BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig2819

Length=1630
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006341528.1|  PREDICTED: phosphoethanolamine N-methyltrans...    446   7e-148   Solanum tuberosum [potatoes]
ref|XP_011072995.1|  PREDICTED: phosphoethanolamine N-methyltrans...    445   2e-147   Sesamum indicum [beniseed]
ref|XP_002532097.1|  phosphoethanolamine n-methyltransferase, put...    445   2e-147   Ricinus communis
ref|NP_001234549.1|  phosphoethanolamine N-methyltransferase            444   3e-147   Solanum lycopersicum
ref|XP_009776424.1|  PREDICTED: phosphoethanolamine N-methyltrans...    445   4e-147   Nicotiana sylvestris
ref|XP_009614862.1|  PREDICTED: phosphoethanolamine N-methyltrans...    444   5e-147   Nicotiana tomentosiformis
ref|XP_011084227.1|  PREDICTED: phosphoethanolamine N-methyltrans...    444   7e-147   Sesamum indicum [beniseed]
ref|XP_011084235.1|  PREDICTED: phosphoethanolamine N-methyltrans...    444   8e-147   Sesamum indicum [beniseed]
ref|XP_009757363.1|  PREDICTED: phosphoethanolamine N-methyltrans...    441   1e-145   Nicotiana sylvestris
ref|XP_009616694.1|  PREDICTED: phosphoethanolamine N-methyltrans...    440   3e-145   Nicotiana tomentosiformis
emb|CDO98349.1|  unnamed protein product                                436   8e-144   Coffea canephora [robusta coffee]
ref|XP_004241642.1|  PREDICTED: phosphoethanolamine N-methyltrans...    436   9e-144   Solanum lycopersicum
ref|XP_010677350.1|  PREDICTED: phosphoethanolamine N-methyltrans...    434   1e-143   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010033717.1|  PREDICTED: phosphoethanolamine N-methyltrans...    435   2e-143   Eucalyptus grandis [rose gum]
ref|XP_006365411.1|  PREDICTED: phosphoethanolamine N-methyltrans...    435   2e-143   Solanum tuberosum [potatoes]
ref|XP_011039130.1|  PREDICTED: phosphomethylethanolamine N-methy...    435   2e-143   Populus euphratica
emb|CBI26879.3|  unnamed protein product                                434   4e-143   Vitis vinifera
ref|XP_002282182.1|  PREDICTED: phosphomethylethanolamine N-methy...    433   8e-143   Vitis vinifera
ref|XP_004299531.1|  PREDICTED: phosphomethylethanolamine N-methy...    434   9e-143   Fragaria vesca subsp. vesca
gb|AGI56231.1|  phosphoethanolamine N-methyltransferase                 433   1e-142   Lycium barbarum [Duke of Argyll's teatree]
ref|XP_010655650.1|  PREDICTED: phosphomethylethanolamine N-methy...    433   2e-142   Vitis vinifera
ref|XP_002891445.1|  hypothetical protein ARALYDRAFT_473996             432   2e-142   
ref|XP_002284594.1|  PREDICTED: phosphoethanolamine N-methyltrans...    432   2e-142   Vitis vinifera
ref|XP_006843796.1|  PREDICTED: phosphomethylethanolamine N-methy...    432   3e-142   Amborella trichopoda
ref|XP_011623100.1|  PREDICTED: phosphomethylethanolamine N-methy...    432   3e-142   
gb|EYU24136.1|  hypothetical protein MIMGU_mgv1a005261mg                432   4e-142   Erythranthe guttata [common monkey flower]
gb|AAG52075.1|AC012679_13  putative S-adenosyl-methionine-sterol-...    424   5e-142   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009782224.1|  PREDICTED: phosphoethanolamine N-methyltrans...    431   5e-142   Nicotiana sylvestris
ref|XP_006376720.1|  hypothetical protein POPTR_0012s044901g            426   6e-142   
dbj|BAC57432.1|  phosphoethanolamine N-methyltransferase                431   7e-142   Suaeda japonica
ref|XP_006346642.1|  PREDICTED: phosphoethanolamine N-methyltrans...    431   8e-142   Solanum tuberosum [potatoes]
ref|XP_009595958.1|  PREDICTED: phosphoethanolamine N-methyltrans...    431   8e-142   Nicotiana tomentosiformis
gb|ABG57185.1|  phosphoethanolamine N-methyltransferase                 431   1e-141   Salicornia europaea [chicken-claws]
emb|CAN64744.1|  hypothetical protein VITISV_041321                     431   1e-141   Vitis vinifera
ref|XP_010314226.1|  PREDICTED: phosphoethanolamine N-methyltrans...    427   1e-141   
ref|XP_010686587.1|  PREDICTED: phosphoethanolamine N-methyltrans...    430   2e-141   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU33965.1|  hypothetical protein MIMGU_mgv1a005263mg                430   2e-141   Erythranthe guttata [common monkey flower]
ref|XP_011008809.1|  PREDICTED: phosphomethylethanolamine N-methy...    429   2e-141   Populus euphratica
ref|XP_011014101.1|  PREDICTED: phosphomethylethanolamine N-methy...    429   3e-141   Populus euphratica
gb|ABK42071.1|  phosphoethanolamine N-methyltransferase                 429   4e-141   Suaeda liaotungensis
ref|XP_008240154.1|  PREDICTED: phosphoethanolamine N-methyltrans...    429   4e-141   
ref|XP_011008808.1|  PREDICTED: phosphomethylethanolamine N-methy...    429   4e-141   Populus euphratica
ref|XP_012088549.1|  PREDICTED: phosphoethanolamine N-methyltrans...    429   4e-141   Jatropha curcas
emb|CDY11100.1|  BnaC06g23520D                                          429   5e-141   Brassica napus [oilseed rape]
gb|AFZ78648.1|  methyl transferase                                      429   5e-141   Populus tomentosa [Chinese white poplar]
dbj|BAE07178.1|  phosphoethanolamine N-methyltransferase                429   7e-141   Beta vulgaris [beet]
ref|XP_007036802.1|  S-adenosyl-L-methionine-dependent methyltran...    428   7e-141   
emb|CBI26877.3|  unnamed protein product                                428   8e-141   Vitis vinifera
ref|XP_004252273.1|  PREDICTED: phosphomethylethanolamine N-methy...    429   8e-141   Solanum lycopersicum
ref|XP_010274723.1|  PREDICTED: phosphomethylethanolamine N-methy...    428   8e-141   Nelumbo nucifera [Indian lotus]
ref|XP_008240152.1|  PREDICTED: phosphoethanolamine N-methyltrans...    428   9e-141   Prunus mume [ume]
ref|XP_010655490.1|  PREDICTED: phosphomethylethanolamine N-methy...    427   9e-141   Vitis vinifera
emb|CDX68222.1|  BnaA07g22620D                                          429   1e-140   
ref|XP_009385384.1|  PREDICTED: phosphoethanolamine N-methyltrans...    428   1e-140   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009104804.1|  PREDICTED: phosphoethanolamine N-methyltrans...    428   1e-140   Brassica rapa
ref|XP_006451624.1|  hypothetical protein CICLE_v10010749mg             427   2e-140   Citrus clementina [clementine]
ref|XP_006490771.1|  PREDICTED: phosphoethanolamine N-methyltrans...    427   2e-140   
ref|XP_010428286.1|  PREDICTED: phosphoethanolamine N-methyltrans...    427   2e-140   Camelina sativa [gold-of-pleasure]
ref|XP_007209942.1|  hypothetical protein PRUPE_ppa004742mg             427   3e-140   Prunus persica
ref|XP_010428285.1|  PREDICTED: phosphoethanolamine N-methyltrans...    427   4e-140   Camelina sativa [gold-of-pleasure]
ref|XP_002317876.2|  hypothetical protein POPTR_0012s044901g            421   4e-140   
ref|NP_177501.2|  putative phosphoethanolamine N-methyltransferase 3    426   4e-140   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008453479.1|  PREDICTED: phosphoethanolamine N-methyltrans...    427   5e-140   Cucumis melo [Oriental melon]
ref|NP_974139.2|  putative phosphoethanolamine N-methyltransferase 3    426   6e-140   Arabidopsis thaliana [mouse-ear cress]
gb|KJB30118.1|  hypothetical protein B456_005G132000                    421   7e-140   Gossypium raimondii
ref|XP_010678114.1|  PREDICTED: phosphoethanolamine N-methyltrans...    426   8e-140   Beta vulgaris subsp. vulgaris [field beet]
gb|KFK36082.1|  hypothetical protein AALP_AA4G075100                    426   9e-140   Arabis alpina [alpine rockcress]
pir||H96762  hypothetical protein F6D5.1 [imported] - Arabidopsis...    428   9e-140
ref|XP_002887491.1|  predicted protein                                  425   1e-139   
ref|XP_010471422.1|  PREDICTED: phosphoethanolamine N-methyltrans...    425   2e-139   Camelina sativa [gold-of-pleasure]
ref|XP_006393387.1|  hypothetical protein EUTSA_v10011451mg             424   2e-139   
ref|XP_010416170.1|  PREDICTED: phosphoethanolamine N-methyltrans...    425   2e-139   Camelina sativa [gold-of-pleasure]
ref|XP_010533969.1|  PREDICTED: phosphomethylethanolamine N-methy...    424   2e-139   Tarenaya hassleriana [spider flower]
ref|XP_010471421.1|  PREDICTED: phosphoethanolamine N-methyltrans...    425   3e-139   Camelina sativa [gold-of-pleasure]
dbj|BAE99185.1|  putative phosphoethanolamine N-methyltransferase       424   3e-139   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004137341.1|  PREDICTED: phosphoethanolamine N-methyltrans...    424   4e-139   Cucumis sativus [cucumbers]
ref|XP_007036803.1|  S-adenosyl-L-methionine-dependent methyltran...    424   4e-139   
gb|KFK41794.1|  hypothetical protein AALP_AA2G173000                    424   5e-139   Arabis alpina [alpine rockcress]
ref|XP_002322102.2|  hypothetical protein POPTR_0015s04540g             424   7e-139   
sp|Q9M571.1|PEAMT_SPIOL  RecName: Full=Phosphoethanolamine N-meth...    423   7e-139   Spinacia oleracea
ref|XP_008393424.1|  PREDICTED: phosphoethanolamine N-methyltrans...    423   9e-139   
ref|XP_010519218.1|  PREDICTED: phosphoethanolamine N-methyltrans...    424   9e-139   Tarenaya hassleriana [spider flower]
ref|XP_008360927.1|  PREDICTED: phosphoethanolamine N-methyltrans...    423   9e-139   
ref|XP_006390538.1|  hypothetical protein EUTSA_v10018431mg             423   1e-138   Eutrema salsugineum [saltwater cress]
emb|CDX95799.1|  BnaC05g35500D                                          422   1e-138   
ref|XP_010461683.1|  PREDICTED: phosphomethylethanolamine N-methy...    423   1e-138   Camelina sativa [gold-of-pleasure]
ref|XP_010519219.1|  PREDICTED: phosphoethanolamine N-methyltrans...    423   1e-138   Tarenaya hassleriana [spider flower]
gb|KJB30120.1|  hypothetical protein B456_005G132000                    422   1e-138   Gossypium raimondii
ref|XP_010263678.1|  PREDICTED: phosphoethanolamine N-methyltrans...    422   1e-138   Nelumbo nucifera [Indian lotus]
gb|KJB30122.1|  hypothetical protein B456_005G132000                    422   2e-138   Gossypium raimondii
ref|XP_006302164.1|  hypothetical protein CARUB_v10020173mg             422   2e-138   Capsella rubella
ref|XP_008464197.1|  PREDICTED: phosphoethanolamine N-methyltrans...    422   2e-138   Cucumis melo [Oriental melon]
gb|KJB30117.1|  hypothetical protein B456_005G132000                    422   2e-138   Gossypium raimondii
ref|XP_010921161.1|  PREDICTED: phosphoethanolamine N-methyltrans...    421   4e-138   Elaeis guineensis
ref|XP_009145948.1|  PREDICTED: phosphoethanolamine N-methyltrans...    421   4e-138   Brassica rapa
dbj|BAD80838.1|  phosphoethanolamine N-methyltransferase                422   4e-138   Atriplex nummularia
ref|XP_004137500.1|  PREDICTED: phosphoethanolamine N-methyltrans...    421   7e-138   Cucumis sativus [cucumbers]
ref|XP_009360079.1|  PREDICTED: phosphoethanolamine N-methyltrans...    421   8e-138   Pyrus x bretschneideri [bai li]
gb|KHG16117.1|  Phosphoethanolamine N-methyltransferase 1 -like p...    420   1e-137   Gossypium arboreum [tree cotton]
ref|XP_009356042.1|  PREDICTED: phosphoethanolamine N-methyltrans...    420   1e-137   Pyrus x bretschneideri [bai li]
emb|CDX92181.1|  BnaA05g22260D                                          419   2e-137   
gb|AEY75253.1|  phosphoethanolamine N-methyltransferase                 419   2e-137   Atriplex canescens [shadscale]
ref|XP_008364653.1|  PREDICTED: phosphoethanolamine N-methyltrans...    419   3e-137   
ref|XP_010921197.1|  PREDICTED: phosphoethanolamine N-methyltrans...    419   4e-137   Elaeis guineensis
gb|KFK39125.1|  hypothetical protein AALP_AA3G204100                    419   4e-137   Arabis alpina [alpine rockcress]
ref|XP_010921205.1|  PREDICTED: phosphoethanolamine N-methyltrans...    418   4e-137   
gb|AER10512.1|  phosphoethanolamine N-methyltransferase                 419   5e-137   Pyrus betulifolia
ref|XP_002441466.1|  hypothetical protein SORBIDRAFT_09g027360          419   8e-137   Sorghum bicolor [broomcorn]
ref|XP_010540184.1|  PREDICTED: phosphoethanolamine N-methyltrans...    417   8e-137   Tarenaya hassleriana [spider flower]
gb|EMT21187.1|  Phosphoethanolamine N-methyltransferase 1               418   9e-137   
emb|CDM83845.1|  unnamed protein product                                418   1e-136   Triticum aestivum [Canadian hard winter wheat]
gb|EMS54147.1|  Phosphoethanolamine N-methyltransferase 1               418   1e-136   Triticum urartu
ref|XP_008799222.1|  PREDICTED: phosphomethylethanolamine N-methy...    417   1e-136   
gb|ACV89824.1|  S-adenosyl-L-methionine:phosphoethanolamine N-met...    418   1e-136   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008799221.1|  PREDICTED: phosphomethylethanolamine N-methy...    417   1e-136   Phoenix dactylifera
ref|XP_008799219.1|  PREDICTED: phosphomethylethanolamine N-methy...    417   2e-136   Phoenix dactylifera
gb|EPS65842.1|  hypothetical protein M569_08933                         417   2e-136   Genlisea aurea
dbj|BAC57960.1|  phosphoethanolamine N-methyltransferase                417   2e-136   Tripolium pannonicum [sea starwort]
ref|XP_002883100.1|  N-methyltransferase 1                              417   2e-136   
ref|XP_007209943.1|  hypothetical protein PRUPE_ppa004742mg             417   2e-136   
ref|XP_004969638.1|  PREDICTED: phosphoethanolamine N-methyltrans...    417   3e-136   Setaria italica
ref|NP_188427.2|  phosphoethanolamine N-methyltransferase 1             417   3e-136   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB02720.1|  methyl transferase-like protein                        417   3e-136   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010921188.1|  PREDICTED: phosphoethanolamine N-methyltrans...    418   3e-136   
gb|AFW78991.1|  hypothetical protein ZEAMMB73_932976                    411   5e-136   
gb|AAP83582.1|  phosphoethanolamine N-methyltransferase                 416   6e-136   Brassica napus [oilseed rape]
ref|NP_175293.1|  phosphoethanolamine N-methyltransferase 2             415   6e-136   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010097563.1|  hypothetical protein L484_017373                   416   6e-136   
ref|XP_009404071.1|  PREDICTED: phosphomethylethanolamine N-methy...    415   1e-135   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_973993.1|  phosphoethanolamine N-methyltransferase 2             415   1e-135   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010097561.1|  Phosphoethanolamine N-methyltransferase 1          416   2e-135   
ref|XP_002456194.1|  hypothetical protein SORBIDRAFT_03g031950          415   2e-135   Sorghum bicolor [broomcorn]
gb|AAM13092.1|  unknown protein                                         414   4e-135   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006297517.1|  hypothetical protein CARUB_v10013541mg             414   4e-135   Capsella rubella
ref|XP_010487709.1|  PREDICTED: phosphoethanolamine N-methyltrans...    414   5e-135   Camelina sativa [gold-of-pleasure]
ref|XP_010487710.1|  PREDICTED: phosphoethanolamine N-methyltrans...    413   6e-135   Camelina sativa [gold-of-pleasure]
ref|XP_010465872.1|  PREDICTED: phosphoethanolamine N-methyltrans...    413   6e-135   Camelina sativa [gold-of-pleasure]
ref|NP_001169597.1|  uncharacterized LOC100383478                       413   7e-135   Zea mays [maize]
dbj|BAH01482.1|  unnamed protein product                                413   1e-134   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001043957.1|  Os01g0695100                                       412   1e-134   
ref|XP_010506234.1|  PREDICTED: phosphoethanolamine N-methyltrans...    412   1e-134   Camelina sativa [gold-of-pleasure]
ref|XP_004961340.1|  PREDICTED: phosphoethanolamine N-methyltrans...    412   1e-134   Setaria italica
dbj|BAJ97525.1|  predicted protein                                      412   2e-134   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010506242.1|  PREDICTED: phosphoethanolamine N-methyltrans...    412   2e-134   Camelina sativa [gold-of-pleasure]
gb|EEC79642.1|  hypothetical protein OsI_20868                          412   2e-134   Oryza sativa Indica Group [Indian rice]
ref|XP_010461752.1|  PREDICTED: phosphomethylethanolamine N-methy...    412   2e-134   Camelina sativa [gold-of-pleasure]
ref|XP_006303987.1|  hypothetical protein CARUB_v10008968mg             411   3e-134   Capsella rubella
gb|AAS57723.1|  phosphoethanolamine N-methyltransferase                 411   4e-134   Oryza sativa [red rice]
ref|XP_010231068.1|  PREDICTED: phosphomethylethanolamine N-methy...    409   8e-134   Brachypodium distachyon [annual false brome]
ref|XP_003567962.1|  PREDICTED: phosphomethylethanolamine N-methy...    410   1e-133   Brachypodium distachyon [annual false brome]
