|XP_006441237.1| hypothetical protein CICLE_v10020581mg [Citrus clementina]
 gb|ESR54477.1| hypothetical protein CICLE_v10020581mg [Citrus clementina]
Length=383

 Score =   277 bits (709),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 136/196 (69%), Positives = 160/196 (82%), Gaps = 2/196 (1%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIWK+G  YYCVTKGVP N VPR+ KPRRVDL YSSWCIRP  S+R +GQ+
Sbjct  188  SDREYIIGRRIWKAGTDYYCVTKGVPCNSVPRRDKPRRVDLCYSSWCIRPVESRRGNGQL  247

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEV+LFHHEDMGIP EIAKLG+RQGMWGAVKKI+PGLR YQK RA+ APLS+ A MAQ
Sbjct  248  TACEVILFHHEDMGIPREIAKLGIRQGMWGAVKKIEPGLRVYQKQRASGAPLSQPAFMAQ  307

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            INTKV    LR+LE    +S+ E + +SD+P  RNI KL+++GGA+ LAC+++ GLL KA
Sbjct  308  INTKVDPSYLRALEGVEDLSKTEVAAASDRPLDRNISKLIILGGAIVLACTLNGGLLPKA  367

Query  235  LIFGVARRFAGFGKRL  188
             IFGVARRF   GK+L
Sbjct  368  FIFGVARRFGNMGKKL  383



>ref|XP_010496633.1| PREDICTED: uncharacterized protein LOC104773688 [Camelina sativa]
Length=398

 Score =   278 bits (710),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 139/196 (71%), Positives = 163/196 (83%), Gaps = 8/196 (4%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW +G+ +YC+TKGV    VPRQ+KPRRVDLYYSSWCIR   SKR DG+M
Sbjct  209  SDREYIIGRRIWDAGRVFYCITKGVQYPSVPRQNKPRRVDLYYSSWCIRAVESKRGDGEM  268

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            T+CEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKI+PGLRAYQ+ +A  A LS SA MAQ
Sbjct  269  TSCEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIEPGLRAYQRAKAAGAGLSPSASMAQ  328

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            INTKV+ ++     +    S  E +G  +KPTG+NIPK+LVVGGA+ALAC++D+GLLTKA
Sbjct  329  INTKVSAEEF----MNERDSIVEVTG--EKPTGKNIPKILVVGGAIALACTLDKGLLTKA  382

Query  235  LIFGVARRFAGFGKRL  188
            +IFGVARRFA  GKR+
Sbjct  383  VIFGVARRFARMGKRM  398



>ref|XP_009413766.1| PREDICTED: uncharacterized protein LOC103995005 [Musa acuminata 
subsp. malaccensis]
Length=390

 Score =   277 bits (709),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 136/195 (70%), Positives = 153/195 (78%), Gaps = 1/195 (1%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSSWCIRPGASKRDGQMT  593
            S+REYIIGRRIW+SG+TYYC+TKGVP   VPR++KPRRVDLYYSSWCIR   S+RDG+MT
Sbjct  196  SNREYIIGRRIWESGRTYYCITKGVPRPAVPRRNKPRRVDLYYSSWCIRAAESRRDGRMT  255

Query  592  ACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQI  413
            ACEVLLFHHEDMGIPWEIAKLGVRQGMW  V+KI+PGL AYQ  R +  PLSR A MAQI
Sbjct  256  ACEVLLFHHEDMGIPWEIAKLGVRQGMWSCVRKIEPGLCAYQLARRSNEPLSRFAFMAQI  315

Query  412  NTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKAL  233
            NTK   D LRS E    +S         K    +IPK LVVGGAVA+AC++D GLLTKA+
Sbjct  316  NTKFDADKLRSFETITDLSGNVVEAEKQKNWTSSIPKFLVVGGAVAIACTLDHGLLTKAV  375

Query  232  IFGVARRFAGFGKRL  188
            IFGVARRFA  GKRL
Sbjct  376  IFGVARRFANIGKRL  390



>ref|XP_004495515.1| PREDICTED: uncharacterized protein LOC101494889 [Cicer arietinum]
Length=399

 Score =   277 bits (708),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 133/197 (68%), Positives = 159/197 (81%), Gaps = 3/197 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKRDGQMT  593
            SDREYIIGRRIW + + YYCVTKGVP + +PR SKP+RVDLYYSS+C+R   S+ DGQ+T
Sbjct  203  SDREYIIGRRIWDAERAYYCVTKGVPCSSMPRHSKPKRVDLYYSSYCVRAVKSRNDGQLT  262

Query  592  ACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQI  413
            +CEVLLFH+EDMGIPWEIAKLGVRQGMWGAVKK DPGLR Y+K R +  PLSR A  A+ 
Sbjct  263  SCEVLLFHYEDMGIPWEIAKLGVRQGMWGAVKKFDPGLRTYKKERDSGVPLSRCANAAKF  322

Query  412  NTKVTTDDLRSLE--LRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTK  239
            NTKVT D +RS+E      +       SSDKP GR+IPKLLVVGGA+ALAC++D+GL+TK
Sbjct  323  NTKVTADYVRSVEDSTSNLLETENQEDSSDKPIGRSIPKLLVVGGAIALACTLDQGLVTK  382

Query  238  ALIFGVARRFAGFGKRL  188
            A+IFG+ARRF  FG+RL
Sbjct  383  AVIFGIARRFGKFGRRL  399



>ref|XP_006493201.1| PREDICTED: uncharacterized protein LOC102612642 [Citrus sinensis]
Length=383

 Score =   276 bits (706),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 136/196 (69%), Positives = 159/196 (81%), Gaps = 2/196 (1%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIWK+G  YYCVTKGVP N VP++ KPRRVDL YSSWCIRP  S+R +GQ+
Sbjct  188  SDREYIIGRRIWKAGTDYYCVTKGVPCNSVPQRDKPRRVDLCYSSWCIRPVESRRGNGQL  247

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEV+LFHHEDMGIP EIAKLG+RQGMWGAVKKI+PGLR YQK RA+ APLS+ A MAQ
Sbjct  248  TACEVILFHHEDMGIPREIAKLGIRQGMWGAVKKIEPGLRVYQKQRASGAPLSQPAFMAQ  307

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            INTKV    LR+LE    +S+ E   +SD+P  RNI KL+++GGA+ LACS++ GLL KA
Sbjct  308  INTKVDPSYLRALEGVEDLSKTEVVAASDRPLDRNISKLIILGGAIVLACSLNGGLLPKA  367

Query  235  LIFGVARRFAGFGKRL  188
             IFGVARRF   GK+L
Sbjct  368  FIFGVARRFGNMGKKL  383



>ref|XP_009114221.1| PREDICTED: uncharacterized protein LOC103839466 [Brassica rapa]
Length=382

 Score =   276 bits (706),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 138/196 (70%), Positives = 160/196 (82%), Gaps = 6/196 (3%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW +G+ +YCVTKGV    VPRQSKPRRVDLYYSSWCIR   SKR DG+M
Sbjct  191  SDREYIIGRRIWDAGRVFYCVTKGVQYPAVPRQSKPRRVDLYYSSWCIRAVESKRGDGEM  250

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            T+CEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKI+PGLRAYQ+ +A  A LS SA MAQ
Sbjct  251  TSCEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIEPGLRAYQRAKAAGAGLSPSAIMAQ  310

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            INTKV+ ++     +    S  E +G     +G+NIPK+LVVGGA+ALAC++D+GLLTKA
Sbjct  311  INTKVSVEEF----MNERDSTGEVAGDEKPSSGKNIPKMLVVGGAIALACTLDKGLLTKA  366

Query  235  LIFGVARRFAGFGKRL  188
            +IFGVARRFA  GKR+
Sbjct  367  VIFGVARRFARMGKRM  382



>ref|XP_011014759.1| PREDICTED: uncharacterized protein LOC105118489 isoform X2 [Populus 
euphratica]
Length=453

 Score =   278 bits (711),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 139/196 (71%), Positives = 158/196 (81%), Gaps = 3/196 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW+SG++Y+CVTKGVP + VPR+ KP+RVDLYYSSWCIR   SKR DGQ+
Sbjct  250  SDREYIIGRRIWESGRSYFCVTKGVPCSSVPRRDKPKRVDLYYSSWCIRAVESKRGDGQL  309

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEVLLFHHEDMGIPWEIAKLGVRQGMWG VKKI+PGLRAYQK RA+ A LSR A MAQ
Sbjct  310  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGTVKKIEPGLRAYQKARASGAELSRPAFMAQ  369

Query  415  INTKVTTDDLRSLELRRTMSEAE-ASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTK  239
            INTK+    LRSL     +SE E A+ +S+K  G+NIPKLL+ GGA+ LACS DR LLTK
Sbjct  370  INTKINPVLLRSLGGDENLSENEAATTTSEKSLGQNIPKLLIFGGAIILACSFDRALLTK  429

Query  238  ALIFGVARRFAGFGKR  191
            A IF V RRF   G+ 
Sbjct  430  AFIFNVGRRFGNMGRN  445



>ref|XP_011014758.1| PREDICTED: uncharacterized protein LOC105118489 isoform X1 [Populus 
euphratica]
Length=454

 Score =   278 bits (711),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 139/196 (71%), Positives = 158/196 (81%), Gaps = 3/196 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW+SG++Y+CVTKGVP + VPR+ KP+RVDLYYSSWCIR   SKR DGQ+
Sbjct  251  SDREYIIGRRIWESGRSYFCVTKGVPCSSVPRRDKPKRVDLYYSSWCIRAVESKRGDGQL  310

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEVLLFHHEDMGIPWEIAKLGVRQGMWG VKKI+PGLRAYQK RA+ A LSR A MAQ
Sbjct  311  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGTVKKIEPGLRAYQKARASGAELSRPAFMAQ  370

Query  415  INTKVTTDDLRSLELRRTMSEAE-ASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTK  239
            INTK+    LRSL     +SE E A+ +S+K  G+NIPKLL+ GGA+ LACS DR LLTK
Sbjct  371  INTKINPVLLRSLGGDENLSENEAATTTSEKSLGQNIPKLLIFGGAIILACSFDRALLTK  430

Query  238  ALIFGVARRFAGFGKR  191
            A IF V RRF   G+ 
Sbjct  431  AFIFNVGRRFGNMGRN  446



>emb|CDY17454.1| BnaC09g20830D [Brassica napus]
Length=379

 Score =   275 bits (704),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 137/196 (70%), Positives = 160/196 (82%), Gaps = 6/196 (3%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW +G+ +YCVTKGV    VPRQSKPRRVDLYYSSWCIR   SKR +G+M
Sbjct  188  SDREYIIGRRIWDAGRVFYCVTKGVQYLSVPRQSKPRRVDLYYSSWCIRAVESKRGNGEM  247

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            T+CEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKI+PGLRAYQ+ +A  A LS SA MAQ
Sbjct  248  TSCEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIEPGLRAYQRAKAAGAGLSPSAIMAQ  307

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            INTKV+ ++     +    S  E +G     +G+NIPK+LVVGGA+ALAC++D+GLLTKA
Sbjct  308  INTKVSVEEF----MNERDSTGEVAGDEKPSSGKNIPKMLVVGGAIALACTLDKGLLTKA  363

Query  235  LIFGVARRFAGFGKRL  188
            +IFGVARRFA  GKR+
Sbjct  364  VIFGVARRFARMGKRM  379



>ref|XP_004502755.1| PREDICTED: uncharacterized protein LOC101512743 [Cicer arietinum]
Length=425

 Score =   277 bits (708),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 165/193 (85%), Gaps = 2/193 (1%)
 Frame = -2

Query  766  DREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKRD-GQMT  593
            DREYIIGRRIW+ G++YYC+TKG+   ++PR+ KPRRVD+YYSSWCIR   SKR+ GQ+T
Sbjct  233  DREYIIGRRIWECGRSYYCITKGLDCPEIPRKEKPRRVDVYYSSWCIRAVESKRNNGQLT  292

Query  592  ACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQI  413
            ACE+LLFHHE+MGIPWEIAKLGVR+GMWG V+KI+PGLRAYQ+ RA+ APLSRSA MA I
Sbjct  293  ACEILLFHHEEMGIPWEIAKLGVRKGMWGTVQKIEPGLRAYQEARASGAPLSRSAFMAGI  352

Query  412  NTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKAL  233
            NTKV+ + L+S+     +S+ E++ +SDKP G N+PK+LV+GGA+ALACS+DRGL+TK +
Sbjct  353  NTKVSPEYLQSIGSSNDLSQTESAITSDKPQGVNVPKMLVIGGAIALACSLDRGLVTKYV  412

Query  232  IFGVARRFAGFGK  194
            +FGVARRFA  GK
Sbjct  413  LFGVARRFANMGK  425



>ref|XP_011043689.1| PREDICTED: uncharacterized protein LOC105139073 isoform X2 [Populus 
euphratica]
Length=456

 Score =   277 bits (709),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 138/196 (70%), Positives = 158/196 (81%), Gaps = 3/196 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW+SG++Y+CVTKGVP + VPR+ KP+RVDLYYSSWCIR   SKR DGQ+
Sbjct  253  SDREYIIGRRIWESGRSYFCVTKGVPCSSVPRRDKPKRVDLYYSSWCIRAVESKRGDGQL  312

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEVLLFHHEDMGIPWEIAKLGVRQGMWG VKKI+PGLRAYQK RA+ A LSR A MAQ
Sbjct  313  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGTVKKIEPGLRAYQKARASGAELSRPAFMAQ  372

Query  415  INTKVTTDDLRSLELRRTMSEAE-ASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTK  239
            +NTK+    LRSL     +SE E A+ +S+K  G+NIPKLL+ GGA+ LACS DR LLTK
Sbjct  373  MNTKINPVLLRSLGGDENLSENEAATTTSEKSLGQNIPKLLIFGGAIILACSFDRALLTK  432

Query  238  ALIFGVARRFAGFGKR  191
            A IF V RRF   G+ 
Sbjct  433  AFIFNVGRRFGNMGRN  448



>ref|XP_011043688.1| PREDICTED: uncharacterized protein LOC105139073 isoform X1 [Populus 
euphratica]
Length=457

 Score =   277 bits (709),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 138/196 (70%), Positives = 158/196 (81%), Gaps = 3/196 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW+SG++Y+CVTKGVP + VPR+ KP+RVDLYYSSWCIR   SKR DGQ+
Sbjct  254  SDREYIIGRRIWESGRSYFCVTKGVPCSSVPRRDKPKRVDLYYSSWCIRAVESKRGDGQL  313

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEVLLFHHEDMGIPWEIAKLGVRQGMWG VKKI+PGLRAYQK RA+ A LSR A MAQ
Sbjct  314  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGTVKKIEPGLRAYQKARASGAELSRPAFMAQ  373

Query  415  INTKVTTDDLRSLELRRTMSEAE-ASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTK  239
            +NTK+    LRSL     +SE E A+ +S+K  G+NIPKLL+ GGA+ LACS DR LLTK
Sbjct  374  MNTKINPVLLRSLGGDENLSENEAATTTSEKSLGQNIPKLLIFGGAIILACSFDRALLTK  433

Query  238  ALIFGVARRFAGFGKR  191
            A IF V RRF   G+ 
Sbjct  434  AFIFNVGRRFGNMGRN  449



>ref|XP_008452046.1| PREDICTED: uncharacterized protein LOC103493171 [Cucumis melo]
Length=432

 Score =   275 bits (704),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 140/199 (70%), Positives = 165/199 (83%), Gaps = 5/199 (3%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREY+IGRRIW++G++YYCVTK VP + VPR++KPRRVDLYYSSWCIR   SK+ DGQ+
Sbjct  234  SDREYVIGRRIWEAGRSYYCVTKSVPCSSVPRRNKPRRVDLYYSSWCIRAVESKKGDGQL  293

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEV+LFH+EDMGIPWEIAKLGVRQGMWG VKKIDPGLRAYQK RA  + +   A MAQ
Sbjct  294  TACEVILFHYEDMGIPWEIAKLGVRQGMWGTVKKIDPGLRAYQKERALNSAIPHCAFMAQ  353

Query  415  INTKVTTDDLRSLE---LRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLL  245
            INTKV  D LRSLE      +  +  +S SS+KP G+NIPKLLVVGGA+ALAC+IDRGLL
Sbjct  354  INTKVNVDYLRSLENSSHNDSSEDQSSSKSSEKPVGKNIPKLLVVGGAIALACTIDRGLL  413

Query  244  TKALIFGVARRFAGFGKRL  188
            TKA+IFG+ R+FA  G+RL
Sbjct  414  TKAVIFGIGRQFAKIGRRL  432



>ref|XP_010666130.1| PREDICTED: uncharacterized protein LOC104883331 [Beta vulgaris 
subsp. vulgaris]
Length=439

 Score =   276 bits (705),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 139/196 (71%), Positives = 155/196 (79%), Gaps = 2/196 (1%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPNDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQMT  593
            SDREYI+GRRIW+S +TYYCVTKGVPN VPR+ KPRRVDLYYSSWCIRP  SKR  GQMT
Sbjct  244  SDREYIVGRRIWESERTYYCVTKGVPNSVPRKDKPRRVDLYYSSWCIRPVESKRGTGQMT  303

Query  592  ACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQI  413
            ACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQK RA+  PLS  A MA I
Sbjct  304  ACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKARASGGPLSAQASMAHI  363

Query  412  NTKVTTDDLRSLELRRTMSEAEASGSSDKPT-GRNIPKLLVVGGAVALACSIDRGLLTKA  236
             TKV  + L+SL      S +E +   +K   G  +PKLL+  GAVALACS+DRGLLTKA
Sbjct  364  TTKVNPNYLKSLLSGDDQSLSEVALPEEKQQGGLRVPKLLIFSGAVALACSLDRGLLTKA  423

Query  235  LIFGVARRFAGFGKRL  188
            +IFGVAR+    G +L
Sbjct  424  VIFGVARKLGRIGGKL  439



>gb|EYU19436.1| hypothetical protein MIMGU_mgv1a007177mg [Erythranthe guttata]
Length=416

 Score =   275 bits (702),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 138/200 (69%), Positives = 162/200 (81%), Gaps = 6/200 (3%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKRDGQMT  593
            SDREYIIGRRIW+SG+TYYCVTKGVP + VPR +KPRRVDLYYSSW IR   S+RDG ++
Sbjct  217  SDREYIIGRRIWESGKTYYCVTKGVPCSSVPRLNKPRRVDLYYSSWFIRAAESRRDGSLS  276

Query  592  ACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATE-APLSRSACMAQ  416
            ACEV+LFHHEDMGIP+EIAKLG+RQGMWGAVKKIDPGLRAYQ+HRA+  A LS SA MAQ
Sbjct  277  ACEVVLFHHEDMGIPYEIAKLGIRQGMWGAVKKIDPGLRAYQRHRASPIACLSPSAQMAQ  336

Query  415  INTKVTTDDLRSLELRR----TMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGL  248
            IN+KV  + L   E  +    ++   E     DKP G+ IPK++VVGGA+ALA ++DRGL
Sbjct  337  INSKVNIEILEEAEESQDKNTSIVSQEEETRDDKPAGKGIPKIMVVGGAIALAYTLDRGL  396

Query  247  LTKALIFGVARRFAGFGKRL  188
            LTKALIFGVARRFA  G+RL
Sbjct  397  LTKALIFGVARRFAKTGRRL  416



>gb|EYU35617.1| hypothetical protein MIMGU_mgv1a007464mg [Erythranthe guttata]
Length=406

 Score =   274 bits (701),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 144/206 (70%), Positives = 164/206 (80%), Gaps = 12/206 (6%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKRDGQMT  593
            SDREYIIGRRIW+S +TYYC+TKGVP + VPR++KPRRVDLYYSSW IR   SKRDG+MT
Sbjct  201  SDREYIIGRRIWESERTYYCITKGVPCSSVPRRNKPRRVDLYYSSWFIRAAESKRDGRMT  260

Query  592  ACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRA-TEAPLSRSACMAQ  416
            ACEV+LFHHEDMGIPWEIAKLG+RQGMWGAVKKIDPGLRAYQ  RA +E PLS SA MAQ
Sbjct  261  ACEVVLFHHEDMGIPWEIAKLGIRQGMWGAVKKIDPGLRAYQNQRALSEIPLSPSASMAQ  320

Query  415  INTKVTTDDLRSLELRRTM---------SEAEASGSSDK-PTGRNIPKLLVVGGAVALAC  266
            INTK     L+  E + +          S+ E   S DK P+GR+  K+LVVGGA+ALAC
Sbjct  321  INTKANLVSLQEEEKKESQETSSTAIGPSKGENVISPDKQPSGRSFQKILVVGGAIALAC  380

Query  265  SIDRGLLTKALIFGVARRFAGFGKRL  188
            S+DRGLLTKA+IFGVARRFA  GKRL
Sbjct  381  SLDRGLLTKAVIFGVARRFAKTGKRL  406



>ref|XP_007039199.1| Polyketide cyclase/dehydrase and lipid transport superfamily 
protein [Theobroma cacao]
 gb|EOY23700.1| Polyketide cyclase/dehydrase and lipid transport superfamily 
protein [Theobroma cacao]
Length=437

 Score =   275 bits (704),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 134/196 (68%), Positives = 155/196 (79%), Gaps = 2/196 (1%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW+   +YYCVTKGVP   +PRQ KPRRVDLYYSSW IR   S+R  GQ 
Sbjct  228  SDREYIIGRRIWELDGSYYCVTKGVPWPSIPRQKKPRRVDLYYSSWYIRAVESERGHGQR  287

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
             ACEVLLFHHEDMGIPWEI KLGVRQGMWG VKKI+PGLRAYQK RA+ APLSRSA MAQ
Sbjct  288  NACEVLLFHHEDMGIPWEIVKLGVRQGMWGTVKKIEPGLRAYQKERASVAPLSRSASMAQ  347

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            INTK+ T+ LRSLE    +S++E + +S+KP  +NI + L +GG + LACS+D GLL++A
Sbjct  348  INTKINTEYLRSLETNEDLSKSEIAATSEKPMAKNISRFLFLGGVIVLACSLDHGLLSRA  407

Query  235  LIFGVARRFAGFGKRL  188
             IFGV RR A  GKRL
Sbjct  408  FIFGVGRRLANRGKRL  423



>ref|XP_010934199.1| PREDICTED: uncharacterized protein LOC105054408 [Elaeis guineensis]
Length=419

 Score =   275 bits (702),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 136/196 (69%), Positives = 154/196 (79%), Gaps = 2/196 (1%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREY IGRRIW SG+TYYCVTKGVP + VPR  KPRRVDLYYSSWCIR   S+R DGQ+
Sbjct  224  SDREYTIGRRIWDSGRTYYCVTKGVPCHSVPRCKKPRRVDLYYSSWCIRAVESRRGDGQL  283

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEVLLFHHEDMGIPWEIAKLGVRQGMW  VK+I+PGLRAY+  R ++ PLSR A MAQ
Sbjct  284  TACEVLLFHHEDMGIPWEIAKLGVRQGMWSCVKRIEPGLRAYEITRRSDEPLSRCAVMAQ  343

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            IN+ +  DDLRSLE+  + S         K    NIPK LV+GGAV LAC++D GLLTKA
Sbjct  344  INSNLNADDLRSLEVGTSSSSEIVEAEKQKHWAGNIPKFLVIGGAVTLACTLDHGLLTKA  403

Query  235  LIFGVARRFAGFGKRL  188
            +IFGVARRFA  G+RL
Sbjct  404  IIFGVARRFAKQGRRL  419



>gb|KEH42916.1| mammalian STARD2 lipid-binding START domain protein [Medicago 
truncatula]
Length=395

 Score =   273 bits (699),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 135/197 (69%), Positives = 161/197 (82%), Gaps = 3/197 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKRDGQMT  593
            SDREYIIGRRIW + +TYYCVTKGVP + +PRQSKPRRVDLYYSS+ IR   S++DGQ+T
Sbjct  199  SDREYIIGRRIWDAERTYYCVTKGVPCSSIPRQSKPRRVDLYYSSFFIRAVKSRKDGQLT  258

Query  592  ACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQI  413
            +CEVL FH+EDMGIPWEIAKLGVRQGMWGAVKK DPGLR Y+K R +  PLS  A  A+I
Sbjct  259  SCEVLFFHYEDMGIPWEIAKLGVRQGMWGAVKKFDPGLRTYKKERDSGVPLSPCANNAKI  318

Query  412  NTKVTTDDLRSLELRRT-MSEAEASGS-SDKPTGRNIPKLLVVGGAVALACSIDRGLLTK  239
            NTKVT D +R LE   + + E E   S  DKP GR+IPKLLVVGGA+ALAC++D+GL+TK
Sbjct  319  NTKVTADYVRCLEDSTSNLLETENQDSFDDKPIGRSIPKLLVVGGAIALACTLDQGLVTK  378

Query  238  ALIFGVARRFAGFGKRL  188
            A++FG+ARRF  FG+RL
Sbjct  379  AVVFGIARRFGKFGRRL  395



>ref|XP_010099429.1| hypothetical protein L484_003253 [Morus notabilis]
 gb|EXB78391.1| hypothetical protein L484_003253 [Morus notabilis]
Length=389

 Score =   273 bits (699),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 133/196 (68%), Positives = 158/196 (81%), Gaps = 3/196 (2%)
 Frame = -2

Query  766  DREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQMT  593
            DREYIIGRRIW+SG++YYC+TKGVP   +PR  KPRRVDLYYSSWC+R   S   DGQ++
Sbjct  194  DREYIIGRRIWESGRSYYCITKGVPCPSIPRHDKPRRVDLYYSSWCVRAVESTSGDGQLS  253

Query  592  ACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQI  413
            ACEVLLFHHEDMGIPWEIAKLGVR+GMWG VKKI+PGLRAYQK RA+ APLSR A MA I
Sbjct  254  ACEVLLFHHEDMGIPWEIAKLGVRKGMWGTVKKIEPGLRAYQKERASGAPLSRPAFMASI  313

Query  412  NTKVTTDDLRSL-ELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            NTK+    +RSL ++     E +   +S+KP  RNIPK+L+V GA+ LAC++D+GLLTKA
Sbjct  314  NTKINPHYMRSLGDITDNSLETQVEKASEKPRRRNIPKVLIVSGAIILACTLDQGLLTKA  373

Query  235  LIFGVARRFAGFGKRL  188
            +IFGVARR A  GKRL
Sbjct  374  VIFGVARRLANVGKRL  389



>emb|CDY04099.1| BnaA09g18770D [Brassica napus]
Length=380

 Score =   273 bits (697),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 136/196 (69%), Positives = 159/196 (81%), Gaps = 6/196 (3%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW + + +YCVTKGV    VPRQSKPRRVDLYYSSWCIR   SKR +G+M
Sbjct  189  SDREYIIGRRIWDASRVFYCVTKGVQYPSVPRQSKPRRVDLYYSSWCIRAVESKRGNGEM  248

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            T+CEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKI+PGLRAYQ+ +A  A LS SA MAQ
Sbjct  249  TSCEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIEPGLRAYQRAKAAGAGLSPSAIMAQ  308

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            INTKV+ ++     +    S  E +G     +G+NIPK+LVVGGA+ALAC++D+GLLTKA
Sbjct  309  INTKVSVEEF----MNERDSTGEVAGDEKPSSGKNIPKMLVVGGAIALACTLDKGLLTKA  364

Query  235  LIFGVARRFAGFGKRL  188
            +IFGVARRFA  GKR+
Sbjct  365  VIFGVARRFARMGKRM  380



>ref|XP_008785106.1| PREDICTED: stAR-related lipid transfer protein 7, mitochondrial-like 
[Phoenix dactylifera]
Length=419

 Score =   273 bits (699),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 139/196 (71%), Positives = 156/196 (80%), Gaps = 2/196 (1%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREY IGRRIW  G+TYYCVTKGVP + VPR++KPRRVDLYYSSWCIR   S+R DGQ+
Sbjct  224  SDREYTIGRRIWDLGRTYYCVTKGVPCHSVPRRNKPRRVDLYYSSWCIRAVESRRGDGQL  283

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEVLLFHHEDMGIP EIAKLGVRQGMWG VK+I+PGLRAYQ  R ++ PLSRSA MAQ
Sbjct  284  TACEVLLFHHEDMGIPREIAKLGVRQGMWGCVKRIEPGLRAYQIARRSDEPLSRSAVMAQ  343

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            INTK+  DDLRS E+    S         K    NIPK LV+GGAVALAC++D GLLTKA
Sbjct  344  INTKLNADDLRSSEVGTCSSLEIVEAEKQKHWAGNIPKFLVIGGAVALACTLDHGLLTKA  403

Query  235  LIFGVARRFAGFGKRL  188
            +IFGVARRFA  G+RL
Sbjct  404  VIFGVARRFAKQGRRL  419



>ref|XP_007136439.1| hypothetical protein PHAVU_009G045400g [Phaseolus vulgaris]
 gb|ESW08433.1| hypothetical protein PHAVU_009G045400g [Phaseolus vulgaris]
Length=442

 Score =   272 bits (695),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 131/194 (68%), Positives = 158/194 (81%), Gaps = 2/194 (1%)
 Frame = -2

Query  766  DREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQMT  593
            DREYIIGRRIW+SG+ YYCVTKG+    +P++ KPRRVD+YYSSWCIR   SKR  GQ+T
Sbjct  249  DREYIIGRRIWESGRHYYCVTKGIDCPSIPKRDKPRRVDVYYSSWCIRAVESKRGTGQLT  308

Query  592  ACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQI  413
            ACEVLLFHHE+MGIPWEIAKLGVR+GMWG V+KI+PGLRAYQ+ R + A LS SA MAQ+
Sbjct  309  ACEVLLFHHEEMGIPWEIAKLGVRKGMWGTVQKIEPGLRAYQEARTSGAALSHSAFMAQV  368

Query  412  NTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKAL  233
            NTK++ +DL+++       E E+  S  KP G NIPK+LV+GGAVALACS+DRGL+TK L
Sbjct  369  NTKISPEDLQTVGANDNSEEEESVTSYQKPQGVNIPKMLVIGGAVALACSLDRGLVTKYL  428

Query  232  IFGVARRFAGFGKR  191
            +FGVARRFA  GKR
Sbjct  429  LFGVARRFANIGKR  442



>ref|XP_003523319.1| PREDICTED: uncharacterized protein LOC100785446 [Glycine max]
 gb|KHN19560.1| StAR-related lipid transfer protein 7, mitochondrial [Glycine 
soja]
Length=442

 Score =   271 bits (694),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 132/194 (68%), Positives = 161/194 (83%), Gaps = 2/194 (1%)
 Frame = -2

