BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig2833

Length=817
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP05903.1|  unnamed protein product                                332   3e-109   Coffea canephora [robusta coffee]
ref|XP_009595567.1|  PREDICTED: choline transporter-like protein 2      342   4e-109   Nicotiana tomentosiformis
ref|XP_009789519.1|  PREDICTED: choline transporter-like protein 2      342   5e-109   Nicotiana sylvestris
gb|EYU44898.1|  hypothetical protein MIMGU_mgv1a002214mg                326   8e-103   Erythranthe guttata [common monkey flower]
ref|XP_010098992.1|  hypothetical protein L484_025652                   325   1e-102   
ref|XP_007021392.1|  Plasma-membrane choline transporter family p...    326   1e-102   
ref|XP_004291650.1|  PREDICTED: choline transporter-like protein 2      325   2e-102   Fragaria vesca subsp. vesca
ref|XP_007021393.1|  Plasma-membrane choline transporter family p...    325   2e-102   Theobroma cacao [chocolate]
ref|XP_006451902.1|  hypothetical protein CICLE_v10007637mg             324   2e-102   
ref|XP_012084940.1|  PREDICTED: choline transporter-like protein 2      324   5e-102   Jatropha curcas
ref|XP_008226648.1|  PREDICTED: choline transporter-like protein 2      323   1e-101   Prunus mume [ume]
ref|XP_006451901.1|  hypothetical protein CICLE_v10007637mg             323   1e-101   Citrus clementina [clementine]
ref|XP_008452469.1|  PREDICTED: choline transporter-like protein 2      322   3e-101   Cucumis melo [Oriental melon]
ref|XP_009356828.1|  PREDICTED: choline transporter-like protein 2      322   3e-101   Pyrus x bretschneideri [bai li]
ref|XP_004141227.1|  PREDICTED: choline transporter-like protein 2      322   4e-101   Cucumis sativus [cucumbers]
ref|XP_004244222.1|  PREDICTED: choline transporter-like protein 2      322   5e-101   Solanum lycopersicum
ref|XP_009343591.1|  PREDICTED: choline transporter-like protein 2      322   5e-101   Pyrus x bretschneideri [bai li]
ref|XP_002316905.2|  choline transporter-related family protein         322   6e-101   
ref|XP_011029459.1|  PREDICTED: choline transporter-like protein ...    321   6e-101   Populus euphratica
ref|XP_011029460.1|  PREDICTED: choline transporter-like protein ...    321   6e-101   Populus euphratica
ref|XP_011082663.1|  PREDICTED: choline transporter-like protein 2      321   7e-101   Sesamum indicum [beniseed]
ref|XP_002528555.1|  conserved hypothetical protein                     321   8e-101   Ricinus communis
ref|XP_007213616.1|  hypothetical protein PRUPE_ppa002216mg             321   9e-101   Prunus persica
ref|XP_006348242.1|  PREDICTED: choline transporter-like protein ...    321   9e-101   Solanum tuberosum [potatoes]
gb|KJB45693.1|  hypothetical protein B456_007G321200                    319   3e-100   Gossypium raimondii
gb|KHG10168.1|  Choline transporter-like protein 2                      320   4e-100   Gossypium arboreum [tree cotton]
ref|XP_008386171.1|  PREDICTED: choline transporter-like protein 2      319   7e-100   
gb|KJB13393.1|  hypothetical protein B456_002G072200                    314   2e-99    Gossypium raimondii
ref|XP_010060542.1|  PREDICTED: choline transporter-like protein 2      317   3e-99    Eucalyptus grandis [rose gum]
ref|XP_008363605.1|  PREDICTED: choline transporter-like protein 2      317   3e-99    
ref|XP_002284857.1|  PREDICTED: choline transporter-like protein 2      317   4e-99    Vitis vinifera
emb|CAN73032.1|  hypothetical protein VITISV_026350                     316   1e-98    Vitis vinifera
ref|XP_007149582.1|  hypothetical protein PHAVU_005G082400g             304   1e-98    Phaseolus vulgaris [French bean]
gb|KJB13392.1|  hypothetical protein B456_002G072200                    313   4e-98    Gossypium raimondii
gb|KJB13391.1|  hypothetical protein B456_002G072200                    312   2e-97    Gossypium raimondii
ref|XP_010545818.1|  PREDICTED: choline transporter-like protein ...    311   4e-97    Tarenaya hassleriana [spider flower]
gb|KHG30658.1|  Choline transporter-like protein 2                      311   6e-97    Gossypium arboreum [tree cotton]
ref|XP_010242931.1|  PREDICTED: choline transporter-like protein 2      309   4e-96    Nelumbo nucifera [Indian lotus]
ref|XP_010695012.1|  PREDICTED: choline transporter-like protein 2      308   5e-96    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008778474.1|  PREDICTED: choline transporter-like protein 2      308   7e-96    Phoenix dactylifera
emb|CDX75829.1|  BnaC03g39120D                                          296   7e-95    
ref|XP_002882939.1|  hypothetical protein ARALYDRAFT_478976             305   1e-94    
gb|KHN28052.1|  Choline transporter-like protein 5-A                    305   2e-94    Glycine soja [wild soybean]
ref|XP_003540458.1|  PREDICTED: choline transporter-like protein ...    304   2e-94    Glycine max [soybeans]
ref|XP_010940430.1|  PREDICTED: choline transporter-like protein ...    304   4e-94    Elaeis guineensis
ref|XP_010940429.1|  PREDICTED: choline transporter-like protein ...    304   4e-94    Elaeis guineensis
ref|XP_010502919.1|  PREDICTED: choline transporter-like protein 2      303   7e-94    Camelina sativa [gold-of-pleasure]
ref|XP_010487363.1|  PREDICTED: choline transporter-like protein 2      303   9e-94    Camelina sativa [gold-of-pleasure]
ref|XP_010465506.1|  PREDICTED: choline transporter-like protein 2      302   1e-93    Camelina sativa [gold-of-pleasure]
ref|XP_009408146.1|  PREDICTED: choline transporter-like protein ...    302   2e-93    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009408147.1|  PREDICTED: choline transporter-like protein ...    302   2e-93    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006299581.1|  hypothetical protein CARUB_v10015755mg             301   3e-93    Capsella rubella
ref|XP_010535109.1|  PREDICTED: choline transporter-like protein 2      301   4e-93    Tarenaya hassleriana [spider flower]
ref|XP_008810450.1|  PREDICTED: choline transporter-like protein ...    297   7e-93    Phoenix dactylifera
ref|XP_010934827.1|  PREDICTED: choline transporter-like protein ...    297   8e-93    
ref|XP_004514344.1|  PREDICTED: choline transporter-like protein ...    299   2e-92    Cicer arietinum [garbanzo]
ref|XP_009146248.1|  PREDICTED: choline transporter-like protein ...    298   3e-92    Brassica rapa
emb|CDX98556.1|  BnaC05g38190D                                          298   4e-92    
emb|CDX97664.1|  BnaA05g24150D                                          298   4e-92    
gb|KHN36810.1|  Choline transporter-like protein 2                      298   4e-92    Glycine soja [wild soybean]
ref|XP_010934825.1|  PREDICTED: choline transporter-like protein ...    298   5e-92    
ref|XP_006594780.1|  PREDICTED: choline transporter-like protein ...    298   5e-92    Glycine max [soybeans]
ref|XP_003540093.1|  PREDICTED: choline transporter-like protein ...    298   6e-92    Glycine max [soybeans]
ref|XP_007133083.1|  hypothetical protein PHAVU_011G150000g             298   6e-92    Phaseolus vulgaris [French bean]
ref|XP_003527259.1|  PREDICTED: choline transporter-like protein ...    298   8e-92    Glycine max [soybeans]
gb|KHN37168.1|  Choline transporter-like protein 2                      298   8e-92    Glycine soja [wild soybean]
ref|XP_010934824.1|  PREDICTED: choline transporter-like protein ...    298   8e-92    
ref|NP_566511.1|  plasma-membrane choline transporter family protein    297   9e-92    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006406975.1|  hypothetical protein EUTSA_v10020171mg             297   1e-91    Eutrema salsugineum [saltwater cress]
dbj|BAB02367.1|  unnamed protein product                                296   2e-91    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008810449.1|  PREDICTED: choline transporter-like protein ...    296   2e-91    Phoenix dactylifera
ref|XP_009135440.1|  PREDICTED: choline transporter-like protein 2      296   4e-91    Brassica rapa
gb|KEH38752.1|  plasma-membrane choline transporter family protein      295   4e-91    Medicago truncatula
gb|KHN23450.1|  Choline transporter-like protein 2                      295   5e-91    Glycine soja [wild soybean]
gb|KEH19431.1|  plasma-membrane choline transporter family protein      295   9e-91    Medicago truncatula
gb|KFK38880.1|  hypothetical protein AALP_AA3G172900                    293   6e-90    Arabis alpina [alpine rockcress]
ref|XP_009391079.1|  PREDICTED: choline transporter-like protein ...    292   1e-89    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009391078.1|  PREDICTED: choline transporter-like protein ...    292   1e-89    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX82434.1|  BnaA03g33870D                                          294   3e-89    
gb|EPS61834.1|  hypothetical protein M569_12959                         296   1e-88    Genlisea aurea
gb|EEE61921.1|  hypothetical protein OsJ_16656                          286   1e-88    Oryza sativa Japonica Group [Japonica rice]
gb|EMT10231.1|  hypothetical protein F775_15809                         288   1e-88    
emb|CAJ86275.1|  H0901F07.12                                            288   3e-88    Oryza sativa [red rice]
ref|NP_001054289.1|  Os04g0681400                                       288   4e-88    
gb|EAZ32442.1|  hypothetical protein OsJ_16653                          288   4e-88    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006827775.1|  PREDICTED: choline transporter-like protein 2      287   6e-88    Amborella trichopoda
ref|XP_006653038.1|  PREDICTED: choline transporter-like protein ...    288   7e-88    Oryza brachyantha
ref|XP_008668676.1|  PREDICTED: choline transporter-like protein 2      287   8e-88    Zea mays [maize]
ref|XP_002448788.1|  hypothetical protein SORBIDRAFT_06g033190          287   9e-88    Sorghum bicolor [broomcorn]
dbj|BAK04094.1|  predicted protein                                      286   2e-87    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAF35404.1|  hypothetical protein                                    286   2e-87    Arabidopsis thaliana [mouse-ear cress]
emb|CAJ86278.1|  H0901F07.15                                            285   3e-87    Oryza sativa [red rice]
ref|XP_004960043.1|  PREDICTED: choline transporter-like protein ...    286   3e-87    Setaria italica
ref|NP_001054291.1|  Os04g0681600                                       285   6e-87    
ref|XP_004972393.1|  PREDICTED: choline transporter-like protein ...    285   7e-87    Setaria italica
ref|XP_003580838.1|  PREDICTED: choline transporter-like protein 2      284   1e-86    Brachypodium distachyon [annual false brome]
ref|XP_002444851.1|  hypothetical protein SORBIDRAFT_07g000250          282   1e-85    Sorghum bicolor [broomcorn]
dbj|BAK00584.1|  predicted protein                                      275   3e-83    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004487693.1|  PREDICTED: choline transporter-like protein ...    274   8e-83    
ref|XP_008647208.1|  PREDICTED: choline transporter-like protein 2      272   1e-82    
ref|XP_008679492.1|  PREDICTED: choline transporter-like protein 2      271   9e-82    Zea mays [maize]
ref|XP_006659724.1|  PREDICTED: choline transporter-like protein ...    263   1e-78    Oryza brachyantha
ref|XP_009351421.1|  PREDICTED: choline transporter-like protein 2      254   5e-76    Pyrus x bretschneideri [bai li]
ref|XP_003573246.1|  PREDICTED: choline transporter-like protein 2      253   5e-75    Brachypodium distachyon [annual false brome]
ref|XP_002862703.1|  predicted protein                                  236   8e-74    
gb|EMT23496.1|  hypothetical protein F775_29578                         239   3e-69    
ref|XP_001757700.1|  predicted protein                                  217   3e-61    
gb|EMS55310.1|  hypothetical protein TRIUR3_16176                       207   1e-58    Triticum urartu
ref|XP_010545817.1|  PREDICTED: choline transporter-like protein ...    207   5e-58    Tarenaya hassleriana [spider flower]
ref|XP_001771780.1|  predicted protein                                  181   2e-48    
gb|AFK44223.1|  unknown                                                 149   9e-42    Lotus japonicus
ref|XP_003064404.1|  choline transporter like family                    159   1e-40    Micromonas pusilla CCMP1545
ref|XP_002500718.1|  choline transporter like family                    157   3e-40    Micromonas commoda
ref|XP_003084176.1|  Choline transporter-like protein (ISS)             141   3e-34    
emb|CEG00747.1|  Choline transporter-like                               141   4e-34    Ostreococcus tauri
ref|XP_005648747.1|  DUF580-domain-containing protein                   139   1e-33    Coccomyxa subellipsoidea C-169
ref|XP_001422243.1|  predicted protein                                  135   3e-32    Ostreococcus lucimarinus CCE9901
gb|KIZ04426.1|  Choline transporter-like protein 5-A                    127   6e-32    Monoraphidium neglectum
ref|XP_009146249.1|  PREDICTED: choline transporter-like protein ...    129   2e-30    Brassica rapa
ref|XP_003062745.1|  choline transporter like family                    129   3e-30    Micromonas pusilla CCMP1545
ref|XP_002952038.1|  hypothetical protein VOLCADRAFT_121040             128   2e-29    Volvox carteri f. nagariensis
ref|XP_007511067.1|  predicted protein                                  127   3e-29    Bathycoccus prasinos
ref|XP_001689518.1|  predicted protein                                  127   4e-29    Chlamydomonas reinhardtii
ref|XP_002508657.1|  choline transporter like family                    124   1e-28    Micromonas commoda
ref|XP_010934826.1|  PREDICTED: choline transporter-like protein ...    117   6e-26    
ref|XP_006674882.1|  hypothetical protein BATDEDRAFT_1420               115   2e-25    Batrachochytrium dendrobatidis JAM81
gb|EPZ32735.1|  Choline transporter-like domain-containing protein      112   2e-24    Rozella allomycis CSF55
ref|XP_007480210.1|  PREDICTED: choline transporter-like protein 5      108   3e-23    
ref|XP_004350030.1|  solute carrier family 44 protein member 2          108   8e-23    Cavenderia fasciculata
ref|XP_011666027.1|  PREDICTED: choline transporter-like protein 1      106   1e-22    
gb|EFB29962.1|  hypothetical protein PANDA_005099                       107   1e-22    Ailuropoda melanoleuca
ref|XP_004363972.1|  choline transporter-like protein                   107   2e-22    Capsaspora owczarzaki ATCC 30864
ref|XP_001461575.1|  hypothetical protein                               105   7e-22    Paramecium tetraurelia strain d4-2
gb|KDR16745.1|  Choline transporter-like protein 1                      105   8e-22    Zootermopsis nevadensis
ref|XP_004758234.1|  PREDICTED: choline transporter-like protein ...    105   1e-21    Mustela putorius furo [black ferret]
ref|XP_004758230.1|  PREDICTED: choline transporter-like protein ...    105   1e-21    Mustela putorius furo [black ferret]
ref|XP_004784930.1|  PREDICTED: choline transporter-like protein ...    105   1e-21    
ref|XP_008861285.1|  hypothetical protein H310_00321                    104   2e-21    Aphanomyces invadans
ref|XP_001944379.2|  PREDICTED: choline transporter-like protein 1      103   3e-21    Acyrthosiphon pisum
ref|XP_001458717.1|  hypothetical protein                               103   3e-21    Paramecium tetraurelia strain d4-2
gb|KDO33054.1|  hypothetical protein SPRG_01869                         103   4e-21    Saprolegnia parasitica CBS 223.65
ref|XP_001007756.1|  hypothetical protein TTHERM_00069180               102   5e-21    Tetrahymena thermophila SB210
ref|XP_008469468.1|  PREDICTED: choline transporter-like protein 1      102   7e-21    
ref|XP_008612348.1|  hypothetical protein SDRG_08250                    102   8e-21    Saprolegnia diclina VS20
emb|CDS19864.1|  choline transporter protein 2                          102   8e-21    Echinococcus granulosus
ref|XP_009822172.1|  hypothetical protein H257_00933                    102   8e-21    Aphanomyces astaci
emb|CDI98202.1|  choline transporter protein 2                          101   2e-20    Echinococcus multilocularis
ref|XP_002731355.1|  PREDICTED: choline transporter-like protein ...    101   2e-20    Saccoglossus kowalevskii
ref|XP_006919531.1|  PREDICTED: choline transporter-like protein 5      101   2e-20    
gb|EUB61135.1|  Choline transporter-like protein 5-A                    101   3e-20    Echinococcus granulosus
gb|EYB94274.1|  hypothetical protein Y032_0173g396                      100   3e-20    Ancylostoma ceylanicum
dbj|GAM18465.1|  hypothetical protein SAMD00019534_016400               100   3e-20    Acytostelium subglobosum LB1
gb|EYB94272.1|  hypothetical protein Y032_0173g396                    99.8    4e-20    Ancylostoma ceylanicum
gb|EYB94273.1|  hypothetical protein Y032_0173g396                    99.8    4e-20    Ancylostoma ceylanicum
gb|EPQ11280.1|  Choline transporter-like protein 5                      100   4e-20    Myotis brandtii
ref|XP_001636308.1|  predicted protein                                99.8    5e-20    Nematostella vectensis
ref|XP_002916963.2|  PREDICTED: choline transporter-like protein 5      100   6e-20    
ref|NP_942572.1|  choline transporter-like protein 2                  99.8    7e-20    Danio rerio [leopard danio]
ref|XP_005835119.1|  hypothetical protein GUITHDRAFT_58746            99.0    8e-20    Guillardia theta CCMP2712
ref|XP_008137662.1|  PREDICTED: choline transporter-like protein 5    99.4    9e-20    
gb|ENN79819.1|  hypothetical protein YQE_03642                        98.6    1e-19    Dendroctonus ponderosae
ref|XP_007062626.1|  PREDICTED: choline transporter-like protein ...  98.6    1e-19    
gb|ERL87775.1|  hypothetical protein D910_05164                       98.2    1e-19    Dendroctonus ponderosae
ref|XP_002432883.1|  conserved hypothetical protein                   98.6    1e-19    Pediculus humanus corporis [human body lice]
ref|XP_008689047.1|  PREDICTED: choline transporter-like protein 5    99.0    2e-19    Ursus maritimus [white bear]
gb|EYB94271.1|  hypothetical protein Y032_0173g396                    99.0    2e-19    Ancylostoma ceylanicum
ref|XP_011437432.1|  PREDICTED: choline transporter-like protein 1    97.8    2e-19    
ref|XP_001309538.1|  hypothetical protein                             98.2    2e-19    Trichomonas vaginalis G3
gb|ENN83028.1|  hypothetical protein YQE_00610                        93.6    3e-19    Dendroctonus ponderosae
ref|XP_002156866.2|  PREDICTED: choline transporter-like protein ...  98.2    3e-19    
ref|XP_002167680.2|  PREDICTED: choline transporter-like protein ...  94.4    3e-19    
ref|XP_008112317.1|  PREDICTED: choline transporter-like protein ...  97.8    3e-19    Anolis carolinensis [Carolina anole]
ref|XP_012011369.1|  PREDICTED: choline transporter-like protein ...  97.4    4e-19    
ref|XP_008328958.1|  PREDICTED: LOW QUALITY PROTEIN: choline tran...  97.4    4e-19    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_002909909.1|  choline transporter-like protein                 95.9    4e-19    Phytophthora infestans T30-4
gb|EPZ31046.1|  Choline transporter-like domain-containing protein    97.4    4e-19    Rozella allomycis CSF55
ref|XP_008112314.1|  PREDICTED: choline transporter-like protein ...  97.4    4e-19    Anolis carolinensis [Carolina anole]
ref|XP_002589940.1|  hypothetical protein BRAFLDRAFT_127837           97.4    4e-19    Branchiostoma floridae
gb|KHJ85813.1|  hypothetical protein OESDEN_14452                     94.4    4e-19    Oesophagostomum dentatum [nodule worm]
ref|XP_006823430.1|  PREDICTED: choline transporter-like protein ...  97.4    4e-19    Saccoglossus kowalevskii
ref|XP_008112313.1|  PREDICTED: choline transporter-like protein ...  97.4    4e-19    Anolis carolinensis [Carolina anole]
ref|XP_002901659.1|  choline transporter-like protein                 97.4    4e-19    Phytophthora infestans T30-4
ref|XP_012011368.1|  PREDICTED: choline transporter-like protein ...  97.4    4e-19    
ref|XP_010866084.1|  PREDICTED: choline transporter-like protein ...  97.1    5e-19    
gb|ETN64441.1|  ctl transporter                                       97.1    5e-19    Anopheles darlingi [American malaria mosquito]
ref|XP_010866086.1|  PREDICTED: choline transporter-like protein ...  96.7    5e-19    
ref|XP_004758232.1|  PREDICTED: choline transporter-like protein ...  97.4    5e-19    
ref|XP_007432671.1|  PREDICTED: choline transporter-like protein 5    96.7    5e-19    
ref|XP_005050755.1|  PREDICTED: choline transporter-like protein 5    97.1    5e-19    
ref|XP_004071894.1|  PREDICTED: choline transporter-like protein ...  97.1    6e-19    
ref|XP_004653796.1|  PREDICTED: choline transporter-like protein 5    97.1    6e-19    Jaculus jaculus
ref|XP_003770471.1|  PREDICTED: choline transporter-like protein 5    95.5    6e-19    
gb|ELR57995.1|  Choline transporter-like protein 5                    96.7    7e-19    Bos mutus
ref|XP_004431638.1|  PREDICTED: choline transporter-like protein 5    96.7    7e-19    
gb|ERL89403.1|  hypothetical protein D910_06771                       93.2    8e-19    Dendroctonus ponderosae
ref|XP_010873286.1|  PREDICTED: choline transporter-like protein ...  96.3    9e-19    Esox lucius
ref|XP_005165807.1|  PREDICTED: choline transporter-like protein ...  96.3    9e-19    
ref|XP_010873284.1|  PREDICTED: choline transporter-like protein ...  96.3    9e-19    Esox lucius
ref|XP_009971631.1|  PREDICTED: choline transporter-like protein 5    92.0    1e-18    Tyto alba [Schleiereule]
ref|XP_008328913.1|  PREDICTED: LOW QUALITY PROTEIN: choline tran...  95.9    1e-18    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_006069767.1|  PREDICTED: choline transporter-like protein 5    95.9    1e-18    
ref|XP_008878156.1|  hypothetical protein H310_12745                  95.9    1e-18    Aphanomyces invadans
ref|XP_001430596.1|  hypothetical protein                             92.8    1e-18    Paramecium tetraurelia strain d4-2
ref|XP_008112316.1|  PREDICTED: choline transporter-like protein ...  95.9    2e-18    Anolis carolinensis [Carolina anole]
ref|XP_008102018.1|  PREDICTED: choline transporter-like protein ...  95.5    2e-18    Anolis carolinensis [Carolina anole]
ref|XP_007062625.1|  PREDICTED: choline transporter-like protein ...  95.1    2e-18    Chelonia mydas [green seaturtle]
ref|XP_010793741.1|  PREDICTED: LOW QUALITY PROTEIN: choline tran...  95.1    2e-18    Notothenia coriiceps [yellowbelly rockcod]
ref|XP_008102019.1|  PREDICTED: choline transporter-like protein ...  95.5    2e-18    
ref|XP_006269016.1|  PREDICTED: choline transporter-like protein ...  95.5    2e-18    Alligator mississippiensis
ref|XP_004482970.1|  PREDICTED: choline transporter-like protein ...  95.5    2e-18    Dasypus novemcinctus
gb|KFM79681.1|  hypothetical protein X975_14148                       95.5    2e-18    Stegodyphus mimosarum
ref|XP_006733648.1|  PREDICTED: choline transporter-like protein 5    95.1    2e-18    
ref|XP_004482969.1|  PREDICTED: choline transporter-like protein ...  95.5    2e-18    Dasypus novemcinctus
ref|XP_012011370.1|  PREDICTED: choline transporter-like protein ...  95.1    2e-18    
ref|XP_009944736.1|  PREDICTED: choline transporter-like protein 5    90.9    2e-18    Leptosomus discolor
ref|XP_011476896.1|  PREDICTED: choline transporter-like protein ...  95.1    2e-18    Oryzias latipes [Japanese rice fish]
ref|XP_006130470.1|  PREDICTED: choline transporter-like protein ...  95.1    2e-18    Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_005622113.1|  PREDICTED: solute carrier family 44, member ...  95.1    2e-18    Canis lupus familiaris [dogs]
ref|XP_011476897.1|  PREDICTED: choline transporter-like protein ...  95.1    3e-18    Oryzias latipes [Japanese rice fish]
ref|XP_001434380.1|  hypothetical protein                             94.7    3e-18    Paramecium tetraurelia strain d4-2
ref|XP_005622115.1|  PREDICTED: solute carrier family 44, member ...  95.1    3e-18    Canis lupus familiaris [dogs]
dbj|GAM17171.1|  hypothetical protein SAMD00019534_003460             94.0    3e-18    Acytostelium subglobosum LB1
ref|XP_005976302.1|  PREDICTED: choline transporter-like protein 5    95.1    3e-18    
ref|XP_006021826.1|  PREDICTED: choline transporter-like protein 5    94.7    3e-18    Alligator sinensis
tpg|DAA31341.1|  TPA: choline transporter-like protein 4-like         94.7    3e-18    Bos taurus [bovine]
ref|XP_006086156.1|  PREDICTED: choline transporter-like protein 5    94.7    3e-18    
ref|XP_005871987.1|  PREDICTED: choline transporter-like protein 5    94.7    3e-18    Myotis brandtii
ref|XP_011612925.1|  PREDICTED: choline transporter-like protein ...  94.7    3e-18    
ref|XP_005302473.1|  PREDICTED: choline transporter-like protein ...  94.4    3e-18    Chrysemys picta bellii
ref|XP_006269015.1|  PREDICTED: choline transporter-like protein ...  94.7    3e-18    Alligator mississippiensis
ref|NP_001268845.1|  choline transporter-like protein 5               94.7    3e-18    Bos taurus [bovine]
emb|CCD28277.1|  choline-like transporter                             90.5    3e-18    Plasmopara viticola
ref|XP_005893526.1|  PREDICTED: choline transporter-like protein 5    94.7    4e-18    Bos mutus
ref|XP_010203379.1|  PREDICTED: choline transporter-like protein 5    92.0    4e-18    Colius striatus
gb|ACN10831.1|  Choline transporter-like protein 2                    94.4    4e-18    Salmo salar
ref|XP_008169510.1|  PREDICTED: choline transporter-like protein ...  94.4    5e-18    Chrysemys picta bellii
ref|XP_004699662.1|  PREDICTED: choline transporter-like protein 5    94.4    5e-18    
gb|ENN79400.1|  hypothetical protein YQE_04149                        92.4    5e-18    Dendroctonus ponderosae
ref|XP_005302469.1|  PREDICTED: choline transporter-like protein ...  94.0    5e-18    Chrysemys picta bellii
emb|CDQ68631.1|  unnamed protein product                              94.0    5e-18    Oncorhynchus mykiss
ref|XP_007488614.1|  PREDICTED: solute carrier family 44, member ...  94.0    6e-18    Monodelphis domestica
ref|XP_007488613.1|  PREDICTED: solute carrier family 44, member ...  94.0    6e-18    Monodelphis domestica
ref|XP_005302472.1|  PREDICTED: choline transporter-like protein ...  94.0    6e-18    Chrysemys picta bellii
ref|XP_005302470.1|  PREDICTED: choline transporter-like protein ...  94.0    6e-18    Chrysemys picta bellii
ref|XP_007488612.1|  PREDICTED: solute carrier family 44, member ...  94.0    6e-18    Monodelphis domestica
ref|XP_007079301.1|  PREDICTED: choline transporter-like protein 5    94.0    6e-18    Panthera tigris altaica
ref|XP_636423.1|  solute carrier family 44 protein member 2           93.6    7e-18    Dictyostelium discoideum AX4
ref|XP_006775967.1|  PREDICTED: choline transporter-like protein 5    94.0    7e-18    
ref|XP_006934904.2|  PREDICTED: LOW QUALITY PROTEIN: choline tran...  93.6    7e-18    
emb|CDJ87532.1|  unnamed protein product                              94.0    8e-18    Haemonchus contortus [red stomach worm]
gb|EJY88486.1|  hypothetical protein OXYTRI_12340                     93.6    8e-18    Oxytricha trifallax
ref|XP_004410892.1|  PREDICTED: choline transporter-like protein 5    93.6    8e-18    
ref|XP_004280006.1|  PREDICTED: choline transporter-like protein 5    93.6    8e-18    Orcinus orca [Orca]
gb|EKC21155.1|  Choline transporter-like protein 2                    91.7    8e-18    
ref|XP_006130469.1|  PREDICTED: choline transporter-like protein ...  93.2    9e-18    Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_001308490.1|  hypothetical protein                             93.2    9e-18    Trichomonas vaginalis G3
ref|XP_002681381.1|  choline transporter-like protein                 93.2    9e-18    Naegleria gruberi strain NEG-M
dbj|BAC03655.1|  unnamed protein product                              91.7    1e-17    Homo sapiens [man]
ref|NP_001120142.1|  choline transporter-like protein 5               93.2    1e-17    Xenopus tropicalis [western clawed frog]
gb|ENN83027.1|  hypothetical protein YQE_00610                        92.0    1e-17    Dendroctonus ponderosae
ref|XP_005994196.1|  PREDICTED: choline transporter-like protein ...  93.2    1e-17    Latimeria chalumnae
ref|XP_009047952.1|  hypothetical protein LOTGIDRAFT_112007           92.8    1e-17    Lottia gigantea
ref|XP_009820544.1|  PREDICTED: choline transporter-like protein 5    91.3    1e-17    Gavia stellata
ref|XP_005994195.1|  PREDICTED: choline transporter-like protein ...  93.2    1e-17    Latimeria chalumnae
gb|KFQ69864.1|  Choline transporter-like 5                            90.9    1e-17    Phaethon lepturus
gb|KFV49295.1|  Choline transporter-like 5                            90.9    1e-17    Gavia stellata
gb|ERL89402.1|  hypothetical protein D910_06771                       91.7    1e-17    Dendroctonus ponderosae
ref|XP_006004883.1|  PREDICTED: choline transporter-like protein ...  92.4    1e-17    Latimeria chalumnae
gb|ENN79399.1|  hypothetical protein YQE_04149                        92.0    1e-17    Dendroctonus ponderosae
ref|XP_011067341.1|  PREDICTED: choline transporter-like protein ...  92.4    2e-17    Acromyrmex echinatior
ref|XP_007430260.1|  PREDICTED: choline transporter-like protein ...  92.8    2e-17    Python bivittatus
ref|XP_003760512.1|  PREDICTED: choline transporter-like protein ...  92.4    2e-17    
dbj|BAH12459.1|  unnamed protein product                              92.4    2e-17    Homo sapiens [man]
ref|XP_004026041.1|  PREDICTED: choline transporter-like protein ...  92.4    2e-17    
ref|XP_011067500.1|  PREDICTED: choline transporter-like protein ...  92.4    2e-17    Acromyrmex echinatior
ref|XP_009421892.1|  PREDICTED: choline transporter-like protein ...  92.4    2e-17    
gb|EKC38816.1|  Choline transporter-like protein 1                    92.4    2e-17    
ref|XP_011433539.1|  PREDICTED: choline transporter-like protein 1    92.4    2e-17    Crassostrea gigas
ref|XP_009421864.1|  PREDICTED: choline transporter-like protein ...  92.4    2e-17    Pan troglodytes
ref|XP_010293145.1|  PREDICTED: choline transporter-like protein 5    90.9    2e-17    
gb|AAH28743.1|  Solute carrier family 44, member 5                    92.4    2e-17    
ref|XP_006004879.1|  PREDICTED: choline transporter-like protein ...  92.4    2e-17    
gb|KFP45190.1|  Choline transporter-like 5                            90.9    2e-17    
ref|XP_006631698.1|  PREDICTED: choline transporter-like protein ...  92.4    2e-17    
ref|XP_006004881.1|  PREDICTED: choline transporter-like protein ...  92.4    2e-17    
ref|XP_006710508.1|  PREDICTED: choline transporter-like protein ...  92.4    2e-17    
ref|XP_010125442.1|  PREDICTED: choline transporter-like protein 5    91.3    2e-17    
ref|XP_001167809.1|  PREDICTED: choline transporter-like protein ...  92.4    2e-17    
ref|XP_003308206.1|  PREDICTED: choline transporter-like protein ...  92.4    2e-17    
ref|XP_008920221.1|  PREDICTED: choline transporter-like protein 5    92.0    2e-17    
ref|XP_003830625.1|  PREDICTED: choline transporter-like protein ...  92.0    2e-17    
gb|AAH90749.1|  Wu:fc26c03 protein                                    89.7    2e-17    
emb|CDQ88922.1|  unnamed protein product                              91.3    2e-17    
ref|XP_006178378.1|  PREDICTED: choline transporter-like protein 5    92.0    2e-17    
ref|XP_010589489.1|  PREDICTED: choline transporter-like protein 5    91.7    2e-17    
ref|XP_011611316.1|  PREDICTED: choline transporter-like protein ...  92.4    2e-17    
ref|XP_011539285.1|  PREDICTED: choline transporter-like protein ...  92.0    2e-17    
ref|XP_011539287.1|  PREDICTED: choline transporter-like protein ...  92.0    3e-17    
gb|KFP83063.1|  Choline transporter-like 2                            92.0    3e-17    
ref|XP_011611315.1|  PREDICTED: choline transporter-like protein ...  92.4    3e-17    
ref|XP_011539283.1|  PREDICTED: choline transporter-like protein ...  92.0    3e-17    
ref|XP_009075837.1|  PREDICTED: choline transporter-like protein 2    92.0    3e-17    
ref|XP_005233491.1|  PREDICTED: choline transporter-like protein 2    92.0    3e-17    
ref|XP_011792325.1|  PREDICTED: choline transporter-like protein ...  91.7    3e-17    
ref|XP_008999750.1|  PREDICTED: choline transporter-like protein ...  92.0    3e-17    
ref|XP_008999751.1|  PREDICTED: choline transporter-like protein ...  92.0    3e-17    
ref|NP_689910.2|  choline transporter-like protein 5 isoform A        92.0    3e-17    
ref|XP_007183014.1|  PREDICTED: choline transporter-like protein 5    91.7    3e-17    
ref|XP_321327.5|  AGAP001756-PA                                       91.7    3e-17    
ref|XP_005166904.1|  PREDICTED: choline transporter-like protein ...  91.7    3e-17    
sp|A5PMW0.1|CTL5A_DANRE  RecName: Full=Choline transporter-like p...  91.7    3e-17    
ref|XP_009983559.1|  PREDICTED: choline transporter-like protein 5    90.9    3e-17    
ref|XP_011741181.1|  PREDICTED: choline transporter-like protein ...  91.7    3e-17    
gb|KFV17460.1|  Choline transporter-like 5                            90.9    3e-17    
ref|XP_009087056.1|  PREDICTED: choline transporter-like protein ...  91.7    3e-17    
ref|XP_011593556.1|  PREDICTED: choline transporter-like protein 5    91.3    3e-17    
ref|XP_009087055.1|  PREDICTED: choline transporter-like protein ...  91.7    3e-17    
gb|KGL78613.1|  Choline transporter-like 5                            91.7    3e-17    
ref|XP_696562.6|  PREDICTED: choline transporter-like protein 5-A     91.7    3e-17    
gb|KFZ53956.1|  Choline transporter-like 2                            90.9    3e-17    
ref|XP_009302127.1|  PREDICTED: choline transporter-like protein ...  91.7    3e-17    
ref|XP_010161575.1|  PREDICTED: choline transporter-like protein 2    90.9    3e-17    
ref|XP_010357413.1|  PREDICTED: choline transporter-like protein ...  91.7    3e-17    
ref|XP_007483630.1|  PREDICTED: choline transporter-like protein ...  91.7    4e-17    
ref|XP_011308154.1|  PREDICTED: choline transporter-like protein 1    91.3    4e-17    
ref|XP_009209339.1|  PREDICTED: choline transporter-like protein ...  91.7    4e-17    
gb|KFQ59836.1|  Choline transporter-like 2                            91.7    4e-17    
ref|XP_001376310.1|  PREDICTED: choline transporter-like protein ...  91.7    4e-17    
ref|XP_005436245.1|  PREDICTED: choline transporter-like protein 2    91.7    4e-17    
ref|XP_011741174.1|  PREDICTED: choline transporter-like protein ...  91.7    4e-17    
ref|XP_007115400.1|  PREDICTED: choline transporter-like protein ...  87.4    4e-17    
ref|XP_007483631.1|  PREDICTED: choline transporter-like protein ...  91.3    4e-17    
ref|XP_007483632.1|  PREDICTED: choline transporter-like protein ...  91.3    4e-17    
ref|XP_011937593.1|  PREDICTED: choline transporter-like protein ...  91.3    4e-17    
ref|XP_011937587.1|  PREDICTED: choline transporter-like protein ...  91.3    4e-17    
ref|XP_011937583.1|  PREDICTED: choline transporter-like protein ...  91.3    4e-17    
ref|XP_011937588.1|  PREDICTED: choline transporter-like protein ...  91.3    4e-17    
gb|EHH14891.1|  hypothetical protein EGK_00889                        91.3    4e-17    
emb|CDQ88148.1|  unnamed protein product                              91.3    4e-17    
ref|XP_011792322.1|  PREDICTED: choline transporter-like protein ...  91.3    4e-17    
ref|XP_011937589.1|  PREDICTED: choline transporter-like protein ...  91.3    4e-17    
ref|XP_011741180.1|  PREDICTED: choline transporter-like protein ...  91.3    4e-17    
ref|XP_012059277.1|  PREDICTED: choline transporter-like protein 1    91.3    4e-17    
ref|XP_006217181.1|  PREDICTED: choline transporter-like protein 5    91.3    4e-17    
ref|XP_696586.3|  PREDICTED: choline transporter-like protein 2 i...  91.7    4e-17    
ref|XP_001100356.1|  PREDICTED: solute carrier family 44, member ...  91.3    4e-17    
ref|XP_010214948.1|  PREDICTED: choline transporter-like protein 5    91.3    4e-17    
ref|XP_011937584.1|  PREDICTED: choline transporter-like protein ...  91.3    4e-17    
ref|XP_005438311.1|  PREDICTED: choline transporter-like protein 5    91.3    4e-17    
ref|XP_007976460.1|  PREDICTED: choline transporter-like protein ...  91.3    4e-17    
ref|XP_010732920.1|  PREDICTED: choline transporter-like protein ...  91.7    4e-17    
ref|XP_011792324.1|  PREDICTED: choline transporter-like protein ...  91.3    4e-17    
ref|XP_009247219.1|  PREDICTED: choline transporter-like protein ...  91.3    4e-17    
ref|XP_005244535.1|  PREDICTED: choline transporter-like protein 5    91.3    4e-17    
emb|CDQ58297.1|  unnamed protein product                              91.3    5e-17    
ref|XP_011937585.1|  PREDICTED: choline transporter-like protein ...  91.3    5e-17    
ref|XP_011937582.1|  PREDICTED: choline transporter-like protein ...  91.3    5e-17    
ref|XP_006831092.1|  PREDICTED: choline transporter-like protein 5    90.9    5e-17    
ref|XP_007976459.1|  PREDICTED: choline transporter-like protein ...  91.3    5e-17    
ref|XP_010732919.1|  PREDICTED: choline transporter-like protein ...  91.3    5e-17    
ref|XP_008933899.1|  PREDICTED: choline transporter-like protein 5    90.5    5e-17    
emb|CDW80041.1|  solute carrier family 44 protein member              90.9    5e-17    
ref|XP_005165806.1|  PREDICTED: choline transporter-like protein ...  91.3    5e-17    
ref|XP_009056507.1|  hypothetical protein LOTGIDRAFT_120296           91.3    5e-17    
gb|KGL92421.1|  Choline transporter-like 5                            90.9    5e-17    
gb|KFQ21933.1|  Choline transporter-like 5                            90.1    5e-17    
ref|XP_007976456.1|  PREDICTED: choline transporter-like protein ...  91.3    5e-17    
ref|XP_010743278.1|  PREDICTED: choline transporter-like protein ...  91.3    5e-17    
gb|KFQ05900.1|  Choline transporter-like 5                            90.9    5e-17    
gb|KFQ32366.1|  Choline transporter-like 5                            90.9    5e-17    
ref|XP_010743279.1|  PREDICTED: choline transporter-like protein ...  90.9    5e-17    
gb|KFR17098.1|  Choline transporter-like 5                            90.9    5e-17    
ref|XP_011833212.1|  PREDICTED: choline transporter-like protein ...  91.3    5e-17    
ref|XP_002810741.1|  PREDICTED: choline transporter-like protein ...  90.9    5e-17    
ref|XP_007447433.1|  PREDICTED: choline transporter-like protein 5    91.3    5e-17    
ref|XP_011937577.1|  PREDICTED: choline transporter-like protein ...  90.9    5e-17    
ref|XP_007976453.1|  PREDICTED: choline transporter-like protein ...  90.9    5e-17    
ref|XP_010181908.1|  PREDICTED: choline transporter-like protein 2    88.6    6e-17    
ref|XP_010898991.1|  PREDICTED: choline transporter-like protein 5-B  90.9    6e-17    
ref|XP_007976452.1|  PREDICTED: choline transporter-like protein ...  90.9    6e-17    
ref|XP_005747555.1|  PREDICTED: choline transporter-like protein ...  90.9    6e-17    
gb|KFO96336.1|  Choline transporter-like 5                            90.9    6e-17    
gb|KFQ50084.1|  Choline transporter-like 5                            90.5    6e-17    
ref|XP_011937575.1|  PREDICTED: choline transporter-like protein ...  90.9    6e-17    
ref|XP_007976450.1|  PREDICTED: choline transporter-like protein ...  90.9    6e-17    
gb|KFW07559.1|  Choline transporter-like 5                            90.9    6e-17    
gb|KFV76136.1|  Choline transporter-like 5                            90.9    6e-17    
gb|KFP67152.1|  Choline transporter-like 5                            90.9    6e-17    
emb|CAG03310.1|  unnamed protein product                              91.3    6e-17    
ref|XP_009702766.1|  PREDICTED: choline transporter-like protein 5    90.9    6e-17    
ref|XP_009919516.1|  PREDICTED: choline transporter-like protein 5    90.9    6e-17    
ref|XP_011937576.1|  PREDICTED: choline transporter-like protein ...  90.9    6e-17    
ref|XP_008281969.1|  PREDICTED: choline transporter-like protein ...  90.9    6e-17    
ref|XP_005405665.1|  PREDICTED: choline transporter-like protein ...  90.9    6e-17    
gb|KFP54496.1|  Choline transporter-like 5                            90.9    6e-17    
ref|XP_007976455.1|  PREDICTED: choline transporter-like protein ...  90.9    6e-17    
ref|XP_009882255.1|  PREDICTED: choline transporter-like protein 5    90.9    6e-17    
ref|XP_010013405.1|  PREDICTED: choline transporter-like protein 5    90.5    6e-17    
gb|KFQ59723.1|  Choline transporter-like 5                            90.9    6e-17    
ref|XP_011419024.1|  PREDICTED: choline transporter-like protein 2    90.9    6e-17    
ref|XP_002129182.1|  PREDICTED: choline transporter-like protein 1    90.5    6e-17    
gb|EOB01622.1|  Choline transporter-like protein 5                    90.9    6e-17    
gb|KFM11630.1|  Choline transporter-like 5                            90.5    6e-17    
ref|XP_009941013.1|  PREDICTED: choline transporter-like protein 5    90.9    6e-17    
gb|KFW64723.1|  Choline transporter-like 5                            90.5    7e-17    
ref|XP_010987383.1|  PREDICTED: choline transporter-like protein 5    90.9    7e-17    
ref|XP_005208848.1|  PREDICTED: choline transporter-like protein ...  90.9    7e-17    
ref|XP_004555116.1|  PREDICTED: choline transporter-like protein ...  90.9    7e-17    
ref|XP_010559794.1|  PREDICTED: choline transporter-like protein 5    90.9    7e-17    
ref|XP_008281968.1|  PREDICTED: choline transporter-like protein ...  90.5    7e-17    
gb|KFO12313.1|  Choline transporter-like 5                            90.5    7e-17    
ref|XP_009871296.1|  PREDICTED: choline transporter-like protein 5    90.5    7e-17    
ref|XP_009283583.1|  PREDICTED: choline transporter-like protein 5    90.5    7e-17    
ref|XP_003440056.1|  PREDICTED: choline transporter-like protein ...  90.5    7e-17    
ref|XP_010743276.1|  PREDICTED: choline transporter-like protein ...  90.5    7e-17    
gb|KFP90627.1|  Choline transporter-like 5                            90.5    7e-17    
ref|XP_006068427.1|  PREDICTED: choline transporter-like protein ...  90.5    7e-17    
ref|XP_011937573.1|  PREDICTED: choline transporter-like protein ...  90.9    7e-17    
ref|XP_009907324.1|  PREDICTED: choline transporter-like protein 5    90.5    8e-17    
ref|XP_005208847.1|  PREDICTED: choline transporter-like protein ...  90.5    8e-17    
ref|XP_009519325.1|  hypothetical protein PHYSODRAFT_485041           90.5    8e-17    
ref|XP_005747552.1|  PREDICTED: choline transporter-like protein ...  90.5    8e-17    
ref|XP_008498993.1|  PREDICTED: choline transporter-like protein 5    90.5    8e-17    
gb|KFW90307.1|  Choline transporter-like 5                            90.5    8e-17    
ref|XP_010633346.1|  PREDICTED: choline transporter-like protein 2    90.5    8e-17    
ref|XP_009501669.1|  PREDICTED: choline transporter-like protein 5    90.5    8e-17    
ref|XP_009477979.1|  PREDICTED: choline transporter-like protein 5    90.5    8e-17    
ref|XP_009318863.1|  PREDICTED: choline transporter-like protein 5    90.5    8e-17    
ref|XP_005405664.1|  PREDICTED: choline transporter-like protein ...  90.5    8e-17    
ref|XP_009579069.1|  PREDICTED: choline transporter-like protein 5    90.5    8e-17    
ref|XP_005588014.1|  PREDICTED: choline transporter-like protein ...  89.4    8e-17    
emb|CAH56352.1|  hypothetical protein                                 89.4    8e-17    
ref|XP_006068426.1|  PREDICTED: choline transporter-like protein ...  90.5    8e-17    
ref|XP_005019265.1|  PREDICTED: choline transporter-like protein 5    90.5    8e-17    
ref|XP_010743277.1|  PREDICTED: choline transporter-like protein ...  90.5    8e-17    
gb|EFX88458.1|  hypothetical protein DAPPUDRAFT_305570                90.5    8e-17    
ref|XP_010345792.1|  PREDICTED: choline transporter-like protein ...  90.1    8e-17    
ref|XP_002644687.1|  C. briggsae CBR-CHTL-1 protein                   90.5    8e-17    
gb|EMC79177.1|  Choline transporter-like protein 5                    90.5    8e-17    
ref|XP_010179284.1|  PREDICTED: choline transporter-like protein 5    90.5    8e-17    
ref|XP_004865574.1|  PREDICTED: choline transporter-like protein ...  90.5    9e-17    
ref|XP_010159806.1|  PREDICTED: choline transporter-like protein 5    90.5    9e-17    
gb|AAH68154.1|  Solute carrier family 44, member 5                    87.8    9e-17    
gb|KFO78102.1|  Choline transporter-like 5                            90.1    9e-17    
sp|A8XKF2.2|CTL1L_CAEBR  RecName: Full=Choline transporter-like p...  90.5    9e-17    
gb|KFV99756.1|  Choline transporter-like 5                            90.1    9e-17    
gb|EFA82487.1|  solute carrier family 44 protein member 2             90.1    9e-17    
ref|XP_008173659.1|  PREDICTED: choline transporter-like protein ...  90.1    9e-17    
ref|XP_010961759.1|  PREDICTED: choline transporter-like protein 5    90.5    9e-17    
ref|XP_005499009.1|  PREDICTED: choline transporter-like protein ...  90.1    1e-16    
ref|XP_003216885.1|  PREDICTED: choline transporter-like protein ...  90.1    1e-16    
gb|KFO90097.1|  Choline transporter-like 5                            90.1    1e-16    
ref|XP_010303737.1|  PREDICTED: choline transporter-like protein 5    90.1    1e-16    
ref|XP_004900371.1|  PREDICTED: choline transporter-like protein ...  90.1    1e-16    
ref|XP_002199756.2|  PREDICTED: solute carrier family 44, member ...  90.1    1e-16    
ref|XP_007257224.1|  PREDICTED: choline transporter-like protein ...  90.5    1e-16    
ref|XP_007257223.1|  PREDICTED: choline transporter-like protein ...  90.5    1e-16    
ref|XP_007257225.1|  PREDICTED: choline transporter-like protein ...  90.1    1e-16    
ref|XP_010714557.1|  PREDICTED: choline transporter-like protein 5    90.1    1e-16    
ref|XP_008173658.1|  PREDICTED: choline transporter-like protein ...  90.1    1e-16    
ref|XP_004900369.1|  PREDICTED: choline transporter-like protein ...  90.1    1e-16    
ref|XP_003921453.1|  PREDICTED: choline transporter-like protein ...  90.1    1e-16    
gb|KFP13749.1|  Choline transporter-like 5                            90.1    1e-16    
dbj|BAB25938.1|  unnamed protein product                              88.2    1e-16    
ref|XP_009561796.1|  PREDICTED: choline transporter-like protein 5    90.1    1e-16    
ref|XP_008848251.1|  PREDICTED: choline transporter-like protein ...  89.4    1e-16    
ref|XP_003921452.1|  PREDICTED: choline transporter-like protein ...  90.1    1e-16    
ref|XP_005279643.1|  PREDICTED: choline transporter-like protein ...  90.1    1e-16    
ref|XP_005029994.1|  PREDICTED: choline transporter-like protein ...  89.7    1e-16    
ref|XP_005151378.1|  PREDICTED: choline transporter-like protein 5    90.1    1e-16    
ref|XP_003292424.1|  hypothetical protein DICPUDRAFT_57949            89.7    1e-16    
ref|XP_005654920.1|  PREDICTED: choline transporter-like protein ...  90.1    1e-16    
ref|XP_010135037.1|  PREDICTED: choline transporter-like protein 5    90.1    1e-16    
gb|KJH41925.1|  hypothetical protein DICVIV_12108                     90.1    1e-16    
ref|XP_007107330.1|  PREDICTED: choline transporter-like protein ...  90.1    1e-16    
ref|XP_005654919.1|  PREDICTED: choline transporter-like protein ...  89.7    1e-16    
ref|XP_007107329.1|  PREDICTED: choline transporter-like protein ...  89.7    1e-16    
ref|XP_005429213.1|  PREDICTED: choline transporter-like protein 5    89.7    1e-16    
ref|XP_006146107.1|  PREDICTED: choline transporter-like protein ...  89.7    1e-16    
ref|XP_004999509.1|  PREDICTED: solute carrier family 44, member ...  89.7    1e-16    
gb|KFQ93986.1|  Choline transporter-like 5                            89.7    1e-16    
ref|XP_426673.2|  PREDICTED: solute carrier family 44, member 5 i...  89.7    1e-16    
ref|XP_004319516.1|  PREDICTED: choline transporter-like protein ...  86.7    1e-16    
ref|XP_007236994.1|  PREDICTED: choline transporter-like protein ...  89.7    1e-16    
ref|XP_005532828.1|  PREDICTED: choline transporter-like protein ...  89.7    1e-16    
ref|XP_009634496.1|  PREDICTED: choline transporter-like protein 5    89.7    1e-16    
ref|XP_005532827.1|  PREDICTED: choline transporter-like protein ...  89.7    1e-16    
ref|XP_007528180.1|  PREDICTED: choline transporter-like protein 5    89.7    1e-16    
ref|XP_007107327.1|  PREDICTED: choline transporter-like protein ...  89.7    1e-16    
gb|KFO52907.1|  Choline transporter-like 5                            89.7    1e-16    
ref|XP_008960087.1|  PREDICTED: choline transporter-like protein ...  89.0    2e-16    
ref|XP_002189393.1|  PREDICTED: choline transporter-like protein 5    89.7    2e-16    
ref|XP_009459461.1|  PREDICTED: choline transporter-like protein 5    89.7    2e-16    
gb|KFB45360.1|  hypothetical protein ZHAS_00013311                    89.4    2e-16    
ref|XP_008628810.1|  PREDICTED: choline transporter-like protein 5    89.7    2e-16    
ref|XP_005495456.1|  PREDICTED: choline transporter-like protein 5    89.4    2e-16    
ref|XP_009478203.1|  PREDICTED: choline transporter-like protein 2    89.4    2e-16    
ref|XP_010765987.1|  PREDICTED: choline transporter-like protein 2    89.7    2e-16    
ref|XP_001423808.1|  hypothetical protein                             89.4    2e-16    
ref|XP_003733518.1|  PREDICTED: choline transporter-like protein ...  89.4    2e-16    