ref|XP_003569614.1|  PREDICTED: phosphoethanolamine N-methyltrans...    409   4e-133   Brachypodium distachyon [annual false brome]
ref|XP_006644536.1|  PREDICTED: phosphoethanolamine N-methyltrans...    409   4e-133   Oryza brachyantha
gb|KJB53040.1|  hypothetical protein B456_008G289900                    408   5e-133   Gossypium raimondii
gb|KJB53039.1|  hypothetical protein B456_008G289900                    408   5e-133   Gossypium raimondii
gb|AFW83642.1|  phosphoethanolamine N-methyltransferase                 409   5e-133   
ref|NP_001148925.1|  LOC100282545                                       407   1e-132   Zea mays [maize]
ref|XP_012088548.1|  PREDICTED: phosphoethanolamine N-methyltrans...    408   1e-132   Jatropha curcas
ref|XP_008675144.1|  PREDICTED: phosphoethanolamine N-methyltrans...    407   3e-132   
ref|XP_004969637.1|  PREDICTED: phosphoethanolamine N-methyltrans...    406   4e-132   Setaria italica
ref|XP_004137342.1|  PREDICTED: phosphomethylethanolamine N-methy...    405   4e-132   Cucumis sativus [cucumbers]
tpg|DAA57997.1|  TPA: putative phosphoethanolamine N-methyltransf...    406   4e-132   
gb|AAV67950.1|  putative phosphoethanolamine N-methyltransferase        406   5e-132   Zea mays [maize]
ref|XP_006655550.1|  PREDICTED: phosphoethanolamine N-methyltrans...    405   8e-132   Oryza brachyantha
ref|XP_002456193.1|  hypothetical protein SORBIDRAFT_03g031940          405   8e-132   Sorghum bicolor [broomcorn]
gb|AFW04224.1|  phosphoethanolamine N-methyl transferase                404   2e-131   Suaeda maritima
gb|EEE55232.1|  hypothetical protein OsJ_03109                          405   2e-131   Oryza sativa Japonica Group [Japonica rice]
gb|EMT23240.1|  Phosphoethanolamine N-methyltransferase 1               404   3e-131   
gb|AGO59019.1|  heat responsive transcription factor protein            402   3e-131   Triticum aestivum [Canadian hard winter wheat]
gb|AAL40895.1|  phosphoethanolamine methyltransferase                   404   4e-131   Triticum aestivum [Canadian hard winter wheat]
gb|EMT23241.1|  Phosphoethanolamine N-methyltransferase 1               402   1e-129   
emb|CDX93681.1|  BnaA06g03670D                                          399   2e-129   
ref|XP_009147956.1|  PREDICTED: phosphomethylethanolamine N-methy...    399   3e-129   Brassica rapa
emb|CDM83854.1|  unnamed protein product                                395   4e-129   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006406666.1|  hypothetical protein EUTSA_v10020595mg             397   8e-129   Eutrema salsugineum [saltwater cress]
emb|CDY40594.1|  BnaC06g02100D                                          394   1e-127   Brassica napus [oilseed rape]
ref|XP_012088547.1|  PREDICTED: phosphoethanolamine N-methyltrans...    393   9e-127   Jatropha curcas
ref|XP_010481025.1|  PREDICTED: phosphomethylethanolamine N-methy...    390   1e-126   
ref|XP_012088546.1|  PREDICTED: phosphoethanolamine N-methyltrans...    393   2e-126   Jatropha curcas
gb|KJB53038.1|  hypothetical protein B456_008G289900                    389   1e-125   Gossypium raimondii
gb|AAF79705.1|AC020889_13  T1N15.23                                     385   2e-125   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006303561.1|  hypothetical protein CARUB_v10011038mg             386   2e-124   
gb|ABX10444.1|  phosphoethanolamine N-methyltransferase                 385   4e-124   Gossypium hirsutum [American cotton]
ref|XP_001763293.1|  predicted protein                                  379   2e-121   
ref|XP_002969650.1|  hypothetical protein SELMODRAFT_146547             378   4e-121   Selaginella moellendorffii
gb|KDO63824.1|  hypothetical protein CISIN_1g043471mg                   377   4e-121   Citrus sinensis [apfelsine]
gb|KJB30123.1|  hypothetical protein B456_005G132000                    376   7e-121   Gossypium raimondii
ref|XP_002970912.1|  hypothetical protein SELMODRAFT_270875             375   3e-120   Selaginella moellendorffii
ref|XP_010500398.1|  PREDICTED: phosphomethylethanolamine N-methy...    368   2e-117   Camelina sativa [gold-of-pleasure]
ref|XP_008675146.1|  PREDICTED: phosphoethanolamine N-methyltrans...    365   1e-116   Zea mays [maize]
gb|EAY75471.1|  hypothetical protein OsI_03371                          362   1e-115   Oryza sativa Indica Group [Indian rice]
ref|XP_008799258.1|  PREDICTED: phosphomethylethanolamine N-methy...    360   6e-115   
gb|ABK24808.1|  unknown                                                 357   3e-113   Picea sitchensis
ref|XP_003534138.1|  PREDICTED: phosphoethanolamine N-methyltrans...    353   7e-112   
ref|NP_001056231.2|  Os05g0548900                                       343   1e-111   
ref|XP_003619840.1|  Phosphoethanolamine N-methyltransferase            349   3e-111   
ref|XP_003619836.1|  Phosphoethanolamine N-methyltransferase            351   8e-111   Medicago truncatula
gb|KHN10536.1|  Phosphoethanolamine N-methyltransferase                 349   3e-110   Glycine soja [wild soybean]
ref|XP_003525185.1|  PREDICTED: phosphoethanolamine N-methyltrans...    349   3e-110   
ref|XP_004512744.1|  PREDICTED: phosphoethanolamine N-methyltrans...    347   2e-109   Cicer arietinum [garbanzo]
ref|XP_004512745.1|  PREDICTED: phosphoethanolamine N-methyltrans...    347   3e-109   Cicer arietinum [garbanzo]
ref|XP_007209941.1|  hypothetical protein PRUPE_ppa004742mg             344   1e-108   
gb|KJB30119.1|  hypothetical protein B456_005G132000                    343   3e-108   Gossypium raimondii
ref|XP_003528975.2|  PREDICTED: phosphoethanolamine N-methyltrans...    345   5e-108   
ref|XP_007160542.1|  hypothetical protein PHAVU_002G330400g             342   3e-107   Phaseolus vulgaris [French bean]
emb|CAN75113.1|  hypothetical protein VITISV_043577                     336   7e-106   Vitis vinifera
ref|XP_007152684.1|  hypothetical protein PHAVU_004G150500g             335   1e-104   Phaseolus vulgaris [French bean]
gb|KJB53041.1|  hypothetical protein B456_008G289900                    330   4e-103   Gossypium raimondii
gb|AFK45429.1|  unknown                                                 320   5e-101   Medicago truncatula
ref|XP_004503268.1|  PREDICTED: phosphoethanolamine N-methyltrans...    322   1e-99    Cicer arietinum [garbanzo]
ref|XP_003631125.1|  Phosphoethanolamine N-methyltransferase            321   2e-99    
gb|AET05600.2|  phosphoethanolamine N-methyltransferase                 321   3e-99    Medicago truncatula
ref|XP_010774827.1|  PREDICTED: phosphoethanolamine N-methyltrans...    317   2e-98    Notothenia coriiceps [yellowbelly rockcod]
gb|KJB30121.1|  hypothetical protein B456_005G132000                    315   6e-98    Gossypium raimondii
gb|AAI35513.1|  LOC100124841 protein                                    317   6e-98    Xenopus tropicalis [western clawed frog]
ref|XP_011608845.1|  PREDICTED: phosphoethanolamine N-methyltrans...    317   1e-97    Takifugu rubripes [tiger puffer]
ref|NP_001096276.2|  phosphoethanolamine methyltransferase              317   1e-97    Xenopus tropicalis [western clawed frog]
ref|XP_011608844.1|  PREDICTED: phosphoethanolamine N-methyltrans...    318   1e-97    
ref|XP_003631124.1|  Phosphoethanolamine N-methyltransferase            317   2e-97    
ref|XP_004073222.1|  PREDICTED: phosphoethanolamine N-methyltrans...    313   2e-96    
ref|NP_001070105.1|  phosphoethanolamine methyltransferase              313   3e-96    Danio rerio [leopard danio]
ref|XP_008324913.1|  PREDICTED: phosphoethanolamine N-methyltrans...    312   7e-96    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_008324912.1|  PREDICTED: phosphoethanolamine N-methyltrans...    312   8e-96    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_008324914.1|  PREDICTED: phosphoethanolamine N-methyltrans...    311   1e-95    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_004545582.1|  PREDICTED: phosphoethanolamine N-methyltrans...    311   2e-95    
ref|XP_005643867.1|  S-adenosyl-L-methionine-dependent methyltran...    311   2e-95    Coccomyxa subellipsoidea C-169
ref|XP_004545581.1|  PREDICTED: phosphoethanolamine N-methyltrans...    311   2e-95    
ref|XP_005723169.1|  PREDICTED: phosphoethanolamine N-methyltrans...    311   2e-95    Pundamilia nyererei
ref|XP_005723168.1|  PREDICTED: phosphoethanolamine N-methyltrans...    311   2e-95    
ref|XP_005723167.1|  PREDICTED: phosphoethanolamine N-methyltrans...    311   2e-95    Pundamilia nyererei
ref|XP_005467627.1|  PREDICTED: phosphoethanolamine N-methyltrans...    310   3e-95    Oreochromis niloticus
ref|XP_005467629.1|  PREDICTED: phosphoethanolamine N-methyltrans...    310   3e-95    Oreochromis niloticus
ref|XP_003444639.1|  PREDICTED: phosphoethanolamine N-methyltrans...    310   4e-95    Oreochromis niloticus
ref|XP_005913450.1|  PREDICTED: phosphoethanolamine N-methyltrans...    310   5e-95    Haplochromis burtoni
ref|XP_005913451.1|  PREDICTED: phosphoethanolamine N-methyltrans...    310   5e-95    Haplochromis burtoni
ref|XP_008278560.1|  PREDICTED: phosphoethanolamine N-methyltrans...    309   1e-94    Stegastes partitus
ref|XP_006781399.1|  PREDICTED: phosphoethanolamine N-methyltrans...    309   1e-94    Neolamprologus brichardi [lyretail cichlid]
ref|XP_010730439.1|  PREDICTED: phosphomethylethanolamine N-methy...    310   1e-94    
ref|XP_010730440.1|  PREDICTED: phosphomethylethanolamine N-methy...    309   1e-94    
ref|XP_008278559.1|  PREDICTED: phosphoethanolamine N-methyltrans...    310   1e-94    Stegastes partitus
ref|XP_007550439.1|  PREDICTED: phosphoethanolamine N-methyltrans...    308   2e-94    Poecilia formosa
ref|NP_001087172.1|  phosphoethanolamine methyltransferase              308   5e-94    Xenopus laevis [clawed frog]
ref|XP_007160543.1|  hypothetical protein PHAVU_002G330400g             308   5e-94    Phaseolus vulgaris [French bean]
emb|CDX74572.1|  BnaA04g08170D                                          303   8e-94    
ref|NP_001167350.1|  phosphoethanolamine N-methyltransferase 3          304   9e-93    Salmo salar
ref|XP_005806845.1|  PREDICTED: phosphoethanolamine N-methyltrans...    304   1e-92    Xiphophorus maculatus
ref|XP_010864863.1|  PREDICTED: phosphoethanolamine N-methyltrans...    303   3e-92    Esox lucius
ref|XP_009832411.1|  hypothetical protein H257_08283                    303   3e-92    Aphanomyces astaci
ref|XP_008418600.1|  PREDICTED: phosphoethanolamine N-methyltrans...    303   3e-92    Poecilia reticulata
ref|XP_008418601.1|  PREDICTED: phosphoethanolamine N-methyltrans...    303   3e-92    Poecilia reticulata
ref|XP_007228349.1|  PREDICTED: phosphoethanolamine N-methyltrans...    304   6e-92    
ref|XP_011453571.1|  PREDICTED: phosphoethanolamine N-methyltrans...    298   1e-90    Crassostrea gigas
emb|CCA16454.1|  phosphoethanolamine Nmethyltransferase putative        298   2e-90    Albugo laibachii Nc14
ref|XP_011453570.1|  PREDICTED: phosphoethanolamine N-methyltrans...    298   2e-90    Crassostrea gigas
ref|XP_011453569.1|  PREDICTED: phosphoethanolamine N-methyltrans...    298   3e-90    Crassostrea gigas
gb|ETP40953.1|  hypothetical protein F442_11791                         289   3e-90    Phytophthora parasitica P10297
emb|CCI39434.1|  unnamed protein product                                296   1e-89    Albugo candida
ref|XP_008872791.1|  hypothetical protein H310_08714                    296   1e-89    Aphanomyces invadans
ref|XP_002594089.1|  hypothetical protein BRAFLDRAFT_118790             298   3e-89    Branchiostoma floridae
emb|CAG09731.1|  unnamed protein product                                295   4e-89    Tetraodon nigroviridis
gb|KEH21429.1|  phosphoethanolamine N-methyltransferase                 291   3e-88    Medicago truncatula
emb|CDY07952.1|  BnaC03g35710D                                          289   5e-88    Brassica napus [oilseed rape]
ref|XP_002898136.1|  phosphoethanolamine N-methyltransferase            290   3e-87    Phytophthora infestans T30-4
ref|XP_001634828.1|  predicted protein                                  281   7e-87    Nematostella vectensis
gb|ELT87122.1|  hypothetical protein CAPTEDRAFT_189076                  288   2e-86    Capitella teleta
ref|XP_002898137.1|  phosphoethanolamine N-methyltransferase, put...    288   2e-86    Phytophthora infestans T30-4
gb|EFX73213.1|  hypothetical protein DAPPUDRAFT_58148                   284   3e-85    Daphnia pulex
ref|XP_009012150.1|  hypothetical protein HELRODRAFT_183893             281   5e-85    Helobdella robusta
ref|XP_009061459.1|  hypothetical protein LOTGIDRAFT_219756             283   1e-84    Lottia gigantea
emb|CDY35847.1|  BnaC09g37790D                                          277   6e-84    Brassica napus [oilseed rape]
ref|XP_011660744.1|  PREDICTED: phosphoethanolamine N-methyltrans...    280   6e-84    Strongylocentrotus purpuratus [purple urchin]
ref|XP_005096335.1|  PREDICTED: phosphoethanolamine N-methyltrans...    280   1e-83    Aplysia californica
ref|XP_007440631.1|  PREDICTED: phosphomethylethanolamine N-methy...    280   1e-83    
ref|XP_005096334.1|  PREDICTED: phosphoethanolamine N-methyltrans...    280   2e-83    Aplysia californica
ref|XP_008620240.1|  hypothetical protein SDRG_15834                    277   2e-83    Saprolegnia diclina VS20
gb|KDO18852.1|  hypothetical protein SPRG_15851                         275   1e-82    Saprolegnia parasitica CBS 223.65
ref|XP_008620239.1|  hypothetical protein SDRG_15833                    277   2e-82    Saprolegnia diclina VS20
gb|AFK34318.1|  unknown                                                 266   6e-82    Lotus japonicus
gb|KDO18851.1|  hypothetical protein SPRG_15850                         273   9e-81    Saprolegnia parasitica CBS 223.65
gb|KEH21430.1|  phosphoethanolamine N-methyltransferase                 269   1e-79    Medicago truncatula
emb|CBY30945.1|  unnamed protein product                                258   6e-78    
emb|CBY12280.1|  unnamed protein product                                258   8e-78    
ref|XP_001768934.1|  predicted protein                                  251   3e-73    
ref|XP_011399976.1|  Phosphoethanolamine N-methyltransferase            244   7e-70    
gb|ETO16413.1|  hypothetical protein RFI_20925                          238   9e-70    
emb|CDX72992.1|  BnaC06g34400D                                          232   2e-69    
emb|CBY30905.1|  unnamed protein product                                230   5e-67    
ref|XP_009525359.1|  hypothetical protein PHYSODRAFT_345888             233   9e-66    
ref|WP_015250142.1|  methyltransferase family protein                   224   3e-65    
ref|WP_027370921.1|  hypothetical protein                               215   1e-61    
gb|AAM97038.1|  phosphoethanolamine N-methyltransferase, putative       218   3e-61    
gb|KHG05875.1|  Phosphoethanolamine N-methyltransferase 1 -like p...    207   6e-59    
emb|CDJ43178.1|  hypothetical protein, conserved                        207   2e-58    
ref|XP_001614208.1|  phosphoethanolamine N-methyltransferase            205   9e-58    
ref|XP_002259925.1|  phosphoethanolamine N-methyltransferase            204   1e-57    
pdb|4MWZ|A  Chain A, Crystal Structure Of N-methyl Transferase Fr...    204   1e-57    
emb|CDJ67597.1|  hypothetical protein, conserved                        205   2e-57    
pdb|4IV0|A  Chain A, Crystal Structure Of N-methyl Transferase Fr...    204   3e-57    
pdb|4IV8|A  Chain A, Crystal Structure Of N-methyl Transferase Fr...    204   3e-57    
emb|CDJ58552.1|  Sterol 24-C-methyltransferase, related                 204   5e-57    
gb|KJP85901.1|  hypothetical protein AK88_04433                         202   9e-57    
ref|XP_008243378.1|  PREDICTED: uncharacterized protein LOC103341609    206   5e-56    
ref|XP_008815737.1|  phosphoethanolamine N-methyltransferase            199   1e-55    
emb|CDI77742.1|  hypothetical protein, conserved                        199   2e-55    
gb|KDO64623.1|  hypothetical protein CISIN_1g011986mg                   204   3e-55    
ref|XP_006448235.1|  hypothetical protein CICLE_v10015117mg             204   3e-55    
ref|XP_006469187.1|  PREDICTED: uncharacterized protein LOC102611927    204   3e-55    
ref|XP_007223142.1|  hypothetical protein PRUPE_ppa005484mg             204   3e-55    
ref|XP_001350151.1|  phosphoethanolamine N-methyltransferase            197   8e-55    
gb|ETW16777.1|  hypothetical protein PFFVO_04306                        196   2e-54    
pdb|3UJD|A  Chain A, Phosphoethanolamine Methyltransferase Mutant...    196   3e-54    