Query  766  DREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSSWCIRPGASKR-DGQMT  593
            DREYIIGRRIW+SG+ YYCVTKGV    +P++ KPRRVD+YYSSWCIR   S R +GQ+T
Sbjct  249  DREYIIGRRIWESGRHYYCVTKGVDCPLIPKKDKPRRVDVYYSSWCIRAVESNRGNGQLT  308

Query  592  ACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQI  413
            ACEVLLFHHE+MGIPWEIAKLGVR+GMWG V+KI+PGLRAYQ+ RA+ A LS SA MAQ+
Sbjct  309  ACEVLLFHHEEMGIPWEIAKLGVRKGMWGTVQKIEPGLRAYQEARASGAALSHSAFMAQV  368

Query  412  NTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKAL  233
            NTK++ + L+S+      +E E+  +S+KP G NIPK+LV+GGAVALACS+DRGL+TK L
Sbjct  369  NTKISPEYLQSIGGDDNSAENESLVASEKPQGMNIPKMLVIGGAVALACSLDRGLVTKYL  428

Query  232  IFGVARRFAGFGKR  191
            +FGVARRFA  GKR
Sbjct  429  LFGVARRFANIGKR  442



>ref|XP_003526760.1| PREDICTED: uncharacterized protein LOC100802806 [Glycine max]
Length=443

 Score =   271 bits (692),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 133/194 (69%), Positives = 159/194 (82%), Gaps = 2/194 (1%)
 Frame = -2

Query  766  DREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQMT  593
            DREYIIGRRIW+SG  YYCVTKGV    +PR+ KPRRVD+YYSSWCIR   S R +GQ+T
Sbjct  250  DREYIIGRRIWESGTHYYCVTKGVNCPSMPRKDKPRRVDVYYSSWCIRAVESNRGNGQLT  309

Query  592  ACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQI  413
            ACEVLLFHHE+MGIPWEIAKLGVR+GMWG V+KI+PGLRAYQ+ RA+ A LS SA MAQ+
Sbjct  310  ACEVLLFHHEEMGIPWEIAKLGVRKGMWGTVQKIEPGLRAYQEARASGAALSHSAFMAQV  369

Query  412  NTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKAL  233
            NTK+  + L+S+      +E E+  +S+KP G NIPK+LV+GGAVALACS+DRGL+TK L
Sbjct  370  NTKIGPEYLQSIGGDDNSAENESVVASEKPQGVNIPKMLVIGGAVALACSLDRGLVTKYL  429

Query  232  IFGVARRFAGFGKR  191
            +FGVARRFA  GKR
Sbjct  430  LFGVARRFANIGKR  443



>gb|AGV54490.1| StAR-related lipid transfer protein [Phaseolus vulgaris]
Length=425

 Score =   270 bits (690),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 131/194 (68%), Positives = 158/194 (81%), Gaps = 2/194 (1%)
 Frame = -2

Query  766  DREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQMT  593
            DREYIIGRRIW+SG+ YYCVTKG+    +P++ KPRRVD+YYSSWCIR   SKR  GQ+T
Sbjct  232  DREYIIGRRIWESGRHYYCVTKGIDCPSIPKRDKPRRVDVYYSSWCIRAVESKRGTGQLT  291

Query  592  ACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQI  413
            ACEVLLFHHE+MGIPWEIAKLGVR+GMWG V+KI+PGLRAYQ+ R + A LS SA MAQ+
Sbjct  292  ACEVLLFHHEEMGIPWEIAKLGVRKGMWGTVQKIEPGLRAYQEARTSGAALSHSAFMAQV  351

Query  412  NTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKAL  233
            NTK++ +DL+++       E E+  S  KP G NIPK+LV+GGAVALACS+DRGL+TK L
Sbjct  352  NTKISPEDLQTVGANDNSEEEESVTSYQKPQGVNIPKMLVIGGAVALACSLDRGLVTKYL  411

Query  232  IFGVARRFAGFGKR  191
            +FGVARRFA  GKR
Sbjct  412  LFGVARRFANIGKR  425



>ref|XP_008778542.1| PREDICTED: uncharacterized protein LOC103698325 [Phoenix dactylifera]
 ref|XP_008778543.1| PREDICTED: uncharacterized protein LOC103698325 [Phoenix dactylifera]
Length=415

 Score =   269 bits (688),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 135/196 (69%), Positives = 154/196 (79%), Gaps = 2/196 (1%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            S+REYIIGRRIW+SG+TYYCVTKGVP   VPR+ KPRRVDLYYSSWCIR   S+R DGQ+
Sbjct  220  SNREYIIGRRIWESGRTYYCVTKGVPCLSVPRRDKPRRVDLYYSSWCIRAVESRRGDGQL  279

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEVLLFHHEDMGIPWE+AKLGVRQGMWG VK+I+PG RAYQ  R++  P SR A MAQ
Sbjct  280  TACEVLLFHHEDMGIPWELAKLGVRQGMWGCVKRIEPGFRAYQIARSSHEPPSRCAFMAQ  339

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            INTK ++DDL + E     S         K    +IPK LV+GGAVALACS+D GLLTKA
Sbjct  340  INTKFSSDDLITSEAGTCSSSEVVEAEKHKNWAESIPKFLVIGGAVALACSLDHGLLTKA  399

Query  235  LIFGVARRFAGFGKRL  188
            +IFGVARRFA  G+RL
Sbjct  400  VIFGVARRFARPGRRL  415



>ref|XP_006391589.1| hypothetical protein EUTSA_v10023504mg [Eutrema salsugineum]
 gb|ESQ28875.1| hypothetical protein EUTSA_v10023504mg [Eutrema salsugineum]
Length=398

 Score =   268 bits (684),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 135/196 (69%), Positives = 162/196 (83%), Gaps = 8/196 (4%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW +G+ +YC+TKGV    VPRQ+KPRRVDLYYSSWCIR   SKR DG+M
Sbjct  209  SDREYIIGRRIWDAGRVFYCITKGVQYPSVPRQNKPRRVDLYYSSWCIRAVESKRGDGEM  268

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            T+CEVLLFHHEDMGIPWE+AKLGVRQGMWGAVKKI+PGLRAY + +A  A LS SA MA 
Sbjct  269  TSCEVLLFHHEDMGIPWELAKLGVRQGMWGAVKKIEPGLRAYLRAKAEGAGLSPSARMAH  328

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            INT+V+ +  + +  R +++E  A    +KPTG+ IPKLLVVGGA+ALAC++D+GLLTKA
Sbjct  329  INTQVSAE--KFMNERDSIAEVAA----EKPTGKAIPKLLVVGGAIALACTLDKGLLTKA  382

Query  235  LIFGVARRFAGFGKRL  188
            +IFGVARRFA  GKR+
Sbjct  383  VIFGVARRFARMGKRM  398



>gb|AAL57201.1|AF355597_1 putative nodule membrane protein [Medicago sativa]
Length=424

 Score =   267 bits (682),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 161/198 (81%), Gaps = 6/198 (3%)
 Frame = -2

Query  766  DREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKRD-GQMT  593
            DREYIIGRRIW+ G++YYCVTKGV    +PRQ KPRRVD+YYSSWCIR   SKRD GQ+T
Sbjct  227  DREYIIGRRIWECGRSYYCVTKGVDCPSIPRQEKPRRVDVYYSSWCIRAVESKRDNGQLT  286

Query  592  ACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQI  413
            ACEVLLFHHE+MGIPWEIAKLGVR+GMWG V+KI+PGLRAYQ+ +A+ APLSRSA MA +
Sbjct  287  ACEVLLFHHEEMGIPWEIAKLGVRKGMWGMVQKIEPGLRAYQEAKASGAPLSRSAFMACV  346

Query  412  NTKVTTDDLRSL--ELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTK  239
            NTK++ + L+S+      ++    A  S DKP G  +PK+LV+GGAVALACS+D+GL+TK
Sbjct  347  NTKISPEYLQSIGSSDDESLQTESAITSDDKPKGMTVPKMLVIGGAVALACSLDKGLVTK  406

Query  238  ALIFGVARR--FAGFGKR  191
            A+IFGVA+R  FA  GKR
Sbjct  407  AVIFGVAKRFGFANLGKR  424



>ref|XP_010553581.1| PREDICTED: uncharacterized protein LOC104823628 [Tarenaya hassleriana]
Length=430

 Score =   266 bits (681),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 135/199 (68%), Positives = 157/199 (79%), Gaps = 5/199 (3%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW +G+ +YC+TKGV    +PR+ KPRRVDLYYSSWCIR   S+R DGQM
Sbjct  232  SDREYIIGRRIWDAGRVFYCITKGVNYPSIPRRKKPRRVDLYYSSWCIRAAESRRGDGQM  291

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEV+LFHHEDMGIPWEIAKLGVRQGMWGAVKKI+PGLRAYQK RA E+    S  MA+
Sbjct  292  TACEVILFHHEDMGIPWEIAKLGVRQGMWGAVKKIEPGLRAYQKLRAAESGSHPSPEMAR  351

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGR---NIPKLLVVGGAVALACSIDRGLL  245
            INTKV  +DL          E EA  S  KP+G+   ++ K+LVVGGA+ALAC++D+GLL
Sbjct  352  INTKVNLEDLSKERESFQQEEVEARDSPRKPSGKSSSSVQKVLVVGGAIALACTLDKGLL  411

Query  244  TKALIFGVARRFAGFGKRL  188
            TKA+IFGVARRFA  GKRL
Sbjct  412  TKAVIFGVARRFAKMGKRL  430



>ref|XP_011084568.1| PREDICTED: uncharacterized protein LOC105166783 [Sesamum indicum]
Length=436

 Score =   266 bits (681),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 132/196 (67%), Positives = 158/196 (81%), Gaps = 3/196 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW+SG++YYCVTKGVP   VPR+ KPRRVDLYYSSW I+   S++ +GQ+
Sbjct  235  SDREYIIGRRIWESGRSYYCVTKGVPCLSVPRRDKPRRVDLYYSSWYIQAVESRKGNGQL  294

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEV+LFHHEDMGIPWEIAK GVRQGMWGAVK I+ G RAYQKHR + AP+SR A MAQ
Sbjct  295  SACEVILFHHEDMGIPWEIAKFGVRQGMWGAVKNIERGFRAYQKHRLSGAPISRHAFMAQ  354

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSD-KPTGRNIPKLLVVGGAVALACSIDRGLLTK  239
            +NTK+  D ++ LE     SE ++   +D KP   NIPKLL++GGAVA+ACS+DRGLLTK
Sbjct  355  VNTKLDPDYMKILEGEGDSSETQSQDLADEKPKRVNIPKLLIIGGAVAVACSLDRGLLTK  414

Query  238  ALIFGVARRFAGFGKR  191
             LIFGVARRF   G+R
Sbjct  415  TLIFGVARRFGNIGRR  430



>ref|XP_003602372.1| StAR-related lipid transfer protein [Medicago truncatula]
 gb|AES72623.1| membrane-related protein CP5, putative [Medicago truncatula]
Length=424

 Score =   266 bits (680),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 161/198 (81%), Gaps = 6/198 (3%)
 Frame = -2

Query  766  DREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKRD-GQMT  593
            DREYIIGRRIW+ G++YYC+TKGV    +PRQ KPRRVD+YYSSWCIR   SKRD GQ+T
Sbjct  227  DREYIIGRRIWECGRSYYCITKGVDCPSIPRQEKPRRVDVYYSSWCIRAVESKRDNGQLT  286

Query  592  ACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQI  413
            ACE+LLFHHE+MGIPWEIAKLGVR+GMWG V+KI+PGLRAYQ+ +A+ APLSRSA MA +
Sbjct  287  ACEILLFHHEEMGIPWEIAKLGVRKGMWGMVQKIEPGLRAYQEAKASGAPLSRSAFMAGV  346

Query  412  NTKVTTDDLRSL--ELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTK  239
            NTK++ + L+S+      ++    A  S DKP G  +PK+LV+GGAVALACS+D+GL+TK
Sbjct  347  NTKISPEYLQSIGSSDDESLQTESAITSDDKPKGMTVPKMLVIGGAVALACSLDKGLVTK  406

Query  238  ALIFGVARR--FAGFGKR  191
            A+IFGVA+R  FA  GKR
Sbjct  407  AVIFGVAKRFGFANMGKR  424



>gb|KHN23303.1| StAR-related lipid transfer protein 7, mitochondrial [Glycine 
soja]
Length=433

 Score =   266 bits (679),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 130/190 (68%), Positives = 157/190 (83%), Gaps = 2/190 (1%)
 Frame = -2

Query  766  DREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQMT  593
            DREYIIGRRIW+SG+ YYCVTKGV    +PR+ KPRRVD+YYSSWCIR   S R +GQ+T
Sbjct  226  DREYIIGRRIWESGRHYYCVTKGVNCPSMPRKDKPRRVDVYYSSWCIRAVESNRGNGQLT  285

Query  592  ACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQI  413
            ACEVLLFHHE+MGIPWEIAKLGVR+GMWG V+KI+PGLRAYQ+ RA+ A LS SA MAQ+
Sbjct  286  ACEVLLFHHEEMGIPWEIAKLGVRKGMWGTVQKIEPGLRAYQEARASGAALSHSAFMAQV  345

Query  412  NTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKAL  233
            NTK+  + L+S+      +E E+  +S+KP G NIPK+LV+GGAVALACS+DRGL+TK L
Sbjct  346  NTKIGPEYLQSIGGDDNSAENESVVASEKPQGVNIPKMLVIGGAVALACSLDRGLVTKYL  405

Query  232  IFGVARRFAG  203
            +FGVARRFA 
Sbjct  406  LFGVARRFAN  415



>ref|XP_006652076.1| PREDICTED: uncharacterized protein LOC102712157 [Oryza brachyantha]
Length=407

 Score =   263 bits (673),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 156/198 (79%), Gaps = 7/198 (4%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW SG+TYYCVTKGV    VPR +KPRRVDLYYSSWCIRP  S+  DG M
Sbjct  212  SDREYIIGRRIWASGKTYYCVTKGVHRPSVPRSNKPRRVDLYYSSWCIRPVESRNGDGSM  271

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEV LFHHEDMGIPWEIAKLG+RQGMWG VK+I+PGLRAYQ  R    PLS+ A MA 
Sbjct  272  TACEVFLFHHEDMGIPWEIAKLGIRQGMWGCVKRIEPGLRAYQIERTAGEPLSKYAAMAH  331

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKP---TGRNIPKLLVVGGAVALACSIDRGLL  245
            +NTKV  D+L + E  +T + +  +  ++KP   TG NIPK+L+VGGAVALAC+ D GLL
Sbjct  332  VNTKVDPDELIAAE-DKTEASSTNNVEAEKPKHWTG-NIPKVLLVGGAVALACTFDHGLL  389

Query  244  TKALIFGVARRFAGFGKR  191
            TKA+IFG ARRFAG G+R
Sbjct  390  TKAVIFGTARRFAGPGRR  407



>ref|XP_004952047.1| PREDICTED: uncharacterized protein LOC101765043 isoform X2 [Setaria 
italica]
Length=421

 Score =   263 bits (671),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 131/196 (67%), Positives = 157/196 (80%), Gaps = 4/196 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIWK G  YYCVTKG+P + +PR++KPRRVDLYYSSWCIR   SKR +G +
Sbjct  228  SDREYIIGRRIWKLGGAYYCVTKGIPCSSIPRRNKPRRVDLYYSSWCIRAVESKRGNGGL  287

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACE+LLFHHEDMGIP+EIAKLG+RQGMWG VKKI+PGLRAYQ+ RA   P S+SA MA+
Sbjct  288  TACEILLFHHEDMGIPYEIAKLGIRQGMWGCVKKIEPGLRAYQEARAAGEPASKSALMAR  347

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            INTKV  + +RSLE      E+E   + +KP   N+ + LV+GGAVALAC++D+GLLTKA
Sbjct  348  INTKVGDNFVRSLE--SNSQESEIVEAEEKPARNNVARFLVLGGAVALACTLDQGLLTKA  405

Query  235  LIFGVARRFAGFGKRL  188
            LIFGVAR+F G  K L
Sbjct  406  LIFGVARKFVGQRKTL  421



>gb|EMS48425.1| hypothetical protein TRIUR3_01630 [Triticum urartu]
Length=339

 Score =   260 bits (664),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/198 (65%), Positives = 149/198 (75%), Gaps = 6/198 (3%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREY+IGRRIW SG+TYYCVTK VP   VPR SKPRRVDLYYSSWCIRP  S+  DG M
Sbjct  143  SDREYVIGRRIWASGKTYYCVTKSVPRPSVPRSSKPRRVDLYYSSWCIRPVESRNGDGAM  202

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEVLLFHHEDMGIPW IAKLGV+QGMWG VK+I+PGLRAYQ  RA   P+S+ A MA 
Sbjct  203  TACEVLLFHHEDMGIPWSIAKLGVQQGMWGCVKRIEPGLRAYQTARAAGEPISKCAAMAH  262

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKP---TGRNIPKLLVVGGAVALACSIDRGLL  245
             NTK   D+L + E          +  ++KP   TG N+PK+ V+G  VALAC+ D+GLL
Sbjct  263  ANTKFVADELTASENNTEAGSTSNNAQAEKPKHWTG-NLPKVFVIGSVVALACTFDKGLL  321

Query  244  TKALIFGVARRFAGFGKR  191
            TKAL+FG ARRFAG G+R
Sbjct  322  TKALVFGTARRFAGPGRR  339



>ref|XP_003580301.1| PREDICTED: uncharacterized protein LOC100841092 [Brachypodium 
distachyon]
Length=407

 Score =   262 bits (669),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 132/197 (67%), Positives = 149/197 (76%), Gaps = 4/197 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW SG+TYYCVTKGVP   VPR SKPRRVDLYYSSWCIRP  S+  DG M
Sbjct  211  SDREYIIGRRIWASGKTYYCVTKGVPRPSVPRSSKPRRVDLYYSSWCIRPVESRNGDGAM  270

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEVLLFHHEDMGIPW IAKLGV+QGMWG VK+I+PGLRAY+  R T  PLS+ A MA 
Sbjct  271  TACEVLLFHHEDMGIPWGIAKLGVQQGMWGCVKRIEPGLRAYEIARTTGEPLSKYAAMAH  330

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGR--NIPKLLVVGGAVALACSIDRGLLT  242
             NTK   D+L S E             ++KP     NIPK+ ++GGAVALAC+ D+GLLT
Sbjct  331  ANTKFIADELISAEDNNDAGSTSNKALAEKPKHWTCNIPKVFLIGGAVALACTFDQGLLT  390

Query  241  KALIFGVARRFAGFGKR  191
            KA+IFG ARRFAG G+R
Sbjct  391  KAVIFGTARRFAGPGRR  407



>gb|EMT15608.1| hypothetical protein F775_30865 [Aegilops tauschii]
Length=410

 Score =   261 bits (668),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 129/198 (65%), Positives = 149/198 (75%), Gaps = 6/198 (3%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREY+IGRRIW SG+TYYCVTK VP   VPR SKPRRVDLYYSSWCIRP  S+  DG M
Sbjct  214  SDREYVIGRRIWASGKTYYCVTKSVPRPSVPRSSKPRRVDLYYSSWCIRPVESRNGDGAM  273

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEVLLFHHEDMGIPW IAKLGV+QGMWG VK+I+PGLRAYQ  RA   P+S+ A MA 
Sbjct  274  TACEVLLFHHEDMGIPWSIAKLGVQQGMWGCVKRIEPGLRAYQTARAAGVPISKCAAMAH  333

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKP---TGRNIPKLLVVGGAVALACSIDRGLL  245
             NTK   D+L + E          +  ++KP   TG N+PK+ V+G  VALAC+ D+GLL
Sbjct  334  ANTKFVADELTASENNTEAGSTSNNAQAEKPKHWTG-NLPKVFVIGSVVALACTFDKGLL  392

Query  244  TKALIFGVARRFAGFGKR  191
            TKAL+FG ARRFAG G+R
Sbjct  393  TKALVFGTARRFAGPGRR  410



>ref|NP_001052066.1| Os04g0119500 [Oryza sativa Japonica Group]
 emb|CAE01295.2| OSJNBa0020P07.12 [Oryza sativa Japonica Group]
 dbj|BAF13980.1| Os04g0119500 [Oryza sativa Japonica Group]
 gb|EAY92847.1| hypothetical protein OsI_14648 [Oryza sativa Indica Group]
 gb|EAZ29518.1| hypothetical protein OsJ_13592 [Oryza sativa Japonica Group]
 dbj|BAG88167.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89333.1| unnamed protein product [Oryza sativa Japonica Group]
Length=400

 Score =   260 bits (664),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 157/198 (79%), Gaps = 7/198 (4%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW SG+TYYCVTKGVP   VPR +KPRRVD+YYSSWCIRP  S+  DG M
Sbjct  205  SDREYIIGRRIWASGKTYYCVTKGVPRPSVPRCNKPRRVDVYYSSWCIRPVESRNGDGSM  264

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEVLLFHHE+MGIP EIAKLGVRQGMWG VK+I+PGLRAYQ  R    PLS+ A MA 
Sbjct  265  TACEVLLFHHEEMGIPREIAKLGVRQGMWGCVKRIEPGLRAYQIARTAGEPLSKCAAMAH  324

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKP---TGRNIPKLLVVGGAVALACSIDRGLL  245
            +NTKV  D+L + E  +T + +  +  ++KP   TG NIPK+++VGGAVALAC+ D GLL
Sbjct  325  VNTKVDPDELITAE-DKTEASSTNNAEAEKPKHWTG-NIPKVILVGGAVALACTFDHGLL  382

Query  244  TKALIFGVARRFAGFGKR  191
            TKALIFG ARRFAG G+R
Sbjct  383  TKALIFGTARRFAGPGRR  400



>emb|CAG27307.1| membrane related protein [Oryza sativa Japonica Group]
Length=400

 Score =   259 bits (663),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 157/198 (79%), Gaps = 7/198 (4%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW SG+TYYCVTKGVP   VPR +KPRRVD+YYSSWCIRP  S+  DG M
Sbjct  205  SDREYIIGRRIWASGKTYYCVTKGVPRPSVPRCNKPRRVDVYYSSWCIRPVESRNGDGSM  264

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEVLLFHHE+MGIP EIAKLGVRQGMWG VK+I+PGLRAYQ  R    PLS+ A MA 
Sbjct  265  TACEVLLFHHEEMGIPREIAKLGVRQGMWGCVKRIEPGLRAYQIARTAGEPLSKCAAMAH  324

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKP---TGRNIPKLLVVGGAVALACSIDRGLL  245
            +NTKV  D+L + E  +T + +  +  ++KP   TG NIPK+++VGGAVALAC+ D GLL
Sbjct  325  VNTKVDPDELITAE-DKTEASSTNNAEAEKPKHWTG-NIPKVILVGGAVALACTFDHGLL  382

Query  244  TKALIFGVARRFAGFGKR  191
            TKALIFG ARRFAG G+R
Sbjct  383  TKALIFGTARRFAGPGRR  400



>ref|XP_002453232.1| hypothetical protein SORBIDRAFT_04g002070 [Sorghum bicolor]
 gb|EES06208.1| hypothetical protein SORBIDRAFT_04g002070 [Sorghum bicolor]
Length=425

 Score =   260 bits (665),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 132/196 (67%), Positives = 156/196 (80%), Gaps = 4/196 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYII RRIWK G  YYCVTKG+P + VPR++KPRRVDLYYSSWCIR   SKR +G +
Sbjct  232  SDREYIIARRIWKLGGAYYCVTKGIPCSSVPRRNKPRRVDLYYSSWCIRAVESKRGNGGL  291

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEVLLFHHEDMGIP+EIAKLG+RQGMWG VKKI+PGLRAYQ+ RA   P SRSA MA+
Sbjct  292  TACEVLLFHHEDMGIPYEIAKLGIRQGMWGCVKKIEPGLRAYQEARAAGEPASRSALMAR  351

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            INTKV  + +RSLE      E+E   + +KP   ++ + LV+GGAVALAC++D+GLLTKA
Sbjct  352  INTKVGDNFVRSLE--SNSDESEIVEAEEKPARNHVARFLVLGGAVALACTLDQGLLTKA  409

Query  235  LIFGVARRFAGFGKRL  188
            LIFGVAR+F G  K L
Sbjct  410  LIFGVARKFVGQRKTL  425



>emb|CAH65950.1| H0716A07.8 [Oryza sativa Indica Group]
Length=400

 Score =   258 bits (660),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 134/198 (68%), Positives = 156/198 (79%), Gaps = 7/198 (4%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW SG+TYYCVTKGVP   VPR +KPRRVD+YYSSWCIRP  S+  DG M
Sbjct  205  SDREYIIGRRIWASGKTYYCVTKGVPRPSVPRCNKPRRVDVYYSSWCIRPVESRNGDGSM  264

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEVLLFHHE+MGIP E AKLGVRQGMWG VK+I+PGLRAYQ  R    PLS+ A MA 
Sbjct  265  TACEVLLFHHEEMGIPREFAKLGVRQGMWGCVKRIEPGLRAYQIARTAGEPLSKCAAMAH  324

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKP---TGRNIPKLLVVGGAVALACSIDRGLL  245
            +NTKV  D+L + E  +T + +  +  ++KP   TG NIPK+++VGGAVALAC+ D GLL
Sbjct  325  VNTKVDPDELITAE-DKTEASSTNNAEAEKPKHWTG-NIPKVILVGGAVALACTFDHGLL  382

Query  244  TKALIFGVARRFAGFGKR  191
            TKALIFG ARRFAG G+R
Sbjct  383  TKALIFGTARRFAGPGRR  400



>ref|XP_002447442.1| hypothetical protein SORBIDRAFT_06g001130 [Sorghum bicolor]
 gb|EES11770.1| hypothetical protein SORBIDRAFT_06g001130 [Sorghum bicolor]
Length=425

 Score =   258 bits (660),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 146/193 (76%), Gaps = 2/193 (1%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW SG+T+YCVTKGVP   VPR +KPRRVDLYYSSWCIRP  S++ DG M
Sbjct  228  SDREYIIGRRIWASGKTFYCVTKGVPRPSVPRHNKPRRVDLYYSSWCIRPVESRKGDGSM  287

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEVLLFHHEDMGIPWEIAKLGVRQGMWG VK+I+PGLRAYQ  R    P+S+ A MA 
Sbjct  288  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGCVKRIEPGLRAYQVARTAGEPISKCAAMAH  347

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            + T+   D+L + E     S         K    NIPK+L++GGAVALAC+ D GLLTKA
Sbjct  348  VTTRFNADELITEENTEGSSSNNTEVEKPKHWTNNIPKVLMIGGAVALACTFDGGLLTKA  407

Query  235  LIFGVARRFAGFG  197
            +IFG ARRFAG G
Sbjct  408  VIFGTARRFAGPG  420



>ref|XP_004952046.1| PREDICTED: uncharacterized protein LOC101765043 isoform X1 [Setaria 
italica]
Length=540

 Score =   261 bits (666),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 131/196 (67%), Positives = 157/196 (80%), Gaps = 4/196 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIWK G  YYCVTKG+P + +PR++KPRRVDLYYSSWCIR   SKR +G +
Sbjct  347  SDREYIIGRRIWKLGGAYYCVTKGIPCSSIPRRNKPRRVDLYYSSWCIRAVESKRGNGGL  406

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACE+LLFHHEDMGIP+EIAKLG+RQGMWG VKKI+PGLRAYQ+ RA   P S+SA MA+
Sbjct  407  TACEILLFHHEDMGIPYEIAKLGIRQGMWGCVKKIEPGLRAYQEARAAGEPASKSALMAR  466

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            INTKV  + +RSLE      E+E   + +KP   N+ + LV+GGAVALAC++D+GLLTKA
Sbjct  467  INTKVGDNFVRSLE--SNSQESEIVEAEEKPARNNVARFLVLGGAVALACTLDQGLLTKA  524

Query  235  LIFGVARRFAGFGKRL  188
            LIFGVAR+F G  K L
Sbjct  525  LIFGVARKFVGQRKTL  540



>ref|XP_010676932.1| PREDICTED: uncharacterized protein LOC104892647 [Beta vulgaris 
subsp. vulgaris]
Length=442

 Score =   258 bits (658),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 127/200 (64%), Positives = 155/200 (78%), Gaps = 7/200 (4%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGAS-KRDGQM  596
            SDREY+IGRRIW+S  +YYCVTKGVP   +PR+ KPRRVDLYYSSWCIR   S K+ GQM
Sbjct  242  SDREYVIGRRIWESEGSYYCVTKGVPFTSLPRRDKPRRVDLYYSSWCIRAVESQKKVGQM  301

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            T+CEV+LFHHEDMGIPWEIAKLGVRQGMW AVKKI+PGLR YQ+ R++ APLS  A MAQ
Sbjct  302  TSCEVILFHHEDMGIPWEIAKLGVRQGMWKAVKKIEPGLRVYQRERSSGAPLSHYALMAQ  361

Query  415  INTKVTTDDLRSLE-----LRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRG  251
             NT+V TD L++ E     L     + +A+    +  G  IP+ L+VGGA+ +AC+IDRG
Sbjct  362  TNTRVNTDYLKAQEASSDDLPIENQDTDANSLESRKPGMPIPRALIVGGAIVVACTIDRG  421

Query  250  LLTKALIFGVARRFAGFGKR  191
            LLTKA+IFGVAR+FA  G++
Sbjct  422  LLTKAVIFGVARKFARMGRK  441



>ref|XP_004977725.1| PREDICTED: uncharacterized protein LOC101783053 [Setaria italica]
Length=805

 Score =   265 bits (678),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 134/197 (68%), Positives = 151/197 (77%), Gaps = 5/197 (3%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW SG+T+YCVTKGVP   VPRQ+KPRRVDLYYSSWCIRP  S+  DG M
Sbjct  610  SDREYIIGRRIWASGKTFYCVTKGVPRPSVPRQNKPRRVDLYYSSWCIRPVESRNGDGAM  669

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEVLLFHHEDMGIPWEIAKLGVRQGMWG VK+I+PGLRAYQ  R    P+S+ A MA 
Sbjct  670  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGCVKRIEPGLRAYQIARTAGEPISKCAAMAH  729

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPT--GRNIPKLLVVGGAVALACSIDRGLLT  242
            + TK   D L + E     S +  +   +KP     NIPK L+VGGAVALAC+ DRGLLT
Sbjct  730  VTTKFNADQLDT-EDNTMASSSNNNTEVEKPKHWANNIPKALMVGGAVALACTFDRGLLT  788

Query  241  KALIFGVARRFAGFGKR  191
            KA+IFG ARRFAG G+R
Sbjct  789  KAVIFGTARRFAGPGRR  805



>dbj|BAJ95846.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=411

 Score =   255 bits (652),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 148/198 (75%), Gaps = 6/198 (3%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREY+IGRRIW SG+TYYCVTK VP   VPR SKPRRVDLYYSSWCIRP  S+  DG M
Sbjct  215  SDREYVIGRRIWASGKTYYCVTKSVPRPSVPRCSKPRRVDLYYSSWCIRPVESRNGDGAM  274