>emb|CDP05903.1| unnamed protein product [Coffea canephora]
Length=345

 Score =   332 bits (851),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 158/200 (79%), Positives = 180/200 (90%), Gaps = 0/200 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ SF+E +RFIL A+RR+LK +NS PESW G++ F +SQ CLR + W +KSVN NA
Sbjct  146  LGSLIVSFVESVRFILEALRRKLKVANSMPESWVGRVLFRSSQFCLRCIGWTIKSVNHNA  205

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGK FFKASEIATELIISN+LRIGKVNVIGDVILFLGKL VSL SALFAFLMLD
Sbjct  206  YIMIAITGKGFFKASEIATELIISNILRIGKVNVIGDVILFLGKLCVSLSSALFAFLMLD  265

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            T+KYKS+++KISSP+FPVLVCW +GYVVATLFF+VVEMSIDTIILSFCQDSEEH GTAQ+
Sbjct  266  TNKYKSAHNKISSPIFPVLVCWSLGYVVATLFFAVVEMSIDTIILSFCQDSEEHQGTAQY  325

Query  276  APPLLMETLDSQNEMQRLTQ  217
            APPLL+ETL  QNEMQRLTQ
Sbjct  326  APPLLIETLSDQNEMQRLTQ  345



>ref|XP_009595567.1| PREDICTED: choline transporter-like protein 2 [Nicotiana tomentosiformis]
Length=700

 Score =   342 bits (878),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 162/200 (81%), Positives = 186/200 (93%), Gaps = 0/200 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ SFIE IRF+L A+RR+LK +NS PESW G+M +++SQGCLR +SWI+KSVNRNA
Sbjct  501  LGSLIVSFIESIRFLLEALRRKLKVANSAPESWVGRMVYNSSQGCLRCISWIIKSVNRNA  560

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YI+IAITGKSFFK+SEIAT+LIISN+LRIGKVNVIGDVILFLGKL VSL SALFAFLMLD
Sbjct  561  YILIAITGKSFFKSSEIATDLIISNILRIGKVNVIGDVILFLGKLCVSLASALFAFLMLD  620

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKYKS ++KISSP+FPVLVCW +GYVVATLFF+VVEMSIDTIILSFCQDSEEH GTAQ+
Sbjct  621  THKYKSGHNKISSPIFPVLVCWSLGYVVATLFFAVVEMSIDTIILSFCQDSEEHQGTAQY  680

Query  276  APPLLMETLDSQNEMQRLTQ  217
            APPLL+ETL+ QNEMQRLTQ
Sbjct  681  APPLLIETLNDQNEMQRLTQ  700



>ref|XP_009789519.1| PREDICTED: choline transporter-like protein 2 [Nicotiana sylvestris]
Length=700

 Score =   342 bits (878),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 162/200 (81%), Positives = 186/200 (93%), Gaps = 0/200 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ SFIE IRF+L A+RR+LK +NS PESW G+M +++SQGCLR +SWI+KSVNRNA
Sbjct  501  LGSLIVSFIESIRFLLEALRRKLKVANSAPESWVGRMVYNSSQGCLRCISWIIKSVNRNA  560

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YI+IAITGKSFFK+SEIAT+LIISN+LRIGKVNVIGDVILFLGKL VSL SALFAFLMLD
Sbjct  561  YILIAITGKSFFKSSEIATDLIISNILRIGKVNVIGDVILFLGKLCVSLASALFAFLMLD  620

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKYKS ++KISSP+FPVLVCW +GYVVATLFF+VVEMSIDTIILSFCQDSEEH GTAQ+
Sbjct  621  THKYKSGHNKISSPIFPVLVCWSLGYVVATLFFAVVEMSIDTIILSFCQDSEEHQGTAQY  680

Query  276  APPLLMETLDSQNEMQRLTQ  217
            APPLL+ETL+ QNEMQRLTQ
Sbjct  681  APPLLIETLNDQNEMQRLTQ  700



>gb|EYU44898.1| hypothetical protein MIMGU_mgv1a002214mg [Erythranthe guttata]
Length=700

 Score =   326 bits (836),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 180/200 (90%), Gaps = 0/200 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ SF+E IRFIL ++RR+LK  N    SW GK+ + TSQGC+R + +++KSVNRNA
Sbjct  501  LGSLVVSFVESIRFILESLRRKLKLVNPNHGSWIGKVVYQTSQGCIRCIGYVIKSVNRNA  560

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGK+FFKASEIATELI+SN+LRIGKVNVIGDVILFLGKL VSL SALFAFLMLD
Sbjct  561  YIMIAITGKNFFKASEIATELIMSNILRIGKVNVIGDVILFLGKLCVSLTSALFAFLMLD  620

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKYKS+++KISSPLFPVLVCWG GY+VATLFF VVEMSIDTIILSFCQDS+EH GTAQ+
Sbjct  621  THKYKSAHNKISSPLFPVLVCWGFGYIVATLFFGVVEMSIDTIILSFCQDSDEHQGTAQY  680

Query  276  APPLLMETLDSQNEMQRLTQ  217
            APPLL+ETL+ QNEMQRLTQ
Sbjct  681  APPLLIETLNDQNEMQRLTQ  700



>ref|XP_010098992.1| hypothetical protein L484_025652 [Morus notabilis]
 gb|EXB76294.1| hypothetical protein L484_025652 [Morus notabilis]
Length=671

 Score =   325 bits (833),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 155/202 (77%), Positives = 182/202 (90%), Gaps = 0/202 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ SF+E IRF+L ++RR+LK + + P++W G+MAFH S+ CLR V W ++SVNRNA
Sbjct  467  LGSLILSFVESIRFMLESVRRKLKVAGTAPDNWFGRMAFHISRFCLRCVDWTIRSVNRNA  526

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGKSF KAS IATELII+N+LRIG+VNVIGDVILFLGKL VSL SALFAFLMLD
Sbjct  527  YIMIAITGKSFCKASAIATELIINNILRIGRVNVIGDVILFLGKLCVSLSSALFAFLMLD  586

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKY++S++KISSPLFPVLVCW +GYVVATLFF+VVEMSIDTIILSFCQDSEEH GTAQ+
Sbjct  587  THKYRASHNKISSPLFPVLVCWCLGYVVATLFFAVVEMSIDTIILSFCQDSEEHQGTAQY  646

Query  276  APPLLMETLDSQNEMQRLTQ*P  211
            APPLL+ETL+ QNEMQRLTQ P
Sbjct  647  APPLLIETLNDQNEMQRLTQGP  668



>ref|XP_007021392.1| Plasma-membrane choline transporter family protein isoform 1 
[Theobroma cacao]
 gb|EOY12917.1| Plasma-membrane choline transporter family protein isoform 1 
[Theobroma cacao]
Length=701

 Score =   326 bits (835),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 177/200 (89%), Gaps = 0/200 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS+  SF+E IRFIL +IRR+LK + +TP+SW GKM +HTSQGC R V W +KSVNRNA
Sbjct  502  LGSLFVSFVESIRFILESIRRKLKVAGTTPDSWFGKMGYHTSQGCWRCVEWTIKSVNRNA  561

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGKSF +AS IATELI++N+LRIG+VNVIGDVILFLGKL VSL SA+F FLMLD
Sbjct  562  YIMIAITGKSFCRASAIATELIMNNILRIGRVNVIGDVILFLGKLCVSLSSAVFGFLMLD  621

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKY S ++KISSPL PVLVCW +GYVVATLFF+VVEMSIDTIILSFCQDSEEH GTAQ+
Sbjct  622  THKYSSGHNKISSPLLPVLVCWALGYVVATLFFAVVEMSIDTIILSFCQDSEEHQGTAQY  681

Query  276  APPLLMETLDSQNEMQRLTQ  217
            APPLL+ETL+ QNEMQRLTQ
Sbjct  682  APPLLIETLNDQNEMQRLTQ  701



>ref|XP_004291650.1| PREDICTED: choline transporter-like protein 2 [Fragaria vesca 
subsp. vesca]
Length=702

 Score =   325 bits (834),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 181/200 (91%), Gaps = 0/200 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ S +E IRF+L +IRRRLK S +TP +W GK AFHT++ CL  + W +KSVNRNA
Sbjct  498  LGSLIVSSVESIRFMLESIRRRLKVSGTTPNNWFGKAAFHTARFCLSCIEWTLKSVNRNA  557

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGKSF K+S +AT+LIISN+LRIG+VNVIGDVILFLGKL VSL +ALFAFLMLD
Sbjct  558  YIMIAITGKSFCKSSAVATDLIISNILRIGRVNVIGDVILFLGKLCVSLSTALFAFLMLD  617

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            TH+YKS+++KISSPLFPVLVCWG+GYVVATLFF+VVEMSIDTIILSFCQDSEEHHGTAQ+
Sbjct  618  THRYKSAHNKISSPLFPVLVCWGLGYVVATLFFAVVEMSIDTIILSFCQDSEEHHGTAQY  677

Query  276  APPLLMETLDSQNEMQRLTQ  217
            APPLL+ETL+ QNEMQRLTQ
Sbjct  678  APPLLIETLNDQNEMQRLTQ  697



>ref|XP_007021393.1| Plasma-membrane choline transporter family protein isoform 2 
[Theobroma cacao]
 gb|EOY12918.1| Plasma-membrane choline transporter family protein isoform 2 
[Theobroma cacao]
Length=697

 Score =   325 bits (834),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 177/200 (89%), Gaps = 0/200 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS+  SF+E IRFIL +IRR+LK + +TP+SW GKM +HTSQGC R V W +KSVNRNA
Sbjct  498  LGSLFVSFVESIRFILESIRRKLKVAGTTPDSWFGKMGYHTSQGCWRCVEWTIKSVNRNA  557

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGKSF +AS IATELI++N+LRIG+VNVIGDVILFLGKL VSL SA+F FLMLD
Sbjct  558  YIMIAITGKSFCRASAIATELIMNNILRIGRVNVIGDVILFLGKLCVSLSSAVFGFLMLD  617

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKY S ++KISSPL PVLVCW +GYVVATLFF+VVEMSIDTIILSFCQDSEEH GTAQ+
Sbjct  618  THKYSSGHNKISSPLLPVLVCWALGYVVATLFFAVVEMSIDTIILSFCQDSEEHQGTAQY  677

Query  276  APPLLMETLDSQNEMQRLTQ  217
            APPLL+ETL+ QNEMQRLTQ
Sbjct  678  APPLLIETLNDQNEMQRLTQ  697



>ref|XP_006451902.1| hypothetical protein CICLE_v10007637mg [Citrus clementina]
 ref|XP_006464736.1| PREDICTED: choline transporter-like protein 2-like isoform X2 
[Citrus sinensis]
 gb|ESR65142.1| hypothetical protein CICLE_v10007637mg [Citrus clementina]
Length=646

 Score =   324 bits (830),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 154/200 (77%), Positives = 181/200 (91%), Gaps = 0/200 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ SF+E +RFIL +IRR++K   +TP+SW GK AF++SQG LR + W +KSVNRNA
Sbjct  447  LGSLIVSFVESVRFILESIRRKMKVFGTTPDSWYGKAAFYSSQGILRCIEWTVKSVNRNA  506

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGKSF +AS IATELII+N+LRIG+VNVIGDVILFLGKL VSL SA+FAFLMLD
Sbjct  507  YIMIAITGKSFCRASSIATELIINNILRIGRVNVIGDVILFLGKLCVSLSSAVFAFLMLD  566

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKY+S+++KISSPLFPVLVCW +GYVVA+LFF+VVEMSIDTIILSFCQDSEEH GTAQ+
Sbjct  567  THKYRSAHNKISSPLFPVLVCWFLGYVVASLFFAVVEMSIDTIILSFCQDSEEHQGTAQY  626

Query  276  APPLLMETLDSQNEMQRLTQ  217
            APPLLMETL+ QNEMQRLTQ
Sbjct  627  APPLLMETLNDQNEMQRLTQ  646



>ref|XP_012084940.1| PREDICTED: choline transporter-like protein 2 [Jatropha curcas]
 gb|KDP27036.1| hypothetical protein JCGZ_20971 [Jatropha curcas]
Length=695

 Score =   324 bits (831),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 157/200 (79%), Positives = 180/200 (90%), Gaps = 0/200 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ SF+E IRFIL +IRR+LK +N+TP+SW GKM  HTSQ CLR V   +KSVNRNA
Sbjct  496  LGSLIVSFVESIRFILESIRRKLKVANATPDSWIGKMVHHTSQFCLRCVELTIKSVNRNA  555

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGKSF +AS IATELI++N+LRIGKVNVIGDVILFLGKL VSL SA+FAFLMLD
Sbjct  556  YIMIAITGKSFCRASAIATELIMNNILRIGKVNVIGDVILFLGKLCVSLSSAVFAFLMLD  615

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKY+SS++KISSPLFPV+VCW +GYVVATLFF+VVEMSIDTIILSFCQDSEEH GTAQ+
Sbjct  616  THKYRSSHNKISSPLFPVMVCWALGYVVATLFFAVVEMSIDTIILSFCQDSEEHQGTAQY  675

Query  276  APPLLMETLDSQNEMQRLTQ  217
            APPLL+ETL+ QNE QRLTQ
Sbjct  676  APPLLIETLNDQNETQRLTQ  695



>ref|XP_008226648.1| PREDICTED: choline transporter-like protein 2 [Prunus mume]
Length=699

 Score =   323 bits (829),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 155/202 (77%), Positives = 181/202 (90%), Gaps = 0/202 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ SF+E IRF+L +IRRRLK S +TP++W GK  +HTS+  LR + W +KS NRNA
Sbjct  497  LGSLIVSFVESIRFMLESIRRRLKVSGTTPDNWFGKAVYHTSRFSLRCIEWTIKSANRNA  556

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGKSF KAS IAT+LIISN+LRIG+VNVIGDVILFLGKL VSL +ALFAFLMLD
Sbjct  557  YIMIAITGKSFCKASAIATDLIISNILRIGRVNVIGDVILFLGKLCVSLSTALFAFLMLD  616

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            TH+Y+S+++KISSPLFPVLVCWG+GYVVATLFF+VVEMSIDTIILSFCQDSEEH GTAQ+
Sbjct  617  THRYRSAHNKISSPLFPVLVCWGLGYVVATLFFAVVEMSIDTIILSFCQDSEEHQGTAQY  676

Query  276  APPLLMETLDSQNEMQRLTQ*P  211
            APPLL+ETL+ QNEMQRLTQ P
Sbjct  677  APPLLIETLNDQNEMQRLTQGP  698



>ref|XP_006451901.1| hypothetical protein CICLE_v10007637mg [Citrus clementina]
 ref|XP_006464735.1| PREDICTED: choline transporter-like protein 2-like isoform X1 
[Citrus sinensis]
 gb|ESR65141.1| hypothetical protein CICLE_v10007637mg [Citrus clementina]
 gb|KDO74086.1| hypothetical protein CISIN_1g005448mg [Citrus sinensis]
Length=696

 Score =   323 bits (828),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/200 (77%), Positives = 181/200 (91%), Gaps = 0/200 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ SF+E +RFIL +IRR++K   +TP+SW GK AF++SQG LR + W +KSVNRNA
Sbjct  497  LGSLIVSFVESVRFILESIRRKMKVFGTTPDSWYGKAAFYSSQGILRCIEWTVKSVNRNA  556

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGKSF +AS IATELII+N+LRIG+VNVIGDVILFLGKL VSL SA+FAFLMLD
Sbjct  557  YIMIAITGKSFCRASSIATELIINNILRIGRVNVIGDVILFLGKLCVSLSSAVFAFLMLD  616

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKY+S+++KISSPLFPVLVCW +GYVVA+LFF+VVEMSIDTIILSFCQDSEEH GTAQ+
Sbjct  617  THKYRSAHNKISSPLFPVLVCWFLGYVVASLFFAVVEMSIDTIILSFCQDSEEHQGTAQY  676

Query  276  APPLLMETLDSQNEMQRLTQ  217
            APPLLMETL+ QNEMQRLTQ
Sbjct  677  APPLLMETLNDQNEMQRLTQ  696



>ref|XP_008452469.1| PREDICTED: choline transporter-like protein 2 [Cucumis melo]
Length=702

 Score =   322 bits (826),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 158/202 (78%), Positives = 181/202 (90%), Gaps = 0/202 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS+  SF+E IRFIL +IRR+LK +++TP+S  G+   +TS+ CLR + WI+KSVNRNA
Sbjct  498  LGSLTVSFMESIRFILESIRRKLKVASTTPDSRIGRAVHNTSRFCLRCIEWIIKSVNRNA  557

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGKSF KAS IATELII+N+LRIG+VNVIGDVILFLGKL VSL SALFAFLMLD
Sbjct  558  YIMIAITGKSFCKASAIATELIINNILRIGRVNVIGDVILFLGKLCVSLSSALFAFLMLD  617

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKY+S+++KISSPLFPVLVCWG+GYVVATLFF VVEMSIDTIILSFCQDSEEH GTAQ+
Sbjct  618  THKYRSAHNKISSPLFPVLVCWGLGYVVATLFFGVVEMSIDTIILSFCQDSEEHQGTAQY  677

Query  276  APPLLMETLDSQNEMQRLTQ*P  211
            APPLLMETL+ QNEMQRLTQ P
Sbjct  678  APPLLMETLNDQNEMQRLTQGP  699



>ref|XP_009356828.1| PREDICTED: choline transporter-like protein 2 [Pyrus x bretschneideri]
Length=706

 Score =   322 bits (826),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 155/207 (75%), Positives = 182/207 (88%), Gaps = 0/207 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ SF+E IRF+L +IRRR+K   +TP +W GK  +HTS+ CL  + W ++SVNRNA
Sbjct  498  LGSLIVSFVESIRFMLESIRRRIKVGGTTPNNWFGKAVYHTSRFCLMCIEWTIRSVNRNA  557

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGKSF  AS IAT+LI+SN+LRIG+VNVIGDVILFLGKL VSL +ALFAFLMLD
Sbjct  558  YIMIAITGKSFCNASAIATDLILSNILRIGRVNVIGDVILFLGKLCVSLSTALFAFLMLD  617

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKYKS+++KI+SPLFPVLVCWG+GYVVATLFF+VVEMSIDTIILSFCQDSEEH GTAQ+
Sbjct  618  THKYKSAHNKITSPLFPVLVCWGLGYVVATLFFAVVEMSIDTIILSFCQDSEEHQGTAQY  677

Query  276  APPLLMETLDSQNEMQRLTQ*PF*NSL  196
            APPLL+ETL+ QNEMQRLTQ P  NSL
Sbjct  678  APPLLIETLNDQNEMQRLTQGPQSNSL  704



>ref|XP_004141227.1| PREDICTED: choline transporter-like protein 2 [Cucumis sativus]
 gb|KGN55136.1| hypothetical protein Csa_4G637760 [Cucumis sativus]
Length=702

 Score =   322 bits (825),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 158/202 (78%), Positives = 181/202 (90%), Gaps = 0/202 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS+  SF+E IRFIL +IRR+LK +++TP+S  G+   +TS+ CLR + WI+KSVNRNA
Sbjct  498  LGSLTVSFMESIRFILESIRRKLKVASTTPDSRIGRAVHNTSRFCLRCIEWIIKSVNRNA  557

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGKSF KAS IATELII+N+LRIG+VNVIGDVILFLGKL VSL SALFAFLMLD
Sbjct  558  YIMIAITGKSFCKASAIATELIINNILRIGRVNVIGDVILFLGKLCVSLSSALFAFLMLD  617

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKY+S+++KISSPLFPVLVCWG+GYVVATLFF VVEMSIDTIILSFCQDSEEH GTAQ+
Sbjct  618  THKYRSAHNKISSPLFPVLVCWGLGYVVATLFFGVVEMSIDTIILSFCQDSEEHQGTAQY  677

Query  276  APPLLMETLDSQNEMQRLTQ*P  211
            APPLLMETL+ QNEMQRLTQ P
Sbjct  678  APPLLMETLNDQNEMQRLTQGP  699



>ref|XP_004244222.1| PREDICTED: choline transporter-like protein 2 [Solanum lycopersicum]
Length=699

 Score =   322 bits (824),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 178/200 (89%), Gaps = 0/200 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ SFIE IRFIL A+RR+LK +NS PESW G+M + +SQ  L+ V WI+KSVNRNA
Sbjct  500  LGSLIVSFIESIRFILEALRRKLKVTNSAPESWFGRMVYSSSQCLLQCVGWIIKSVNRNA  559

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YI+IAITGK FFK+SEIAT+LIISN+LRIGKVNVIGDVILFLGKL VSL SALFAFLMLD
Sbjct  560  YILIAITGKGFFKSSEIATDLIISNILRIGKVNVIGDVILFLGKLCVSLASALFAFLMLD  619

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKY   ++KISSP+FPVLVCW +GYVVATLFF+VVEMSIDTIILSFCQDSEEH GTAQ+
Sbjct  620  THKYNIGHNKISSPIFPVLVCWFLGYVVATLFFAVVEMSIDTIILSFCQDSEEHQGTAQY  679

Query  276  APPLLMETLDSQNEMQRLTQ  217
            APPLL+ETL+ Q EMQRLTQ
Sbjct  680  APPLLLETLNEQTEMQRLTQ  699



>ref|XP_009343591.1| PREDICTED: choline transporter-like protein 2 [Pyrus x bretschneideri]
Length=706

 Score =   322 bits (825),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 155/207 (75%), Positives = 182/207 (88%), Gaps = 0/207 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ SF+E IRF+L +IRRR+K   +TP +W GK  +HTS+ CL  V W ++SVNRNA
Sbjct  498  LGSLIVSFVESIRFMLESIRRRIKVGGTTPNNWFGKAVYHTSRFCLMCVEWTIRSVNRNA  557

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGKSF  AS IAT+LI+SN+LRIG+VNVIGDVILFLGKL VSL +ALFAFLMLD
Sbjct  558  YIMIAITGKSFCNASAIATDLILSNILRIGRVNVIGDVILFLGKLCVSLSTALFAFLMLD  617

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKYKS+++KI+SPLFPVLVCWG+GYVVA+LFF+VVEMSIDTIILSFCQDSEEH GTAQ+
Sbjct  618  THKYKSAHNKITSPLFPVLVCWGLGYVVASLFFAVVEMSIDTIILSFCQDSEEHQGTAQY  677

Query  276  APPLLMETLDSQNEMQRLTQ*PF*NSL  196
            APPLL+ETL+ QNEMQRLTQ P  NSL
Sbjct  678  APPLLIETLNDQNEMQRLTQGPQSNSL  704



>ref|XP_002316905.2| choline transporter-related family protein [Populus trichocarpa]
 gb|EEE97517.2| choline transporter-related family protein [Populus trichocarpa]
Length=697

 Score =   322 bits (824),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 153/200 (77%), Positives = 179/200 (90%), Gaps = 0/200 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ SF+E +RFIL +IRR+LK +N+TPES  G+ A+HTS+ C + + WI++SVNRNA
Sbjct  498  LGSLVLSFVESVRFILESIRRKLKVANTTPESCMGRTAYHTSRFCFQCIEWIIRSVNRNA  557

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGKSF +AS IATELIISN+LRIG+VNVIGDVIL+LGKL VSL SALFAFLMLD
Sbjct  558  YIMIAITGKSFCRASAIATELIISNILRIGRVNVIGDVILYLGKLCVSLSSALFAFLMLD  617

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKY+S+++KISSPL PVLVCW +GYVVATLFF+VVEMSID IILSFCQDSEEH GTAQ+
Sbjct  618  THKYRSAHNKISSPLLPVLVCWALGYVVATLFFAVVEMSIDAIILSFCQDSEEHQGTAQY  677

Query  276  APPLLMETLDSQNEMQRLTQ  217
            APPLLMETL  QNEMQRLTQ
Sbjct  678  APPLLMETLGDQNEMQRLTQ  697



>ref|XP_011029459.1| PREDICTED: choline transporter-like protein 2 isoform X1 [Populus 
euphratica]
Length=697

 Score =   321 bits (823),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 153/200 (77%), Positives = 179/200 (90%), Gaps = 0/200 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ SF+E +RFIL +IRR+LK +N+TPES  G+ A+HTS+ C + + WI++SVNRNA
Sbjct  498  LGSLVLSFVESVRFILESIRRKLKVANTTPESCMGRTAYHTSRFCFQCIEWIIRSVNRNA  557

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGKSF +AS IATELIISN+LRIG+VNVIGDVIL+LGKL VSL SALFAFLMLD
Sbjct  558  YIMIAITGKSFCRASAIATELIISNILRIGRVNVIGDVILYLGKLCVSLSSALFAFLMLD  617

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKY+S+++KISSPL PVLVCW +GYVVATLFF+VVEMSID IILSFCQDSEEH GTAQ+
Sbjct  618  THKYRSAHNKISSPLLPVLVCWALGYVVATLFFAVVEMSIDAIILSFCQDSEEHQGTAQY  677

Query  276  APPLLMETLDSQNEMQRLTQ  217
            APPLLMETL  QNEMQRLTQ
Sbjct  678  APPLLMETLGDQNEMQRLTQ  697



>ref|XP_011029460.1| PREDICTED: choline transporter-like protein 2 isoform X2 [Populus 
euphratica]
Length=697

 Score =   321 bits (823),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 153/200 (77%), Positives = 179/200 (90%), Gaps = 0/200 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ SF+E +RFIL +IRR+LK +N+TPES  G+ A+HTS+ C + + WI++SVNRNA
Sbjct  498  LGSLVLSFVESVRFILESIRRKLKVANTTPESCMGRTAYHTSRFCFQCIEWIIRSVNRNA  557

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGKSF +AS IATELIISN+LRIG+VNVIGDVIL+LGKL VSL SALFAFLMLD
Sbjct  558  YIMIAITGKSFCRASAIATELIISNILRIGRVNVIGDVILYLGKLCVSLSSALFAFLMLD  617

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKY+S+++KISSPL PVLVCW +GYVVATLFF+VVEMSID IILSFCQDSEEH GTAQ+
Sbjct  618  THKYRSAHNKISSPLLPVLVCWALGYVVATLFFAVVEMSIDAIILSFCQDSEEHQGTAQY  677

Query  276  APPLLMETLDSQNEMQRLTQ  217
            APPLLMETL  QNEMQRLTQ
Sbjct  678  APPLLMETLGDQNEMQRLTQ  697



>ref|XP_011082663.1| PREDICTED: choline transporter-like protein 2 [Sesamum indicum]
Length=702

 Score =   321 bits (823),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 178/200 (89%), Gaps = 0/200 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ SF+E IRFIL A+RR+LK  NS P+SW GK+ + TSQ CL+ +  I++SVNRNA
Sbjct  503  LGSLVVSFVESIRFILEALRRKLKLVNSMPQSWIGKVIYQTSQCCLKCIGCIIRSVNRNA  562

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGK FFKASEIATELI+SN+LRIGKVNVIGDVILFLGKL VSL SALFAFLMLD
Sbjct  563  YIMIAITGKGFFKASEIATELIMSNILRIGKVNVIGDVILFLGKLCVSLTSALFAFLMLD  622

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            TH+YKS+++KISSPLFPVLVCW  GY+VATLFF VVEMSIDTIILSFCQDS+EH GTAQ+
Sbjct  623  THRYKSAHNKISSPLFPVLVCWVFGYIVATLFFGVVEMSIDTIILSFCQDSDEHQGTAQY  682

Query  276  APPLLMETLDSQNEMQRLTQ  217
            APPLL+ETL+ QNE QRLTQ
Sbjct  683  APPLLIETLNDQNETQRLTQ  702



>ref|XP_002528555.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF33810.1| conserved hypothetical protein [Ricinus communis]
Length=697

 Score =   321 bits (822),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 181/200 (91%), Gaps = 0/200 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ SF+E IRF+L +IRR+LK +++TP+SW GKM  HTS+ CLR V   +KSVNRNA
Sbjct  498  LGSLIVSFVESIRFMLESIRRKLKVASTTPDSWIGKMVHHTSRFCLRCVDCTIKSVNRNA  557

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGKSF +AS IATELIISN+LRIG+VNVIGDVILFLGKL VSL SA+FAFLMLD
Sbjct  558  YIMIAITGKSFCRASSIATELIISNILRIGRVNVIGDVILFLGKLCVSLSSAVFAFLMLD  617

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKY+SS++KI+SPLFPVLVCW +GY+VATLFF+VVEMSIDTIILSFCQDSEEH GTAQ+
Sbjct  618  THKYRSSHNKITSPLFPVLVCWVLGYIVATLFFAVVEMSIDTIILSFCQDSEEHQGTAQY  677

Query  276  APPLLMETLDSQNEMQRLTQ  217
            APPLL+ETL+ QNEMQRLTQ
Sbjct  678  APPLLIETLNDQNEMQRLTQ  697



>ref|XP_007213616.1| hypothetical protein PRUPE_ppa002216mg [Prunus persica]
 gb|EMJ14815.1| hypothetical protein PRUPE_ppa002216mg [Prunus persica]
Length=699

 Score =   321 bits (822),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 180/202 (89%), Gaps = 0/202 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ SF+E IRF+L +IRRRLK + +TP++W GK  +HTS+  LR + W +KS NRNA
Sbjct  497  LGSLIVSFVESIRFMLESIRRRLKVAGTTPDNWFGKAVYHTSRFSLRCIEWTIKSANRNA  556

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGKSF KAS IAT+LI SN+LRIG+VNVIGDVILFLGKL VSL +ALFAFLMLD
Sbjct  557  YIMIAITGKSFCKASAIATDLIFSNILRIGRVNVIGDVILFLGKLCVSLSTALFAFLMLD  616

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            TH+Y+S+++KISSPLFPVLVCWG+GYVVATLFF+VVEMSIDTIILSFCQDSEEH GTAQ+
Sbjct  617  THRYRSAHNKISSPLFPVLVCWGLGYVVATLFFAVVEMSIDTIILSFCQDSEEHQGTAQY  676

Query  276  APPLLMETLDSQNEMQRLTQ*P  211
            APPLL+ETL+ QNEMQRLTQ P
Sbjct  677  APPLLIETLNDQNEMQRLTQGP  698



>ref|XP_006348242.1| PREDICTED: choline transporter-like protein 2-like [Solanum tuberosum]
Length=699

 Score =   321 bits (822),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 177/200 (89%), Gaps = 0/200 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ SFIE IRFIL A+RR+LK SNS PESW G+M +++SQ  LR + W +KSVNRNA
Sbjct  500  LGSLIVSFIESIRFILEALRRKLKVSNSAPESWFGRMVYNSSQCLLRCIGWTIKSVNRNA  559

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YI+IAITGK FFK+SEIAT+LIISN+LRIGKVNVIGDVILFLGKL VSL SALFAFLMLD
Sbjct  560  YILIAITGKGFFKSSEIATDLIISNILRIGKVNVIGDVILFLGKLCVSLASALFAFLMLD  619

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKY   ++KISSP+FPVLVCW +GYVVATLFF+VVEMSIDTIILSFCQDSEEH GTAQ+
Sbjct  620  THKYNIGHNKISSPIFPVLVCWFLGYVVATLFFAVVEMSIDTIILSFCQDSEEHQGTAQY  679

Query  276  APPLLMETLDSQNEMQRLTQ  217
            APPLL+ TL+ Q EMQRLTQ
Sbjct  680  APPLLLATLNDQTEMQRLTQ  699



>gb|KJB45693.1| hypothetical protein B456_007G321200 [Gossypium raimondii]
Length=697

 Score =   319 bits (818),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 153/200 (77%), Positives = 177/200 (89%), Gaps = 0/200 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ S +E IRFIL +IRR+LK +  T + W GK+  HTSQGCLR V W +KSVNRNA
Sbjct  498  LGSLVVSLVESIRFILESIRRKLKVAGVTSDGWFGKIGNHTSQGCLRCVEWTIKSVNRNA  557

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGKSFFKASEIATELI++N+LRIGKVNVIGDVILFLGKL VSL SA+F FLMLD
Sbjct  558  YIMIAITGKSFFKASEIATELIMNNILRIGKVNVIGDVILFLGKLCVSLSSAIFGFLMLD  617

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            T+KY+++++KISSPL PVL+CW +GYVVATLFF+VVEMSIDTIILSFCQDSEEH GTAQ+
Sbjct  618  TYKYRAAHNKISSPLLPVLICWALGYVVATLFFAVVEMSIDTIILSFCQDSEEHQGTAQY  677

Query  276  APPLLMETLDSQNEMQRLTQ  217
            APPLL+ETL  QNEMQRLTQ
Sbjct  678  APPLLIETLGDQNEMQRLTQ  697



>gb|KHG10168.1| Choline transporter-like protein 2 [Gossypium arboreum]
Length=709

 Score =   320 bits (819),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 153/200 (77%), Positives = 177/200 (89%), Gaps = 0/200 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ SF+E IRFIL +IRR+LK +  T + W GK+  HTSQGCLR V W +KSVNRNA
Sbjct  510  LGSLVVSFVESIRFILESIRRKLKVAGVTSDGWFGKIGNHTSQGCLRCVEWTIKSVNRNA  569

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGKSFFKASEIATELI++N+LRIGKVNVIGDVILFLGKL VSL SA+F FLMLD
Sbjct  570  YIMIAITGKSFFKASEIATELIMNNILRIGKVNVIGDVILFLGKLCVSLSSAVFGFLMLD  629

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            T+KY+++++KISSPL PVL+CW +GYVVA LFF+VVEMSIDTIILSFCQDSEEH GTAQ+
Sbjct  630  TYKYRAAHNKISSPLLPVLICWALGYVVAALFFAVVEMSIDTIILSFCQDSEEHQGTAQY  689

Query  276  APPLLMETLDSQNEMQRLTQ  217
            APPLL+ETL  QNEMQRLTQ
Sbjct  690  APPLLIETLGDQNEMQRLTQ  709



>ref|XP_008386171.1| PREDICTED: choline transporter-like protein 2 [Malus domestica]
Length=706

 Score =   319 bits (817),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 156/207 (75%), Positives = 181/207 (87%), Gaps = 0/207 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ SF+E IRF+L +IRRRLK + +T ++W GK  +H S+  LR + W +KSVNRNA
Sbjct  498  LGSLIVSFVESIRFMLESIRRRLKVAGTTXDNWFGKXVYHASRFFLRCIEWTIKSVNRNA  557

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGKSF KAS IAT+LIISN+LRIGKVNVIGDVILFLGKL VSL +ALFAFLMLD
Sbjct  558  YIMIAITGKSFCKASAIATDLIISNILRIGKVNVIGDVILFLGKLCVSLSTALFAFLMLD  617

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKYKS ++KI+SPLFPVLVCW +GYVVATLFF+VVEMSIDTIILSFCQDSEEH GTAQ+
Sbjct  618  THKYKSGHNKITSPLFPVLVCWALGYVVATLFFAVVEMSIDTIILSFCQDSEEHQGTAQY  677

Query  276  APPLLMETLDSQNEMQRLTQ*PF*NSL  196
            APPLL++TLD QNEMQRLTQ P  +SL
Sbjct  678  APPLLIQTLDDQNEMQRLTQGPQSDSL  704



>gb|KJB13393.1| hypothetical protein B456_002G072200 [Gossypium raimondii]
Length=555

 Score =   314 bits (804),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 148/200 (74%), Positives = 176/200 (88%), Gaps = 0/200 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ SF+E IRFIL + RR+LK + +TP+SW GKM +HTSQGCLR V W +KSVNRNA
Sbjct  356  LGSLIVSFVESIRFILESFRRKLKVTETTPDSWFGKMVYHTSQGCLRCVEWTIKSVNRNA  415

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGKSF ++S IATELI++N+LR+ ++NVIGDVILFLGKL VSL SA+F FL+LD
Sbjct  416  YIMIAITGKSFCRSSAIATELIMNNILRLVRLNVIGDVILFLGKLFVSLSSAVFGFLVLD  475

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKY S ++K+SSPL PVLVCW +GYVVATLFF+VVEMSIDT+ILSFCQDSEEH GTAQF
Sbjct  476  THKYSSGHNKLSSPLLPVLVCWTLGYVVATLFFAVVEMSIDTLILSFCQDSEEHEGTAQF  535

Query  276  APPLLMETLDSQNEMQRLTQ  217
            AP LLMETL+ QN+MQRLTQ
Sbjct  536  APLLLMETLNEQNDMQRLTQ  555



>ref|XP_010060542.1| PREDICTED: choline transporter-like protein 2 [Eucalyptus grandis]
 gb|KCW67319.1| hypothetical protein EUGRSUZ_F01103 [Eucalyptus grandis]
Length=700

 Score =   317 bits (812),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 155/202 (77%), Positives = 177/202 (88%), Gaps = 0/202 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ SF+E IRFIL ++RR+LK   STP  + GK  FH+SQ  LR + W +KSVNRNA
Sbjct  498  LGSLVVSFVESIRFILESVRRKLKAVTSTPNGFFGKATFHSSQFLLRCIEWTLKSVNRNA  557

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGKSF +AS IATELI SN+LRIG+VNVIGDVIL LGKL VSL SALFAFLMLD
Sbjct  558  YIMIAITGKSFCRASAIATELIFSNILRIGRVNVIGDVILSLGKLCVSLSSALFAFLMLD  617

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKY+S+++KISSPLFPVLVCWG+GYVVATLFF+VVEMSIDTIILSFCQDSEEH GTAQ+
Sbjct  618  THKYRSADNKISSPLFPVLVCWGLGYVVATLFFAVVEMSIDTIILSFCQDSEEHQGTAQY  677

Query  276  APPLLMETLDSQNEMQRLTQ*P  211
            APPLL+ETL+ QNEMQRLTQ P
Sbjct  678  APPLLIETLNDQNEMQRLTQGP  699



>ref|XP_008363605.1| PREDICTED: choline transporter-like protein 2 [Malus domestica]
Length=706

 Score =   317 bits (813),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 151/207 (73%), Positives = 180/207 (87%), Gaps = 0/207 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ SF+E IRF+L +IRRR+K   +TP +W G+  +HTS+ CL  + W ++S NRNA
Sbjct  498  LGSLIVSFVESIRFMLESIRRRIKVGGTTPNNWFGRAVYHTSRFCLMCIEWTIRSANRNA  557

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGKSF  AS IAT+LI++N+LRIG+VNVIGDVILFLGKL VSL +ALFAFLMLD
Sbjct  558  YIMIAITGKSFCNASAIATDLILNNILRIGRVNVIGDVILFLGKLCVSLSTALFAFLMLD  617

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKYKS+++KI+SPLFPVLVCWG+GYVVATLFF VVEMSIDTIILS+CQDSEEH GTAQ+
Sbjct  618  THKYKSAHNKITSPLFPVLVCWGLGYVVATLFFGVVEMSIDTIILSYCQDSEEHQGTAQY  677

Query  276  APPLLMETLDSQNEMQRLTQ*PF*NSL  196
            APPLL+ETL+ QNEMQRLTQ P  NSL
Sbjct  678  APPLLIETLNDQNEMQRLTQGPQSNSL  704



>ref|XP_002284857.1| PREDICTED: choline transporter-like protein 2 [Vitis vinifera]
 emb|CBI20324.3| unnamed protein product [Vitis vinifera]
Length=697

 Score =   317 bits (811),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 177/200 (89%), Gaps = 0/200 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS+  SF+E IRF+L +IRR+LK  N  PES  G++AF+ SQG  + + W +KSVNRNA
Sbjct  498  LGSLTVSFVESIRFMLESIRRKLKVYNMMPESRVGRVAFYFSQGFRKCIEWTIKSVNRNA  557

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGKSF +AS IATELIISN+LRIGKVNVIGDVILFLGKL VSL SA+FAFLMLD
Sbjct  558  YIMIAITGKSFCRASAIATELIISNILRIGKVNVIGDVILFLGKLCVSLSSAVFAFLMLD  617