pdb|3UJ6|A  Chain A, Semet Phosphoethanolamine Methyltransferase ...    195   3e-54    
emb|CDO66214.1|  phosphoethanolamine N-methyltransferase                195   5e-54    
gb|ADV61410.1|  Methyltransferase type 11                               194   6e-54    
pdb|4R6W|A  Chain A, Plasmodium Falciparum Phosphoethanolamine Me...    194   1e-53    
ref|XP_004223586.1|  phosphoethanolamine N-methyltransferase            193   2e-53    
pdb|3UJC|A  Chain A, Phosphoethanolamine Methyltransferase Mutant...    193   2e-53    
ref|XP_004298472.1|  PREDICTED: uncharacterized protein LOC101293390    198   4e-53    
emb|CDP00794.1|  unnamed protein product                                197   8e-53    
ref|XP_010274721.1|  PREDICTED: uncharacterized protein LOC104609967    197   1e-52    
emb|CDP00793.1|  unnamed protein product                                196   3e-52    
ref|XP_002278448.1|  PREDICTED: uncharacterized protein LOC100247...    196   3e-52    
emb|CDO98350.1|  unnamed protein product                                196   6e-52    
ref|XP_009351496.1|  PREDICTED: uncharacterized protein LOC103943...    195   6e-52    
ref|XP_009351495.1|  PREDICTED: uncharacterized protein LOC103943...    194   2e-51    
gb|ADI22186.1|  SAM-dependent methyltransferases                        185   1e-50    
ref|XP_011070615.1|  PREDICTED: uncharacterized protein LOC105156238    191   2e-50    
ref|XP_006451625.1|  hypothetical protein CICLE_v10008271mg             191   2e-50    
gb|KDO63819.1|  hypothetical protein CISIN_1g012208mg                   191   2e-50    
ref|XP_002280818.1|  PREDICTED: uncharacterized protein LOC100257599    191   2e-50    
gb|ETW47365.1|  hypothetical protein PFMALIP_04544                      184   2e-50    
ref|XP_002526034.1|  conserved hypothetical protein                     190   3e-50    
ref|XP_009356041.1|  PREDICTED: uncharacterized protein LOC103946...    189   3e-50    
ref|XP_008339539.1|  PREDICTED: uncharacterized protein LOC103402581    190   4e-50    
gb|KDP38068.1|  hypothetical protein JCGZ_04711                         185   9e-50    
ref|XP_006306318.1|  hypothetical protein CARUB_v10012188mg             186   1e-49    
ref|XP_009356040.1|  PREDICTED: uncharacterized protein LOC103946...    189   1e-49    
ref|XP_007036800.1|  Uncharacterized protein isoform 1                  189   1e-49    
gb|ETN82894.1|  methyltransferase domain protein                        186   5e-49    
gb|EYU24134.1|  hypothetical protein MIMGU_mgv1a006909mg                186   6e-49    
ref|XP_008364654.1|  PREDICTED: uncharacterized protein LOC103428325    186   9e-49    
ref|XP_011075478.1|  PREDICTED: uncharacterized protein LOC105159942    186   9e-49    
ref|XP_008240155.1|  PREDICTED: uncharacterized protein LOC103338699    186   1e-48    
ref|XP_012072237.1|  PREDICTED: uncharacterized protein LOC105634072    186   2e-48    
gb|AGM38074.1|  putative phosphoethanolamine N-methyltransferase        174   2e-48    
gb|EYU31822.1|  hypothetical protein MIMGU_mgv1a005827mg                185   2e-48    
gb|EPB71549.1|  methyltransferase domain protein                        184   3e-48    
ref|XP_004299533.1|  PREDICTED: uncharacterized protein LOC101308870    184   4e-48    
ref|XP_002635479.1|  C. briggsae CBR-PMT-2 protein                      184   4e-48    
gb|KFM82339.1|  Phosphoethanolamine N-methyltransferase                 176   5e-48    
ref|XP_007208790.1|  hypothetical protein PRUPE_ppa024185mg             184   6e-48    
ref|XP_008809805.1|  PREDICTED: uncharacterized protein LOC103721...    176   3e-47    
gb|ABK94591.1|  unknown                                                 176   4e-47    
gb|EGT43583.1|  CBN-PMT-2 protein                                       180   9e-47    
ref|XP_007153404.1|  hypothetical protein PHAVU_003G032200g             180   1e-46    
ref|XP_011654483.1|  PREDICTED: uncharacterized protein LOC101219...    176   1e-46    
ref|XP_002315877.1|  hypothetical protein POPTR_0010s12120g             176   2e-46    
ref|XP_006343177.1|  PREDICTED: uncharacterized protein LOC102605709    180   2e-46    
emb|CDJ96940.1|  Methyltransferase type 11 domain containing protein    179   2e-46    
pdb|4KRI|A  Chain A, Haemonchus Contortus Phospholethanolamine N-...    179   2e-46    
ref|XP_003115237.1|  CRE-PMT-2 protein                                  179   2e-46    
gb|EYC15765.1|  hypothetical protein Y032_0036g3344                     182   3e-46    
emb|CBY31441.1|  unnamed protein product                                181   5e-46    
ref|XP_008809804.1|  PREDICTED: uncharacterized protein LOC103721...    179   6e-46    
gb|ETK83144.1|  hypothetical protein L915_11579                         176   8e-46    
ref|XP_011038625.1|  PREDICTED: uncharacterized protein LOC105135...    177   8e-46    
ref|NP_504248.1|  Protein PMT-2                                         177   1e-45    
ref|XP_008450244.1|  PREDICTED: uncharacterized protein LOC103491...    173   1e-45    
pdb|4INE|A  Chain A, Crystal Structure Of N-methyl Transferase (p...    177   1e-45    
ref|XP_011654481.1|  PREDICTED: uncharacterized protein LOC101219...    177   2e-45    
ref|XP_008450243.1|  PREDICTED: uncharacterized protein LOC103491...    174   2e-45    
gb|KHN87001.1|  Phosphoethanolamine N-methyltransferase 1               172   2e-45    
ref|XP_008809803.1|  PREDICTED: uncharacterized protein LOC103721...    177   2e-45    
pdb|4KRH|A  Chain A, Semet Haemonchus Contortus Phosphoethanolami...    175   5e-45    
gb|ADI22300.1|  SAM-dependent methyltransferases                        168   1e-44    
ref|XP_008450239.1|  PREDICTED: uncharacterized protein LOC103491...    174   2e-44    
ref|WP_044253490.1|  hypothetical protein                               165   8e-44    
ref|XP_011465388.1|  PREDICTED: uncharacterized protein LOC101313...    168   9e-44    
ref|XP_009383629.1|  PREDICTED: uncharacterized protein LOC103971356    172   9e-44    
ref|XP_004301826.2|  PREDICTED: uncharacterized protein LOC101313...    170   1e-43    
gb|ABJ15736.1|  phosphoethanolamine N-methyltransferase                 160   3e-43    
ref|XP_010066617.1|  PREDICTED: uncharacterized protein LOC104453708    169   9e-43    
gb|KCW64578.1|  hypothetical protein EUGRSUZ_G02179                     169   2e-42    
ref|XP_010916523.1|  PREDICTED: uncharacterized protein LOC105041...    166   2e-42    
gb|KDO63820.1|  hypothetical protein CISIN_1g012208mg                   167   3e-42    
emb|CBY10458.1|  unnamed protein product                                171   3e-42    
ref|XP_010916521.1|  PREDICTED: uncharacterized protein LOC105041...    167   4e-42    
ref|XP_010916522.1|  PREDICTED: uncharacterized protein LOC105041...    166   7e-42    
ref|XP_006301406.1|  hypothetical protein CARUB_v10021837mg             167   8e-42    
ref|XP_010916520.1|  PREDICTED: uncharacterized protein LOC105041...    166   2e-41    
gb|EEE59778.1|  hypothetical protein OsJ_12284                          165   2e-41    
gb|AAK50125.1|AC087797_10  unknown protein                              165   2e-41    
gb|EEC76038.1|  hypothetical protein OsI_13211                          165   2e-41    
ref|XP_007036801.1|  Uncharacterized protein isoform 2                  164   3e-41    
ref|XP_006650471.1|  PREDICTED: uncharacterized protein LOC102707198    163   3e-41    
ref|XP_010427888.1|  PREDICTED: uncharacterized protein LOC104712648    164   6e-41    
dbj|BAJ84872.1|  predicted protein                                      163   8e-41    
ref|XP_010415782.1|  PREDICTED: uncharacterized protein LOC104701740    162   4e-40    
emb|CDJ34460.1|  Tocopherol o-methyltransferase, related                155   5e-40    
emb|CDX95562.1|  BnaC01g34540D                                          152   6e-40    
gb|EYU24135.1|  hypothetical protein MIMGU_mgv1a006909mg                157   5e-39    
gb|AFW04252.1|  integral membrane protein                               157   1e-38    
gb|AFW04245.1|  integral membrane protein                               157   1e-38    
ref|XP_007045169.1|  Uncharacterized protein TCM_010907                 150   2e-38    
gb|AFW04247.1|  integral membrane protein                               156   2e-38    
emb|CDX96485.1|  BnaA07g30960D                                          145   3e-38    
ref|XP_009106017.1|  PREDICTED: phosphoethanolamine N-methyltrans...    147   4e-38    
gb|KCW64580.1|  hypothetical protein EUGRSUZ_G02179                     154   5e-38    
gb|AFW04249.1|  integral membrane protein                               155   5e-38    
emb|CEF62382.1|  Hypothetical protein SRAE_1000065500                   155   5e-38    
ref|XP_003560765.1|  PREDICTED: uncharacterized protein LOC100834566    154   1e-37    
gb|ACF82847.1|  unknown                                                 149   1e-37    
gb|KJH40940.1|  methyltransferase domain protein                        148   2e-37    
tpg|DAA50915.1|  TPA: hypothetical protein ZEAMMB73_740209              149   6e-37    
emb|CDQ99741.1|  unnamed protein product                                146   1e-36    
ref|XP_004982032.1|  PREDICTED: uncharacterized protein LOC101771722    151   2e-36    
ref|XP_008678973.1|  PREDICTED: integral membrane protein DUF6 co...    150   2e-36    
ref|NP_001151096.1|  integral membrane protein DUF6 containing pr...    150   2e-36    
tpg|DAA50914.1|  TPA: hypothetical protein ZEAMMB73_740209              150   3e-36    
ref|WP_038744912.1|  methyltransferase                                  145   4e-36    
ref|WP_038793743.1|  methyltransferase                                  145   5e-36    
ref|WP_010118738.1|  methyltransferase                                  145   6e-36    
ref|XP_010471093.1|  PREDICTED: uncharacterized protein LOC104750930    149   8e-36    
ref|WP_038787099.1|  methyltransferase                                  144   9e-36    
ref|WP_010108956.1|  methyltransferase                                  144   9e-36    
gb|EBA45191.1|  cyclopropane-fatty-acyl-phospholipid synthase           144   1e-35    
gb|ABN93730.1|  cyclopropane-fatty-acyl-phospholipid synthase           144   1e-35    
ref|WP_017844165.1|  methyltransferase                                  144   1e-35    
ref|WP_004532962.1|  methyltransferase                                  144   1e-35    
gb|KIZ00504.1|  hypothetical protein MNEG_7455                          139   1e-35    
ref|WP_038727077.1|  methyltransferase                                  144   1e-35    
gb|EES21972.1|  cyclopropane-fatty-acyl-phospholipid synthase           144   2e-35    
gb|ACS88373.1|  putative protein                                        148   2e-35    
ref|WP_038733335.1|  methyltransferase                                  144   2e-35    
ref|WP_038773359.1|  methyltransferase                                  144   2e-35    
gb|EDO87536.1|  cyclopropane-fatty-acyl-phospholipid synthase           143   2e-35    
gb|EET03909.1|  cyclopropane-fatty-acyl-phospholipid synthase           143   2e-35    
ref|WP_045604271.1|  methyltransferase                                  143   2e-35    
ref|WP_038742287.1|  methyltransferase                                  143   2e-35    
gb|EEH25635.1|  cyclopropane-fatty-acyl-phospholipid synthase           143   2e-35    
ref|WP_004531806.1|  MULTISPECIES: methyltransferase                    143   3e-35    
ref|WP_038749925.1|  methyltransferase                                  143   3e-35    
ref|WP_041190171.1|  methyltransferase                                  143   3e-35    
emb|CFT78953.1|  phosphoethanolamine N-methyltransferase                143   3e-35    
ref|WP_011325999.1|  MULTISPECIES: methyltransferase                    143   3e-35    
ref|WP_038793751.1|  MULTISPECIES: methyltransferase                    143   3e-35    
ref|WP_009948102.1|  MULTISPECIES: methyltransferase                    143   3e-35    
ref|WP_038799888.1|  methyltransferase                                  143   4e-35    
ref|WP_041191926.1|  methyltransferase                                  142   4e-35    
ref|WP_044353071.1|  methyltransferase                                  142   4e-35    
ref|WP_030008425.1|  hypothetical protein                               141   5e-35    
ref|XP_006838423.1|  PREDICTED: uncharacterized protein LOC18429067     146   6e-35    
gb|ABN86795.1|  cyclopropane-fatty-acyl-phospholipid synthase           142   6e-35    
ref|WP_038755336.1|  methyltransferase                                  142   8e-35    
ref|XP_010097565.1|  putative transporter                               143   9e-35    
ref|WP_038749813.1|  methyltransferase                                  140   3e-34    
ref|WP_038775589.1|  methyltransferase                                  140   3e-34    
ref|WP_038779212.1|  methyltransferase                                  140   4e-34    
ref|WP_038739292.1|  MULTISPECIES: methyltransferase                    139   5e-34    
ref|WP_004557577.1|  phosphoethanolamine N-methyltransferase            139   5e-34    
ref|XP_002466595.1|  hypothetical protein SORBIDRAFT_01g010670          143   6e-34    
ref|WP_038730130.1|  methyltransferase                                  139   1e-33    
ref|XP_008450240.1|  PREDICTED: uncharacterized protein LOC103491...    142   1e-33    
ref|NP_001057355.1|  Os06g0269200                                       133   1e-33    
gb|KHN00145.1|  Phosphoethanolamine N-methyltransferase                 142   3e-33    
gb|ETL89749.1|  hypothetical protein L917_11367                         131   1e-32    
ref|WP_015877778.1|  methyltransferase                                  135   2e-32    
ref|WP_037711497.1|  hypothetical protein                               135   2e-32    
ref|XP_006655992.1|  PREDICTED: uncharacterized protein LOC102716419    129   4e-32    
ref|WP_042628692.1|  methyltransferase                                  132   2e-31    
gb|KGT03169.1|  ubiE/COQ5 methyltransferase family protein              132   3e-31    
gb|EEC80368.1|  hypothetical protein OsI_22478                          135   1e-30    
gb|EEE65496.1|  hypothetical protein OsJ_20924                          135   2e-30    
ref|WP_042734046.1|  hypothetical protein                               128   4e-30    
ref|XP_003560823.2|  PREDICTED: uncharacterized protein LOC100835286    131   6e-30    
gb|KGC36951.1|  ubiE/COQ5 methyltransferase family protein              126   7e-30    
gb|KGS76095.1|  ubiE/COQ5 methyltransferase family protein              126   8e-30    
gb|KGS61388.1|  ubiE/COQ5 methyltransferase family protein              126   9e-30    
gb|ETL89752.1|  hypothetical protein L917_11366                         128   2e-29    
gb|ACH61204.1|  phosphoethanolamine methyltransferase                   120   3e-29    
ref|WP_006201234.1|  SAM-dependent methlyltransferase                   126   3e-29    
gb|EPS69227.1|  hypothetical protein M569_05544                         127   3e-29    
ref|WP_023734633.1|  SAM-dependent methlyltransferase                   125   5e-29    
gb|AFW76908.1|  hypothetical protein ZEAMMB73_627373                    119   1e-28    
ref|WP_023711680.1|  MULTISPECIES: SAM-dependent methlyltransferase     124   1e-28    
emb|CEG03634.1|  unnamed protein product                                117   4e-28    
gb|ACH61228.1|  phosphoethanolamine methyltransferase                   117   7e-28    
ref|WP_023715007.1|  SAM-dependent methlyltransferase                   122   7e-28    
ref|WP_006328098.1|  Methyltransferase type 11                          122   9e-28    
gb|ABK93894.1|  unknown                                                 116   1e-27    
ref|WP_023696414.1|  MULTISPECIES: SAM-dependent methlyltransferase     122   1e-27    
ref|XP_004965202.1|  PREDICTED: uncharacterized protein LOC101760541    124   1e-27    
ref|WP_023690119.1|  MULTISPECIES: SAM-dependent methlyltransferase     121   2e-27    
ref|WP_028096892.1|  hypothetical protein                               121   2e-27    
ref|WP_023727283.1|  SAM-dependent methlyltransferase                   121   2e-27    
ref|WP_023683953.1|  MULTISPECIES: SAM-dependent methlyltransferase     120   2e-27    
ref|WP_023806546.1|  SAM-dependent methlyltransferase                   120   2e-27    
gb|ACN30664.1|  unknown                                                 122   6e-27    
ref|WP_035529505.1|  SAM-dependent methlyltransferase                   119   8e-27    
ref|WP_023754158.1|  MULTISPECIES: SAM-dependent methlyltransferase     119   9e-27    
ref|WP_023737415.1|  MULTISPECIES: SAM-dependent methlyltransferase     119   1e-26    