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEVLLFHHEDMGIPW IAKLGV+QGMWG VK+I+PGLRAYQ  RA   P+S+ A MA 
Sbjct  275  TACEVLLFHHEDMGIPWSIAKLGVQQGMWGCVKRIEPGLRAYQTARAAGEPISKFAAMAH  334

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKP---TGRNIPKLLVVGGAVALACSIDRGLL  245
             NTK    +L + E          +  ++KP   TG N+PK+ V+G  VALAC+ D+GLL
Sbjct  335  ANTKFVAGELTASENNDEAGSTSNNAQAEKPKHWTG-NLPKVFVIGSVVALACTFDKGLL  393

Query  244  TKALIFGVARRFAGFGKR  191
            TKAL+FG ARRFAG G+R
Sbjct  394  TKALVFGTARRFAGPGRR  411



>ref|NP_001168384.1| hypothetical protein [Zea mays]
 gb|ACN28038.1| unknown [Zea mays]
 tpg|DAA38705.1| TPA: hypothetical protein ZEAMMB73_284509 [Zea mays]
Length=408

 Score =   255 bits (652),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 128/199 (64%), Positives = 154/199 (77%), Gaps = 6/199 (3%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW SG+T+YCVTKGVP   VPRQ+KPRRVDLYYSSWCIRP  S++ DG M
Sbjct  210  SDREYIIGRRIWASGKTFYCVTKGVPRPSVPRQNKPRRVDLYYSSWCIRPVESRKGDGAM  269

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEVLLFHHEDMGIPWEIAKLGVRQGMWG VK+I+PGLRAYQ  R    P+S+ A MA 
Sbjct  270  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGCVKRIEPGLRAYQVARTAGEPISKHAAMAH  329

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSD----KPTGRNIPKLLVVGGAVALACSIDRGL  248
            + T+   D+L + +     S ++ + +++    K    NIPK+L++GGAVALAC+ D GL
Sbjct  330  VTTRFDADELVTEDSAEASSSSDNNKTAEVEKPKHWTNNIPKVLMIGGAVALACTFDGGL  389

Query  247  LTKALIFGVARRFAGFGKR  191
            +TKA IFG ARRFAG G+R
Sbjct  390  MTKAAIFGTARRFAGPGRR  408



>gb|EMS50172.1| hypothetical protein TRIUR3_23911 [Triticum urartu]
Length=315

 Score =   251 bits (641),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 152/191 (80%), Gaps = 4/191 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIWK G  YYCVTKGVP + +PR+SKPRRVDLYYSSWCIR   S+R +G  
Sbjct  122  SDREYIIGRRIWKLGSAYYCVTKGVPCSSIPRRSKPRRVDLYYSSWCIRAVESRRGNGGS  181

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACE+LLFHHEDMGIP+E+AK+G+RQGMWG VK+I+PGLRAYQK RA   P S SA MA+
Sbjct  182  TACEILLFHHEDMGIPYELAKIGIRQGMWGCVKRIEPGLRAYQKARAAGEPPSPSALMAR  241

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            INTKV+ + +R +E      +++   + +KP    + + LV+GGAVALAC++D+GLLTKA
Sbjct  242  INTKVSDNFVRGME--SNSDQSDIMEAEEKPVKNRMARFLVLGGAVALACTLDQGLLTKA  299

Query  235  LIFGVARRFAG  203
            LIFGVAR+F G
Sbjct  300  LIFGVARKFVG  310



>ref|NP_001142221.1| hypothetical protein [Zea mays]
 gb|ACF87918.1| unknown [Zea mays]
 gb|AFW66619.1| hypothetical protein ZEAMMB73_358635 [Zea mays]
Length=419

 Score =   254 bits (649),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 130/196 (66%), Positives = 153/196 (78%), Gaps = 4/196 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYII RRIWK G  YYCVTKG+P + +PR++KPRRVDLYYSSWCIR   S+R +G  
Sbjct  226  SDREYIIARRIWKLGGAYYCVTKGIPCSSIPRRNKPRRVDLYYSSWCIRAVESRRGNGGS  285

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEVLLFHHEDMGIP+EIAKLG+RQGMWG VK+I+PGLRAYQ+ RA   P+SRSA MAQ
Sbjct  286  TACEVLLFHHEDMGIPYEIAKLGIRQGMWGCVKRIEPGLRAYQQARAAGEPVSRSALMAQ  345

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            INTKV    +RSLE     SE     + +KP    + + LV+GGAVALAC++D+GLLTKA
Sbjct  346  INTKVGDSFVRSLESDSDGSETVE--AEEKPARNRVARFLVLGGAVALACTLDQGLLTKA  403

Query  235  LIFGVARRFAGFGKRL  188
            LIFGVAR+F G  K L
Sbjct  404  LIFGVARKFVGQRKAL  419



>gb|AFW66620.1| hypothetical protein ZEAMMB73_358635 [Zea mays]
Length=421

 Score =   254 bits (649),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 130/196 (66%), Positives = 153/196 (78%), Gaps = 4/196 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYII RRIWK G  YYCVTKG+P + +PR++KPRRVDLYYSSWCIR   S+R +G  
Sbjct  228  SDREYIIARRIWKLGGAYYCVTKGIPCSSIPRRNKPRRVDLYYSSWCIRAVESRRGNGGS  287

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEVLLFHHEDMGIP+EIAKLG+RQGMWG VK+I+PGLRAYQ+ RA   P+SRSA MAQ
Sbjct  288  TACEVLLFHHEDMGIPYEIAKLGIRQGMWGCVKRIEPGLRAYQQARAAGEPVSRSALMAQ  347

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            INTKV    +RSLE     SE     + +KP    + + LV+GGAVALAC++D+GLLTKA
Sbjct  348  INTKVGDSFVRSLESDSDGSETVE--AEEKPARNRVARFLVLGGAVALACTLDQGLLTKA  405

Query  235  LIFGVARRFAGFGKRL  188
            LIFGVAR+F G  K L
Sbjct  406  LIFGVARKFVGQRKAL  421



>gb|EEC72388.1| hypothetical protein OsI_05667 [Oryza sativa Indica Group]
 gb|EEE56217.1| hypothetical protein OsJ_05199 [Oryza sativa Japonica Group]
Length=420

 Score =   253 bits (646),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 152/191 (80%), Gaps = 4/191 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYII RRIWK G  YYCVTKGVP + +PR++KPRRVD+YYSSWCIRP  S+R +  +
Sbjct  227  SDREYIIARRIWKLGGAYYCVTKGVPCSSIPRRNKPRRVDVYYSSWCIRPVESRRGNSGL  286

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEVLLFHHEDMGIP+EIAK+G+RQGMWG VK+I+PGLRAYQK RA   PLS+SA MA 
Sbjct  287  TACEVLLFHHEDMGIPYEIAKIGIRQGMWGCVKRIEPGLRAYQKARAAGEPLSQSALMAH  346

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            INTKV  + +R LE      +++   + +KP    + + LV+GGAVALAC++D+GLLTKA
Sbjct  347  INTKVGDNFVRGLE--SNDDQSDIVEAEEKPAKNRVARFLVLGGAVALACTLDQGLLTKA  404

Query  235  LIFGVARRFAG  203
            LIFGVAR+F G
Sbjct  405  LIFGVARKFVG  415



>ref|XP_006648262.1| PREDICTED: uncharacterized protein LOC102714348 [Oryza brachyantha]
Length=347

 Score =   250 bits (639),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 125/196 (64%), Positives = 152/196 (78%), Gaps = 4/196 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYII RRIWK G  YYCVTKGVP   +PR++KPRRVD+YYSSWCIR   S+R +G  
Sbjct  154  SDREYIIARRIWKLGGAYYCVTKGVPCASIPRRNKPRRVDVYYSSWCIRAVESRRGNGGF  213

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEVLLFHHEDMGIP+EIAK+G+RQGMWG VK+I+PGLRAYQK +A   PLS+SA MA 
Sbjct  214  TACEVLLFHHEDMGIPYEIAKIGIRQGMWGCVKRIEPGLRAYQKAKAAGEPLSKSALMAH  273

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            INTKV  + +R LE      + +   + +KP   ++ + LV+GGAVALAC++D+GLLTKA
Sbjct  274  INTKVGDNFVRGLE--SNDDQPDIVEAEEKPAKNHVARFLVLGGAVALACTLDQGLLTKA  331

Query  235  LIFGVARRFAGFGKRL  188
            LIFGVAR+F G  K L
Sbjct  332  LIFGVARKFVGQRKTL  347



>ref|XP_008676876.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=502

 Score =   253 bits (645),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 151/191 (79%), Gaps = 4/191 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYII RRIWK G  YYCVTKG+P + +PR++KPRRVDLYYSSWCIR   S+R +G  
Sbjct  300  SDREYIIARRIWKLGGAYYCVTKGIPCSSIPRRNKPRRVDLYYSSWCIRAVESRRGNGGS  359

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEVLLFHHEDMGIP+EIAKLG+RQGMWG VK+I+PGLRAYQ+ RA   P+SRSA MAQ
Sbjct  360  TACEVLLFHHEDMGIPYEIAKLGIRQGMWGCVKRIEPGLRAYQQARAAGEPVSRSALMAQ  419

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            INTKV    +RSLE     SE     + +KP    + + LV+GGAVALAC++D+GLLTKA
Sbjct  420  INTKVGDSFVRSLESDSDGSETVE--AEEKPARNRVARFLVLGGAVALACTLDQGLLTKA  477

Query  235  LIFGVARRFAG  203
            LIFGVAR+F G
Sbjct  478  LIFGVARKFVG  488



>gb|ABK24392.1| unknown [Picea sitchensis]
Length=426

 Score =   249 bits (636),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 131/196 (67%), Positives = 157/196 (80%), Gaps = 9/196 (5%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW+SG+TY+CVTKGVP   VPR SKPRRVDLY+SSW IR   S++ DGQM
Sbjct  235  SDREYIIGRRIWESGRTYFCVTKGVPYPSVPRHSKPRRVDLYHSSWRIRAVESRKGDGQM  294

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TA EV+LFH+EDMGIP EIAK+GVRQGMWGAVKK++PG+RAYQ  R ++APLSRSA MA+
Sbjct  295  TAMEVMLFHNEDMGIPREIAKIGVRQGMWGAVKKVEPGVRAYQMARKSDAPLSRSALMAR  354

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIP-KLLVVGGAVALACSIDRGLLTK  239
            INTK+   DLRSLE   +  E E +      T + IP + ++VGGAVALAC +DRG+++K
Sbjct  355  INTKLPVSDLRSLE--DSSDEEEVATK----TQQGIPWRWVIVGGAVALACGLDRGVVSK  408

Query  238  ALIFGVARRFAGFGKR  191
            ALIFGVARRF   GKR
Sbjct  409  ALIFGVARRFGNLGKR  424



>gb|AAD28760.1|AF130253_1 membrane related protein CP5 [Arabidopsis thaliana]
Length=387

 Score =   247 bits (631),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 135/200 (68%), Positives = 156/200 (78%), Gaps = 14/200 (7%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW +G+ +YC+TKGV    VPRQ+KPRRVDLYYSSWCIR   SKR DG+M
Sbjct  196  SDREYIIGRRIWDAGRVFYCITKGVQYPSVPRQNKPRRVDLYYSSWCIRAVESKRGDGEM  255

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWG-AVKKIDPGLRAYQKHRAT---EAPLSRSA  428
            T+CEVLLFHHEDMGIPWEIAKLGVRQG  G AVKKI+P  R Y   R     E  LS SA
Sbjct  256  TSCEVLLFHHEDMGIPWEIAKLGVRQGYVGVAVKKIEP--RPYVHIRGLKQREPGLSPSA  313

Query  427  CMAQINTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGL  248
             MA INTKV+ ++     + R  S AE +G  DKPTG+NIPK+LVVGGA+ALAC++D+GL
Sbjct  314  IMAHINTKVSAEEF----MMRRGSIAEVTG--DKPTGKNIPKILVVGGAIALACTLDKGL  367

Query  247  LTKALIFGVARRFAGFGKRL  188
            LTKA+IFGVARRFA  GKR+
Sbjct  368  LTKAVIFGVARRFARMGKRM  387



>ref|XP_010544864.1| PREDICTED: uncharacterized protein LOC104817383 [Tarenaya hassleriana]
Length=419

 Score =   247 bits (630),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 136/205 (66%), Positives = 158/205 (77%), Gaps = 15/205 (7%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW +G+ +YCVTKGV    +PR++KPRRVDLYYSSWCIR   S+R +G+M
Sbjct  219  SDREYIIGRRIWDAGRVFYCVTKGVNYPAIPRRNKPRRVDLYYSSWCIRAVESRRREGEM  278

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEA-------PLS  437
            TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKI+PGLR YQK R++ A       PLS
Sbjct  279  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIEPGLRLYQKLRSSSAAGGGGAMPLS  338

Query  436  RSACMAQINTKVTTDDL-RSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSI  260
             SA MAQINTKV  DDL    E   + S +    S  +P G    K+L+VGGA+A+ACS+
Sbjct  339  ASASMAQINTKVNLDDLFLDKEKGSSSSSSPVVDSPRRPLG----KILLVGGAIAVACSL  394

Query  259  DRGLLTKALIFGVARRFAGF-GKRL  188
            D+GLLTKA+IFGVARRFA   GKRL
Sbjct  395  DKGLLTKAVIFGVARRFANMGGKRL  419



>gb|ACG40939.1| CP5 [Zea mays]
Length=421

 Score =   246 bits (628),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 152/198 (77%), Gaps = 9/198 (5%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW SG+T+YCVTKGVP   VPRQ+KPRRVDLYYSSWCIRP  S++ DG M
Sbjct  219  SDREYIIGRRIWASGKTFYCVTKGVPRPSVPRQNKPRRVDLYYSSWCIRPVESRKGDGAM  278

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEVLLFHHEDMGIPWEIAKLGVRQGMWG VK+I+PGLRAYQ  R     +S+ A MAQ
Sbjct  279  SACEVLLFHHEDMGIPWEIAKLGVRQGMWGCVKRIEPGLRAYQVGRTAGEAVSKCAAMAQ  338

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSS---DKPT---GRNIPKLLVVGGAVALA-CSID  257
            + T+ + D+L       T + + +SG     DK T     +IPK+L+VGGAVALA C+ D
Sbjct  339  VTTRFSADELVIAGPGNTEASSSSSGDGAEVDKATKHWANSIPKVLMVGGAVALACCTFD  398

Query  256  RGLLTKALIFGVARRFAG  203
             GLLTKA+IFG ARRFAG
Sbjct  399  GGLLTKAVIFGTARRFAG  416



>ref|NP_001148371.1| CP5 [Zea mays]
 gb|ACG31170.1| CP5 [Zea mays]
Length=421

 Score =   246 bits (628),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 152/198 (77%), Gaps = 9/198 (5%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW SG+T+YCVTKGVP   VPRQ+KPRRVDLYYSSWCIRP  S++ DG M
Sbjct  219  SDREYIIGRRIWASGKTFYCVTKGVPRPSVPRQNKPRRVDLYYSSWCIRPVESRKGDGAM  278

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEVLLFHHEDMGIPWEIAKLGVRQGMWG VK+I+PGLRAYQ  R     +S+ A MAQ
Sbjct  279  SACEVLLFHHEDMGIPWEIAKLGVRQGMWGCVKRIEPGLRAYQVGRTAGEAVSKCAAMAQ  338

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSS---DKPT---GRNIPKLLVVGGAVALA-CSID  257
            + T+ + D+L       T + + +SG     DK T     +IPK+L+VGGAVALA C+ D
Sbjct  339  VTTRFSADELVIAGPGNTEASSSSSGDGAEVDKATKHWANSIPKVLMVGGAVALACCTFD  398

Query  256  RGLLTKALIFGVARRFAG  203
             GLLTKA+IFG ARRFAG
Sbjct  399  GGLLTKAVIFGTARRFAG  416



>ref|XP_010233743.1| PREDICTED: uncharacterized protein LOC100824806 [Brachypodium 
distachyon]
Length=417

 Score =   246 bits (627),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 151/191 (79%), Gaps = 4/191 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYII RRIWK G  YYCVTKGV  + +PR+SKPRRVDLYYSSWCIR   S+R +G  
Sbjct  224  SDREYIIARRIWKLGSAYYCVTKGVQCSSIPRRSKPRRVDLYYSSWCIRAVESRRGNGGS  283

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACE+LLFHHEDMGIP+EIAK+G+RQGMWG VK+I+PGLRAYQ+ RA   P S SA MA+
Sbjct  284  TACEILLFHHEDMGIPYEIAKIGIRQGMWGCVKRIEPGLRAYQEARAAGEPPSPSALMAR  343

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            INTKV  + +R+LE     ++++   + +KP    + + LV+GGAVALAC++D+GLLTKA
Sbjct  344  INTKVGDNFVRALE--SNSNQSDIVEAEEKPVKNRVARFLVLGGAVALACTLDQGLLTKA  401

Query  235  LIFGVARRFAG  203
            LIFGVAR+F G
Sbjct  402  LIFGVARKFVG  412



>gb|KGN49968.1| hypothetical protein Csa_5G146910 [Cucumis sativus]
Length=399

 Score =   245 bits (625),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 121/177 (68%), Positives = 142/177 (80%), Gaps = 4/177 (2%)
 Frame = -2

Query  709  VTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQMTACEVLLFHHEDMGIPWEIA  536
            V KG+P + +PRQ+KP+RVDLYYSSWCIR   S++ + Q+TACEVLLFHHEDMGIPWEIA
Sbjct  223  VRKGIPCSSIPRQNKPKRVDLYYSSWCIRAVESRKGNSQLTACEVLLFHHEDMGIPWEIA  282

Query  535  KLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQINTKVTTDDLRSLELRRTMS  356
            KLGVRQGMWGAVKKIDP LR+YQKHRATEAPLS  A MA INTKV+ D LR  E     S
Sbjct  283  KLGVRQGMWGAVKKIDPALRSYQKHRATEAPLSNCALMANINTKVSIDYLRCSEDASDDS  342

Query  355  EAEASGSS--DKPTGRNIPKLLVVGGAVALACSIDRGLLTKALIFGVARRFAGFGKR  191
                +     +KP G+N+PKLL+VGGA+ALACS+D GLLTKA++FGVARRF+  GKR
Sbjct  343  SDNKALEEPLEKPAGKNLPKLLIVGGAIALACSLDHGLLTKAVVFGVARRFSNIGKR  399



>ref|XP_007220046.1| hypothetical protein PRUPE_ppa026850mg [Prunus persica]
 gb|EMJ21245.1| hypothetical protein PRUPE_ppa026850mg [Prunus persica]
Length=409

 Score =   245 bits (625),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 119/195 (61%), Positives = 147/195 (75%), Gaps = 2/195 (1%)
 Frame = -2

Query  766  DREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQMT  593
            DREYIIGRRIW+SG+ YYCVTKGVP   +PR  KPRRVDLYYSSWCI+   S+R +GQ+T
Sbjct  215  DREYIIGRRIWESGRLYYCVTKGVPYASIPRNDKPRRVDLYYSSWCIQAVESRRANGQLT  274

Query  592  ACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQI  413
            ACEVLLFHHED+GIPW+IAKLG+R+ +WG +KKI+ GLRAYQ  RA   PLSRSA MA I
Sbjct  275  ACEVLLFHHEDLGIPWDIAKLGIRKAIWGTIKKIEAGLRAYQTERALGLPLSRSAFMAHI  334

Query  412  NTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKAL  233
            NTK+  + L++       S+ E   +S K   R+I KLL+ GG + LAC+++RGLL K L
Sbjct  335  NTKIHPEYLKASGDTEDSSQTEVVTASGKAVRRHISKLLIFGGTIILACTLNRGLLIKTL  394

Query  232  IFGVARRFAGFGKRL  188
            +FGV R FA  GK+L
Sbjct  395  VFGVTRTFAKVGKKL  409



>ref|XP_008661910.1| PREDICTED: CP5 isoform X1 [Zea mays]
Length=427

 Score =   245 bits (626),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 148/198 (75%), Gaps = 9/198 (5%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW SG+T+YCVTKGVP   VPRQ+KPRRVDLYYSSWCIRP  S++ DG M
Sbjct  225  SDREYIIGRRIWASGKTFYCVTKGVPRPSVPRQNKPRRVDLYYSSWCIRPVESRKGDGAM  284

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEVLLFHHEDMGIPWEIAKLGVRQGMWG VK+I+PGLRAYQ  R     +S+ A MAQ
Sbjct  285  SACEVLLFHHEDMGIPWEIAKLGVRQGMWGCVKRIEPGLRAYQVGRTAGEAVSKCAAMAQ  344

Query  415  INTKVTTDDL------RSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALA-CSID  257
            + T+ + D+L       +     +  +    G   K    +IPK+L+VGGAVALA C+ D
Sbjct  345  VTTRFSADELVIAGPGNTEASSSSSGDGAEVGKVTKHWANSIPKVLMVGGAVALACCTFD  404

Query  256  RGLLTKALIFGVARRFAG  203
             GLLTKA+IFG ARRFAG
Sbjct  405  GGLLTKAVIFGTARRFAG  422



>dbj|BAD07966.1| putative membrane related protein CP5 [Oryza sativa Japonica 
Group]
Length=412

 Score =   244 bits (624),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 124/206 (60%), Positives = 152/206 (74%), Gaps = 19/206 (9%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-------ND---------VPRQSKPRRVDLYYSS  638
            SDREYII RRIWK G  YYCVTK +P       ND         +PR++KPRRVD+YYSS
Sbjct  204  SDREYIIARRIWKLGGAYYCVTKSLPALTRMQQNDPLKGVPCSSIPRRNKPRRVDVYYSS  263

Query  637  WCIRPGASKR-DGQMTACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKH  461
            WCIRP  S+R +  +TACEVLLFHHEDMGIP+EIAK+G+RQGMWG VK+I+PGLRAYQK 
Sbjct  264  WCIRPVESRRGNSGLTACEVLLFHHEDMGIPYEIAKIGIRQGMWGCVKRIEPGLRAYQKA  323

Query  460  RATEAPLSRSACMAQINTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGA  281
            RA   PLS+SA MA INTKV  + +R LE      +++   + +KP    + + LV+GGA
Sbjct  324  RAAGEPLSQSALMAHINTKVGDNFVRGLE--SNDDQSDIVEAEEKPAKNRVARFLVLGGA  381

Query  280  VALACSIDRGLLTKALIFGVARRFAG  203
            VALAC++D+GLLTKALIFGVAR+F G
Sbjct  382  VALACTLDQGLLTKALIFGVARKFVG  407



>ref|XP_009757290.1| PREDICTED: uncharacterized protein LOC104210169 [Nicotiana sylvestris]
Length=410

 Score =   244 bits (623),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/195 (60%), Positives = 147/195 (75%), Gaps = 2/195 (1%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW SG++YYCVTKGVP   +PR+ KPRRVDLYYSSW I    S R + Q 
Sbjct  211  SDREYIIGRRIWDSGRSYYCVTKGVPCPSIPRKDKPRRVDLYYSSWYIGEVESSRGNSQP  270

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEV+LFHHEDMGIPWEIAK GV+QGMWGAV+KI+ G RAYQK +A+   +S  A MA+
Sbjct  271  TACEVILFHHEDMGIPWEIAKFGVKQGMWGAVRKIERGFRAYQKAKASGLKISHCAFMAR  330

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            +NTK+  + L+S+E     SE E   S  KP G NIPKL+++GGAVA+AC++++G+L K 
Sbjct  331  VNTKIDREYLKSMEDDEDSSETELQASPAKPEGMNIPKLIIIGGAVAVACTLNQGILPKV  390

Query  235  LIFGVARRFAGFGKR  191
            L+F   +RF   G+R
Sbjct  391  LLFNAVKRFGNIGRR  405



>ref|XP_008234648.1| PREDICTED: uncharacterized protein LOC103333570 isoform X2 [Prunus 
mume]
Length=439

 Score =   244 bits (624),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 121/195 (62%), Positives = 146/195 (75%), Gaps = 2/195 (1%)
 Frame = -2

Query  766  DREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQMT  593
            DREYIIGRRIW+SG+ YYCVTKGVP   +PR  K RRVDLYYSSWCI+   S+R +GQ+T
Sbjct  245  DREYIIGRRIWESGRLYYCVTKGVPYASIPRNDKRRRVDLYYSSWCIQAVESRRANGQLT  304

Query  592  ACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQI  413
            ACE+LLFH+ED GIPW+IAKLG+R+ MWG VKKI+ GL AYQ  RA   PLSRSA MAQI
Sbjct  305  ACEILLFHYEDTGIPWDIAKLGIRKAMWGTVKKIEAGLHAYQTERALGLPLSRSAFMAQI  364

Query  412  NTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKAL  233
            NTK+  + L++       S+ E    S K T R+IPKLL+ GG + LAC ++RGLL K L
Sbjct  365  NTKIHPEYLKASGDTEDSSQTEVVTVSGKATRRHIPKLLIFGGTIILACILNRGLLMKTL  424

Query  232  IFGVARRFAGFGKRL  188
            +FGV RRFA  GK+L
Sbjct  425  VFGVTRRFAKVGKKL  439



>ref|XP_009604590.1| PREDICTED: phosphatidylcholine transfer protein isoform X2 [Nicotiana 
tomentosiformis]
Length=317

 Score =   240 bits (613),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 119/196 (61%), Positives = 149/196 (76%), Gaps = 3/196 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYI GRRIW+SG++YYCVTKGVP   VPR+ KPRRVDLYYSSW I+   S+R +GQ+
Sbjct  117  SDREYIFGRRIWESGRSYYCVTKGVPCPTVPRKDKPRRVDLYYSSWYIQAVESRRGNGQL  176

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEVLLFH+EDMGIPWEIAK GVRQGMWG V+KI+ GLR+YQK RA+   +SR A MAQ
Sbjct  177  TACEVLLFHYEDMGIPWEIAKFGVRQGMWGLVRKIERGLRSYQKSRASNMKISRCAFMAQ  236

Query  415  INTKVTTDDLRSLELR-RTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTK  239
            +NTK+  + L+S+E      S  E   S  K  G NIPKLL++GGA+ +AC++DRG++ K
Sbjct  237  VNTKIDPEYLKSMEGDVEESSGTEVQVSPAKSEGINIPKLLIIGGALVVACTLDRGIIPK  296

Query  238  ALIFGVARRFAGFGKR  191
            AL+    +RF   G+R
Sbjct  297  ALLLNAVKRFGNIGRR  312



>gb|KJB52500.1| hypothetical protein B456_008G265200 [Gossypium raimondii]
Length=411

 Score =   243 bits (620),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 144/190 (76%), Gaps = 2/190 (1%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW+   +YYCVTKGV    VPR++KPRRVDLYYSSW IR   S+R +GQ+
Sbjct  219  SDREYIIGRRIWEVDGSYYCVTKGVTCASVPRRNKPRRVDLYYSSWYIRAVESRRGNGQL  278

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEVLLFHHEDMGIPWEIAKLGVRQGMWG VKKI PGL AYQK R + A LS+SA MAQ
Sbjct  279  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGTVKKIKPGLCAYQKERESLASLSQSAYMAQ  338

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            +NTK++ + L SLE    +S ++   +S+ P  +NI + L+ GG + LACS+D G L+K 
Sbjct  339  VNTKISMEYLISLESNEVLSRSDVDSTSENPLAQNISRALIYGGLIVLACSLDHGALSKT  398

Query  235  LIFGVARRFA  206
             IFG+ R+  
Sbjct  399  FIFGMGRKLT  408



>gb|KCW46620.1| hypothetical protein EUGRSUZ_K00428 [Eucalyptus grandis]
Length=428

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 121/195 (62%), Positives = 150/195 (77%), Gaps = 2/195 (1%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGAS-KRDGQM  596
            SDREYIIGRRIW+   +Y+CVTKGV    +PR++KPRRVDLYYSSWCIR   S K DGQ+
Sbjct  228  SDREYIIGRRIWEYEGSYFCVTKGVHYPSIPRRNKPRRVDLYYSSWCIRAVESRKNDGQL  287

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEVLLFH+EDMGIP EIAKLG+RQGMWGAVKKI+PGLRAYQK RA+ APLS    MAQ
Sbjct  288  TACEVLLFHYEDMGIPNEIAKLGIRQGMWGAVKKIEPGLRAYQKARASGAPLSHPVKMAQ  347

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            INTK++ + ++SLE     SE   +   +KP G N+PK+L +GG + LA S++ GLLTKA
Sbjct  348  INTKISPEFVKSLEESDDTSEVGKADVVEKPKGGNLPKVLFIGGILVLAFSLNHGLLTKA  407

Query  235  LIFGVARRFAGFGKR  191
            +IF  A++F    ++
Sbjct  408  VIFSGAQKFGNLRRK  422



>ref|XP_009798509.1| PREDICTED: uncharacterized protein LOC104244732 [Nicotiana sylvestris]
Length=425

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 118/196 (60%), Positives = 150/196 (77%), Gaps = 3/196 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREY+ GRRIW+SG++YYCVTKGVP   VPR+ KPRRVDLYYSSW I+   S+R +GQ+
Sbjct  225  SDREYLFGRRIWESGRSYYCVTKGVPCPSVPRKDKPRRVDLYYSSWYIQAVESRRGNGQL  284

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEVLLFH+EDMGIPWEIAK GVRQGMWG V+KI+ G R+YQK RA+   +SR A MAQ
Sbjct  285  TACEVLLFHYEDMGIPWEIAKFGVRQGMWGLVRKIERGFRSYQKSRASNMKISRCAFMAQ  344

Query  415  INTKVTTDDLRSLELR-RTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTK  239
            +NTK+  + L+ +E      S  E   S  K  G N+PKLL++GGA+ +AC++DRG++ K
Sbjct  345  VNTKIDPEYLKLMEGDVEESSGTEVQVSPAKSEGINVPKLLIIGGALIVACTLDRGIIPK  404

Query  238  ALIFGVARRFAGFGKR  191
            AL+F VA+RF   G+R
Sbjct  405  ALLFNVAKRFGNIGRR  420



>ref|XP_010035315.1| PREDICTED: uncharacterized protein LOC104424552 [Eucalyptus grandis]
Length=440

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 121/195 (62%), Positives = 150/195 (77%), Gaps = 2/195 (1%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGAS-KRDGQM  596
            SDREYIIGRRIW+   +Y+CVTKGV    +PR++KPRRVDLYYSSWCIR   S K DGQ+
Sbjct  228  SDREYIIGRRIWEYEGSYFCVTKGVHYPSIPRRNKPRRVDLYYSSWCIRAVESRKNDGQL  287