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKY+S+++KISSPLFPVLVCWG+GYVVATLFF VVEMSIDTIILSFCQDSEEH GTAQ+
Sbjct  618  THKYRSAHNKISSPLFPVLVCWGLGYVVATLFFGVVEMSIDTIILSFCQDSEEHQGTAQY  677

Query  276  APPLLMETLDSQNEMQRLTQ  217
            APPLL+ETL+ QNEMQRLTQ
Sbjct  678  APPLLIETLNDQNEMQRLTQ  697



>emb|CAN73032.1| hypothetical protein VITISV_026350 [Vitis vinifera]
Length=738

 Score =   316 bits (810),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 177/200 (89%), Gaps = 0/200 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS+  SF+E IRF+L +IRR+LK  N  PES  G++AF+ SQG  + + W +KSVNRNA
Sbjct  539  LGSLTVSFVESIRFMLESIRRKLKVYNMMPESRVGRVAFYFSQGFRKCIEWTIKSVNRNA  598

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGKSF +AS IATELIISN+LRIGKVNVIGDVILFLGKL VSL SA+FAFLMLD
Sbjct  599  YIMIAITGKSFCRASAIATELIISNILRIGKVNVIGDVILFLGKLCVSLSSAVFAFLMLD  658

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKY+S+++KISSPLFPVLVCWG+GYVVATLFF VVEMSIDTIILSFCQDSEEH GTAQ+
Sbjct  659  THKYRSAHNKISSPLFPVLVCWGLGYVVATLFFGVVEMSIDTIILSFCQDSEEHQGTAQY  718

Query  276  APPLLMETLDSQNEMQRLTQ  217
            APPLL+ETL+ QNEMQRLTQ
Sbjct  719  APPLLIETLNDQNEMQRLTQ  738



>ref|XP_007149582.1| hypothetical protein PHAVU_005G082400g [Phaseolus vulgaris]
 gb|ESW21576.1| hypothetical protein PHAVU_005G082400g [Phaseolus vulgaris]
Length=341

 Score =   304 bits (779),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 147/202 (73%), Positives = 173/202 (86%), Gaps = 1/202 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS+  SF+E IRF+L +IRR+LK S+  P+SW GK A+ +SQ   R + W +KSVNRNA
Sbjct  140  LGSLTVSFVESIRFLLESIRRKLKVSSHVPDSWIGKAAYQSSQCFQRCIGWTIKSVNRNA  199

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIA+TGKSFF AS +ATELI++N+LRIG+VNVIGDVILFLGKL VSL SA+FAFLMLD
Sbjct  200  YIMIAVTGKSFFNASAVATELIMNNILRIGRVNVIGDVILFLGKLCVSLSSAVFAFLMLD  259

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKY+S++ KISSPL PV+VCW +GYVVATLFF+VVEMSIDTIILSFCQDSEE HGTAQ+
Sbjct  260  THKYRSAHDKISSPLLPVVVCWALGYVVATLFFAVVEMSIDTIILSFCQDSEE-HGTAQY  318

Query  276  APPLLMETLDSQNEMQRLTQ*P  211
            A PLL+ETL  QNEMQRL Q P
Sbjct  319  ASPLLIETLGDQNEMQRLAQAP  340



>gb|KJB13392.1| hypothetical protein B456_002G072200 [Gossypium raimondii]
Length=644

 Score =   313 bits (801),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 148/200 (74%), Positives = 176/200 (88%), Gaps = 0/200 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ SF+E IRFIL + RR+LK + +TP+SW GKM +HTSQGCLR V W +KSVNRNA
Sbjct  445  LGSLIVSFVESIRFILESFRRKLKVTETTPDSWFGKMVYHTSQGCLRCVEWTIKSVNRNA  504

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGKSF ++S IATELI++N+LR+ ++NVIGDVILFLGKL VSL SA+F FL+LD
Sbjct  505  YIMIAITGKSFCRSSAIATELIMNNILRLVRLNVIGDVILFLGKLFVSLSSAVFGFLVLD  564

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKY S ++K+SSPL PVLVCW +GYVVATLFF+VVEMSIDT+ILSFCQDSEEH GTAQF
Sbjct  565  THKYSSGHNKLSSPLLPVLVCWTLGYVVATLFFAVVEMSIDTLILSFCQDSEEHEGTAQF  624

Query  276  APPLLMETLDSQNEMQRLTQ  217
            AP LLMETL+ QN+MQRLTQ
Sbjct  625  APLLLMETLNEQNDMQRLTQ  644



>gb|KJB13391.1| hypothetical protein B456_002G072200 [Gossypium raimondii]
Length=697

 Score =   312 bits (800),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 148/200 (74%), Positives = 176/200 (88%), Gaps = 0/200 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ SF+E IRFIL + RR+LK + +TP+SW GKM +HTSQGCLR V W +KSVNRNA
Sbjct  498  LGSLIVSFVESIRFILESFRRKLKVTETTPDSWFGKMVYHTSQGCLRCVEWTIKSVNRNA  557

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGKSF ++S IATELI++N+LR+ ++NVIGDVILFLGKL VSL SA+F FL+LD
Sbjct  558  YIMIAITGKSFCRSSAIATELIMNNILRLVRLNVIGDVILFLGKLFVSLSSAVFGFLVLD  617

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKY S ++K+SSPL PVLVCW +GYVVATLFF+VVEMSIDT+ILSFCQDSEEH GTAQF
Sbjct  618  THKYSSGHNKLSSPLLPVLVCWTLGYVVATLFFAVVEMSIDTLILSFCQDSEEHEGTAQF  677

Query  276  APPLLMETLDSQNEMQRLTQ  217
            AP LLMETL+ QN+MQRLTQ
Sbjct  678  APLLLMETLNEQNDMQRLTQ  697



>ref|XP_010545818.1| PREDICTED: choline transporter-like protein 2 isoform X2 [Tarenaya 
hassleriana]
Length=699

 Score =   311 bits (798),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 148/202 (73%), Positives = 179/202 (89%), Gaps = 2/202 (1%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ SF+E +RFIL AIRR+LK + + P++W G+MA++  +GCL+ + W +KSVNRNA
Sbjct  498  LGSLIVSFVESVRFILEAIRRKLKVAGTPPDNWFGRMAYYACRGCLKSIEWTIKSVNRNA  557

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGKSF K+S +ATELII+NVLRIGKVNVIGDVILFLGKL VSL SALF FLMLD
Sbjct  558  YIMIAITGKSFCKSSAMATELIINNVLRIGKVNVIGDVILFLGKLCVSLFSALFGFLMLD  617

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            +HKY+SS++K+SSPLFPVLVCW +GYVVATLFF+VVEMSI+TIILSFCQDSEEH GTAQ+
Sbjct  618  SHKYRSSHNKVSSPLFPVLVCWVLGYVVATLFFAVVEMSIETIILSFCQDSEEHQGTAQY  677

Query  276  APPLLMETLD--SQNEMQRLTQ  217
            APPLL+ETLD   Q ++QRLTQ
Sbjct  678  APPLLLETLDHNDQTDVQRLTQ  699



>gb|KHG30658.1| Choline transporter-like protein 2 [Gossypium arboreum]
Length=707

 Score =   311 bits (797),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 148/199 (74%), Positives = 175/199 (88%), Gaps = 0/199 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ SF+E IRFIL + RR+LK + +TP+SW GKM +HTSQGCLR V W +KSVNRNA
Sbjct  509  LGSLIVSFVESIRFILESFRRKLKVAETTPDSWFGKMVYHTSQGCLRCVEWTIKSVNRNA  568

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGKSF ++S IATELI++N+LR+ +VNVIGDVILFLGKL VSL SA+F FL+LD
Sbjct  569  YIMIAITGKSFCRSSAIATELIMNNILRLVRVNVIGDVILFLGKLFVSLSSAVFGFLVLD  628

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKY S ++K+SSPL PVLVCW +GYVVATLFF+VVEMSIDT+ILSFCQDSEEH GTAQF
Sbjct  629  THKYSSGHNKLSSPLLPVLVCWTLGYVVATLFFAVVEMSIDTLILSFCQDSEEHEGTAQF  688

Query  276  APPLLMETLDSQNEMQRLT  220
            AP LLMETL+ QN+MQRLT
Sbjct  689  APLLLMETLNEQNDMQRLT  707



>ref|XP_010242931.1| PREDICTED: choline transporter-like protein 2 [Nelumbo nucifera]
Length=700

 Score =   309 bits (791),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 146/200 (73%), Positives = 175/200 (88%), Gaps = 0/200 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS+L S +E +R+IL +IRR+LK +N+TPE WP K+ F++S+ C   +   ++SVNRNA
Sbjct  498  LGSLLVSLVESVRYILESIRRKLKVANTTPEGWPSKVKFYSSRCCFTCIQSTIRSVNRNA  557

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGK FFKAS IAT LI++N+LRIG+VNVIGDVILFLGKL VSL SA+FAFLMLD
Sbjct  558  YIMIAITGKGFFKASAIATGLIMNNILRIGRVNVIGDVILFLGKLCVSLSSAVFAFLMLD  617

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKY+S+++KISSPLFPVLVCW +GYVVATLFF+VVEMSIDTIILSFCQDSEEH G AQ+
Sbjct  618  THKYRSAHNKISSPLFPVLVCWWLGYVVATLFFAVVEMSIDTIILSFCQDSEEHQGNAQY  677

Query  276  APPLLMETLDSQNEMQRLTQ  217
            APPLL+ETL+ QNEMQRLT 
Sbjct  678  APPLLIETLNDQNEMQRLTH  697



>ref|XP_010695012.1| PREDICTED: choline transporter-like protein 2 [Beta vulgaris 
subsp. vulgaris]
Length=696

 Score =   308 bits (790),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 150/200 (75%), Positives = 173/200 (87%), Gaps = 0/200 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            +GS++ SF+E IRFIL +IRR+LK S + PE+W GKM  H+S+ CL+ V W +KSVNRNA
Sbjct  497  IGSLVLSFVESIRFILESIRRKLKVSYTAPENWFGKMVHHSSKWCLKCVEWTIKSVNRNA  556

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGKSFFK+S IATELI++N+LRIGKVNVIGDVIL LGKL VSL S LF FLMLD
Sbjct  557  YIMIAITGKSFFKSSAIATELIMNNILRIGKVNVIGDVILSLGKLCVSLSSTLFGFLMLD  616

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKYKSS++KISSPLFPVL CW +GYVVATLFF VVEMSIDTIILSFCQD+EEH G AQ+
Sbjct  617  THKYKSSHNKISSPLFPVLACWVLGYVVATLFFGVVEMSIDTIILSFCQDAEEHQGNAQY  676

Query  276  APPLLMETLDSQNEMQRLTQ  217
            AP LL+ETL+ QNE QRLTQ
Sbjct  677  APSLLIETLNDQNETQRLTQ  696



>ref|XP_008778474.1| PREDICTED: choline transporter-like protein 2 [Phoenix dactylifera]
Length=706

 Score =   308 bits (790),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 173/202 (86%), Gaps = 0/202 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ S +E IRFIL ++RRRLK ++S+P S  GKM   +SQ CL  + W +KS NRNA
Sbjct  505  LGSLIVSIVEWIRFILESLRRRLKLADSSPVSLMGKMMSSSSQCCLGCIDWTIKSANRNA  564

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGK F KAS IAT LI++N+LRIGKVNVIGDVILFLGKL VSL  ALFAFLMLD
Sbjct  565  YIMIAITGKGFCKASAIATGLIMNNILRIGKVNVIGDVILFLGKLCVSLFCALFAFLMLD  624

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKYKS+++KISSPLFPVLVCWG+GYVVATLFF+VVEMSIDTIILSFCQD+EEH G AQ+
Sbjct  625  THKYKSAHNKISSPLFPVLVCWGLGYVVATLFFAVVEMSIDTIILSFCQDAEEHQGAAQY  684

Query  276  APPLLMETLDSQNEMQRLTQ*P  211
            APPLLMETLD Q EMQRLTQ P
Sbjct  685  APPLLMETLDGQGEMQRLTQGP  706



>emb|CDX75829.1| BnaC03g39120D [Brassica napus]
Length=379

 Score =   296 bits (758),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 140/196 (71%), Positives = 167/196 (85%), Gaps = 0/196 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ SF+E +RFIL AIRRR K S + P+ W G+M ++TS+GCL+ V W +KS NRNA
Sbjct  175  LGSLVVSFVESVRFILEAIRRRTKVSGTRPDHWLGRMGYYTSRGCLKSVEWTIKSANRNA  234

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGKSF K+S IATELI +N++RIGKVNVIGDVILFLGKL VSL SALF FLMLD
Sbjct  235  YIMIAITGKSFCKSSAIATELIRNNIMRIGKVNVIGDVILFLGKLCVSLFSALFGFLMLD  294

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            +HKY+SS++K+SSPL PVL CW +GYVVATLFF+VVEMSIDTIILSFCQDSEE+ G AQ 
Sbjct  295  SHKYRSSHNKVSSPLLPVLACWALGYVVATLFFAVVEMSIDTIILSFCQDSEENEGNAQH  354

Query  276  APPLLMETLDSQNEMQ  229
            AP LL+ETLDS +E +
Sbjct  355  APSLLLETLDSNHEEE  370



>ref|XP_002882939.1| hypothetical protein ARALYDRAFT_478976 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59198.1| hypothetical protein ARALYDRAFT_478976 [Arabidopsis lyrata subsp. 
lyrata]
Length=697

 Score =   305 bits (781),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 148/202 (73%), Positives = 174/202 (86%), Gaps = 2/202 (1%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ SF+E +RFIL AIRRR K S +TP+ W  +MA +TS+GCL+ V W +KSVNRNA
Sbjct  496  LGSLIVSFVESVRFILEAIRRRTKVSGTTPDHWFWRMAHYTSRGCLKSVEWTIKSVNRNA  555

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGKSF K+S IATELIISN+LRIGKVNVIGDVILFLGKL VSL SALF FLMLD
Sbjct  556  YIMIAITGKSFCKSSAIATELIISNILRIGKVNVIGDVILFLGKLCVSLFSALFGFLMLD  615

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            +H+Y+SS++K+SSPL PVL CW +GY+VATLFF+VVEMSIDTIILSFCQDSEE+ G AQ 
Sbjct  616  SHRYRSSHNKVSSPLLPVLACWALGYIVATLFFAVVEMSIDTIILSFCQDSEENQGNAQH  675

Query  276  APPLLMETLDS--QNEMQRLTQ  217
            APPLL+ETLDS  + E+QRLT 
Sbjct  676  APPLLLETLDSNQEEEVQRLTH  697



>gb|KHN28052.1| Choline transporter-like protein 5-A [Glycine soja]
Length=696

 Score =   305 bits (780),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 149/202 (74%), Positives = 174/202 (86%), Gaps = 1/202 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS+  SF+E IRF+L +IRR+LK S+  P+SW GK A  +SQ   R + W +KSVNRNA
Sbjct  495  LGSLTVSFVESIRFLLESIRRKLKGSSHVPDSWIGKAAHQSSQCFRRSIEWTIKSVNRNA  554

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGKSFF+AS IATELI++N+LRIG+VNVIGDVILFLGKL VSL SA FAFLMLD
Sbjct  555  YIMIAITGKSFFRASAIATELIMNNILRIGRVNVIGDVILFLGKLCVSLSSAAFAFLMLD  614

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
             HKY+S+++KISSPL PV+VCW +GY+VATLFF+VVEMSIDTIILSFCQDSEE HGTAQ+
Sbjct  615  AHKYRSAHNKISSPLLPVVVCWALGYIVATLFFAVVEMSIDTIILSFCQDSEE-HGTAQY  673

Query  276  APPLLMETLDSQNEMQRLTQ*P  211
            APPLL+ETL  QNEMQRLTQ P
Sbjct  674  APPLLIETLGDQNEMQRLTQGP  695



>ref|XP_003540458.1| PREDICTED: choline transporter-like protein 2-like [Glycine max]
Length=699

 Score =   304 bits (779),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 149/202 (74%), Positives = 174/202 (86%), Gaps = 1/202 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS+  SF+E IRF+L +IRR+LK S+  P+SW GK A  +SQ   R + W +KSVNRNA
Sbjct  498  LGSLTVSFVESIRFLLESIRRKLKGSSHVPDSWIGKAAHQSSQCFRRSIEWTIKSVNRNA  557

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGKSFF+AS IATELI++N+LRIG+VNVIGDVILFLGKL VSL SA FAFLMLD
Sbjct  558  YIMIAITGKSFFRASAIATELIMNNILRIGRVNVIGDVILFLGKLCVSLSSAAFAFLMLD  617

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
             HKY+S+++KISSPL PV+VCW +GY+VATLFF+VVEMSIDTIILSFCQDSEE HGTAQ+
Sbjct  618  AHKYRSAHNKISSPLLPVVVCWALGYIVATLFFAVVEMSIDTIILSFCQDSEE-HGTAQY  676

Query  276  APPLLMETLDSQNEMQRLTQ*P  211
            APPLL+ETL  QNEMQRLTQ P
Sbjct  677  APPLLIETLGDQNEMQRLTQGP  698



>ref|XP_010940430.1| PREDICTED: choline transporter-like protein 2 isoform X2 [Elaeis 
guineensis]
Length=706

 Score =   304 bits (778),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 147/200 (74%), Positives = 173/200 (87%), Gaps = 0/200 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ S +E +RFIL ++RRRLK ++++PES  GKM   +SQ CL  + W +KS NRNA
Sbjct  505  LGSLIVSIVEWVRFILESLRRRLKLADTSPESLMGKMTSSSSQCCLGCIDWTIKSANRNA  564

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGK F KAS IAT LI++N+LRIGKVNVIGDVILFLGKL VSL  ALFAFLMLD
Sbjct  565  YIMIAITGKGFCKASAIATGLIMNNILRIGKVNVIGDVILFLGKLCVSLFCALFAFLMLD  624

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKYKS+++K+SSPLFPVL CWG+GYVVATLFF+VVEMSIDTIILSFCQD+EE+ GTAQ+
Sbjct  625  THKYKSAHNKVSSPLFPVLACWGLGYVVATLFFAVVEMSIDTIILSFCQDAEENQGTAQY  684

Query  276  APPLLMETLDSQNEMQRLTQ  217
            APPLLMETLD  +EMQRLTQ
Sbjct  685  APPLLMETLDGPSEMQRLTQ  704



>ref|XP_010940429.1| PREDICTED: choline transporter-like protein 2 isoform X1 [Elaeis 
guineensis]
Length=707

 Score =   304 bits (778),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 147/200 (74%), Positives = 173/200 (87%), Gaps = 0/200 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ S +E +RFIL ++RRRLK ++++PES  GKM   +SQ CL  + W +KS NRNA
Sbjct  506  LGSLIVSIVEWVRFILESLRRRLKLADTSPESLMGKMTSSSSQCCLGCIDWTIKSANRNA  565

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGK F KAS IAT LI++N+LRIGKVNVIGDVILFLGKL VSL  ALFAFLMLD
Sbjct  566  YIMIAITGKGFCKASAIATGLIMNNILRIGKVNVIGDVILFLGKLCVSLFCALFAFLMLD  625

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKYKS+++K+SSPLFPVL CWG+GYVVATLFF+VVEMSIDTIILSFCQD+EE+ GTAQ+
Sbjct  626  THKYKSAHNKVSSPLFPVLACWGLGYVVATLFFAVVEMSIDTIILSFCQDAEENQGTAQY  685

Query  276  APPLLMETLDSQNEMQRLTQ  217
            APPLLMETLD  +EMQRLTQ
Sbjct  686  APPLLMETLDGPSEMQRLTQ  705



>ref|XP_010502919.1| PREDICTED: choline transporter-like protein 2 [Camelina sativa]
Length=700

 Score =   303 bits (776),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 146/202 (72%), Positives = 174/202 (86%), Gaps = 2/202 (1%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ SF+E +RFIL AIRRR K S +TP+ W  +MA +TS+GCL+ V W +KSVNRNA
Sbjct  499  LGSLIVSFVESVRFILEAIRRRTKVSGATPDHWFWRMAHYTSRGCLKSVEWTIKSVNRNA  558

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGKSF K+S IATELI+SN+LRIGKVNVIGDVILFLGKL VSL SALF FLMLD
Sbjct  559  YIMIAITGKSFCKSSAIATELIMSNILRIGKVNVIGDVILFLGKLCVSLFSALFGFLMLD  618

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            +HKY++S++K+SSPL PVL CW +GY+VATLFF+VVEMSIDTIILSFCQDSE++ G AQ 
Sbjct  619  SHKYRTSHNKVSSPLLPVLACWALGYIVATLFFAVVEMSIDTIILSFCQDSEDNQGNAQH  678

Query  276  APPLLMETLDS--QNEMQRLTQ  217
            APPLL+ETLDS  + E+QRLT 
Sbjct  679  APPLLLETLDSNQEEEVQRLTH  700



>ref|XP_010487363.1| PREDICTED: choline transporter-like protein 2 [Camelina sativa]
Length=700

 Score =   303 bits (775),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 146/202 (72%), Positives = 174/202 (86%), Gaps = 2/202 (1%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ SF+E +RFIL AIRRR K S +TP+ W  +MA +TS+GCL+ V W +KSVNRNA
Sbjct  499  LGSLIVSFVESVRFILEAIRRRTKVSGATPDHWFWRMAHYTSRGCLKSVEWTIKSVNRNA  558

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGKSF K+S IATELI+SN+LRIGKVNVIGDVILFLGKL VSL SALF FLMLD
Sbjct  559  YIMIAITGKSFCKSSAIATELIMSNILRIGKVNVIGDVILFLGKLCVSLFSALFGFLMLD  618

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            +HKY++S++K+SSPL PVL CW +GY+VATLFF+VVEMSIDTIILSFCQDSE++ G AQ 
Sbjct  619  SHKYRTSHNKVSSPLLPVLACWALGYIVATLFFAVVEMSIDTIILSFCQDSEDNQGNAQH  678

Query  276  APPLLMETLDS--QNEMQRLTQ  217
            APPLL+ETLDS  + E+QRLT 
Sbjct  679  APPLLLETLDSNQEEEVQRLTH  700



>ref|XP_010465506.1| PREDICTED: choline transporter-like protein 2 [Camelina sativa]
Length=700

 Score =   302 bits (774),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 147/202 (73%), Positives = 173/202 (86%), Gaps = 2/202 (1%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ SF+E +RFIL AIRRR K S +TP+ W  +MA +TS+GCL+ V W +KSVNRNA
Sbjct  499  LGSLIVSFVESVRFILEAIRRRTKVSGATPDHWFWRMAHYTSRGCLKTVEWTIKSVNRNA  558

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGKSF K+S IATELI+SN+LRIGKVNVIGDVILFLGKL VSL SALF FLMLD
Sbjct  559  YIMIAITGKSFCKSSAIATELIMSNILRIGKVNVIGDVILFLGKLCVSLFSALFGFLMLD  618

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            +HKY+SS++K+SSPL PVL CW +GY VATLFF+VVEMSIDTIILSFCQDSE++ G AQ 
Sbjct  619  SHKYRSSHNKVSSPLLPVLACWALGYTVATLFFAVVEMSIDTIILSFCQDSEDNQGNAQH  678

Query  276  APPLLMETLDS--QNEMQRLTQ  217
            APPLL+ETLDS  + E+QRLT 
Sbjct  679  APPLLLETLDSNQEEEVQRLTH  700



>ref|XP_009408146.1| PREDICTED: choline transporter-like protein 2 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=707

 Score =   302 bits (774),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 149/200 (75%), Positives = 172/200 (86%), Gaps = 0/200 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ S +E +RFIL A+RRRL+ S+  P +  GK    +SQ CL  + WI+KSVNRNA
Sbjct  506  LGSLVVSIVEWVRFILEALRRRLRHSDPAPVTCIGKFMSSSSQCCLGCIDWIIKSVNRNA  565

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGK F KAS IAT LI++N+LRIGKVNVIGDVIL+LGKL VSL  ALFAFLMLD
Sbjct  566  YIMIAITGKGFSKASAIATGLIMNNILRIGKVNVIGDVILYLGKLCVSLFCALFAFLMLD  625

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKYKS+++KISSPLFPVLV WG+GY+VATLFF+VVEMSIDTIILSFCQD+EEH GTAQ+
Sbjct  626  THKYKSAHNKISSPLFPVLVTWGLGYIVATLFFAVVEMSIDTIILSFCQDAEEHQGTAQY  685

Query  276  APPLLMETLDSQNEMQRLTQ  217
            APPLLMETLDSQ EMQRLTQ
Sbjct  686  APPLLMETLDSQGEMQRLTQ  705



>ref|XP_009408147.1| PREDICTED: choline transporter-like protein 2 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=706

 Score =   302 bits (773),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 149/200 (75%), Positives = 172/200 (86%), Gaps = 0/200 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ S +E +RFIL A+RRRL+ S+  P +  GK    +SQ CL  + WI+KSVNRNA
Sbjct  505  LGSLVVSIVEWVRFILEALRRRLRHSDPAPVTCIGKFMSSSSQCCLGCIDWIIKSVNRNA  564

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGK F KAS IAT LI++N+LRIGKVNVIGDVIL+LGKL VSL  ALFAFLMLD
Sbjct  565  YIMIAITGKGFSKASAIATGLIMNNILRIGKVNVIGDVILYLGKLCVSLFCALFAFLMLD  624

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKYKS+++KISSPLFPVLV WG+GY+VATLFF+VVEMSIDTIILSFCQD+EEH GTAQ+
Sbjct  625  THKYKSAHNKISSPLFPVLVTWGLGYIVATLFFAVVEMSIDTIILSFCQDAEEHQGTAQY  684

Query  276  APPLLMETLDSQNEMQRLTQ  217
            APPLLMETLDSQ EMQRLTQ
Sbjct  685  APPLLMETLDSQGEMQRLTQ  704



>ref|XP_006299581.1| hypothetical protein CARUB_v10015755mg [Capsella rubella]
 gb|EOA32479.1| hypothetical protein CARUB_v10015755mg [Capsella rubella]
Length=700

 Score =   301 bits (771),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 146/202 (72%), Positives = 172/202 (85%), Gaps = 2/202 (1%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ SF+E +RFIL AIRRR K S + P+ W  +MA +TS+GCL+ V W +KSVNRNA
Sbjct  499  LGSLIVSFVESVRFILEAIRRRTKVSGTIPDHWFWRMAHYTSRGCLKSVEWTIKSVNRNA  558

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGKSF K+S IATELIISN++RIGKVNVIGDVILFLGKL VSL SALF FLMLD
Sbjct  559  YIMIAITGKSFCKSSAIATELIISNIMRIGKVNVIGDVILFLGKLCVSLFSALFGFLMLD  618

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            +HKY+SS++K+SSPL PVL CW +GY+VATLFF+VVEMSIDTIILSFCQDSE++ G AQ 
Sbjct  619  SHKYRSSHNKVSSPLLPVLACWALGYIVATLFFAVVEMSIDTIILSFCQDSEDNQGNAQH  678

Query  276  APPLLMETLDS--QNEMQRLTQ  217
            APPLL+ETLDS  + E QRLT 
Sbjct  679  APPLLLETLDSNQEEETQRLTH  700



>ref|XP_010535109.1| PREDICTED: choline transporter-like protein 2 [Tarenaya hassleriana]
Length=700

 Score =   301 bits (771),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 146/203 (72%), Positives = 177/203 (87%), Gaps = 3/203 (1%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ SF+E +RFIL AIR+RLK  ++ P++W GKMA++T +GCL+ V W +KSVNRNA
Sbjct  498  LGSLVVSFVEWVRFILEAIRQRLKVVSTPPDNWFGKMAYYTCRGCLKTVEWTIKSVNRNA  557

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YI IAITGKSF K+S +ATELI++N+LRIGKVNVIGDVILFLGKL VSL SA+F FLMLD
Sbjct  558  YITIAITGKSFCKSSAMATELIVNNILRIGKVNVIGDVILFLGKLCVSLFSAIFGFLMLD  617

Query  456  THKYKSSN-HKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQ  280
            + KY+SS+ +K+SSPLFPVLVCWG GYVVATLFF VVEMSIDTIILS+CQDSE+H GTA+
Sbjct  618  SDKYRSSSGNKVSSPLFPVLVCWGFGYVVATLFFGVVEMSIDTIILSYCQDSEDHQGTAR  677

Query  279  FAPPLLMETL--DSQNEMQRLTQ  217
            +APPLL+ETL  D Q E+QRLTQ
Sbjct  678  YAPPLLLETLGDDDQTEVQRLTQ  700



>ref|XP_008810450.1| PREDICTED: choline transporter-like protein 2 isoform X2 [Phoenix 
dactylifera]
 ref|XP_008810452.1| PREDICTED: choline transporter-like protein 2 isoform X2 [Phoenix 
dactylifera]
 ref|XP_008810453.1| PREDICTED: choline transporter-like protein 2 isoform X2 [Phoenix 
dactylifera]
Length=581

 Score =   297 bits (761),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 145/200 (73%), Positives = 168/200 (84%), Gaps = 0/200 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ S +E  RFIL ++RRRLK +++ P S  GKM   +SQ CL  + W + SVNRNA
Sbjct  380  LGSLVVSIVEWFRFILESLRRRLKLADTAPVSCMGKMMSSSSQCCLGCIDWTINSVNRNA  439

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGK F KAS IAT LI++N+LRIGKVNVIGDVILFLGKL VSL  ALFAFLMLD
Sbjct  440  YIMIAITGKGFCKASAIATGLIMNNILRIGKVNVIGDVILFLGKLCVSLFCALFAFLMLD  499

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKYKS++++ISSPLFPVLVCW +GY+VA LFF+VVEMSIDTIILSFCQD+EEH GTAQ 
Sbjct  500  THKYKSAHNRISSPLFPVLVCWALGYIVAALFFAVVEMSIDTIILSFCQDAEEHQGTAQC  559

Query  276  APPLLMETLDSQNEMQRLTQ  217
            APPLLMETLD + EMQRLTQ
Sbjct  560  APPLLMETLDGEGEMQRLTQ  579



>ref|XP_010934827.1| PREDICTED: choline transporter-like protein 2 isoform X4 [Elaeis 
guineensis]
Length=585

 Score =   297 bits (761),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 146/200 (73%), Positives = 169/200 (85%), Gaps = 0/200 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ S +E  RFIL ++RRRLK +++ P S  GKM   +SQ CL  + W +KSVNRNA
Sbjct  384  LGSLVVSIVEWFRFILESLRRRLKLADTAPVSCMGKMMSSSSQCCLGCIDWTIKSVNRNA  443

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGK F KAS IAT LI++N+LRIGKVNVIGDVILFLGKL VSL  ALFAFLMLD
Sbjct  444  YIMIAITGKGFCKASAIATGLIMNNILRIGKVNVIGDVILFLGKLCVSLFCALFAFLMLD  503

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKYKS++++ISSPLFPV VCWG+GY+VATLFF+VVEMSIDTIILSFCQD+EEH GTAQ 
Sbjct  504  THKYKSAHNRISSPLFPVQVCWGLGYIVATLFFAVVEMSIDTIILSFCQDAEEHQGTAQC  563

Query  276  APPLLMETLDSQNEMQRLTQ  217
            APPLLMETLD + E QRLTQ
Sbjct  564  APPLLMETLDGEGETQRLTQ  583



>ref|XP_004514344.1| PREDICTED: choline transporter-like protein 2-like [Cicer arietinum]
Length=700

 Score =   299 bits (766),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 140/200 (70%), Positives = 173/200 (87%), Gaps = 0/200 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ SF+E IRF+L +IRR+LK S+   +SW GK A+ +SQ  LR + W +KSVNRNA
Sbjct  498  LGSLIVSFVESIRFLLESIRRKLKVSSHAHDSWIGKAAYQSSQCFLRCIEWTIKSVNRNA  557

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGK FF AS IAT+LI++N+L+IG++N+IGDVILFLGKL VSL S++FAFLMLD
Sbjct  558  YIMIAITGKGFFSASSIATDLIMNNILKIGRLNIIGDVILFLGKLCVSLSSSVFAFLMLD  617

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKY S ++K SSPLFPV+VCWG+GY VATLFF+VVEMSID+I+LSFCQDSEEH GTAQ+
Sbjct  618  THKYNSGHNKTSSPLFPVVVCWGLGYTVATLFFAVVEMSIDSIVLSFCQDSEEHQGTAQY  677

Query  276  APPLLMETLDSQNEMQRLTQ  217
            APPLL++TL +QNEM RLTQ
Sbjct  678  APPLLIDTLGNQNEMHRLTQ  697



>ref|XP_009146248.1| PREDICTED: choline transporter-like protein 2 isoform X1 [Brassica 
rapa]
Length=700

 Score =   298 bits (764),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 142/201 (71%), Positives = 171/201 (85%), Gaps = 1/201 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ SF+E +RFIL AIRRR K   +TP+ W G+M ++TS+GCL+ V W +KSVNRNA
Sbjct  500  LGSLVVSFVESVRFILEAIRRRTKVRGTTPDHWLGRMGYYTSRGCLKSVEWTLKSVNRNA  559

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGKSF K+S +ATELI++N++RIGKVNVIGDVILFLGKL VSL SALF FLMLD
Sbjct  560  YIMIAITGKSFCKSSAMATELIMNNIMRIGKVNVIGDVILFLGKLCVSLFSALFGFLMLD  619

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            +HKY+ S++K+SSPL PVL CW +GYVVATLFF+VVEMSIDTIILSFCQDSEE+ G AQ 
Sbjct  620  SHKYRDSHNKVSSPLLPVLACWALGYVVATLFFAVVEMSIDTIILSFCQDSEENQGNAQH  679

Query  276  APPLLMETLDSQNE-MQRLTQ  217
            AP LL+ETLD+  E +QRLT 
Sbjct  680  APSLLLETLDNNEEDVQRLTH  700



>emb|CDX98556.1| BnaC05g38190D [Brassica napus]
Length=700

 Score =   298 bits (764),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 142/201 (71%), Positives = 171/201 (85%), Gaps = 1/201 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ SF+E +RFIL AIRRR K   +TP+ W G+M ++TS+GCL+ V W +KSVNRNA
Sbjct  500  LGSLVVSFVESVRFILEAIRRRTKVRGTTPDHWLGRMGYYTSRGCLKSVEWTLKSVNRNA  559

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGKSF K+S +ATELI++N++RIGKVNVIGDVILFLGKL VSL SALF FLMLD
Sbjct  560  YIMIAITGKSFCKSSAMATELIMNNIMRIGKVNVIGDVILFLGKLCVSLFSALFGFLMLD  619

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            +HKY+ S++K+SSPL PVL CW +GYVVATLFF+VVEMSIDTIILSFCQDSEE+ G AQ 
Sbjct  620  SHKYRDSHNKVSSPLLPVLACWALGYVVATLFFAVVEMSIDTIILSFCQDSEENQGNAQH  679

Query  276  APPLLMETLDSQNE-MQRLTQ  217
            AP LL+ETLD+  E +QRLT 
Sbjct  680  APSLLLETLDNNEEDVQRLTH  700



>emb|CDX97664.1| BnaA05g24150D [Brassica napus]
Length=700

 Score =   298 bits (764),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 142/201 (71%), Positives = 171/201 (85%), Gaps = 1/201 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ SF+E +RFIL AIRRR K   +TP+ W G+M ++TS+GCL+ V W +KSVNRNA
Sbjct  500  LGSLVVSFVESVRFILEAIRRRTKVRGTTPDHWLGRMGYYTSRGCLKSVEWTLKSVNRNA  559

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGKSF K+S +ATELI++N++RIGKVNVIGDVILFLGKL VSL SALF FLMLD
Sbjct  560  YIMIAITGKSFCKSSAMATELIMNNIMRIGKVNVIGDVILFLGKLCVSLFSALFGFLMLD  619

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            +HKY+ S++K+SSPL PVL CW +GYVVATLFF+VVEMSIDTIILSFCQDSEE+ G AQ 
Sbjct  620  SHKYRDSHNKVSSPLLPVLACWALGYVVATLFFAVVEMSIDTIILSFCQDSEENQGNAQH  679

Query  276  APPLLMETLDSQNE-MQRLTQ  217
            AP LL+ETLD+  E +QRLT 
Sbjct  680  APSLLLETLDNNEEDVQRLTH  700



>gb|KHN36810.1| Choline transporter-like protein 2 [Glycine soja]
Length=696

 Score =   298 bits (763),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 146/202 (72%), Positives = 172/202 (85%), Gaps = 1/202 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS+  SF+E IRF+L +IRR+LK S+  P+SW  K A+ +SQ   R + W +KSVNRNA
Sbjct  495  LGSLTVSFVESIRFLLESIRRKLKGSSHMPDSWIDKAAYQSSQCFRRCIEWTIKSVNRNA  554

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGKSFF+AS IATELI++N+LRIG VNVIGDVILFLGKL VSL SA+FAFLMLD
Sbjct  555  YIMIAITGKSFFRASAIATELIMNNILRIGHVNVIGDVILFLGKLCVSLSSAVFAFLMLD  614

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            TH Y S+++KISSPL PV+VCW +GY+VATLFF+VVEMSIDTIILSFCQDSEE HGTA +
Sbjct  615  THNYSSAHNKISSPLLPVVVCWALGYIVATLFFAVVEMSIDTIILSFCQDSEE-HGTAHY  673

Query  276  APPLLMETLDSQNEMQRLTQ*P  211
            APPLL+ETL  QN+MQRLTQ P
Sbjct  674  APPLLIETLGDQNDMQRLTQGP  695



>ref|XP_010934825.1| PREDICTED: choline transporter-like protein 2 isoform X2 [Elaeis 
guineensis]
Length=692

 Score =   298 bits (763),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 146/200 (73%), Positives = 169/200 (85%), Gaps = 0/200 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ S +E  RFIL ++RRRLK +++ P S  GKM   +SQ CL  + W +KSVNRNA
Sbjct  491  LGSLVVSIVEWFRFILESLRRRLKLADTAPVSCMGKMMSSSSQCCLGCIDWTIKSVNRNA  550

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGK F KAS IAT LI++N+LRIGKVNVIGDVILFLGKL VSL  ALFAFLMLD
Sbjct  551  YIMIAITGKGFCKASAIATGLIMNNILRIGKVNVIGDVILFLGKLCVSLFCALFAFLMLD  610

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKYKS++++ISSPLFPV VCWG+GY+VATLFF+VVEMSIDTIILSFCQD+EEH GTAQ 
Sbjct  611  THKYKSAHNRISSPLFPVQVCWGLGYIVATLFFAVVEMSIDTIILSFCQDAEEHQGTAQC  670

Query  276  APPLLMETLDSQNEMQRLTQ  217
            APPLLMETLD + E QRLTQ
Sbjct  671  APPLLMETLDGEGETQRLTQ  690



>ref|XP_006594780.1| PREDICTED: choline transporter-like protein 2-like [Glycine max]
Length=699

 Score =   298 bits (763),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 146/202 (72%), Positives = 172/202 (85%), Gaps = 1/202 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS+  SF+E IRF+L +IRR+LK S+  P+SW  K A+ +SQ   R + W +KSVNRNA
Sbjct  498  LGSLTVSFVESIRFLLESIRRKLKGSSHMPDSWIDKAAYQSSQCFRRCIEWTIKSVNRNA  557

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGKSFF+AS IATELI++N+LRIG VNVIGDVILFLGKL VSL SA+FAFLMLD
Sbjct  558  YIMIAITGKSFFRASAIATELIMNNILRIGHVNVIGDVILFLGKLCVSLSSAVFAFLMLD  617

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            TH Y S+++KISSPL PV+VCW +GY+VATLFF+VVEMSIDTIILSFCQDSEE HGTA +
Sbjct  618  THNYSSAHNKISSPLLPVVVCWALGYIVATLFFAVVEMSIDTIILSFCQDSEE-HGTAHY  676

Query  276  APPLLMETLDSQNEMQRLTQ*P  211
            APPLL+ETL  QN+MQRLTQ P
Sbjct  677  APPLLIETLGDQNDMQRLTQGP  698



>ref|XP_003540093.1| PREDICTED: choline transporter-like protein 2-like [Glycine max]
Length=699

 Score =   298 bits (763),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 143/202 (71%), Positives = 172/202 (85%), Gaps = 0/202 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ SF+E IRF+L  IRR+LK S+   +S  GK A+ +SQ  LR + W +KSVNRNA
Sbjct  498  LGSLIVSFVESIRFLLEVIRRKLKVSSHRHDSCLGKAAYQSSQCFLRCIEWTIKSVNRNA  557

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YI+IAITGKSFF AS IATELI++N+L+IG++NVIGDVILFLGKL VSL  ALFAFLMLD
Sbjct  558  YILIAITGKSFFSASSIATELIMNNILKIGRLNVIGDVILFLGKLCVSLSCALFAFLMLD  617

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKY S+++K SSPL PV+VCW +GY+V+TLFF+VVEMSIDTI+LSFCQDSEEH GTAQ+
Sbjct  618  THKYNSAHNKTSSPLLPVVVCWALGYIVSTLFFAVVEMSIDTIVLSFCQDSEEHQGTAQY  677

Query  276  APPLLMETLDSQNEMQRLTQ*P  211
            APPLL+ETL  QNEMQRLTQ P
Sbjct  678  APPLLVETLSDQNEMQRLTQGP  699



>ref|XP_007133083.1| hypothetical protein PHAVU_011G150000g [Phaseolus vulgaris]
 gb|ESW05077.1| hypothetical protein PHAVU_011G150000g [Phaseolus vulgaris]
Length=700

 Score =   298 bits (762),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 143/202 (71%), Positives = 173/202 (86%), Gaps = 0/202 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ SF+E IRF+L AIRR+LK S+   +S  GK A+ +SQ  L+ + W MKSVNRNA
Sbjct  498  LGSLIVSFVESIRFLLEAIRRKLKGSSDGHDSCIGKAAYQSSQCLLKCIEWTMKSVNRNA  557

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGKSFF AS IA +LI++N+L+IG++NVIGDVILFLGKL VSL  ALFAFLMLD
Sbjct  558  YIMIAITGKSFFGASSIAADLIMNNILKIGRLNVIGDVILFLGKLCVSLSCALFAFLMLD  617

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKYKS+++K SSPL PV+VCW +GY+VATLFF+VVEMSIDTI+LSFCQDSEEH GTAQ+
Sbjct  618  THKYKSAHNKTSSPLLPVVVCWALGYIVATLFFAVVEMSIDTIVLSFCQDSEEHQGTAQY  677

Query  276  APPLLMETLDSQNEMQRLTQ*P  211
            APPLL++TL  Q+EMQRLTQ P
Sbjct  678  APPLLIDTLTDQSEMQRLTQGP  699



>ref|XP_003527259.1| PREDICTED: choline transporter-like protein 2-like [Glycine max]
Length=699

 Score =   298 bits (762),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 145/202 (72%), Positives = 171/202 (85%), Gaps = 0/202 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ SF+E IRF+L AIRR+LK S+   +S  GK A+  SQ  LR + W +KSVNRN 
Sbjct  498  LGSLIVSFVESIRFLLEAIRRKLKVSSHGHDSCLGKAAYQFSQCFLRCIEWTIKSVNRNG  557

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGKSFF AS IATELI++N+L+IG++NVIGDVILFLGKL VSL  ALFAFLMLD
Sbjct  558  YIMIAITGKSFFSASFIATELIMNNILKIGRLNVIGDVILFLGKLCVSLSCALFAFLMLD  617

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKY S+++K SSPL PV+VCW +GY+VATLFF+VVEMSIDTI+LSFCQDSEEH GTAQ+
Sbjct  618  THKYNSAHNKTSSPLLPVVVCWALGYIVATLFFAVVEMSIDTIVLSFCQDSEEHQGTAQY  677

Query  276  APPLLMETLDSQNEMQRLTQ*P  211
            APPLL+ETL  QNEMQRLTQ P
Sbjct  678  APPLLVETLSDQNEMQRLTQGP  699



>gb|KHN37168.1| Choline transporter-like protein 2 [Glycine soja]
Length=699

 Score =   298 bits (762),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 145/202 (72%), Positives = 171/202 (85%), Gaps = 0/202 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ SF+E IRF+L AIRR+LK S+   +S  GK A+  SQ  LR + W +KSVNRN 
Sbjct  498  LGSLIVSFVESIRFLLEAIRRKLKVSSHGHDSCLGKAAYQFSQCFLRCIEWTIKSVNRNG  557

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGKSFF AS IATELI++N+L+IG++NVIGDVILFLGKL VSL  ALFAFLMLD
Sbjct  558  YIMIAITGKSFFSASFIATELIMNNILKIGRLNVIGDVILFLGKLCVSLSCALFAFLMLD  617

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKY S+++K SSPL PV+VCW +GY+VATLFF+VVEMSIDTI+LSFCQDSEEH GTAQ+
Sbjct  618  THKYNSAHNKTSSPLLPVVVCWALGYIVATLFFAVVEMSIDTIVLSFCQDSEEHQGTAQY  677

Query  276  APPLLMETLDSQNEMQRLTQ*P  211
            APPLL+ETL  QNEMQRLTQ P
Sbjct  678  APPLLVETLSDQNEMQRLTQGP  699



>ref|XP_010934824.1| PREDICTED: choline transporter-like protein 2 isoform X1 [Elaeis 
guineensis]
Length=704

 Score =   298 bits (762),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 146/200 (73%), Positives = 169/200 (85%), Gaps = 0/200 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ S +E  RFIL ++RRRLK +++ P S  GKM   +SQ CL  + W +KSVNRNA
Sbjct  503  LGSLVVSIVEWFRFILESLRRRLKLADTAPVSCMGKMMSSSSQCCLGCIDWTIKSVNRNA  562

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGK F KAS IAT LI++N+LRIGKVNVIGDVILFLGKL VSL  ALFAFLMLD
Sbjct  563  YIMIAITGKGFCKASAIATGLIMNNILRIGKVNVIGDVILFLGKLCVSLFCALFAFLMLD  622

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKYKS++++ISSPLFPV VCWG+GY+VATLFF+VVEMSIDTIILSFCQD+EEH GTAQ 
Sbjct  623  THKYKSAHNRISSPLFPVQVCWGLGYIVATLFFAVVEMSIDTIILSFCQDAEEHQGTAQC  682