>ref|XP_006341528.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006341529.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X2 [Solanum tuberosum]
Length=491

 Score =   446 bits (1148),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 208/244 (85%), Positives = 228/244 (93%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             DTVQYKCSGILRYERVFG G+VSTGGLETTKEFVA LDLQPGQKVLDVGCGIGGG+FYMA
Sbjct  242   DTVQYKCSGILRYERVFGQGFVSTGGLETTKEFVAMLDLQPGQKVLDVGCGIGGGNFYMA  301

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E YDVHV+GIDLS NMI+ ALERAIGLKCAVEFEVADCTKKTYPD TFDVIYSRDTILHI
Sbjct  302   EKYDVHVVGIDLSINMISFALERAIGLKCAVEFEVADCTKKTYPDCTFDVIYSRDTILHI  361

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFRSFYKWL+PGGKVLI+DYCKR+GP S+EF  YIKQRGYDLHD E YGQMLRDA
Sbjct  362   QDKPALFRSFYKWLRPGGKVLISDYCKRAGPASKEFEGYIKQRGYDLHDVEAYGQMLRDA  421

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF +V+AEDRT+QF++VL+KELD VEKE+E+FI +FSE+DYN+IVGGWK KL R+SSGEQ
Sbjct  422   GFHEVVAEDRTEQFIEVLQKELDTVEKERESFIHEFSEQDYNEIVGGWKAKLIRSSSGEQ  481

Query  910   RWGL  899
             RWGL
Sbjct  482   RWGL  485



>ref|XP_011072995.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Sesamum 
indicum]
Length=491

 Score =   445 bits (1145),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 211/244 (86%), Positives = 227/244 (93%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYERVFG G+VSTGG++TT+EFVAKLDLQPGQKVLDVGCGIGGGDFYMA
Sbjct  242   DNVQYKSSGILRYERVFGQGFVSTGGIDTTREFVAKLDLQPGQKVLDVGCGIGGGDFYMA  301

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E YDVHV+GIDLS NMI+ ALERAIGLKCAVEFEVADCTKK YPD TFDVIYSRDTILHI
Sbjct  302   EKYDVHVVGIDLSVNMISFALERAIGLKCAVEFEVADCTKKEYPDGTFDVIYSRDTILHI  361

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFRSFYKWLKPGGKVLI+DYC+  G PS EFA YIKQRGYDLHD + YGQMLRDA
Sbjct  362   QDKPALFRSFYKWLKPGGKVLISDYCRNDGTPSTEFAEYIKQRGYDLHDVKAYGQMLRDA  421

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF++VIAEDRTDQF+KVL+KEL+AVEKEKEAFIQDFSEEDY+DIVGGWK KL R+SSGEQ
Sbjct  422   GFDEVIAEDRTDQFIKVLEKELNAVEKEKEAFIQDFSEEDYSDIVGGWKAKLVRSSSGEQ  481

Query  910   RWGL  899
             RWGL
Sbjct  482   RWGL  485



>ref|XP_002532097.1| phosphoethanolamine n-methyltransferase, putative [Ricinus communis]
 gb|EEF30287.1| phosphoethanolamine n-methyltransferase, putative [Ricinus communis]
Length=492

 Score =   445 bits (1145),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 209/244 (86%), Positives = 226/244 (93%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK +GILRYERVFGPG+VSTGG+ETTKEFVAKLDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  243   DNVQYKSNGILRYERVFGPGFVSTGGVETTKEFVAKLDLKPGQKVLDVGCGIGGGDFYMA  302

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DV VIGIDLS NMI+ ALERAIGLKCAVEFEVADCTKKTYPD +FDVIYSRDTILHI
Sbjct  303   ENFDVEVIGIDLSINMISFALERAIGLKCAVEFEVADCTKKTYPDNSFDVIYSRDTILHI  362

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFRSFYKWLKPGGKVLI+DYCK +G PS EFA YIKQRGYDLHD + YGQML+DA
Sbjct  363   QDKPALFRSFYKWLKPGGKVLISDYCKSAGTPSSEFAEYIKQRGYDLHDVKAYGQMLKDA  422

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF+DVIAEDRTDQF +VLK+ELD +EKEK+ FI DFSEEDYNDIVGGWK KL R+SSGEQ
Sbjct  423   GFDDVIAEDRTDQFNQVLKRELDVIEKEKDEFIHDFSEEDYNDIVGGWKAKLIRSSSGEQ  482

Query  910   RWGL  899
             RWGL
Sbjct  483   RWGL  486



>ref|NP_001234549.1| phosphoethanolamine N-methyltransferase [Solanum lycopersicum]
 gb|AAG59894.1|AF328858_1 phosphoethanolamine N-methyltransferase [Solanum lycopersicum]
Length=491

 Score =   444 bits (1143),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 208/244 (85%), Positives = 227/244 (93%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             DTVQYKCSGILRYERVFG G+VSTGGLETTKEFVA LDLQ GQKVLDVGCGIGGG+FYMA
Sbjct  242   DTVQYKCSGILRYERVFGQGFVSTGGLETTKEFVAMLDLQRGQKVLDVGCGIGGGNFYMA  301

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E YDVHV+GIDLS NMI+ ALERAIGLKCAVEFEVADCTKKTYPD TFDVIYSRDTILHI
Sbjct  302   EKYDVHVVGIDLSINMISFALERAIGLKCAVEFEVADCTKKTYPDCTFDVIYSRDTILHI  361

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFRSFYKWL+PGGKVLI+DYCKR+GP S+EF  YIKQRGYDLHD E YGQMLRDA
Sbjct  362   QDKPALFRSFYKWLRPGGKVLISDYCKRAGPASKEFEGYIKQRGYDLHDVEAYGQMLRDA  421

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF +V+AEDRT+QF+KVL+KELD VEKE+E+FI +FSE+DYN+IVGGWK KL R+SSGEQ
Sbjct  422   GFHEVVAEDRTEQFIKVLQKELDTVEKERESFIHEFSEQDYNEIVGGWKSKLIRSSSGEQ  481

Query  910   RWGL  899
             RWGL
Sbjct  482   RWGL  485



>ref|XP_009776424.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Nicotiana 
sylvestris]
Length=499

 Score =   445 bits (1144),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 207/244 (85%), Positives = 227/244 (93%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYKCSGILRYERVFG GYVSTGG++TTKEFV+ LDLQPGQKVLDVGCGIGGGDFYMA
Sbjct  250   DNVQYKCSGILRYERVFGEGYVSTGGVDTTKEFVSMLDLQPGQKVLDVGCGIGGGDFYMA  309

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             ENYDVHV+ IDLS NMI+ ALERAIGLKCAVEFEVADCTKKTYPD TFDVIYSRDTILHI
Sbjct  310   ENYDVHVVAIDLSINMISFALERAIGLKCAVEFEVADCTKKTYPDGTFDVIYSRDTILHI  369

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFRSFY+WLKPGGKVLI+DYCK  GP SEEFA YIKQRGYDLHD  EYGQMLRDA
Sbjct  370   QDKPALFRSFYRWLKPGGKVLISDYCKSPGPASEEFAGYIKQRGYDLHDVAEYGQMLRDA  429

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF++VIAEDRT+QF+ VL+KEL+ VEKE+++FIQ+FSE+DYN+IVGGWK KL R+SSGEQ
Sbjct  430   GFDEVIAEDRTEQFINVLQKELNTVEKERDSFIQEFSEQDYNEIVGGWKAKLIRSSSGEQ  489

Query  910   RWGL  899
             RWGL
Sbjct  490   RWGL  493



>ref|XP_009614862.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=499

 Score =   444 bits (1143),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 207/244 (85%), Positives = 226/244 (93%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYKCSGILRYERVFG GYVSTGG++TTKEFV+ LDLQPGQKVLDVGCGIGGGDFYMA
Sbjct  250   DNVQYKCSGILRYERVFGEGYVSTGGVDTTKEFVSMLDLQPGQKVLDVGCGIGGGDFYMA  309

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             ENYDVHV+ IDLS NMI+ ALERAIGLKCAVEFEVADCTKKTYPD TFDVIYSRDTILHI
Sbjct  310   ENYDVHVVAIDLSINMISFALERAIGLKCAVEFEVADCTKKTYPDGTFDVIYSRDTILHI  369

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFRSFY WLKPGGKVLI+DYCK  GP SEEFA YIKQRGYDLHD  EYGQMLRDA
Sbjct  370   QDKPALFRSFYNWLKPGGKVLISDYCKSPGPASEEFAGYIKQRGYDLHDVAEYGQMLRDA  429

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF++VIAEDRT+QF+ VL+KEL+ VEKE+++FIQ+FSE+DYN+IVGGWK KL R+SSGEQ
Sbjct  430   GFDEVIAEDRTEQFINVLQKELNTVEKERDSFIQEFSEQDYNEIVGGWKAKLIRSSSGEQ  489

Query  910   RWGL  899
             RWGL
Sbjct  490   RWGL  493



>ref|XP_011084227.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X1 [Sesamum indicum]
Length=494

 Score =   444 bits (1141),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 210/244 (86%), Positives = 227/244 (93%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             DTVQYK +GILRYERVFG GYVSTGG++TTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA
Sbjct  245   DTVQYKSNGILRYERVFGEGYVSTGGIDTTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  304

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             + YDVHV+GIDLS NMI+ ALERAIGLKCAVEFEVADCTKK YPD TFDVIYSRDTILHI
Sbjct  305   DKYDVHVVGIDLSINMISFALERAIGLKCAVEFEVADCTKKEYPDGTFDVIYSRDTILHI  364

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFRSFY+WLKPGGKVLI+DYC+ SG PS EFA YIKQRGYDLHD + YGQMLRDA
Sbjct  365   QDKPALFRSFYRWLKPGGKVLISDYCRSSGTPSAEFAGYIKQRGYDLHDVDTYGQMLRDA  424

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF +VIAEDRT+QF+KVL+KELDAVEK+KE FI+DFSEEDYNDIVGGWK KL R+SSGEQ
Sbjct  425   GFAEVIAEDRTEQFIKVLEKELDAVEKDKETFIRDFSEEDYNDIVGGWKAKLVRSSSGEQ  484

Query  910   RWGL  899
             RWGL
Sbjct  485   RWGL  488



>ref|XP_011084235.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X2 [Sesamum indicum]
Length=491

 Score =   444 bits (1141),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 210/244 (86%), Positives = 227/244 (93%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             DTVQYK +GILRYERVFG GYVSTGG++TTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA
Sbjct  242   DTVQYKSNGILRYERVFGEGYVSTGGIDTTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  301

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             + YDVHV+GIDLS NMI+ ALERAIGLKCAVEFEVADCTKK YPD TFDVIYSRDTILHI
Sbjct  302   DKYDVHVVGIDLSINMISFALERAIGLKCAVEFEVADCTKKEYPDGTFDVIYSRDTILHI  361

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFRSFY+WLKPGGKVLI+DYC+ SG PS EFA YIKQRGYDLHD + YGQMLRDA
Sbjct  362   QDKPALFRSFYRWLKPGGKVLISDYCRSSGTPSAEFAGYIKQRGYDLHDVDTYGQMLRDA  421

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF +VIAEDRT+QF+KVL+KELDAVEK+KE FI+DFSEEDYNDIVGGWK KL R+SSGEQ
Sbjct  422   GFAEVIAEDRTEQFIKVLEKELDAVEKDKETFIRDFSEEDYNDIVGGWKAKLVRSSSGEQ  481