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEVLLFH+EDMGIP EIAKLG+RQGMWGAVKKI+PGLRAYQK RA+ APLS    MAQ
Sbjct  288  TACEVLLFHYEDMGIPNEIAKLGIRQGMWGAVKKIEPGLRAYQKARASGAPLSHPVKMAQ  347

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            INTK++ + ++SLE     SE   +   +KP G N+PK+L +GG + LA S++ GLLTKA
Sbjct  348  INTKISPEFVKSLEESDDTSEVGKADVVEKPKGGNLPKVLFIGGILVLAFSLNHGLLTKA  407

Query  235  LIFGVARRFAGFGKR  191
            +IF  A++F    ++
Sbjct  408  VIFSGAQKFGNLRRK  422



>dbj|BAJ94056.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=458

 Score =   242 bits (618),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 148/191 (77%), Gaps = 4/191 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYII RRIWK G  YYCVTKGVP + +PR+SKPRRVD YYSSWCIR   S+R +G  
Sbjct  265  SDREYIIARRIWKLGSAYYCVTKGVPCSSIPRRSKPRRVDSYYSSWCIRAVESRRGNGGS  324

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACE+LLFHHEDMGIP EIAK+G+RQGMWG VK+I+PGLRAYQK RA   P S SA MA+
Sbjct  325  SACEILLFHHEDMGIPNEIAKIGIRQGMWGCVKRIEPGLRAYQKARAAGEPPSPSALMAR  384

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            INTKV  + +R LE      +++   + +KP    + + LV+GGAVALAC++D+GLLTKA
Sbjct  385  INTKVGDNFVRGLE--SNSDQSDIMEAEEKPVKNRMARFLVLGGAVALACTLDQGLLTKA  442

Query  235  LIFGVARRFAG  203
            LIFGVAR+F G
Sbjct  443  LIFGVARKFVG  453



>ref|XP_009604589.1| PREDICTED: uncharacterized protein LOC104099338 isoform X1 [Nicotiana 
tomentosiformis]
Length=425

 Score =   241 bits (615),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 119/196 (61%), Positives = 149/196 (76%), Gaps = 3/196 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYI GRRIW+SG++YYCVTKGVP   VPR+ KPRRVDLYYSSW I+   S+R +GQ+
Sbjct  225  SDREYIFGRRIWESGRSYYCVTKGVPCPTVPRKDKPRRVDLYYSSWYIQAVESRRGNGQL  284

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEVLLFH+EDMGIPWEIAK GVRQGMWG V+KI+ GLR+YQK RA+   +SR A MAQ
Sbjct  285  TACEVLLFHYEDMGIPWEIAKFGVRQGMWGLVRKIERGLRSYQKSRASNMKISRCAFMAQ  344

Query  415  INTKVTTDDLRSLELR-RTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTK  239
            +NTK+  + L+S+E      S  E   S  K  G NIPKLL++GGA+ +AC++DRG++ K
Sbjct  345  VNTKIDPEYLKSMEGDVEESSGTEVQVSPAKSEGINIPKLLIIGGALVVACTLDRGIIPK  404

Query  238  ALIFGVARRFAGFGKR  191
            AL+    +RF   G+R
Sbjct  405  ALLLNAVKRFGNIGRR  420



>ref|XP_008234647.1| PREDICTED: uncharacterized protein LOC103333570 isoform X1 [Prunus 
mume]
Length=446

 Score =   239 bits (610),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 118/189 (62%), Positives = 142/189 (75%), Gaps = 2/189 (1%)
 Frame = -2

Query  766  DREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQMT  593
            DREYIIGRRIW+SG+ YYCVTKGVP   +PR  K RRVDLYYSSWCI+   S+R +GQ+T
Sbjct  245  DREYIIGRRIWESGRLYYCVTKGVPYASIPRNDKRRRVDLYYSSWCIQAVESRRANGQLT  304

Query  592  ACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQI  413
            ACE+LLFH+ED GIPW+IAKLG+R+ MWG VKKI+ GL AYQ  RA   PLSRSA MAQI
Sbjct  305  ACEILLFHYEDTGIPWDIAKLGIRKAMWGTVKKIEAGLHAYQTERALGLPLSRSAFMAQI  364

Query  412  NTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKAL  233
            NTK+  + L++       S+ E    S K T R+IPKLL+ GG + LAC ++RGLL K L
Sbjct  365  NTKIHPEYLKASGDTEDSSQTEVVTVSGKATRRHIPKLLIFGGTIILACILNRGLLMKTL  424

Query  232  IFGVARRFA  206
            +FGV RRFA
Sbjct  425  VFGVTRRFA  433



>emb|CDP04991.1| unnamed protein product [Coffea canephora]
Length=431

 Score =   238 bits (607),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 126/197 (64%), Positives = 153/197 (78%), Gaps = 4/197 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSS-WCIRPGASKR-DGQ  599
            SDREYIIGRRIW+SG++YYCVTKGVP D +PR+ KPRRVDLYYSS W I+   S++ +GQ
Sbjct  230  SDREYIIGRRIWESGRSYYCVTKGVPCDSIPRRGKPRRVDLYYSSCWYIQAVESRKGNGQ  289

Query  598  MTACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMA  419
            + ACEVLLFHHEDMGIPWEIAK GVRQGMWG V+KI+ G R+YQ+ RA+ A LS +A MA
Sbjct  290  LDACEVLLFHHEDMGIPWEIAKFGVRQGMWGTVRKIERGFRSYQRTRASGALLSHAAFMA  349

Query  418  QINTKVTTDDLR-SLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLT  242
            QINTK+  D LR         SE+E   S++KP G  IPKLL++GGAV +ACS+D GL T
Sbjct  350  QINTKIDPDHLRSLESSEEDSSESEMLESTEKPRGMIIPKLLILGGAVVVACSVDHGLFT  409

Query  241  KALIFGVARRFAGFGKR  191
            KA+IF VA+ FA  G+R
Sbjct  410  KAIIFSVAKTFANIGRR  426



>ref|XP_006347513.1| PREDICTED: uncharacterized protein LOC102587815 [Solanum tuberosum]
Length=419

 Score =   237 bits (604),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 118/201 (59%), Positives = 151/201 (75%), Gaps = 13/201 (6%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYI  RRIW+SG++YYCVTKGVP   +PR+ KPRRVDLYYSSW I+   S+  +GQ+
Sbjct  219  SDREYIFARRIWESGRSYYCVTKGVPCPTIPRKDKPRRVDLYYSSWFIQAVESREGNGQL  278

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEVLLFHHEDMGIPWEIAK GVRQGMWGAV+KI+ GLR+YQK RA+ A +S  A MAQ
Sbjct  279  TACEVLLFHHEDMGIPWEIAKFGVRQGMWGAVRKIERGLRSYQKSRASNAKISHCALMAQ  338

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDK--PTGR----NIPKLLVVGGAVALACSIDR  254
            +NTK+  + L+S     T    E+SG+  +  P  R    NIPKLL++GGA+ +AC++D+
Sbjct  339  VNTKIDPEYLKS-----TDGNEESSGTDIEILPAKREGSINIPKLLIIGGALVVACTLDQ  393

Query  253  GLLTKALIFGVARRFAGFGKR  191
            G++ K  +F VA+RF   GK+
Sbjct  394  GIIPKTFLFNVAKRFGNIGKK  414



>ref|XP_004235020.1| PREDICTED: uncharacterized protein LOC101249155 [Solanum lycopersicum]
Length=419

 Score =   235 bits (600),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 113/196 (58%), Positives = 148/196 (76%), Gaps = 3/196 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYI  RRIW++G++YYCVTKGVP  ++ R+ KPRRVDLYYSSW I+   S+  +GQ+
Sbjct  219  SDREYIFARRIWEAGRSYYCVTKGVPCPNISRKDKPRRVDLYYSSWFIQAVESREGNGQL  278

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEVLLFHHEDMGIPWEIAK GVRQGMWGAV+KI+ GLR+YQ+ RA+ A +S  A MAQ
Sbjct  279  TACEVLLFHHEDMGIPWEIAKFGVRQGMWGAVRKIERGLRSYQRSRASNAKISHCALMAQ  338

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGR-NIPKLLVVGGAVALACSIDRGLLTK  239
            +NTK+  + L+S++     S  E      K  G  NIPKLL++GGA+ +AC++D+G++ K
Sbjct  339  VNTKIDPEYLKSMDGNEESSGTEIEVLPAKCEGNINIPKLLIIGGALVVACTLDQGIIPK  398

Query  238  ALIFGVARRFAGFGKR  191
              +F VA+RF   GK+
Sbjct  399  TFLFNVAKRFGNIGKK  414



>ref|XP_008376819.1| PREDICTED: uncharacterized protein LOC103439947 [Malus domestica]
Length=419

 Score =   233 bits (595),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 114/195 (58%), Positives = 142/195 (73%), Gaps = 2/195 (1%)
 Frame = -2

Query  766  DREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQMT  593
            DREYIIGRRIW+SG+ YYCVTKGVP   VPR  K  RVDLY+SSWCI+   S+R DGQ+T
Sbjct  216  DREYIIGRRIWESGRLYYCVTKGVPYASVPRHDKQVRVDLYFSSWCIQAVESRRADGQLT  275

Query  592  ACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQI  413
            ACEV+  H+ED G+PWEI KLG+R GMW  VKKI+ GLR YQK RA  +PLSR A MAQI
Sbjct  276  ACEVIFLHYEDNGLPWEIVKLGIRTGMWDTVKKIEAGLRTYQKERAAGSPLSRPAFMAQI  335

Query  412  NTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKAL  233
            NTK+    L+S       S+ E   +S KP GR+IPKLL++GG + +AC++++G L K +
Sbjct  336  NTKIHPGYLKSSGATEDSSQTEVVIASKKPAGRHIPKLLILGGTIIIACTLNKGHLMKVV  395

Query  232  IFGVARRFAGFGKRL  188
            IFGV  + A  GK+L
Sbjct  396  IFGVGGKLAKVGKKL  410



>ref|XP_010527384.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104804742 
[Tarenaya hassleriana]
Length=455

 Score =   231 bits (590),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 119/196 (61%), Positives = 143/196 (73%), Gaps = 3/196 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW   Q+YYC+TKGV    +PR  KPRRVDLYYSSWCIR   S+R DG  
Sbjct  251  SDREYIIGRRIWNCEQSYYCITKGVSLPSIPRNDKPRRVDLYYSSWCIRAVESRRGDGLK  310

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPL-SRSACMA  419
            T+CEV+LFHHEDMGIP E+AKLGVRQGMWGAVKK++PG  +YQK R +     S SA MA
Sbjct  311  TSCEVILFHHEDMGIPRELAKLGVRQGMWGAVKKMEPGFCSYQKERFSGGGTPSHSAAMA  370

Query  418  QINTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTK  239
            QIN+K+T   L SL  R T  EA    +S++  G NIPKL+++ GAV +ACS+ +GLL  
Sbjct  371  QINSKITAQHLNSLADRETSPEAGTPVTSNQQHGPNIPKLVILCGAVLVACSLSKGLLPS  430

Query  238  ALIFGVARRFAGFGKR  191
            AL+ G  RRFA  G+R
Sbjct  431  ALVVGFGRRFANAGRR  446



>ref|XP_004307892.1| PREDICTED: uncharacterized protein LOC101306175 [Fragaria vesca 
subsp. vesca]
Length=439

 Score =   230 bits (587),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 114/195 (58%), Positives = 141/195 (72%), Gaps = 3/195 (2%)
 Frame = -2

Query  766  DREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKRD-GQMT  593
            DREYIIGRRIW+SG+ YYCVTKGVP   +PR  K RRVD YYSSWCI+   S+ D GQ++
Sbjct  241  DREYIIGRRIWESGRLYYCVTKGVPYPSIPRHDKLRRVDNYYSSWCIQAAESRHDNGQLS  300

Query  592  ACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQI  413
            ACEV LFH EDMGIPWEIAKL VR+GMW  VK I+ GLRAYQK RA    +SR A MAQI
Sbjct  301  ACEVQLFHQEDMGIPWEIAKLAVRKGMWDTVKNIESGLRAYQKQRALGGIISRPAFMAQI  360

Query  412  NTKVTTDDLRSLELRRTMSE-AEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            NTK++ + L++       S+ A  + S DKP G NI  L+++GG++ LAC++DRG L K 
Sbjct  361  NTKISLEYLKASAGTEVSSQTAVVTASDDKPFGGNIRNLIIIGGSILLACTLDRGYLVKT  420

Query  235  LIFGVARRFAGFGKR  191
            +I GVA +F   GK+
Sbjct  421  IISGVANKFGNVGKK  435



>gb|AFW66617.1| hypothetical protein ZEAMMB73_358635 [Zea mays]
Length=179

 Score =   221 bits (563),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 138/179 (77%), Gaps = 4/179 (2%)
 Frame = -2

Query  718  YYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQMTACEVLLFHHEDMGIPW  545
            +Y  T+G+P + +PR++KPRRVDLYYSSWCIR   S+R +G  TACEVLLFHHEDMGIP+
Sbjct  3    WYNATQGIPCSSIPRRNKPRRVDLYYSSWCIRAVESRRGNGGSTACEVLLFHHEDMGIPY  62

Query  544  EIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQINTKVTTDDLRSLELRR  365
            EIAKLG+RQGMWG VK+I+PGLRAYQ+ RA   P+SRSA MAQINTKV    +RSLE   
Sbjct  63   EIAKLGIRQGMWGCVKRIEPGLRAYQQARAAGEPVSRSALMAQINTKVGDSFVRSLESDS  122

Query  364  TMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKALIFGVARRFAGFGKRL  188
              SE     + +KP    + + LV+GGAVALAC++D+GLLTKALIFGVAR+F G  K L
Sbjct  123  DGSETVE--AEEKPARNRVARFLVLGGAVALACTLDQGLLTKALIFGVARKFVGQRKAL  179



>emb|CDY00704.1| BnaC03g36880D [Brassica napus]
Length=455

 Score =   218 bits (554),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 117/201 (58%), Positives = 147/201 (73%), Gaps = 13/201 (6%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREY+IGRRIW  G++YYCVTKGV  + +PR +K +RVDL+YSSWCIRP  S+R DG  
Sbjct  234  SDREYVIGRRIWNCGKSYYCVTKGVSVSCIPRNNKQKRVDLFYSSWCIRPVKSRREDGVT  293

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATE---APLSRSAC  425
            +ACEVLLFHHEDMGIP EIAKLGV++GMWGAVKK++PGLRAYQ+ R +    + LSR A 
Sbjct  294  SACEVLLFHHEDMGIPKEIAKLGVKRGMWGAVKKMEPGLRAYQEQRLSREGGSKLSRPAF  353

Query  424  MAQINTKVTTDDLRSLELRRTMSEAEASGSSDKPT------GRNIPKLLVVGGAVALACS  263
            MAQINTK+T++ L SL    T SEAEA  +    T      G N+ KLL +GGAVA+AC+
Sbjct  354  MAQINTKITSEHLVSLSNGAT-SEAEAPETEAPVTLDRGNGGENLKKLLFIGGAVAIACT  412

Query  262  ID-RGLLTKALIFGVARRFAG  203
            +   G +  A++ G  +RF G
Sbjct  413  LSGGGFVPPAVLLGFGKRFGG  433



>gb|EPS63012.1| hypothetical protein M569_11775, partial [Genlisea aurea]
Length=419

 Score =   216 bits (551),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 115/209 (55%), Positives = 140/209 (67%), Gaps = 19/209 (9%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSSWCIRPGASKRDG--Q  599
            SDREYIIGRRIW+S  +YYCVTKGVP + VPR+ KPRRVD+YYSSW IR   + R+G   
Sbjct  210  SDREYIIGRRIWESKGSYYCVTKGVPYESVPRKDKPRRVDVYYSSWLIR---TVRNGPSS  266

Query  598  MTACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMA  419
             +  EVLLFHHEDMGIPWEIAK+GVRQGMWGAVK I+ G RAYQK+R +   +S  A MA
Sbjct  267  SSTSEVLLFHHEDMGIPWEIAKIGVRQGMWGAVKNIERGFRAYQKYRFSGGSVSHHATMA  326

Query  418  QINTKVTTDDLRSLELRRTM-------------SEAEASGSSDKPTGRNIPKLLVVGGAV  278
             INTKV   +  S    + +                    +     G +IPK+L+VGG V
Sbjct  327  HINTKVHVKEEESSSESQIIIMRSSSSSSSSGGGGGGGDDNGGSKNGIHIPKMLIVGGVV  386

Query  277  ALACSIDRGLLTKALIFGVARRFAGFGKR  191
            ALACS+D+GLLTK LIFG+AR+    G+R
Sbjct  387  ALACSLDQGLLTKTLIFGIARKLGSIGRR  415



>emb|CDY18307.1| BnaC09g30570D [Brassica napus]
Length=261

 Score =   211 bits (537),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 139/198 (70%), Gaps = 5/198 (3%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREY+IGRRIW  G++YYCVTKGV    +PR +K +RV+L+YSSWCIRP  S+R DG  
Sbjct  46   SDREYVIGRRIWNCGKSYYCVTKGVSVPCIPRNNKQKRVELFYSSWCIRPVESRREDGVA  105

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEVLLFHHEDMGIP EIAKLGV++GMWGAVKK++PGLRAYQ+ R + + LSR A MAQ
Sbjct  106  SACEVLLFHHEDMGIPREIAKLGVKRGMWGAVKKMEPGLRAYQEQRLSGSKLSRPALMAQ  165

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGL---L  245
            INTKVT++ L SL    +         +      N+ KLL +GGAVA+ C++  G    L
Sbjct  166  INTKVTSEHLISLSNGASPVNETPVTHNGGNVAANLKKLLFIGGAVAVVCALTGGGGGAL  225

Query  244  TKALIFGVARRFAGFGKR  191
                + G  +RFA  G++
Sbjct  226  VPPALLGFGKRFANGGRK  243



>gb|KFK27030.1| hypothetical protein AALP_AA8G325000 [Arabis alpina]
Length=455

 Score =   216 bits (551),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 139/198 (70%), Gaps = 5/198 (3%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKRD-GQM  596
            +DREY+IGRRIW  G++YYCVTKGV    +PR +K RRVDL+YSSWCIRP  S+RD G  
Sbjct  233  TDREYVIGRRIWNCGKSYYCVTKGVSVPSIPRNNKLRRVDLFYSSWCIRPVESRRDDGVT  292

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAP--LSRSACM  422
            +ACEVLLFHHEDMGIP EIAKLGV++GMWGAVKK++PGLRAYQ  R +E    LSR A M
Sbjct  293  SACEVLLFHHEDMGIPREIAKLGVKRGMWGAVKKMEPGLRAYQNQRLSEGETKLSRPAIM  352

Query  421  AQINTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLT  242
            AQINTK+T+D L SL    T         +      N+ KLL++GGAVA+ CS+  G+L 
Sbjct  353  AQINTKITSDHLISLSNGATPVTETPITLNQGNGASNLKKLLIIGGAVAVVCSLSTGVLV  412

Query  241  -KALIFGVARRFAGFGKR  191
              A + G  +R    GK+
Sbjct  413  PPAFLLGFGQRLVNGGKK  430



>dbj|BAB11579.1| membrane related protein-like [Arabidopsis thaliana]
Length=400

 Score =   214 bits (544),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 138/198 (70%), Gaps = 5/198 (3%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKRD-GQM  596
            SDREY+IGRRIW  G +YYCVTKGV    +P  +K +RVDL+YSSWCIRP  S+RD G  
Sbjct  187  SDREYVIGRRIWNCGNSYYCVTKGVSVPSIPPNNKQKRVDLFYSSWCIRPVESRRDDGVT  246

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATE--APLSRSACM  422
            +ACEVLLFHHEDMGIP EIAKLGV++GMWGAVKK++PGLRAYQ HR ++    LSRSA M
Sbjct  247  SACEVLLFHHEDMGIPREIAKLGVKRGMWGAVKKMEPGLRAYQTHRLSDGGTKLSRSAFM  306

Query  421  AQINTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRG-LL  245
            AQINTK+T D L SL    +         +      N+ KLL++GGAVA+ CS+  G  +
Sbjct  307  AQINTKITQDHLISLSNGASPVTETPVTLNQGNRAANLKKLLIIGGAVAVVCSLSGGAFV  366

Query  244  TKALIFGVARRFAGFGKR  191
              A + G  +RF   G++
Sbjct  367  PPAFLLGFGKRFVNGGRK  384



>emb|CDY71555.1| BnaAnng37890D, partial [Brassica napus]
Length=280

 Score =   210 bits (534),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 108/197 (55%), Positives = 138/197 (70%), Gaps = 4/197 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREY+IGRRIW  G++YYCVTKGV    +PR +K +RV+L+YSSWCIRP  S+R DG  
Sbjct  66   SDREYVIGRRIWNCGKSYYCVTKGVSVPCIPRNNKQKRVELFYSSWCIRPVESRREDGVA  125

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEVLLFHHEDMGIP EIAKLGV++GMWGAVKK++PGLRAYQ+ R + + LSR A MAQ
Sbjct  126  SACEVLLFHHEDMGIPREIAKLGVKRGMWGAVKKMEPGLRAYQEQRLSGSKLSRPALMAQ  185

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSID--RGLLT  242
            INTKVT++ L SL    +         +      N+ KLL +GGAVA+ C++    G L 
Sbjct  186  INTKVTSEHLISLSNGASPVSETPVTHNGGNVAANLKKLLFIGGAVAVVCALTGGGGALV  245

Query  241  KALIFGVARRFAGFGKR  191
               + G  +RF   G++
Sbjct  246  PPALLGFGKRFVNGGRK  262



>gb|AAM65221.1| membrane related protein-like [Arabidopsis thaliana]
Length=449

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 138/198 (70%), Gaps = 5/198 (3%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKRD-GQM  596
            SDREY+IGRRIW  G +YYCVTKGV    +P  +K +RVDL+YSSWCIRP  S+RD G  
Sbjct  236  SDREYVIGRRIWNCGNSYYCVTKGVSVPSIPPNNKQKRVDLFYSSWCIRPVESRRDDGVT  295

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEA--PLSRSACM  422
            +ACEVLLFHHEDMGIP EIAKLGV++GMWGAVKK++PGLRAYQ HR ++    LSRSA M
Sbjct  296  SACEVLLFHHEDMGIPREIAKLGVKRGMWGAVKKMEPGLRAYQTHRLSDVGTKLSRSAFM  355

Query  421  AQINTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRG-LL  245
            AQINTK+T D L SL    +         +      N+ KLL++GGAVA+ CS+  G  +
Sbjct  356  AQINTKITQDHLISLSNGASPVTETPVTLNQGNRAANLKKLLIIGGAVAVVCSLSGGAFV  415

Query  244  TKALIFGVARRFAGFGKR  191
              A + G  +RF   G++
Sbjct  416  PPAFLLGFGKRFVNGGRK  433



>ref|NP_568805.1| lipid-binding START domain-containing protein [Arabidopsis thaliana]
 gb|AED96462.1| lipid-binding START domain-containing protein [Arabidopsis thaliana]
Length=449

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 138/198 (70%), Gaps = 5/198 (3%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKRD-GQM  596
            SDREY+IGRRIW  G +YYCVTKGV    +P  +K +RVDL+YSSWCIRP  S+RD G  
Sbjct  236  SDREYVIGRRIWNCGNSYYCVTKGVSVPSIPPNNKQKRVDLFYSSWCIRPVESRRDDGVT  295

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATE--APLSRSACM  422
            +ACEVLLFHHEDMGIP EIAKLGV++GMWGAVKK++PGLRAYQ HR ++    LSRSA M
Sbjct  296  SACEVLLFHHEDMGIPREIAKLGVKRGMWGAVKKMEPGLRAYQTHRLSDGGTKLSRSAFM  355

Query  421  AQINTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRG-LL  245
            AQINTK+T D L SL    +         +      N+ KLL++GGAVA+ CS+  G  +
Sbjct  356  AQINTKITQDHLISLSNGASPVTETPVTLNQGNRAANLKKLLIIGGAVAVVCSLSGGAFV  415

Query  244  TKALIFGVARRFAGFGKR  191
              A + G  +RF   G++
Sbjct  416  PPAFLLGFGKRFVNGGRK  433



>ref|XP_009361280.1| PREDICTED: uncharacterized protein LOC103951585 [Pyrus x bretschneideri]
Length=425

 Score =   213 bits (543),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 109/195 (56%), Positives = 136/195 (70%), Gaps = 10/195 (5%)
 Frame = -2

Query  766  DREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQMT  593
            DREYIIGRRIW+SG+ YYCVTKG+P   VPR  K  RVDLY+SSWCI+   S+R DGQ+T
Sbjct  230  DREYIIGRRIWESGRLYYCVTKGLPYASVPRHDKQVRVDLYFSSWCIQAVESRRADGQLT  289

Query  592  ACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQI  413
            ACEV+  H+EDM +PWEI KLG+R+GMW  V KI+ GLRAYQK RA  +PLSR A MAQI
Sbjct  290  ACEVIFLHYEDMRLPWEIVKLGLRKGMWDTVTKIEAGLRAYQKERAAGSPLSRPAFMAQI  349

Query  412  NTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKAL  233
            NTK+    L+S       S+ E   +S KP GR+IPKLL++ G + +AC++ RG L    
Sbjct  350  NTKIHPGYLKSSGATEDSSQTEVVIASKKPAGRHIPKLLILVGTIIIACTLTRGHL----  405

Query  232  IFGVARRFAGFGKRL  188
                 R+ A  GK+L
Sbjct  406  ----GRKLAKVGKKL  416



>ref|XP_009132450.1| PREDICTED: uncharacterized protein LOC103857054 [Brassica rapa]
 emb|CDY43050.1| BnaA03g11970D [Brassica napus]
Length=443

 Score =   213 bits (541),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 114/200 (57%), Positives = 143/200 (72%), Gaps = 11/200 (6%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSSWCIRPGASKRD-GQM  596
            SDREY+IGRRIW  G++YYCVTKGV    +PR +K +RVDL+YSSWCIRP  S+ D G  
Sbjct  222  SDREYVIGRRIWNCGKSYYCVTKGVSVPCIPRNNKQKRVDLFYSSWCIRPVESRSDDGVT  281

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEA---PLSRSAC  425
            +ACEVLLFHHEDMGIP EIAKLGV++GMWGAVKK++PGLRAYQ+ R +      LSR A 
Sbjct  282  SACEVLLFHHEDMGIPKEIAKLGVKRGMWGAVKKMEPGLRAYQEQRLSREGGFKLSRPAF  341

Query  424  MAQINTKVTTDDLRSLELRRTMS----EAEASGSSDKPTG-RNIPKLLVVGGAVALACSI  260
            MAQINTK+T++ L SL    T      E EA  + D+  G  N+ KLL +GGAVA+AC++
Sbjct  342  MAQINTKITSEHLVSLSNGATSEAEAPETEAPVTLDRGNGAENLKKLLFIGGAVAVACTL  401

Query  259  D-RGLLTKALIFGVARRFAG  203
               G +  A++ G  +RF G
Sbjct  402  SGGGFVPPAVLLGFGKRFGG  421



>gb|AFW69926.1| hypothetical protein ZEAMMB73_637092 [Zea mays]
Length=440

 Score =   211 bits (537),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 132/212 (62%), Positives = 156/212 (74%), Gaps = 18/212 (8%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKRDGQM-  596
            SDREYII RRIWK G  YYCVTKG+P + +PR+S+PRRVDLYYSSWCIR   S+R     
Sbjct  229  SDREYIIARRIWKLGGAYYCVTKGIPCSSIPRRSRPRRVDLYYSSWCIRAVESRRGNGGG  288

Query  595  ---TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSAC  425
               TACEVLLFHHEDMGIP+EIAKLG+RQGMWG VK+I+PGLRAYQ+ RA  AP SRSA 
Sbjct  289  RGATACEVLLFHHEDMGIPYEIAKLGIRQGMWGCVKRIEPGLRAYQQARAAGAPPSRSAL  348

Query  424  MAQINTKVTTDDL--RSLELRRTMSEAEASGSSD--------KPTGRN--IPKLLVVGGA  281
            MA+INTKV+ D    RS+E   + S  +   ++D        KP  R+    +LLV+GGA
Sbjct  349  MARINTKVSADGFARRSMESLSSSSGGDGPETADDAQETENKKPATRSHAAARLLVLGGA  408

Query  280  VALA-CSIDRGLLTKALIFGVARRFAGFGKRL  188
            VALA C++D+GLLTKALIFGVARRF G  K L
Sbjct  409  VALACCTLDQGLLTKALIFGVARRFVGQRKTL  440



>ref|XP_008680976.1| PREDICTED: uncharacterized protein LOC100191642 isoform X1 [Zea 
mays]
 gb|AFW69925.1| hypothetical protein ZEAMMB73_637092 [Zea mays]
Length=456

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 132/212 (62%), Positives = 156/212 (74%), Gaps = 18/212 (8%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKRDGQM-  596
            SDREYII RRIWK G  YYCVTKG+P + +PR+S+PRRVDLYYSSWCIR   S+R     
Sbjct  245  SDREYIIARRIWKLGGAYYCVTKGIPCSSIPRRSRPRRVDLYYSSWCIRAVESRRGNGGG  304

Query  595  ---TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSAC  425
               TACEVLLFHHEDMGIP+EIAKLG+RQGMWG VK+I+PGLRAYQ+ RA  AP SRSA 
Sbjct  305  RGATACEVLLFHHEDMGIPYEIAKLGIRQGMWGCVKRIEPGLRAYQQARAAGAPPSRSAL  364

Query  424  MAQINTKVTTDDL--RSLELRRTMSEAEASGSSD--------KPTGRN--IPKLLVVGGA  281
            MA+INTKV+ D    RS+E   + S  +   ++D        KP  R+    +LLV+GGA
Sbjct  365  MARINTKVSADGFARRSMESLSSSSGGDGPETADDAQETENKKPATRSHAAARLLVLGGA  424

Query  280  VALA-CSIDRGLLTKALIFGVARRFAGFGKRL  188
            VALA C++D+GLLTKALIFGVARRF G  K L
Sbjct  425  VALACCTLDQGLLTKALIFGVARRFVGQRKTL  456



>ref|XP_010442992.1| PREDICTED: uncharacterized protein LOC104725938 [Camelina sativa]
Length=454

 Score =   211 bits (536),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 137/198 (69%), Gaps = 5/198 (3%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKRD-GQM  596
            SDREY+IGRRIW  G +YYCVTKGV    VP  +K +RVDL+YSSWCIRP  S+RD G  
Sbjct  238  SDREYVIGRRIWNCGNSYYCVTKGVSVPSVPPNNKQKRVDLFYSSWCIRPVESRRDDGVT  297