Query  276  APPLLMETLDSQNEMQRLTQ  217
            APPLLMETLD + E QRLTQ
Sbjct  683  APPLLMETLDGEGETQRLTQ  702



>ref|NP_566511.1| plasma-membrane choline transporter family protein [Arabidopsis 
thaliana]
 gb|AAK76591.1| unknown protein [Arabidopsis thaliana]
 gb|AAN71973.1| unknown protein [Arabidopsis thaliana]
 gb|AEE75661.1| plasma-membrane choline transporter family protein [Arabidopsis 
thaliana]
Length=700

 Score =   297 bits (761),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 144/202 (71%), Positives = 172/202 (85%), Gaps = 2/202 (1%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ SF+E +RFIL AIRR+ K S + P+ W  +MA +TS+GCL+ V W +KSVNRNA
Sbjct  499  LGSLIVSFVESVRFILEAIRRKTKVSGTIPDHWFWRMAHYTSRGCLKSVEWTIKSVNRNA  558

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGKSF K+S IATELIISN+LRIGKVNVIGDVILFLGKL VSL SALF FLMLD
Sbjct  559  YIMIAITGKSFCKSSAIATELIISNILRIGKVNVIGDVILFLGKLCVSLFSALFGFLMLD  618

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            +H+Y++S++K+SSPL PVL CW +GY+VATLFF+VVEMSIDTIILSFCQDSEE+ G AQ 
Sbjct  619  SHRYRASHNKVSSPLLPVLACWALGYIVATLFFAVVEMSIDTIILSFCQDSEENQGNAQH  678

Query  276  APPLLMETLDS--QNEMQRLTQ  217
            APPLL+ETLDS  + E+Q LT 
Sbjct  679  APPLLLETLDSNQEEEVQSLTH  700



>ref|XP_006406975.1| hypothetical protein EUTSA_v10020171mg [Eutrema salsugineum]
 gb|ESQ48428.1| hypothetical protein EUTSA_v10020171mg [Eutrema salsugineum]
Length=703

 Score =   297 bits (761),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 144/202 (71%), Positives = 171/202 (85%), Gaps = 2/202 (1%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ SF+E +RFIL AIRRR K S +TP+ W  +M  +TS+GCL+ V W +KSVNRNA
Sbjct  502  LGSLIVSFVESVRFILEAIRRRTKVSGTTPDHWFWRMGHYTSRGCLKSVEWTIKSVNRNA  561

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGKSF K+S IATELI++N++RIGKVNVIGDVILFLGKL VSL SALF FLMLD
Sbjct  562  YIMIAITGKSFCKSSAIATELIMNNIMRIGKVNVIGDVILFLGKLCVSLFSALFGFLMLD  621

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            +HKY+SS++K+SSPL PVL CW +GY+VATLFF+VVEMSIDTIILSFCQDSEE+ G AQ 
Sbjct  622  SHKYRSSHNKVSSPLLPVLACWALGYIVATLFFAVVEMSIDTIILSFCQDSEENQGNAQH  681

Query  276  APPLLMETLDSQN--EMQRLTQ  217
            AP LL+ETLDS    E+QRLT 
Sbjct  682  APSLLLETLDSNQDEEVQRLTH  703



>dbj|BAB02367.1| unnamed protein product [Arabidopsis thaliana]
Length=697

 Score =   296 bits (759),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 144/202 (71%), Positives = 172/202 (85%), Gaps = 2/202 (1%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ SF+E +RFIL AIRR+ K S + P+ W  +MA +TS+GCL+ V W +KSVNRNA
Sbjct  496  LGSLIVSFVESVRFILEAIRRKTKVSGTIPDHWFWRMAHYTSRGCLKSVEWTIKSVNRNA  555

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGKSF K+S IATELIISN+LRIGKVNVIGDVILFLGKL VSL SALF FLMLD
Sbjct  556  YIMIAITGKSFCKSSAIATELIISNILRIGKVNVIGDVILFLGKLCVSLFSALFGFLMLD  615

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            +H+Y++S++K+SSPL PVL CW +GY+VATLFF+VVEMSIDTIILSFCQDSEE+ G AQ 
Sbjct  616  SHRYRASHNKVSSPLLPVLACWALGYIVATLFFAVVEMSIDTIILSFCQDSEENQGNAQH  675

Query  276  APPLLMETLDS--QNEMQRLTQ  217
            APPLL+ETLDS  + E+Q LT 
Sbjct  676  APPLLLETLDSNQEEEVQSLTH  697



>ref|XP_008810449.1| PREDICTED: choline transporter-like protein 2 isoform X1 [Phoenix 
dactylifera]
Length=679

 Score =   296 bits (758),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 145/200 (73%), Positives = 168/200 (84%), Gaps = 0/200 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ S +E  RFIL ++RRRLK +++ P S  GKM   +SQ CL  + W + SVNRNA
Sbjct  478  LGSLVVSIVEWFRFILESLRRRLKLADTAPVSCMGKMMSSSSQCCLGCIDWTINSVNRNA  537

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGK F KAS IAT LI++N+LRIGKVNVIGDVILFLGKL VSL  ALFAFLMLD
Sbjct  538  YIMIAITGKGFCKASAIATGLIMNNILRIGKVNVIGDVILFLGKLCVSLFCALFAFLMLD  597

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKYKS++++ISSPLFPVLVCW +GY+VA LFF+VVEMSIDTIILSFCQD+EEH GTAQ 
Sbjct  598  THKYKSAHNRISSPLFPVLVCWALGYIVAALFFAVVEMSIDTIILSFCQDAEEHQGTAQC  657

Query  276  APPLLMETLDSQNEMQRLTQ  217
            APPLLMETLD + EMQRLTQ
Sbjct  658  APPLLMETLDGEGEMQRLTQ  677



>ref|XP_009135440.1| PREDICTED: choline transporter-like protein 2 [Brassica rapa]
Length=701

 Score =   296 bits (757),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 141/200 (71%), Positives = 168/200 (84%), Gaps = 0/200 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ SF+E  RFIL AIRRR K S + P+ W G+M ++TS+GCL+ V W +KS NRNA
Sbjct  501  LGSLVVSFVESFRFILEAIRRRTKVSGTRPDHWLGRMGYYTSRGCLKSVEWTIKSANRNA  560

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGKSF K+S IATELI +N++RIGKVNVIGDVILFLGKL VSL SALF FLMLD
Sbjct  561  YIMIAITGKSFCKSSAIATELIRNNIMRIGKVNVIGDVILFLGKLCVSLFSALFGFLMLD  620

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            +HKY+SS++K+SSPL PVL CW +GYVVATLFF+VVEMSIDTIILSFCQDSEE+ G AQ 
Sbjct  621  SHKYRSSHNKVSSPLLPVLACWALGYVVATLFFAVVEMSIDTIILSFCQDSEENEGNAQH  680

Query  276  APPLLMETLDSQNEMQRLTQ  217
            AP LL+ETLDS +E + +T 
Sbjct  681  APSLLLETLDSNHEEEEVTD  700



>gb|KEH38752.1| plasma-membrane choline transporter family protein [Medicago 
truncatula]
Length=688

 Score =   295 bits (756),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 141/202 (70%), Positives = 173/202 (86%), Gaps = 1/202 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS+  SF+E IRF+L +IRR+LK S+  P++W GK A+ +SQ  LR + W +KSVNRNA
Sbjct  487  LGSLTVSFVESIRFLLESIRRKLKVSSHVPDNWIGKAAYQSSQFFLRCIEWTIKSVNRNA  546

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGKSFF+AS IAT+L+ +N+LRIG VNVIGDVILFLGKL VSL SA+FAFLMLD
Sbjct  547  YIMIAITGKSFFRASAIATDLVKNNILRIGHVNVIGDVILFLGKLCVSLSSAVFAFLMLD  606

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKYKS+++K+SSPL PV+VCW +GY+V TLFF V+EMSIDTIILS+CQDSEE HGTA++
Sbjct  607  THKYKSAHNKLSSPLLPVVVCWALGYIVVTLFFGVIEMSIDTIILSYCQDSEE-HGTARY  665

Query  276  APPLLMETLDSQNEMQRLTQ*P  211
            APPLL+ETL  QN+M+RL Q P
Sbjct  666  APPLLIETLSDQNDMERLAQEP  687



>gb|KHN23450.1| Choline transporter-like protein 2 [Glycine soja]
Length=699

 Score =   295 bits (756),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 142/202 (70%), Positives = 171/202 (85%), Gaps = 0/202 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ SF+E IRF+L  IR +LK S+   +S  GK A+ +SQ  LR + W +KSVNRNA
Sbjct  498  LGSLIVSFVESIRFLLEVIRHKLKVSSHRHDSCLGKAAYQSSQCFLRCIEWTIKSVNRNA  557

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YI+IAITGKSFF AS IATELI++N+L+IG++NVIGDVILFLGKL VSL  ALFAFLMLD
Sbjct  558  YILIAITGKSFFSASSIATELIMNNILKIGRLNVIGDVILFLGKLCVSLSCALFAFLMLD  617

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKY S+++K SSPL PV+VCW +GY+V+TLFF+VVEMSIDTI+LSFCQDSEEH GTAQ+
Sbjct  618  THKYNSAHNKTSSPLLPVVVCWALGYIVSTLFFAVVEMSIDTIVLSFCQDSEEHQGTAQY  677

Query  276  APPLLMETLDSQNEMQRLTQ*P  211
            APPLL+ETL  QNEMQRLTQ P
Sbjct  678  APPLLVETLSDQNEMQRLTQGP  699



>gb|KEH19431.1| plasma-membrane choline transporter family protein [Medicago 
truncatula]
Length=701

 Score =   295 bits (755),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 141/200 (71%), Positives = 169/200 (85%), Gaps = 0/200 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ SF+E IRF+L ++RR+LK S+    SW GK A  +SQ  LR + W +KSVNRNA
Sbjct  499  LGSLIVSFVESIRFLLESLRRKLKVSSHMHSSWIGKAAHQSSQCFLRCIEWTIKSVNRNA  558

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITG SFF AS IAT+LI++N+L+IG++NVIGDVILFLGKL VSL S++FAFLMLD
Sbjct  559  YIMIAITGNSFFSASSIATDLIMNNILKIGRLNVIGDVILFLGKLCVSLSSSVFAFLMLD  618

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKY S ++K SSPLFPV+VCW +GY VATLFF+VVEMSIDTI+LSFCQDSEEH GTAQ+
Sbjct  619  THKYSSGHNKTSSPLFPVVVCWALGYTVATLFFAVVEMSIDTIVLSFCQDSEEHQGTAQY  678

Query  276  APPLLMETLDSQNEMQRLTQ  217
            APPLLMETL +QNE  RLTQ
Sbjct  679  APPLLMETLGNQNETNRLTQ  698



>gb|KFK38880.1| hypothetical protein AALP_AA3G172900 [Arabis alpina]
Length=700

 Score =   293 bits (749),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 144/199 (72%), Positives = 166/199 (83%), Gaps = 1/199 (1%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ SF+E +RFIL AIRRR K   +TP+ W  +M  +TS GCL+ V W +KSVNRNA
Sbjct  499  LGSLIVSFVESVRFILEAIRRRTKVRGATPDHWFMRMGHYTSHGCLKSVEWTIKSVNRNA  558

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGKSF KAS IAT LIISN+ RIGKVNVIGDVILFLGKL VSL SALF FLMLD
Sbjct  559  YIMIAITGKSFCKASAIATGLIISNIRRIGKVNVIGDVILFLGKLCVSLFSALFGFLMLD  618

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
             HKY+SS++K+SSPL PVL CW +GY+VATLFF+VVEMSIDTIILSFCQDSEE+ G AQ 
Sbjct  619  AHKYRSSHNKVSSPLLPVLTCWALGYIVATLFFAVVEMSIDTIILSFCQDSEENQGNAQH  678

Query  276  APPLLMETLDSQN-EMQRL  223
            APP L+ETLDS+  E+QRL
Sbjct  679  APPDLLETLDSEEVEVQRL  697



>ref|XP_009391079.1| PREDICTED: choline transporter-like protein 2 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=706

 Score =   292 bits (747),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 143/200 (72%), Positives = 168/200 (84%), Gaps = 0/200 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ S +E +RFIL A+RRR++  +  P +   K+   +SQ CL  + W +KSVNRNA
Sbjct  505  LGSLIVSIVEWVRFILEALRRRIRHGDPAPVTCIEKLMSTSSQCCLGCIDWTIKSVNRNA  564

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGK F +AS IAT LI++N+LRIGKVNVIGDVIL+LGKL VSL  ALFAFLMLD
Sbjct  565  YIMIAITGKGFNRASAIATGLIVNNILRIGKVNVIGDVILYLGKLCVSLFCALFAFLMLD  624

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKYKS+++KISSPLFPVLV WG+GYVVATLFF+VVEMSIDTIILSFCQD+EEH GTAQ+
Sbjct  625  THKYKSAHNKISSPLFPVLVSWGLGYVVATLFFAVVEMSIDTIILSFCQDAEEHQGTAQY  684

Query  276  APPLLMETLDSQNEMQRLTQ  217
            APPLLM TLD Q EMQRLTQ
Sbjct  685  APPLLMATLDGQGEMQRLTQ  704



>ref|XP_009391078.1| PREDICTED: choline transporter-like protein 2 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=707

 Score =   292 bits (747),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 143/200 (72%), Positives = 168/200 (84%), Gaps = 0/200 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ S +E +RFIL A+RRR++  +  P +   K+   +SQ CL  + W +KSVNRNA
Sbjct  506  LGSLIVSIVEWVRFILEALRRRIRHGDPAPVTCIEKLMSTSSQCCLGCIDWTIKSVNRNA  565

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGK F +AS IAT LI++N+LRIGKVNVIGDVIL+LGKL VSL  ALFAFLMLD
Sbjct  566  YIMIAITGKGFNRASAIATGLIVNNILRIGKVNVIGDVILYLGKLCVSLFCALFAFLMLD  625

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKYKS+++KISSPLFPVLV WG+GYVVATLFF+VVEMSIDTIILSFCQD+EEH GTAQ+
Sbjct  626  THKYKSAHNKISSPLFPVLVSWGLGYVVATLFFAVVEMSIDTIILSFCQDAEEHQGTAQY  685

Query  276  APPLLMETLDSQNEMQRLTQ  217
            APPLLM TLD Q EMQRLTQ
Sbjct  686  APPLLMATLDGQGEMQRLTQ  705



>emb|CDX82434.1| BnaA03g33870D [Brassica napus]
Length=839

 Score =   294 bits (752),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 140/198 (71%), Positives = 166/198 (84%), Gaps = 0/198 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ SF+E  RFIL AIRRR K S + P+ W G+M ++TS+GCL+ V W +KS NRNA
Sbjct  501  LGSLVVSFVESFRFILEAIRRRTKVSGTRPDHWLGRMGYYTSRGCLKSVEWTIKSANRNA  560

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGKSF K+S IATELI +N++RIGKVNVIGDVILFLGKL VSL SALF FLMLD
Sbjct  561  YIMIAITGKSFCKSSAIATELIRNNIMRIGKVNVIGDVILFLGKLCVSLFSALFGFLMLD  620

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            +HKY+SS++K+SSPL PVL CW +GYVVATLFF+VVEMSIDTIILSFCQDSEE+ G AQ 
Sbjct  621  SHKYRSSHNKVSSPLLPVLACWALGYVVATLFFAVVEMSIDTIILSFCQDSEENEGNAQH  680

Query  276  APPLLMETLDSQNEMQRL  223
            AP LL+ETLDS +E +  
Sbjct  681  APSLLLETLDSNHEEEEF  698



>gb|EPS61834.1| hypothetical protein M569_12959 [Genlisea aurea]
Length=1063

 Score =   296 bits (757),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 141/200 (71%), Positives = 172/200 (86%), Gaps = 0/200 (0%)
 Frame = -2

Query  816   LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
             +GS+  SF+E IRF+L A+RRRLK+ +S P +  G+  ++TSQ  LR + +I+KSVNRN 
Sbjct  864   VGSLAVSFVESIRFMLEALRRRLKSVDSMPGTCLGEATYNTSQCVLRCIGFIVKSVNRNG  923

Query  636   YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
             YIMIAITGK FFKASEIATELI+SN+ RIG VNV+GDVILFLGKL VSL SALF FLMLD
Sbjct  924   YIMIAITGKGFFKASEIATELIVSNISRIGNVNVLGDVILFLGKLCVSLSSALFGFLMLD  983

Query  456   THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
              H+YKS++ KISSPLFPV+VCWG+GYVVA+LFF VVE S+DTIILSFCQDSEEH GTA++
Sbjct  984   AHEYKSAHDKISSPLFPVMVCWGLGYVVASLFFGVVETSVDTIILSFCQDSEEHQGTARY  1043

Query  276   APPLLMETLDSQNEMQRLTQ  217
             APPLL++TLD Q+E++RLTQ
Sbjct  1044  APPLLIQTLDDQSELRRLTQ  1063



>gb|EEE61921.1| hypothetical protein OsJ_16656 [Oryza sativa Japonica Group]
Length=565

 Score =   286 bits (731),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 141/202 (70%), Positives = 167/202 (83%), Gaps = 0/202 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            +GS++ S +E +RFIL  +RR+LK  +S  ES  GKM   +SQ CL  + W +KSVNRNA
Sbjct  364  IGSLVVSAVEWVRFILECLRRKLKLFDSARESCFGKMTSSSSQCCLGCIDWTLKSVNRNA  423

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGK FFKAS +AT LI++N+LRIGKVNVIGDVILFLGKL VSL  ALFAFLMLD
Sbjct  424  YIMIAITGKGFFKASVLATGLIMNNILRIGKVNVIGDVILFLGKLCVSLFCALFAFLMLD  483

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKYKS+++KISSPL PV+V W +G++VA LFF VVEMSIDTIILSFCQDSEEH G AQ+
Sbjct  484  THKYKSAHNKISSPLVPVVVSWALGFIVAKLFFQVVEMSIDTIILSFCQDSEEHQGNAQY  543

Query  276  APPLLMETLDSQNEMQRLTQ*P  211
            APPLL+ETLD Q+E+ RLTQ P
Sbjct  544  APPLLVETLDEQSELHRLTQGP  565



>gb|EMT10231.1| hypothetical protein F775_15809 [Aegilops tauschii]
Length=653

 Score =   288 bits (737),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 143/202 (71%), Positives = 167/202 (83%), Gaps = 0/202 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            +GS++ S +E +RFIL  +RR+LK   S  ES  GK++  +SQ C   + W + SVNRNA
Sbjct  452  IGSLVVSAVEWVRFILECLRRKLKLVGSAGESCFGKVSSSSSQCCRGCIDWTLMSVNRNA  511

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGK FFKAS +AT LI++N+LRIGKVNVIGDVILFLGKL VSL  ALFAFLMLD
Sbjct  512  YIMIAITGKGFFKASVLATGLIMNNILRIGKVNVIGDVILFLGKLCVSLFCALFAFLMLD  571

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKYKS+++KISSPL PVLV WG+GY VA LFF+VVEMSIDTIILSFCQD+EEH GTAQ+
Sbjct  572  THKYKSAHNKISSPLVPVLVTWGLGYTVAKLFFAVVEMSIDTIILSFCQDAEEHQGTAQY  631

Query  276  APPLLMETLDSQNEMQRLTQ*P  211
            APPLLMETLD Q E+QRLTQ P
Sbjct  632  APPLLMETLDEQGELQRLTQGP  653



>emb|CAJ86275.1| H0901F07.12 [Oryza sativa Indica Group]
 gb|EAY96079.1| hypothetical protein OsI_17953 [Oryza sativa Indica Group]
Length=711

 Score =   288 bits (738),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 142/202 (70%), Positives = 168/202 (83%), Gaps = 0/202 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            +GS++ S +E +RFIL  +RR+LK  +S  ES  GKM   +SQ CL  + W +KSVNRNA
Sbjct  510  IGSLVVSAVEWVRFILECLRRKLKLVDSARESCFGKMTSSSSQCCLGCIDWTLKSVNRNA  569

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGK FFKAS +AT LI++N+LRIGKVNVIGDVILFLGKL VSL  ALFAFLMLD
Sbjct  570  YIMIAITGKGFFKASVLATGLIMNNILRIGKVNVIGDVILFLGKLCVSLFCALFAFLMLD  629

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKYKS+++KISSPL PV+V W +G++VA LFF VVEMSIDTIILSFCQD+EEH G AQ+
Sbjct  630  THKYKSAHNKISSPLVPVVVSWALGFIVAKLFFQVVEMSIDTIILSFCQDAEEHQGNAQY  689

Query  276  APPLLMETLDSQNEMQRLTQ*P  211
            APPLLMETLD Q+E+QRLTQ P
Sbjct  690  APPLLMETLDEQSELQRLTQGP  711



>ref|NP_001054289.1| Os04g0681400 [Oryza sativa Japonica Group]
 emb|CAE05747.1| OSJNBb0017I01.27 [Oryza sativa Japonica Group]
 emb|CAE03422.1| OSJNBa0032F06.5 [Oryza sativa Japonica Group]
 dbj|BAF16203.1| Os04g0681400 [Oryza sativa Japonica Group]
 dbj|BAG92666.1| unnamed protein product [Oryza sativa Japonica Group]
Length=711

 Score =   288 bits (737),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 142/202 (70%), Positives = 168/202 (83%), Gaps = 0/202 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            +GS++ S +E +RFIL  +RR+LK  +S  ES  GKM   +SQ CL  + W +KSVNRNA
Sbjct  510  IGSLVVSAVEWVRFILECLRRKLKLVDSARESCFGKMTSSSSQCCLGCIDWTLKSVNRNA  569

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGK FFKAS +AT LI++N+LRIGKVNVIGDVILFLGKL VSL  ALFAFLMLD
Sbjct  570  YIMIAITGKGFFKASVLATGLIMNNILRIGKVNVIGDVILFLGKLCVSLFCALFAFLMLD  629

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKYKS+++KISSPL PV+V W +G++VA LFF VVEMSIDTIILSFCQD+EEH G AQ+
Sbjct  630  THKYKSAHNKISSPLVPVVVSWALGFIVAKLFFQVVEMSIDTIILSFCQDAEEHQGNAQY  689

Query  276  APPLLMETLDSQNEMQRLTQ*P  211
            APPLLMETLD Q+E+QRLTQ P
Sbjct  690  APPLLMETLDEQSELQRLTQGP  711



>gb|EAZ32442.1| hypothetical protein OsJ_16653 [Oryza sativa Japonica Group]
Length=711

 Score =   288 bits (737),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 142/202 (70%), Positives = 168/202 (83%), Gaps = 0/202 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            +GS++ S +E +RFIL  +RR+LK  +S  ES  GKM   +SQ CL  + W +KSVNRNA
Sbjct  510  IGSLVVSAVEWVRFILECLRRKLKLVDSARESCFGKMTSSSSQCCLGCIDWTLKSVNRNA  569

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGK FFKAS +AT LI++N+LRIGKVNVIGDVILFLGKL VSL  ALFAFLMLD
Sbjct  570  YIMIAITGKGFFKASVLATGLIMNNILRIGKVNVIGDVILFLGKLCVSLFCALFAFLMLD  629

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKYKS+++KISSPL PV+V W +G++VA LFF VVEMSIDTIILSFCQD+EEH G AQ+
Sbjct  630  THKYKSAHNKISSPLVPVVVSWALGFIVAKLFFQVVEMSIDTIILSFCQDAEEHQGNAQY  689

Query  276  APPLLMETLDSQNEMQRLTQ*P  211
            APPLLMETLD Q+E+QRLTQ P
Sbjct  690  APPLLMETLDEQSELQRLTQGP  711



>ref|XP_006827775.1| PREDICTED: choline transporter-like protein 2 [Amborella trichopoda]
 gb|ERM95191.1| hypothetical protein AMTR_s00009p00264940 [Amborella trichopoda]
Length=701

 Score =   287 bits (735),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 140/200 (70%), Positives = 167/200 (84%), Gaps = 0/200 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ S +E +R+IL  IRRRLK ++S      G+M    S  CL  + W  KSVNRNA
Sbjct  502  LGSLVVSIVESVRYILEFIRRRLKHTDSASSGIMGRMMSCLSNCCLSCIEWTTKSVNRNA  561

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGKSF KASEIAT LI++N+LRIGKVNVIGDVILFLGKL VSL  A+FAFLML 
Sbjct  562  YIMIAITGKSFCKASEIATGLILNNILRIGKVNVIGDVILFLGKLCVSLACAVFAFLMLH  621

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKYK +++KISSPL PVLVCWG+GY+VA+LFF+VVEM+IDTIILSFCQD+EEH G AQ+
Sbjct  622  THKYKDAHNKISSPLLPVLVCWGLGYIVASLFFAVVEMAIDTIILSFCQDAEEHQGNAQY  681

Query  276  APPLLMETLDSQNEMQRLTQ  217
            APPLL+ETL++Q+EMQRLTQ
Sbjct  682  APPLLIETLNNQSEMQRLTQ  701



>ref|XP_006653038.1| PREDICTED: choline transporter-like protein 2-like [Oryza brachyantha]
Length=709

 Score =   288 bits (736),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 142/202 (70%), Positives = 168/202 (83%), Gaps = 0/202 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            +GS++ S +E +RFIL  +RR+LK  +S  ES  GK+   +SQ CL  V W +KSVNRNA
Sbjct  508  IGSLVVSAVEWVRFILECLRRKLKLVDSARESCFGKVTSSSSQCCLGCVDWTLKSVNRNA  567

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGK FFKAS +AT LI++N+LRIGKVNVIGDVILFLGKL VSL  ALFAFLMLD
Sbjct  568  YIMIAITGKGFFKASVLATGLIMNNILRIGKVNVIGDVILFLGKLCVSLFCALFAFLMLD  627

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKYKS+++KISSPL PV+V W +G++VA LFF VVEMSIDTIILSFCQD+EEH G AQ+
Sbjct  628  THKYKSAHNKISSPLIPVVVSWALGFIVAKLFFQVVEMSIDTIILSFCQDAEEHQGNAQY  687

Query  276  APPLLMETLDSQNEMQRLTQ*P  211
            APPLL+ETLD QNE+QRLTQ P
Sbjct  688  APPLLIETLDEQNELQRLTQGP  709



>ref|XP_008668676.1| PREDICTED: choline transporter-like protein 2 [Zea mays]
 tpg|DAA35311.1| TPA: hypothetical protein ZEAMMB73_361718 [Zea mays]
Length=705

 Score =   287 bits (735),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 142/202 (70%), Positives = 165/202 (82%), Gaps = 0/202 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ S +E +RFIL  +RR+LK  +S  ES  GK    +S+ CL  + W +KSVNRNA
Sbjct  504  LGSLVVSVVEWVRFILECLRRKLKLVDSARESCFGKATSSSSECCLGCIDWTLKSVNRNA  563

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGK FFKAS +AT LI+ N+LRIGKVNVIGDVILFLGKL VSL  ALFAFLMLD
Sbjct  564  YIMIAITGKGFFKASVLATGLIMKNILRIGKVNVIGDVILFLGKLCVSLFCALFAFLMLD  623

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKYKS+++KISSP+ PVLV W +GYVVA LFF+VVEMSIDTIILSFCQD+EEH G AQ+
Sbjct  624  THKYKSAHNKISSPVIPVLVTWALGYVVAKLFFAVVEMSIDTIILSFCQDAEEHQGNAQY  683

Query  276  APPLLMETLDSQNEMQRLTQ*P  211
            APP LMETLD Q E+QRLTQ P
Sbjct  684  APPALMETLDEQGELQRLTQGP  705



>ref|XP_002448788.1| hypothetical protein SORBIDRAFT_06g033190 [Sorghum bicolor]
 gb|EES13116.1| hypothetical protein SORBIDRAFT_06g033190 [Sorghum bicolor]
Length=705

 Score =   287 bits (735),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 142/202 (70%), Positives = 165/202 (82%), Gaps = 0/202 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS+L S +E +RFIL  +RR+LK  +S  ES  GK    +S+ CL  + W +KSVNRNA
Sbjct  504  LGSLLVSVVEWVRFILECLRRKLKLVDSARESCFGKATSSSSECCLGCIDWTLKSVNRNA  563

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGK FFKAS +AT LI+ N+LRIGKVNVIGDVILFLGKL VSL  ALFAFLMLD
Sbjct  564  YIMIAITGKGFFKASVLATGLIMKNILRIGKVNVIGDVILFLGKLCVSLFCALFAFLMLD  623

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKYKS+++KISSP+ PVLV W +GY+VA LFF+VVEMSIDTIILSFCQD+EEH G AQ+
Sbjct  624  THKYKSAHNKISSPVIPVLVTWALGYIVAKLFFAVVEMSIDTIILSFCQDAEEHQGNAQY  683

Query  276  APPLLMETLDSQNEMQRLTQ*P  211
            APP LMETLD Q E+QRLTQ P
Sbjct  684  APPALMETLDEQGELQRLTQGP  705



>dbj|BAK04094.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=712

 Score =   286 bits (733),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 142/202 (70%), Positives = 166/202 (82%), Gaps = 0/202 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            +GS++ S +E +RFIL  +RR+LK   S  ES  GK++  +SQ C   + W + SVNRNA
Sbjct  511  IGSLVVSAVEWVRFILECLRRKLKLVGSARESCFGKVSSSSSQCCRGCIDWTLMSVNRNA  570

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGK FFKAS +AT LI++N+LRIGKVNVIGDVILFLGKL VSL  ALFAFLMLD
Sbjct  571  YIMIAITGKGFFKASVLATGLIMNNILRIGKVNVIGDVILFLGKLCVSLFCALFAFLMLD  630

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKYKS+++KISSPL PVLV WG+GY VA LFF+VVEMSIDTIILSFCQD+EEH G AQ+
Sbjct  631  THKYKSAHNKISSPLVPVLVTWGLGYTVAKLFFAVVEMSIDTIILSFCQDAEEHQGAAQY  690

Query  276  APPLLMETLDSQNEMQRLTQ*P  211
            APPLLMETLD Q E+QRLTQ P
Sbjct  691  APPLLMETLDEQGELQRLTQGP  712



>gb|AAF35404.1| hypothetical protein [Arabidopsis thaliana]
Length=722

 Score =   286 bits (733),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 145/224 (65%), Positives = 173/224 (77%), Gaps = 24/224 (11%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ SF+E +RFIL AIRR+ K S + P+ W  +MA +TS+GCL+ V W +KSVNRNA
Sbjct  499  LGSLIVSFVESVRFILEAIRRKTKVSGTIPDHWFWRMAHYTSRGCLKSVEWTIKSVNRNA  558

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGKSF K+S IATELIISN+LRIGKVNVIGDVILFLGKL VSL SALF FLMLD
Sbjct  559  YIMIAITGKSFCKSSAIATELIISNILRIGKVNVIGDVILFLGKLCVSLFSALFGFLMLD  618

Query  456  THKYKSSNHKISSPLFPVLV----------------------CWGIGYVVATLFFSVVEM  343
            +H+Y++S++K+SSPL PVLV                      CW +GY+VATLFF+VVEM
Sbjct  619  SHRYRASHNKVSSPLLPVLVKSFSLLSRLNCLLACDSLYAQACWALGYIVATLFFAVVEM  678

Query  342  SIDTIILSFCQDSEEHHGTAQFAPPLLMETLDS--QNEMQRLTQ  217
            SIDTIILSFCQDSEE+ G AQ APPLL+ETLDS  + E+Q LT 
Sbjct  679  SIDTIILSFCQDSEENQGNAQHAPPLLLETLDSNQEEEVQSLTH  722



>emb|CAJ86278.1| H0901F07.15 [Oryza sativa Indica Group]
 emb|CAJ86286.1| H0124B04.3 [Oryza sativa Indica Group]
 gb|EAY96082.1| hypothetical protein OsI_17956 [Oryza sativa Indica Group]
Length=678

 Score =   285 bits (730),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 141/202 (70%), Positives = 167/202 (83%), Gaps = 0/202 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            +GS++ S +E +RFIL  +RR+LK  +S  ES  GKM   +SQ CL  + W +KSVNRNA
Sbjct  477  IGSLVVSAVEWVRFILECLRRKLKLFDSARESCFGKMTSSSSQCCLGCIDWTLKSVNRNA  536

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGK FFKAS +AT LI++N+LRIGKVNVIGDVILFLGKL VSL  ALFAFLMLD
Sbjct  537  YIMIAITGKGFFKASVLATGLIMNNILRIGKVNVIGDVILFLGKLCVSLFCALFAFLMLD  596

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKYKS+++KISSPL PV+V W +G++VA LFF VVEMSIDTIILSFCQDSEEH G AQ+
Sbjct  597  THKYKSAHNKISSPLVPVVVSWALGFIVAKLFFQVVEMSIDTIILSFCQDSEEHQGNAQY  656

Query  276  APPLLMETLDSQNEMQRLTQ*P  211
            APPLL+ETLD Q+E+ RLTQ P
Sbjct  657  APPLLVETLDEQSELHRLTQGP  678



>ref|XP_004960043.1| PREDICTED: choline transporter-like protein 2-like [Setaria italica]
Length=710

 Score =   286 bits (731),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 142/202 (70%), Positives = 166/202 (82%), Gaps = 0/202 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ S +E +RFIL  +RR+LK   ST ES  GK    +S+ CL  + W +KSVNRNA
Sbjct  509  LGSLVVSVVEWVRFILECLRRKLKFVGSTRESCFGKATSSSSECCLGCIDWTLKSVNRNA  568

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGK F KAS +AT LI+ N+LRIGKVNVIGDVILFLGKL VSL  ALFAFLMLD
Sbjct  569  YIMIAITGKGFHKASVLATGLIMKNILRIGKVNVIGDVILFLGKLCVSLFCALFAFLMLD  628

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKYKS+++KISSPL PVLV W +GY+VA LFF+VVEMSIDTIILSFCQD+EEH G AQ+
Sbjct  629  THKYKSAHNKISSPLIPVLVTWALGYIVAKLFFAVVEMSIDTIILSFCQDAEEHQGNAQY  688

Query  276  APPLLMETLDSQNEMQRLTQ*P  211
            APPLLMETLD Q+++QRLTQ P
Sbjct  689  APPLLMETLDEQSDLQRLTQGP  710



>ref|NP_001054291.1| Os04g0681600 [Oryza sativa Japonica Group]
 emb|CAE03425.1| OSJNBa0032F06.8 [Oryza sativa Japonica Group]
 dbj|BAF16205.1| Os04g0681600 [Oryza sativa Japonica Group]
 dbj|BAG97153.1| unnamed protein product [Oryza sativa Japonica Group]
Length=711

 Score =   285 bits (729),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 141/202 (70%), Positives = 167/202 (83%), Gaps = 0/202 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            +GS++ S +E +RFIL  +RR+LK  +S  ES  GKM   +SQ CL  + W +KSVNRNA
Sbjct  510  IGSLVVSAVEWVRFILECLRRKLKLFDSARESCFGKMTSSSSQCCLGCIDWTLKSVNRNA  569

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGK FFKAS +AT LI++N+LRIGKVNVIGDVILFLGKL VSL  ALFAFLMLD
Sbjct  570  YIMIAITGKGFFKASVLATGLIMNNILRIGKVNVIGDVILFLGKLCVSLFCALFAFLMLD  629

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKYKS+++KISSPL PV+V W +G++VA LFF VVEMSIDTIILSFCQDSEEH G AQ+
Sbjct  630  THKYKSAHNKISSPLVPVVVSWALGFIVAKLFFQVVEMSIDTIILSFCQDSEEHQGNAQY  689

Query  276  APPLLMETLDSQNEMQRLTQ*P  211
            APPLL+ETLD Q+E+ RLTQ P
Sbjct  690  APPLLVETLDEQSELHRLTQGP  711



>ref|XP_004972393.1| PREDICTED: choline transporter-like protein 2-like [Setaria italica]
Length=701

 Score =   285 bits (728),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 138/202 (68%), Positives = 167/202 (83%), Gaps = 0/202 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ S +E +RFIL ++RRRLK  NS  +SW GK A  +SQ CL  + W +KSVNRNA
Sbjct  500  LGSLIVSIVEWVRFILESLRRRLKFVNSAHDSWFGKTASSSSQCCLGCIDWTLKSVNRNA  559

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGK F KAS +ATELI+ N+LRIGKVNVIGDVIL LGKL VSL  ALFAF+MLD
Sbjct  560  YIMIAITGKGFCKASALATELIMKNILRIGKVNVIGDVILMLGKLCVSLFCALFAFIMLD  619

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
             HKY+S ++KISSPL PVLV W +GY+VA LFF+VVEMSIDTI+LSFCQD+EEH G A++
Sbjct  620  KHKYRSGHNKISSPLVPVLVSWALGYIVAKLFFAVVEMSIDTIMLSFCQDTEEHEGNARY  679

Query  276  APPLLMETLDSQNEMQRLTQ*P  211
            APPLLMETLD ++E++RLT+ P
Sbjct  680  APPLLMETLDEESELRRLTEGP  701



>ref|XP_003580838.1| PREDICTED: choline transporter-like protein 2 [Brachypodium distachyon]
Length=712

 Score =   284 bits (727),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 142/202 (70%), Positives = 165/202 (82%), Gaps = 0/202 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            +GS++ S +E +RFIL   RR+LK   S  ES  GKM   +SQ CL  + W + SVNRNA
Sbjct  511  IGSLVVSPVEWVRFILECFRRKLKLVGSARESCFGKMTSSSSQCCLGCIDWTLMSVNRNA  570

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGK FFKAS +AT LI++N+LRIGKVNVIGDVILFLGKL VSL  ALFAFLMLD
Sbjct  571  YIMIAITGKGFFKASVLATGLIMNNILRIGKVNVIGDVILFLGKLCVSLFCALFAFLMLD  630

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKYKS+++KISSPL PVLV W +GY VA LFF+VVEMSI+TIILSFCQD+EEH G AQ+
Sbjct  631  THKYKSAHNKISSPLVPVLVTWALGYTVAKLFFAVVEMSIETIILSFCQDAEEHQGNAQY  690

Query  276  APPLLMETLDSQNEMQRLTQ*P  211
            APPLLMETLD Q+E+QRLTQ P
Sbjct  691  APPLLMETLDEQSELQRLTQGP  712



>ref|XP_002444851.1| hypothetical protein SORBIDRAFT_07g000250 [Sorghum bicolor]
 gb|EES14346.1| hypothetical protein SORBIDRAFT_07g000250 [Sorghum bicolor]
Length=711

 Score =   282 bits (721),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 138/200 (69%), Positives = 168/200 (84%), Gaps = 0/200 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ S IE +RFIL ++RRRLK  +S  ES  GK    +SQ CL  + W +KSVNRNA
Sbjct  508  LGSLIVSIIEWVRFILESLRRRLKFVDSARESRLGKAVSSSSQCCLGCIDWTLKSVNRNA  567

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            Y+MIAITGK FFKAS +ATELI++N+LRIGKVNVIGDVIL LGKL VSL+ ALFAFLMLD
Sbjct  568  YVMIAITGKGFFKASVLATELIMNNILRIGKVNVIGDVILLLGKLCVSLLCALFAFLMLD  627

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
             HKY+S ++KISSPL PVL+ W +GY+VA LFF+VVEMSIDT++LSFCQDSEEH G+AQ+
Sbjct  628  EHKYRSGHNKISSPLVPVLLSWVLGYIVAKLFFAVVEMSIDTMVLSFCQDSEEHQGSAQY  687

Query  276  APPLLMETLDSQNEMQRLTQ  217
            APPLLMETLD ++E++RLTQ
Sbjct  688  APPLLMETLDEESELRRLTQ  707



>dbj|BAK00584.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=706

 Score =   275 bits (704),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 136/202 (67%), Positives = 165/202 (82%), Gaps = 0/202 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ S +E +R IL  +R RLK  +ST ES  GK    +S  CL  + W +KSVNRNA
Sbjct  505  LGSLVVSSVEWVRCILKWLRHRLKGVDSTGESRLGKTVSSSSHCCLGCIDWTIKSVNRNA  564

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YI+IA+TGK F KASE+AT LI++N+LRIGKVNVIGDVIL+LGKL VSL SALFAFLMLD
Sbjct  565  YIVIAVTGKGFCKASELATGLIMNNILRIGKVNVIGDVILYLGKLCVSLSSALFAFLMLD  624

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKY+S+++KISSPLFPVL+CW +GYVVA LFF VVE S++TIILSFCQD+EEH G AQ+
Sbjct  625  THKYRSAHNKISSPLFPVLLCWALGYVVAQLFFGVVETSVETIILSFCQDAEEHDGEAQY  684

Query  276  APPLLMETLDSQNEMQRLTQ*P  211
            APPLLMETL   +++QRLTQ P
Sbjct  685  APPLLMETLGDTSQLQRLTQGP  706



>ref|XP_004487693.1| PREDICTED: choline transporter-like protein 2-like [Cicer arietinum]
Length=693

 Score =   274 bits (700),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 134/195 (69%), Positives = 165/195 (85%), Gaps = 1/195 (1%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS+  SF+E IRF+L +IRR+LK ++  P++  GK A+H+S    R + W +KS NRNA
Sbjct  500  LGSLTVSFVESIRFLLESIRRKLKVTSHVPDNRIGKAAYHSSLLFRRCIEWTIKSFNRNA  559

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAI+GKSFF AS IAT+LI++N+LRIG+VNVIGDVILFLGKL VSL SA+FAFLMLD
Sbjct  560  YIMIAISGKSFFGASAIATDLIMNNILRIGRVNVIGDVILFLGKLCVSLSSAVFAFLMLD  619

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKY S+++KISSPL  + VCW +GY+VATLFF V+EMSIDTIILS+CQDSEE HGTAQ+
Sbjct  620  THKYNSAHNKISSPLCKMQVCWALGYIVATLFFGVIEMSIDTIILSYCQDSEE-HGTAQY  678

Query  276  APPLLMETLDSQNEM  232
            APPLL+ETL+ QNEM
Sbjct  679  APPLLIETLNDQNEM  693



>ref|XP_008647208.1| PREDICTED: choline transporter-like protein 2, partial [Zea mays]
Length=640

 Score =   272 bits (696),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 133/202 (66%), Positives = 165/202 (82%), Gaps = 0/202 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ S +E +RFIL ++RRRLK  +S   S  GK    +SQ CL  + W +KSVNRNA
Sbjct  439  LGSLIVSIVEWVRFILESLRRRLKFVDSARGSRFGKTVSSSSQCCLGCIDWTLKSVNRNA  498

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            Y+MIAITGK F KAS +AT LI++NVLR+GKVNVIGDVIL LGKL VSL+ ALFAFLMLD
Sbjct  499  YVMIAITGKGFCKASVLATGLIMNNVLRVGKVNVIGDVILLLGKLCVSLLCALFAFLMLD  558

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
             HKY+S ++KISSPL PVL+ W +GY+VA LFF+VVE+SIDT++LSFCQDSEEH G A++
Sbjct  559  EHKYRSGHNKISSPLVPVLLSWALGYIVAKLFFAVVEVSIDTMVLSFCQDSEEHQGNARY  618

Query  276  APPLLMETLDSQNEMQRLTQ*P  211
            APPLLMETLD ++E++RLTQ P
Sbjct  619  APPLLMETLDEESELRRLTQGP  640



>ref|XP_008679492.1| PREDICTED: choline transporter-like protein 2 [Zea mays]
 gb|AFW65040.1| hypothetical protein ZEAMMB73_896694 [Zea mays]
Length=711

 Score =   271 bits (694),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 133/202 (66%), Positives = 165/202 (82%), Gaps = 0/202 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ S +E +RFIL ++RRRLK  +S   S  GK    +SQ CL  + W +KSVNRNA
Sbjct  510  LGSLIVSIVEWVRFILESLRRRLKFVDSARGSRFGKTVSSSSQCCLGCIDWTLKSVNRNA  569

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            Y+MIAITGK F KAS +AT LI++NVLR+GKVNVIGDVIL LGKL VSL+ ALFAFLMLD
Sbjct  570  YVMIAITGKGFCKASVLATGLIMNNVLRVGKVNVIGDVILLLGKLCVSLLCALFAFLMLD  629

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
             HKY+S ++KISSPL PVL+ W +GY+VA LFF+VVE+SIDT++LSFCQDSEEH G A++
Sbjct  630  EHKYRSGHNKISSPLVPVLLSWALGYIVAKLFFAVVEVSIDTMVLSFCQDSEEHQGNARY  689

Query  276  APPLLMETLDSQNEMQRLTQ*P  211
            APPLLMETLD ++E++RLTQ P
Sbjct  690  APPLLMETLDEESELRRLTQGP  711



>ref|XP_006659724.1| PREDICTED: choline transporter-like protein 2-like [Oryza brachyantha]
Length=705

 Score =   263 bits (673),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 134/200 (67%), Positives = 161/200 (81%), Gaps = 4/200 (2%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ S +E +RFIL +IRRRLK  +S  ESW  K    +SQ CL  + W ++SVNRN 
Sbjct  504  LGSLIVSMVEWVRFILESIRRRLKLVDSAHESWFAKTISSSSQCCLGCMDWTIRSVNRNG  563

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGK F+KAS +AT LI++N+LRIGKVNVIGDVIL LGKL VSL+ ALFAFLMLD
Sbjct  564  YIMIAITGKGFWKASVLATGLIMNNILRIGKVNVIGDVILLLGKLCVSLMCALFAFLMLD  623

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            TH+YKS+++KISSPL PVLV W +GYVVA LFF+VVEMSI+T ILSFCQD+EEH G A++
Sbjct  624  THRYKSAHNKISSPLVPVLVSWALGYVVAKLFFAVVEMSIETNILSFCQDAEEHEGNARY  683

Query  276  APPLLMETLDSQNEMQRLTQ  217
            A PLL+ETL    E QRLTQ
Sbjct  684  ATPLLVETL----EQQRLTQ  699



>ref|XP_009351421.1| PREDICTED: choline transporter-like protein 2, partial [Pyrus 
x bretschneideri]
Length=623

 Score =   254 bits (649),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 125/200 (63%), Positives = 153/200 (77%), Gaps = 0/200 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS+    +E  R+IL +IRRRLK        +  K    ++Q CL  V   +K VNRNA
Sbjct  424  LGSLCVFVVESFRYILESIRRRLKPFQDLQGGYSAKAMSWSTQCCLGCVERTLKFVNRNA  483

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGK F KA+ +AT +I+SN+LRI  VNVIGD+ILFLGKL VSL  A+FAFLMLD
Sbjct  484  YIMIAITGKGFCKAAGMATTIIMSNILRIANVNVIGDIILFLGKLCVSLTCAVFAFLMLD  543