Query  910   RWGL  899
             RWGL
Sbjct  482   RWGL  485



>ref|XP_009757363.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Nicotiana 
sylvestris]
Length=491

 Score =   441 bits (1133),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 206/244 (84%), Positives = 225/244 (92%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             DTVQYKCSGILRYE VFG G+VSTGG+ETTKEFVA L+LQPGQKVLDVGCGIGGGDFYMA
Sbjct  242   DTVQYKCSGILRYEHVFGQGFVSTGGIETTKEFVAMLNLQPGQKVLDVGCGIGGGDFYMA  301

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             + YDVHV+GIDLS NMI+ ALERAIGLKCAVEFEVADCTKKTYPD  FDVIYSRDTILHI
Sbjct  302   DKYDVHVVGIDLSINMISFALERAIGLKCAVEFEVADCTKKTYPDGAFDVIYSRDTILHI  361

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFRSFYKWLKPGGKVLI+DYCK++G  SEEFA YIKQRGYDLHD E YGQMLRDA
Sbjct  362   QDKPALFRSFYKWLKPGGKVLISDYCKKAGTASEEFAGYIKQRGYDLHDVEAYGQMLRDA  421

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF +V+AEDRT+QF+ VL+KELD VEKE+E+FI DFSE+DYN+IVGGWK KL R+SSGEQ
Sbjct  422   GFNEVVAEDRTEQFIGVLQKELDTVEKERESFIHDFSEQDYNEIVGGWKAKLIRSSSGEQ  481

Query  910   RWGL  899
             RWGL
Sbjct  482   RWGL  485



>ref|XP_009616694.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Nicotiana 
tomentosiformis]
Length=491

 Score =   440 bits (1131),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 205/244 (84%), Positives = 226/244 (93%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             DTVQYKCSGILRYERVFG G+VSTGG+ETTKEFVA L+LQPGQKVLDVGCGIGGGDFYMA
Sbjct  242   DTVQYKCSGILRYERVFGQGFVSTGGIETTKEFVAMLNLQPGQKVLDVGCGIGGGDFYMA  301

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             + YDVHV+GIDLS NMI+ ALERAIGLKCAVEFEVADCTKKTYPD  FDVIYSRDTILHI
Sbjct  302   DKYDVHVVGIDLSINMISFALERAIGLKCAVEFEVADCTKKTYPDGAFDVIYSRDTILHI  361

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFRSFYKWLKPGGKVLI+DYCK++G  SEEFA YIKQRGYDLHD E YGQMLRDA
Sbjct  362   QDKPALFRSFYKWLKPGGKVLISDYCKKAGTASEEFAGYIKQRGYDLHDVEAYGQMLRDA  421

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF +V+AEDRT+QF+ VL+KELD VEKE+++FI +FSE+DYN+IVGGWK KL R+SSGEQ
Sbjct  422   GFNEVVAEDRTEQFVGVLQKELDTVEKERKSFIHEFSEQDYNEIVGGWKAKLIRSSSGEQ  481

Query  910   RWGL  899
             RWGL
Sbjct  482   RWGL  485



>emb|CDO98349.1| unnamed protein product [Coffea canephora]
Length=491

 Score =   436 bits (1121),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 200/244 (82%), Positives = 226/244 (93%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYERVFGPG+VSTGG++TT+EFV KLDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  242   DNVQYKSSGILRYERVFGPGFVSTGGIDTTREFVGKLDLRPGQKVLDVGCGIGGGDFYMA  301

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E YD HV+GIDLS NM+++ALERAIGL+C+VEFEVADCTKKTYPD +FDVIYSRDTILHI
Sbjct  302   EKYDAHVVGIDLSINMVSLALERAIGLRCSVEFEVADCTKKTYPDGSFDVIYSRDTILHI  361

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALF+SFYKWLKPGG VLI+DYCKR+GPPS++F  YIKQRGYDLHD E YGQML+DA
Sbjct  362   QDKPALFKSFYKWLKPGGTVLISDYCKRAGPPSDDFVKYIKQRGYDLHDVEAYGQMLKDA  421

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF++VIAEDRT QF+ VL+KEL+ VEK++EAFI DFSEEDYNDIVGGWK KL R+SSGEQ
Sbjct  422   GFDEVIAEDRTHQFINVLQKELELVEKDREAFISDFSEEDYNDIVGGWKAKLLRSSSGEQ  481

Query  910   RWGL  899
             RWGL
Sbjct  482   RWGL  485



>ref|XP_004241642.1| PREDICTED: phosphoethanolamine N-methyltransferase [Solanum lycopersicum]
Length=494

 Score =   436 bits (1121),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 202/244 (83%), Positives = 226/244 (93%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             DTVQYK +GILRYERVFG G+VSTGG++TTKEFVA +DLQPG+KVLDVGCGIGGGDFYMA
Sbjct  245   DTVQYKSNGILRYERVFGAGFVSTGGIDTTKEFVAMMDLQPGEKVLDVGCGIGGGDFYMA  304

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E YDVHV+GIDLS NMIT+A ERAIG KCAVEFEVADCT KTYP+ +FDVIYSRDTILHI
Sbjct  305   EKYDVHVVGIDLSVNMITLAFERAIGRKCAVEFEVADCTVKTYPEESFDVIYSRDTILHI  364

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFRSFYKWLKPGG+VLI+DYCK++GP SE+FAAYIKQRGYDLHD E YGQMLRDA
Sbjct  365   QDKPALFRSFYKWLKPGGRVLISDYCKKAGPASEDFAAYIKQRGYDLHDVEAYGQMLRDA  424

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF +VIA+DRT+QFM+VL+KELD VE E+E FIQ+FSE+DYNDIVGGWK KL R+SSGEQ
Sbjct  425   GFNEVIADDRTEQFMQVLQKELDTVENERELFIQEFSEQDYNDIVGGWKAKLVRSSSGEQ  484

Query  910   RWGL  899
             RWGL
Sbjct  485   RWGL  488



>ref|XP_010677350.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Beta 
vulgaris subsp. vulgaris]
Length=449

 Score =   434 bits (1115),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 205/244 (84%), Positives = 221/244 (91%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             DTVQYK  GILRYERVFGPGYVSTGGLETTKEFVAKLDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  197   DTVQYKAQGILRYERVFGPGYVSTGGLETTKEFVAKLDLKPGQKVLDVGCGIGGGDFYMA  256

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN++V V+GIDLS NMI+IALERA+GL CAVEFEVADCT  TYPD  FDVIYSRDTILHI
Sbjct  257   ENFNVEVVGIDLSINMISIALERAVGLNCAVEFEVADCTTITYPDNAFDVIYSRDTILHI  316

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFRSFYKWLKPGGKVLI+DYC+ +G  S EFA YIKQRGYDLHD + YGQMLRDA
Sbjct  317   QDKPALFRSFYKWLKPGGKVLISDYCRSAGTASPEFAEYIKQRGYDLHDVQAYGQMLRDA  376

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF++VIAEDRTDQF KVL++EL+AVEKEKE FI DFSEEDY+ IVGGWK KL R SSGEQ
Sbjct  377   GFDEVIAEDRTDQFSKVLERELNAVEKEKERFITDFSEEDYDAIVGGWKSKLVRVSSGEQ  436

Query  910   RWGL  899
             RWGL
Sbjct  437   RWGL  440



>ref|XP_010033717.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 [Eucalyptus 
grandis]
 gb|KCW84063.1| hypothetical protein EUGRSUZ_B00946 [Eucalyptus grandis]
Length=491

 Score =   435 bits (1119),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 205/244 (84%), Positives = 225/244 (92%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYKCSGILRYERVFG G+VSTGG++TTKEFVAKL+LQPGQKVLDVGCGIGGGDFYMA
Sbjct  242   DNVQYKCSGILRYERVFGQGFVSTGGIDTTKEFVAKLELQPGQKVLDVGCGIGGGDFYMA  301

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E +DV V+GIDLS NMI+ ALERAIGLKC+VEFEVADCTKK+YPD TFDVIYSRDTILHI
Sbjct  302   EKFDVEVVGIDLSINMISFALERAIGLKCSVEFEVADCTKKSYPDNTFDVIYSRDTILHI  361

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFRSF+KWLKPGGKVLI+DYCK +G PS EFAAYIKQRGYDLHD + YGQMLRDA
Sbjct  362   QDKPALFRSFFKWLKPGGKVLISDYCKHAGTPSPEFAAYIKQRGYDLHDVKAYGQMLRDA  421

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF +VIAEDRTDQF+KVL+KEL+AVEK+K+ FI DFSEEDYNDIVGGWK KL R+SS EQ
Sbjct  422   GFAEVIAEDRTDQFIKVLEKELNAVEKDKDTFISDFSEEDYNDIVGGWKAKLMRSSSSEQ  481

Query  910   RWGL  899
              WGL
Sbjct  482   CWGL  485



>ref|XP_006365411.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Solanum 
tuberosum]
Length=494

 Score =   435 bits (1118),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 203/244 (83%), Positives = 225/244 (92%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             DTVQYK +GILRYERVFG G+VSTGG++TTKEFVA +DLQPG+KVLDVGCGIGGGDFYMA
Sbjct  245   DTVQYKSNGILRYERVFGAGFVSTGGIDTTKEFVAMMDLQPGEKVLDVGCGIGGGDFYMA  304

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E YDVHV+GIDLS NMIT+A ERAIG KCAVEFEVADCT KTYP+ +FDVIYSRDTILHI
Sbjct  305   EKYDVHVVGIDLSVNMITLAFERAIGRKCAVEFEVADCTVKTYPEESFDVIYSRDTILHI  364

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFRSFYKWLKPGG+VLI+DYCK+SGP SE+FA YIKQRGYDLHD E YGQMLRDA
Sbjct  365   QDKPALFRSFYKWLKPGGRVLISDYCKKSGPASEDFAVYIKQRGYDLHDVEAYGQMLRDA  424

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF +VIAEDRT+QFMKVL+KELD VE E+E+FIQ+FSE+DY DIVGGWK KL R+SSGEQ
Sbjct  425   GFNEVIAEDRTEQFMKVLQKELDIVENERESFIQEFSEQDYYDIVGGWKAKLVRSSSGEQ  484

Query  910   RWGL  899
             RWGL
Sbjct  485   RWGL  488



>ref|XP_011039130.1| PREDICTED: phosphomethylethanolamine N-methyltransferase [Populus 
euphratica]
Length=490

 Score =   435 bits (1118),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 205/244 (84%), Positives = 224/244 (92%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK +GILRYERVFG G+VSTGG+ETTKEFV KLDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  241   DNVQYKSNGILRYERVFGQGFVSTGGMETTKEFVEKLDLKPGQKVLDVGCGIGGGDFYMA  300

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DV V+GIDLS NMI+ ALERAIGLKC+VEFEVADCT KTYPD TFDVIYSRDTILHI
Sbjct  301   ENFDVEVVGIDLSINMISFALERAIGLKCSVEFEVADCTTKTYPDDTFDVIYSRDTILHI  360

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFRSF+KWLKPGGKVLI+DYCKR+G PS EFA YIKQRGYDLHD E YGQMLRDA
Sbjct  361   QDKPALFRSFFKWLKPGGKVLISDYCKRAGTPSPEFAEYIKQRGYDLHDVEAYGQMLRDA  420

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF++VIAEDRTDQF +VL +EL+A+EKEK+ FI DFSEEDYNDIVGGWK KL R+SSGEQ
Sbjct  421   GFDEVIAEDRTDQFNQVLLRELNAIEKEKDEFILDFSEEDYNDIVGGWKAKLIRSSSGEQ  480

Query  910   RWGL  899
             RWGL
Sbjct  481   RWGL  484



>emb|CBI26879.3| unnamed protein product [Vitis vinifera]
Length=475

 Score =   434 bits (1115),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 203/244 (83%), Positives = 224/244 (92%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYKC GILRYERVFG G+VSTGGLETTKEFV KLDL+P QKVLDVGCGIGGGDFYMA
Sbjct  226   DNVQYKCRGILRYERVFGEGFVSTGGLETTKEFVTKLDLKPSQKVLDVGCGIGGGDFYMA  285

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E++DV V+GIDLS NMI+IALERAIG KC VEFEVADCTKKTYPD TFDVIYSRDTILHI
Sbjct  286   EDFDVEVVGIDLSINMISIALERAIGRKCLVEFEVADCTKKTYPDNTFDVIYSRDTILHI  345

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALF+SF+KWLKPGGKVLITDYCKR+GPPS EF  YI+QRGYDLHD + YGQML+DA
Sbjct  346   QDKPALFKSFFKWLKPGGKVLITDYCKRAGPPSPEFQEYIEQRGYDLHDVKAYGQMLKDA  405

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF +VIAEDRT+QF+KVL++E+DAVEK K+ FIQDFSEEDYN+IVGGWK KL R+SSGEQ
Sbjct  406   GFCEVIAEDRTEQFIKVLQREMDAVEKNKDEFIQDFSEEDYNEIVGGWKSKLNRSSSGEQ  465

Query  910   RWGL  899
             RWGL
Sbjct  466   RWGL  469



>ref|XP_002282182.1| PREDICTED: phosphomethylethanolamine N-methyltransferase [Vitis 
vinifera]
 emb|CBI15568.3| unnamed protein product [Vitis vinifera]
Length=491

 Score =   433 bits (1114),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 199/244 (82%), Positives = 225/244 (92%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYKC+GILRYERVFG G+VSTGG+ETTKEFV KLDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  242   DNVQYKCNGILRYERVFGEGFVSTGGIETTKEFVGKLDLKPGQKVLDVGCGIGGGDFYMA  301

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DV V+GIDLS NM++ ALERAIGLKC+VEFEVADCTKK+YPD TFDVIYSRDTILHI
Sbjct  302   ENFDVEVVGIDLSINMVSFALERAIGLKCSVEFEVADCTKKSYPDNTFDVIYSRDTILHI  361

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALF+SF+KWLKPGGKVLI+DYCKR+GPPS EF+ YIKQRGYDLHD E YG+MLRDA
Sbjct  362   QDKPALFKSFFKWLKPGGKVLISDYCKRAGPPSSEFSEYIKQRGYDLHDVEAYGEMLRDA  421

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF +VIAEDRTDQF++VL++EL+AVE  K  F+QDFSE+DYN+IV GWK KL R+SSGEQ
Sbjct  422   GFIEVIAEDRTDQFLQVLQRELNAVETNKNEFVQDFSEDDYNEIVDGWKAKLMRSSSGEQ  481

Query  910   RWGL  899
             RWGL
Sbjct  482   RWGL  485



>ref|XP_004299531.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Fragaria vesca subsp. vesca]
Length=500

 Score =   434 bits (1115),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 202/244 (83%), Positives = 225/244 (92%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK +GILRYERVFGPG+VSTGGLETTKEFVAKL+L+PGQKVLDVGCGIGGGDFYMA
Sbjct  251   DNVQYKSNGILRYERVFGPGFVSTGGLETTKEFVAKLELKPGQKVLDVGCGIGGGDFYMA  310

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
               +DV V+GIDLS NMI+ ALE++IGLKCAVEFEVADCT KTYPD +FDVIYSRDTILHI
Sbjct  311   STFDVEVVGIDLSVNMISFALEQSIGLKCAVEFEVADCTTKTYPDNSFDVIYSRDTILHI  370

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFRSFYKWLKPGGKVLITDYC+ +G PS EFA YIKQRGYDLHD + YGQML DA
Sbjct  371   QDKPALFRSFYKWLKPGGKVLITDYCRSAGTPSAEFAEYIKQRGYDLHDVKAYGQMLTDA  430

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF DV+AEDRTDQF++VL++EL+AVEK+KEAFI+DFSEEDYNDIVGGWK KL RT+SGEQ
Sbjct  431   GFVDVVAEDRTDQFIRVLQRELNAVEKDKEAFIKDFSEEDYNDIVGGWKAKLVRTNSGEQ  490

Query  910   RWGL  899
             +WGL
Sbjct  491   KWGL  494



>gb|AGI56231.1| phosphoethanolamine N-methyltransferase [Lycium barbarum]
Length=498

 Score =   433 bits (1114),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 202/244 (83%), Positives = 222/244 (91%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYKCSGILRYERVFG GYVSTGGL+TTKEFV+ LDLQPGQKVLDVGCGIGGGDFYMA
Sbjct  250   DNVQYKCSGILRYERVFGEGYVSTGGLDTTKEFVSMLDLQPGQKVLDVGCGIGGGDFYMA  309