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATE--APLSRSACM  422
            +ACEVLLFHHEDMGIP EIAKLGV++GMWGAVKK++PGLRAYQ  R +E    LSR A M
Sbjct  298  SACEVLLFHHEDMGIPREIAKLGVKRGMWGAVKKMEPGLRAYQTQRLSEGGTKLSRPAFM  357

Query  421  AQINTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRG-LL  245
            AQINTK+T++ L SL    +         +      N+ KLL++GGA+A+ CS+  G  +
Sbjct  358  AQINTKITSEHLISLSNGASPVTETPVTQNQGNQAANLKKLLIIGGAIAVVCSLSGGAFV  417

Query  244  TKALIFGVARRFAGFGKR  191
              A + G  +RF   G++
Sbjct  418  PPAFVLGFGKRFGNGGRK  435



>ref|XP_010482825.1| PREDICTED: uncharacterized protein LOC104761442 [Camelina sativa]
Length=451

 Score =   211 bits (536),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 137/198 (69%), Gaps = 5/198 (3%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKRD-GQM  596
            SDREY+IGRRIW  G +YYCVTKGV    VP  +K +RVDL+YSSWCIRP  S+RD G  
Sbjct  236  SDREYVIGRRIWNCGNSYYCVTKGVSVPSVPPNNKQKRVDLFYSSWCIRPVESRRDDGVT  295

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATE--APLSRSACM  422
            +ACEVLLFHHEDMGIP EIAKLGV++GMWGAVKK++PGLRAYQ  R +E    LSR A M
Sbjct  296  SACEVLLFHHEDMGIPREIAKLGVKRGMWGAVKKMEPGLRAYQTQRLSEGGTKLSRPAFM  355

Query  421  AQINTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRG-LL  245
            AQINTK+T++ L SL    +         +      N+ KLL++GGA+A+ CS+  G  +
Sbjct  356  AQINTKITSEHLISLSNGASPVTETPVTQNQGNRAANLKKLLIIGGAIAVVCSLSGGAFV  415

Query  244  TKALIFGVARRFAGFGKR  191
              A + G  +RF   G++
Sbjct  416  PPAFVLGFGKRFGNGGRK  433



>ref|XP_009119952.1| PREDICTED: uncharacterized protein LOC103844879 [Brassica rapa]
Length=449

 Score =   209 bits (533),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 108/197 (55%), Positives = 138/197 (70%), Gaps = 4/197 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREY+IGRRIW  G++YYCVTKGV    +PR +K +RV+L+YSSWCIRP  S+R DG  
Sbjct  235  SDREYVIGRRIWNCGKSYYCVTKGVSVPCIPRNNKQKRVELFYSSWCIRPVESRREDGVA  294

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEVLLFHHEDMGIP EIAKLGV++GMWGAVKK++PGLRAYQ+ R + + LSR A MAQ
Sbjct  295  SACEVLLFHHEDMGIPREIAKLGVKRGMWGAVKKMEPGLRAYQEQRLSGSKLSRPALMAQ  354

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSID--RGLLT  242
            INTKVT++ L SL    +         +      N+ KLL +GGAVA+ C++    G L 
Sbjct  355  INTKVTSEHLISLSNGASPVSETPVTHNGGNVAANLKKLLFIGGAVAVVCALTGGGGALV  414

Query  241  KALIFGVARRFAGFGKR  191
               + G  +RF   G++
Sbjct  415  PPALLGFGKRFVNGGRK  431



>ref|XP_008786107.1| PREDICTED: uncharacterized protein LOC103704543 isoform X2 [Phoenix 
dactylifera]
Length=439

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 109/192 (57%), Positives = 137/192 (71%), Gaps = 4/192 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW+SG+TYYCVTKGVP   + ++ KPRRV+LY+SSW IRP  S+R DGQ+
Sbjct  246  SDREYIIGRRIWESGKTYYCVTKGVPYPALCKKEKPRRVELYFSSWRIRPVESRRQDGQV  305

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEV L HHEDMGIP ++AK+GVR GMWGAVKK+  G+RAYQ  R TE  LSRSA MA+
Sbjct  306  SACEVTLVHHEDMGIPKDVAKVGVRHGMWGAVKKLQSGMRAYQVMRKTETSLSRSALMAR  365

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIP--KLLVVGGAVALACSIDRGLLT  242
            I TK+  D   +L       E+EA  + D    R     K +V+GG +A+ C +  GL+ 
Sbjct  366  ITTKIPVDGTVTLSDPEPSGESEAGNNDDAHEVRQGVEWKWVVIGGTIAVICGLQTGLIG  425

Query  241  KALIFGVARRFA  206
            K+L+FG ARR A
Sbjct  426  KSLLFGAARRLA  437



>ref|XP_008786105.1| PREDICTED: uncharacterized protein LOC103704543 isoform X1 [Phoenix 
dactylifera]
Length=440

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 109/192 (57%), Positives = 137/192 (71%), Gaps = 4/192 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW+SG+TYYCVTKGVP   + ++ KPRRV+LY+SSW IRP  S+R DGQ+
Sbjct  247  SDREYIIGRRIWESGKTYYCVTKGVPYPALCKKEKPRRVELYFSSWRIRPVESRRQDGQV  306

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEV L HHEDMGIP ++AK+GVR GMWGAVKK+  G+RAYQ  R TE  LSRSA MA+
Sbjct  307  SACEVTLVHHEDMGIPKDVAKVGVRHGMWGAVKKLQSGMRAYQVMRKTETSLSRSALMAR  366

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIP--KLLVVGGAVALACSIDRGLLT  242
            I TK+  D   +L       E+EA  + D    R     K +V+GG +A+ C +  GL+ 
Sbjct  367  ITTKIPVDGTVTLSDPEPSGESEAGNNDDAHEVRQGVEWKWVVIGGTIAVICGLQTGLIG  426

Query  241  KALIFGVARRFA  206
            K+L+FG ARR A
Sbjct  427  KSLLFGAARRLA  438



>ref|XP_006401611.1| hypothetical protein EUTSA_v10013518mg [Eutrema salsugineum]
 gb|ESQ43064.1| hypothetical protein EUTSA_v10013518mg [Eutrema salsugineum]
Length=451

 Score =   209 bits (532),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 110/199 (55%), Positives = 143/199 (72%), Gaps = 7/199 (4%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREY+IGRRIW  G +YYCVTKGV    +PR +K +RV+L+YSSWCIRP  S+R DG  
Sbjct  236  SDREYVIGRRIWNCGNSYYCVTKGVSVPSIPRNNKQKRVELFYSSWCIRPVESRREDGVT  295

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRAT--EAPLSRSACM  422
            +ACEVLLFHHEDMGIP EIAKLGV++GMWGAVKK++PGLRAYQ+ R +  E+ LSR A M
Sbjct  296  SACEVLLFHHEDMGIPREIAKLGVKRGMWGAVKKMEPGLRAYQEQRLSGGESKLSRPALM  355

Query  421  AQINTKVTTDDLRSLELRRTMSEAEASGSSDKPT-GRNIPKLLVVGGAVALACSID-RGL  248
            AQINTK+T++ L SL        AE + + D+     N+ KLL++GGAVA+ C++   G 
Sbjct  356  AQINTKITSEHLISLS-NGASPVAETAVTLDRGNHAANLKKLLILGGAVAVVCTLSGGGF  414

Query  247  LTKALIFGVARRFAGFGKR  191
               A + G  ++F   G++
Sbjct  415  APPAFLLGFGKKFVNGGRK  433



>ref|XP_006280456.1| hypothetical protein CARUB_v10026389mg [Capsella rubella]
 gb|EOA13354.1| hypothetical protein CARUB_v10026389mg [Capsella rubella]
Length=450

 Score =   209 bits (532),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 137/198 (69%), Gaps = 5/198 (3%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREY+IGRRIW  G +YYCVTKGV    +P  +K +RVDL+YSSWCIRP  S+R DG  
Sbjct  234  SDREYVIGRRIWNCGNSYYCVTKGVSVPSLPPNNKQKRVDLFYSSWCIRPVESRREDGVT  293

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATE--APLSRSACM  422
            +ACEVLLFHHEDMGIP EIAKLGV++GMWGAVKK++PGLRAYQ  R  E    LSR A M
Sbjct  294  SACEVLLFHHEDMGIPREIAKLGVKRGMWGAVKKMEPGLRAYQTQRLAEGGTKLSRPAFM  353

Query  421  AQINTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRG-LL  245
            AQIN KVT++ L SL    T         +      N+ KLL++GGAVA+ CS+  G  +
Sbjct  354  AQINAKVTSEHLISLSNGATPVTETPVTLNQGNRAANLKKLLIIGGAVAVVCSLSGGAFV  413

Query  244  TKALIFGVARRFAGFGKR  191
              A + G+ +RF+  G++
Sbjct  414  PPAFLLGLGKRFSNGGRK  431



>ref|XP_002866025.1| hypothetical protein ARALYDRAFT_918536 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42284.1| hypothetical protein ARALYDRAFT_918536 [Arabidopsis lyrata subsp. 
lyrata]
Length=449

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 109/197 (55%), Positives = 136/197 (69%), Gaps = 4/197 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKRD-GQM  596
            SDREY+IGRRIW  G +YYCVTKGV    +P  +K +RVDL+YSSWCIRP  S+RD G  
Sbjct  238  SDREYVIGRRIWNCGNSYYCVTKGVSVPSIPPNNKQKRVDLFYSSWCIRPVESRRDDGVT  297

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAP-LSRSACMA  419
            +ACEVLLFHHEDMGIP EIAKLGV++GMWGAVKK++PGLRAYQ  R +    LSRSA MA
Sbjct  298  SACEVLLFHHEDMGIPREIAKLGVKRGMWGAVKKMEPGLRAYQTQRLSGGTKLSRSAFMA  357

Query  418  QINTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRG-LLT  242
            QINT++T D L SL    +         +      N+ KLL++GGAVA+ CS+  G  + 
Sbjct  358  QINTRITQDHLISLSNGASPVTETPVTLNQGNRAANLKKLLIIGGAVAVVCSLSGGAFVP  417

Query  241  KALIFGVARRFAGFGKR  191
             A + G  +RF   G++
Sbjct  418  PAFLLGFGKRFVNGGRK  434



>emb|CDY43837.1| BnaC03g14700D [Brassica napus]
Length=1176

 Score =   217 bits (552),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 116/201 (58%), Positives = 147/201 (73%), Gaps = 13/201 (6%)
 Frame = -2

Query  769   SDREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
             SDREY+IGRRIW  G++YYCVTKGV    +PR +K +RVDL+YSSWCIRP  S+R DG  
Sbjct  955   SDREYVIGRRIWNCGKSYYCVTKGVSVSCIPRNNKQKRVDLFYSSWCIRPVKSRREDGVT  1014

Query  595   TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATE---APLSRSAC  425
             +ACEVLLFHHEDMGIP EIAKLGV++GMWGAVKK++PGLRAYQ+ R +    + LSR A 
Sbjct  1015  SACEVLLFHHEDMGIPKEIAKLGVKRGMWGAVKKMEPGLRAYQEQRLSREGGSKLSRPAF  1074

Query  424   MAQINTKVTTDDLRSLELRRTMSEAEASGSS-----DKPTG-RNIPKLLVVGGAVALACS  263
             MAQINTK+T++ + SL    T SEAEA  +      D+  G  N+ KLL +GGAVA+AC+
Sbjct  1075  MAQINTKITSEHIVSLSNGAT-SEAEAPETEAPVTLDRGNGAENLKKLLFIGGAVAIACT  1133

Query  262   ID-RGLLTKALIFGVARRFAG  203
             +   G +  A++ G  +RF G
Sbjct  1134  LSGGGFVPPAVLLGFGKRFGG  1154



>ref|XP_010923463.1| PREDICTED: uncharacterized protein LOC105046548 [Elaeis guineensis]
Length=439

 Score =   206 bits (523),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 108/192 (56%), Positives = 137/192 (71%), Gaps = 4/192 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSSWCIRPGAS-KRDGQM  596
            SDREYIIGRRIW+SG+TYYCVTKGVP   + ++ KPRRV+LY+SSW IR   S K+DGQ+
Sbjct  246  SDREYIIGRRIWESGKTYYCVTKGVPYPALSKKEKPRRVELYFSSWRIRAVESRKQDGQL  305

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEV L H+EDMGIP ++AK+GVR GMWGAVKK+  G+RAYQ  R TE  LSRSA MA+
Sbjct  306  SACEVTLIHYEDMGIPKDVAKVGVRHGMWGAVKKLQSGMRAYQVMRKTETSLSRSALMAR  365

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRN--IPKLLVVGGAVALACSIDRGLLT  242
            I TK+  D   +L     +SE+E   + +    R     K +V+GG VA+ C +  GL+ 
Sbjct  366  ITTKIPIDGTVTLLDPEPLSESEEGNNDNSHEVRQGVDWKWVVIGGTVAVVCGLQTGLIG  425

Query  241  KALIFGVARRFA  206
            KAL+FG ARR A
Sbjct  426  KALLFGAARRLA  437



>ref|XP_009409211.1| PREDICTED: uncharacterized protein LOC103991461 [Musa acuminata 
subsp. malaccensis]
Length=448

 Score =   203 bits (517),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 107/193 (55%), Positives = 135/193 (70%), Gaps = 5/193 (3%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGAS-KRDGQM  596
            SDREYIIGRRIW+SG+ YYCVTKGVP + +P+  KPRRV+LY+SSWCIR   S K+DGQ+
Sbjct  254  SDREYIIGRRIWESGKAYYCVTKGVPYSSLPKSVKPRRVELYFSSWCIRAVESRKQDGQL  313

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEV L H+EDMGIP ++AK+GVR GMWGAVKK+  G+RAYQ  R TE   SRSA MA+
Sbjct  314  SACEVTLIHYEDMGIPRDVAKVGVRHGMWGAVKKLQSGMRAYQVTRKTEMSPSRSALMAR  373

Query  415  INTKVTTDDLRSLELRRTM---SEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLL  245
            + TK+ TD   ++E   T    SE   +  + K   + I    VV G VA+ C +  G++
Sbjct  374  VTTKLPTDGTITVEGTETSSRPSEIACNDDAGKEHHQGIDWKWVVIGGVAVVCGLQTGMI  433

Query  244  TKALIFGVARRFA  206
             KAL FG ARR A
Sbjct  434  GKALAFGAARRLA  446



>ref|XP_002977388.1| hypothetical protein SELMODRAFT_228472 [Selaginella moellendorffii]
 gb|EFJ21392.1| hypothetical protein SELMODRAFT_228472 [Selaginella moellendorffii]
Length=435

 Score =   202 bits (515),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 106/200 (53%), Positives = 139/200 (70%), Gaps = 7/200 (4%)
 Frame = -2

Query  766  DREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSSWCIRPGASKR-DGQMT  593
            DREY IGRRIW+ G TYYC+  GV  D VPR++KPRRVD++YSS+ IR   S++ D Q+T
Sbjct  236  DREYTIGRRIWEHGNTYYCLQMGVETDKVPRKNKPRRVDVFYSSFRIRAVESRKGDSQLT  295

Query  592  ACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQI  413
            ACEVLLFH E+MGI  ++AKLGVRQGMWG VK ++PG  +Y   R +  PLSR A MAQI
Sbjct  296  ACEVLLFHSEEMGIQKDLAKLGVRQGMWGCVKGMEPGAHSYLASRKSAKPLSRPALMAQI  355

Query  412  NTKVTTDDLRSLELRRTMSEAEA-SGSSDKPTG----RNIPKLLVVGGAVALACSIDRGL  248
             TKV     R L +  T  E +A SGS+ +       +N+ + +++GGAVALAC +DRG 
Sbjct  356  TTKVPASVFRELGIADTTLEVQAGSGSAVEEVSAENKKNVWRWIILGGAVALACGVDRGA  415

Query  247  LTKALIFGVARRFAGFGKRL  188
            + K L+FG+ARR    G++L
Sbjct  416  VGKVLLFGIARRLGRLGRKL  435



>gb|KEH27365.1| mammalian STARD2 lipid-binding START domain protein [Medicago 
truncatula]
Length=326

 Score =   199 bits (507),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 135/192 (70%), Gaps = 4/192 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYII RRIW++G  YYCVTKGVP   +P++ KPRRVDLY+SSW I+P  S++ DGQ+
Sbjct  133  SDREYIIARRIWQAGNAYYCVTKGVPYPSLPKRDKPRRVDLYFSSWVIKPVESRKGDGQL  192

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEV L HHEDMGIP ++AKLGVR GMWGAVKK+  G+RAYQ  R T+A LSR A MA 
Sbjct  193  SACEVTLLHHEDMGIPKDVAKLGVRHGMWGAVKKLHSGMRAYQNARKTDASLSRCALMAS  252

Query  415  INTKVTTD-DLRSLELRRTMSEAEASGSSDKPTGRNIP-KLLVVGGAVALACSIDRGLLT  242
              T+++++ +L SLE    M E E + ++ +  G  +  K + +GG VA+   I  G + 
Sbjct  253  KTTRLSSNGNLHSLEDASLMEEREQAINNARQIGHGLDWKWVALGGTVAVVLGIHSGAVG  312

Query  241  KALIFGVARRFA  206
            +AL+ G   RFA
Sbjct  313  RALLLGAGHRFA  324



>ref|XP_002517011.1| phosphatidylcholine transfer protein, putative [Ricinus communis]
 gb|EEF45174.1| phosphatidylcholine transfer protein, putative [Ricinus communis]
Length=442

 Score =   201 bits (512),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 108/200 (54%), Positives = 138/200 (69%), Gaps = 20/200 (10%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW++G+TYYC+TKGVP + +P++ KPRRVDLY+SSW IR   S++ DGQM
Sbjct  249  SDREYIIGRRIWEAGKTYYCLTKGVPYEGLPKRDKPRRVDLYFSSWVIRAVESRKGDGQM  308

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEV LFH EDMGIP ++AKLGVR GMWG VKK+  G+RAYQ  R + A LSRSA MA+
Sbjct  309  SACEVTLFHCEDMGIPKDVAKLGVRHGMWGTVKKLHSGMRAYQNARKSGASLSRSALMAR  368

Query  415  INTKVTTDDLRSLELRRTMSEAE-ASGSSDKPTGRNIP---------KLLVVGGAVALAC  266
            I TK++ D+        +M  +E  +G  DK    +I          K +VVGG VAL C
Sbjct  369  ITTKISFDE--------SMDSSEPVTGEEDKHGAVDIRRHKDHGIDWKWIVVGGTVALVC  420

Query  265  SIDRGLLTKALIFGVARRFA  206
             +  G + KAL+FG  +R A
Sbjct  421  GLHSGAVGKALLFGAGQRIA  440



>ref|XP_002974969.1| hypothetical protein SELMODRAFT_267823 [Selaginella moellendorffii]
 gb|EFJ23754.1| hypothetical protein SELMODRAFT_267823 [Selaginella moellendorffii]
Length=418

 Score =   199 bits (507),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 103/195 (53%), Positives = 132/195 (68%), Gaps = 14/195 (7%)
 Frame = -2

Query  766  DREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSSWCIRPGASKR-DGQMT  593
            DREY IGRRIW+ G TYYC+  GV  D VPR++KPRRVD++YSS+ IR   S++ D Q+T
Sbjct  236  DREYTIGRRIWEHGNTYYCLQMGVETDKVPRKNKPRRVDVFYSSFRIRAVESRKGDSQLT  295

Query  592  ACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQI  413
            ACEVLLFH E+MGI  ++AKLGVRQGMWG VK ++PG  +Y   R +  PLSR A MAQI
Sbjct  296  ACEVLLFHSEEMGIQKDLAKLGVRQGMWGCVKGMEPGAHSYLASRKSAKPLSRPALMAQI  355

Query  412  NTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKAL  233
             TKV     R L            G +D    RN+ + +++GGAVALAC +DRG + K L
Sbjct  356  TTKVPASVFREL------------GIADTALERNVWRWIILGGAVALACGVDRGAVGKVL  403

Query  232  IFGVARRFAGFGKRL  188
            +FG+ARR    G++L
Sbjct  404  LFGIARRLGRLGRKL  418



>emb|CBI26372.3| unnamed protein product [Vitis vinifera]
Length=404

 Score =   199 bits (505),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 134/198 (68%), Gaps = 19/198 (10%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKRDGQMT  593
            SDREYIIGRRIW++G+TYYCVTKGVP   +P++ KPRRV+LY+SSW IR   S +   M+
Sbjct  212  SDREYIIGRRIWEAGKTYYCVTKGVPYPGLPKRDKPRRVELYFSSWIIRAVESSKGEGMS  271

Query  592  ACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQI  413
            ACEV L H+EDMGIP ++AKLGVR GMWG VKK+  G+RAYQ  R TEAPLSRSA MA+I
Sbjct  272  ACEVSLVHYEDMGIPKDVAKLGVRHGMWGTVKKLHSGMRAYQNARKTEAPLSRSALMARI  331

Query  412  NTKVTTDDLR-SLELRRTMSEAEASGSSDKPTGRNIP---------KLLVVGGAVALACS  263
             TK++ D+   SLE         ASG  +K    +I          K +V+GG VAL C 
Sbjct  332  TTKISFDETSDSLE--------PASGEEEKGQVVDIQRKKDKGIDWKWIVIGGTVALVCG  383

Query  262  IDRGLLTKALIFGVARRF  209
            +  G + KAL+ G  +RF
Sbjct  384  LHTGTIGKALLIGAGQRF  401



>ref|XP_011073492.1| PREDICTED: uncharacterized protein LOC105158432 [Sesamum indicum]
Length=460

 Score =   200 bits (508),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 105/198 (53%), Positives = 133/198 (67%), Gaps = 19/198 (10%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW+ G+TY+CVTKGVP   VPR+ KPRRVDLY+SSW I+P  S++ DGQ+
Sbjct  264  SDREYIIGRRIWEGGKTYFCVTKGVPYPSVPRRDKPRRVDLYFSSWVIKPAHSRKGDGQL  323

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEV+L H+EDMGIP ++AKLGVR GMWG VKK+  G RAYQ  R  EA LSR A MA+
Sbjct  324  SACEVMLIHYEDMGIPKDVAKLGVRHGMWGTVKKLHAGFRAYQAARKLEASLSRCALMAR  383

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSD----------KPTGRNIPKLLVVGGAVALAC  266
            I TK++TD+        T S  + SG  +          K  G    K + +GG VAL C
Sbjct  384  ITTKISTDE-------ETDSGEQVSGEEERKELVTTERQKDQGGIDWKWVAIGGTVALVC  436

Query  265  SIDRGLLTKALIFGVARR  212
             +  GL+ +AL+ G  +R
Sbjct  437  GLQTGLIGRALLIGAGQR  454



>ref|XP_003610788.1| Membrane related protein-like protein [Medicago truncatula]
 gb|AES93746.1| mammalian STARD2 lipid-binding START domain protein [Medicago 
truncatula]
Length=436

 Score =   199 bits (506),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 135/192 (70%), Gaps = 4/192 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYII RRIW++G  YYCVTKGVP   +P++ KPRRVDLY+SSW I+P  S++ DGQ+
Sbjct  243  SDREYIIARRIWQAGNAYYCVTKGVPYPSLPKRDKPRRVDLYFSSWVIKPVESRKGDGQL  302

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEV L HHEDMGIP ++AKLGVR GMWGAVKK+  G+RAYQ  R T+A LSR A MA 
Sbjct  303  SACEVTLLHHEDMGIPKDVAKLGVRHGMWGAVKKLHSGMRAYQNARKTDASLSRCALMAS  362

Query  415  INTKVTTD-DLRSLELRRTMSEAEASGSSDKPTGRNIP-KLLVVGGAVALACSIDRGLLT  242
              T+++++ +L SLE    M E E + ++ +  G  +  K + +GG VA+   I  G + 
Sbjct  363  KTTRLSSNGNLHSLEDASLMEEREQAINNARQIGHGLDWKWVALGGTVAVVLGIHSGAVG  422

Query  241  KALIFGVARRFA  206
            +AL+ G   RFA
Sbjct  423  RALLLGAGHRFA  434



>gb|AFK44283.1| unknown [Medicago truncatula]
Length=436

 Score =   199 bits (506),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 135/192 (70%), Gaps = 4/192 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYII RRIW++G  YYCVTKGVP   +P++ KPRRVDLY+SSW I+P  S++ DGQ+
Sbjct  243  SDREYIIARRIWQAGNAYYCVTKGVPYPSLPKRDKPRRVDLYFSSWVIKPVESRKGDGQL  302

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEV L HHEDMGIP ++AKLGVR GMWGAVKK+  G+RAYQ  R T+A LSR A MA 
Sbjct  303  SACEVTLLHHEDMGIPKDVAKLGVRHGMWGAVKKLHSGMRAYQNARKTDASLSRCALMAS  362

Query  415  INTKVTTD-DLRSLELRRTMSEAEASGSSDKPTGRNIP-KLLVVGGAVALACSIDRGLLT  242
              T+++++ +L SLE    M E E + ++ +  G  +  K + +GG VA+   I  G + 
Sbjct  363  KTTRLSSNGNLHSLEDASLMEEREQAINNARQIGHGLDWKWVALGGTVAVVLGIHSGAVG  422

Query  241  KALIFGVARRFA  206
            +AL+ G   RFA
Sbjct  423  RALLLGAGHRFA  434



>gb|AFK35199.1| unknown [Medicago truncatula]
Length=436

 Score =   199 bits (506),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 135/192 (70%), Gaps = 4/192 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYII RRIW++G  YYCVTKGVP   +P++ KPRRVDLY+SSW I+P  S++ DGQ+
Sbjct  243  SDREYIIARRIWQAGNAYYCVTKGVPYPSLPKRDKPRRVDLYFSSWVIKPVESRKGDGQL  302

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEV L HHEDMGIP ++AKLGVR GMWGAVKK+  G+RAYQ  R T+A LSR A MA 
Sbjct  303  SACEVTLLHHEDMGIPKDVAKLGVRHGMWGAVKKLHSGMRAYQNARKTDASLSRCALMAS  362

Query  415  INTKVTTD-DLRSLELRRTMSEAEASGSSDKPTGRNIP-KLLVVGGAVALACSIDRGLLT  242
              T+++++ +L SLE    M E E + ++ +  G  +  K + +GG VA+   I  G + 
Sbjct  363  KTTRLSSNGNLHSLEDASLMEEREQAINNARQIGHGLDWKWVALGGTVAVVLGIHSGAVG  422

Query  241  KALIFGVARRFA  206
            +AL+ G   RFA
Sbjct  423  RALLLGAGHRFA  434



>ref|XP_006838839.1| PREDICTED: uncharacterized protein LOC18429490 [Amborella trichopoda]
 gb|ERN01408.1| hypothetical protein AMTR_s00002p00263850 [Amborella trichopoda]
Length=433

 Score =   199 bits (505),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 102/191 (53%), Positives = 136/191 (71%), Gaps = 3/191 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW+ G+TYYCVTKGVP   +P++ KPRRVDLYYSSW IR   S++ DGQ+
Sbjct  241  SDREYIIGRRIWECGRTYYCVTKGVPYPALPKRDKPRRVDLYYSSWRIRAVESRKGDGQL  300

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEV L H+EDMGIP ++AK+GVR GMWGAVKK+  G+RAYQ  R + A LSR+A +A+
Sbjct  301  SACEVTLVHYEDMGIPKDVAKVGVRHGMWGAVKKLHSGMRAYQLARKSGASLSRTATLAR  360

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIP-KLLVVGGAVALACSIDRGLLTK  239
            INT +      +    ++++E ++  S        +P KL+ + G VAL C +  G++ K
Sbjct  361  INTSIPMGWFSNSLADQSLTEEKSQVSELMKENHGVPWKLVFICGTVALVCGLHTGVVGK  420

Query  238  ALIFGVARRFA  206
            AL+FG ARR A
Sbjct  421  ALLFGAARRLA  431



>ref|XP_010650006.1| PREDICTED: uncharacterized protein LOC100263172 [Vitis vinifera]
Length=439

 Score =   198 bits (504),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 105/197 (53%), Positives = 132/197 (67%), Gaps = 17/197 (9%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKRDGQMT  593
            SDREYIIGRRIW++G+TYYCVTKGVP   +P++ KPRRV+LY+SSW IR   S +   M+
Sbjct  247  SDREYIIGRRIWEAGKTYYCVTKGVPYPGLPKRDKPRRVELYFSSWIIRAVESSKGEGMS  306

Query  592  ACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQI  413
            ACEV L H+EDMGIP ++AKLGVR GMWG VKK+  G+RAYQ  R TEAPLSRSA MA+I
Sbjct  307  ACEVSLVHYEDMGIPKDVAKLGVRHGMWGTVKKLHSGMRAYQNARKTEAPLSRSALMARI  366

Query  412  NTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIP---------KLLVVGGAVALACSI  260
             TK++ D+          S   ASG  +K    +I          K +V+GG VAL C +
Sbjct  367  TTKISFDETSD-------SLEPASGEEEKGQVVDIQRKKDKGIDWKWIVIGGTVALVCGL  419

Query  259  DRGLLTKALIFGVARRF  209
              G + KAL+ G  +RF
Sbjct  420  HTGTIGKALLIGAGQRF  436



>gb|KHN35161.1| StAR-related lipid transfer protein 7, mitochondrial [Glycine 
soja]
Length=357

 Score =   195 bits (495),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 132/192 (69%), Gaps = 4/192 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYII RRIW++G TYYCVTKGVP   +P++ KPRRV+LY+SSW I+P  S++ DGQ+
Sbjct  164  SDREYIIARRIWQAGNTYYCVTKGVPYPSLPKRDKPRRVELYFSSWVIKPVESRKGDGQL  223

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEV L H+EDMGIP ++AKLGVR GMWGAVKK+  G+RAYQ  R TEA LSR A MA 
Sbjct  224  SACEVTLLHYEDMGIPKDVAKLGVRHGMWGAVKKLHSGMRAYQSARKTEASLSRCALMAS  283

Query  415  INTKVTTD-DLRSLELRRTMSEAEASGSSDKPTGRNIP-KLLVVGGAVALACSIDRGLLT  242
              TK+T+D ++ S E    M +   + ++    G  I  K + VGG VAL   +  G + 
Sbjct  284  KTTKITSDANMHSSEPSSCMEDRVQAMNNTAQKGNGIDWKWVAVGGTVALVLGLHTGAVG  343

Query  241  KALIFGVARRFA  206
            +AL+ G   R A
Sbjct  344  RALLLGAGHRIA  355



>ref|XP_004511397.1| PREDICTED: stAR-related lipid transfer protein 7, mitochondrial-like 
[Cicer arietinum]
Length=437