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
             H+YKS+++KISSPLFPVL CW IGY++A+LFF+VVEM+IDTIILSFCQD+ EH G  Q+
Sbjct  544  VHRYKSAHNKISSPLFPVLACWSIGYIMASLFFAVVEMTIDTIILSFCQDTLEHQGIPQY  603

Query  276  APPLLMETLDSQNEMQRLTQ  217
            APPLL ETL + +EMQRLTQ
Sbjct  604  APPLLTETLRNHSEMQRLTQ  623



>ref|XP_003573246.1| PREDICTED: choline transporter-like protein 2 [Brachypodium distachyon]
Length=709

 Score =   253 bits (647),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 161/204 (79%), Gaps = 2/204 (1%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ S +E ++F+L +IRRRLK  +S  ES  GK    +S  CL  + W +KSVNRNA
Sbjct  506  LGSLMVSVVEWVQFVLKSIRRRLKVVDSARESCFGKTVSSSSHCCLGCIDWTIKSVNRNA  565

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGK F KASE+AT LI++N+LRIGKVNVIGDVILFLGKL VSL S LFAFLMLD
Sbjct  566  YIMIAITGKGFCKASELATGLIMNNILRIGKVNVIGDVILFLGKLCVSLSSVLFAFLMLD  625

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
             HKY+SS+ KISSPLFPVL+CW +GY VA LFF VVE S++T++LSFCQD+EEH G AQ+
Sbjct  626  NHKYRSSHSKISSPLFPVLLCWALGYAVAQLFFGVVETSVETVVLSFCQDAEEHQGDAQY  685

Query  276  APPLLMETL--DSQNEMQRLTQ*P  211
            APP+LMETL      ++QRLT  P
Sbjct  686  APPVLMETLLGGDPTQLQRLTAQP  709



>ref|XP_002862703.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH38961.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=209

 Score =   236 bits (602),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 122/202 (60%), Positives = 143/202 (71%), Gaps = 35/202 (17%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ SF+E +RFIL AIRRR K S +TP+ W  +MA +TS+GCL+ V W +KSVNRNA
Sbjct  41   LGSLIVSFVESVRFILEAIRRRTKVSGTTPDHWFWRMAHYTSRGCLKSVEWTIKSVNRNA  100

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGKSF K+S IATELIISN+LRIGKVNVIGDVILFLG+L               
Sbjct  101  YIMIAITGKSFCKSSAIATELIISNILRIGKVNVIGDVILFLGQL---------------  145

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
                                CW +GY+VATLFF V+EMSIDTIILSFCQDSEE+ G AQ 
Sbjct  146  ------------------CACWALGYIVATLFFPVLEMSIDTIILSFCQDSEENQGNAQH  187

Query  276  APPLLMETLDS--QNEMQRLTQ  217
            APPLL+ETLDS  + E+QRLT 
Sbjct  188  APPLLLETLDSNQEEEVQRLTH  209



>gb|EMT23496.1| hypothetical protein F775_29578 [Aegilops tauschii]
Length=781

 Score =   239 bits (610),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 147/180 (82%), Gaps = 0/180 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ S +E +R IL A+RRRLK  +ST ES  GK    +S  CL  + W +KSVNRNA
Sbjct  454  LGSLVVSSVEWVRCILKALRRRLKGVDSTGESRLGKTVSSSSHCCLGCIDWTIKSVNRNA  513

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YI+IA+TGK F KASE+AT LI++N+LRIGKVNVIGDVIL+LGKL V+L SALFAFLMLD
Sbjct  514  YIVIAVTGKGFCKASELATGLIMNNILRIGKVNVIGDVILYLGKLCVNLSSALFAFLMLD  573

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            THKY+S+++KISSP FPVL+CW +GY+VA LFF VVE S++TIILSFCQD+EEH G  ++
Sbjct  574  THKYRSAHNKISSPPFPVLLCWALGYMVAQLFFGVVETSVETIILSFCQDTEEHDGEEKY  633


 Score =   151 bits (381),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 84/100 (84%), Gaps = 0/100 (0%)
 Frame = -2

Query  516  FLGKLLVSLVSALFAFLMLDTHKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSI  337
            + GKL VSL S LFAFLMLDTHKY+S+++KISSP F VL+CW +GYVVA LFF VVE S+
Sbjct  680  YPGKLFVSLSSVLFAFLMLDTHKYRSAHNKISSPRFLVLLCWALGYVVAQLFFGVVETSV  739

Query  336  DTIILSFCQDSEEHHGTAQFAPPLLMETLDSQNEMQRLTQ  217
            +TIILSFCQD+EEH G AQ+APPLLME L   +++QRLTQ
Sbjct  740  ETIILSFCQDAEEHDGEAQYAPPLLMEMLGDTSQLQRLTQ  779



>ref|XP_001757700.1| predicted protein [Physcomitrella patens]
 gb|EDQ77340.1| predicted protein [Physcomitrella patens]
Length=766

 Score =   217 bits (552),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 145/192 (76%), Gaps = 0/192 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS+L + IE IRF+L  +R++LK   + P      +     Q CL  + W +K +NRNA
Sbjct  552  LGSLLVAIIEMIRFLLEMLRKKLKALEAAPGGCFITICCCCVQCCLGCIEWTIKFINRNA  611

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YI+IAI GK F +A+  AT LI++NVLR+  VN+IGD+ILFLGK++VSL SALFAFLMLD
Sbjct  612  YIVIAINGKGFCRAAGKATGLIVNNVLRVAAVNIIGDMILFLGKVVVSLASALFAFLMLD  671

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            T +YK+ + K+SSPLFPVL CW IG++VA +FF VVEM+IDTI+LSFC DSEE++GT  F
Sbjct  672  TKQYKTGHSKVSSPLFPVLFCWFIGFLVAGMFFGVVEMAIDTILLSFCIDSEENNGTPMF  731

Query  276  APPLLMETLDSQ  241
            APPLL++TL S 
Sbjct  732  APPLLLDTLTSH  743



>gb|EMS55310.1| hypothetical protein TRIUR3_16176 [Triticum urartu]
Length=608

 Score =   207 bits (528),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 109/202 (54%), Positives = 135/202 (67%), Gaps = 33/202 (16%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ S +E +R IL ++RRRLK  +ST ES  GK    +S  CL  + W +KSVNRNA
Sbjct  440  LGSLIVSSVEWVRCILKSLRRRLKGVDSTGESRLGKTVSSSSHCCLGCIDWTIKSVNRNA  499

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YI+IA+TGK F KASE+AT LI++N+LRIGKVNVIGDVIL+LGKL +             
Sbjct  500  YIVIAVTGKGFCKASELATGLIMNNILRIGKVNVIGDVILYLGKLCL-------------  546

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
                                CW +GYVVA LFF VVE S++TIILSFCQD+EEH G AQ+
Sbjct  547  --------------------CWALGYVVAQLFFGVVETSVETIILSFCQDAEEHDGEAQY  586

Query  276  APPLLMETLDSQNEMQRLTQ*P  211
            APPLLMETL   +++QRLTQ P
Sbjct  587  APPLLMETLGDTSQLQRLTQGP  608



>ref|XP_010545817.1| PREDICTED: choline transporter-like protein 2 isoform X1 [Tarenaya 
hassleriana]
Length=715

 Score =   207 bits (528),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ SF+E +RFIL AIRR+LK + + P++W G+MA++  +GCL+ + W +KSVNRNA
Sbjct  498  LGSLIVSFVESVRFILEAIRRKLKVAGTPPDNWFGRMAYYACRGCLKSIEWTIKSVNRNA  557

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAITGKSF K+S +ATELII+NVLRIGKVNVIGDVILFLGKL VSL SALF FLMLD
Sbjct  558  YIMIAITGKSFCKSSAMATELIINNVLRIGKVNVIGDVILFLGKLCVSLFSALFGFLMLD  617

Query  456  THKYKSSNHKISSPLFPVLV  397
            +HKY+SS++K+SSPLFPVLV
Sbjct  618  SHKYRSSHNKVSSPLFPVLV  637



>ref|XP_001771780.1| predicted protein [Physcomitrella patens]
 gb|EDQ63388.1| predicted protein [Physcomitrella patens]
Length=753

 Score =   181 bits (460),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/200 (47%), Positives = 136/200 (68%), Gaps = 5/200 (3%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNST-PESWPGKMAFHTSQG--CLRGVSWIMKSVN  646
            LGS++   +E  +FIL  +R RL+++  T P      ++ H   G  CL  +   +  +N
Sbjct  510  LGSLVVPPVEFAQFILQTLRSRLRSAEMTMPNG--AVISTHGRPGTYCLGCLDRTLTHIN  567

Query  645  RNAYIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFL  466
            RNAYI+ A++GK F KASE AT L+ +N  ++G V +I D+I+ L KL VSL  ALFAF 
Sbjct  568  RNAYIVTAVSGKKFCKASERATSLVTNNPSKVGNVFIISDLIISLCKLCVSLACALFAFS  627

Query  465  MLDTHKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGT  286
            MLD+H+YKSS +++SSPLFPVL CWG  Y  A+LFF+V E+++DT++LS+C D+EE+ GT
Sbjct  628  MLDSHRYKSSLNRVSSPLFPVLFCWGFAYTTASLFFAVAEIAVDTVLLSYCIDAEENKGT  687

Query  285  AQFAPPLLMETLDSQNEMQR  226
            A FAP  L E+L++  E + 
Sbjct  688  AVFAPASLAESLNTFTESEE  707



>gb|AFK44223.1| unknown [Lotus japonicus]
Length=85

 Score =   149 bits (377),  Expect = 9e-42, Method: Composition-based stats.
 Identities = 66/85 (78%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = -2

Query  465  MLDTHKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGT  286
            MLDTHKY S ++K SSPLFPV++CW +GY+VATLFF+VVEMSIDTI+LS+CQDSEEH GT
Sbjct  1    MLDTHKYSSDHNKTSSPLFPVVMCWALGYIVATLFFAVVEMSIDTIVLSYCQDSEEHQGT  60

Query  285  AQFAPPLLMETLDSQNEMQRLTQ*P  211
            AQ+APPLL+ETL  QNEMQRLTQ P
Sbjct  61   AQYAPPLLIETLSDQNEMQRLTQGP  85



>ref|XP_003064404.1| choline transporter like family [Micromonas pusilla CCMP1545]
 gb|EEH51309.1| choline transporter like family [Micromonas pusilla CCMP1545]
Length=716

 Score =   159 bits (401),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/197 (43%), Positives = 126/197 (64%), Gaps = 2/197 (1%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
             GS+L + ++ IR I+  +  ++K + +  +S   K A    Q CL  +  +++ +N+NA
Sbjct  514  FGSLLVAILQFIRIIVAYVVHKMKKAGN--DSCCIKYAACCLQYCLWYLQKVLEWINKNA  571

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YI+IAI GKSF  ++  A  LI+SN+L +G VN++GDV+LFLGKL V+L S  FAF+ LD
Sbjct  572  YILIAIEGKSFCFSAWEAISLIMSNILTVGAVNIVGDVLLFLGKLGVALTSGFFAFMYLD  631

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
            T +Y   ++++SSPL  V+      +++A LF SVVEM ID  +LSFC+D + H G  +F
Sbjct  632  TDEYTEGDNRVSSPLLIVVFVIIFAFILAGLFMSVVEMGIDATLLSFCKDCKIHGGKPKF  691

Query  276  APPLLMETLDSQNEMQR  226
            APPLL E L      Q+
Sbjct  692  APPLLAEVLGKYESKQK  708



>ref|XP_002500718.1| choline transporter like family [Micromonas sp. RCC299]
 gb|ACO61976.1| choline transporter like family [Micromonas sp. RCC299]
Length=700

 Score =   157 bits (398),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 86/189 (46%), Positives = 122/189 (65%), Gaps = 2/189 (1%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
             GS+L + ++ IR I+  +  +LK +    ++   K A    Q CL  +  I++ +NRN 
Sbjct  498  FGSLLVAILQFIRIIVAYMVHQLKKAGK--DNLLVKYAACCVQYCLWYLQKIIEWINRNT  555

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YI+IAI GKSF  ++  A  LI +N+  +G VNVIGDV+LFLGKL VSL   + AFL LD
Sbjct  556  YILIAIEGKSFCASAMEALSLIFNNLATVGAVNVIGDVLLFLGKLSVSLTCGVLAFLYLD  615

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
               Y + ++K+SSPL  V+ C   G+V+A LF SVVEM+IDT +LSFC+D + H G  ++
Sbjct  616  DDAYATGDNKVSSPLLIVIFCIIFGFVIAGLFMSVVEMAIDTTLLSFCKDCKLHGGKPRY  675

Query  276  APPLLMETL  250
            APPLL + L
Sbjct  676  APPLLEQVL  684



>ref|XP_003084176.1| Choline transporter-like protein (ISS) [Ostreococcus tauri]
Length=698

 Score =   141 bits (355),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 77/200 (39%), Positives = 122/200 (61%), Gaps = 2/200 (1%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS   + ++ IR +   +  RLK  N   +S   K   +  + CL  +   ++  NRNA
Sbjct  489  LGSFFVALLQFIRIVTRFVVHRLKKLNK--DSKIIKYVGYYVECCLWYLQKCIEWFNRNA  546

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIM AI G SF  ++  A  LI+ N+  I  V+++GD++LFLGKL VSL S + AFLMLD
Sbjct  547  YIMTAIEGTSFCTSAWNALALIVKNITSIATVSILGDIMLFLGKLTVSLGSGVIAFLMLD  606

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
               +   + K+SSPLF V+V     +++A++F S+VE+ IDTI+L +C+D +++ GT   
Sbjct  607  ADTFNYGDEKVSSPLFIVIVVVLFAFLIASVFMSLVELGIDTIVLCYCKDCDDNGGTPLN  666

Query  276  APPLLMETLDSQNEMQRLTQ  217
            APP L++ L +  ++ ++ Q
Sbjct  667  APPALVKALGASKKIAKMRQ  686



>emb|CEG00747.1| Choline transporter-like [Ostreococcus tauri]
Length=722

 Score =   141 bits (355),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 77/200 (39%), Positives = 122/200 (61%), Gaps = 2/200 (1%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS   + ++ IR +   +  RLK  N   +S   K   +  + CL  +   ++  NRNA
Sbjct  513  LGSFFVALLQFIRIVTRFVVHRLKKLNK--DSKIIKYVGYYVECCLWYLQKCIEWFNRNA  570

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIM AI G SF  ++  A  LI+ N+  I  V+++GD++LFLGKL VSL S + AFLMLD
Sbjct  571  YIMTAIEGTSFCTSAWNALALIVKNITSIATVSILGDIMLFLGKLTVSLGSGVIAFLMLD  630

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
               +   + K+SSPLF V+V     +++A++F S+VE+ IDTI+L +C+D +++ GT   
Sbjct  631  ADTFNYGDEKVSSPLFIVIVVVLFAFLIASVFMSLVELGIDTIVLCYCKDCDDNGGTPLN  690

Query  276  APPLLMETLDSQNEMQRLTQ  217
            APP L++ L +  ++ ++ Q
Sbjct  691  APPALVKALGASKKIAKMRQ  710



>ref|XP_005648747.1| DUF580-domain-containing protein, partial [Coccomyxa subellipsoidea 
C-169]
 gb|EIE24203.1| DUF580-domain-containing protein, partial [Coccomyxa subellipsoidea 
C-169]
Length=752

 Score =   139 bits (351),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 82/205 (40%), Positives = 121/205 (59%), Gaps = 17/205 (8%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKT-SNSTPESWPGKMAFHTSQGCLRGVSWIM----KS  652
            +GS + + +  IR +L  I+RR K  + +   SW          GC+    WI+    K 
Sbjct  533  IGSFILALLMFIRIVLEFIQRRTKYFARTKYTSW-----LKYIMGCISCFLWILEKIVKF  587

Query  651  VNRNAYIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFA  472
            +N+NAYIM AI G  F  ++ +A + I++NVLR+  V+ +GD ++FLGKL V     + A
Sbjct  588  INKNAYIMAAIHGNGFCTSATLAVKTIVTNVLRVAAVDTVGDALVFLGKLSVMAGCGVIA  647

Query  471  FLMLDTHKY----KSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDS  304
             LM     Y    K  N  +SSPL PV++   IGY+VA++FF+V EM+IDTI+L+FC+D 
Sbjct  648  LLMSTLTYYTDPVKYPNTFMSSPLLPVILSLLIGYIVASVFFNVYEMAIDTILLAFCEDC  707

Query  303  EEHHGTAQFAPPLLMETLDSQNEMQ  229
            E H G  + APPLL+E +    EM+
Sbjct  708  ESHGGHPKHAPPLLLEAI---GEME  729



>ref|XP_001422243.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABP00560.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=687

 Score =   135 bits (340),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 73/198 (37%), Positives = 121/198 (61%), Gaps = 2/198 (1%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            +GS   + ++ IR I+  I  R+K    + +S   K   +  + CL  +   ++ +NRNA
Sbjct  492  VGSFFVALLQFIRLIVRFIVHRMK--KLSKDSKIIKYVGYYVEYCLWYLQKTIEWLNRNA  549

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIM AI G SF  ++  A  L++ NV  +  VN++GD++L LGKL+V+L S   AFLMLD
Sbjct  550  YIMTAIEGTSFCNSAWNALALMVKNVAAVATVNIVGDIMLVLGKLVVALGSGTIAFLMLD  609

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
               +   + K+SSPLF V+V     +++A +F S+VE+ IDTI+L +C+D ++++G    
Sbjct  610  ADTFNYGDEKVSSPLFIVIVVVLFAFIIANVFMSIVELGIDTILLCYCKDCDDNNGAPVN  669

Query  276  APPLLMETLDSQNEMQRL  223
            APP L++TL    ++ ++
Sbjct  670  APPALVKTLGMSRKIAKM  687



>gb|KIZ04426.1| Choline transporter-like protein 5-A [Monoraphidium neglectum]
Length=173

 Score =   127 bits (318),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 93/142 (65%), Gaps = 4/142 (3%)
 Frame = -2

Query  663  IMKSVNRNAYIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVS  484
            I+  +NRNAYI++A+ G ++  ++    +LI++N +R+  VN++GD +LFLGKL ++   
Sbjct  14   IVAFINRNAYIIVAVKGSNYCTSAARGVQLIVANAIRLATVNIVGDALLFLGKLAIAACC  73

Query  483  ALFAFLMLDTHKYKSS----NHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSF  316
             L AF M +   Y  +    +  +SS +FP+ V    G+VVA +FFSV EM+IDT +LSF
Sbjct  74   GLAAFGMANLQYYNDAVTYPSTYLSSAIFPIAVSVITGFVVAQMFFSVYEMAIDTTLLSF  133

Query  315  CQDSEEHHGTAQFAPPLLMETL  250
            C+D E H G  + APP+LME +
Sbjct  134  CEDCESHGGHPRHAPPILMEAI  155



>ref|XP_009146249.1| PREDICTED: choline transporter-like protein 2 isoform X2 [Brassica 
rapa]
Length=621

 Score =   129 bits (324),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ SF+E +RFIL AIRRR K   +TP+ W G+M ++TS+GCL+ V W +KSVNRNA
Sbjct  500  LGSLVVSFVESVRFILEAIRRRTKVRGTTPDHWLGRMGYYTSRGCLKSVEWTLKSVNRNA  559

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGK  544
            YIMIAITGKSF K+S +ATELI++N++RIGK
Sbjct  560  YIMIAITGKSFCKSSAMATELIMNNIMRIGK  590


 Score = 31.2 bits (69),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 23/37 (62%), Gaps = 6/37 (16%)
 Frame = -1

Query  460  GYSQVQVLESQDLVPAISCAGVLGDWLCCGDPFLLGG  350
            G+SQ      Q L+P+I+C G+LG  +CCG   L GG
Sbjct  591  GFSQ------QSLLPSITCLGMLGSGVCCGYTVLCGG  621



>ref|XP_003062745.1| choline transporter like family [Micromonas pusilla CCMP1545]
 gb|EEH52684.1| choline transporter like family [Micromonas pusilla CCMP1545]
Length=687

 Score =   129 bits (325),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 75/191 (39%), Positives = 114/191 (60%), Gaps = 5/191 (3%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS + + ++ +R IL  I R  KT N+   S   K     ++ C+  +  ++K +NRNA
Sbjct  479  LGSFIVAVVQFVRLILEYINR--KTKNAQEGSAVLKYFMCCARYCMWYLERVLKYINRNA  536

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YI++A+ G SF  ++  A +L+I N +R+  VNVIGD +  LGKL+V+       FL LD
Sbjct  537  YILVAVKGYSFCFSAISAVKLLILNAMRVATVNVIGDFLTALGKLVVAGTCTFIGFLYLD  596

Query  456  THKYK--SSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTA  283
              +Y   +S+  ISSP+ P++    I + +A +F  + EM+IDTI+LSFC+D    +G  
Sbjct  597  QDQYTDPTSDSYISSPVLPLIFIALIAFFLADIFLGLYEMAIDTILLSFCEDCGTANG-P  655

Query  282  QFAPPLLMETL  250
             FAPPLLM  L
Sbjct  656  NFAPPLLMSAL  666



>ref|XP_002952038.1| hypothetical protein VOLCADRAFT_121040 [Volvox carteri f. nagariensis]
 gb|EFJ46829.1| hypothetical protein VOLCADRAFT_121040 [Volvox carteri f. nagariensis]
Length=791

 Score =   128 bits (321),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/200 (35%), Positives = 116/200 (58%), Gaps = 6/200 (3%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
              + + + I+ IRF+L  + R  KT     ++   + A    + C+  +  I+K +NRNA
Sbjct  587  FAACIIAIIQLIRFLLEYLDR--KTKEIQQQNKFAEWAMCCVKCCMWCLEQIVKFINRNA  644

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIM+AI GK +  ++  A +LI+SN LRI  VN++GD ++FLGK+ V+    + A+ M +
Sbjct  645  YIMMAIKGKGYCCSAIQAVKLIVSNALRIAVVNLVGDWLIFLGKVSVAAACGVIAYAMTE  704

Query  456  THKYKS----SNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHG  289
               Y S     N  + SP+  + +     Y VA +FF+V EM+IDT+IL+FC+D + + G
Sbjct  705  AKYYNSPEEFPNTYLYSPVLVIAISVITAYAVAEIFFAVFEMAIDTVILAFCEDCDANDG  764

Query  288  TAQFAPPLLMETLDSQNEMQ  229
              ++AP LLM+ +    + +
Sbjct  765  NPKYAPELLMDVMGGPKDEE  784



>ref|XP_007511067.1| predicted protein [Bathycoccus prasinos]
 emb|CCO66627.1| predicted protein [Bathycoccus prasinos]
Length=757

 Score =   127 bits (319),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 73/199 (37%), Positives = 119/199 (60%), Gaps = 11/199 (6%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
             GS L + ++ +R  +  +   +K  +   + +   +  +  + CL     I++ +NRNA
Sbjct  545  FGSFLIAVMQFVRVCMRVVMTGMKKIDRNGKVF--AVVGYVIECCLWCCQKIIEFINRNA  602

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMI I G SF  ++  A +L+I+NV+ +  +N++GD++LFL KL +S+ +A  AF+ML+
Sbjct  603  YIMIVIDGNSFCWSAFQALKLMIANVMSVAAINIVGDLLLFLAKLSISIGTAFLAFVMLN  662

Query  456  THKYKSSNHKISSPLFPVLVCWGI---GYVVATLFFSVVEMSIDTIILSFCQDSEEHHGT  286
               YK    +ISS   PVL+C  I    Y VA +F  +VEM IDT +L +C+D E+H+GT
Sbjct  663  GDDYK---EEISS---PVLICSVIAIFAYSVAAVFMGIVEMGIDTTLLCYCRDMEKHNGT  716

Query  285  AQFAPPLLMETLDSQNEMQ  229
             Q+AP +L + L    E+Q
Sbjct  717  PQYAPEVLQKALGIAGEVQ  735



>ref|XP_001689518.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP09256.1| predicted protein [Chlamydomonas reinhardtii]
Length=777

 Score =   127 bits (318),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 74/194 (38%), Positives = 117/194 (60%), Gaps = 10/194 (5%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
             G+++ + I+ IR +L  + R+ K   +  +    + A    + C++ + WI++ +NRNA
Sbjct  574  FGALIIAIIQFIRALLEYLDRKTKELQAQNKF--AEWAMCIVKCCMKCLEWIVRFINRNA  631

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAI GK +  A+  A  LI+SN+ RI  VN++  V++FLGK+ V+  + + A+ M +
Sbjct  632  YIMIAIKGKGYCCAAMDAIALIVSNIGRIAVVNMVAAVLIFLGKVSVASAAGVIAYAMTE  691

Query  456  THKYKSSNHKISSPLF-PVLVCWGI----GYVVATLFFSVVEMSIDTIILSFCQDSEEHH  292
               Y S      + L+ PVLV   I     Y +A +FF+V EM+IDTIIL+FC+D    +
Sbjct  692  AKYYNSQEEYPETYLYSPVLVI-AISVISAYAIAEIFFAVYEMAIDTIILAFCEDCS--N  748

Query  291  GTAQFAPPLLMETL  250
            G  +FAPPLLME +
Sbjct  749  GGPKFAPPLLMEVM  762



>ref|XP_002508657.1| choline transporter like family [Micromonas sp. RCC299]
 gb|ACO69915.1| choline transporter like family [Micromonas sp. RCC299]
Length=578

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 70/203 (34%), Positives = 112/203 (55%), Gaps = 13/203 (6%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSW----IMKSV  649
            LGS + + ++ IR +L  I R+ K          G         C++   W    ++K +
Sbjct  380  LGSFIVAVVQFIRAVLEYIDRKTKKMQE------GNPILKYVMCCVKYCMWYLEKVLKYI  433

Query  648  NRNAYIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAF  469
            NRNAYI++A+ G S+  ++  A +L+I N+ RI  +N +GD + +LGK++V+ +  + AF
Sbjct  434  NRNAYILVAVKGYSYCYSAIHAIKLLIMNMARIAVINTVGDFLTWLGKIVVTGICGILAF  493

Query  468  LMLDTHKYK--SSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEH  295
            LM D   Y    S + ++SP+ PV+V   I Y  A +F  V EM++DTI+LSFC+D    
Sbjct  494  LMCDMSMYTDPDSANYLTSPILPVIVTVFIAYQEADIFMGVYEMAVDTIMLSFCEDCNTS  553

Query  294  HGTAQFAPPLLMETLDSQNEMQR  226
             G   +APPLLM  L    +  +
Sbjct  554  GG-PHYAPPLLMSALGKSTKKTK  575



>ref|XP_010934826.1| PREDICTED: choline transporter-like protein 2 isoform X3 [Elaeis 
guineensis]
Length=628

 Score =   117 bits (292),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = -2

Query  405  VLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQFAPPLLMETLDSQNEMQR  226
            ++VCWG+GY+VATLFF+VVEMSIDTIILSFCQD+EEH GTAQ APPLLMETLD + E QR
Sbjct  564  IMVCWGLGYIVATLFFAVVEMSIDTIILSFCQDAEEHQGTAQCAPPLLMETLDGEGETQR  623

Query  225  LTQ  217
            LTQ
Sbjct  624  LTQ  626


 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 55/88 (63%), Gaps = 5/88 (6%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ S +E  RFIL ++RRRLK +++ P S  GKM   +SQ CL  + W +KSVNRNA
Sbjct  503  LGSLVVSIVEWFRFILESLRRRLKLADTAPVSCMGKMMSSSSQCCLGCIDWTIKSVNRNA  562

Query  636  YIMIA-----ITGKSFFKASEIATELII  568
            YIM+      I    FF   E++ + II
Sbjct  563  YIMVCWGLGYIVATLFFAVVEMSIDTII  590



>ref|XP_006674882.1| hypothetical protein BATDEDRAFT_1420, partial [Batrachochytrium 
dendrobatidis JAM81]
 gb|EGF83665.1| hypothetical protein BATDEDRAFT_1420, partial [Batrachochytrium 
dendrobatidis JAM81]
Length=611

 Score =   115 bits (288),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 71/191 (37%), Positives = 108/191 (57%), Gaps = 9/191 (5%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRL-KTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRN  640
            LGS L + IE +R +L  I+R+  KT N T +     +     Q C++ V  +MK +N+N
Sbjct  426  LGSFLLTLIEMVRIVLWYIQRQAQKTHNQTIQYIVACL-----QCCMKCVEMLMKFINKN  480

Query  639  AYIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLML  460
            AYI IAI GK+FFK++  A+ L++ N LR+  V+ + D IL + KL V+ +     +L  
Sbjct  481  AYIYIAIKGKAFFKSAAEASSLLLRNALRLVAVDFVADFILIISKLGVTTLCGFLCYLWF  540

Query  459  DTHKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQ  280
                 + +N K   P   V+V     Y+VAT FFS+  M+IDTI LSF +D E + G+ +
Sbjct  541  SYQAAQYTNVKF--PFITVMVVVVEAYMVATAFFSIYHMAIDTIFLSFLEDCETNDGSPE  598

Query  279  FAPPLLMETLD  247
              P  + +TL 
Sbjct  599  -KPYYMSDTLK  608



>gb|EPZ32735.1| Choline transporter-like domain-containing protein [Rozella allomycis 
CSF55]
Length=608

 Score =   112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 66/197 (34%), Positives = 115/197 (58%), Gaps = 10/197 (5%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ + I+ I+FIL  + +++K S +       K      Q     +   ++ +N+NA
Sbjct  403  LGSLILAIIQTIQFILYQLEKKVKNSQNKF----AKYVLRCLQCLFFCLERFIRFLNKNA  458

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YI IA+ G SF KA+ +A EL++ N  R+  ++ IGD ILFLG LL+S +S +    +L 
Sbjct  459  YIEIAVYGYSFCKAARVAFELLLRNAFRVAIIDKIGDFILFLGILLISGLSTIVGMFLLQ  518

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQ-  280
            T+   +  +     + P+++ + + + +A+LF SV EM+IDTI LSFC+D E + G+++ 
Sbjct  519  TYSDIAEFY-----VAPLIIIFILSFYIASLFTSVFEMAIDTIFLSFCEDCERNDGSSKP  573

Query  279  FAPPLLMETLDSQNEMQ  229
            F  P  ++   S+N  +
Sbjct  574  FFMPESLKQFISKNSQE  590



>ref|XP_007480210.1| PREDICTED: choline transporter-like protein 5 [Monodelphis domestica]
Length=571

 Score =   108 bits (271),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 68/212 (32%), Positives = 115/212 (54%), Gaps = 9/212 (4%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LG++  + ++ +RF L  I   LK S         K      + CL  +   +K +NRNA
Sbjct  358  LGAITLTTVQCLRFFLEYINHHLKDSKRMQS----KFILCCCRFCLWCLEKFLKYLNRNA  413

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIM+AI G +F  A++ A  L++ NV+R+  ++ + D +L+LGK+LVS+      +L   
Sbjct  414  YIMVAIYGDNFCTAAQDAFHLVMRNVVRVAMLDKVTDFLLWLGKMLVSVSIGALGYLFF-  472

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQ-  280
            T K   +   ++    P+LV     Y++A  FFSV  M +DT+ L FC+D E ++G+ + 
Sbjct  473  TQKLPIAAPTLNYYWIPLLVMVLGSYIIAHGFFSVFAMCVDTLFLCFCEDLERNNGSLER  532

Query  279  --FAPPLLMETLDSQNEMQRLTQ*PF*NSLHP  190
              F PP L++TL  + + ++L +  +    HP
Sbjct  533  PYFMPPTLLKTL-GKRQYRKLKKKVWKRVKHP  563



>ref|XP_004350030.1| solute carrier family 44 protein member 2 [Dictyostelium fasciculatum]
 gb|EGG13327.1| solute carrier family 44 protein member 2 [Dictyostelium fasciculatum]
Length=634

 Score =   108 bits (269),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 66/185 (36%), Positives = 110/185 (59%), Gaps = 22/185 (12%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTS--QGCLRGVSW----IMK  655
            LGS++ + I+ IR++L  + ++ K          GK AF       CL+ + W     +K
Sbjct  444  LGSLILAIIKFIRYVLQYVEKKFK----------GKEAFLARFIVKCLQCLFWCFEKFIK  493

Query  654  SVNRNAYIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALF  475
             +++NAYIMI+I G SF K ++   ELI+SNVLR+  VN+I   +LFLG++L+++++   
Sbjct  494  FLDKNAYIMISIYGYSFCKGAKRGFELILSNVLRVAAVNMISGFLLFLGRVLITVMTVGI  553

Query  474  AFLMLDTHKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEH  295
            AF  L           ++  + PV++   I Y +AT F SV +M+IDT++L FC+DS ++
Sbjct  554  AFYAL------QRVDDLTFYVIPVILIGVIAYAIATGFMSVYDMTIDTMLLCFCEDSSKN  607

Query  294  HGTAQ  280
             G+A+
Sbjct  608  DGSAE  612



>ref|XP_011666027.1| PREDICTED: choline transporter-like protein 1 [Strongylocentrotus 
purpuratus]
Length=508

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/206 (30%), Positives = 110/206 (53%), Gaps = 20/206 (10%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSW----IMKSV  649
             GS+L + I  IR +LG I+ +LK + S P  +  K        C++ + W    +++ +
Sbjct  306  FGSLLIAIIMFIRIVLGYIQSKLKGAKSAPAQYCLK--------CMQCILWLFEKVLRYI  357

Query  648  NRNAYIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAF  469
            NRNAYI IAI G +F KA++ A  +++SN LR+  +N +GD +L LGK  V+    +   
Sbjct  358  NRNAYIEIAIYGYNFCKAAQKAFSVLVSNALRVAAINSVGDFLLLLGKFAVTACVVVIGL  417

Query  468  LMLDTHKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHG  289
             +L   +       ++    P+ +     + ++ +F  V EM+IDT+ L FC+DSE + G
Sbjct  418  QLLQDRE------DLNCYAIPIALAGVCAFFISHVFLLVYEMAIDTLFLCFCEDSERNDG  471

Query  288  TAQ--FAPPLLMETLDSQNEMQRLTQ  217
              +  F    LM  +++  + Q +++
Sbjct  472  VQKPYFMSKQLMTFVENAKKAQAISK  497



>gb|EFB29962.1| hypothetical protein PANDA_005099, partial [Ailuropoda melanoleuca]
Length=662

 Score =   107 bits (267),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 73/213 (34%), Positives = 114/213 (54%), Gaps = 28/213 (13%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIM----KSV  649
             GS++ + ++  +FIL  + RRLK + +    +         Q CL+   W M    K  
Sbjct  461  FGSLILALVQMFKFILEYLDRRLKEAQNNISKF--------LQCCLKCCFWCMEKMVKFF  512

Query  648  NRNAYIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAF  469
            NRNAY+MIAI GK+F +++  A  L++ N+L++  ++ + D +L LGK+LV+    + AF
Sbjct  513  NRNAYVMIAIYGKNFCRSARDAFNLLMRNILKVAVMDKVTDFVLILGKILVAGCIGVLAF  572

Query  468  LMLDTHKYKSSNHKISS------PLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQD  307
            L+  TH+  +     +S      PL  V++     Y+VA  FFSV  M IDTI + FC+D
Sbjct  573  LLF-THRLPTMIEGPTSLNYYWIPLLTVIIG---SYLVAHGFFSVYAMCIDTIFICFCED  628

Query  306  SEEHHGTAQ---FAPPLLMETLDSQNEMQRLTQ  217
             E + G+ +   F  P L  TL   N MQ + Q
Sbjct  629  LERNDGSTEKPYFIAPALHGTL---NRMQLVPQ  658



>ref|XP_004363972.1| choline transporter-like protein [Capsaspora owczarzaki ATCC 
30864]
 gb|KJE92111.1| choline transporter-like protein [Capsaspora owczarzaki ATCC 
30864]
Length=668

 Score =   107 bits (266),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 67/202 (33%), Positives = 113/202 (56%), Gaps = 14/202 (7%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
             GS++ + ++  R +L  I R+ +TS S       K+     + CL  +   ++ +N+NA
Sbjct  477  FGSLILALVQVARVMLEYIDRQTRTSQSEFV----KVIVKCFRCCLWCLEKFIRFLNKNA  532

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YI IA+ G SF  A+  A EL+  N+LR+  V+ +GD ++FLGK++V+  +++  + +L 
Sbjct  533  YIEIAVYGYSFCHAAVRAFELLTRNILRLAFVDKVGDFVIFLGKMMVACTASVLTWYIL-  591

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
                K+ +  ++  + PV+V     Y++A   FSV +M+IDTI L FC+D E + GTA+ 
Sbjct  592  ----KNRSADLNYFMLPVIVVAVFAYMIAKGIFSVFDMTIDTIFLCFCEDCERNDGTAE-  646

Query  276  APPLLMETLDS----QNEMQRL  223
             P  + E L      QNE   L
Sbjct  647  KPYYMSEKLQRIVGHQNEKPAL  668



>ref|XP_001461575.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK94202.1| unnamed protein product [Paramecium tetraurelia]
Length=663

 Score =   105 bits (262),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 69/204 (34%), Positives = 111/204 (54%), Gaps = 8/204 (4%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
             GS++ + ++ IR +L  IR + +    + E+   K        C+      ++ +N NA
Sbjct  463  FGSLILAIVQLIRIMLEYIRYQTEKVAGS-ENKAVKCLLRCLSCCMACFERFIRFLNNNA  521

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIA+TGK+F  A++ A E I +N +R   VN IG   +F+GK  +S+V+ +  + ++ 
Sbjct  522  YIMIALTGKNFCSAAKAAFETIWANSMRFSLVNGIGGAFIFVGKFCISIVTLMIFYYVIT  581

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFC--QDSEEHHG--  289
            T  Y     KI SP+FP +V + I Y +A LF S+  M+ DT++L F   +D  + +G  
Sbjct  582  TMDY--FKEKIFSPVFPCIVVFIIAYALAVLFMSIYGMACDTVLLCFIFDEDLNKQNGGL  639

Query  288  TAQFAPPLLMETLDSQNEMQRLTQ  217
            +A   P  L E L+ Q EM  L Q
Sbjct  640  SASRCPETLKEFLE-QPEMANLKQ  662



>gb|KDR16745.1| Choline transporter-like protein 1 [Zootermopsis nevadensis]
Length=616

 Score =   105 bits (261),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 63/179 (35%), Positives = 94/179 (53%), Gaps = 10/179 (6%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            +GS+  + ++  R IL AI+ +LK      E+   +  F T Q CL     I+K ++RNA
Sbjct  403  MGSLFIALVQLARTILAAIQSQLKGH----ENAVSRCLFRTCQCCLYCFEKILKYLSRNA  458

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YI  A+ G SF +  + A   + SN LR+  +N +GD +LFLGK LV + + L    M D
Sbjct  459  YIETAVFGYSFCRGGQEAFRHLASNALRVAAINSVGDFVLFLGKALVVVATILIGITMFD  518

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQ  280
                      I     P+ +     Y+VA  F +V EM+IDTI L FC+D E + G ++
Sbjct  519  ------DKTGIRHVWVPLTLAGIFAYLVAHCFITVYEMAIDTIFLCFCEDCERNDGLSR  571



>ref|XP_004758234.1| PREDICTED: choline transporter-like protein 5 isoform X5 [Mustela 
putorius furo]
 ref|XP_004784932.1| PREDICTED: choline transporter-like protein 5 isoform X3 [Mustela 
putorius furo]
Length=714

 Score =   105 bits (261),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 72/213 (34%), Positives = 114/213 (54%), Gaps = 28/213 (13%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIM----KSV  649
             GS++ + ++  +FIL  + RRLK + +              Q CL+   W +    K  
Sbjct  513  FGSLILALVQMFKFILEYLDRRLKEAQNN--------VCKFLQCCLKCCFWCLERMVKFF  564

Query  648  NRNAYIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAF  469
            NRNAY+MIAI GK+F +++  A  L++ NVL++  ++ + D +L LGK+LV+    + AF
Sbjct  565  NRNAYVMIAIYGKNFCRSARDAFNLLMRNVLKVAVMDKVTDFVLILGKILVAGCIGVLAF  624

Query  468  LMLDTHKYKSSNHKISS------PLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQD  307
            L+  TH+  +     +S      PL  V++     Y+VA  FFSV  M IDTI + FC+D
Sbjct  625  LLF-THRLPTMIEGPTSLNYYWVPLLTVII---GSYLVAHGFFSVYAMCIDTIFICFCED  680

Query  306  SEEHHGTAQ---FAPPLLMETLDSQNEMQRLTQ  217
             E + G+ +   +  P L  TL   N+MQ + Q
Sbjct  681  LERNDGSREKPYYIAPTLHGTL---NKMQLVPQ  710



>ref|XP_004758230.1| PREDICTED: choline transporter-like protein 5 isoform X1 [Mustela 
putorius furo]
 ref|XP_004758231.1| PREDICTED: choline transporter-like protein 5 isoform X2 [Mustela 
putorius furo]
Length=720

 Score =   105 bits (261),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 72/213 (34%), Positives = 114/213 (54%), Gaps = 28/213 (13%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIM----KSV  649
             GS++ + ++  +FIL  + RRLK + +              Q CL+   W +    K  
Sbjct  519  FGSLILALVQMFKFILEYLDRRLKEAQNN--------VCKFLQCCLKCCFWCLERMVKFF  570

Query  648  NRNAYIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAF  469
            NRNAY+MIAI GK+F +++  A  L++ NVL++  ++ + D +L LGK+LV+    + AF
Sbjct  571  NRNAYVMIAIYGKNFCRSARDAFNLLMRNVLKVAVMDKVTDFVLILGKILVAGCIGVLAF  630

Query  468  LMLDTHKYKSSNHKISS------PLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQD  307
            L+  TH+  +     +S      PL  V++     Y+VA  FFSV  M IDTI + FC+D
Sbjct  631  LLF-THRLPTMIEGPTSLNYYWVPLLTVII---GSYLVAHGFFSVYAMCIDTIFICFCED  686

Query  306  SEEHHGTAQ---FAPPLLMETLDSQNEMQRLTQ  217
             E + G+ +   +  P L  TL   N+MQ + Q
Sbjct  687  LERNDGSREKPYYIAPTLHGTL---NKMQLVPQ  716



>ref|XP_004784930.1| PREDICTED: choline transporter-like protein 5 isoform X1 [Mustela 
putorius furo]
Length=719

 Score =   105 bits (261),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 72/213 (34%), Positives = 114/213 (54%), Gaps = 28/213 (13%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIM----KSV  649
             GS++ + ++  +FIL  + RRLK + +              Q CL+   W +    K  
Sbjct  518  FGSLILALVQMFKFILEYLDRRLKEAQNN--------VCKFLQCCLKCCFWCLERMVKFF  569

Query  648  NRNAYIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAF  469
            NRNAY+MIAI GK+F +++  A  L++ NVL++  ++ + D +L LGK+LV+    + AF
Sbjct  570  NRNAYVMIAIYGKNFCRSARDAFNLLMRNVLKVAVMDKVTDFVLILGKILVAGCIGVLAF  629

Query  468  LMLDTHKYKSSNHKISS------PLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQD  307
            L+  TH+  +     +S      PL  V++     Y+VA  FFSV  M IDTI + FC+D
Sbjct  630  LLF-THRLPTMIEGPTSLNYYWVPLLTVII---GSYLVAHGFFSVYAMCIDTIFICFCED  685

Query  306  SEEHHGTAQ---FAPPLLMETLDSQNEMQRLTQ  217
             E + G+ +   +  P L  TL   N+MQ + Q
Sbjct  686  LERNDGSREKPYYIAPTLHGTL---NKMQLVPQ  715



>ref|XP_008861285.1| hypothetical protein H310_00321 [Aphanomyces invadans]
 gb|ETW09874.1| hypothetical protein H310_00321 [Aphanomyces invadans]
Length=781

 Score =   104 bits (260),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/187 (32%), Positives = 106/187 (57%), Gaps = 10/187 (5%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
             GS++ + I+  R +L  + ++LKT+    ++   K+     + CL      MK +N+NA
Sbjct  571  FGSLIIASIQFARLVLEYVDQKLKTAQK--QNAMVKVVMCAFKCCLWCFEKCMKFLNKNA  628

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIM+A+ G SF  A + +  LI++N  R+  V+++   ++ LGK+ ++  S +  FL L 
Sbjct  629  YIMVAMKGTSFCSAMKESFGLILANAARVATVSIVSMFLILLGKIFITSFSCMMLFLFL-  687

Query  456  THK-------YKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEE  298
            +H        +  +   +SSP+FP+LVC  + Y +A+ F  V E +IDTI+L FC+D + 
Sbjct  688  SHPPSGLPSFFTDNLDNLSSPVFPLLVCGLLSYTIASFFLDVYETAIDTILLCFCEDCKV  747

Query  297  HHGTAQF  277
            + G+  +
Sbjct  748  NQGSGTY  754



>ref|XP_001944379.2| PREDICTED: choline transporter-like protein 1 [Acyrthosiphon 
pisum]
Length=591

 Score =   103 bits (257),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 68/200 (34%), Positives = 103/200 (52%), Gaps = 12/200 (6%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS + + ++ IR IL  I   LK S +       K  +   Q     +   ++ + RNA
Sbjct  396  LGSFIIAVLQIIRAILNFIDETLKDSQNEV----AKSLYKIFQCLFSCIQQFIQYLTRNA  451

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YI IAI G +F ++ + A ++I SNVLR+  +N +GD +LFLGK+LV   + L  F ML+
Sbjct  452  YIEIAIYGDNFCRSGQQAFKMITSNVLRVAAINSVGDFVLFLGKVLVVTSTVLLGFKMLE  511

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQ-  280
            T         +     P+ V     Y VA  F SV EM IDTI + FC+D   + G  Q 
Sbjct  512  TKP------GVLHLWVPLTVAGIFAYFVAHCFISVYEMVIDTIFMCFCEDCNLNDGVTQE  565

Query  279  -FAPPLLMETLDSQNEMQRL  223
             +    LM+ ++S  ++ R+
Sbjct  566  YYMSKELMDFVESSQKVLRV  585



>ref|XP_001458717.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK91320.1| unnamed protein product [Paramecium tetraurelia]
Length=665

 Score =   103 bits (257),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 68/204 (33%), Positives = 110/204 (54%), Gaps = 8/204 (4%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
             GS++ + ++ IR +L  IR + +    + E+   K        C+      ++ +N NA
Sbjct  465  FGSLILAIVQLIRIMLEYIRYQTEKVAGS-ENKAVKCLLRCLSCCMACFERFIRFLNNNA  523