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             ENYDVHV+ IDLS NMI+ ALER+IG+KCAVEFEVADCTKKTYPD TFDVIYSRDTILHI
Sbjct  310   ENYDVHVVAIDLSINMISFALERSIGIKCAVEFEVADCTKKTYPDGTFDVIYSRDTILHI  369

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFRSFYKWLKPGGKVLI+DYC+   P SEE A YIKQRGYDLHD   YGQMLRDA
Sbjct  370   QDKPALFRSFYKWLKPGGKVLISDYCRSPEPASEELAGYIKQRGYDLHDVAAYGQMLRDA  429

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF++VIAEDRT QF+ VL+KEL+ VEKE+++FIQ+FSE+DYN+IVG WK KL R+SSGEQ
Sbjct  430   GFDEVIAEDRTAQFINVLQKELNTVEKERDSFIQEFSEQDYNEIVGSWKAKLIRSSSGEQ  489

Query  910   RWGL  899
             RWGL
Sbjct  490   RWGL  493



>ref|XP_010655650.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X1 [Vitis vinifera]
Length=494

 Score =   433 bits (1113),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 203/244 (83%), Positives = 224/244 (92%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYKC GILRYERVFG G+VSTGGLETTKEFV KLDL+P QKVLDVGCGIGGGDFYMA
Sbjct  245   DNVQYKCRGILRYERVFGEGFVSTGGLETTKEFVTKLDLKPSQKVLDVGCGIGGGDFYMA  304

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E++DV V+GIDLS NMI+IALERAIG KC VEFEVADCTKKTYPD TFDVIYSRDTILHI
Sbjct  305   EDFDVEVVGIDLSINMISIALERAIGRKCLVEFEVADCTKKTYPDNTFDVIYSRDTILHI  364

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALF+SF+KWLKPGGKVLITDYCKR+GPPS EF  YI+QRGYDLHD + YGQML+DA
Sbjct  365   QDKPALFKSFFKWLKPGGKVLITDYCKRAGPPSPEFQEYIEQRGYDLHDVKAYGQMLKDA  424

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF +VIAEDRT+QF+KVL++E+DAVEK K+ FIQDFSEEDYN+IVGGWK KL R+SSGEQ
Sbjct  425   GFCEVIAEDRTEQFIKVLQREMDAVEKNKDEFIQDFSEEDYNEIVGGWKSKLNRSSSGEQ  484

Query  910   RWGL  899
             RWGL
Sbjct  485   RWGL  488



>ref|XP_002891445.1| hypothetical protein ARALYDRAFT_473996 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67704.1| hypothetical protein ARALYDRAFT_473996 [Arabidopsis lyrata subsp. 
lyrata]
Length=491

 Score =   432 bits (1112),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 202/244 (83%), Positives = 223/244 (91%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYERVFG GYVSTGG ETTKEFVAK+DL+PGQKVLDVGCGIGGGDFYMA
Sbjct  242   DNVQYKSSGILRYERVFGEGYVSTGGFETTKEFVAKMDLKPGQKVLDVGCGIGGGDFYMA  301

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DVHV+GIDLS NMI+ ALERAIGLKC+VEFEVADCT KTYPD +FDVIYSRDTILHI
Sbjct  302   ENFDVHVVGIDLSVNMISFALERAIGLKCSVEFEVADCTTKTYPDNSFDVIYSRDTILHI  361

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFR+F+KWLKPGGKVLITDYC+ +  PS +FA YI+QRGYDLHD + YGQML+DA
Sbjct  362   QDKPALFRAFFKWLKPGGKVLITDYCRSAETPSPDFAEYIEQRGYDLHDVQAYGQMLKDA  421

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GFEDVIAEDRTDQF++VL++ELD VEKEKE FI DFSEEDYNDIVGGW  KL RT+SGEQ
Sbjct  422   GFEDVIAEDRTDQFVRVLRRELDKVEKEKEEFISDFSEEDYNDIVGGWTAKLERTASGEQ  481

Query  910   RWGL  899
             +WGL
Sbjct  482   KWGL  485



>ref|XP_002284594.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Vitis vinifera]
Length=490

 Score =   432 bits (1111),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 203/244 (83%), Positives = 224/244 (92%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYKC GILRYERVFG G+VSTGGLETTKEFV KLDL+P QKVLDVGCGIGGGDFYMA
Sbjct  241   DNVQYKCRGILRYERVFGEGFVSTGGLETTKEFVTKLDLKPSQKVLDVGCGIGGGDFYMA  300

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E++DV V+GIDLS NMI+IALERAIG KC VEFEVADCTKKTYPD TFDVIYSRDTILHI
Sbjct  301   EDFDVEVVGIDLSINMISIALERAIGRKCLVEFEVADCTKKTYPDNTFDVIYSRDTILHI  360

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALF+SF+KWLKPGGKVLITDYCKR+GPPS EF  YI+QRGYDLHD + YGQML+DA
Sbjct  361   QDKPALFKSFFKWLKPGGKVLITDYCKRAGPPSPEFQEYIEQRGYDLHDVKAYGQMLKDA  420

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF +VIAEDRT+QF+KVL++E+DAVEK K+ FIQDFSEEDYN+IVGGWK KL R+SSGEQ
Sbjct  421   GFCEVIAEDRTEQFIKVLQREMDAVEKNKDEFIQDFSEEDYNEIVGGWKSKLNRSSSGEQ  480

Query  910   RWGL  899
             RWGL
Sbjct  481   RWGL  484



>ref|XP_006843796.1| PREDICTED: phosphomethylethanolamine N-methyltransferase isoform 
X1 [Amborella trichopoda]
 gb|ERN05471.1| hypothetical protein AMTR_s00007p00250490 [Amborella trichopoda]
Length=489

 Score =   432 bits (1111),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 203/244 (83%), Positives = 223/244 (91%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQY CSGILRYERVFG G+VSTGG+ETTK+FV+KL+L+PGQKVLDVGCGIGGGDFYMA
Sbjct  240   DNVQYNCSGILRYERVFGEGFVSTGGIETTKDFVSKLELKPGQKVLDVGCGIGGGDFYMA  299

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E YDV V+GIDLS NMI+ A+ERAIG KCAVEFEVADCTKKTYPD TFDV+YSRDTILHI
Sbjct  300   EKYDVEVVGIDLSINMISFAIERAIGRKCAVEFEVADCTKKTYPDNTFDVMYSRDTILHI  359

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKP+LFR+F+KWLKPGGKVLI+DYCKRSGPPS EFA YIKQRGYDLHD E YGQMLRDA
Sbjct  360   QDKPSLFRTFFKWLKPGGKVLISDYCKRSGPPSPEFAEYIKQRGYDLHDVEAYGQMLRDA  419

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF DV AEDRTDQF+KVL+KELDAVEK+K++FI DFSEEDY DIV GWK KL R+S GEQ
Sbjct  420   GFHDVTAEDRTDQFLKVLQKELDAVEKDKDSFIGDFSEEDYFDIVNGWKAKLKRSSGGEQ  479

Query  910   RWGL  899
             RWGL
Sbjct  480   RWGL  483



>ref|XP_011623100.1| PREDICTED: phosphomethylethanolamine N-methyltransferase isoform 
X2 [Amborella trichopoda]
Length=491

 Score =   432 bits (1110),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 203/244 (83%), Positives = 223/244 (91%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQY CSGILRYERVFG G+VSTGG+ETTK+FV+KL+L+PGQKVLDVGCGIGGGDFYMA
Sbjct  242   DNVQYNCSGILRYERVFGEGFVSTGGIETTKDFVSKLELKPGQKVLDVGCGIGGGDFYMA  301

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E YDV V+GIDLS NMI+ A+ERAIG KCAVEFEVADCTKKTYPD TFDV+YSRDTILHI
Sbjct  302   EKYDVEVVGIDLSINMISFAIERAIGRKCAVEFEVADCTKKTYPDNTFDVMYSRDTILHI  361

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKP+LFR+F+KWLKPGGKVLI+DYCKRSGPPS EFA YIKQRGYDLHD E YGQMLRDA
Sbjct  362   QDKPSLFRTFFKWLKPGGKVLISDYCKRSGPPSPEFAEYIKQRGYDLHDVEAYGQMLRDA  421

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF DV AEDRTDQF+KVL+KELDAVEK+K++FI DFSEEDY DIV GWK KL R+S GEQ
Sbjct  422   GFHDVTAEDRTDQFLKVLQKELDAVEKDKDSFIGDFSEEDYFDIVNGWKAKLKRSSGGEQ  481

Query  910   RWGL  899
             RWGL
Sbjct  482   RWGL  485



>gb|EYU24136.1| hypothetical protein MIMGU_mgv1a005261mg [Erythranthe guttata]
Length=491

 Score =   432 bits (1110),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 206/244 (84%), Positives = 223/244 (91%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             DTVQYK SGILRYERVFG GYVSTGGL+TT+EFV KL+L+ GQKVLDVGCGIGGGDFYMA
Sbjct  242   DTVQYKRSGILRYERVFGEGYVSTGGLDTTREFVDKLELEAGQKVLDVGCGIGGGDFYMA  301

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E YDVHV+GIDLS NMI+ ALERAIGLKCAVEFEVADCTKK YPD TFDVIYSRDTILHI
Sbjct  302   EKYDVHVVGIDLSINMISFALERAIGLKCAVEFEVADCTKKDYPDGTFDVIYSRDTILHI  361

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFRSFYKWLKPGGKVLI+DYCK +G  S +F  YIKQRGYDLHD E YGQMLRDA
Sbjct  362   QDKPALFRSFYKWLKPGGKVLISDYCKNAGASSADFTEYIKQRGYDLHDVEAYGQMLRDA  421

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF+DVIAEDRT+QFM VL+KEL+AVEK+KE FI+DFS+EDY+DIVGGWK KL RTSSGEQ
Sbjct  422   GFDDVIAEDRTNQFMTVLEKELNAVEKDKETFIRDFSQEDYDDIVGGWKSKLVRTSSGEQ  481

Query  910   RWGL  899
             RWGL
Sbjct  482   RWGL  485



>gb|AAG52075.1|AC012679_13 putative S-adenosyl-methionine-sterol-C-methyltransferase, 5' 
partial; 1-1344 [Arabidopsis thaliana]
Length=295

 Score =   424 bits (1090),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 203/244 (83%), Positives = 219/244 (90%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYERVFG G+VSTGGLETTKEFV  LDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  46    DNVQYKSSGILRYERVFGEGFVSTGGLETTKEFVDMLDLKPGQKVLDVGCGIGGGDFYMA  105

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DV V+GIDLS NMI+ ALE AIGLKC+VEFEVADCTKK YPD TFDVIYSRDTILHI
Sbjct  106   ENFDVDVVGIDLSVNMISFALEHAIGLKCSVEFEVADCTKKEYPDNTFDVIYSRDTILHI  165

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFR FYKWLKPGGKVLITDYC+    PS +FA YIK+RGYDLHD + YGQMLRDA
Sbjct  166   QDKPALFRRFYKWLKPGGKVLITDYCRSPKTPSPDFAIYIKKRGYDLHDVQAYGQMLRDA  225

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GFE+VIAEDRTDQFMKVLK+ELDAVEKEKE FI DFS+EDY DI+GGWK KL R+SSGEQ
Sbjct  226   GFEEVIAEDRTDQFMKVLKRELDAVEKEKEEFISDFSKEDYEDIIGGWKSKLLRSSSGEQ  285

Query  910   RWGL  899
             +WGL
Sbjct  286   KWGL  289



>ref|XP_009782224.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Nicotiana 
sylvestris]
Length=496

 Score =   431 bits (1109),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 203/245 (83%), Positives = 226/245 (92%), Gaps = 1/245 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             DTVQYK +GILRYERVFG  +VSTGG++TT+EFVA L+LQPGQKVLDVGCGIGGGDFYMA
Sbjct  247   DTVQYKSNGILRYERVFGHSFVSTGGIDTTREFVAMLELQPGQKVLDVGCGIGGGDFYMA  306

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E YDV+V+GIDLS NMI++A ERAIG KCAVEFEVADCTK TYP+ TFDVIYSRDTILHI
Sbjct  307   EKYDVYVVGIDLSVNMISLAFERAIGRKCAVEFEVADCTKTTYPEGTFDVIYSRDTILHI  366

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFRSFYKWLKPGGKVLI+DYCK++GP SEEFA YIKQRGYDLHD E YGQMLRDA
Sbjct  367   QDKPALFRSFYKWLKPGGKVLISDYCKKAGPASEEFAGYIKQRGYDLHDVEAYGQMLRDA  426

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTR-TSSGE  914
             GF +V+AEDRT+QF+KVL+KELD VEKE+E+FIQ+FSE+DYNDIVGGWK KL R TSSGE
Sbjct  427   GFNEVVAEDRTEQFIKVLQKELDTVEKERESFIQEFSEKDYNDIVGGWKAKLIRSTSSGE  486

Query  913   QRWGL  899
             QRWGL
Sbjct  487   QRWGL  491



>ref|XP_006376720.1| hypothetical protein POPTR_0012s044901g, partial [Populus trichocarpa]
 gb|ERP54517.1| hypothetical protein POPTR_0012s044901g, partial [Populus trichocarpa]
Length=355

 Score =   426 bits (1095),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 202/244 (83%), Positives = 222/244 (91%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK +GILRYERVFG G+VSTGG+ETTKEFV KLDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  106   DNVQYKSNGILRYERVFGQGFVSTGGMETTKEFVEKLDLKPGQKVLDVGCGIGGGDFYMA  165

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN++V V+GIDLS NMI+ ALERAIGLKC+VEFEVADCT KTYPD TFDVIYSRDTILHI
Sbjct  166   ENFEVEVVGIDLSVNMISFALERAIGLKCSVEFEVADCTTKTYPDNTFDVIYSRDTILHI  225

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFRSF+KWLKPGGKVLI+DYCK +G PS EFA YIKQRGYDLHD + YGQMLRDA
Sbjct  226   QDKPALFRSFFKWLKPGGKVLISDYCKCAGTPSPEFAEYIKQRGYDLHDVKAYGQMLRDA  285

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF++VIAEDRTDQF +VL +EL A+EKEK+ FI DFSEEDYNDIVGGWK KL R+SSGEQ
Sbjct  286   GFDEVIAEDRTDQFNQVLLRELKAIEKEKDEFIHDFSEEDYNDIVGGWKAKLIRSSSGEQ  345

Query  910   RWGL  899
             RWGL
Sbjct  346   RWGL  349



>dbj|BAC57432.1| phosphoethanolamine N-methyltransferase [Suaeda japonica]
Length=494

 Score =   431 bits (1108),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 201/244 (82%), Positives = 222/244 (91%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             DT QYKC+ ILRYERVFGPGYVSTGG ETTKEFV+ LDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  245   DTSQYKCNSILRYERVFGPGYVSTGGYETTKEFVSMLDLKPGQKVLDVGCGIGGGDFYMA  304

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E +DV V+G DLS NMI+ ALER+IGLKCAVEFEVADCTK  YPD +FDVIYSRDTILHI
Sbjct  305   ETFDVEVVGFDLSVNMISFALERSIGLKCAVEFEVADCTKINYPDNSFDVIYSRDTILHI  364

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFRSFYKWLKPGGKVLI+DYCK++GPPS EFAAYIKQRGYDLHD +EYGQML+DA
Sbjct  365   QDKPALFRSFYKWLKPGGKVLISDYCKKAGPPSPEFAAYIKQRGYDLHDVKEYGQMLKDA  424

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF DV+AEDRT+QF++VL+KEL+ VEKEK+ FI DFSEEDYNDIVGGW  KL RT+ GEQ
Sbjct  425   GFVDVLAEDRTEQFIRVLRKELETVEKEKDVFISDFSEEDYNDIVGGWNDKLRRTAKGEQ  484

Query  910   RWGL  899
             RWGL
Sbjct  485   RWGL  488



>ref|XP_006346642.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Solanum 
tuberosum]
Length=500

 Score =   431 bits (1109),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 201/244 (82%), Positives = 224/244 (92%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYKCSGILRYERVFG GYVSTGGL+TTKEFV+ LDLQPGQKVLDVGCGIGGGDFYMA
Sbjct  251   DNVQYKCSGILRYERVFGEGYVSTGGLDTTKEFVSMLDLQPGQKVLDVGCGIGGGDFYMA  310