 Score =   195 bits (496),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 131/192 (68%), Gaps = 4/192 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYII RRIW++G  YYCVTKGVP+  +P++ KPRRVDLY+SSW I+P  S++ DGQ+
Sbjct  244  SDREYIIARRIWQAGNAYYCVTKGVPHPSLPKRDKPRRVDLYFSSWVIKPVESRKGDGQL  303

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEV L H+EDMGIP ++AKLGVR GMWGAVKK+  G+RAYQ  R TEA LSR A MA 
Sbjct  304  SACEVTLLHYEDMGIPKDVAKLGVRHGMWGAVKKLHSGMRAYQNARKTEASLSRCAVMAS  363

Query  415  INTKVTTD-DLRSLELRRTMSEAEASGSSDKPTGRNIP-KLLVVGGAVALACSIDRGLLT  242
              TK++ D +  S E    + E   S S+    G  +  K + +GG VA+   I  G + 
Sbjct  364  KTTKISFDRNSHSTEAASCLEERVQSISNTPQNGHGLDWKWVALGGTVAVVLGIHSGAVG  423

Query  241  KALIFGVARRFA  206
            +AL+ G   RFA
Sbjct  424  RALLLGAGHRFA  435



>ref|XP_003537648.1| PREDICTED: stAR-related lipid transfer protein 7, mitochondrial-like 
[Glycine max]
Length=434

 Score =   195 bits (495),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 132/192 (69%), Gaps = 4/192 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYII RRIW++G TYYCVTKGVP   +P++ KPRRV+LY+SSW I+P  S++ DGQ+
Sbjct  241  SDREYIIARRIWQAGNTYYCVTKGVPYPSLPKRDKPRRVELYFSSWVIKPVESRKGDGQL  300

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEV L H+EDMGIP ++AKLGVR GMWGAVKK+  G+RAYQ  R TEA LSR A MA 
Sbjct  301  SACEVTLLHYEDMGIPKDVAKLGVRHGMWGAVKKLHSGMRAYQSARKTEASLSRCALMAS  360

Query  415  INTKVTTD-DLRSLELRRTMSEAEASGSSDKPTGRNIP-KLLVVGGAVALACSIDRGLLT  242
              TK+T+D ++ S E    M +   + ++    G  I  K + VGG VAL   +  G + 
Sbjct  361  KTTKITSDANMHSSEPSSCMEDRVQAMNNTAQKGNGIDWKWVAVGGTVALVLGLHTGAVG  420

Query  241  KALIFGVARRFA  206
            +AL+ G   R A
Sbjct  421  RALLLGAGHRIA  432



>ref|XP_003517561.1| PREDICTED: stAR-related lipid transfer protein 7, mitochondrial-like 
isoform 1 [Glycine max]
Length=434

 Score =   194 bits (492),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 131/192 (68%), Gaps = 4/192 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYII RRIW++G TYYCVTKGVP   +P++ KPRRV+LY+SSW I+P  S++ DGQM
Sbjct  241  SDREYIIARRIWQAGNTYYCVTKGVPYPSLPKRDKPRRVELYFSSWVIKPVESRKGDGQM  300

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEV L H+EDMGIP ++AKLGVR GMWGAVKK+  G+RAYQ  R TEA LSR A MA 
Sbjct  301  SACEVTLLHYEDMGIPKDVAKLGVRHGMWGAVKKLHSGMRAYQNARKTEASLSRCALMAS  360

Query  415  INTKVTTD-DLRSLELRRTMSEAEASGSSDKPTGRNIP-KLLVVGGAVALACSIDRGLLT  242
              TK+++D ++ S E    M +   + S+    G  I  K + VGG VAL   +    + 
Sbjct  361  KTTKISSDTNMHSSEPASCMEDRVQAMSNTAQKGNGIDWKWVAVGGTVALVLGLHTSAVG  420

Query  241  KALIFGVARRFA  206
            +AL+ G   R A
Sbjct  421  RALLLGAGHRIA  432



>ref|XP_008367202.1| PREDICTED: phosphatidylcholine transfer protein-like [Malus domestica]
Length=304

 Score =   190 bits (482),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 99/192 (52%), Positives = 134/192 (70%), Gaps = 4/192 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREY+IGRRIW++G+TYYC+TKGVP   +P++ KPRRV+ Y+SSW I+   S++ DGQ+
Sbjct  110  SDREYLIGRRIWEAGKTYYCLTKGVPYPGLPKRDKPRRVEQYFSSWIIKAVESRKGDGQL  169

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEV L H+EDMGIP ++AKLGVR GMW  VKK+  G+RAYQ  R +EA LS+SA MA+
Sbjct  170  TACEVTLVHYEDMGIPKDVAKLGVRHGMWSTVKKLHSGMRAYQNARKSEACLSQSAQMAK  229

Query  415  INTKVTTD-DLRSLELRRTMSEAEASGSSDKPTGRNIP-KLLVVGGAVALACSIDRGLLT  242
            I TKV++   +  LE      E     ++ +P    I  K +V+GG+VAL C +  G + 
Sbjct  230  ITTKVSSHGSMNYLEPTPGEEEKGQIPNNKRPNESGIDWKWIVIGGSVALVCGLHTGAIG  289

Query  241  KALIFGVARRFA  206
            K L+ G  +RFA
Sbjct  290  KGLLLGAGQRFA  301



>ref|XP_010450029.1| PREDICTED: uncharacterized protein LOC104732193 [Camelina sativa]
Length=428

 Score =   192 bits (489),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 131/190 (69%), Gaps = 3/190 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW+SG+ YYCVTKGVP   +P++ KPRRV+LY+SSW IR   S++ DGQ 
Sbjct  238  SDREYIIGRRIWESGKKYYCVTKGVPYPALPKRDKPRRVELYFSSWVIRAVESRKGDGQQ  297

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEV L H+EDMGIP ++AKLGVR GMWGAVKK++ GLRAYQ  R + +PLS  A MA+
Sbjct  298  TACEVSLVHYEDMGIPKDVAKLGVRHGMWGAVKKLNSGLRAYQAARKSGSPLSHIAQMAR  357

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            I TK++ D   S       S A       +   R   K +VVGG VALAC +  G++ KA
Sbjct  358  ITTKLSMDSAESSSRDEDRSRAMDYARRQRDHLRMDWKWVVVGG-VALACGLHTGVIGKA  416

Query  235  LIFGVARRFA  206
            L+ G  +R A
Sbjct  417  LLAGAGQRLA  426



>emb|CDY16287.1| BnaC01g23220D [Brassica napus]
Length=435

 Score =   192 bits (489),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 131/190 (69%), Gaps = 3/190 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW+SG TYYCVTKGVP   +P++ KPRRV+LY+SSW IR   S++ DGQ+
Sbjct  245  SDREYIIGRRIWESGNTYYCVTKGVPYPALPKRDKPRRVELYFSSWVIRAVESRKGDGQL  304

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEV L H+EDMGIP ++AKLGVR GMWGAVKK++ GLRAYQ  R +++ LSR A MA+
Sbjct  305  SACEVSLVHYEDMGIPKDVAKLGVRHGMWGAVKKLNSGLRAYQTARKSDSSLSRIAQMAR  364

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            I T +  D   S       S A       +   R   K +VVGG VALAC +  G++ KA
Sbjct  365  ITTVLNMDSTESSTGDEDRSRAMGYARRQRDNLRMDWKWVVVGG-VALACGLHTGVIGKA  423

Query  235  LIFGVARRFA  206
            L+ G  +R A
Sbjct  424  LLAGAGQRLA  433



>ref|XP_010087789.1| hypothetical protein L484_016360 [Morus notabilis]
 gb|EXB29870.1| hypothetical protein L484_016360 [Morus notabilis]
Length=435

 Score =   192 bits (488),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 105/194 (54%), Positives = 136/194 (70%), Gaps = 9/194 (5%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW++G++YYCVTK VP   +P++ KPRRV+LY+SSW IR   S++ DGQ+
Sbjct  243  SDREYIIGRRIWEAGKSYYCVTKAVPYPGLPKRDKPRRVELYFSSWFIRAVESRKGDGQL  302

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEV L H+EDMGIP ++AKLGVR GMWGAVKK+  G+RAYQ  R +EA  SRSA MA+
Sbjct  303  SACEVTLLHYEDMGIPKDVAKLGVRHGMWGAVKKLHSGMRAYQNARKSEASFSRSALMAR  362

Query  415  INTKVTTDDLRSLE-LRRTMSEAEASGSSD---KPTGRNIPKLLVVGGAVALACSIDRGL  248
            I TK+  D   S++ L  T  E +     D   K  G +  K LV+GG VAL C +  G+
Sbjct  363  ITTKIPLDG--SMDCLAPTSGEEKVEPVHDGRQKDNGIDW-KWLVLGGTVALVCGLHSGV  419

Query  247  LTKALIFGVARRFA  206
            + KAL+ G  +R A
Sbjct  420  IGKALLLGAGKRIA  433



>ref|XP_011029867.1| PREDICTED: stAR-related lipid transfer protein 7, mitochondrial-like 
[Populus euphratica]
Length=439

 Score =   192 bits (488),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 105/194 (54%), Positives = 135/194 (70%), Gaps = 9/194 (5%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW +G+TYYCVTKGVP   + ++ K RRVDLY+S W IR   S++ DGQM
Sbjct  247  SDREYIIGRRIWDAGKTYYCVTKGVPYPGLHKRDKLRRVDLYFSGWVIRAVESRKGDGQM  306

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEV L H+EDMGIP ++AKLGVR  MWGAVKK+  G+RAYQ  R +EA LSRSA MA+
Sbjct  307  SACEVTLLHYEDMGIPKDVAKLGVRHAMWGAVKKLHSGMRAYQNARKSEASLSRSALMAR  366

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSD----KPTGRNIPKLLVVGGAVALACSIDRGL  248
            I TKV+ D+   ++   T++E + S + D    K  G +  K + VGG VAL C +  G 
Sbjct  367  ITTKVSFDE--GMDSSETVNEEDRSPAVDIQRHKDHGIDW-KWIAVGGTVALVCGLHTGA  423

Query  247  LTKALIFGVARRFA  206
            + KAL+ G  +R A
Sbjct  424  IGKALLLGAGQRLA  437



>ref|XP_010440453.1| PREDICTED: uncharacterized protein LOC104723752 [Camelina sativa]
Length=428

 Score =   192 bits (488),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 130/190 (68%), Gaps = 3/190 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW+SG+ YYCVTKGVP   +P++ KPRRV+LY+SSW IR   S++ DGQ 
Sbjct  238  SDREYIIGRRIWESGKKYYCVTKGVPYPALPKRDKPRRVELYFSSWVIRAVESRKGDGQQ  297

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEV L H+EDMGIP ++AKLGVR GMWGAVKK++ GLRAYQ  R + +PLS  A MA+
Sbjct  298  TACEVSLVHYEDMGIPKDVAKLGVRHGMWGAVKKLNSGLRAYQAARKSGSPLSHIAQMAR  357

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            I TK+  D   S       S A       +   R   K +VVGG VALAC +  G++ KA
Sbjct  358  ITTKLNMDSAESSSRDEDRSRAMDYARRQRDHLRMDWKWVVVGG-VALACGLHTGVIGKA  416

Query  235  LIFGVARRFA  206
            L+ G  +R A
Sbjct  417  LLAGAGQRLA  426



>ref|XP_006283754.1| hypothetical protein CARUB_v10004845mg [Capsella rubella]
 gb|EOA16652.1| hypothetical protein CARUB_v10004845mg [Capsella rubella]
Length=434

 Score =   192 bits (488),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 130/190 (68%), Gaps = 3/190 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW+SG+ YYCVTKGVP   +P++ KPRRV+LY+SSW IR   S++ DGQ 
Sbjct  244  SDREYIIGRRIWESGKKYYCVTKGVPYPALPKRDKPRRVELYFSSWVIRAVESRKGDGQQ  303

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEV L H+EDMGIP ++AKLGVR GMWGAVKK++ GLRAYQ  R + +PLS  A MA+
Sbjct  304  TACEVSLVHYEDMGIPKDVAKLGVRHGMWGAVKKLNSGLRAYQAARKSGSPLSHIAQMAR  363

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            I TK+  D   S       S A       +   R   K +VVGG VALAC +  G++ KA
Sbjct  364  ITTKLNMDSAESSSRDEDRSRAMDYARRQRDHLRMDWKWVVVGG-VALACGLHTGVIGKA  422

Query  235  LIFGVARRFA  206
            L+ G  +R A
Sbjct  423  LLAGAGQRLA  432



>emb|CDY29739.1| BnaA01g19270D [Brassica napus]
Length=340

 Score =   189 bits (481),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 129/190 (68%), Gaps = 3/190 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW+SG  YYCVTKGVP   +P++ KPRRV+LY+SSW IR   S++ DGQ 
Sbjct  150  SDREYIIGRRIWESGNKYYCVTKGVPYPALPKRDKPRRVELYFSSWVIRAVESRKGDGQS  209

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEV L H+EDMGIP ++AKLGVR GMWGAVKK++ GLRAYQ  R +++ LSR A MA+
Sbjct  210  SACEVSLVHYEDMGIPKDVAKLGVRHGMWGAVKKLNSGLRAYQTARKSDSSLSRIAQMAR  269

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            I T +  D   S       S A       +   R   K +VVGG VALAC +  G++ KA
Sbjct  270  ITTVLNMDSTESSTEDEDRSRAMGYARRQRDNLRMDWKWVVVGG-VALACGLHTGVIGKA  328

Query  235  LIFGVARRFA  206
            L+ G  +R A
Sbjct  329  LLAGAGQRLA  338



>ref|XP_010228266.1| PREDICTED: uncharacterized protein LOC100828419 isoform X1 [Brachypodium 
distachyon]
Length=441

 Score =   192 bits (487),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 105/194 (54%), Positives = 132/194 (68%), Gaps = 6/194 (3%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGAS-KRDGQM  596
            SDREYI GRRIW+SG+ Y+CVTKGVP   +P++ KPRRV+LY+SSW IRP  S K+DGQ 
Sbjct  246  SDREYIFGRRIWESGKAYFCVTKGVPYPSLPKKEKPRRVELYFSSWRIRPVQSPKQDGQQ  305

Query  595  -TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMA  419
             TACEV L H+EDMGIP ++AK+GVR GMWGAVKK+  G RAYQ+ R TE  LSRSA MA
Sbjct  306  HTACEVTLVHYEDMGIPKDVAKVGVRHGMWGAVKKLQSGFRAYQQMRDTENILSRSAIMA  365

Query  418  QINTKVT---TDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGL  248
            ++ TK +   +D      L  T   +   G S         K +V+GGAVA  C ++ G+
Sbjct  366  RVTTKTSIAGSDSPLDQGLSSTEKASNKDGDSSAVQQGFDWKWVVIGGAVAAVCVLNTGI  425

Query  247  LTKALIFGVARRFA  206
            + KAL+ G ARR A
Sbjct  426  VGKALLLGAARRQA  439



>ref|XP_008805969.1| PREDICTED: uncharacterized protein LOC103718779 [Phoenix dactylifera]
Length=439

 Score =   191 bits (486),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 103/192 (54%), Positives = 131/192 (68%), Gaps = 4/192 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPNDVPRQS-KPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW+S +TYYC+TK VP    R++ KPRRV+LY+SSW IR   S+R D Q+
Sbjct  246  SDREYIIGRRIWESEKTYYCLTKNVPYPALRKNEKPRRVELYFSSWRIRAVESRRQDAQL  305

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEV L H+EDMGIP ++AK+GVR GMWGAVKK+  G+RAYQ  R T+  LSRSA MA+
Sbjct  306  SACEVTLIHYEDMGIPKDVAKVGVRHGMWGAVKKLQSGMRAYQVMRKTDVTLSRSALMAR  365

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDK-PTGRNIP-KLLVVGGAVALACSIDRGLLT  242
            + TK+  D    L       E+E   + D       I  K +V+GG VA+ C +  GL+ 
Sbjct  366  VTTKIPVDGSIGLLDSEPSHESETGNNDDVIEVHHGIDWKWVVIGGTVAVVCGLQTGLIG  425

Query  241  KALIFGVARRFA  206
            KAL+FG ARR A
Sbjct  426  KALLFGAARRLA  437



>ref|XP_003557464.1| PREDICTED: uncharacterized protein LOC100828419 isoform X2 [Brachypodium 
distachyon]
Length=440

 Score =   191 bits (486),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 105/194 (54%), Positives = 132/194 (68%), Gaps = 6/194 (3%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGAS-KRDGQM  596
            SDREYI GRRIW+SG+ Y+CVTKGVP   +P++ KPRRV+LY+SSW IRP  S K+DGQ 
Sbjct  245  SDREYIFGRRIWESGKAYFCVTKGVPYPSLPKKEKPRRVELYFSSWRIRPVQSPKQDGQQ  304

Query  595  -TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMA  419
             TACEV L H+EDMGIP ++AK+GVR GMWGAVKK+  G RAYQ+ R TE  LSRSA MA
Sbjct  305  HTACEVTLVHYEDMGIPKDVAKVGVRHGMWGAVKKLQSGFRAYQQMRDTENILSRSAIMA  364

Query  418  QINTKVT---TDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGL  248
            ++ TK +   +D      L  T   +   G S         K +V+GGAVA  C ++ G+
Sbjct  365  RVTTKTSIAGSDSPLDQGLSSTEKASNKDGDSSAVQQGFDWKWVVIGGAVAAVCVLNTGI  424

Query  247  LTKALIFGVARRFA  206
            + KAL+ G ARR A
Sbjct  425  VGKALLLGAARRQA  438



>ref|XP_004241025.1| PREDICTED: uncharacterized protein LOC101253385 [Solanum lycopersicum]
Length=454

 Score =   192 bits (487),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 100/194 (52%), Positives = 133/194 (69%), Gaps = 3/194 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW+SG+TYYCVTK VP + + R+ KPRRVDLY+SSW ++P  SK+ DGQ+
Sbjct  260  SDREYIIGRRIWESGKTYYCVTKSVPYSSLQRRDKPRRVDLYFSSWIVKPVESKKGDGQL  319

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEV L H+EDMGIP ++AKLGVR GMWG VKK+  G RAYQ  R +EA +SR A MA+
Sbjct  320  SACEVTLLHYEDMGIPKDVAKLGVRHGMWGTVKKLHNGFRAYQNARKSEAAVSRCAMMAR  379

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            I TK++ D+      + ++ E  A     +  G  I    V  G VA+ C +  G++ KA
Sbjct  380  ITTKISLDENVDALEQVSVEEDRAEIQGQRGDG-GIDWKWVAIGTVAVVCGVRSGMIGKA  438

Query  235  LIFGVARRFAGFGK  194
            ++FG  +R A  G+
Sbjct  439  VLFGAGQRIARRGR  452



>ref|XP_006414699.1| hypothetical protein EUTSA_v10025252mg [Eutrema salsugineum]
 gb|ESQ56152.1| hypothetical protein EUTSA_v10025252mg [Eutrema salsugineum]
Length=432

 Score =   191 bits (485),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 102/190 (54%), Positives = 130/190 (68%), Gaps = 3/190 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW+SG  YYCVTKG+P   +P++ KPRRV+LY+SSW IR   S++ DGQ 
Sbjct  242  SDREYIIGRRIWESGNKYYCVTKGIPYPALPKRDKPRRVELYFSSWVIRAVESRKGDGQQ  301

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEV L H+EDMGIP ++AKLGVR GMWGAVKK++ GLRAYQ  R +++ LSR A MA+
Sbjct  302  SACEVSLVHYEDMGIPKDVAKLGVRHGMWGAVKKLNSGLRAYQTARKSDSSLSRIAQMAR  361

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            I TK+  D + +       S A       +   R   K  VVGG VALAC +  G++ KA
Sbjct  362  ITTKLNMDSIETSTGDEDRSRAIDYARRQRDNLRMDWKWFVVGG-VALACGLHTGVIGKA  420

Query  235  LIFGVARRFA  206
            L+ G  +R A
Sbjct  421  LLAGAGQRLA  430



>ref|XP_008224419.1| PREDICTED: uncharacterized protein LOC103324159 [Prunus mume]
Length=448

 Score =   191 bits (486),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 101/194 (52%), Positives = 134/194 (69%), Gaps = 8/194 (4%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREY+IGRRIW++G+TYYCVTKGVP   +P++ KPRRV+ Y+SSW I+   S++ DGQ+
Sbjct  254  SDREYLIGRRIWEAGKTYYCVTKGVPYPGLPKRDKPRRVEHYFSSWIIKAVESRKGDGQL  313

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEV L H+EDMGIP ++AKLGVR GMW  VKK+  G+RAYQ  R +EA  S+ A MA+
Sbjct  314  SACEVTLVHYEDMGIPKDVAKLGVRHGMWCTVKKLHSGMRAYQNARKSEASPSKCALMAR  373

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIP----KLLVVGGAVALACSIDRGL  248
            I TKV++D   S+      S  E  G + K T +N      K +V+GG VAL C +  G 
Sbjct  374  ITTKVSSDG--SMNYLEPASGEEEKGQTIKNTRQNDNGIDWKWIVIGGTVALVCGLHTGA  431

Query  247  LTKALIFGVARRFA  206
            + K L+ GV +RFA
Sbjct  432  IGKGLLLGVGQRFA  445



>dbj|BAC83004.1| putative membrane related protein CP5 [Oryza sativa Japonica 
Group]
 dbj|BAC83191.1| putative membrane related protein CP5 [Oryza sativa Japonica 
Group]
Length=394

 Score =   190 bits (482),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 104/194 (54%), Positives = 130/194 (67%), Gaps = 11/194 (6%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSSWCIRPGAS-KRDGQM  596
            SDREYI GRRIW+SG+TYYCVTKGVP   +P++ KPRRV+LY+SSW IR   S K+DGQ 
Sbjct  199  SDREYIFGRRIWESGKTYYCVTKGVPYPALPKKEKPRRVELYFSSWRIRAVQSPKQDGQQ  258

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEV L H+EDMGIP ++AK+GVR GMWGAVKK   G RAYQ+ R TE  LSRSA MA+
Sbjct  259  SACEVTLVHYEDMGIPKDVAKVGVRHGMWGAVKKFQSGFRAYQQMRDTENTLSRSAIMAR  318

Query  415  INTKVTTD------DLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDR  254
            + TK +        D       +T+ E+E S +          K +V GGAVA  C ++ 
Sbjct  319  VTTKTSIASSSCPLDQEPSNAAKTIDESENSRAVQPGFDW---KWVVFGGAVAAVCVLNT  375

Query  253  GLLTKALIFGVARR  212
            GL+ KAL+ G A R
Sbjct  376  GLVGKALLIGAASR  389



>ref|NP_001059064.1| Os07g0185200 [Oryza sativa Japonica Group]
 dbj|BAF20978.1| Os07g0185200 [Oryza sativa Japonica Group]
Length=395

 Score =   190 bits (482),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 104/194 (54%), Positives = 130/194 (67%), Gaps = 11/194 (6%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSSWCIRPGAS-KRDGQM  596
            SDREYI GRRIW+SG+TYYCVTKGVP   +P++ KPRRV+LY+SSW IR   S K+DGQ 
Sbjct  200  SDREYIFGRRIWESGKTYYCVTKGVPYPALPKKEKPRRVELYFSSWRIRAVQSPKQDGQQ  259

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEV L H+EDMGIP ++AK+GVR GMWGAVKK   G RAYQ+ R TE  LSRSA MA+
Sbjct  260  SACEVTLVHYEDMGIPKDVAKVGVRHGMWGAVKKFQSGFRAYQQMRDTENTLSRSAIMAR  319

Query  415  INTKVTTD------DLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDR  254
            + TK +        D       +T+ E+E S +          K +V GGAVA  C ++ 
Sbjct  320  VTTKTSIASSSCPLDQEPSNAAKTIDESENSRAVQPGFDW---KWVVFGGAVAAVCVLNT  376

Query  253  GLLTKALIFGVARR  212
            GL+ KAL+ G A R
Sbjct  377  GLVGKALLIGAASR  390



>ref|XP_010278112.1| PREDICTED: stAR-related lipid transfer protein 7, mitochondrial-like 
[Nelumbo nucifera]
Length=438

 Score =   191 bits (485),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 100/192 (52%), Positives = 137/192 (71%), Gaps = 4/192 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGR+IW+SG+TYYCVTKGVP   + +++KP+RV+LY+SSW I+   S++ DGQ+
Sbjct  245  SDREYIIGRQIWESGKTYYCVTKGVPYPGLEKRNKPKRVELYFSSWIIKAVESRKGDGQL  304

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEV+L H+EDMGIP ++AKLGVR GM GAVKK+  G+R+YQ  R + APLSR A MAQ
Sbjct  305  SACEVILVHYEDMGIPKDVAKLGVRHGMRGAVKKLHSGMRSYQLARKSGAPLSRCAQMAQ  364

Query  415  INTKVTTDD-LRSLELRRTMSEAEASGSSDKPTGRNIP-KLLVVGGAVALACSIDRGLLT  242
            I TK+  DD   S+E      E + +    +        K +++GG+VAL C +  G++ 
Sbjct  365  ITTKIPVDDSTDSVESLSVEQEKDQTMDFQRKVDLGFDWKWVLIGGSVALLCGLRTGVIG  424

Query  241  KALIFGVARRFA  206
            KAL+FG AR+ A
Sbjct  425  KALLFGAARKLA  436



>ref|XP_010274161.1| PREDICTED: stAR-related lipid transfer protein 7, mitochondrial-like 
[Nelumbo nucifera]
Length=440

 Score =   191 bits (484),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 101/195 (52%), Positives = 133/195 (68%), Gaps = 9/195 (5%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW+SG+TYYCVTKGVP   + ++ KPRRVDLY+SSW I+   S++ DGQ+
Sbjct  246  SDREYIIGRRIWESGKTYYCVTKGVPYPGLQKRDKPRRVDLYFSSWIIKTVESRKGDGQL  305

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEV+L H+EDMGIP ++AKLGVR GMWGAVKK+  G+RAYQ  R + + LSR A MAQ
Sbjct  306  SACEVILVHYEDMGIPKDVAKLGVRHGMWGAVKKLHSGMRAYQLARKSGSSLSRCAQMAQ  365

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIP-----KLLVVGGAVALACSIDRG  251
            I T +  +D  S      +S  E  G +     R +      K + +GG VA+ C +  G
Sbjct  366  ITTTIPVND--STNSLDPVSVEEERGQTVNLQQRKVDHGFDWKWVFIGGTVAVVCGLQTG  423

Query  250  LLTKALIFGVARRFA  206
            ++ +AL+ G ARR A
Sbjct  424  IIGRALLLGAARRVA  438



>ref|XP_012069777.1| PREDICTED: uncharacterized protein LOC105632095 [Jatropha curcas]
 gb|KDP40284.1| hypothetical protein JCGZ_02282 [Jatropha curcas]
Length=442

 Score =   191 bits (484),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 102/200 (51%), Positives = 134/200 (67%), Gaps = 20/200 (10%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSSWCIRPGAS-KRDGQM  596
            SDREYIIGRRIW++ +TYYCVTKGVP   +P++ KPRRV+ Y+SSW IR   S K DGQM
Sbjct  249  SDREYIIGRRIWEADKTYYCVTKGVPYPALPKRDKPRRVEHYFSSWVIRTVESCKGDGQM  308

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEV L H+EDMGIP ++AKLG+R GMWG VKK+  G+RAYQ  R ++APLSRSA MA+
Sbjct  309  SACEVTLLHYEDMGIPKDVAKLGLRHGMWGTVKKLHSGMRAYQNARKSDAPLSRSALMAR  368

Query  415  INTKVTTDDLRSLELRRTMSEAE-ASGSSDKPTGRNIP---------KLLVVGGAVALAC  266
            I TK++ ++        +M  +E  +G  DK     I          K +V+GG VAL C
Sbjct  369  ITTKISFNE--------SMDSSEPVTGEEDKGQVVGIQRQKDCGLDWKWIVIGGTVALVC  420

Query  265  SIDRGLLTKALIFGVARRFA  206
             +  G + K+L+ G  +R A
Sbjct  421  GLHSGAIGKSLLLGAGQRIA  440



>gb|EEE66698.1| hypothetical protein OsJ_23361 [Oryza sativa Japonica Group]
Length=388

 Score =   189 bits (481),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 105/194 (54%), Positives = 132/194 (68%), Gaps = 11/194 (6%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSSWCIRPGAS-KRDGQM  596
            SDREYI GRRIW+SG+TYYCVTKGVP   +P++ KPRRV+LY+SSW IR   S K+DGQ 
Sbjct  193  SDREYIFGRRIWESGKTYYCVTKGVPYPALPKKEKPRRVELYFSSWRIRAVQSPKQDGQQ  252

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEV L H+EDMGIP ++AK+GVR GMWGAVKK   G RAYQ+ R TE  LSRSA MA+
Sbjct  253  SACEVTLVHYEDMGIPKDVAKVGVRHGMWGAVKKFQSGFRAYQQMRDTENTLSRSAIMAR  312

Query  415  INTKVTTD------DLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDR  254
            + TK +        D       +T+ E+E S +     G +  K +V GGAVA  C ++ 
Sbjct  313  VTTKTSIASSSCPLDQEPSNAAKTIDESENSRAVQP--GFDW-KWVVFGGAVAAVCVLNT  369

Query  253  GLLTKALIFGVARR  212
            GL+ KAL+ G A R
Sbjct  370  GLVGKALLIGAASR  383



>ref|XP_010936383.1| PREDICTED: uncharacterized protein LOC105056016 [Elaeis guineensis]
Length=441

 Score =   190 bits (483),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 105/194 (54%), Positives = 135/194 (70%), Gaps = 6/194 (3%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW+SG+TYYCVTKGVP   + +  KPRRV+L++SSW IR   S+R D Q+
Sbjct  246  SDREYIIGRRIWESGKTYYCVTKGVPYPALCKNEKPRRVELFFSSWRIRAVESRRQDAQL  305

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEV L H+EDMGIP ++AK+GVR GMWGAVKK+  G+RAYQ  R T+   SRSA MA 
Sbjct  306  SACEVTLIHYEDMGIPKDVAKVGVRHGMWGAVKKLQSGMRAYQVMRKTDITPSRSALMAC  365

Query  415  INTKVTTD-DLRSLELRRTMSEAEASGSSD--KPTGRNIP-KLLVVGGAVALACSIDRGL  248
            I TK+  D  +  L+     S A  +G++D      + I  K +V+GG VA+ C +  GL
Sbjct  366  ITTKIPIDGTVGLLDPEPEPSNASEAGNNDDAHEVHQGIDWKWVVIGGTVAVVCGLQTGL  425