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIA+TGK+F  A++ A E I +N +R   VN IG   +F+GK  +S+V+ +  + ++ 
Sbjct  524  YIMIALTGKNFCSAAKAAFETIWANSMRFSLVNGIGGAFIFVGKFCISIVTLMIFYYVIT  583

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFC--QDSEEHHG--  289
            T  Y     KI SP+FP +V + I Y +A LF S+  M+ D ++L F   +D  + +G  
Sbjct  584  TMDY--FKEKIFSPVFPCIVVFIIAYALAVLFMSIYGMACDAVLLCFIFDEDLNKQNGGQ  641

Query  288  TAQFAPPLLMETLDSQNEMQRLTQ  217
            +A   P  L E L+ Q EM  L Q
Sbjct  642  SASRCPETLKEFLE-QPEMANLKQ  664



>gb|KDO33054.1| hypothetical protein SPRG_01869 [Saprolegnia parasitica CBS 223.65]
Length=775

 Score =   103 bits (257),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 59/185 (32%), Positives = 105/185 (57%), Gaps = 9/185 (5%)
 Frame = -2

Query  813  GSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNAY  634
            GS++ + I+  R +L  I ++LK++    ++   K+A    + CL      +K +N+NAY
Sbjct  548  GSLIIAIIQFARLVLEYIDQKLKSAQ---QNTLVKVAMLCFKCCLWCFEKCIKFLNKNAY  604

Query  633  IMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLDT  454
            I++A+ G  F  + + +  L+++N  R+  V+VI   +LFLGK+ ++  S +  FL +  
Sbjct  605  IIVAMKGDGFCSSMKESFSLLLANAARVATVSVITTFLLFLGKIFITAFSCMMLFLFITN  664

Query  453  HK------YKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHH  292
                    +      I+SP+FP+LVC  + Y VAT+F +V E +IDTI+L FC+D + + 
Sbjct  665  PPKQLPAFFLGDVENINSPVFPLLVCGLLAYGVATMFLNVYETAIDTILLCFCEDCKVNK  724

Query  291  GTAQF  277
             T  +
Sbjct  725  ATGTY  729



>ref|XP_001007756.1| hypothetical protein TTHERM_00069180 [Tetrahymena thermophila]
 gb|EAR87511.1| plasma-membrane choline transporter [Tetrahymena thermophila 
SB210]
Length=636

 Score =   102 bits (255),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 64/197 (32%), Positives = 104/197 (53%), Gaps = 6/197 (3%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
             G+++ + ++ IR +L  + +++K S     +   K      Q  +      +K +N+NA
Sbjct  442  FGALILAIVQFIRLVLEFMEQQVKKSGQGNNTCV-KYLLKCLQCYVACFERFIKFLNKNA  500

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YI IA+TGK F  A++ A ELI  N  + G V  IG++ +F+G+L ++ ++ L ++++L 
Sbjct  501  YIQIALTGKGFCSAAKDAFELIWCNPAKFGTVATIGNIFIFIGRLFIAGITGLISYIILI  560

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGT---  286
               Y  S+  + SP+ P + C  IGY V T F SV  M IDTI+   C D E    T   
Sbjct  561  KSSYYDSH--LFSPIVPTVFCVVIGYFVGTFFMSVYGMGIDTILQCTCLDEELTKKTGKD  618

Query  285  AQFAPPLLMETLDSQNE  235
            +Q  P  L E  D Q +
Sbjct  619  SQRCPGPLKEFFDQQGK  635



>ref|XP_008469468.1| PREDICTED: choline transporter-like protein 1 [Diaphorina citri]
Length=550

 Score =   102 bits (253),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 67/188 (36%), Positives = 101/188 (54%), Gaps = 13/188 (7%)
 Frame = -2

Query  783  IRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNAYIMIAITGKSF  604
            IR IL +++  +K S      W  + A+   Q C   +  I+K + RNAYI +A+ G SF
Sbjct  365  IRVILTSLKSAMKDSK---HDWV-RSAYEGLQCCFACLESILKYITRNAYIEVAMFGTSF  420

Query  603  FKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLDTHKYKSSNHKI  424
             +  + A +L+ SN LR+  +N +GD +L LGK+LV   +    F ++D          +
Sbjct  421  CRGGQQAFKLLTSNALRVAAINSVGDFVLQLGKVLVVACTVFLGFYLIDP---IPGVQHL  477

Query  423  SSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQ--FAPPLLMETL  250
              PL  V +   + Y +A  FFSV EM IDTI L FC+D E + G A+  F    LME +
Sbjct  478  GVPLTIVGL---VSYFIAHCFFSVYEMVIDTIFLCFCEDCELNDGEAKPYFMSAGLMEFV  534

Query  249  -DSQNEMQ  229
             DS+ E++
Sbjct  535  EDSKRELR  542



>ref|XP_008612348.1| hypothetical protein SDRG_08250 [Saprolegnia diclina VS20]
 gb|EQC34036.1| hypothetical protein SDRG_08250 [Saprolegnia diclina VS20]
Length=769

 Score =   102 bits (255),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 58/186 (31%), Positives = 105/186 (56%), Gaps = 9/186 (5%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
             GS++ + I+  R +L  I ++LK++    ++   K+A    + CL      +K +N+NA
Sbjct  556  FGSLIVAIIQFARLVLEYIDQKLKSAQ---QNTLVKVAMLCFKCCLWCFEKCIKFLNKNA  612

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YI++A+ G  F  + + +  L+++N  R+  V+VI   +LFLGK+ ++  S +  FL + 
Sbjct  613  YIIVAMKGDGFCSSMKESFSLLLANAARVATVSVITTFLLFLGKIFITAFSCMMLFLFIT  672

Query  456  THK------YKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEH  295
                     +      I+SP+FP+LVC  + Y +AT+F +V E +IDTI+L FC+D + +
Sbjct  673  NPPKQLPAFFLGDVANINSPVFPLLVCGLLAYGIATMFLNVYETAIDTILLCFCEDCKVN  732

Query  294  HGTAQF  277
              T  +
Sbjct  733  KATGTY  738



>emb|CDS19864.1| choline transporter protein 2 [Echinococcus granulosus]
Length=729

 Score =   102 bits (254),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 65/185 (35%), Positives = 99/185 (54%), Gaps = 10/185 (5%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS+L +    +R  L  + RRLKT+N+       +        CL  +   ++ +N+NA
Sbjct  526  LGSILITIFWFLRACLLRLERRLKTANNEL----AQFFLRCFCCCLWCLEKFLRFLNKNA  581

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLML-  460
            YIMIAI G  F +++  A +LI+ NV+R+  V  I D IL +GKL VS  ++  A+  L 
Sbjct  582  YIMIAIYGHGFCRSARDAFQLIVRNVVRVFLVEKITDYILVVGKLAVSAAASCLAYFYLG  641

Query  459  -----DTHKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEH  295
                   +     N +++    P+LV     Y+VA  FFSV EM +DTI +  C+D E +
Sbjct  642  GVIPDKLNLVPEQNLQLNYIFVPILVIAIASYLVAKAFFSVYEMGVDTIFICVCEDLERN  701

Query  294  HGTAQ  280
             GTA+
Sbjct  702  DGTAE  706



>ref|XP_009822172.1| hypothetical protein H257_00933 [Aphanomyces astaci]
 gb|ETV87309.1| hypothetical protein H257_00933 [Aphanomyces astaci]
Length=784

 Score =   102 bits (255),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 58/187 (31%), Positives = 104/187 (56%), Gaps = 10/187 (5%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
             GS++ + I+ IR +L  + ++LKT+         K+A    + CL      MK +N+NA
Sbjct  574  FGSLIIAIIQFIRLVLEYVDQKLKTAQKGNTMV--KVAMCAFKCCLWCFEKCMKFLNKNA  631

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIM+A+ G SF  A + +  LI++N  R+  V+++   ++ LGK+ ++    +  FL L 
Sbjct  632  YIMVAMKGTSFCSAMKESFGLILANAARVATVSIVSMFLILLGKIFITSFCCMMLFLFL-  690

Query  456  THK-------YKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEE  298
            +H        +  +   +SSP+FP+LVC  + + +A+ F  V E +IDTI+L FC+D + 
Sbjct  691  SHPPAGLPSFFTDNLDNLSSPVFPLLVCGLLSFTIASFFLDVYETAIDTILLCFCEDCKV  750

Query  297  HHGTAQF  277
            +  +  +
Sbjct  751  NQASGTY  757



>emb|CDI98202.1| choline transporter protein 2 [Echinococcus multilocularis]
Length=729

 Score =   101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 64/185 (35%), Positives = 99/185 (54%), Gaps = 10/185 (5%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS+L +    +R  L  + RRLKT+N+       +        CL  +   ++ +N+NA
Sbjct  526  LGSILITIFWFLRACLLRLERRLKTANNEI----AQFFLRCFCCCLWCLEKFLRFLNKNA  581

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLML-  460
            YIMIAI G  F +++  A +LI+ NV+R+  V  I D IL +GKL VS  ++  A+  L 
Sbjct  582  YIMIAIYGHGFCRSARDAFQLIVRNVVRVFLVEKITDYILVVGKLAVSAAASCLAYFYLG  641

Query  459  -----DTHKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEH  295
                   +     N +++    P+LV     Y+VA  FFSV EM +DTI +  C+D E +
Sbjct  642  GVIPDKLNLVPEQNLQLNYIFVPILVIAIASYLVAKAFFSVYEMGVDTIFICVCEDLERN  701

Query  294  HGTAQ  280
            +GT +
Sbjct  702  NGTVE  706



>ref|XP_002731355.1| PREDICTED: choline transporter-like protein 1-like [Saccoglossus 
kowalevskii]
Length=678

 Score =   101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 95/177 (54%), Gaps = 10/177 (6%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LG+ + + ++  R IL   + +LK S S    W           CL      +K +N NA
Sbjct  441  LGAFIITLVKIPRAILAYTQAKLKDSTSKVAQW----IMTCLSCCLWCFEKCLKYLNENA  496

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YI+IAI G SF  A++ A   ++SN LR+  +N +GD ++FLGKL V  ++A    L+  
Sbjct  497  YIVIAIEGVSFCPAAQKAFITLVSNALRVAAINCVGDFVMFLGKLAVVGITAFIGLLIFG  556

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGT  286
            +H        ++    P+L+     +++A  FF++ EM+IDT++L FC+D   + G+
Sbjct  557  SHS------SVNYYAIPILLAGIFAFLIAHAFFTIYEMTIDTLLLCFCEDCRVNDGS  607



>ref|XP_006919531.1| PREDICTED: choline transporter-like protein 5 [Pteropus alecto]
Length=728

 Score =   101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 66/205 (32%), Positives = 108/205 (53%), Gaps = 23/205 (11%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSV----  649
             GS++ + I+ IR IL  + +R K S +    +         Q CL+   W ++ V    
Sbjct  527  FGSLILALIQMIRIILEYLDKRFKESQNNISKF--------LQCCLKCCFWCLEKVVKFL  578

Query  648  NRNAYIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAF  469
            NRNAY+MIAI GKSF +++  A  L+I N+L++  ++ + D +L LGK+LV+    + AF
Sbjct  579  NRNAYVMIAIHGKSFCRSARDAFNLLIRNILKVAIMDKVTDFVLILGKMLVAGCIGILAF  638

Query  468  LMLDTH-----KYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDS  304
            L+         +  +S +    PL  V++     Y++A  FFSV  M IDT+ + FC+D 
Sbjct  639  LLFTQRIPMILEGPTSLNYYWVPLLTVVIG---SYLIAHGFFSVYAMCIDTLFICFCEDL  695

Query  303  EEHHGTAQ---FAPPLLMETLDSQN  238
            E + G+ +   F  P L   L+ + 
Sbjct  696  ERNDGSTEKPYFIAPTLHGILNKKQ  720



>gb|EUB61135.1| Choline transporter-like protein 5-A [Echinococcus granulosus]
Length=926

 Score =   101 bits (251),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 65/185 (35%), Positives = 99/185 (54%), Gaps = 10/185 (5%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS+L +    +R  L  + RRLKT+N+       +        CL  +   ++ +N+NA
Sbjct  723  LGSILITIFWFLRACLLRLERRLKTANNEL----AQFFLRCFCCCLWCLEKFLRFLNKNA  778

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLML-  460
            YIMIAI G  F +++  A +LI+ NV+R+  V  I D IL +GKL VS  ++  A+  L 
Sbjct  779  YIMIAIYGHGFCRSARDAFQLIVRNVVRVFLVEKITDYILVVGKLAVSAAASCLAYFYLG  838

Query  459  -----DTHKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEH  295
                   +     N +++    P+LV     Y+VA  FFSV EM +DTI +  C+D E +
Sbjct  839  GVIPDKLNLVPEQNLQLNYIFVPILVIAIASYLVAKAFFSVYEMGVDTIFICVCEDLERN  898

Query  294  HGTAQ  280
             GTA+
Sbjct  899  DGTAE  903



>gb|EYB94274.1| hypothetical protein Y032_0173g396 [Ancylostoma ceylanicum]
Length=539

 Score =   100 bits (248),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 61/199 (31%), Positives = 107/199 (54%), Gaps = 9/199 (5%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
             GS++ + ++ IR IL  + ++L T+NST      K+ F   + C   +    K + +NA
Sbjct  344  FGSLIIAIVKIIRVILDYLDKKLSTTNSTVL----KIIFTALKCCFWCMEVFFKFLTKNA  399

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            +IM+AI GK+FF +++ +  L++ N +R   VN +  ++LFLGK L++L   + AF    
Sbjct  400  FIMMAIYGKNFFTSAKDSFLLLVRNCVRAAVVNQVAGILLFLGKALITLGMGVVAFFYFS  459

Query  456  THKYKSSNHKISSPLF--PVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTA  283
                     ++    +  P+++     Y VA LFF V EM++DT  + F +DSE++ G+ 
Sbjct  460  GQWVVDGIPRVELYYYFVPIILVLIGSYFVADLFFDVYEMAVDTTFICFLEDSEQNDGSP  519

Query  282  Q---FAPPLLMETLDSQNE  235
            +   +    L   LD +NE
Sbjct  520  EKPFYMSKNLQNILDKKNE  538



>dbj|GAM18465.1| hypothetical protein SAMD00019534_016400, partial [Acytostelium 
subglobosum LB1]
Length=629

 Score =   100 bits (249),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 61/179 (34%), Positives = 103/179 (58%), Gaps = 10/179 (6%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ + ++ IR++L  I ++ K      E++  +         L      +K ++ NA
Sbjct  440  LGSLILAVVQFIRWMLRLIEKKFKGK----EAYLARFVLKCLDCLLGCFERFIKFIDENA  495

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMI+I G SF K +     LI+SNVLR+  V+VI   +LFLG++L+++V+   AF +L 
Sbjct  496  YIMISIYGYSFCKGARRGFSLIVSNVLRVAAVSVISSFLLFLGRILITVVTVGIAFYVL-  554

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQ  280
              +  +S   +     PV++   I + +A  F SV  M+IDT++L FC+DSE + G+A+
Sbjct  555  -QRVDNSGFYV----VPVILIGFIAFFIAGGFMSVYHMAIDTMLLCFCEDSERNDGSAE  608



>gb|EYB94272.1| hypothetical protein Y032_0173g396 [Ancylostoma ceylanicum]
Length=532

 Score = 99.8 bits (247),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 61/199 (31%), Positives = 107/199 (54%), Gaps = 9/199 (5%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
             GS++ + ++ IR IL  + ++L T+NST      K+ F   + C   +    K + +NA
Sbjct  337  FGSLIIAIVKIIRVILDYLDKKLSTTNSTVL----KIIFTALKCCFWCMEVFFKFLTKNA  392

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            +IM+AI GK+FF +++ +  L++ N +R   VN +  ++LFLGK L++L   + AF    
Sbjct  393  FIMMAIYGKNFFTSAKDSFLLLVRNCVRAAVVNQVAGILLFLGKALITLGMGVVAFFYFS  452

Query  456  THKYKSSNHKISSPLF--PVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTA  283
                     ++    +  P+++     Y VA LFF V EM++DT  + F +DSE++ G+ 
Sbjct  453  GQWVVDGIPRVELYYYFVPIILVLIGSYFVADLFFDVYEMAVDTTFICFLEDSEQNDGSP  512

Query  282  Q---FAPPLLMETLDSQNE  235
            +   +    L   LD +NE
Sbjct  513  EKPFYMSKNLQNILDKKNE  531



>gb|EYB94273.1| hypothetical protein Y032_0173g396 [Ancylostoma ceylanicum]
Length=547

 Score = 99.8 bits (247),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 61/199 (31%), Positives = 107/199 (54%), Gaps = 9/199 (5%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
             GS++ + ++ IR IL  + ++L T+NST      K+ F   + C   +    K + +NA
Sbjct  352  FGSLIIAIVKIIRVILDYLDKKLSTTNSTVL----KIIFTALKCCFWCMEVFFKFLTKNA  407

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            +IM+AI GK+FF +++ +  L++ N +R   VN +  ++LFLGK L++L   + AF    
Sbjct  408  FIMMAIYGKNFFTSAKDSFLLLVRNCVRAAVVNQVAGILLFLGKALITLGMGVVAFFYFS  467

Query  456  THKYKSSNHKISSPLF--PVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTA  283
                     ++    +  P+++     Y VA LFF V EM++DT  + F +DSE++ G+ 
Sbjct  468  GQWVVDGIPRVELYYYFVPIILVLIGSYFVADLFFDVYEMAVDTTFICFLEDSEQNDGSP  527

Query  282  Q---FAPPLLMETLDSQNE  235
            +   +    L   LD +NE
Sbjct  528  EKPFYMSKNLQNILDKKNE  546



>gb|EPQ11280.1| Choline transporter-like protein 5 [Myotis brandtii]
Length=714

 Score =   100 bits (249),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 64/199 (32%), Positives = 108/199 (54%), Gaps = 11/199 (6%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
             GS+L + I+  R  L  + +R+K + +       K   H  + C   +  ++K +NRNA
Sbjct  513  FGSLLLALIQMFRIALEYLDKRIKDNQNNI----AKFLQHCLKCCFWCLEKVVKFLNRNA  568

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            Y+MIAI GK+F ++++ A +L+I N+L++  ++ + D +L LGK+LVS    + AFL+  
Sbjct  569  YVMIAIYGKNFCRSAKDAFDLLIRNILKVAVLDKVTDFVLVLGKILVSGCIGVLAFLLF-  627

Query  456  THKYK---SSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGT  286
            T +          ++    P+L      Y+VA  FFSV  M IDTI + FC+D E + G+
Sbjct  628  TQRISIIIEGPTSLNYYWVPLLTIIAGSYLVAHGFFSVYAMCIDTIFICFCEDLERNDGS  687

Query  285  AQ---FAPPLLMETLDSQN  238
             +   F  P L   L+ ++
Sbjct  688  TEKPYFIAPTLHGILNKRH  706



>ref|XP_001636308.1| predicted protein [Nematostella vectensis]
 gb|EDO44245.1| predicted protein [Nematostella vectensis]
Length=651

 Score = 99.8 bits (247),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 67/208 (32%), Positives = 114/208 (55%), Gaps = 14/208 (7%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
             G+ + + ++ IR +L  I R+LK S    ++   K      + C   +   ++ +N+NA
Sbjct  448  FGAAIIAIVQFIRAVLEYIDRKLKESGHDNKAV--KFIMCCCKCCFWCLEKCLRFLNKNA  505

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSL---VSALFAFL  466
            YIMIAI GK+F  +++ A +L++ N+LR+  VN +   +LFLGK+LV+    V++ + F 
Sbjct  506  YIMIAIYGKNFCTSAKDAFQLLLRNILRVAAVNSVTSFLLFLGKVLVTSIVGVASYYWFR  565

Query  465  MLDTHKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGT  286
             +D     S N+ +     PV++     YVV  +FF V +M IDTI L F +D E + G+
Sbjct  566  KIDADDPDSLNYDV----VPVIISVVFAYVVTVMFFDVYDMCIDTIFLCFLEDLERNDGS  621

Query  285  AQ---FAPPLLMETLDSQNE--MQRLTQ  217
            A+   +    L + L+ QN    ++L Q
Sbjct  622  AEKPYYMNDDLKKILNKQNRASTEQLDQ  649



>ref|XP_002916963.2| PREDICTED: choline transporter-like protein 5 [Ailuropoda melanoleuca]
Length=724

 Score =   100 bits (248),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 63/189 (33%), Positives = 105/189 (56%), Gaps = 22/189 (12%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSV----  649
             GS++ + ++  +FIL  + RRLK + +    +         Q CL+   W M+ +    
Sbjct  525  FGSLILALVQMFKFILEYLDRRLKEAQNNISKF--------LQCCLKCCFWCMEKMVKFF  576

Query  648  NRNAYIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAF  469
            NRNAY+MIAI GK+F +++  A  L++ N+L++  ++ + D +L LGK+LV+    + AF
Sbjct  577  NRNAYVMIAIYGKNFCRSARDAFNLLMRNILKVAVMDKVTDFVLILGKILVAGCIGVLAF  636

Query  468  LMLDTHKYKSSNHKISS------PLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQD  307
            L+  TH+  +     +S      PL  V++     Y+VA  FFSV  M IDTI + F +D
Sbjct  637  LLF-THRLPTMIEGPTSLNYYWIPLLTVIIG---SYLVAHGFFSVYAMCIDTIFICFLED  692

Query  306  SEEHHGTAQ  280
             E + G+A+
Sbjct  693  VERNDGSAE  701



>ref|NP_942572.1| choline transporter-like protein 2 [Danio rerio]
 sp|Q7SYC9.1|CTL2_DANRE RecName: Full=Choline transporter-like protein 2; AltName: Full=Solute 
carrier family 44 member 2 [Danio rerio]
 gb|AAH54915.1| Zgc:63569 [Danio rerio]
Length=697

 Score = 99.8 bits (247),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 70/194 (36%), Positives = 108/194 (56%), Gaps = 13/194 (7%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
             GS+L + ++ IR +L  I  +LK +    E+   K      + C   +   +K +NRNA
Sbjct  501  FGSLLLAIVQVIRVLLEYIDHKLKGA----ENKFAKFLLCCLKCCFWCLEKFIKFINRNA  556

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLML-  460
            YIM+AI GK+F +++  A  L++ NV+R+  ++ + D ILFLGKLL+  +  +FAF    
Sbjct  557  YIMVAIYGKNFCRSARDAFFLLMRNVVRVVVLDKVTDFILFLGKLLIVGLVGIFAFFFFS  616

Query  459  -DTHKYKS---SNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHH  292
              T  +K    S H    P+  VLVC    Y++A  FFSV  M +DT+ L F +D E + 
Sbjct  617  GQTDAFKGTAPSLHYYWVPILTVLVC---SYLIAHGFFSVYAMCVDTLFLCFLEDLERND  673

Query  291  GTAQFAPPLLMETL  250
            G+A+  P L+ E L
Sbjct  674  GSAE-RPYLMSENL  686



>ref|XP_005835119.1| hypothetical protein GUITHDRAFT_58746, partial [Guillardia theta 
CCMP2712]
 gb|EKX48139.1| hypothetical protein GUITHDRAFT_58746, partial [Guillardia theta 
CCMP2712]
Length=538

 Score = 99.0 bits (245),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 96/172 (56%), Gaps = 5/172 (3%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS + + ++ IR+I      +LK  N  P+S   K+     + CL  +   +  +N+NA
Sbjct  372  LGSFIIAVVQMIRWIFRYYMYQLKKMN--PDSKIVKVLAFIGECCLACLERFLNFINKNA  429

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YI  AITG  F+ A+  A  L++ N LRIG +N++  + +++GKL ++LV+ +   L++ 
Sbjct  430  YIQTAITGAGFWTAAVAAFNLLVRNCLRIGTLNIVATIYIYIGKLFIALVTGIICALIMV  489

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSE  301
               Y +      +P+FP+ +   I + +A++F  V E+ IDTI   +C D E
Sbjct  490  GGDYGNVT---DAPVFPMTIILLIAFGIASIFLDVWEICIDTIFQCYCMDEE  538



>ref|XP_008137662.1| PREDICTED: choline transporter-like protein 5 [Eptesicus fuscus]
Length=678

 Score = 99.4 bits (246),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 64/199 (32%), Positives = 107/199 (54%), Gaps = 11/199 (6%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
             GS+L + I+  R  L  + +R++ + +       K   H  + C   +  ++K +NRNA
Sbjct  477  FGSLLLALIQIFRIALEYLDKRIRDNQNNI----AKFLQHCLKCCFWCLEKLVKFLNRNA  532

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            Y+MIAI GK+F +++  A EL+I N+L++  ++ + D +L LGK+LVS    + AFL+  
Sbjct  533  YVMIAIYGKNFCRSARDAFELLIRNILKVAVMDKVTDFVLVLGKILVSGSIGVLAFLLF-  591

Query  456  THKYK---SSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGT  286
            T +          ++    P+L      Y+VA  FFSV  M IDTI + FC+D E + G+
Sbjct  592  TQRVSIIIEGPTSLNYYWVPLLTIIAGSYLVAHGFFSVYAMCIDTIFICFCEDLERNDGS  651

Query  285  AQ---FAPPLLMETLDSQN  238
             +   F  P L   L+ ++
Sbjct  652  TEKPYFIAPTLHGILNKRH  670



>gb|ENN79819.1| hypothetical protein YQE_03642, partial [Dendroctonus ponderosae]
Length=558

 Score = 98.6 bits (244),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 62/196 (32%), Positives = 102/196 (52%), Gaps = 9/196 (5%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS   + ++ +R I  A++R +   +++   W  K        C   +  ++  ++RNA
Sbjct  347  LGSFCLATVQILRLIFTAMQRMVTYQSNSHLVWLAKTCLCLCNCCFWLLDRVLNVISRNA  406

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YI+ A+ G SF +A + A   + +N LR+  +N +GD +LFL K+LV   S       L 
Sbjct  407  YILTAMYGDSFCRAGKQALAHLTANPLRVAAINSVGDFVLFLAKVLVVACSVAIGSYFL-  465

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQ-  280
              K+K + H    PL  + +     Y +A  F +V EM+IDTI + FC+D E + G ++ 
Sbjct  466  --KHKDNLHHYWVPLALIGL---FSYFIAHCFMTVYEMTIDTIFMCFCEDCELNDGASRP  520

Query  279  -FAPPLLMETL-DSQN  238
             F    LME + DS+N
Sbjct  521  YFMSRGLMEFVEDSKN  536



>ref|XP_007062626.1| PREDICTED: choline transporter-like protein 5 isoform X2 [Chelonia 
mydas]
Length=588

 Score = 98.6 bits (244),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 68/205 (33%), Positives = 111/205 (54%), Gaps = 14/205 (7%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLK-TSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRN  640
             GS++ + ++ IR IL  +  +LK T NS       +      + C   +   +K +NRN
Sbjct  389  FGSLILAIVQLIRIILEYLDHKLKGTQNSCT-----RFLLCCLKCCFWCLEKFIKFINRN  443

Query  639  AYIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLML  460
            AYIMIAI GK+F  +++ A  L++ NV+R+  ++ + D +LFLGKLLV+    + AF   
Sbjct  444  AYIMIAIYGKNFCTSAKEAFFLLMRNVVRVAVLDKVTDFLLFLGKLLVAGGVGVLAFFFF  503

Query  459  DTHK---YKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHG  289
             TH+   +      ++    P+L      Y++A  FFSV  M +DT+ L F +D E H G
Sbjct  504  -THRIPVFTQETPTLNYYWVPLLTVIIGSYLIAHGFFSVYAMCVDTLFLCFLEDLERHDG  562

Query  288  TAQ---FAPPLLMETLDSQN-EMQR  226
            +A+   +    L++ L+ QN E +R
Sbjct  563  SAERPYYMNKSLLKILNKQNVETKR  587



>gb|ERL87775.1| hypothetical protein D910_05164 [Dendroctonus ponderosae]
Length=561

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 62/196 (32%), Positives = 102/196 (52%), Gaps = 9/196 (5%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS   + ++ +R I  A++R +   +++   W  K        C   +  ++  ++RNA
Sbjct  350  LGSFCLATVQILRLIFTAMQRMVTYQSNSHLVWLAKTCLCLCNCCFWLLDRVLNVISRNA  409

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YI+ A+ G SF +A + A   + +N LR+  +N +GD +LFL K+LV   S       L 
Sbjct  410  YILTAMYGDSFCRAGKQALAHLTANPLRVAAINSVGDFVLFLAKVLVVACSVAIGSYFL-  468

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQ-  280
              K+K + H    PL  + +     Y +A  F +V EM+IDTI + FC+D E + G ++ 
Sbjct  469  --KHKDNLHHYWVPLALIGL---FSYFIAHCFMTVYEMTIDTIFMCFCEDCELNDGASRP  523

Query  279  -FAPPLLMETL-DSQN  238
             F    LME + DS+N
Sbjct  524  YFMSRGLMEFVEDSKN  539



>ref|XP_002432883.1| conserved hypothetical protein [Pediculus humanus corporis]
 gb|EEB20145.1| conserved hypothetical protein [Pediculus humanus corporis]
Length=595

 Score = 98.6 bits (244),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 70/196 (36%), Positives = 98/196 (50%), Gaps = 12/196 (6%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
             GS   + I+ IR IL  I  R K S S    +  K+A    + CL     I+K   R A
Sbjct  407  FGSFFIALIQMIRTILTFIEERCKNSES---EFIKKIA-SAVECCLSCFESILKYFTRTA  462

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YI IAI G SF    + A  LI SNVLR+  +N +GD ILFLGK+ V L + L   L+L 
Sbjct  463  YIEIAIHGVSFCTGGKKAFRLISSNVLRVATINSVGDFILFLGKVFVVLSTVLIGILIL-  521

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQ-  280
                  S   +     P+ +     ++V+  F +V EM ID+I + FC+D E ++G  + 
Sbjct  522  -----KSKEGVIHVWVPITLAGIFAFIVSHCFITVYEMIIDSIFVCFCEDYEMNNGADKP  576

Query  279  -FAPPLLMETLDSQNE  235
             F    LME + + N 
Sbjct  577  YFMSKGLMEFVQNNNR  592



>ref|XP_008689047.1| PREDICTED: choline transporter-like protein 5 [Ursus maritimus]
Length=726

 Score = 99.0 bits (245),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 63/189 (33%), Positives = 105/189 (56%), Gaps = 22/189 (12%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSW----IMKSV  649
             GS++ + ++  +F+L  + RRLK + +    +         Q CL+   W    ++K  
Sbjct  527  FGSLILALVQMFKFVLEYLDRRLKEAQNNISKF--------LQCCLKCCFWCVEKMVKFF  578

Query  648  NRNAYIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAF  469
            NRNAY+MIAI GK+F +++  A  L++ NVL++  ++ + D +L LGK+LV+    + AF
Sbjct  579  NRNAYVMIAIYGKNFCRSARDAFNLLMRNVLKVAVMDKVTDFVLILGKILVAGCIGVLAF  638

Query  468  LMLDTHKYKSSNHKISS------PLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQD  307
            L+  TH+  +     +S      PL  V++     Y+VA  FFSV  M IDTI + F +D
Sbjct  639  LLF-THRLPTMIEGPTSLNYYWIPLLTVIIG---SYLVAHGFFSVYAMCIDTIFICFLED  694

Query  306  SEEHHGTAQ  280
             E + G+A+
Sbjct  695  VERNDGSAE  703



>gb|EYB94271.1| hypothetical protein Y032_0173g396 [Ancylostoma ceylanicum]
Length=796

 Score = 99.0 bits (245),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/199 (31%), Positives = 107/199 (54%), Gaps = 9/199 (5%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
             GS++ + ++ IR IL  + ++L T+NST      K+ F   + C   +    K + +NA
Sbjct  601  FGSLIIAIVKIIRVILDYLDKKLSTTNSTVL----KIIFTALKCCFWCMEVFFKFLTKNA  656

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            +IM+AI GK+FF +++ +  L++ N +R   VN +  ++LFLGK L++L   + AF    
Sbjct  657  FIMMAIYGKNFFTSAKDSFLLLVRNCVRAAVVNQVAGILLFLGKALITLGMGVVAFFYFS  716

Query  456  THKYKSSNHKISSPLF--PVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTA  283
                     ++    +  P+++     Y VA LFF V EM++DT  + F +DSE++ G+ 
Sbjct  717  GQWVVDGIPRVELYYYFVPIILVLIGSYFVADLFFDVYEMAVDTTFICFLEDSEQNDGSP  776

Query  282  Q---FAPPLLMETLDSQNE  235
            +   +    L   LD +NE
Sbjct  777  EKPFYMSKNLQNILDKKNE  795



>ref|XP_011437432.1| PREDICTED: choline transporter-like protein 1 [Crassostrea gigas]
Length=516

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 65/200 (33%), Positives = 100/200 (50%), Gaps = 14/200 (7%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
             GS + + +   R IL  I+ RL+   S P            Q CL      +  +NRNA
Sbjct  311  FGSFIIAVVRLARLILAYIQSRLR-GKSGPVV---DFVLKVLQCCLWCFEKFLAYLNRNA  366

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YI IAI G SF   ++ A  LI+ N LR+  +N IGD +LFLGKL      +  A +++ 
Sbjct  367  YIEIAIFGHSFCTGAKKAFLLILENALRVAAINSIGDFVLFLGKL------STMAVVLVV  420

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
             +++   +  ++    P+ V     Y ++  F  V E++IDTI L FC+D +E+ G  + 
Sbjct  421  GNEFFQGHEDVNFVFVPLTVSCAFAYAISHCFLLVYEITIDTIFLCFCEDCKENDGINK-  479

Query  276  APPLLMETLDSQNEMQRLTQ  217
              P  M T D  N MQ+ ++
Sbjct  480  --PYYMST-DLLNYMQKTSK  496



>ref|XP_001309538.1| hypothetical protein [Trichomonas vaginalis G3]
 gb|EAX96608.1| conserved hypothetical protein [Trichomonas vaginalis G3]
Length=689

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/194 (31%), Positives = 103/194 (53%), Gaps = 8/194 (4%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
             GS+L +  + IR  L  I R  KT  +  ES   K      + C+      ++ +NRNA
Sbjct  503  FGSLLIAICQFIRACLEYIDR--KTKAAQQESCFIKFIIKCMKCCMWCFEKFLRYINRNA  560

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            Y++IAI G +F++ +  A  LI+ N +R   VN +GD +LFLG++ V+ + A  + L   
Sbjct  561  YVLIAIHGYNFWQGACKAFGLILRNPVRATTVNFVGDFMLFLGRVFVAAICAGCSLLW--  618

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
               +K  N+ +     P +  + + Y+V+  F S+ EM ID+  +   +D E + G+ +F
Sbjct  619  ---FKRINN-LYYYYIPAIFVFILSYIVSGTFTSLFEMGIDSCFMCVLEDEERNKGSQRF  674

Query  276  APPLLMETLDSQNE  235
            APP L+E ++   E
Sbjct  675  APPDLLEAMEKPEE  688



>gb|ENN83028.1| hypothetical protein YQE_00610, partial [Dendroctonus ponderosae]
Length=207

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 64/203 (32%), Positives = 111/203 (55%), Gaps = 19/203 (9%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTS-QGCLRGVSW----IMKS  652
             GS++ +    IR +L  + ++LK  ++         AF  +   CL+   W     +K 
Sbjct  10   FGSLIIAICRMIRVMLECVDKKLKKYDN---------AFTRAILCCLKCFFWCLEKFLKF  60

Query  651  VNRNAYIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFA  472
            +N+NAYIM AI GK+F  +++ A  L+++N++R+  ++ + D + FL KLLV+      A
Sbjct  61   INKNAYIMCAIHGKNFCASAKDAFTLLLNNIVRVFVLDKVTDFLFFLSKLLVTFGVGAIA  120

Query  471  FLMLDTHKYKS--SNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEE  298
            ++   T  Y S   N +I   L PV+      Y++ATLFF+V  M++DT+ L F +DSE+
Sbjct  121  YVFFVTD-YISFVDNSEIQYGLAPVVAIIIATYLIATLFFNVYSMAVDTLFLCFLEDSEK  179

Query  297  HHGTAQ--FAPPLLMETLDSQNE  235
            ++G  +  +    LM  L  +N+
Sbjct  180  NNGKDRPYYMSRNLMRILGKRNK  202



>ref|XP_002156866.2| PREDICTED: choline transporter-like protein 4-like [Hydra vulgaris]
Length=774

 Score = 98.2 bits (243),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 66/202 (33%), Positives = 108/202 (53%), Gaps = 17/202 (8%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKS----V  649
            LG+ + + ++ IR  L  I R+LK + + P +            CL+   W ++     +
Sbjct  565  LGAAIIAIVKLIRITLEYIDRKLKENTNNPVA-------SFIMKCLKCCFWCLEKCLRFL  617

Query  648  NRNAYIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAF  469
            N+NAYIMIA+ G++F  +++ A  L++ N  R   +N I   ILFLGK+LV+    + +F
Sbjct  618  NKNAYIMIAVYGRNFCVSAKEAFSLLVRNPARALAINGITGFILFLGKILVTGGVGVGSF  677

Query  468  LMLDTHKYKS-SNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHH  292
                  KY +    K+   + P+L+C    Y+VA LFFSV +M IDT+ L F +D E + 
Sbjct  678  FWF--GKYNAFQPDKLQYSIAPILICTIGAYLVAMLFFSVYDMGIDTLFLCFLEDLERND  735

Query  291  GTAQ---FAPPLLMETLDSQNE  235
            G+A+   F    L   +D +N+
Sbjct  736  GSAEKPYFMSKELRNIMDVKNK  757



>ref|XP_002167680.2| PREDICTED: choline transporter-like protein 4-like [Hydra vulgaris]
Length=246

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 59/197 (30%), Positives = 106/197 (54%), Gaps = 10/197 (5%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
             GS++ + ++ IR  L  I  +L    + P     K      + C   +   +K +N+NA
Sbjct  51   FGSLIIAIVQLIRAALEYIEYKLTGQGAQPSP-VTKFLLKCLKCCFWCLEKFLKFLNKNA  109

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YI IA+ GK+F  +++ A  L++ N+LR+  ++ + D +LF+GKL ++    + +F    
Sbjct  110  YIEIAVYGKNFCVSAKNAFMLLMRNILRVAVLDKVTDFLLFIGKLSITAGMGIASFYFF-  168

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQ-  280
             HK K+ N+  +    P+++     +VV+T FF V EM+I+TI L F +D E H G+   
Sbjct  169  -HKEKNMNYYFT----PIVIITVGAWVVSTAFFGVYEMAINTIFLCFLEDCERHDGSPDK  223

Query  279  --FAPPLLMETLDSQNE  235
              +    LM+ L+ +N+
Sbjct  224  PYYMSKKLMKILNKKNK  240



>ref|XP_008112317.1| PREDICTED: choline transporter-like protein 5 isoform X4 [Anolis 
carolinensis]
Length=679

 Score = 97.8 bits (242),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 66/192 (34%), Positives = 102/192 (53%), Gaps = 16/192 (8%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
             GS++ + ++ IR IL  +  +LK S +       K      + C   +   +K +NRNA
Sbjct  478  FGSLILAIVQLIRVILEYLDHKLKGSQNAF----AKFLLCCLKCCFWCLEKFLKFINRNA  533

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAI GK+F  ++  A  L++ NV+R+  ++ + D +LFLGK+LV+    + AF    
Sbjct  534  YIMIAIYGKNFCASAREAFFLLMRNVVRVAVLDKVTDFLLFLGKILVAGGVGVLAFFFF-  592

Query  456  THKYKSSNHKISS------PLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEH  295
            TH+     H+  S      PL  V++     Y+VA  FFSV  M +DT+ L FC+D E +
Sbjct  593  THRIPIFTHEAPSLNYYWVPLLTVIIG---SYLVAHGFFSVYAMCVDTLFLCFCEDLERN  649

Query  294  HGTAQFAPPLLM  259
             G+   A P  M
Sbjct  650  DGST--AKPYYM  659



>ref|XP_012011369.1| PREDICTED: choline transporter-like protein 5 isoform X4 [Ovis 
aries musimon]
Length=678

 Score = 97.4 bits (241),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 65/205 (32%), Positives = 108/205 (53%), Gaps = 23/205 (11%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIM----KSV  649
             GS++ + I+  R IL  + +RL+ + S    +         + CLR   W +    K +
Sbjct  477  FGSLILAIIQMFRLILEYLDKRLQKAQSNISKF--------LKCCLRCCFWCLEKAVKFL  528

Query  648  NRNAYIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAF  469
            NRNAY+M+AI GK+F K++  A  L++ N+L+I  ++ + D +L LGK+LV+    + AF
Sbjct  529  NRNAYVMMAIYGKNFCKSARDAFNLLMRNILKIAVMDRVTDFVLILGKILVAGCIGVLAF  588

Query  468  LMLDTH-----KYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDS  304
            L+         +  +S +    PL  V+V     Y++A  FFSV  M I+TI + FC+D 
Sbjct  589  LLFTERLPVIIEGPTSLNYYWVPLLTVIVG---SYIIAHGFFSVYAMCIETIFICFCEDL  645

Query  303  EEHHGTAQ---FAPPLLMETLDSQN  238
            E + G+ +   F  P L   L+ + 
Sbjct  646  ERNDGSTEKPYFITPTLHGILNKKQ  670



>ref|XP_008328958.1| PREDICTED: LOW QUALITY PROTEIN: choline transporter-like protein 
5 [Cynoglossus semilaevis]
Length=712

 Score = 97.4 bits (241),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 64/185 (35%), Positives = 100/185 (54%), Gaps = 16/185 (9%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIM----KSV  649
             GS++ + ++ IR IL  +  +LK S ++   +           CLR   W M    K +
Sbjct  510  FGSLILAMVQVIRIILEYMGNKLKGSRNSFAKF--------LVCCLRCCFWCMERFIKFI  561

Query  648  NRNAYIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAF  469
            NRNAYIM+AI GKSF  +S+ A  L++ NV+R+  ++ + D +LFL KLLV+      AF
Sbjct  562  NRNAYIMMAIYGKSFCTSSKDAFLLLMRNVIRVAVLDKVTDFLLFLAKLLVAGGVGALAF  621

Query  468  LMLDTHKYKSSNHKISS---PLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEE  298
                THK  +   ++ S   P  P++      Y++A  F SV  M +DT+ L FC+D E 
Sbjct  622  CFF-THKIPALQEEVPSLNYPWVPIVTVIFGSYLIAHGFLSVYAMCVDTLFLCFCEDLER  680

Query  297  HHGTA  283
            + G++
Sbjct  681  NDGSS  685



>ref|XP_002909909.1| choline transporter-like protein [Phytophthora infestans T30-4]
 gb|EEY58494.1| choline transporter-like protein [Phytophthora infestans T30-4]
Length=440

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 94/148 (64%), Gaps = 3/148 (2%)
 Frame = -2

Query  711  KMAFHTSQGCLRGVSWIMKSVNRNAYIMIAITGKSFFKASEIATELIISNVLRIGKVNVI  532
            K+     Q CL  +   ++ +++NAYI+IA+ G SF  +++ A +++++N+ ++G V+ +
Sbjct  265  KVVMKIVQCCLWCLEKCLRFLSKNAYILIAMKGHSFCVSAKDAFKILLTNIAQVGAVSTV  324

Query  531  GDVILFLGKLLVSLVSAL--FAFLMLDTHKYK-SSNHKISSPLFPVLVCWGIGYVVATLF  361
              ++L  GKL V+L  A+  FA+L  +T  Y    +H++SSPL  +LV   +G+ VA+  
Sbjct  325  TFLLLGAGKLAVALSCAIATFAYLEKNTDDYGVGGDHELSSPLASILVALLLGWFVASTL  384

Query  360  FSVVEMSIDTIILSFCQDSEEHHGTAQF  277
              V EM+IDTI++ FC+D E +  +AQ+
Sbjct  385  LGVYEMAIDTILMCFCEDKELNKESAQY  412



>gb|EPZ31046.1| Choline transporter-like domain-containing protein [Rozella allomycis 
CSF55]
Length=626

 Score = 97.4 bits (241),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 61/189 (32%), Positives = 96/189 (51%), Gaps = 12/189 (6%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
             GS++ +    +R +L  I + LK S +       K  F   Q C   V+  +  +N+NA
Sbjct  440  FGSLIIAIFYLVRIVLLYIEKNLKVSQNKFL----KFLFACLQCCFACVTRFIAFLNKNA  495

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YI IAI GKSF  +++ A +L+I N LR+  V+ +   ILF  KL +S     + F  L 
Sbjct  496  YIEIAIYGKSFCASAKDAFQLLIRNALRLAVVDSVSGFILFFSKLFISSCGTFYLFARL-  554

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
                   N  +S    P+++ +   Y +AT F  + EM+IDTI L FC+D E++ G  + 
Sbjct  555  -----RDNASVSFYTVPLVIVFICSYCIATFFLYIYEMAIDTIFLCFCEDCEKNDGVNK-  608

Query  276  APPLLMETL  250
             P  + + L
Sbjct  609  -PYFMSDNL  616



>ref|XP_008112314.1| PREDICTED: choline transporter-like protein 5 isoform X2 [Anolis 
carolinensis]
Length=712

 Score = 97.4 bits (241),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 66/192 (34%), Positives = 102/192 (53%), Gaps = 16/192 (8%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
             GS++ + ++ IR IL  +  +LK S +       K      + C   +   +K +NRNA
Sbjct  511  FGSLILAIVQLIRVILEYLDHKLKGSQNAF----AKFLLCCLKCCFWCLEKFLKFINRNA  566

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAI GK+F  ++  A  L++ NV+R+  ++ + D +LFLGK+LV+    + AF    
Sbjct  567  YIMIAIYGKNFCASAREAFFLLMRNVVRVAVLDKVTDFLLFLGKILVAGGVGVLAFFFF-  625

Query  456  THKYKSSNHKISS------PLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEH  295
            TH+     H+  S      PL  V++     Y+VA  FFSV  M +DT+ L FC+D E +
Sbjct  626  THRIPIFTHEAPSLNYYWVPLLTVIIG---SYLVAHGFFSVYAMCVDTLFLCFCEDLERN  682

Query  294  HGTAQFAPPLLM  259
             G+   A P  M
Sbjct  683  DGST--AKPYYM  692



>ref|XP_002589940.1| hypothetical protein BRAFLDRAFT_127837 [Branchiostoma floridae]
 gb|EEN45951.1| hypothetical protein BRAFLDRAFT_127837 [Branchiostoma floridae]
Length=656