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             ENYDVHV+ IDLS NMI+ ALER+IGLKCAVEFEVADCTKKTYPD TFDVIYSRDTILHI
Sbjct  311   ENYDVHVVAIDLSINMISFALERSIGLKCAVEFEVADCTKKTYPDGTFDVIYSRDTILHI  370

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFRSFY+WLKPGGKVLI+DYCK   P S+EF+ YIKQRGYDLHD   YGQML+DA
Sbjct  371   QDKPALFRSFYRWLKPGGKVLISDYCKCPIPASDEFSEYIKQRGYDLHDVATYGQMLKDA  430

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
              F++VIAEDRT+QF+ VL+KEL+ VEKE+++FIQ+FSE+DYN+IVGGWK KL R+SSGEQ
Sbjct  431   SFDEVIAEDRTEQFINVLQKELNTVEKERDSFIQEFSEQDYNEIVGGWKAKLLRSSSGEQ  490

Query  910   RWGL  899
             RWGL
Sbjct  491   RWGL  494



>ref|XP_009595958.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=496

 Score =   431 bits (1108),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 205/245 (84%), Positives = 225/245 (92%), Gaps = 1/245 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             DTVQYK +GILRYERVFG  +VSTGG++TTKEFVA LDLQPGQKVLDVGCGIGGGDFYMA
Sbjct  247   DTVQYKSNGILRYERVFGHSFVSTGGIDTTKEFVAMLDLQPGQKVLDVGCGIGGGDFYMA  306

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E YDV+V+GIDLS NMI++A ERAIG KCAVEFEVADCTK TYP+ TFDVIYSRDTILHI
Sbjct  307   EKYDVYVVGIDLSVNMISLAFERAIGRKCAVEFEVADCTKATYPEGTFDVIYSRDTILHI  366

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDK ALFRSFYKWLKPGGKVLI+DYCKR+GP SEEFA YIKQRGYDLHD E YGQMLRDA
Sbjct  367   QDKLALFRSFYKWLKPGGKVLISDYCKRAGPASEEFAGYIKQRGYDLHDVEAYGQMLRDA  426

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTR-TSSGE  914
             GF +V+AEDRT+QF+KVL+KELD VEKE+E+FIQ+FSE+DYNDIVGGWK KL R TSSGE
Sbjct  427   GFNEVVAEDRTEQFIKVLQKELDTVEKERESFIQEFSEQDYNDIVGGWKAKLIRSTSSGE  486

Query  913   QRWGL  899
             QRWGL
Sbjct  487   QRWGL  491



>gb|ABG57185.1| phosphoethanolamine N-methyltransferase [Salicornia europaea]
Length=494

 Score =   431 bits (1107),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 201/244 (82%), Positives = 223/244 (91%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             DT QYKC+ ILRYERVFGPGYVSTGG ETTKEFV+ LDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  245   DTSQYKCNSILRYERVFGPGYVSTGGYETTKEFVSMLDLKPGQKVLDVGCGIGGGDFYMA  304

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E +DV V+GIDLS NMI+ ALER+IGLKCAVEFEVADCTKKTYPD++F VIYSRDTILHI
Sbjct  305   ETFDVEVVGIDLSVNMISFALERSIGLKCAVEFEVADCTKKTYPDSSFGVIYSRDTILHI  364

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKP LFR+FYKWLKPG KVLI+DYCK++GPPS EFA+YIKQRGYDLHD +EYGQML+DA
Sbjct  365   QDKPELFRTFYKWLKPGDKVLISDYCKKAGPPSPEFASYIKQRGYDLHDVKEYGQMLKDA  424

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF DVIAEDRTDQF++VL+KEL+ VEKEK+ FI DFSEEDYNDIVGGW  KL RT+ GEQ
Sbjct  425   GFIDVIAEDRTDQFIRVLQKELETVEKEKDEFISDFSEEDYNDIVGGWNAKLQRTAKGEQ  484

Query  910   RWGL  899
             RWGL
Sbjct  485   RWGL  488



>emb|CAN64744.1| hypothetical protein VITISV_041321 [Vitis vinifera]
Length=490

 Score =   431 bits (1107),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 197/244 (81%), Positives = 224/244 (92%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYKC+GILRYERVFG G+VSTGG+ETTKEFV KLDL+PG+KVLDVGCGIGGGDFYMA
Sbjct  241   DNVQYKCNGILRYERVFGEGFVSTGGIETTKEFVGKLDLKPGRKVLDVGCGIGGGDFYMA  300

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DV V+GIDLS NM++ ALERAIGLKC+VEFEVADCTKK+YPD TFDVIYSRDTILHI
Sbjct  301   ENFDVEVVGIDLSINMVSFALERAIGLKCSVEFEVADCTKKSYPDNTFDVIYSRDTILHI  360

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALF+SF+KWLKPGGKVLI+DYCKR+GPPS EF+ YIKQRGYDLH+ E YG+MLRDA
Sbjct  361   QDKPALFKSFFKWLKPGGKVLISDYCKRAGPPSSEFSEYIKQRGYDLHBVEAYGEMLRDA  420

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF +VIAEDRTDQF++VL +EL+AVE  K  F+QDFSE+DYN+IV GWK KL R+SSGEQ
Sbjct  421   GFIEVIAEDRTDQFLQVLXRELNAVETNKNEFVQDFSEDDYNEIVDGWKAKLMRSSSGEQ  480

Query  910   RWGL  899
             RWGL
Sbjct  481   RWGL  484



>ref|XP_010314226.1| PREDICTED: phosphoethanolamine N-methyltransferase isoform X2 
[Solanum lycopersicum]
Length=388

 Score =   427 bits (1097),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 199/244 (82%), Positives = 223/244 (91%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYKCSGILRYERVFG GYVSTGGL+TTKEFV+ LDLQPGQ+VLDVGCGIGGGDFYMA
Sbjct  139   DNVQYKCSGILRYERVFGEGYVSTGGLDTTKEFVSMLDLQPGQQVLDVGCGIGGGDFYMA  198

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             ENYDVHV+ IDLS NMI+ ALER+IGLKCAVEFEVADCTKKTYPD TFDVIYSRDTILHI
Sbjct  199   ENYDVHVVAIDLSINMISFALERSIGLKCAVEFEVADCTKKTYPDGTFDVIYSRDTILHI  258

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFRSFYKWLKPGGKVLI+DYCK   P S++F+ YIKQRGYDLHD   YGQML+DA
Sbjct  259   QDKPALFRSFYKWLKPGGKVLISDYCKSPIPASDKFSEYIKQRGYDLHDVATYGQMLKDA  318

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF++VIAEDRT+QF+ VL+KEL+ VEKE+++FI +FSE+DYN+IVGGW  KL R+SSGEQ
Sbjct  319   GFDEVIAEDRTEQFINVLQKELNTVEKERDSFIHEFSEQDYNEIVGGWTAKLLRSSSGEQ  378

Query  910   RWGL  899
             RWGL
Sbjct  379   RWGL  382



>ref|XP_010686587.1| PREDICTED: phosphoethanolamine N-methyltransferase [Beta vulgaris 
subsp. vulgaris]
Length=494

 Score =   430 bits (1106),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 201/244 (82%), Positives = 222/244 (91%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D+ QYKC+ ILRYERVFGPGYVSTGG ETTKEFV+KLDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  245   DSSQYKCNSILRYERVFGPGYVSTGGFETTKEFVSKLDLKPGQKVLDVGCGIGGGDFYMA  304

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DV V+GIDLS NMI+ ALER+IGLKCAVEFEVADCTKK YP+ +FDVIYSRDTILHI
Sbjct  305   ENFDVEVVGIDLSINMISFALERSIGLKCAVEFEVADCTKKPYPEQSFDVIYSRDTILHI  364

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFR+FYKWLKPGGKVLI+DYCK SGPPS EFA YIKQRGYDLHD E YGQML+DA
Sbjct  365   QDKPALFRNFYKWLKPGGKVLISDYCKSSGPPSAEFAMYIKQRGYDLHDVEAYGQMLKDA  424

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF DVIA+D+TDQF++VL+KELD++EKEK+ FI DFSE DYNDIV GWK KL RT  GEQ
Sbjct  425   GFVDVIAQDKTDQFIQVLQKELDSLEKEKDKFIADFSEGDYNDIVDGWKAKLIRTKVGEQ  484

Query  910   RWGL  899
             RWGL
Sbjct  485   RWGL  488



>gb|EYU33965.1| hypothetical protein MIMGU_mgv1a005263mg [Erythranthe guttata]
Length=491

 Score =   430 bits (1105),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 202/244 (83%), Positives = 222/244 (91%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYKCSGILRYERVFG G+VSTGG++TT+EFV KLDL+PGQKVLDVGCGIGGGDF+MA
Sbjct  242   DNVQYKCSGILRYERVFGRGFVSTGGIDTTREFVEKLDLKPGQKVLDVGCGIGGGDFFMA  301

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             + YDVHV+GIDLS NMI+ ALE AIGL CAVEFEVADCTKK YPD TFDVIYSRDTILHI
Sbjct  302   DKYDVHVVGIDLSVNMISFALEHAIGLNCAVEFEVADCTKKEYPDGTFDVIYSRDTILHI  361

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFRSFYKWLKPGGKVLI+DYC+  G PS EFA YIKQRGYDLHD + Y QML DA
Sbjct  362   QDKPALFRSFYKWLKPGGKVLISDYCRNVGSPSAEFAEYIKQRGYDLHDVKAYSQMLGDA  421

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF++VIAEDRTDQF+KVL+KELDAVEK+KE FI+DFSEEDYN+IVGGWK KL R+SSGEQ
Sbjct  422   GFDEVIAEDRTDQFIKVLEKELDAVEKDKEEFIRDFSEEDYNEIVGGWKAKLVRSSSGEQ  481

Query  910   RWGL  899
             RWGL
Sbjct  482   RWGL  485



>ref|XP_011008809.1| PREDICTED: phosphomethylethanolamine N-methyltransferase isoform 
X2 [Populus euphratica]
Length=490

 Score =   429 bits (1104),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 202/244 (83%), Positives = 223/244 (91%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK +GILRYERVFG GYVSTGG+ETTKEFV KLDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  241   DNVQYKSNGILRYERVFGQGYVSTGGIETTKEFVGKLDLKPGQKVLDVGCGIGGGDFYMA  300

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DV V+GIDLS NMI+ ALERAIGLKC+VEFEVADCT KTYPD TFDVIYSRDTILHI
Sbjct  301   ENFDVEVVGIDLSINMISFALERAIGLKCSVEFEVADCTTKTYPDNTFDVIYSRDTILHI  360

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFRSF+KWLKPGGKVLI+DYCK SG PS EFA YIKQRGYDLHD + YGQMLRDA
Sbjct  361   QDKPALFRSFFKWLKPGGKVLISDYCKCSGTPSPEFAEYIKQRGYDLHDVKAYGQMLRDA  420

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF++V+AEDRTDQF K+L++EL+A+EK+K+ FI DFSE DYNDIVGGWK KL R+SSGEQ
Sbjct  421   GFDEVVAEDRTDQFNKLLQRELNAIEKDKDEFIHDFSEGDYNDIVGGWKAKLIRSSSGEQ  480

Query  910   RWGL  899
             RWGL
Sbjct  481   RWGL  484



>ref|XP_011014101.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Populus euphratica]
Length=490

 Score =   429 bits (1104),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 203/244 (83%), Positives = 222/244 (91%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK +GILRYERVFG G+VSTGG+ETTKEFV KLDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  241   DNVQYKSNGILRYERVFGQGFVSTGGMETTKEFVEKLDLKPGQKVLDVGCGIGGGDFYMA  300

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DV V+GIDLS NMI+ ALERAIGLKC+VEFEVADCT KTYPD TFDVIYSRDTILHI
Sbjct  301   ENFDVEVVGIDLSINMISFALERAIGLKCSVEFEVADCTTKTYPDDTFDVIYSRDTILHI  360

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFRSF+KWLKPGGKVLI+DYCK +G PS EFA YIKQRGYDLHD E YGQMLRDA
Sbjct  361   QDKPALFRSFFKWLKPGGKVLISDYCKHAGTPSPEFAEYIKQRGYDLHDVEAYGQMLRDA  420

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF++VIAED TDQF +VL +EL+A+EKEK+ FI DFSEEDYNDIVGGWK KL R+SSGEQ
Sbjct  421   GFDEVIAEDLTDQFNQVLLRELNAIEKEKDEFILDFSEEDYNDIVGGWKAKLIRSSSGEQ  480

Query  910   RWGL  899
             RWGL
Sbjct  481   RWGL  484



>gb|ABK42071.1| phosphoethanolamine N-methyltransferase [Suaeda liaotungensis]
Length=494

 Score =   429 bits (1103),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 200/244 (82%), Positives = 222/244 (91%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             DT QYKC+ ILRYERVFGPGYVSTGG ETTKEFV+ LDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  245   DTSQYKCNSILRYERVFGPGYVSTGGYETTKEFVSMLDLKPGQKVLDVGCGIGGGDFYMA  304

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E +DV V+G DLS NMI+ ALER+IGLKCAVEFEVADCTK  YPD +FDVIYSRDTILHI
Sbjct  305   ETFDVEVVGFDLSVNMISFALERSIGLKCAVEFEVADCTKINYPDNSFDVIYSRDTILHI  364

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFRSFYKWLKPGGKVLI+DYCK++GPPS EFAAYIKQRGYDLHD +EYGQML+DA
Sbjct  365   QDKPALFRSFYKWLKPGGKVLISDYCKKAGPPSPEFAAYIKQRGYDLHDVKEYGQMLKDA  424

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF DV+AEDRT+QF++VL+KEL+ VEKEK+ FI DFSEEDYN+IVGGW  KL RT+ GEQ
Sbjct  425   GFVDVLAEDRTEQFIRVLRKELETVEKEKDVFISDFSEEDYNEIVGGWNDKLRRTAKGEQ  484

Query  910   RWGL  899
             RWGL
Sbjct  485   RWGL  488



>ref|XP_008240154.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 isoform 
X2 [Prunus mume]
Length=485

 Score =   429 bits (1102),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 201/244 (82%), Positives = 222/244 (91%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK +GILRYERVFG G+VSTGG+ETTKEFVA LDL+P QKVLDVGCGIGGGDFYMA
Sbjct  236   DNVQYKSNGILRYERVFGQGFVSTGGIETTKEFVAMLDLKPSQKVLDVGCGIGGGDFYMA  295

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
              NYDV V+GIDLS NMI+ ALE AIGLKCAVEFEVADCT+KTYPD TFDVIYSRDTILHI
Sbjct  296   SNYDVEVVGIDLSVNMISFALEHAIGLKCAVEFEVADCTQKTYPDDTFDVIYSRDTILHI  355

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFRSFYKWLKPGGKVLI+DYC+ +G PS EFA YIKQRGYDLHD + YGQML+DA
Sbjct  356   QDKPALFRSFYKWLKPGGKVLISDYCRSAGTPSAEFAEYIKQRGYDLHDVQAYGQMLKDA  415

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF++VIAEDRTDQF +VL++ELDAVEK+K+AFIQDFSEEDY+DIVGGWK KL R  SGEQ
Sbjct  416   GFDEVIAEDRTDQFKEVLQRELDAVEKDKDAFIQDFSEEDYDDIVGGWKAKLIRADSGEQ  475

Query  910   RWGL  899
             +WGL
Sbjct  476   KWGL  479



>ref|XP_011008808.1| PREDICTED: phosphomethylethanolamine N-methyltransferase isoform 
X1 [Populus euphratica]
Length=506

 Score =   429 bits (1104),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 202/244 (83%), Positives = 223/244 (91%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK +GILRYERVFG GYVSTGG+ETTKEFV KLDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  257   DNVQYKSNGILRYERVFGQGYVSTGGIETTKEFVGKLDLKPGQKVLDVGCGIGGGDFYMA  316

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DV V+GIDLS NMI+ ALERAIGLKC+VEFEVADCT KTYPD TFDVIYSRDTILHI
Sbjct  317   ENFDVEVVGIDLSINMISFALERAIGLKCSVEFEVADCTTKTYPDNTFDVIYSRDTILHI  376

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFRSF+KWLKPGGKVLI+DYCK SG PS EFA YIKQRGYDLHD + YGQMLRDA
Sbjct  377   QDKPALFRSFFKWLKPGGKVLISDYCKCSGTPSPEFAEYIKQRGYDLHDVKAYGQMLRDA  436