Query  247  LTKALIFGVARRFA  206
            + KAL+FG ARR A
Sbjct  426  IGKALLFGAARRLA  439



>ref|NP_567433.1| polyketide cyclase/dehydrase and lipid transport superfamily 
protein [Arabidopsis thaliana]
 gb|AAL16115.1|AF428283_1 AT4g14500/dl3290w [Arabidopsis thaliana]
 gb|AAM97025.1| expressed protein [Arabidopsis thaliana]
 gb|AAP49510.1| At4g14500 [Arabidopsis thaliana]
 gb|AEE83451.1| polyketide cyclase/dehydrase and lipid transport superfamily 
protein [Arabidopsis thaliana]
Length=433

 Score =   190 bits (483),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 132/190 (69%), Gaps = 4/190 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW+SG+ YYCVTKGVP   +P++ KPRRV+LY+SSW IR   S++ DGQ 
Sbjct  244  SDREYIIGRRIWESGKKYYCVTKGVPYPALPKRDKPRRVELYFSSWVIRAVESRKGDGQQ  303

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEV L H+EDMGIP ++AKLGVR GMWGAVKK++ GLRAYQ  R +++ LSR A MA+
Sbjct  304  TACEVSLVHYEDMGIPKDVAKLGVRHGMWGAVKKLNSGLRAYQSARKSDSSLSRIAQMAR  363

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            I TK+  D   S       S A    +  +   R   K +VVGG VALAC +  G++ KA
Sbjct  364  ITTKLNMDSAESSSRDEDRSRA-MEYARQRDHLRMDWKWVVVGG-VALACGLHSGIIGKA  421

Query  235  LIFGVARRFA  206
            L+ G  +R A
Sbjct  422  LLAGAGQRLA  431



>ref|XP_006658340.1| PREDICTED: uncharacterized protein LOC102707324 [Oryza brachyantha]
Length=424

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 103/192 (54%), Positives = 131/192 (68%), Gaps = 7/192 (4%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSSWCIRPGAS-KRDGQM  596
            SDREYI G+RIW+SG+TYYCVTKGVP   +P++ KPRRV+LY+SSW IR   S K+DGQ 
Sbjct  229  SDREYIFGQRIWESGKTYYCVTKGVPYPALPKKEKPRRVELYFSSWRIRAVPSPKQDGQQ  288

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEV L H+EDMGIP ++AK+GVR GMWGAVKK   G RAYQ+ R TE  LSRSA MA+
Sbjct  289  SACEVTLVHYEDMGIPKDVAKVGVRHGMWGAVKKFQSGFRAYQQMRNTENTLSRSAVMAR  348

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIP----KLLVVGGAVALACSIDRGL  248
            + TK +     S  L +  S A  +   ++ +    P    K +V GGAVA  C ++ GL
Sbjct  349  VTTKTSVAS-SSCSLDQEHSSATKTIDENENSRAVQPGLDWKWVVFGGAVAAVCVLNTGL  407

Query  247  LTKALIFGVARR  212
            + KAL+ G A R
Sbjct  408  VGKALLIGAATR  419



>ref|XP_010435117.1| PREDICTED: uncharacterized protein LOC104718985 [Camelina sativa]
Length=429

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 130/190 (68%), Gaps = 3/190 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDR+YIIGRRIW+SG+ +YCVTKGVP   +P++ KPRRV+LY+SSW IR   S++ DGQ 
Sbjct  239  SDRDYIIGRRIWESGKKFYCVTKGVPYPALPKRDKPRRVELYFSSWVIRAVESRKGDGQQ  298

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEV L H+EDMGIP ++AKLGVR GMWGAVKK++ GLRAYQ  R + +PLS  A MA+
Sbjct  299  TACEVSLVHYEDMGIPKDVAKLGVRHGMWGAVKKLNSGLRAYQAARKSGSPLSHIAQMAR  358

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            I TK+  D   S       S A       +   R   K +VVGG VALAC +  G++ KA
Sbjct  359  ITTKLNMDSAESSSRDEDRSRAMDYARRQRDHLRMDWKWVVVGG-VALACGLHTGVIGKA  417

Query  235  LIFGVARRFA  206
            L+ G  +R A
Sbjct  418  LLAGAGQRLA  427



>ref|XP_009347795.1| PREDICTED: stAR-related lipid transfer protein 7, mitochondrial-like 
[Pyrus x bretschneideri]
Length=441

 Score =   190 bits (482),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 99/192 (52%), Positives = 135/192 (70%), Gaps = 4/192 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREY+IGRRIW++G+TYYCVTKGVP   +P++ KPRRV+ Y+SSW I+   S++ DGQ+
Sbjct  247  SDREYLIGRRIWEAGKTYYCVTKGVPYPGLPKRDKPRRVEHYFSSWIIKAVESRKGDGQL  306

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
             ACEV L H+EDMGIP ++AKLGVR GMW  VKK+  G+RAYQ  R +EA LS+SA MA+
Sbjct  307  PACEVTLAHYEDMGIPKDVAKLGVRHGMWCTVKKLHSGMRAYQNVRKSEAALSQSAQMAK  366

Query  415  INTKVTTD-DLRSLELRRTMSEAEASGSSDKPTGRNIP-KLLVVGGAVALACSIDRGLLT  242
            I TKV+++  +  LE      E     ++ +P    I  K +V+GG+VAL C +  G++ 
Sbjct  367  ITTKVSSNGSMNHLEPSPGEEEKGQIPNNKRPNENGIDWKWIVIGGSVALVCGLHTGVIG  426

Query  241  KALIFGVARRFA  206
            K L+ G  +RFA
Sbjct  427  KGLLLGAGQRFA  438



>gb|KFK32485.1| hypothetical protein AALP_AA6G248600 [Arabis alpina]
Length=423

 Score =   189 bits (480),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 106/196 (54%), Positives = 133/196 (68%), Gaps = 9/196 (5%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW+SG  YYCVTKGVP   +P++ KPRRV+LY+SSW IR   S++ DGQ+
Sbjct  232  SDREYIIGRRIWESGNKYYCVTKGVPYPALPKRDKPRRVELYFSSWVIRAVESRKGDGQL  291

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEV L H+EDMGIP ++AKLGVR GMWGAVKK++ GLRAYQ  R +++ LSR A MA+
Sbjct  292  SACEVSLVHYEDMGIPKDVAKLGVRHGMWGAVKKLNAGLRAYQNVRKSDSSLSRIAQMAR  351

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            I TK+  D   S       S A       +   R   K +VVGG VALAC +  G++ KA
Sbjct  352  ITTKLNMDSAESSTSDEDRSRAMDYARRQRDNLRMDWKWIVVGG-VALACGLHSGVIGKA  410

Query  235  LIFGVARRFAGFGKRL  188
            L+       AG G+RL
Sbjct  411  LL------AAGAGQRL  420



>ref|XP_007222114.1| hypothetical protein PRUPE_ppa005679mg [Prunus persica]
 gb|EMJ23313.1| hypothetical protein PRUPE_ppa005679mg [Prunus persica]
Length=448

 Score =   190 bits (482),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 100/194 (52%), Positives = 133/194 (69%), Gaps = 8/194 (4%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREY+IGRRIW++G+TYYCVTKGVP   +P++ KPRRV+ Y+SSW I+   S++ DGQ+
Sbjct  254  SDREYLIGRRIWEAGKTYYCVTKGVPYPGLPKRDKPRRVEHYFSSWIIKAVESRKGDGQL  313

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEV L H+EDMGIP ++AKLGVR GMW  VKK+  G+RAYQ  R +EA  S+ A MA+
Sbjct  314  SACEVTLVHYEDMGIPKDVAKLGVRHGMWCTVKKLHSGMRAYQNARKSEASPSKCALMAR  373

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIP----KLLVVGGAVALACSIDRGL  248
            I TKV++D   S+      S  E  G + K T +N      K +V+GG VAL C +  G 
Sbjct  374  ITTKVSSDG--SMNYLEPASGEEEKGQTIKNTRQNDNGIDWKWIVIGGTVALVCGLHTGA  431

Query  247  LTKALIFGVARRFA  206
            + K L+ G  +RFA
Sbjct  432  IGKGLLLGAGQRFA  445



>gb|EEC81632.1| hypothetical protein OsI_25162 [Oryza sativa Indica Group]
Length=442

 Score =   189 bits (481),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 105/194 (54%), Positives = 132/194 (68%), Gaps = 11/194 (6%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSSWCIRPGAS-KRDGQM  596
            SDREYI GRRIW+SG+TYYCVTKGVP   +P++ KPRRV+LY+SSW IR   S K+DGQ 
Sbjct  247  SDREYIFGRRIWESGKTYYCVTKGVPYPALPKKEKPRRVELYFSSWRIRAVQSPKQDGQQ  306

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEV L H+EDMGIP ++AK+GVR GMWGAVKK   G RAYQ+ R TE  LSRSA MA+
Sbjct  307  SACEVTLVHYEDMGIPKDVAKVGVRHGMWGAVKKFQSGFRAYQQMRDTENTLSRSAIMAR  366

Query  415  INTKVTTD------DLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDR  254
            + TK +        D       +T+ E+E S +     G +  K +V GGAVA  C ++ 
Sbjct  367  VTTKTSIASSSCPLDQEPSNAAKTIDESENSRAVQP--GFDW-KWVVFGGAVAAVCVLNT  423

Query  253  GLLTKALIFGVARR  212
            GL+ KAL+ G A R
Sbjct  424  GLVGKALLIGAASR  437



>ref|XP_009148805.1| PREDICTED: uncharacterized protein LOC103872218 [Brassica rapa]
Length=459

 Score =   189 bits (481),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 129/190 (68%), Gaps = 3/190 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW+SG  YYCVTKGVP   +P++ KPRRV+LY+SSW IR   S++ DGQ 
Sbjct  269  SDREYIIGRRIWESGNKYYCVTKGVPYPALPKRDKPRRVELYFSSWVIRAVESRKGDGQS  328

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEV L H+EDMGIP ++AKLGVR GMWGAVKK++ GLRAYQ  R +++ LSR A MA+
Sbjct  329  SACEVSLVHYEDMGIPKDVAKLGVRHGMWGAVKKLNSGLRAYQTARKSDSSLSRIAQMAR  388

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            I T +  D   S       S A       +   R   K +VVGG VALAC +  G++ KA
Sbjct  389  ITTVLNMDSTESSTEDEDRSRAMGYARRQRDNLRMDWKWVVVGG-VALACGLHTGVIGKA  447

Query  235  LIFGVARRFA  206
            L+ G  +R A
Sbjct  448  LLAGAGQRLA  457



>ref|XP_009378796.1| PREDICTED: stAR-related lipid transfer protein 7, mitochondrial-like 
[Pyrus x bretschneideri]
Length=441

 Score =   189 bits (479),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 100/192 (52%), Positives = 134/192 (70%), Gaps = 4/192 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSSWCIRPGAS-KRDGQM  596
            SDREY+IGRRIW++G+TYYCVTKGVP   +P++ KPRRV+ Y+SSW I+   S K DGQ+
Sbjct  247  SDREYLIGRRIWEAGKTYYCVTKGVPYPGLPKRDKPRRVEHYFSSWIIKAVESWKGDGQL  306

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
             ACEV L H+EDMGIP ++AKLGVR GMW  VKK+  G+RAYQ  R +EA LS+SA MA+
Sbjct  307  PACEVTLAHYEDMGIPKDVAKLGVRHGMWCTVKKLHSGMRAYQNVRKSEAALSQSAQMAK  366

Query  415  INTKVTTD-DLRSLELRRTMSEAEASGSSDKPTGRNIP-KLLVVGGAVALACSIDRGLLT  242
            I TKV+++  +  LE      E     ++ +P    I  K +V+GG+VAL C +  G++ 
Sbjct  367  ITTKVSSNGSMNHLEPSPGEEEKGQIPNNKRPNENGIDWKWIVIGGSVALVCGLHTGVIG  426

Query  241  KALIFGVARRFA  206
            K L+ G  +RFA
Sbjct  427  KGLLLGAGQRFA  438



>tpg|DAA36543.1| TPA: hypothetical protein ZEAMMB73_493286 [Zea mays]
Length=277

 Score =   184 bits (468),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 100/193 (52%), Positives = 131/193 (68%), Gaps = 5/193 (3%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGAS-KRDGQM  596
            SDREYI G RIW+SG+TYYCVTKGVP   +P++ KPRRV+LY+SSW IR   S K  GQ 
Sbjct  83   SDREYIFGGRIWESGKTYYCVTKGVPYPSLPKKEKPRRVELYFSSWRIRAVQSPKHVGQQ  142

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEV L H+EDMGIP ++A++ VR GMWGAVKK+  G RAYQ+ R TE  LS S  MA+
Sbjct  143  SACEVTLVHYEDMGIPKDVARVAVRHGMWGAVKKLQSGFRAYQQMRHTETTLSHSVIMAR  202

Query  415  INTKVT---TDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLL  245
            + TK++   ++D    +L      ++ + SS+        K LVVGGAVA  C ++ GL+
Sbjct  203  MTTKISITASNDPLDHDLSVADKISDENDSSNAVQHGFDWKWLVVGGAVAAVCVLNTGLV  262

Query  244  TKALIFGVARRFA  206
             KA++ G ARR A
Sbjct  263  GKAVLLGAARRQA  275



>ref|XP_002870309.1| hypothetical protein ARALYDRAFT_493456 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46568.1| hypothetical protein ARALYDRAFT_493456 [Arabidopsis lyrata subsp. 
lyrata]
Length=429

 Score =   188 bits (478),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 127/189 (67%), Gaps = 2/189 (1%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSSWCIRPGASKRDGQMT  593
            SDREYIIGRRIW+SG  YYCVTKGVP   +P++ KPRRV+LY+SSW IR   S++   +T
Sbjct  240  SDREYIIGRRIWESGNKYYCVTKGVPYPALPKRDKPRRVELYFSSWVIRAVESRKGDGLT  299

Query  592  ACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQI  413
            ACEV L H+EDMGIP ++AKLGVR GMWGAVKK++ GLRAYQ  R +++ LSR A MA+I
Sbjct  300  ACEVSLVHYEDMGIPKDVAKLGVRHGMWGAVKKLNSGLRAYQSARKSDSSLSRIAQMARI  359

Query  412  NTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKAL  233
             TK+  D   S       S         +   R   K +VVGG VALAC +  G++ KAL
Sbjct  360  TTKLNMDSAESSSRDEDRSRTMDYARRQRDHLRMDWKWVVVGG-VALACGLHTGIIGKAL  418

Query  232  IFGVARRFA  206
            + G  +R A
Sbjct  419  LAGAGQRLA  427



>ref|XP_008362030.1| PREDICTED: uncharacterized protein LOC103425717 [Malus domestica]
Length=441

 Score =   189 bits (479),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 99/192 (52%), Positives = 133/192 (69%), Gaps = 4/192 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREY+IGRRIW +G+TYYCVTKGVP   +P+  KPRRV+ Y+SSW I+   S++ DGQ+
Sbjct  247  SDREYLIGRRIWVAGKTYYCVTKGVPYPGLPKCDKPRRVEHYFSSWIIKAVESQKGDGQL  306

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEV L H+EDMGIP ++AKLGVR GMW  VKK+  G+RAYQ  R +EA LS+SA MA+
Sbjct  307  SACEVTLVHYEDMGIPKDVAKLGVRHGMWCTVKKLHSGMRAYQNARKSEAALSQSAQMAK  366

Query  415  INTKVTTD-DLRSLELRRTMSEAEASGSSDKPTGRNIP-KLLVVGGAVALACSIDRGLLT  242
            I T V++D  +  LE      E     ++ +P    I  K +V+GG+VAL C +  G++ 
Sbjct  367  ITTXVSSDGSMNHLEPSPGEEEKGQIPNNKRPNENGIDWKWIVIGGSVALVCGLHTGVIG  426

Query  241  KALIFGVARRFA  206
            K L+ G  +RFA
Sbjct  427  KGLLLGAGQRFA  438



>gb|KCW60440.1| hypothetical protein EUGRSUZ_H03157 [Eucalyptus grandis]
Length=437

 Score =   188 bits (478),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 101/197 (51%), Positives = 129/197 (65%), Gaps = 18/197 (9%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW++G+TYYCVTKGVP   +P++ KPRRV+LY+SSW I+   S++ DGQ+
Sbjct  244  SDREYIIGRRIWEAGKTYYCVTKGVPYPGLPKRDKPRRVELYFSSWVIKAVESRKGDGQL  303

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEV L H+EDMGIP ++AKLGVR GMWG VKK+  G+RAYQ  R TEA LSRSA MA+
Sbjct  304  SACEVTLVHYEDMGIPKDVAKLGVRHGMWGTVKKLHSGMRAYQNARKTEASLSRSALMAK  363

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIP---------KLLVVGGAVALACS  263
            I TK++ D         + S    SG  D+  G  I          K + V G VA+   
Sbjct  364  ITTKISFDG-------NSDSMEPVSGEEDRDHGMEIERRQDNGLDWKWVAVAGTVAVLFG  416

Query  262  IDRGLLTKALIFGVARR  212
            +  G++ KAL  G   R
Sbjct  417  LHTGVIGKALFIGAGNR  433



>ref|XP_010527394.1| PREDICTED: uncharacterized protein LOC104804749 [Tarenaya hassleriana]
Length=439

 Score =   188 bits (478),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 106/194 (55%), Positives = 135/194 (70%), Gaps = 10/194 (5%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSSWCIRPGAS-KRDGQM  596
            SDREYIIGRRIW++G TYYCVTKG+P   +P+++KPRR++LY+SSW IR   S KRDGQ 
Sbjct  248  SDREYIIGRRIWEAGNTYYCVTKGIPYPALPKRAKPRRIELYFSSWVIRAVESRKRDGQK  307

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEV+L H+EDMGIP ++AKLGVR GMWGAVKK++ GLRAYQ  R T + LSR A +A 
Sbjct  308  TACEVMLVHYEDMGIPKDVAKLGVRHGMWGAVKKLNSGLRAYQNARKTGSYLSRMAEIAG  367

Query  415  INTKVTTD----DLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGL  248
            I TK+  D     LR  +  R + E EA    D+   R   K + +GG +ALAC +  G 
Sbjct  368  ITTKLNADSVETSLRDEDKTRVLDE-EARRQRDQL--RVDWKWIAIGG-LALACGLHSGA  423

Query  247  LTKALIFGVARRFA  206
            + KAL+ G  +R A
Sbjct  424  IGKALLAGAGQRLA  437



>emb|CDY62128.1| BnaC08g47370D [Brassica napus]
Length=434

 Score =   188 bits (477),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 128/190 (67%), Gaps = 3/190 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW+SG  YYCVTKGVP   +P++ KPRRV+LY+SSW IR   S++ DGQ 
Sbjct  244  SDREYIIGRRIWESGNKYYCVTKGVPYPALPKRDKPRRVELYFSSWVIRAVESRKGDGQP  303

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEV L H+EDMGIP ++AKLGVR GMWGAVKK+  GLRAYQ  R +++ LSR A MA+
Sbjct  304  TACEVSLVHYEDMGIPKDVAKLGVRHGMWGAVKKLHSGLRAYQTGRKSDSSLSRIAQMAR  363

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            I T +  D   S       S A       +   R   K +VVGG VALAC +  G++ KA
Sbjct  364  ITTVLDMDSTESSTSDEDRSRAMGYARRQRDNLRVDWKWVVVGG-VALACGLHTGVIGKA  422

Query  235  LIFGVARRFA  206
            L+ G  +R A
Sbjct  423  LLAGAGQRLA  432



>emb|CDY14327.1| BnaA10g07280D [Brassica napus]
Length=374

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 2/130 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREY+IGRRIW  G++YYCVTKGV    +PR +K +RV+L+YSSWCIRP  S+R DG  
Sbjct  235  SDREYVIGRRIWNCGKSYYCVTKGVSVPCIPRNNKQKRVELFYSSWCIRPVESRREDGVA  294

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEVLLFHHEDMGIP EIAKLGV++GMWGAVKK++PGLRAYQ+ R + + LSR A MAQ
Sbjct  295  SACEVLLFHHEDMGIPREIAKLGVKRGMWGAVKKMEPGLRAYQEQRLSGSKLSRPALMAQ  354

Query  415  INTKVTTDDL  386
            INTKVT++ L
Sbjct  355  INTKVTSEHL  364



>ref|XP_002314649.1| hypothetical protein POPTR_0010s08690g [Populus trichocarpa]
 gb|EEF00820.1| hypothetical protein POPTR_0010s08690g [Populus trichocarpa]
Length=429

 Score =   187 bits (476),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 103/199 (52%), Positives = 128/199 (64%), Gaps = 17/199 (9%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW + +  YCVTKGVP   + ++ KPRRVDLY+SSW IR   S+R DGQM
Sbjct  235  SDREYIIGRRIWDARKASYCVTKGVPYPGLHKRDKPRRVDLYFSSWVIRAVESRRGDGQM  294

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEV L H+EDMGIP ++AKLGVR GMWGAVKK+  G+RAYQ  R +EA LSRSA MA+
Sbjct  295  SACEVTLLHYEDMGIPKDVAKLGVRHGMWGAVKKLHSGMRAYQNARKSEASLSRSALMAR  354

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIP---------KLLVVGGAVALACS  263
            I TK++ D+          SE    G  DK    +I          K + +GG V L C 
Sbjct  355  ITTKISFDE------GMDSSEPVTGGEEDKSQAVDIQRHNDHGIDWKWIAIGGTVTLVCC  408

Query  262  IDRGLLTKALIFGVARRFA  206
            +  G + KAL+ G  +R A
Sbjct  409  LHSGAIGKALLLGAGQRIA  427



>emb|CDY47149.1| BnaA08g05340D [Brassica napus]
Length=434

 Score =   187 bits (476),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 128/190 (67%), Gaps = 3/190 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW+SG  YYCVTKGVP   +P++ KPRRV+LY+SSW IR   S++ DGQ 
Sbjct  244  SDREYIIGRRIWESGNKYYCVTKGVPYPALPKRDKPRRVELYFSSWVIRAVESRKGDGQP  303

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEV L H+EDMGIP ++AKLGVR GMWGAVKK+  GLRAYQ  R +++ LSR A MA+
Sbjct  304  TACEVSLVHYEDMGIPKDVAKLGVRHGMWGAVKKLHSGLRAYQTGRKSDSSLSRIAQMAR  363

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            I T +  D   S       S A       +   R   K +VVGG VALAC +  G++ KA
Sbjct  364  ITTVLDMDSTESSTSDEDRSRAMGYARRQRDNLRVDWKWVVVGG-VALACGLHTGVIGKA  422

Query  235  LIFGVARRFA  206
            L+ G  +R A
Sbjct  423  LLAGAGQRLA  432



>ref|XP_006844764.2| PREDICTED: uncharacterized protein LOC18434637 [Amborella trichopoda]
Length=451

 Score =   188 bits (477),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 105/199 (53%), Positives = 139/199 (70%), Gaps = 7/199 (4%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYII RRIW+ G+TYYC+TK  P   +PR  KPRRVDLYYSSW IR   S++ DGQ+
Sbjct  248  SDREYIINRRIWEYGRTYYCLTKSTPYRSLPRLRKPRRVDLYYSSWRIRAVKSRKGDGQL  307

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TA EVLLFH+EDMGIP E+AK+G+ + MWG V+K++ G++AY+  +AT A  SR A MA+
Sbjct  308  TASEVLLFHYEDMGIPKELAKIGIGRAMWGLVRKMEAGVQAYRVAQATGASPSRYALMAR  367

Query  415  INTKVTTDDLRSLELRRTMSEAEASG---SSDKPTGR-NIPKLLVVGGAVALACSIDRGL  248
            INTK++ D L S  L+  + E    G     ++P  R N+ K L+VGG + + C +DRGL
Sbjct  368  INTKISADGL-STNLKDALDEIGRDGEVREYERPKERKNVVKWLIVGGVIVVVCGLDRGL  426

Query  247  LTKALIFGVARRFAGFGKR  191
            ++K L+FG  R F   GKR
Sbjct  427  ISKGLLFGFMRGFNKLGKR  445



>ref|XP_006350666.1| PREDICTED: uncharacterized protein LOC102588037 [Solanum tuberosum]
Length=461

 Score =   187 bits (476),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 98/194 (51%), Positives = 129/194 (66%), Gaps = 2/194 (1%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYII RRIW+SG+TYYCVTK VP   + R+ KPRRVDLY+SSW ++P  SK+ DGQ+
Sbjct  265  SDREYIISRRIWESGKTYYCVTKSVPYPSLQRRDKPRRVDLYFSSWIVKPVESKKGDGQL  324

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEV L H+EDMGIP ++AKLGVR GMWG VKK+  G RAYQ  R +EA +SR A MA+
Sbjct  325  SACEVTLLHYEDMGIPKDVAKLGVRHGMWGTVKKLHNGFRAYQNARKSEAAVSRCAMMAR  384

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            I TK++ D+      + +  E  A     +     I    V  G VA+ C +  G++ KA
Sbjct  385  ITTKISLDESVDALEQVSAEEDRAVEIQGQRGDGGIDWKWVAIGTVAVVCGLRSGMIGKA  444

Query  235  LIFGVARRFAGFGK  194
            ++FG  +R A  G+
Sbjct  445  VLFGAGQRIARRGR  458



>gb|KHG09152.1| StAR-related lipid transfer 7, mitochondrial [Gossypium arboreum]
 gb|KHG24117.1| StAR-related lipid transfer 7, mitochondrial [Gossypium arboreum]
Length=447

 Score =   187 bits (475),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 134/193 (69%), Gaps = 7/193 (4%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDR+YIIGRRIW+ G+TYYCVTKGVP   +P++ KPRRV+LY+SSW IRP  S++ DGQ+
Sbjct  251  SDRDYIIGRRIWEDGKTYYCVTKGVPYPGLPKRDKPRRVELYFSSWIIRPVESRKGDGQL  310

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEV L H+EDMGIP ++AKLGVR GMWGAVKK+  G+RAYQ  R T+  LS+ A MA+
Sbjct  311  SACEVSLVHYEDMGIPKDVAKLGVRHGMWGAVKKLHSGMRAYQSARKTDTSLSKCALMAR  370

Query  415  INTKVTTD-DLRSLELRRTMSEAEASGSSDKPTGRNIPKL----LVVGGAVALACSIDRG  251
            I TK++ D ++ S    R   E E S S+     +N   L    + + G VALA  +  G
Sbjct  371  ITTKISCDENISSPGCGRVSREDENSQSTVIIKRKNDNSLNWKWIAIAGTVALAFGLRSG  430

Query  250  LLTKALIFGVARR  212
            ++ KAL+ G  +R
Sbjct  431  VVGKALLVGAGQR  443



>gb|KJB12570.1| hypothetical protein B456_002G024700 [Gossypium raimondii]
Length=445

 Score =   187 bits (474),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 100/192 (52%), Positives = 132/192 (69%), Gaps = 7/192 (4%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDR+YIIGRRIW+ G+TYYCVTKGVP   +P++ KPRRV+LY+SSW IRP  S++ DGQ+
Sbjct  251  SDRDYIIGRRIWEDGKTYYCVTKGVPYPGLPKRDKPRRVELYFSSWIIRPVESRKGDGQL  310

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEV L H+EDMGIP ++AKLGVR GMWGAVKK+  G+RAYQ  R TE  LS+ A MA+
Sbjct  311  SACEVTLVHYEDMGIPKDVAKLGVRHGMWGAVKKLHSGMRAYQSARKTETSLSKCALMAR  370

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKL----LVVGGAVALACSIDRGL  248
            + TK++ D+  S    R + E E   S      +N   L    + + G VALA  +  G+
Sbjct  371  MTTKISCDENIS-SPGRVLREDENDQSMGIIKRKNDNSLNWKWIAIAGTVALAFGLRSGV  429

Query  247  LTKALIFGVARR  212
            + KAL+ G  +R
Sbjct  430  IGKALLVGAGQR  441



>ref|XP_009757654.1| PREDICTED: uncharacterized protein LOC104210451 [Nicotiana sylvestris]
Length=453

 Score =   187 bits (474),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 100/195 (51%), Positives = 130/195 (67%), Gaps = 3/195 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW+SG+TYYCVTK VP   + R+ KPRRVDLY+SSW ++P  SKR DGQ+
Sbjct  257  SDREYIIGRRIWESGKTYYCVTKSVPYPALQRRDKPRRVDLYFSSWIVKPVESKRGDGQL  316

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEV+L H+EDMGIP ++AKLGVR GMWG VKK+  G RAYQ  R + A +SR A MA 
Sbjct  317  SACEVMLTHYEDMGIPKDVAKLGVRHGMWGTVKKLHNGFRAYQNARKSVAVVSRCAMMAG  376

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIP-KLLVVGGAVALACSIDRGLLTK  239
            I TK+  D+      R +  E  A+    +     I  K + +G  VA+ C +  G++ K
Sbjct  377  ITTKILLDEGVDALERVSAEEDRAAEIQGQRGDSGIDWKWVAIGATVAVVCGLRTGMIGK  436

Query  238  ALIFGVARRFAGFGK  194
            AL+ G  +R A  G+
Sbjct  437  ALLLGAGQRIARRGR  451



>ref|XP_010532604.1| PREDICTED: uncharacterized protein LOC104808596 [Tarenaya hassleriana]
Length=497

 Score =   187 bits (476),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 99/192 (52%), Positives = 137/192 (71%), Gaps = 5/192 (3%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            S+REYIIGRRIW++G+TYYCVTKG+P   +P++ KPRR++LY+SSW IR   S++ DG+ 
Sbjct  305  SNREYIIGRRIWEAGKTYYCVTKGIPYPALPKRDKPRRIELYFSSWMIRAVESRKGDGEQ  364

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEV+L H+EDMGIP ++AKLGVR GMWGAVKK++ GLRAYQ  R T +PLS+ A MA+
Sbjct  365  TACEVMLVHYEDMGIPKDVAKLGVRHGMWGAVKKLNSGLRAYQNARKTGSPLSQCAQMAR  424

Query  415  INTKVTTDDLR--SLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLT  242
            I TK++ D +   S E  +T  + +A+ +  +     +    +V G VALAC +    + 
Sbjct  425  IATKLSVDSVETSSGEEEKT-RDLDAARTRRRDEESKVEWRWIVIGGVALACGLHSSAVG  483

Query  241  KALIFGVARRFA  206
            KAL+ G A+R A
Sbjct  484  KALLAGAAQRLA  495



>ref|XP_002312574.2| hypothetical protein POPTR_0008s16250g [Populus trichocarpa]
 gb|EEE89941.2| hypothetical protein POPTR_0008s16250g [Populus trichocarpa]
Length=440