 Score = 97.4 bits (241),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 63/201 (31%), Positives = 101/201 (50%), Gaps = 16/201 (8%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
             G+++ + ++  R IL  I+ RLK                    CL     ++K +NRNA
Sbjct  443  FGAMIIALVQLARIILAYIQNRLKGRAGEV----ADFCLRCLACCLWCFEKVLKFINRNA  498

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAI G +F K+++ A  +++SN LR+  +N IGD  LFLGK+ V   + +    +L 
Sbjct  499  YIMIAIYGYNFCKSAQRAFSVLVSNALRVAALNSIGDFCLFLGKVAVVAATVVVGIELL-  557

Query  456  THKYKSSNHKISSPLFPVLVCWGI--GYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTA  283
                    ++     +PV +  G    +++A  FF+V EM+IDTI L FC+D E + G  
Sbjct  558  -------QNRADLTYYPVPIVLGAISAFLIAHCFFTVYEMAIDTIFLCFCEDEERNDGVT  610

Query  282  Q--FAPPLLMETLDSQNEMQR  226
            +  ++   L + L  Q    R
Sbjct  611  KPYYSSVGLRDYLQKQERAIR  631



>gb|KHJ85813.1| hypothetical protein OESDEN_14452 [Oesophagostomum dentatum]
Length=281

 Score = 94.4 bits (233),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 105/202 (52%), Gaps = 17/202 (8%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIM----KSV  649
             GS++ + ++ IR IL  + ++L T+NST           T  G L+   W M    K +
Sbjct  86   FGSLIIAIVKIIRVILDYLDKKLATTNST--------ILKTILGALKCCFWCMEVFLKFL  137

Query  648  NRNAYIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAF  469
             +NA+IMIAI GK+FF +++ +  L+  N +R   VN +  ++LF+GK +++L   + AF
Sbjct  138  TKNAFIMIAIYGKNFFTSAKDSFMLLARNCVRAAVVNQVAGILLFIGKAVITLGMGVVAF  197

Query  468  LMLDTHKYKSSNHKISSPLF--PVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEH  295
                         ++    +  P+++     Y VA LFF V EM++DT  + F +DSE++
Sbjct  198  FYFSGQWVVDGIPRVELYYYFVPIILVLIGSYFVADLFFDVYEMAVDTTFICFLEDSEQN  257

Query  294  HGTAQ---FAPPLLMETLDSQN  238
             G+ +   +    L   LD +N
Sbjct  258  DGSPEKPFYMSKNLQSILDVKN  279



>ref|XP_006823430.1| PREDICTED: choline transporter-like protein 2-like [Saccoglossus 
kowalevskii]
Length=723

 Score = 97.4 bits (241),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 59/188 (31%), Positives = 101/188 (54%), Gaps = 13/188 (7%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
             GS + + I+ IR +L  +  +LK S    E+   K      + C   +   MK +N+NA
Sbjct  516  FGSFIIAVIQIIRVMLEYLDHKLKGS----ENKVAKFLLKCMKCCFWCLEKFMKFLNKNA  571

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIA+ GK+F  +++ A  L++ N++R+  ++ I D +LFLGKL+V+      A+    
Sbjct  572  YIMIAVYGKNFCTSAKNAFFLLMRNIVRVVVLDKITDFLLFLGKLMVTAAVGTLAYFFFT  631

Query  456  TH---------KYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDS  304
                        Y  S   ++    P+++   + Y++A++FFSV  M+IDT+ L F +D 
Sbjct  632  NQISWYETYLSDYLGSVPTLNYYWIPMIIICILTYLIASIFFSVYNMAIDTLFLCFLEDL  691

Query  303  EEHHGTAQ  280
            E H G+A+
Sbjct  692  ERHDGSAE  699



>ref|XP_008112313.1| PREDICTED: choline transporter-like protein 5 isoform X1 [Anolis 
carolinensis]
Length=712

 Score = 97.4 bits (241),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 66/194 (34%), Positives = 102/194 (53%), Gaps = 16/194 (8%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
             GS++ + ++ IR IL  +  +LK S +       K      + C   +   +K +NRNA
Sbjct  511  FGSLILAIVQLIRVILEYLDHKLKGSQNAF----AKFLLCCLKCCFWCLEKFLKFINRNA  566

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAI GK+F  ++  A  L++ NV+R+  ++ + D +LFLGK+LV+    + AF    
Sbjct  567  YIMIAIYGKNFCASAREAFFLLMRNVVRVAVLDKVTDFLLFLGKILVAGGVGVLAFFFF-  625

Query  456  THKYKSSNHKISS------PLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEH  295
            TH+     H+  S      PL  V++     Y+VA  FFSV  M +DT+ L FC+D E +
Sbjct  626  THRIPIFTHEAPSLNYYWVPLLTVIIG---SYLVAHGFFSVYAMCVDTLFLCFCEDLERN  682

Query  294  HGTAQFAPPLLMET  253
             G+   A P  M  
Sbjct  683  DGST--AKPYYMSA  694



>ref|XP_002901659.1| choline transporter-like protein [Phytophthora infestans T30-4]
 gb|EEY58715.1| choline transporter-like protein [Phytophthora infestans T30-4]
Length=743

 Score = 97.4 bits (241),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 53/148 (36%), Positives = 94/148 (64%), Gaps = 3/148 (2%)
 Frame = -2

Query  711  KMAFHTSQGCLRGVSWIMKSVNRNAYIMIAITGKSFFKASEIATELIISNVLRIGKVNVI  532
            K+     Q CL  +   ++ +++NAYI+IA+ G SF  +++ A +++++N+ ++G V+ +
Sbjct  568  KVVMKIVQCCLWCLEKCLRFLSKNAYILIAMKGHSFCVSAKDAFKILLTNIAQVGAVSTV  627

Query  531  GDVILFLGKLLVSLVSAL--FAFLMLDTHKYK-SSNHKISSPLFPVLVCWGIGYVVATLF  361
              ++L  GKL V+L  A+  FA+L  +T  Y    +H++SSPL  +LV   +G+ VA+  
Sbjct  628  TFLLLGAGKLAVALSCAIATFAYLEKNTDDYGVGGDHELSSPLASILVALLLGWFVASTL  687

Query  360  FSVVEMSIDTIILSFCQDSEEHHGTAQF  277
              V EM+IDTI+L FC+D E +  +AQ+
Sbjct  688  LGVYEMAIDTILLCFCEDKELNKESAQY  715



>ref|XP_012011368.1| PREDICTED: choline transporter-like protein 5 isoform X3 [Ovis 
aries musimon]
Length=679

 Score = 97.4 bits (241),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 65/205 (32%), Positives = 108/205 (53%), Gaps = 23/205 (11%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIM----KSV  649
             GS++ + I+  R IL  + +RL+ + S    +         + CLR   W +    K +
Sbjct  478  FGSLILAIIQMFRLILEYLDKRLQKAQSNISKF--------LKCCLRCCFWCLEKAVKFL  529

Query  648  NRNAYIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAF  469
            NRNAY+M+AI GK+F K++  A  L++ N+L+I  ++ + D +L LGK+LV+    + AF
Sbjct  530  NRNAYVMMAIYGKNFCKSARDAFNLLMRNILKIAVMDRVTDFVLILGKILVAGCIGVLAF  589

Query  468  LMLDTH-----KYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDS  304
            L+         +  +S +    PL  V+V     Y++A  FFSV  M I+TI + FC+D 
Sbjct  590  LLFTERLPVIIEGPTSLNYYWVPLLTVIVG---SYIIAHGFFSVYAMCIETIFICFCEDL  646

Query  303  EEHHGTAQ---FAPPLLMETLDSQN  238
            E + G+ +   F  P L   L+ + 
Sbjct  647  ERNDGSTEKPYFITPTLHGILNKKQ  671



>ref|XP_010866084.1| PREDICTED: choline transporter-like protein 5-A isoform X1 [Esox 
lucius]
Length=584

 Score = 97.1 bits (240),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 60/189 (32%), Positives = 101/189 (53%), Gaps = 10/189 (5%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
             GS++ + ++  + IL  +  +LK +N+       +      + C   +   +K +NRNA
Sbjct  389  FGSLILAMVQMAQIILEYLDSKLKGANNIV----ARFLLCCFKCCFWCLERFIKFINRNA  444

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAI GK F  ++  A  L++ NV+R+  ++ + D +LFLGK+L++    + AF    
Sbjct  445  YIMIAIYGKGFCPSARDAFYLLMRNVVRVAVLDRVTDFLLFLGKMLIAGTVGVIAFFFF-  503

Query  456  THKYKSSNHKISS---PLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGT  286
            THK      ++ +    L P+L      Y++A  FFSV  M +DT+ L FC+D E + G+
Sbjct  504  THKIPIVQEEVPTLHYYLVPLLTVIAGSYLIAHGFFSVYTMCVDTLFLCFCEDLERNDGS  563

Query  285  AQFAPPLLM  259
             +   P LM
Sbjct  564  PE--KPFLM  570



>gb|ETN64441.1| ctl transporter [Anopheles darlingi]
Length=652

 Score = 97.1 bits (240),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 57/176 (32%), Positives = 93/176 (53%), Gaps = 10/176 (6%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS + + ++ +R +L    + L  S   P++      F   Q CLR     ++ + RNA
Sbjct  403  LGSFVIALVQFLRMML----KLLMHSVRNPQNRVTNCLFDCCQCCLRCFERFLQYLTRNA  458

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YI+ A+ G  F +A + A  L+ SN LR+  +N +GD +L L K+ V + +AL    ++ 
Sbjct  459  YILTAMHGDPFCRAGQHAFRLLTSNALRVVAINSVGDFVLVLAKVFVVVATALIGMELI-  517

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHG  289
              + K   H    P  P+++     Y+VA  F +V EM++DTI L FC+D E + G
Sbjct  518  --QRKPGLHH---PYVPLILVGIFAYLVAHCFMTVYEMTVDTIFLCFCEDCETNDG  568



>ref|XP_010866086.1| PREDICTED: choline transporter-like protein 5-A isoform X2 [Esox 
lucius]
Length=543

 Score = 96.7 bits (239),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 60/188 (32%), Positives = 101/188 (54%), Gaps = 10/188 (5%)
 Frame = -2

Query  813  GSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNAY  634
            GS++ + ++  + IL  +  +LK +N+       +      + C   +   +K +NRNAY
Sbjct  349  GSLILAMVQMAQIILEYLDSKLKGANNIV----ARFLLCCFKCCFWCLERFIKFINRNAY  404

Query  633  IMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLDT  454
            IMIAI GK F  ++  A  L++ NV+R+  ++ + D +LFLGK+L++    + AF    T
Sbjct  405  IMIAIYGKGFCPSARDAFYLLMRNVVRVAVLDRVTDFLLFLGKMLIAGTVGVIAFFFF-T  463

Query  453  HKYKSSNHKISS---PLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTA  283
            HK      ++ +    L P+L      Y++A  FFSV  M +DT+ L FC+D E + G+ 
Sbjct  464  HKIPIVQEEVPTLHYYLVPLLTVIAGSYLIAHGFFSVYTMCVDTLFLCFCEDLERNDGSP  523

Query  282  QFAPPLLM  259
            +   P LM
Sbjct  524  E--KPFLM  529



>ref|XP_004758232.1| PREDICTED: choline transporter-like protein 5 isoform X3 [Mustela 
putorius furo]
 ref|XP_004758233.1| PREDICTED: choline transporter-like protein 5 isoform X4 [Mustela 
putorius furo]
 ref|XP_004784931.1| PREDICTED: choline transporter-like protein 5 isoform X2 [Mustela 
putorius furo]
Length=718

 Score = 97.4 bits (241),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 63/189 (33%), Positives = 102/189 (54%), Gaps = 22/189 (12%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIM----KSV  649
             GS++ + ++  +FIL  + RRLK + +              Q CL+   W +    K  
Sbjct  519  FGSLILALVQMFKFILEYLDRRLKEAQNN--------VCKFLQCCLKCCFWCLERMVKFF  570

Query  648  NRNAYIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAF  469
            NRNAY+MIAI GK+F +++  A  L++ NVL++  ++ + D +L LGK+LV+    + AF
Sbjct  571  NRNAYVMIAIYGKNFCRSARDAFNLLMRNVLKVAVMDKVTDFVLILGKILVAGCIGVLAF  630

Query  468  LMLDTHKYKSSNHKISS------PLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQD  307
            L+  TH+  +     +S      PL  V++     Y+VA  FFSV  M IDTI + F +D
Sbjct  631  LLF-THRLPTMIEGPTSLNYYWVPLLTVIIG---SYLVAHGFFSVYAMCIDTIFICFLED  686

Query  306  SEEHHGTAQ  280
             E + G+ +
Sbjct  687  IERNDGSPE  695



>ref|XP_007432671.1| PREDICTED: choline transporter-like protein 5 [Python bivittatus]
Length=556

 Score = 96.7 bits (239),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 65/192 (34%), Positives = 102/192 (53%), Gaps = 16/192 (8%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
             GS++ + ++ IR IL  +  +LK S +       K      + C   +   +K +NRNA
Sbjct  355  FGSLILAVVQLIRVILEYLDHKLKGSQNAF----AKFLLCCLKCCFWCLEKFLKFINRNA  410

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAI GK+F  ++  A  L++ NV+R+  ++ + D +LFLGK+LV+    + AF    
Sbjct  411  YIMIAIYGKNFCTSARDAFFLLMRNVVRVAVLDKVTDFLLFLGKILVAGGVGVLAFFFF-  469

Query  456  THKYKSSNHKISS------PLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEH  295
            TH+  +   +  S      PL  V++     Y+VA  FFSV  M +DT+ L FC+D E +
Sbjct  470  THRIPAFTQEAPSLNYYWVPLLTVIIG---SYLVAHGFFSVYAMCVDTLFLCFCEDLERN  526

Query  294  HGTAQFAPPLLM  259
             G+   A P  M
Sbjct  527  DGST--AKPYYM  536



>ref|XP_005050755.1| PREDICTED: choline transporter-like protein 5, partial [Ficedula 
albicollis]
Length=662

 Score = 97.1 bits (240),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 65/196 (33%), Positives = 107/196 (55%), Gaps = 24/196 (12%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIM----KSV  649
             G+++ + ++ IR IL  +  +LK + ++   +          GCL+   W++    K V
Sbjct  460  FGALIIAIVQLIRVILEYLDHKLKGTQNSFTRF--------LLGCLKCCFWLLEKFLKFV  511

Query  648  NRNAYIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAF  469
            NRNAYIMIAI GK+F  +++ A  L++ NV+R+  ++ + D +LFLGK+LV+    + AF
Sbjct  512  NRNAYIMIAIYGKNFCTSAKDAFYLLMRNVVRVAVLDKVTDFLLFLGKILVAGGVGVLAF  571

Query  468  LMLDTHKYKSSNHKISS------PLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQD  307
                TH+    + ++        PL  V++     Y+VA  FFSV  M +DT+ L FC+D
Sbjct  572  FFF-THRIPVFSQEVPMLNYYWVPLLTVIIG---SYLVAHGFFSVYAMCVDTLFLCFCED  627

Query  306  SEEHHGTAQFAPPLLM  259
             E + G+   A P  M
Sbjct  628  LERNDGST--AKPYFM  641



>ref|XP_004071894.1| PREDICTED: choline transporter-like protein 2 isoform X3 [Oryzias 
latipes]
Length=706

 Score = 97.1 bits (240),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 61/201 (30%), Positives = 107/201 (53%), Gaps = 9/201 (4%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
             G+++ S ++ IR +L  +  +LK + +       K      + C   +  I+K +NRNA
Sbjct  507  FGALILSIVQLIRVLLEYLDHKLKGAQNKF----AKFLLCCLKCCFWCLEKIIKFLNRNA  562

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIM+AI GK+F  A++ A  L++ N++R+  ++ + D +LFLGKLLV  +  +FAF    
Sbjct  563  YIMVAIYGKNFCTAAKDAFFLLLRNMIRVAVLDKVTDFLLFLGKLLVVGLVGIFAFFFFS  622

Query  456  --THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTA  283
                 +  +   +     P+L      +++A+ FFSV  M +DT+ L F +D E + G+A
Sbjct  623  GRVKAFADTAPNLHYYWVPILTVAVGSFLIASGFFSVYSMCVDTLFLCFLEDLERNDGSA  682

Query  282  Q---FAPPLLMETLDSQNEMQ  229
            +     P  L + L+ +N  Q
Sbjct  683  EKPYLMPENLRKILNKKNTAQ  703



>ref|XP_004653796.1| PREDICTED: choline transporter-like protein 5 [Jaculus jaculus]
Length=740

 Score = 97.1 bits (240),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 66/208 (32%), Positives = 110/208 (53%), Gaps = 23/208 (11%)
 Frame = -2

Query  813  GSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIM----KSVN  646
            GS++ + I+  + IL  +  RLK + ++   +         Q CL+   W +    K +N
Sbjct  540  GSLILALIQMFKIILEYLDNRLKRAQNSLSKF--------IQCCLKCCFWCLEKMVKFLN  591

Query  645  RNAYIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFL  466
            RNAYIMIAI GK+F +++  A  L++ N++++   + +   IL LGKLLVS +  L AFL
Sbjct  592  RNAYIMIAIYGKNFCRSTRDAFHLLMRNIIKVAVTDEVTHFILLLGKLLVSGLIGLLAFL  651

Query  465  MLDTH-----KYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSE  301
            +         +  +S +    PL  V++     Y++A  FFSV  M ++TI + FC+D E
Sbjct  652  LFTQRLSVIVEGPTSLNYYWVPLLTVVL---GSYLIAHGFFSVYAMCVETIFICFCEDLE  708

Query  300  EHHGTAQ---FAPPLLMETLDSQNEMQR  226
             + G+A+   F  P L   L  + ++ R
Sbjct  709  RNDGSAEKPYFVTPNLHRILTLRRQLPR  736



>ref|XP_003770471.1| PREDICTED: choline transporter-like protein 5, partial [Sarcophilus 
harrisii]
Length=465

 Score = 95.5 bits (236),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 62/200 (31%), Positives = 104/200 (52%), Gaps = 8/200 (4%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ S ++ +R IL  + RRLK    +      K      + C   +   +K +NRN 
Sbjct  270  LGSLILSVVQFLRLILEYLDRRLKGKRHSC----AKFLLCCLKCCFWCLEKFLKFINRNT  325

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAI G++F  +++ A  L++ NV+R+  ++ + +  L+ GKLL+S    +  FL   
Sbjct  326  YIMIAIYGENFCASAKDAFMLVMRNVVRVAVLDKVTEFTLWTGKLLISAGIGILGFLFF-  384

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQ-  280
            T     S   ++    P+LV     Y++A  FFSV  M +DT+ L FC+D E + G+ + 
Sbjct  385  TKSLPFSAPTLNYYWIPLLVTIFGSYLIAHGFFSVFAMCVDTLFLCFCEDLERNDGSLER  444

Query  279  --FAPPLLMETLDSQNEMQR  226
              +  P L++ L  +   Q 
Sbjct  445  PYYMSPKLLQILGKKQVTQE  464



>gb|ELR57995.1| Choline transporter-like protein 5, partial [Bos mutus]
Length=703

 Score = 96.7 bits (239),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 64/205 (31%), Positives = 108/205 (53%), Gaps = 23/205 (11%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIM----KSV  649
             GS++ + I+  R IL  + +RL+ + S    +         + CLR   W +    K +
Sbjct  502  FGSLILAIIQMFRLILEYLDKRLQEAQSNISKF--------LKCCLRCCFWCLEKAVKFL  553

Query  648  NRNAYIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAF  469
            NRNAY+M+AI GK+F K++  A  L++ N+L+I  ++ + D +L LGK+LV+    + AF
Sbjct  554  NRNAYVMMAIYGKNFCKSARDAFNLLMRNILKIAVMDRVTDFVLILGKILVAGCIGVLAF  613

Query  468  LMLDTH-----KYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDS  304
            L+         +  +S +    PL  V++     Y++A  FFSV  M I+TI + FC+D 
Sbjct  614  LLFTERLPVIIEGPTSLNYYWVPLLTVIIG---SYIIAHGFFSVYAMCIETIFICFCEDL  670

Query  303  EEHHGTAQ---FAPPLLMETLDSQN  238
            E + G+ +   F  P L   L+ + 
Sbjct  671  ERNDGSTEKPYFITPTLHGILNKKQ  695



>ref|XP_004431638.1| PREDICTED: choline transporter-like protein 5 [Ceratotherium 
simum simum]
Length=715

 Score = 96.7 bits (239),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 65/205 (32%), Positives = 108/205 (53%), Gaps = 23/205 (11%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSV----  649
             GS++ + I+  R +L  +  RLK + +    +         Q CL+   W +++V    
Sbjct  514  FGSLILASIQMFRLVLQYLDNRLKEAQNNFSKF--------LQCCLKCCFWCLENVVKFL  565

Query  648  NRNAYIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAF  469
            NRNAY+MIAI GK+F K++  A  L++ NVL++  ++ + + +L LGK+LVS    + AF
Sbjct  566  NRNAYVMIAIYGKNFCKSARDAFNLLMRNVLKVAVMDRVTEFVLILGKILVSGSIGILAF  625

Query  468  LMLDTH-----KYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDS  304
            L+         +  +S +    PL  V++     Y++A  FFSV  M IDTI + FC+D 
Sbjct  626  LLFTQRIPMILEGPTSLNYYWVPLLTVIIG---SYLIAHGFFSVYSMCIDTIFICFCEDL  682

Query  303  EEHHGTAQ---FAPPLLMETLDSQN  238
            E + G+ +   F  P L   L+ + 
Sbjct  683  ERNDGSTEKPYFIAPTLHGILNKKQ  707



>gb|ERL89403.1| hypothetical protein D910_06771 [Dendroctonus ponderosae]
Length=264

 Score = 93.2 bits (230),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 64/203 (32%), Positives = 111/203 (55%), Gaps = 19/203 (9%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTS-QGCLRGVSW----IMKS  652
             GS++ +    IR +L  + ++LK  ++         AF  +   CL+   W     +K 
Sbjct  67   FGSLIIAICRMIRVMLEYVDKKLKKYDN---------AFTRAILCCLKCFFWCLEKFLKF  117

Query  651  VNRNAYIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFA  472
            +N+NAYIM AI GK+F  +++ A  L+++N++R+  ++ + D + FL KLLV+      A
Sbjct  118  INKNAYIMCAIHGKNFCASAKDAFTLLLNNIVRVFVLDKVTDFLFFLSKLLVTFGVGAIA  177

Query  471  FLMLDTHKYKS--SNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEE  298
            ++   T  Y S   N +I   L PV+      Y++ATLFF+V  M++DT+ L F +DSE+
Sbjct  178  YVFFVTD-YISFVDNSEIQYGLAPVVAIMIATYLIATLFFNVYSMAVDTLFLCFLEDSEK  236

Query  297  HHGTAQ--FAPPLLMETLDSQNE  235
            ++G  +  +    LM  L  +N+
Sbjct  237  NNGKDRPYYMSRNLMRILGKRNK  259



>ref|XP_010873286.1| PREDICTED: choline transporter-like protein 2 isoform X2 [Esox 
lucius]
Length=705

 Score = 96.3 bits (238),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 63/194 (32%), Positives = 107/194 (55%), Gaps = 15/194 (8%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
             GS++ S ++ IR +L  I  +L+ + +       K      + C   V   +K +NRNA
Sbjct  506  FGSLILSIVQIIRVLLEYIDHKLQGTQNKIT----KFLLCCLKCCFWCVEKFIKFLNRNA  561

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIM+AI GK+F  ++  A  L++ N++R+  ++ + D +LFLGKLL+  +  +FAF    
Sbjct  562  YIMVAIYGKNFCTSARDAFFLLMRNMIRVAVLDKVTDFLLFLGKLLIVGIVGIFAFFFF-  620

Query  456  THKYKSSNHKISS------PLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEH  295
            + K K+  +   +      P+  V+VC    Y++A  FFSV  M +DT+ L F +D E +
Sbjct  621  SGKVKAFENTAPTLNYYWVPILTVMVC---SYLIAHGFFSVYAMCVDTLFLCFLEDLERN  677

Query  294  HGTAQFAPPLLMET  253
             G+A+  P L+ E+
Sbjct  678  DGSAE-RPYLMSES  690



>ref|XP_005165807.1| PREDICTED: choline transporter-like protein 2 isoform X3 [Danio 
rerio]
Length=717

 Score = 96.3 bits (238),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 63/206 (31%), Positives = 108/206 (52%), Gaps = 11/206 (5%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
             GS++ + ++ IR +L  + ++LK + +       K      + C   +   +K +NRNA
Sbjct  509  FGSLILAIVQVIRVVLEYLDQKLKGAQNKF----AKFLLSCLKCCFWCLEKFIKFINRNA  564

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIM+AI GK+F  ++  A  L++ N++R+  ++ + D +LFLGKLL+  +  + +F    
Sbjct  565  YIMVAIYGKNFCTSARDAFFLLMRNIVRVAVLDKVTDFLLFLGKLLIVGIVGICSFFFF-  623

Query  456  THKYKSSNH---KISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGT  286
            T K K +      ++    P+L      Y++A  FFSV  M +DT+ L F +D E + GT
Sbjct  624  TGKIKIAQDVTPALNYYWVPILTVVFGAYLIAHGFFSVYAMCVDTLFLCFLEDLERNDGT  683

Query  285  AQ---FAPPLLMETLDSQNEMQRLTQ  217
                 F P  LM TL   N+   +T+
Sbjct  684  VDRPYFMPERLMATLKKSNQSPGVTR  709



>ref|XP_010873284.1| PREDICTED: choline transporter-like protein 2 isoform X1 [Esox 
lucius]
Length=707

 Score = 96.3 bits (238),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 63/194 (32%), Positives = 107/194 (55%), Gaps = 15/194 (8%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
             GS++ S ++ IR +L  I  +L+ + +       K      + C   V   +K +NRNA
Sbjct  508  FGSLILSIVQIIRVLLEYIDHKLQGTQNKIT----KFLLCCLKCCFWCVEKFIKFLNRNA  563

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIM+AI GK+F  ++  A  L++ N++R+  ++ + D +LFLGKLL+  +  +FAF    
Sbjct  564  YIMVAIYGKNFCTSARDAFFLLMRNMIRVAVLDKVTDFLLFLGKLLIVGIVGIFAFFFF-  622

Query  456  THKYKSSNHKISS------PLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEH  295
            + K K+  +   +      P+  V+VC    Y++A  FFSV  M +DT+ L F +D E +
Sbjct  623  SGKVKAFENTAPTLNYYWVPILTVMVC---SYLIAHGFFSVYAMCVDTLFLCFLEDLERN  679

Query  294  HGTAQFAPPLLMET  253
             G+A+  P L+ E+
Sbjct  680  DGSAE-RPYLMSES  692



>ref|XP_009971631.1| PREDICTED: choline transporter-like protein 5, partial [Tyto 
alba]
Length=209

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 64/193 (33%), Positives = 103/193 (53%), Gaps = 18/193 (9%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLK-TSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRN  640
             G+++ + ++ IR IL  +  +LK T NS       +      + C   +   +K +NRN
Sbjct  8    FGALILAIVQLIRVILEYLDHKLKGTQNSFT-----RFLLCCLKCCFWCLEKFLKFINRN  62

Query  639  AYIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLML  460
            AYIMIAI GK+F  +++ A  L++ NV+R+  ++ + D +LFLGK+LV+    + AF   
Sbjct  63   AYIMIAIYGKNFCTSAKEAFFLLMRNVVRVAVLDKVTDFLLFLGKILVAGGVGVLAFFFF  122

Query  459  DTHKYKSSNHKISS------PLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEE  298
             T +     H+  +      PL  V++     Y+VA  FFSV  M +DT+ L FC+D E 
Sbjct  123  -TQRIPFFAHEAPTLNYYWVPLLTVIIG---SYLVAHGFFSVYAMCVDTLFLCFCEDLER  178

Query  297  HHGTAQFAPPLLM  259
            + G+   A P  M
Sbjct  179  NDGST--AKPYFM  189



>ref|XP_008328913.1| PREDICTED: LOW QUALITY PROTEIN: choline transporter-like protein 
2 [Cynoglossus semilaevis]
Length=700

 Score = 95.9 bits (237),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 60/201 (30%), Positives = 108/201 (54%), Gaps = 9/201 (4%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
             GS++ S ++ IR +L  +  +LK +++       +      + C   +   +K +NRNA
Sbjct  501  FGSLILSLVQIIRVLLEYLDHKLKGAHNKCT----RFLLCCLKCCFWCLEKFIKFLNRNA  556

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIM+AI GK+F  +++ A  L++ N++R+  ++ + D +LFLGKLLV  +  +FAF    
Sbjct  557  YIMVAIHGKNFCSSAKDAFFLLMRNMIRVAVLDKVTDFLLFLGKLLVVGLVGVFAFFFFS  616

Query  456  --THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTA  283
                 ++ +   +     P+L      Y++A  FFSV  M +DT+ L F +D E + G+A
Sbjct  617  GRVKAFEDTAPHLHYYWVPILTVVIGSYLIANGFFSVYAMCVDTLFLCFLEDLERNDGSA  676

Query  282  Q---FAPPLLMETLDSQNEMQ  229
            +     P  L + L+ +N+ Q
Sbjct  677  ERPYLMPENLRKILNKKNKSQ  697



>ref|XP_006069767.1| PREDICTED: choline transporter-like protein 5 [Bubalus bubalis]
Length=703

 Score = 95.9 bits (237),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 63/205 (31%), Positives = 110/205 (54%), Gaps = 23/205 (11%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIM----KSV  649
             GS++ + I+  R IL  + +RL+ + S    +         + CLR   W +    K +
Sbjct  504  FGSLILAIIQMFRLILEYLDKRLQEAQSNISKF--------LKCCLRCCFWCLEKAVKFL  555

Query  648  NRNAYIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAF  469
            NRNAY+M+AI GK+F K++  A  L++ N+L+I  ++ + D +L LGK+LV+    + AF
Sbjct  556  NRNAYVMMAIYGKNFCKSARDAFNLLMRNILKIAVMDRVTDFVLILGKILVAGCIGVLAF  615

Query  468  LMLDTH-----KYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDS  304
            L+         +  +S +    PL  V++     Y++A  FFSV  M I+TI + F +D 
Sbjct  616  LLFTERLPVIIEGPTSLNYYWVPLLTVII---GSYIIAHGFFSVYAMCIETIFICFLEDL  672

Query  303  EEHHGTAQ---FAPPLLMETLDSQN  238
            E + G+A+   +    LM+ ++ +N
Sbjct  673  ERNDGSAEKPYYMSQCLMKIMNKRN  697



>ref|XP_008878156.1| hypothetical protein H310_12745 [Aphanomyces invadans]
 gb|ETV93134.1| hypothetical protein H310_12745 [Aphanomyces invadans]
Length=666

 Score = 95.9 bits (237),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 88/141 (62%), Gaps = 9/141 (6%)
 Frame = -2

Query  684  CLRGVSWIM----KSVNRNAYIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVIL  517
            C R   W +    K ++RN YI+IA+ G SF  A   A EL+ +N+LRIG ++++   ++
Sbjct  496  CCRACLWCLHKFVKFLSRNGYIVIAMKGSSFCVAIVDAFELVSANLLRIGTLSIVSTFVM  555

Query  516  FLGKLLVSLVSALFAFLMLDTHKYKSSNHKISSPLFPVLVCWGI-GYVVATLFFSVVEMS  340
            F+GK+L++ V  L  F   D   Y+   H +SSP FP LV   +  Y +A+LFFSV E++
Sbjct  556  FMGKMLIAAVCTLLVF--WDITDYEVDLH-LSSP-FPTLVITAVLAYSIASLFFSVFEIA  611

Query  339  IDTIILSFCQDSEEHHGTAQF  277
            IDT++LS C+D + +  TA++
Sbjct  612  IDTVLLSICEDEKLNRTTAKY  632



>ref|XP_001430596.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK63198.1| unnamed protein product [Paramecium tetraurelia]
Length=307

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 84/140 (60%), Gaps = 8/140 (6%)
 Frame = -2

Query  651  VNRNAYIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFA  472
            +N+NAYI IA+T KSF  A++ A E I +N +R   V+ IG +  F+GKL V   + LF+
Sbjct  166  LNKNAYIQIALTSKSFCPAAKDAFESIWANTMRYSLVSGIGSIFTFIGKLFVGFATVLFS  225

Query  471  F-LMLDTHKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSE--  301
            + + ++   YK+    ++SP+ P +VC+ I Y+VA LF S+ +M+ D ++  F  D E  
Sbjct  226  YEIFINVEPYKT---DLASPIVPSIVCFIIAYMVAILFMSIYQMACDAVLTCFIYDEELN  282

Query  300  EHHG--TAQFAPPLLMETLD  247
            + +G  +AQ  P  L E  D
Sbjct  283  KQNGGMSAQHCPETLREWFD  302



>ref|XP_008112316.1| PREDICTED: choline transporter-like protein 5 isoform X3 [Anolis 
carolinensis]
Length=710

 Score = 95.9 bits (237),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 69/209 (33%), Positives = 109/209 (52%), Gaps = 18/209 (9%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
             GS++ + ++ IR IL  +  +LK S +       K      + C   +   +K +NRNA
Sbjct  511  FGSLILAIVQLIRVILEYLDHKLKGSQNAF----AKFLLCCLKCCFWCLEKFLKFINRNA  566

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAI GK+F  ++  A  L++ NV+R+  ++ + D +LFLGK+LV+    + AF    
Sbjct  567  YIMIAIYGKNFCASAREAFFLLMRNVVRVAVLDKVTDFLLFLGKILVAGGVGVLAFFFF-  625

Query  456  THKYKSSNHKISS------PLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEH  295
            TH+     H+  S      PL  V++     Y+VA  FFSV  M +DT+ L F +D E H
Sbjct  626  THRIPIFTHEAPSLNYYWVPLLTVIIG---SYLVAHGFFSVYAMCVDTLFLCFLEDLESH  682

Query  294  HGTAQ---FAPPLLMETLDSQNEMQRLTQ  217
             G+     +    L++ L+ +N MQ   Q
Sbjct  683  DGSPARPYYMSKSLLKILNKKN-MQTKKQ  710



>ref|XP_008102018.1| PREDICTED: choline transporter-like protein 2 isoform X1 [Anolis 
carolinensis]
Length=720

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 65/196 (33%), Positives = 103/196 (53%), Gaps = 13/196 (7%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
             GS++ + ++ IR IL  +  RLK +++       K      + C   +   +K +NRNA
Sbjct  516  FGSLILAIVQVIRVILEYLDHRLKAADNKF----AKFLLVCLKCCFWCLEKFIKFLNRNA  571

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAI G +F  ++  A  L++ N++R+  ++ + D +LFLGKLL+     + AF    
Sbjct  572  YIMIAIYGTNFCTSARNAFFLLMRNIIRVAVLDKVTDFLLFLGKLLIVGSVGILAFFFF-  630

Query  456  THKYKSSNHKISSPL----FPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHG  289
            THK K      + PL     P+L      Y++A  FFSV  M +DT+ L FC+D E + G
Sbjct  631  THKIKVI-QDTAPPLNYYWVPILTVIVGSYLIAHGFFSVYAMCVDTLFLCFCEDLERNDG  689

Query  288  TAQ---FAPPLLMETL  250
            + +   +  P L E L
Sbjct  690  SPERPYYMSPELREIL  705



>ref|XP_007062625.1| PREDICTED: choline transporter-like protein 5 isoform X1 [Chelonia 
mydas]
Length=590

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 64/190 (34%), Positives = 102/190 (54%), Gaps = 12/190 (6%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLK-TSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRN  640
             GS++ + ++ IR IL  +  +LK T NS       +      + C   +   +K +NRN
Sbjct  389  FGSLILAIVQLIRIILEYLDHKLKGTQNSCT-----RFLLCCLKCCFWCLEKFIKFINRN  443

Query  639  AYIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLML  460
            AYIMIAI GK+F  +++ A  L++ NV+R+  ++ + D +LFLGKLLV+    + AF   
Sbjct  444  AYIMIAIYGKNFCTSAKEAFFLLMRNVVRVAVLDKVTDFLLFLGKLLVAGGVGVLAFFFF  503

Query  459  DTHK---YKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHG  289
             TH+   +      ++    P+L      Y++A  FFSV  M +DT+ L FC+D E + G
Sbjct  504  -THRIPVFTQETPTLNYYWVPLLTVIIGSYLIAHGFFSVYAMCVDTLFLCFCEDLERNDG  562

Query  288  TAQFAPPLLM  259
            +   A P  M
Sbjct  563  ST--AKPYYM  570



>ref|XP_010793741.1| PREDICTED: LOW QUALITY PROTEIN: choline transporter-like protein 
5 [Notothenia coriiceps]
Length=554

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 64/188 (34%), Positives = 104/188 (55%), Gaps = 15/188 (8%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
             GS++ + ++ IR +L  +  +LK S    E+   +      Q C   +   ++ +NRNA
Sbjct  352  FGSLILAVVQTIRMVLEYVNTKLKGS----ENACARFLLCCLQCCFWCLENFIRFMNRNA  407

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAI GK+F  +S+ A  L++ N++R+  ++ + D +LFLGKLL+S    + AF    
Sbjct  408  YIMIAIYGKNFCTSSKDAFFLLMRNIIRVAVLDKVTDFLLFLGKLLISGSVGVLAFFFF-  466

Query  456  THKYKSSNHKISS------PLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEH  295
            T K      ++ S      PL  V V +G  Y++A  FF+V  M +DT+ L FC+D E +
Sbjct  467  TRKIPVIQEEVPSLNYYWVPL--VTVIFG-SYMIAHGFFNVYAMCVDTLFLCFCEDLERN  523

Query  294  HGTAQFAP  271
             G++ F P
Sbjct  524  DGSS-FRP  530



>ref|XP_008102019.1| PREDICTED: choline transporter-like protein 2 isoform X3 [Anolis 
carolinensis]
Length=715

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 65/196 (33%), Positives = 103/196 (53%), Gaps = 13/196 (7%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
             GS++ + ++ IR IL  +  RLK +++       K      + C   +   +K +NRNA
Sbjct  511  FGSLILAIVQVIRVILEYLDHRLKAADNKF----AKFLLVCLKCCFWCLEKFIKFLNRNA  566

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAI G +F  ++  A  L++ N++R+  ++ + D +LFLGKLL+     + AF    
Sbjct  567  YIMIAIYGTNFCTSARNAFFLLMRNIIRVAVLDKVTDFLLFLGKLLIVGSVGILAFFFF-  625

Query  456  THKYKSSNHKISSPL----FPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHG  289
            THK K      + PL     P+L      Y++A  FFSV  M +DT+ L FC+D E + G
Sbjct  626  THKIKVI-QDTAPPLNYYWVPILTVIVGSYLIAHGFFSVYAMCVDTLFLCFCEDLERNDG  684

Query  288  TAQ---FAPPLLMETL  250
            + +   +  P L E L
Sbjct  685  SPERPYYMSPELREIL  700



>ref|XP_006269016.1| PREDICTED: choline transporter-like protein 5 isoform X2 [Alligator 
mississippiensis]
Length=713

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 68/208 (33%), Positives = 112/208 (54%), Gaps = 20/208 (10%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLK-TSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRN  640
             GS++ + ++ IR IL  +  +LK T NS       +      + C   +   +K +NRN
Sbjct  514  FGSLILAIVQLIRIILEYLDHKLKGTQNSFT-----RFLLCCLKCCFWCLEKFLKFINRN  568

Query  639  AYIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLML  460
            AYIMIAI GK+F  +++ A  L++ NV+R+  ++ + D +LFLGK+LV+    + AF   
Sbjct  569  AYIMIAIYGKNFCASAKEAFFLLMRNVVRVAVLDKVTDFLLFLGKILVAGGVGVLAFFFF  628

Query  459  DTHKYKSSNHKISS------PLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEE  298
             TH+ +    +  +      PL  V++     Y+VA  FFSV  M +DT+ L F +D E 
Sbjct  629  -THRIQVFTQEAPTLNYYWVPLLTVIIG---SYLVAHGFFSVYAMCVDTLFLCFLEDLER  684

Query  297  HHGTAQ---FAPPLLMETLDSQN-EMQR  226
            H G+ +   +    L++ L+ QN E +R
Sbjct  685  HDGSPERRYYMNKSLLKILNKQNVETKR  712



>ref|XP_004482970.1| PREDICTED: choline transporter-like protein 5 isoform 2 [Dasypus 
novemcinctus]
Length=712

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 64/203 (32%), Positives = 108/203 (53%), Gaps = 19/203 (9%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSW----IMKSV  649
             GS++ + ++  R +L  + R LK +        G +A    Q CL+   W    ++K +
Sbjct  513  FGSLILALVQMFRIVLEYVDRHLKDAK-------GSLA-KFIQFCLQCCFWCLEKLLKFL  564

Query  648  NRNAYIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAF  469
            NRNAYIM+AI GK+F K++  A  L++ NV+++  ++ + D +LFLGK+LV+    + AF
Sbjct  565  NRNAYIMVAIYGKNFCKSARDAFNLLMRNVIKVAVMDRVTDFVLFLGKILVAGSIGILAF  624

Query  468  LMLDTHKYK---SSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEE  298
            L   T K          ++    P+L      Y+VA  FFSV  M +DT+ + F +D E 
Sbjct  625  LFF-TQKVPMIVKGPTTLNYYWVPLLTVIAGSYIVAHGFFSVYAMCVDTLFICFLEDIER  683

Query  297  HHGTAQ---FAPPLLMETLDSQN  238
            + G+ +   +    L++ L+ QN
Sbjct  684  NDGSTERPYYMNQTLLKILNKQN  706



>gb|KFM79681.1| hypothetical protein X975_14148, partial [Stegodyphus mimosarum]
Length=704

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 63/204 (31%), Positives = 115/204 (56%), Gaps = 10/204 (5%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
             GS+L + +  IR +L  I ++LK  ++       K      + C   +  +++ +++NA
Sbjct  500  FGSLLIATVRMIRVMLEYIDQKLKKYDNKLT----KAILCCMKCCFWLLEKVLRFISKNA  555

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAF-LML  460
            YIMIAI GK+F  ++  A  L++ N++R+  ++ I D +LF+GKL V   +A+ +F + +
Sbjct  556  YIMIAIYGKNFCTSARKAFMLLMRNIVRVVVLDKITDFLLFMGKLAVVSFAAVGSFYVFV  615

Query  459  DTHK-YKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTA  283
              HK YKS        + P+ + +G  Y++A+ FFSV  M++DT+ L F +D E + GT 
Sbjct  616  SEHKIYKSGPSLHYDLIPPIFITFG-AYIIASGFFSVYGMAVDTLFLCFLEDCERNDGTP  674

Query  282  Q---FAPPLLMETLDSQNEMQRLT  220
            +   +    LM+ L  +N+ + +T
Sbjct  675  EKPYYMSKELMKILGKKNKFREIT  698



>ref|XP_006733648.1| PREDICTED: choline transporter-like protein 5 [Leptonychotes 
weddellii]
Length=683

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 62/189 (33%), Positives = 103/189 (54%), Gaps = 22/189 (12%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSV----  649
             GS++ + I+  + +L  +  RLK + +    +         Q CL+   W ++ V    
Sbjct  484  FGSLILALIQMFKLVLEYLDHRLKEAQNNISKF--------LQCCLKCCFWCLEKVVKFF  535

Query  648  NRNAYIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAF  469
            NRNAY+MIAI GK+F +++  A  L++ NVL++  ++ + D +L LGK+LV+    + AF
Sbjct  536  NRNAYVMIAIYGKNFCRSARDAFNLLMRNVLKVAVMDKVTDFVLILGKILVAGCIGVLAF  595

Query  468  LMLDTHKYKSSNHKISS------PLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQD  307
            L+  TH+  +     +S      PL  V++     Y+VA  FFSV  M IDTI + F +D
Sbjct  596  LLF-THRLPTMIEGPTSLNYYWVPLLTVIIG---SYLVAHGFFSVYAMCIDTIFICFLED  651

Query  306  SEEHHGTAQ  280
             E + G+A+
Sbjct  652  IERNDGSAE  660



>ref|XP_004482969.1| PREDICTED: choline transporter-like protein 5 isoform 1 [Dasypus 
novemcinctus]
Length=725

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 64/203 (32%), Positives = 108/203 (53%), Gaps = 19/203 (9%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSW----IMKSV  649
             GS++ + ++  R +L  + R LK +        G +A    Q CL+   W    ++K +
Sbjct  526  FGSLILALVQMFRIVLEYVDRHLKDAK-------GSLA-KFIQFCLQCCFWCLEKLLKFL  577

Query  648  NRNAYIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAF  469
            NRNAYIM+AI GK+F K++  A  L++ NV+++  ++ + D +LFLGK+LV+    + AF
Sbjct  578  NRNAYIMVAIYGKNFCKSARDAFNLLMRNVIKVAVMDRVTDFVLFLGKILVAGSIGILAF  637

Query  468  LMLDTHKYK---SSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEE  298
            L   T K          ++    P+L      Y+VA  FFSV  M +DT+ + F +D E 
Sbjct  638  LFF-TQKVPMIVKGPTTLNYYWVPLLTVIAGSYIVAHGFFSVYAMCVDTLFICFLEDIER  696

Query  297  HHGTAQ---FAPPLLMETLDSQN  238
            + G+ +   +    L++ L+ QN
Sbjct  697  NDGSTERPYYMNQTLLKILNKQN  719



>ref|XP_012011370.1| PREDICTED: choline transporter-like protein 5 isoform X5 [Ovis 
aries musimon]
Length=677

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 64/205 (31%), Positives = 110/205 (54%), Gaps = 23/205 (11%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIM----KSV  649
             GS++ + I+  R IL  + +RL+ + S    +         + CLR   W +    K +
Sbjct  478  FGSLILAIIQMFRLILEYLDKRLQKAQSNISKF--------LKCCLRCCFWCLEKAVKFL  529

Query  648  NRNAYIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAF  469
            NRNAY+M+AI GK+F K++  A  L++ N+L+I  ++ + D +L LGK+LV+    + AF
Sbjct  530  NRNAYVMMAIYGKNFCKSARDAFNLLMRNILKIAVMDRVTDFVLILGKILVAGCIGVLAF  589