 Score =   186 bits (471),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 102/195 (52%), Positives = 131/195 (67%), Gaps = 10/195 (5%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW +G+TYYCVTKGVP   + ++ K RRVDLY+S W IR   S++ DGQ+
Sbjct  247  SDREYIIGRRIWDAGKTYYCVTKGVPYPGLHKRDKLRRVDLYFSGWVIRAVESRKGDGQI  306

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEV L H+EDMGIP ++AKLGVR  MWGAVKK+  G+RAYQ  R +EA LSR A MA+
Sbjct  307  SACEVTLLHYEDMGIPKDVAKLGVRHAMWGAVKKLHSGMRAYQNARKSEASLSRCALMAR  366

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSS-----DKPTGRNIPKLLVVGGAVALACSIDRG  251
            I TKV+ D+   ++   T +E E    +      K  G +  K + VGG VAL C +  G
Sbjct  367  ITTKVSFDE--GMDSSETANEEEDRSPAVDIQRHKDHGIDW-KWIAVGGTVALVCGLHTG  423

Query  250  LLTKALIFGVARRFA  206
             + KAL+ G  +R A
Sbjct  424  AIGKALLLGAGQRLA  438



>ref|XP_011030550.1| PREDICTED: stAR-related lipid transfer protein 7, mitochondrial 
[Populus euphratica]
Length=436

 Score =   185 bits (470),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 103/200 (52%), Positives = 130/200 (65%), Gaps = 20/200 (10%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW + +  YCVTKGVP   + ++ KPRRV+LY+SSW IR   S+R DGQM
Sbjct  243  SDREYIIGRRIWDARKASYCVTKGVPYPGLHKRDKPRRVELYFSSWVIRAVESRRGDGQM  302

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEV L H+EDMGIP ++AKLGVR GMWGAVKK+  G+RAYQ  R +EA LSR A MA+
Sbjct  303  SACEVTLLHYEDMGIPKDVAKLGVRHGMWGAVKKLHSGMRAYQNARKSEASLSRCALMAR  362

Query  415  INTKVTTDDLRSLELRRTMSEAE-ASGSSDKPTGRNIP---------KLLVVGGAVALAC  266
            I TKV+ D+         M  +E  +G  DK    +I          K +V+GG V L C
Sbjct  363  ITTKVSFDE--------GMDSSEPVAGEEDKSQAVDIRRHNDHGIDWKWIVIGGTVTLVC  414

Query  265  SIDRGLLTKALIFGVARRFA  206
             +  G + KAL+ G  +R A
Sbjct  415  CLHSGAIGKALLLGAGQRIA  434



>ref|XP_007034990.1| Polyketide cyclase/dehydrase and lipid transport superfamily 
protein isoform 4 [Theobroma cacao]
 gb|EOY05916.1| Polyketide cyclase/dehydrase and lipid transport superfamily 
protein isoform 4 [Theobroma cacao]
Length=450

 Score =   185 bits (470),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 102/201 (51%), Positives = 132/201 (66%), Gaps = 20/201 (10%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPG---ASKRDG  602
            SDREYIIGRRIW +G+TYYCVTKGVP   + ++ KPRRV+LY+SSW IR G   + K DG
Sbjct  255  SDREYIIGRRIWDAGKTYYCVTKGVPYPGLQKRDKPRRVELYFSSWVIRAGKLESRKGDG  314

Query  601  QMTACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACM  422
            Q +ACEV L H+EDMGIP ++A+LG+R GMWGA+KK+  GLRAYQ  R T+  LSRSA M
Sbjct  315  QHSACEVTLVHYEDMGIPKDVARLGLRHGMWGALKKLHSGLRAYQNARKTDTSLSRSAQM  374

Query  421  AQINTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIP---------KLLVVGGAVALA  269
            A+I TK+++D++         S    SG  +K     I          K +VVGG VAL 
Sbjct  375  ARITTKISSDEIMD-------SLCPISGEDEKDQTVVIRRQNDNGLDWKWIVVGGTVALV  427

Query  268  CSIDRGLLTKALIFGVARRFA  206
              +  G++ KAL+ G  +R A
Sbjct  428  FGLHSGVIGKALLLGAGQRIA  448



>ref|NP_001030744.1| polyketide cyclase/dehydrase and lipid transport superfamily 
protein [Arabidopsis thaliana]
 gb|AEE76714.1| polyketide cyclase/dehydrase and lipid transport superfamily 
protein [Arabidopsis thaliana]
Length=388

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 105/203 (52%), Positives = 129/203 (64%), Gaps = 28/203 (14%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW+SG+ YY VTKGVP   + ++ KPRRV+LY+SSW I    S++ DGQM
Sbjct  197  SDREYIIGRRIWESGRKYYAVTKGVPYKALSKRDKPRRVELYFSSWIINAVESRKGDGQM  256

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEV L H+EDMGIP ++AKLGVR GMWGAVKK++ GLRAYQ  R     LSRSA MA 
Sbjct  257  TACEVSLVHYEDMGIPKDVAKLGVRHGMWGAVKKLNSGLRAYQSARKPGTSLSRSAQMAS  316

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIP-------------KLLVVGGAVA  275
            I TK+  D +            E SG+ D+  GR +              K +VVGG VA
Sbjct  317  ITTKLNMDLV------------ETSGAEDEERGRAVENARKQNDQFGVDWKWIVVGG-VA  363

Query  274  LACSIDRGLLTKALIFGVARRFA  206
            LAC +    + KAL+ G  +R A
Sbjct  364  LACGLHSSAIGKALMVGAGQRLA  386



>gb|KJB34524.1| hypothetical protein B456_006G070300 [Gossypium raimondii]
Length=447

 Score =   185 bits (470),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 100/197 (51%), Positives = 128/197 (65%), Gaps = 14/197 (7%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYII RRIW++G  Y+CVTKGVP  D+ ++ KPRRV+LY+SSW IR   S++ DGQM
Sbjct  254  SDREYIIARRIWEAGNAYHCVTKGVPYPDLQKRDKPRRVELYFSSWVIRAVESRKGDGQM  313

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEV L H+EDMGIP ++AKLGVR GMWG VKK+  G+RAYQ  R T + LSR A MA+
Sbjct  314  TACEVALVHYEDMGIPKDVAKLGVRHGMWGTVKKLHSGMRAYQNARKTNSSLSRCAQMAR  373

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIP-------KLLVVGGAVALACSID  257
            I TK++ D     E   ++  A      D+  G           K + +GG VALA  + 
Sbjct  374  ITTKISPD-----ESAGSLRPATVEDEKDRTMGMRREHDNGLDWKWIAIGGTVALAFGLH  428

Query  256  RGLLTKALIFGVARRFA  206
             G++ KAL+ G  RR A
Sbjct  429  SGIIGKALLVGAGRRMA  445



>ref|XP_009627905.1| PREDICTED: uncharacterized protein LOC104118382 [Nicotiana tomentosiformis]
Length=455

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 133/196 (68%), Gaps = 6/196 (3%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW+SG+TYYCVTK VP   + R+ KPRRVDLY+SSW ++P  S + DGQ+
Sbjct  260  SDREYIIGRRIWESGKTYYCVTKSVPYPALQRRDKPRRVDLYFSSWIVKPVESNKGDGQL  319

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEV L H+EDMGIP ++AKLGVR GMWG VKK+  G RAYQ  R +EA +SR A MA+
Sbjct  320  SACEVTLTHYEDMGIPKDVAKLGVRHGMWGTVKKLHNGFRAYQNARKSEAAVSRCAMMAR  379

Query  415  INTKVTTDD-LRSLELRRTMSEAEASGSSDKPTGRNIP-KLLVVGGAVALACSIDRGLLT  242
            I TK++ D+ + + E  R  +E  A     +     I  K + +G  VA+ C +  G++ 
Sbjct  380  ITTKISFDEGVDAFE--RVSAEGRAGEIQGQRGDGGIDWKWVAIGATVAVVCGLRTGMIG  437

Query  241  KALIFGVARRFAGFGK  194
            KA++ G  +R A  G+
Sbjct  438  KAVLLGAGQRIARRGR  453



>ref|XP_007034988.1| Polyketide cyclase/dehydrase and lipid transport superfamily 
protein isoform 2 [Theobroma cacao]
 ref|XP_007034989.1| Polyketide cyclase/dehydrase and lipid transport superfamily 
protein isoform 2 [Theobroma cacao]
 gb|EOY05914.1| Polyketide cyclase/dehydrase and lipid transport superfamily 
protein isoform 2 [Theobroma cacao]
 gb|EOY05915.1| Polyketide cyclase/dehydrase and lipid transport superfamily 
protein isoform 2 [Theobroma cacao]
Length=448

 Score =   185 bits (469),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 101/199 (51%), Positives = 132/199 (66%), Gaps = 18/199 (9%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW +G+TYYCVTKGVP   + ++ KPRRV+LY+SSW IR   S++ DGQ 
Sbjct  255  SDREYIIGRRIWDAGKTYYCVTKGVPYPGLQKRDKPRRVELYFSSWVIRAVESRKGDGQH  314

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEV L H+EDMGIP ++A+LG+R GMWGA+KK+  GLRAYQ  R T+  LSRSA MA+
Sbjct  315  SACEVTLVHYEDMGIPKDVARLGLRHGMWGALKKLHSGLRAYQNARKTDTSLSRSAQMAR  374

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIP---------KLLVVGGAVALACS  263
            I TK+++D++         S    SG  +K     I          K +VVGG VAL   
Sbjct  375  ITTKISSDEIMD-------SLCPISGEDEKDQTVVIRRQNDNGLDWKWIVVGGTVALVFG  427

Query  262  IDRGLLTKALIFGVARRFA  206
            +  G++ KAL+ G  +R A
Sbjct  428  LHSGVIGKALLLGAGQRIA  446



>ref|XP_007157092.1| hypothetical protein PHAVU_002G042100g [Phaseolus vulgaris]
 gb|ESW29086.1| hypothetical protein PHAVU_002G042100g [Phaseolus vulgaris]
Length=436

 Score =   184 bits (468),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 128/191 (67%), Gaps = 4/191 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYII RRIW+SG TYYCVTKGV +  +P + KPRRV+ Y+SSW I+P  S++ DGQ+
Sbjct  245  SDREYIIARRIWQSGNTYYCVTKGVSHPSLPIRDKPRRVEHYFSSWVIKPVESRKGDGQL  304

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEV L H+EDMGIP ++AKLGVR GMWGAVKK+  G+RAYQ  R TE+ LSR A MA 
Sbjct  305  SACEVTLLHYEDMGIPKDVAKLGVRHGMWGAVKKLHLGMRAYQNARKTESSLSRCALMAS  364

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIP-KLLVVGGAVALACSIDRGLLTK  239
              TK+++D   S E   +M +   + S+    G  I  K + +GG VAL   +  G + +
Sbjct  365  KTTKISSDSNIS-EPSSSMEDGMQATSNTAQKGHGIDWKWVALGGTVALVLGLHNGAVGR  423

Query  238  ALIFGVARRFA  206
             L+ G   R A
Sbjct  424  VLLLGAGHRIA  434



>ref|XP_007157091.1| hypothetical protein PHAVU_002G042100g [Phaseolus vulgaris]
 gb|ESW29085.1| hypothetical protein PHAVU_002G042100g [Phaseolus vulgaris]
Length=437

 Score =   184 bits (468),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 128/191 (67%), Gaps = 4/191 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYII RRIW+SG TYYCVTKGV +  +P + KPRRV+ Y+SSW I+P  S++ DGQ+
Sbjct  246  SDREYIIARRIWQSGNTYYCVTKGVSHPSLPIRDKPRRVEHYFSSWVIKPVESRKGDGQL  305

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEV L H+EDMGIP ++AKLGVR GMWGAVKK+  G+RAYQ  R TE+ LSR A MA 
Sbjct  306  SACEVTLLHYEDMGIPKDVAKLGVRHGMWGAVKKLHLGMRAYQNARKTESSLSRCALMAS  365

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIP-KLLVVGGAVALACSIDRGLLTK  239
              TK+++D   S E   +M +   + S+    G  I  K + +GG VAL   +  G + +
Sbjct  366  KTTKISSDSNIS-EPSSSMEDGMQATSNTAQKGHGIDWKWVALGGTVALVLGLHNGAVGR  424

Query  238  ALIFGVARRFA  206
             L+ G   R A
Sbjct  425  VLLLGAGHRIA  435



>gb|EYU19692.1| hypothetical protein MIMGU_mgv1a0075022mg, partial [Erythranthe 
guttata]
Length=159

 Score =   176 bits (447),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 108/144 (75%), Gaps = 6/144 (4%)
 Frame = -2

Query  613  KRDGQMTACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRA--TEAPL  440
            K +GQ++ACEV+LFHHEDMGIPWEIAK GVRQGMWGA K ++ G RAYQKHRA  + +P+
Sbjct  4    KGNGQLSACEVILFHHEDMGIPWEIAKFGVRQGMWGAAKNVERGFRAYQKHRASLSGSPV  63

Query  439  SRSACMAQINTKVTTDDLRSLELRRTMSEAEASG---SSDKP-TGRNIPKLLVVGGAVAL  272
            S  A MAQINTK+  D L++LE     S  E +    + +KP  G N+PKLL++GGAVA+
Sbjct  64   SHHAFMAQINTKIDPDHLKTLEGSEEDSSLETTQLPLAVEKPKEGVNLPKLLIIGGAVAI  123

Query  271  ACSIDRGLLTKALIFGVARRFAGF  200
            A S+DRGL TK LIFGVAR+F  F
Sbjct  124  AFSLDRGLFTKTLIFGVARKFDEF  147



>ref|XP_009408481.1| PREDICTED: uncharacterized protein LOC103990913 [Musa acuminata 
subsp. malaccensis]
Length=440

 Score =   184 bits (467),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 105/191 (55%), Positives = 132/191 (69%), Gaps = 3/191 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGAS-KRDGQM  596
            SDREYIIGRRIW+SG TYYCVTKGVP   +P+  KPRRV+LY+SSW IR   S K+DGQ+
Sbjct  248  SDREYIIGRRIWESGGTYYCVTKGVPYQSLPKNEKPRRVELYFSSWRIRAVESRKQDGQL  307

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            ++CEV L H+EDMGIP ++AK+GVR GMWGAVK++  G+RAYQ  R TEA LSR A MA+
Sbjct  308  SSCEVTLVHYEDMGIPKDVAKVGVRHGMWGAVKRLQSGMRAYQMMRKTEASLSRCALMAR  367

Query  415  INTKVTTD-DLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTK  239
            I TK+  D  +  LE   + +   ASG  +      +    VV G VA+ C +  GL+ K
Sbjct  368  ITTKIPIDGSITPLEAETSRASEAASGIVNSTQLHGLDWKWVVVGGVAVVCGLQAGLVGK  427

Query  238  ALIFGVARRFA  206
            AL+ G ARR A
Sbjct  428  ALLVGAARRLA  438



>ref|XP_002885543.1| hypothetical protein ARALYDRAFT_319027 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61802.1| hypothetical protein ARALYDRAFT_319027 [Arabidopsis lyrata subsp. 
lyrata]
Length=427

 Score =   184 bits (467),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 104/203 (51%), Positives = 130/203 (64%), Gaps = 28/203 (14%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGAS-KRDGQM  596
            SDREYIIGRRIW+SG+ YY VTKGVP   +P++ KPRRV++Y+SSW I+   S KRDGQ+
Sbjct  236  SDREYIIGRRIWESGKKYYAVTKGVPYQALPKRDKPRRVEVYFSSWIIKAVESRKRDGQL  295

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEV L H+EDMGIP ++AKLGVR GMWGAVKK++ GLRAYQ  R     LSRSA MA 
Sbjct  296  SACEVSLVHYEDMGIPKDVAKLGVRHGMWGAVKKLNSGLRAYQSARKPGTSLSRSAQMAS  355

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIP-------------KLLVVGGAVA  275
            I TK+  D +            E SG+ ++  GR +              K +VVGG VA
Sbjct  356  ITTKLNMDLV------------ETSGAEEEERGRAVENARKQKDQVSVDWKWIVVGG-VA  402

Query  274  LACSIDRGLLTKALIFGVARRFA  206
            LAC +    + KAL+ G   R A
Sbjct  403  LACGLHSSAIGKALMVGAGHRLA  425



>ref|XP_009107776.1| PREDICTED: uncharacterized protein LOC103833443 [Brassica rapa]
Length=434

 Score =   184 bits (467),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 127/190 (67%), Gaps = 3/190 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW+SG  YYCVTKGVP   +P++ KPRRV+LY+SSW IR   S++ DGQ 
Sbjct  244  SDREYIIGRRIWESGNKYYCVTKGVPYPALPKRDKPRRVELYFSSWVIRAVESRKGDGQP  303

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEV L H+EDMGIP ++AKLGVR G+WGAVKK+  GLRAYQ  R +++ LSR A MA+
Sbjct  304  TACEVSLVHYEDMGIPKDVAKLGVRHGVWGAVKKLHSGLRAYQTGRKSDSSLSRIAQMAR  363

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLLTKA  236
            I T +  D   S       S A       +   R   K +VVGG VALAC +  G + KA
Sbjct  364  ITTVLDMDSTESSTSDEDRSRAMGYARRQRDNLRVDWKWVVVGG-VALACGLHTGGIGKA  422

Query  235  LIFGVARRFA  206
            L+ G  +R A
Sbjct  423  LLAGAGQRLA  432



>ref|NP_566722.1| polyketide cyclase/dehydrase and lipid transport superfamily 
protein [Arabidopsis thaliana]
 dbj|BAB02099.1| membrane related protein-like [Arabidopsis thaliana]
 gb|AAN13021.1| unknown protein [Arabidopsis thaliana]
 gb|AEE76713.1| polyketide cyclase/dehydrase and lipid transport superfamily 
protein [Arabidopsis thaliana]
Length=419

 Score =   183 bits (465),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 105/203 (52%), Positives = 129/203 (64%), Gaps = 28/203 (14%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW+SG+ YY VTKGVP   + ++ KPRRV+LY+SSW I    S++ DGQM
Sbjct  228  SDREYIIGRRIWESGRKYYAVTKGVPYKALSKRDKPRRVELYFSSWIINAVESRKGDGQM  287

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEV L H+EDMGIP ++AKLGVR GMWGAVKK++ GLRAYQ  R     LSRSA MA 
Sbjct  288  TACEVSLVHYEDMGIPKDVAKLGVRHGMWGAVKKLNSGLRAYQSARKPGTSLSRSAQMAS  347

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIP-------------KLLVVGGAVA  275
            I TK+  D +            E SG+ D+  GR +              K +VVGG VA
Sbjct  348  ITTKLNMDLV------------ETSGAEDEERGRAVENARKQNDQFGVDWKWIVVGG-VA  394

Query  274  LACSIDRGLLTKALIFGVARRFA  206
            LAC +    + KAL+ G  +R A
Sbjct  395  LACGLHSSAIGKALMVGAGQRLA  417



>gb|AAL07016.1| unknown protein [Arabidopsis thaliana]
Length=419

 Score =   183 bits (465),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 105/203 (52%), Positives = 129/203 (64%), Gaps = 28/203 (14%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW+SG+ YY VTKGVP   + ++ KPRRV+LY+SSW I    S++ DGQM
Sbjct  228  SDREYIIGRRIWESGRKYYAVTKGVPYKALSKRDKPRRVELYFSSWIINAVESRKGDGQM  287

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            TACEV L H+EDMGIP ++AKLGVR GMWGAVKK++ GLRAYQ  R     LSRSA MA 
Sbjct  288  TACEVSLVHYEDMGIPKDVAKLGVRHGMWGAVKKLNSGLRAYQSARKPGTSLSRSAQMAS  347

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIP-------------KLLVVGGAVA  275
            I TK+  D +            E SG+ D+  GR +              K +VVGG VA
Sbjct  348  ITTKLNMDLV------------ETSGAEDEERGRAVENARKQNDQFGVDWKWIVVGG-VA  394

Query  274  LACSIDRGLLTKALIFGVARRFA  206
            LAC +    + KAL+ G  +R A
Sbjct  395  LACGLHSSAIGKALMVGAGQRLA  417



>ref|NP_001142403.1| hypothetical protein [Zea mays]
 gb|ACF88412.1| unknown [Zea mays]
 tpg|DAA36545.1| TPA: hypothetical protein ZEAMMB73_493286 [Zea mays]
Length=438

 Score =   184 bits (466),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 100/193 (52%), Positives = 131/193 (68%), Gaps = 5/193 (3%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGAS-KRDGQM  596
            SDREYI G RIW+SG+TYYCVTKGVP   +P++ KPRRV+LY+SSW IR   S K  GQ 
Sbjct  244  SDREYIFGGRIWESGKTYYCVTKGVPYPSLPKKEKPRRVELYFSSWRIRAVQSPKHVGQQ  303

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEV L H+EDMGIP ++A++ VR GMWGAVKK+  G RAYQ+ R TE  LS S  MA+
Sbjct  304  SACEVTLVHYEDMGIPKDVARVAVRHGMWGAVKKLQSGFRAYQQMRHTETTLSHSVIMAR  363

Query  415  INTKVT---TDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRGLL  245
            + TK++   ++D    +L      ++ + SS+        K LVVGGAVA  C ++ GL+
Sbjct  364  MTTKISITASNDPLDHDLSVADKISDENDSSNAVQHGFDWKWLVVGGAVAAVCVLNTGLV  423

Query  244  TKALIFGVARRFA  206
             KA++ G ARR A
Sbjct  424  GKAVLLGAARRQA  436



>ref|XP_006297728.1| hypothetical protein CARUB_v10013761mg [Capsella rubella]
 gb|EOA30626.1| hypothetical protein CARUB_v10013761mg [Capsella rubella]
Length=428

 Score =   183 bits (464),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 132/203 (65%), Gaps = 28/203 (14%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVP-NDVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW+SG+ YY VTKGVP   +P++ KPRRV+LY+SSW I+   S++ DGQ+
Sbjct  237  SDREYIIGRRIWESGKKYYAVTKGVPYQALPKRVKPRRVELYFSSWVIKAVESRKGDGQL  296

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEV L H+EDMGIP ++AKLGVR GMWGAVKK++ GLRAYQ  R     LSRSA MA 
Sbjct  297  SACEVSLVHYEDMGIPKDVAKLGVRHGMWGAVKKLNSGLRAYQTARKPGTSLSRSAQMAS  356

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIP-------------KLLVVGGAVA  275
            I TK++ D +            E SG+ ++  GR +              K +VVGG VA
Sbjct  357  ITTKLSMDLV------------ETSGAEEEERGRAMENERKQKDQFGVDWKWIVVGG-VA  403

Query  274  LACSIDRGLLTKALIFGVARRFA  206
            LAC +    + KAL+ G  +R A
Sbjct  404  LACGLHSSAIGKALMVGAGQRLA  426



>ref|XP_009145238.1| PREDICTED: uncharacterized protein LOC103868940 [Brassica rapa]
Length=412

 Score =   182 bits (462),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 104/203 (51%), Positives = 132/203 (65%), Gaps = 28/203 (14%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW+SG  YY VTKGVP   +P++ KPRRV++Y+SSW I+   S++ DGQM
Sbjct  221  SDREYIIGRRIWESGNKYYAVTKGVPYPALPKRDKPRRVEIYFSSWIIKAVESRKGDGQM  280

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEV L H EDMGIP ++AKLGVR GMWGAVKK++ GLR+YQ  R   A LSRSA +A+
Sbjct  281  SACEVSLVHCEDMGIPKDVAKLGVRHGMWGAVKKLNSGLRSYQTARKAGAALSRSAQIAR  340

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIP-------------KLLVVGGAVA  275
            I TK+             M  AE S   ++  GR++              KL+VVGG VA
Sbjct  341  ITTKL------------NMDVAETSRVDEEERGRDMENARRPKDQFSVDWKLIVVGG-VA  387

Query  274  LACSIDRGLLTKALIFGVARRFA  206
            LAC +    + KAL+FG  +R A
Sbjct  388  LACGLHSSAIGKALMFGAGQRLA  410



>ref|XP_007034987.1| Polyketide cyclase/dehydrase and lipid transport superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY05913.1| Polyketide cyclase/dehydrase and lipid transport superfamily 
protein isoform 1 [Theobroma cacao]
Length=553

 Score =   185 bits (469),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 101/199 (51%), Positives = 132/199 (66%), Gaps = 18/199 (9%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPND-VPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW +G+TYYCVTKGVP   + ++ KPRRV+LY+SSW IR   S++ DGQ 
Sbjct  255  SDREYIIGRRIWDAGKTYYCVTKGVPYPGLQKRDKPRRVELYFSSWVIRAVESRKGDGQH  314

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEV L H+EDMGIP ++A+LG+R GMWGA+KK+  GLRAYQ  R T+  LSRSA MA+
Sbjct  315  SACEVTLVHYEDMGIPKDVARLGLRHGMWGALKKLHSGLRAYQNARKTDTSLSRSAQMAR  374

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIP---------KLLVVGGAVALACS  263
            I TK+++D++         S    SG  +K     I          K +VVGG VAL   
Sbjct  375  ITTKISSDEIMD-------SLCPISGEDEKDQTVVIRRQNDNGLDWKWIVVGGTVALVFG  427

Query  262  IDRGLLTKALIFGVARRFA  206
            +  G++ KAL+ G  +R A
Sbjct  428  LHSGVIGKALLLGAGQRIA  446



>dbj|BAJ97056.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=440

 Score =   182 bits (463),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 103/195 (53%), Positives = 127/195 (65%), Gaps = 8/195 (4%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGAS-KRDGQM  596
            SDREYI GRRIW+SG+ YYCVTKGVP   +P++ KPRRV+LY+SSW IRP  S K+DGQ 
Sbjct  244  SDREYIFGRRIWESGKAYYCVTKGVPYPSLPKKEKPRRVELYFSSWRIRPVQSPKQDGQQ  303

Query  595  -TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMA  419
              ACEV LFH+EDMGIP ++AK+GVR GMWGAVKK+  G RAYQ  R +E  LS SA MA
Sbjct  304  PMACEVTLFHYEDMGIPKDVAKVGVRHGMWGAVKKLQSGFRAYQLMRKSEHILSHSAIMA  363

Query  418  QINTKV----TTDDLRSLELRRTMSEAEASGSSDKPTGRNIPKLLVVGGAVALACSIDRG  251
            ++ TK     +   L         +  E   S     G N  K +VVG  VA  C ++ G
Sbjct  364  RVTTKTCIAGSDGSLDQWPSSTEQASTEDYNSRAVQHGFNW-KWVVVGSTVAAVCVLNTG  422

Query  250  LLTKALIFGVARRFA  206
            ++ KAL+ G ARR A
Sbjct  423  IVGKALLLGAARRQA  437



>ref|XP_006406092.1| hypothetical protein EUTSA_v10020751mg [Eutrema salsugineum]
 gb|ESQ47545.1| hypothetical protein EUTSA_v10020751mg [Eutrema salsugineum]
Length=439

 Score =   182 bits (461),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 103/196 (53%), Positives = 132/196 (67%), Gaps = 14/196 (7%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW+SG+ YY VTKGVP   +P++ KPRRV+LY+SSW I+   S++ DGQM
Sbjct  248  SDREYIIGRRIWESGKKYYSVTKGVPYPGLPKRDKPRRVELYFSSWIIKAVESRKGDGQM  307

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEV L H+EDMGIP ++AKLGVR GMWGAVKK++ GLRAYQ  R   A LSRSA  A+
Sbjct  308  SACEVSLVHYEDMGIPKDVAKLGVRHGMWGAVKKLNSGLRAYQTARKQGATLSRSAQSAR  367

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGRNIP------KLLVVGGAVALACSIDR  254
            I TK+  D + +     + +E E  G + +   R         K +VVGG VALAC +  
Sbjct  368  ITTKLNVDLVET-----SRAEGEERGRAMENARRQKELFSVDWKWIVVGG-VALACGLHS  421

Query  253  GLLTKALIFGVARRFA  206
              + KAL+ G  +R A
Sbjct  422  SAIGKALMVGAGQRLA  437



>ref|XP_009108270.1| PREDICTED: uncharacterized protein LOC103833968 isoform X2 [Brassica 
rapa]
Length=425

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 128/191 (67%), Gaps = 3/191 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW+SG+ YY VTKGVP   +P++ KPRRV+LY+SSW I+   S++ DGQM
Sbjct  233  SDREYIIGRRIWESGKKYYAVTKGVPYPTLPKRDKPRRVELYFSSWIIKAVESRKGDGQM  292

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEV L H+EDMGIP ++AKLGVR GMWGAVKK++ GLRAYQ  R     LSRSA MA 
Sbjct  293  SACEVSLVHYEDMGIPKDVAKLGVRHGMWGAVKKLNSGLRAYQSARKPGVALSRSAQMAG  352

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGR-NIPKLLVVGGAVALACSIDRGLLTK  239
            I TK+  D + +  +     + +A   + +   + N+    +  G VALAC +    + K
Sbjct  353  ITTKLNMDLVETSRVEEEEEKGQAMEKARRQKEQFNVDWKWIAVGGVALACGLHSSAIGK  412

Query  238  ALIFGVARRFA  206
            AL+ G  +R A
Sbjct  413  ALMVGAGQRLA  423



>emb|CDY35496.1| BnaA01g24160D [Brassica napus]
Length=430

 Score =   181 bits (460),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 128/191 (67%), Gaps = 3/191 (2%)
 Frame = -2

Query  769  SDREYIIGRRIWKSGQTYYCVTKGVPN-DVPRQSKPRRVDLYYSSWCIRPGASKR-DGQM  596
            SDREYIIGRRIW+SG+ YY VTKGVP   +P++ KPRRV+LY+SSW I+   S++ DGQM
Sbjct  238  SDREYIIGRRIWESGKKYYAVTKGVPYPTLPKRDKPRRVELYFSSWIIKAVESRKGDGQM  297

Query  595  TACEVLLFHHEDMGIPWEIAKLGVRQGMWGAVKKIDPGLRAYQKHRATEAPLSRSACMAQ  416
            +ACEV L H+EDMGIP ++AKLGVR GMWGAVKK++ GLRAYQ  R     LSRSA MA 
Sbjct  298  SACEVSLVHYEDMGIPKDVAKLGVRHGMWGAVKKLNSGLRAYQSARKPGVALSRSAQMAG  357

Query  415  INTKVTTDDLRSLELRRTMSEAEASGSSDKPTGR-NIPKLLVVGGAVALACSIDRGLLTK  239
            I TK+  D + +  +     + +A   + +   + N+    +  G VALAC +    + K
Sbjct  358  ITTKLNMDLVETSRVEEEEEKGQAMEKARRQKEQFNVDWKWIAVGGVALACGLHSSAIGK  417

Query  238  ALIFGVARRFA  206
            AL+ G  +R A
Sbjct  418  ALMVGAGQRLA  428



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1524835419250