Query  468  LMLDTH-----KYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDS  304
            L+         +  +S +    PL  V+V     Y++A  FFSV  M I+TI + F +D 
Sbjct  590  LLFTERLPVIIEGPTSLNYYWVPLLTVIVG---SYIIAHGFFSVYAMCIETIFICFLEDL  646

Query  303  EEHHGTAQ---FAPPLLMETLDSQN  238
            E + G+A+   +    LM+ ++ +N
Sbjct  647  ERNDGSAEKPYYMSQSLMKIMNRRN  671



>ref|XP_009944736.1| PREDICTED: choline transporter-like protein 5, partial [Leptosomus 
discolor]
 ref|XP_010164275.1| PREDICTED: choline transporter-like protein 5, partial [Caprimulgus 
carolinensis]
Length=209

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/189 (32%), Positives = 99/189 (52%), Gaps = 10/189 (5%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLK-TSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRN  640
             G+++ + ++ IR IL  +  +LK T NS       +      + C   +   +K +NRN
Sbjct  8    FGALILAIVQLIRVILEYLDHKLKGTQNSFT-----RFLLCCLKCCFWCLEKFLKFINRN  62

Query  639  AYIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLML  460
            AYIMIAI GK+F  +++ A  L++ NV+R+  ++ + D +LFLGK+LV+    + AF   
Sbjct  63   AYIMIAIYGKNFCTSAKEAFFLLMRNVVRVAVLDKVTDFLLFLGKILVAGGVGVLAFFFF  122

Query  459  DTH--KYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGT  286
                  +      ++    P+L      Y+VA  FFSV  M +DT+ L FC+D E + G+
Sbjct  123  TQRIPVFAQEAPTLNYYWVPLLTVIIGSYLVAHGFFSVYAMCVDTLFLCFCEDLERNDGS  182

Query  285  AQFAPPLLM  259
               A P  M
Sbjct  183  T--AKPYFM  189



>ref|XP_011476896.1| PREDICTED: choline transporter-like protein 2 isoform X1 [Oryzias 
latipes]
Length=722

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 59/190 (31%), Positives = 102/190 (54%), Gaps = 8/190 (4%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
             G+++ S ++ IR +L  +  +LK + +       K      + C   +  I+K +NRNA
Sbjct  507  FGALILSIVQLIRVLLEYLDHKLKGAQNKF----AKFLLCCLKCCFWCLEKIIKFLNRNA  562

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIM+AI GK+F  A++ A  L++ N++R+  ++ + D +LFLGKLLV  +  +FAF    
Sbjct  563  YIMVAIYGKNFCTAAKDAFFLLLRNMIRVAVLDKVTDFLLFLGKLLVVGLVGIFAFFFFS  622

Query  456  --THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTA  283
                 +  +   +     P+L      +++A+ FFSV  M +DT+ L FC+D E + G+ 
Sbjct  623  GRVKAFADTAPNLHYYWVPILTVAVGSFLIASGFFSVYSMCVDTLFLCFCEDLERNDGSP  682

Query  282  QFAPPLLMET  253
              A P  M +
Sbjct  683  --ARPYYMSS  690



>ref|XP_006130470.1| PREDICTED: choline transporter-like protein 5 isoform X2 [Pelodiscus 
sinensis]
Length=713

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 67/205 (33%), Positives = 110/205 (54%), Gaps = 14/205 (7%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLK-TSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRN  640
             GS++ + ++ IR IL  +  +LK T NS       +      + C   +   +K +NRN
Sbjct  514  FGSLILAIVQLIRIILEYLDHKLKGTQNSFT-----RFLLCCLKCCFWCLEKFIKFINRN  568

Query  639  AYIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLML  460
            AYIMIAI GK+F  +++ A  L++ NV+R+  ++ + D +LFLGKLLV+    + AF   
Sbjct  569  AYIMIAIYGKNFCTSAKEAFFLLMRNVVRVAVLDKVTDFLLFLGKLLVAGGVGVLAFFFF  628

Query  459  DTHK---YKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHG  289
             TH+   +      ++    P+L      Y++A  FFSV  M +DT+ L F +D E H G
Sbjct  629  -THRIPVFTQEAPTLNYYWVPLLTVIIGSYLIAHGFFSVYAMCVDTLFLCFLEDLERHDG  687

Query  288  TAQ---FAPPLLMETLDSQN-EMQR  226
            + +   +    L++ L+ QN E +R
Sbjct  688  SPEKPYYMSKSLLKILNKQNVETKR  712



>ref|XP_005622113.1| PREDICTED: solute carrier family 44, member 5 isoform X1 [Canis 
lupus familiaris]
 ref|XP_005622114.1| PREDICTED: solute carrier family 44, member 5 isoform X2 [Canis 
lupus familiaris]
Length=720

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 63/188 (34%), Positives = 103/188 (55%), Gaps = 20/188 (11%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSV----  649
             GS+L + I+  + +L  + RRLK     P++   K      Q CL+   W +++V    
Sbjct  521  FGSLLLALIQMFKIVLEYLDRRLKD----PQNNISKFL----QCCLKCCFWCLENVIKYF  572

Query  648  NRNAYIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAF  469
            NRNAY+MIAI GK+F +++  A  L++ N+L+I  ++ + D +L LGK+LV+    + AF
Sbjct  573  NRNAYVMIAIYGKNFCRSARDAFNLLMRNILKIAVMDKVTDFVLILGKILVAGCIGMLAF  632

Query  468  LMLDTH-----KYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDS  304
            L+         +  +S +    PL  V++     Y+VA  FFSV  M IDTI + F +D 
Sbjct  633  LLFTQRLPTIIEGPTSLNYYWVPLLTVIIG---SYLVAHGFFSVYAMCIDTIFICFLEDL  689

Query  303  EEHHGTAQ  280
            E + G+ +
Sbjct  690  ERNDGSTE  697



>ref|XP_011476897.1| PREDICTED: choline transporter-like protein 2 isoform X2 [Oryzias 
latipes]
Length=714

 Score = 95.1 bits (235),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 59/190 (31%), Positives = 102/190 (54%), Gaps = 8/190 (4%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
             G+++ S ++ IR +L  +  +LK + +       K      + C   +  I+K +NRNA
Sbjct  499  FGALILSIVQLIRVLLEYLDHKLKGAQNKF----AKFLLCCLKCCFWCLEKIIKFLNRNA  554

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIM+AI GK+F  A++ A  L++ N++R+  ++ + D +LFLGKLLV  +  +FAF    
Sbjct  555  YIMVAIYGKNFCTAAKDAFFLLLRNMIRVAVLDKVTDFLLFLGKLLVVGLVGIFAFFFFS  614

Query  456  --THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTA  283
                 +  +   +     P+L      +++A+ FFSV  M +DT+ L FC+D E + G+ 
Sbjct  615  GRVKAFADTAPNLHYYWVPILTVAVGSFLIASGFFSVYSMCVDTLFLCFCEDLERNDGSP  674

Query  282  QFAPPLLMET  253
              A P  M +
Sbjct  675  --ARPYYMSS  682



>ref|XP_001434380.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK66983.1| unnamed protein product [Paramecium tetraurelia]
Length=635

 Score = 94.7 bits (234),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/141 (38%), Positives = 85/141 (60%), Gaps = 8/141 (6%)
 Frame = -2

Query  651  VNRNAYIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFA  472
            +N+NAYI IA+T KSF  A++ A E I +N +R   V+ IG +  F+GKL V   + LF+
Sbjct  494  LNKNAYIQIALTSKSFCPAAKDAFESIWANTMRYSLVSGIGSIFTFIGKLFVGFATVLFS  553

Query  471  F-LMLDTHKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSE--  301
            + + ++   YK+    ++SP+ P +VC+ I Y+VA LF S+ +M+ D ++  F  D E  
Sbjct  554  YEIFINVEPYKT---DLASPIVPSIVCFIIAYMVAILFMSIYQMACDAVLTCFIYDEELN  610

Query  300  EHHG--TAQFAPPLLMETLDS  244
            + +G  +AQ  P  L E  DS
Sbjct  611  KQNGGMSAQHCPETLREWFDS  631



>ref|XP_005622115.1| PREDICTED: solute carrier family 44, member 5 isoform X3 [Canis 
lupus familiaris]
Length=705

 Score = 95.1 bits (235),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 63/188 (34%), Positives = 103/188 (55%), Gaps = 20/188 (11%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSV----  649
             GS+L + I+  + +L  + RRLK     P++   K      Q CL+   W +++V    
Sbjct  506  FGSLLLALIQMFKIVLEYLDRRLKD----PQNNISKFL----QCCLKCCFWCLENVIKYF  557

Query  648  NRNAYIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAF  469
            NRNAY+MIAI GK+F +++  A  L++ N+L+I  ++ + D +L LGK+LV+    + AF
Sbjct  558  NRNAYVMIAIYGKNFCRSARDAFNLLMRNILKIAVMDKVTDFVLILGKILVAGCIGMLAF  617

Query  468  LMLDTH-----KYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDS  304
            L+         +  +S +    PL  V++     Y+VA  FFSV  M IDTI + F +D 
Sbjct  618  LLFTQRLPTIIEGPTSLNYYWVPLLTVIIG---SYLVAHGFFSVYAMCIDTIFICFLEDL  674

Query  303  EEHHGTAQ  280
            E + G+ +
Sbjct  675  ERNDGSTE  682



>dbj|GAM17171.1| hypothetical protein SAMD00019534_003460 [Acytostelium subglobosum 
LB1]
Length=485

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 61/188 (32%), Positives = 106/188 (56%), Gaps = 28/188 (15%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFH-----TSQGCLRGV-SWIMK  655
            LGS++ + ++ IR++L  + ++ K          GK AF      +   C+ G     +K
Sbjct  296  LGSMILAIVQFIRWMLRLLEKKFK----------GKEAFLARFVVSCLNCIFGCFERFIK  345

Query  654  SVNRNAYIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVS---  484
             +++NAYIMIAI G SF K +     LI+SNVLR+  V VI   ILFLG++ +++++   
Sbjct  346  FLDKNAYIMIAIYGYSFCKGARRGFSLIVSNVLRVAAVGVISSFILFLGRVFITVLTVGA  405

Query  483  ALFAFLMLDTHKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDS  304
            +L+ F+ +D   +  +         PV++   I + ++  F SV +M+IDT++L FC+D 
Sbjct  406  SLYLFMEVDHDGFYIA---------PVILIGFIAFFISGGFMSVYDMAIDTMLLCFCEDC  456

Query  303  EEHHGTAQ  280
            E + G+A+
Sbjct  457  ERNDGSAE  464



>ref|XP_005976302.1| PREDICTED: choline transporter-like protein 5 [Pantholops hodgsonii]
Length=717

 Score = 95.1 bits (235),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 64/205 (31%), Positives = 110/205 (54%), Gaps = 23/205 (11%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIM----KSV  649
             GS++ + I+  R IL  + +RL+ + S    +         + CLR   W +    K +
Sbjct  518  FGSLILAIIQMFRLILEYLDKRLQKAQSNISKF--------LKCCLRCCFWCLEKAVKFL  569

Query  648  NRNAYIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAF  469
            NRNAY+M+AI GK+F K++  A  L++ N+L+I  ++ + D +L LGK+LV+    + AF
Sbjct  570  NRNAYVMMAIYGKNFCKSARDAFNLLMRNILKIAVMDRVTDFVLILGKILVAGCIGVLAF  629

Query  468  LMLDTH-----KYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDS  304
            L+         +  +S +    PL  V+V     Y++A  FFSV  M I+TI + F +D 
Sbjct  630  LLFTERLPVIIEGPTSLNYYWVPLLTVIVG---SYIIAHGFFSVYAMCIETIFICFLEDL  686

Query  303  EEHHGTAQ---FAPPLLMETLDSQN  238
            E + G+A+   +    LM+ ++ +N
Sbjct  687  ERNDGSAEKPYYMSQSLMKIMNRRN  711



>ref|XP_006021826.1| PREDICTED: choline transporter-like protein 5 [Alligator sinensis]
 ref|XP_006269017.1| PREDICTED: choline transporter-like protein 5 isoform X3 [Alligator 
mississippiensis]
Length=707

 Score = 94.7 bits (234),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 65/193 (34%), Positives = 104/193 (54%), Gaps = 18/193 (9%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLK-TSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRN  640
             GS++ + ++ IR IL  +  +LK T NS       +      + C   +   +K +NRN
Sbjct  506  FGSLILAIVQLIRIILEYLDHKLKGTQNSFT-----RFLLCCLKCCFWCLEKFLKFINRN  560

Query  639  AYIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLML  460
            AYIMIAI GK+F  +++ A  L++ NV+R+  ++ + D +LFLGK+LV+    + AF   
Sbjct  561  AYIMIAIYGKNFCASAKEAFFLLMRNVVRVAVLDKVTDFLLFLGKILVAGGVGVLAFFFF  620

Query  459  DTHKYKSSNHKISS------PLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEE  298
             TH+ +    +  +      PL  V++     Y+VA  FFSV  M +DT+ L FC+D E 
Sbjct  621  -THRIQVFTQEAPTLNYYWVPLLTVIIG---SYLVAHGFFSVYAMCVDTLFLCFCEDLER  676

Query  297  HHGTAQFAPPLLM  259
            + G+   A P  M
Sbjct  677  NDGST--AKPYFM  687



>tpg|DAA31341.1| TPA: choline transporter-like protein 4-like [Bos taurus]
Length=684

 Score = 94.7 bits (234),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 63/205 (31%), Positives = 110/205 (54%), Gaps = 23/205 (11%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIM----KSV  649
             GS++ + I+  R IL  + +RL+ + S    +         + CLR   W +    K +
Sbjct  485  FGSLILAIIQMFRLILEYLDKRLQEAQSNISKF--------LKCCLRCCFWCLEKAVKFL  536

Query  648  NRNAYIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAF  469
            NRNAY+M+AI GK+F K++  A  L++ N+L+I  ++ + D +L LGK+LV+    + AF
Sbjct  537  NRNAYVMMAIYGKNFCKSARDAFNLLMRNILKIAVMDRVTDFVLILGKILVAGCIGVLAF  596

Query  468  LMLDTH-----KYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDS  304
            L+         +  +S +    PL  V++     Y++A  FFSV  M I+TI + F +D 
Sbjct  597  LLFTERLPVIIEGPTSLNYYWVPLLTVIIG---SYIIAHGFFSVYAMCIETIFICFLEDL  653

Query  303  EEHHGTAQ---FAPPLLMETLDSQN  238
            E + G+A+   +    LM+ ++ +N
Sbjct  654  ERNDGSAEKPYYMSQSLMKIMNKRN  678



>ref|XP_006086156.1| PREDICTED: choline transporter-like protein 5 [Myotis lucifugus]
Length=712

 Score = 94.7 bits (234),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 59/182 (32%), Positives = 100/182 (55%), Gaps = 8/182 (4%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
             GS+L + I+  R  L  + +R+K + +       K   H  + C   +  ++K +NRNA
Sbjct  513  FGSLLLALIQMFRIALEYLDKRIKDNQNNI----AKFLQHCLKCCFWCLEKVVKFLNRNA  568

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            Y+MIAI GK+F ++++ A +L+I N+L++  ++ + D +L LGK+LVS    + AFL+  
Sbjct  569  YVMIAIYGKNFCRSAKDAFDLLIRNILKVAVLDKVTDFVLVLGKILVSGCIGVLAFLLF-  627

Query  456  THKYK---SSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGT  286
            T +          ++    P+L      Y+VA  FFSV  M IDTI + F +D E + G+
Sbjct  628  TQRISIIIEGPTSLNYYWVPLLTVIAGSYLVAHGFFSVYAMCIDTIFICFLEDLERNDGS  687

Query  285  AQ  280
             +
Sbjct  688  TE  689



>ref|XP_005871987.1| PREDICTED: choline transporter-like protein 5 [Myotis brandtii]
Length=712

 Score = 94.7 bits (234),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 59/182 (32%), Positives = 100/182 (55%), Gaps = 8/182 (4%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
             GS+L + I+  R  L  + +R+K + +       K   H  + C   +  ++K +NRNA
Sbjct  513  FGSLLLALIQMFRIALEYLDKRIKDNQNNI----AKFLQHCLKCCFWCLEKVVKFLNRNA  568

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            Y+MIAI GK+F ++++ A +L+I N+L++  ++ + D +L LGK+LVS    + AFL+  
Sbjct  569  YVMIAIYGKNFCRSAKDAFDLLIRNILKVAVLDKVTDFVLVLGKILVSGCIGVLAFLLF-  627

Query  456  THKYK---SSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGT  286
            T +          ++    P+L      Y+VA  FFSV  M IDTI + F +D E + G+
Sbjct  628  TQRISIIIEGPTSLNYYWVPLLTIIAGSYLVAHGFFSVYAMCIDTIFICFLEDLERNDGS  687

Query  285  AQ  280
             +
Sbjct  688  TE  689



>ref|XP_011612925.1| PREDICTED: choline transporter-like protein 5 isoform X1 [Takifugu 
rubripes]
Length=710

 Score = 94.7 bits (234),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 59/184 (32%), Positives = 102/184 (55%), Gaps = 14/184 (8%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
             GS++ S ++ IR +L  +  +LK +++       +      + C   +   ++ +NRNA
Sbjct  508  FGSLILSLVQMIRIVLEYLDHKLKGAHNACS----RFLLCCLKCCFWCLEHFIRFINRNA  563

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAI GK+F  +S+ A  L++ NV+R+  ++ + D +LFLGKLL+S    + AF    
Sbjct  564  YIMIAIYGKNFCTSSKDAFFLLMRNVIRVAVLDKVTDFLLFLGKLLISGSVGVLAFFFF-  622

Query  456  THKYKSSNHKISS------PLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEH  295
            THK      ++ +      PL  V++     Y++A  FF+V  M +DT+ L FC+D E +
Sbjct  623  THKIPIIREELPTLNYIWVPLLTVIL---GSYMIAHGFFNVYSMCVDTLFLCFCEDLERN  679

Query  294  HGTA  283
             G++
Sbjct  680  DGSS  683



>ref|XP_005302473.1| PREDICTED: choline transporter-like protein 5 isoform X6 [Chrysemys 
picta bellii]
Length=590

 Score = 94.4 bits (233),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 64/190 (34%), Positives = 102/190 (54%), Gaps = 12/190 (6%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLK-TSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRN  640
             GS++ + ++ IR IL  +  +LK T NS       +      + C   +   +K +NRN
Sbjct  389  FGSLILAIVQLIRIILEYLDHKLKGTQNSFT-----RFLLCCLKCCFWCLEKFIKFINRN  443

Query  639  AYIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLML  460
            AYIMIAI GK+F  +++ A  L++ NV+R+  ++ + D +LFLGKLLV+    + AF   
Sbjct  444  AYIMIAIYGKNFCTSAKEAFFLLMRNVVRVAVLDKVTDFLLFLGKLLVAGGVGVLAFFFF  503

Query  459  DTHK---YKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHG  289
             TH+   +      ++    P+L      Y++A  FFSV  M +DT+ L FC+D E + G
Sbjct  504  -THRIPVFTQETPTLNYYWVPLLTVIIGSYLIAHGFFSVYAMCVDTLFLCFCEDLERNDG  562

Query  288  TAQFAPPLLM  259
            +   A P  M
Sbjct  563  ST--AKPYYM  570



>ref|XP_006269015.1| PREDICTED: choline transporter-like protein 5 isoform X1 [Alligator 
mississippiensis]
Length=715

 Score = 94.7 bits (234),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 65/193 (34%), Positives = 104/193 (54%), Gaps = 18/193 (9%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLK-TSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRN  640
             GS++ + ++ IR IL  +  +LK T NS       +      + C   +   +K +NRN
Sbjct  514  FGSLILAIVQLIRIILEYLDHKLKGTQNSFT-----RFLLCCLKCCFWCLEKFLKFINRN  568

Query  639  AYIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLML  460
            AYIMIAI GK+F  +++ A  L++ NV+R+  ++ + D +LFLGK+LV+    + AF   
Sbjct  569  AYIMIAIYGKNFCASAKEAFFLLMRNVVRVAVLDKVTDFLLFLGKILVAGGVGVLAFFFF  628

Query  459  DTHKYKSSNHKISS------PLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEE  298
             TH+ +    +  +      PL  V++     Y+VA  FFSV  M +DT+ L FC+D E 
Sbjct  629  -THRIQVFTQEAPTLNYYWVPLLTVIIG---SYLVAHGFFSVYAMCVDTLFLCFCEDLER  684

Query  297  HHGTAQFAPPLLM  259
            + G+   A P  M
Sbjct  685  NDGST--AKPYFM  695



>ref|NP_001268845.1| choline transporter-like protein 5 [Bos taurus]
 gb|AEZ02301.1| solute carrier family 44 member 5 [Bos taurus]
Length=717

 Score = 94.7 bits (234),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 63/205 (31%), Positives = 110/205 (54%), Gaps = 23/205 (11%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIM----KSV  649
             GS++ + I+  R IL  + +RL+ + S    +         + CLR   W +    K +
Sbjct  518  FGSLILAIIQMFRLILEYLDKRLQEAQSNISKF--------LKCCLRCCFWCLEKAVKFL  569

Query  648  NRNAYIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAF  469
            NRNAY+M+AI GK+F K++  A  L++ N+L+I  ++ + D +L LGK+LV+    + AF
Sbjct  570  NRNAYVMMAIYGKNFCKSARDAFNLLMRNILKIAVMDRVTDFVLILGKILVAGCIGVLAF  629

Query  468  LMLDTH-----KYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDS  304
            L+         +  +S +    PL  V++     Y++A  FFSV  M I+TI + F +D 
Sbjct  630  LLFTERLPVIIEGPTSLNYYWVPLLTVIIG---SYIIAHGFFSVYAMCIETIFICFLEDL  686

Query  303  EEHHGTAQ---FAPPLLMETLDSQN  238
            E + G+A+   +    LM+ ++ +N
Sbjct  687  ERNDGSAEKPYYMSQSLMKIMNKRN  711



>emb|CCD28277.1| choline-like transporter, partial [Plasmopara viticola]
Length=211

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 56/179 (31%), Positives = 98/179 (55%), Gaps = 12/179 (7%)
 Frame = -2

Query  798  SFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNAYIMIAI  619
             FI  +   L    R ++ SN        K+     Q CL  +   ++ +++NAYI+IA+
Sbjct  11   QFIRAVLLYLDHQTRDIQQSNLVL-----KVVMKIVQCCLWCLEKCLRFLSKNAYILIAM  65

Query  618  TGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLDTHKYKS  439
             G SF  +++ A +++  N+ ++  V+ +  ++L  GK+ V+L  A+ AF  L+  KY  
Sbjct  66   KGHSFCVSAKDAFKILFLNIAQVSAVSTVTFLLLGAGKVAVALSCAIAAFAYLE--KYND  123

Query  438  S-----NHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQF  277
                   H++SSPL P+LV   +G+ VA+    V EM+IDTI+L FC+D E +  + ++
Sbjct  124  DYGIGGAHELSSPLAPILVALLLGWFVASTLLGVYEMAIDTILLCFCEDKEINKASGEY  182



>ref|XP_005893526.1| PREDICTED: choline transporter-like protein 5 [Bos mutus]
 ref|XP_010847718.1| PREDICTED: choline transporter-like protein 5 [Bison bison bison]
Length=717

 Score = 94.7 bits (234),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 63/205 (31%), Positives = 110/205 (54%), Gaps = 23/205 (11%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIM----KSV  649
             GS++ + I+  R IL  + +RL+ + S    +         + CLR   W +    K +
Sbjct  518  FGSLILAIIQMFRLILEYLDKRLQEAQSNISKF--------LKCCLRCCFWCLEKAVKFL  569

Query  648  NRNAYIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAF  469
            NRNAY+M+AI GK+F K++  A  L++ N+L+I  ++ + D +L LGK+LV+    + AF
Sbjct  570  NRNAYVMMAIYGKNFCKSARDAFNLLMRNILKIAVMDRVTDFVLILGKILVAGCIGVLAF  629

Query  468  LMLDTH-----KYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDS  304
            L+         +  +S +    PL  V++     Y++A  FFSV  M I+TI + F +D 
Sbjct  630  LLFTERLPVIIEGPTSLNYYWVPLLTVIIG---SYIIAHGFFSVYAMCIETIFICFLEDL  686

Query  303  EEHHGTAQ---FAPPLLMETLDSQN  238
            E + G+A+   +    LM+ ++ +N
Sbjct  687  ERNDGSAEKPYYMSQSLMKIMNKRN  711



>ref|XP_010203379.1| PREDICTED: choline transporter-like protein 5, partial [Colius 
striatus]
Length=357

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 61/190 (32%), Positives = 99/190 (52%), Gaps = 10/190 (5%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLK-TSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRN  640
             G+++ + ++ IR IL  +  +LK T NS       +      + C   +   +K +NRN
Sbjct  156  FGALILAIVQLIRIILEYLDHKLKGTQNSFT-----RFLLCCLKCCFWCLEKFLKFINRN  210

Query  639  AYIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLML  460
            AYIMIAI GK+F  +++ A  L++ NV+R+  ++ + D +LFLGK+LV+    + AF   
Sbjct  211  AYIMIAIYGKNFCTSAKDAFYLLMRNVVRVAVLDKVTDFLLFLGKILVAGGVGVLAFFFF  270

Query  459  DTH--KYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGT  286
                  +      ++    P+L      Y+VA  FFSV  M +DT+ L FC+D E + G+
Sbjct  271  TQRIPVFAQEAPTLNYYWVPLLTVIIGSYLVAHGFFSVYAMCVDTLFLCFCEDLERNDGS  330

Query  285  AQFAPPLLME  256
               A P  M 
Sbjct  331  T--AKPYFMS  338



>gb|ACN10831.1| Choline transporter-like protein 2 [Salmo salar]
Length=704

 Score = 94.4 bits (233),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 62/204 (30%), Positives = 105/204 (51%), Gaps = 9/204 (4%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
             GS++ S ++ IR +L  + ++LK + +       K      + C   +   +K +NRNA
Sbjct  503  FGSLILSLVQVIRVLLEYLDQKLKAAQNRF----AKFLLSCLKCCFWCLEKCIKFLNRNA  558

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIM+AI GKSF  ++  A  L++ N++R+  ++ + D +LFLGKLL+  +  + +F    
Sbjct  559  YIMVAIYGKSFCTSARDAFFLLMRNIIRVAVLDKVTDFLLFLGKLLIVGIVGICSFFFFS  618

Query  456  --THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTA  283
                  + +   ++    P+L      Y++A  FFSV  M +DT+ L F +D E + GTA
Sbjct  619  GRIKAVEQTAPSLNYYWVPILTVVVGSYLIAHGFFSVYAMCVDTLFLCFLEDLERNDGTA  678

Query  282  Q---FAPPLLMETLDSQNEMQRLT  220
            +   F    L+  L   NE Q  T
Sbjct  679  ERPYFMSQNLLTILKKSNEDQAKT  702



>ref|XP_008169510.1| PREDICTED: choline transporter-like protein 5 isoform X3 [Chrysemys 
picta bellii]
Length=713

 Score = 94.4 bits (233),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 67/205 (33%), Positives = 110/205 (54%), Gaps = 14/205 (7%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLK-TSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRN  640
             GS++ + ++ IR IL  +  +LK T NS       +      + C   +   +K +NRN
Sbjct  514  FGSLILAIVQLIRIILEYLDHKLKGTQNSF-----TRFLLCCLKCCFWCLEKFIKFINRN  568

Query  639  AYIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLML  460
            AYIMIAI GK+F  +++ A  L++ NV+R+  ++ + D +LFLGKLLV+    + AF   
Sbjct  569  AYIMIAIYGKNFCTSAKEAFFLLMRNVVRVAVLDKVTDFLLFLGKLLVAGGVGVLAFFFF  628

Query  459  DTHK---YKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHG  289
             TH+   +      ++    P+L      Y++A  FFSV  M +DT+ L F +D E H G
Sbjct  629  -THRIPVFTQETPTLNYYWVPLLTVIIGSYLIAHGFFSVYAMCVDTLFLCFLEDLERHDG  687

Query  288  TAQ---FAPPLLMETLDSQN-EMQR  226
            +A+   +    L++ L+  N E +R
Sbjct  688  SAERPYYMSKSLLKILNKPNVETKR  712



>ref|XP_004699662.1| PREDICTED: choline transporter-like protein 5 [Echinops telfairi]
Length=704

 Score = 94.4 bits (233),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 64/205 (31%), Positives = 110/205 (54%), Gaps = 23/205 (11%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSW----IMKSV  649
             GS+L + I+  R +L  + RR +T+ +    +         Q CLR   W    ++K +
Sbjct  505  FGSLLLASIQMFRIVLEYVDRRARTAQNNISKF--------LQCCLRCCFWCLEKMVKFL  556

Query  648  NRNAYIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAF  469
            N+NAYIMIAI GK+F K+++ A  L++ NV+R+  ++ + + +L LGK+LV+    + AF
Sbjct  557  NKNAYIMIAIYGKNFCKSAKDAFNLLMRNVVRVAVMDKVTEFVLILGKILVTGSIGVLAF  616

Query  468  LMLDTH-----KYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDS  304
            L          K  +S +   +PL  V++     +++A  FF+V  M IDT+ + F +D 
Sbjct  617  LFFTQRVPVIIKGPTSLNYYWAPLLTVILG---SFLIAHGFFTVYAMCIDTLFICFLEDV  673

Query  303  EEHHGTAQ---FAPPLLMETLDSQN  238
            E + G+     +    LM+ L+ QN
Sbjct  674  ERNDGSTTRPYYMSQSLMKVLNQQN  698



>gb|ENN79400.1| hypothetical protein YQE_04149, partial [Dendroctonus ponderosae]
Length=400

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 64/203 (32%), Positives = 111/203 (55%), Gaps = 19/203 (9%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTS-QGCLRGVSW----IMKS  652
             GS++ +    IR +L  + ++LK  ++         AF  +   CL+   W     +K 
Sbjct  203  FGSLIIAICRMIRVMLEYVDKKLKKYDN---------AFTRAILCCLKCFFWCLEKFLKF  253

Query  651  VNRNAYIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFA  472
            +N+NAYIM AI GK+F  +++ A  L+++N++R+  ++ + D + FL KLLV+      A
Sbjct  254  INKNAYIMCAIHGKNFCASAKDAFTLLLNNIVRVFVLDKVTDFLFFLSKLLVTFGVGAIA  313

Query  471  FLMLDTHKYKS--SNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEE  298
            ++   T  Y S   N +I   L PV+      Y++ATLFF+V  M++DT+ L F +DSE+
Sbjct  314  YVFFVTD-YISFVDNSEIQYGLAPVVAIMIATYLIATLFFNVYSMAVDTLFLCFLEDSEK  372

Query  297  HHGTAQ--FAPPLLMETLDSQNE  235
            ++G  +  +    LM  L  +N+
Sbjct  373  NNGKDRPYYMSRNLMRILGKRNK  395



>ref|XP_005302469.1| PREDICTED: choline transporter-like protein 5 isoform X2 [Chrysemys 
picta bellii]
Length=715

 Score = 94.0 bits (232),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 64/190 (34%), Positives = 102/190 (54%), Gaps = 12/190 (6%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLK-TSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRN  640
             GS++ + ++ IR IL  +  +LK T NS       +      + C   +   +K +NRN
Sbjct  514  FGSLILAIVQLIRIILEYLDHKLKGTQNSFT-----RFLLCCLKCCFWCLEKFIKFINRN  568

Query  639  AYIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLML  460
            AYIMIAI GK+F  +++ A  L++ NV+R+  ++ + D +LFLGKLLV+    + AF   
Sbjct  569  AYIMIAIYGKNFCTSAKEAFFLLMRNVVRVAVLDKVTDFLLFLGKLLVAGGVGVLAFFFF  628

Query  459  DTHK---YKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHG  289
             TH+   +      ++    P+L      Y++A  FFSV  M +DT+ L FC+D E + G
Sbjct  629  -THRIPVFTQETPTLNYYWVPLLTVIIGSYLIAHGFFSVYAMCVDTLFLCFCEDLERNDG  687

Query  288  TAQFAPPLLM  259
            +   A P  M
Sbjct  688  ST--AKPYYM  695



>emb|CDQ68631.1| unnamed protein product [Oncorhynchus mykiss]
Length=711

 Score = 94.0 bits (232),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 59/190 (31%), Positives = 102/190 (54%), Gaps = 10/190 (5%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
             G+++ + ++  R IL  +  +LK +N+       +      + C   +   +K +NRNA
Sbjct  509  FGALILAVVQMARIILEYLDSKLKGANNVA----ARFVLCCLKCCFWCLERFVKFMNRNA  564

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAI GK F  ++  A  L++ NV+R+  ++ + D +LFLGK+L++    + AF    
Sbjct  565  YIMIAIYGKGFCMSARDAFCLLMRNVVRVAVLDRVTDFLLFLGKVLIAGSVGVIAFFFF-  623

Query  456  THKYKSSNHKISSPLF---PVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGT  286
            THK      ++ +  +   P+L      Y++A  FFSV  M +DT+ L FC+D E + G+
Sbjct  624  THKMPIFQEEVPTLHYYWVPLLTVIFGSYLIAHGFFSVYAMCVDTLFLCFCEDLERNDGS  683

Query  285  AQFAPPLLME  256
            ++   P LM 
Sbjct  684  SE--KPFLMS  691



>ref|XP_007488614.1| PREDICTED: solute carrier family 44, member 2 isoform X3 [Monodelphis 
domestica]
Length=714

 Score = 94.0 bits (232),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 66/200 (33%), Positives = 104/200 (52%), Gaps = 13/200 (7%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
             GS+L + ++ IR IL  + +RLK +    E+   K      + C   +   +K +NRNA
Sbjct  510  FGSLLLAIVQVIRVILEYLDQRLKAA----ENRFAKFLMTCLKCCFWCLEKFLKFLNRNA  565

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAI G +F  +++ A  L++ N++R+  ++ + D +  LGKLLV     + AF    
Sbjct  566  YIMIAIYGTNFCTSAKNAFFLLMRNIIRVAVLDKVTDFLFLLGKLLVVGSVGILAFFFF-  624

Query  456  THKYKSSNHKISSPL----FPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHG  289
            TH+ K      + PL     P+L      Y++A  FFSV  M +DT+ L FC+D E + G
Sbjct  625  THRIKIV-QDTAPPLNYYWIPILTVIIGSYLIAHGFFSVYGMCVDTLFLCFCEDLERNDG  683

Query  288  TAQ---FAPPLLMETLDSQN  238
            + +   F  P L + L   N
Sbjct  684  SPERPYFMSPELRDILLKGN  703



>ref|XP_007488613.1| PREDICTED: solute carrier family 44, member 2 isoform X2 [Monodelphis 
domestica]
Length=716

 Score = 94.0 bits (232),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 66/200 (33%), Positives = 104/200 (52%), Gaps = 13/200 (7%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
             GS+L + ++ IR IL  + +RLK +    E+   K      + C   +   +K +NRNA
Sbjct  512  FGSLLLAIVQVIRVILEYLDQRLKAA----ENRFAKFLMTCLKCCFWCLEKFLKFLNRNA  567

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAI G +F  +++ A  L++ N++R+  ++ + D +  LGKLLV     + AF    
Sbjct  568  YIMIAIYGTNFCTSAKNAFFLLMRNIIRVAVLDKVTDFLFLLGKLLVVGSVGILAFFFF-  626

Query  456  THKYKSSNHKISSPL----FPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHG  289
            TH+ K      + PL     P+L      Y++A  FFSV  M +DT+ L FC+D E + G
Sbjct  627  THRIKIV-QDTAPPLNYYWIPILTVIIGSYLIAHGFFSVYGMCVDTLFLCFCEDLERNDG  685

Query  288  TAQ---FAPPLLMETLDSQN  238
            + +   F  P L + L   N
Sbjct  686  SPERPYFMSPELRDILLKGN  705



>ref|XP_005302472.1| PREDICTED: choline transporter-like protein 5 isoform X4 [Chrysemys 
picta bellii]
Length=710

 Score = 94.0 bits (232),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 64/190 (34%), Positives = 102/190 (54%), Gaps = 12/190 (6%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLK-TSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRN  640
             GS++ + ++ IR IL  +  +LK T NS       +      + C   +   +K +NRN
Sbjct  509  FGSLILAIVQLIRIILEYLDHKLKGTQNSFT-----RFLLCCLKCCFWCLEKFIKFINRN  563

Query  639  AYIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLML  460
            AYIMIAI GK+F  +++ A  L++ NV+R+  ++ + D +LFLGKLLV+    + AF   
Sbjct  564  AYIMIAIYGKNFCTSAKEAFFLLMRNVVRVAVLDKVTDFLLFLGKLLVAGGVGVLAFFFF  623

Query  459  DTHK---YKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHG  289
             TH+   +      ++    P+L      Y++A  FFSV  M +DT+ L FC+D E + G
Sbjct  624  -THRIPVFTQETPTLNYYWVPLLTVIIGSYLIAHGFFSVYAMCVDTLFLCFCEDLERNDG  682

Query  288  TAQFAPPLLM  259
            +   A P  M
Sbjct  683  ST--AKPYYM  690



>ref|XP_005302470.1| PREDICTED: choline transporter-like protein 5 isoform X1 [Chrysemys 
picta bellii]
Length=715

 Score = 94.0 bits (232),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 64/190 (34%), Positives = 102/190 (54%), Gaps = 12/190 (6%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLK-TSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRN  640
             GS++ + ++ IR IL  +  +LK T NS       +      + C   +   +K +NRN
Sbjct  514  FGSLILAIVQLIRIILEYLDHKLKGTQNSFT-----RFLLCCLKCCFWCLEKFIKFINRN  568

Query  639  AYIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLML  460
            AYIMIAI GK+F  +++ A  L++ NV+R+  ++ + D +LFLGKLLV+    + AF   
Sbjct  569  AYIMIAIYGKNFCTSAKEAFFLLMRNVVRVAVLDKVTDFLLFLGKLLVAGGVGVLAFFFF  628

Query  459  DTHK---YKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHG  289
             TH+   +      ++    P+L      Y++A  FFSV  M +DT+ L FC+D E + G
Sbjct  629  -THRIPVFTQETPTLNYYWVPLLTVIIGSYLIAHGFFSVYAMCVDTLFLCFCEDLERNDG  687

Query  288  TAQFAPPLLM  259
            +   A P  M
Sbjct  688  ST--AKPYYM  695



>ref|XP_007488612.1| PREDICTED: solute carrier family 44, member 2 isoform X1 [Monodelphis 
domestica]
Length=716

 Score = 94.0 bits (232),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 66/200 (33%), Positives = 104/200 (52%), Gaps = 13/200 (7%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
             GS+L + ++ IR IL  + +RLK +    E+   K      + C   +   +K +NRNA
Sbjct  512  FGSLLLAIVQVIRVILEYLDQRLKAA----ENRFAKFLMTCLKCCFWCLEKFLKFLNRNA  567

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIMIAI G +F  +++ A  L++ N++R+  ++ + D +  LGKLLV     + AF    
Sbjct  568  YIMIAIYGTNFCTSAKNAFFLLMRNIIRVAVLDKVTDFLFLLGKLLVVGSVGILAFFFF-  626

Query  456  THKYKSSNHKISSPL----FPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHG  289
            TH+ K      + PL     P+L      Y++A  FFSV  M +DT+ L FC+D E + G
Sbjct  627  THRIKIV-QDTAPPLNYYWIPILTVIIGSYLIAHGFFSVYGMCVDTLFLCFCEDLERNDG  685

Query  288  TAQ---FAPPLLMETLDSQN  238
            + +   F  P L + L   N
Sbjct  686  SPERPYFMSPELRDILLKGN  705



>ref|XP_007079301.1| PREDICTED: choline transporter-like protein 5 [Panthera tigris 
altaica]
Length=717

 Score = 94.0 bits (232),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 66/211 (31%), Positives = 108/211 (51%), Gaps = 20/211 (9%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSV----  649
             GS++ + I+  R +L  + R LK + +    +         Q CL+   W +++V    
Sbjct  518  FGSLILASIQIFRIVLEYLDRHLKEAQNNISKF--------LQCCLKCCFWCLETVVKFL  569

Query  648  NRNAYIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAF  469
            NRNAYIMIAI GK+F K++  A  L++ NVL++  ++ + D +L LGK+LV+    + AF
Sbjct  570  NRNAYIMIAIYGKNFCKSAREAFNLLMRNVLKVAVMDNVTDFVLILGKILVTGCIGVLAF  629

Query  468  LMLDTH-----KYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDS  304
            L+         +  +S +    PL  V++     Y+VA  FFSV  M +DTI + F +D 
Sbjct  630  LLFTQRLPTIIEGPTSLNYYWVPLLTVIIG---SYLVAHGFFSVYAMCVDTIFICFLEDM  686

Query  303  EEHHGTAQFAPPLLMETLDSQNEMQRLTQ*P  211
            E + G+ +    +    L   NE    T+ P
Sbjct  687  ERNDGSTERPYYMSQSLLKILNESSMQTKKP  717



>ref|XP_636423.1| solute carrier family 44 protein member 2 [Dictyostelium discoideum 
AX4]
 sp|Q54I48.1|CTL2_DICDI RecName: Full=Choline transporter-like protein 2; AltName: Full=Solute 
carrier family 44 member 2 [Dictyostelium discoideum]
 gb|EAL62922.1| solute carrier family 44 protein member 2 [Dictyostelium discoideum 
AX4]
Length=628

 Score = 93.6 bits (231),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 48/179 (27%), Positives = 102/179 (57%), Gaps = 10/179 (6%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
            LGS++ + ++ IR++L  + ++ K      E++  +                +K +++NA
Sbjct  438  LGSLILAIVQFIRWVLRFLEKKFKGK----EAYLARFIVRCLNCIFGCFERFIKFLDKNA  493

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            YIM++I G SF + ++   +L+++N+LR+  VN++   ++FLG++ ++  +   +  +L 
Sbjct  494  YIMVSIYGYSFCQGAKRGFQLVLTNILRVAAVNLVSSFLMFLGRVFITAATVGISLYLLK  553

Query  456  THKYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTAQ  280
             H+       +S  + PV++   I + ++T F SV +MSIDT++L FC+D E + G+ +
Sbjct  554  EHE------NLSFYIIPVILIGFIAFAISTGFMSVYDMSIDTMLLCFCEDCERNDGSPE  606



>ref|XP_006775967.1| PREDICTED: choline transporter-like protein 5 [Myotis davidii]
Length=712

 Score = 94.0 bits (232),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 59/182 (32%), Positives = 100/182 (55%), Gaps = 8/182 (4%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
             GS+L + I+  R  L  + +R+K + +       K   H  + C   +  ++K +NRNA
Sbjct  513  FGSLLLALIQMFRIALEYLDKRIKDNQNNI----AKFLQHCLKCCFWCLEKVVKFLNRNA  568

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            Y+MIAI GK+F ++++ A +L+I N+L++  ++ + D +L LGK+LVS    + AFL+  
Sbjct  569  YVMIAIYGKNFCRSAKDAFDLLIRNILKVAVLDKVTDFVLVLGKILVSGSIGVLAFLLF-  627

Query  456  THKYK---SSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGT  286
            T +          ++    P+L      Y+VA  FFSV  M IDTI + F +D E + G+
Sbjct  628  TQRISIIIEGPTSLNYYWVPLLTIIAGSYLVAHGFFSVYAMCIDTIFICFLEDLERNDGS  687

Query  285  AQ  280
             +
Sbjct  688  TE  689



>ref|XP_006934904.2| PREDICTED: LOW QUALITY PROTEIN: choline transporter-like protein 
5 [Felis catus]
Length=717

 Score = 93.6 bits (231),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 66/211 (31%), Positives = 108/211 (51%), Gaps = 20/211 (9%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSV----  649
             GS++ + I+  R +L  + R LK + +    +         Q CL+   W +++V    
Sbjct  518  FGSLILASIQIFRIVLEYLDRHLKEAQNNISKF--------LQCCLKCCFWCLETVVKFL  569

Query  648  NRNAYIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAF  469
            NRNAYIMIAI GK+F K++  A  L++ NVL++  ++ + D +L LGK+LV+    + AF
Sbjct  570  NRNAYIMIAIYGKNFCKSAREAFNLLMRNVLKVAVMDNVTDFVLILGKILVTGCIGVLAF  629

Query  468  LMLDTH-----KYKSSNHKISSPLFPVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDS  304
            L+         +  +S +    PL  V++     Y+VA  FFSV  M +DTI + F +D 
Sbjct  630  LLFTQRLPTIIEGPTSLNYYWVPLLTVIIG---SYLVAHGFFSVYAMCVDTIFICFLEDM  686

Query  303  EEHHGTAQFAPPLLMETLDSQNEMQRLTQ*P  211
            E + G+ +    +    L   NE    T+ P
Sbjct  687  ERNDGSTERPYYMSQSLLKILNEPSMQTKKP  717



>emb|CDJ87532.1| unnamed protein product [Haemonchus contortus]
Length=794

 Score = 94.0 bits (232),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 60/199 (30%), Positives = 107/199 (54%), Gaps = 9/199 (5%)
 Frame = -2

Query  816  LGSVLXSFIEPIRFILGAIRRRLKTSNSTPESWPGKMAFHTSQGCLRGVSWIMKSVNRNA  637
             GS++ + I+ IR +L  + ++L T+NST      K+     + C   +    K + +NA
Sbjct  599  FGSLIIAVIKLIRVLLEYLDKKLSTTNSTVI----KVILSALKCCFWCLEVFFKFLTKNA  654

Query  636  YIMIAITGKSFFKASEIATELIISNVLRIGKVNVIGDVILFLGKLLVSLVSALFAFLMLD  457
            +IM+AI GK+FF +++ +  L++ N +R   VN +  ++LF+GK L++L   + AF    
Sbjct  655  FIMMAIYGKNFFTSAKESFLLLVRNCVRAAVVNQVAGILLFIGKALITLGMGVVAFFYFS  714

Query  456  THKYKSSNHKISSPLF--PVLVCWGIGYVVATLFFSVVEMSIDTIILSFCQDSEEHHGTA  283
                     ++    +  P+++     Y VA LFF V EM++DT  + F +DSE++ GT 
Sbjct  715  GQWIVDGIPRVELYYYFVPIVLVLIGSYFVADLFFDVYEMAVDTTFICFLEDSEQNDGTP  774

Query  282  Q---FAPPLLMETLDSQNE  235
            +   +    L + LD +NE
Sbjct  775  EKPYYMSKNLQKILDIKNE  793



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1724604950500