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF++V+AEDRTDQF K+L++EL+A+EK+K+ FI DFSE DYNDIVGGWK KL R+SSGEQ
Sbjct  437   GFDEVVAEDRTDQFNKLLQRELNAIEKDKDEFIHDFSEGDYNDIVGGWKAKLIRSSSGEQ  496

Query  910   RWGL  899
             RWGL
Sbjct  497   RWGL  500



>ref|XP_012088549.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Jatropha 
curcas]
 gb|KDP23923.1| hypothetical protein JCGZ_27083 [Jatropha curcas]
Length=491

 Score =   429 bits (1103),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 205/244 (84%), Positives = 222/244 (91%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             DTVQYK SGILRYE VFG G+VSTGG+ETTKEFVAKLDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  242   DTVQYKSSGILRYELVFGRGFVSTGGIETTKEFVAKLDLKPGQKVLDVGCGIGGGDFYMA  301

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E +DV V+GIDLS NMI+ ALERAIGLKCAVEFEVADCTKKTYPD TFDVIYSRDTILHI
Sbjct  302   ETFDVEVVGIDLSVNMISFALERAIGLKCAVEFEVADCTKKTYPDNTFDVIYSRDTILHI  361

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFRSFYKWLKPGGK+LITDYCK +G PSEEFA YIKQRGYDLH  + YGQMLRDA
Sbjct  362   QDKPALFRSFYKWLKPGGKILITDYCKSAGTPSEEFAEYIKQRGYDLHCVKAYGQMLRDA  421

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF+DVIAEDRTDQF +VL++ELDA EK K+ FI DFSE+DYNDI+ GWK KL R+SSGEQ
Sbjct  422   GFDDVIAEDRTDQFNQVLQQELDATEKIKDEFITDFSEKDYNDIIDGWKAKLIRSSSGEQ  481

Query  910   RWGL  899
             RWGL
Sbjct  482   RWGL  485



>emb|CDY11100.1| BnaC06g23520D [Brassica napus]
Length=506

 Score =   429 bits (1104),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 203/244 (83%), Positives = 221/244 (91%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYERVFG G+VSTGGLETTKEFVAKLDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  257   DNVQYKSSGILRYERVFGQGFVSTGGLETTKEFVAKLDLKPGQKVLDVGCGIGGGDFYMA  316

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DV V+GIDLS NMI+ ALE AIGLKC+VEFEVADCTKK YPD TFDVIYSRDTILHI
Sbjct  317   ENFDVDVVGIDLSVNMISFALEHAIGLKCSVEFEVADCTKKEYPDNTFDVIYSRDTILHI  376

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFR+FYKWLKPGGKVLITDYC+    PS +FA YIKQRGYDLHD + YGQML+DA
Sbjct  377   QDKPALFRTFYKWLKPGGKVLITDYCRSPKTPSPDFANYIKQRGYDLHDVQAYGQMLKDA  436

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF++VIAEDRTDQFMKVLK+ELDAVEKEK+ FI DFS+EDY DIVGGW  KL R+SSGEQ
Sbjct  437   GFDEVIAEDRTDQFMKVLKRELDAVEKEKDEFISDFSKEDYEDIVGGWNSKLLRSSSGEQ  496

Query  910   RWGL  899
             +WGL
Sbjct  497   KWGL  500



>gb|AFZ78648.1| methyl transferase [Populus tomentosa]
Length=485

 Score =   429 bits (1102),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 201/244 (82%), Positives = 223/244 (91%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK +GILRYERVFG GYVSTGG+ETTKEFV +LDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  236   DNVQYKSNGILRYERVFGQGYVSTGGIETTKEFVGRLDLKPGQKVLDVGCGIGGGDFYMA  295

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DV V+GIDLS NMI+ ALERAIGLKC+VEFEVADCT KTYPD TFDVIYSRDTILHI
Sbjct  296   ENFDVEVVGIDLSINMISFALERAIGLKCSVEFEVADCTTKTYPDNTFDVIYSRDTILHI  355

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFRSF+KWLKPGGKVLI+DYCK +G PS EFA YIKQRGYDLHD + YGQMLRDA
Sbjct  356   QDKPALFRSFFKWLKPGGKVLISDYCKCAGTPSPEFAEYIKQRGYDLHDVKAYGQMLRDA  415

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF++V+AEDRTDQF KVL++EL+A+EK+K+ FI DFSE DYNDIVGGWK KL R+SSGEQ
Sbjct  416   GFDEVVAEDRTDQFNKVLQRELNAIEKDKDEFIHDFSEGDYNDIVGGWKAKLIRSSSGEQ  475

Query  910   RWGL  899
             RWGL
Sbjct  476   RWGL  479



>dbj|BAE07178.1| phosphoethanolamine N-methyltransferase [Beta vulgaris]
Length=494

 Score =   429 bits (1102),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 200/244 (82%), Positives = 221/244 (91%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D+ QYKC+ ILRYERVFGPGYVSTGG ETTKEFV+KLDL+PGQKVLD GCGIGGGDFYMA
Sbjct  245   DSSQYKCNSILRYERVFGPGYVSTGGFETTKEFVSKLDLKPGQKVLDAGCGIGGGDFYMA  304

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DV V+GIDLS NMI+ ALER+IGLKCAVEFEVADCTKK YP+ +FDVIYSRDTILHI
Sbjct  305   ENFDVEVVGIDLSINMISFALERSIGLKCAVEFEVADCTKKPYPEQSFDVIYSRDTILHI  364

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFR+FYKWLKPGGKVLI+DYCK SGPPS EFA YIKQRGYDLHD E YGQML+DA
Sbjct  365   QDKPALFRNFYKWLKPGGKVLISDYCKSSGPPSAEFAMYIKQRGYDLHDVEAYGQMLKDA  424

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF DVIA+D+TDQF++VL+KELD++EKEK+ FI DFSE DYNDIV GWK KL RT  GEQ
Sbjct  425   GFVDVIAQDKTDQFIQVLQKELDSLEKEKDKFIADFSEGDYNDIVDGWKAKLIRTKVGEQ  484

Query  910   RWGL  899
             RWGL
Sbjct  485   RWGL  488



>ref|XP_007036802.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY21303.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
Length=493

 Score =   428 bits (1101),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 197/244 (81%), Positives = 225/244 (92%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             DTVQYKCSGILRYERVFG G+VSTGG+ETTKEFV KLDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  244   DTVQYKCSGILRYERVFGEGFVSTGGIETTKEFVGKLDLKPGQKVLDVGCGIGGGDFYMA  303

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E +DVHV+GIDLS NMI+ ALERAIG+ C+VEFEVADCTKKTYPD +FDVIYSRDTILHI
Sbjct  304   EKFDVHVVGIDLSINMISFALERAIGMNCSVEFEVADCTKKTYPDNSFDVIYSRDTILHI  363

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFRSFYKWLKPGGKVLI+DYCK +G PS EFA YI+QRGYDLHD E YGQ+L DA
Sbjct  364   QDKPALFRSFYKWLKPGGKVLISDYCKNAGTPSSEFAEYIEQRGYDLHDVEAYGQILSDA  423

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF++VIAEDRT+QF++VL++EL+ VEK+K+AF+  FS+EDY+DI+GGWK KL R+SSGEQ
Sbjct  424   GFDEVIAEDRTEQFLQVLQRELNEVEKDKDAFVSSFSQEDYDDILGGWKAKLIRSSSGEQ  483

Query  910   RWGL  899
             RWGL
Sbjct  484   RWGL  487



>emb|CBI26877.3| unnamed protein product [Vitis vinifera]
Length=484

 Score =   428 bits (1100),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 200/244 (82%), Positives = 224/244 (92%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYKC GILRYER+FG G+VSTGGLETTKEFVAKL+L+PGQKVLDVGCGIGGGDFYMA
Sbjct  233   DNVQYKCRGILRYERIFGEGFVSTGGLETTKEFVAKLELKPGQKVLDVGCGIGGGDFYMA  292

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E+++V V+GIDLS NMI+IAL+RAIG    VEFEVADCTKKTYPD+TFDVIYSRDTILHI
Sbjct  293   EDFNVEVVGIDLSINMISIALDRAIGRNRLVEFEVADCTKKTYPDSTFDVIYSRDTILHI  352

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFRSF+KWLKPGGKVLI+DYCKRSGPPS EF AYI QRGYDLHD E YGQML+DA
Sbjct  353   QDKPALFRSFFKWLKPGGKVLISDYCKRSGPPSPEFEAYIGQRGYDLHDVEAYGQMLKDA  412

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF++VIAEDRTDQF++VL+KE+D++EKEK+ FI DFSEEDY DIVGGWK KL R+S GEQ
Sbjct  413   GFDEVIAEDRTDQFIEVLQKEMDSIEKEKDKFISDFSEEDYKDIVGGWKSKLVRSSMGEQ  472

Query  910   RWGL  899
             RWGL
Sbjct  473   RWGL  476



>ref|XP_004252273.1| PREDICTED: phosphomethylethanolamine N-methyltransferase isoform 
X1 [Solanum lycopersicum]
Length=500

 Score =   429 bits (1102),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 199/244 (82%), Positives = 223/244 (91%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYKCSGILRYERVFG GYVSTGGL+TTKEFV+ LDLQPGQ+VLDVGCGIGGGDFYMA
Sbjct  251   DNVQYKCSGILRYERVFGEGYVSTGGLDTTKEFVSMLDLQPGQQVLDVGCGIGGGDFYMA  310

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             ENYDVHV+ IDLS NMI+ ALER+IGLKCAVEFEVADCTKKTYPD TFDVIYSRDTILHI
Sbjct  311   ENYDVHVVAIDLSINMISFALERSIGLKCAVEFEVADCTKKTYPDGTFDVIYSRDTILHI  370

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFRSFYKWLKPGGKVLI+DYCK   P S++F+ YIKQRGYDLHD   YGQML+DA
Sbjct  371   QDKPALFRSFYKWLKPGGKVLISDYCKSPIPASDKFSEYIKQRGYDLHDVATYGQMLKDA  430

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF++VIAEDRT+QF+ VL+KEL+ VEKE+++FI +FSE+DYN+IVGGW  KL R+SSGEQ
Sbjct  431   GFDEVIAEDRTEQFINVLQKELNTVEKERDSFIHEFSEQDYNEIVGGWTAKLLRSSSGEQ  490

Query  910   RWGL  899
             RWGL
Sbjct  491   RWGL  494



>ref|XP_010274723.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Nelumbo nucifera]
Length=489

 Score =   428 bits (1101),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 199/244 (82%), Positives = 226/244 (93%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYKCSGILRYERVFG G+VSTGG++TTKEFVAKL+L+PGQKVLDVGCGIGGGDFYMA
Sbjct  241   DNVQYKCSGILRYERVFGEGFVSTGGIDTTKEFVAKLELKPGQKVLDVGCGIGGGDFYMA  300

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN++V V GIDLS NMI+ ALE AIG KC+VEFEVADCTKKTYPD TFDVIYSRDTILHI
Sbjct  301   ENFNVEVFGIDLSINMISFALEHAIGRKCSVEFEVADCTKKTYPDNTFDVIYSRDTILHI  360

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALF+SF+KWLKPGGKVLI+DYCKR+G PS+EFA YI+QRGY LHD E YGQML+DA
Sbjct  361   QDKPALFKSFFKWLKPGGKVLISDYCKRAGSPSKEFAQYIEQRGYGLHDVEAYGQMLKDA  420

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF++VIAEDRT+QF++VL++ELDAVEK +EAFI DFSEEDY++IVGGWK KL R+SSGEQ
Sbjct  421   GFKEVIAEDRTNQFIEVLQRELDAVEKAREAFIHDFSEEDYDEIVGGWKAKLVRSSSGEQ  480

Query  910   RWGL  899
             RWGL
Sbjct  481   RWGL  484



>ref|XP_008240152.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 isoform 
X1 [Prunus mume]
Length=491

 Score =   428 bits (1101),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 201/244 (82%), Positives = 222/244 (91%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK +GILRYERVFG G+VSTGG+ETTKEFVA LDL+P QKVLDVGCGIGGGDFYMA
Sbjct  242   DNVQYKSNGILRYERVFGQGFVSTGGIETTKEFVAMLDLKPSQKVLDVGCGIGGGDFYMA  301

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
              NYDV V+GIDLS NMI+ ALE AIGLKCAVEFEVADCT+KTYPD TFDVIYSRDTILHI
Sbjct  302   SNYDVEVVGIDLSVNMISFALEHAIGLKCAVEFEVADCTQKTYPDDTFDVIYSRDTILHI  361

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFRSFYKWLKPGGKVLI+DYC+ +G PS EFA YIKQRGYDLHD + YGQML+DA
Sbjct  362   QDKPALFRSFYKWLKPGGKVLISDYCRSAGTPSAEFAEYIKQRGYDLHDVQAYGQMLKDA  421

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF++VIAEDRTDQF +VL++ELDAVEK+K+AFIQDFSEEDY+DIVGGWK KL R  SGEQ
Sbjct  422   GFDEVIAEDRTDQFKEVLQRELDAVEKDKDAFIQDFSEEDYDDIVGGWKAKLIRADSGEQ  481

Query  910   RWGL  899
             +WGL
Sbjct  482   KWGL  485



>ref|XP_010655490.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Vitis vinifera]
 ref|XP_010655528.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Vitis vinifera]
Length=468

 Score =   427 bits (1098),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 200/244 (82%), Positives = 224/244 (92%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYKC GILRYER+FG G+VSTGGLETTKEFVAKL+L+PGQKVLDVGCGIGGGDFYMA
Sbjct  217   DNVQYKCRGILRYERIFGEGFVSTGGLETTKEFVAKLELKPGQKVLDVGCGIGGGDFYMA  276

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E+++V V+GIDLS NMI+IAL+RAIG    VEFEVADCTKKTYPD+TFDVIYSRDTILHI
Sbjct  277   EDFNVEVVGIDLSINMISIALDRAIGRNRLVEFEVADCTKKTYPDSTFDVIYSRDTILHI  336

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFRSF+KWLKPGGKVLI+DYCKRSGPPS EF AYI QRGYDLHD E YGQML+DA
Sbjct  337   QDKPALFRSFFKWLKPGGKVLISDYCKRSGPPSPEFEAYIGQRGYDLHDVEAYGQMLKDA  396

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF++VIAEDRTDQF++VL+KE+D++EKEK+ FI DFSEEDY DIVGGWK KL R+S GEQ
Sbjct  397   GFDEVIAEDRTDQFIEVLQKEMDSIEKEKDKFISDFSEEDYKDIVGGWKSKLVRSSMGEQ  456

Query  910   RWGL  899
             RWGL
Sbjct  457   RWGL  460



>emb|CDX68222.1| BnaA07g22620D [Brassica napus]
Length=506

 Score =   429 bits (1102),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 203/244 (83%), Positives = 221/244 (91%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYERVFG G+VSTGGLETTKEFVAKLDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  257   DNVQYKSSGILRYERVFGQGFVSTGGLETTKEFVAKLDLKPGQKVLDVGCGIGGGDFYMA  316

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DV V+GIDLS NMI+ ALE AIGLKC+VEFEVADCTKK YPD TFDVIYSRDTILHI
Sbjct  317   ENFDVDVVGIDLSVNMISFALEHAIGLKCSVEFEVADCTKKEYPDNTFDVIYSRDTILHI  376

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFR+FYKWLKPGGKVLITDYC+    PS +FA YIKQRGYDLHD + YGQML+DA
Sbjct  377   QDKPALFRTFYKWLKPGGKVLITDYCRSPKTPSPDFANYIKQRGYDLHDVQAYGQMLKDA  436

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF++VIAEDRTDQFMKVLK+ELDAVEKEK+ FI DFS+EDY DIVGGW  KL R+SSGEQ
Sbjct  437   GFDEVIAEDRTDQFMKVLKRELDAVEKEKDDFISDFSKEDYEDIVGGWNSKLLRSSSGEQ  496

Query  910   RWGL  899
             +WGL
Sbjct  497   KWGL  500



>ref|XP_009385384.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Musa 
acuminata subsp. malaccensis]
Length=497

 Score =   428 bits (1101),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 199/244 (82%), Positives = 226/244 (93%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYER+FG G+VSTGG+ETT EFVAKLDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  248   DNVQYKSSGILRYERIFGDGFVSTGGIETTTEFVAKLDLKPGQKVLDVGCGIGGGDFYMA  307

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DV V+GIDLS NMI+ ALERAIG KC+VEFEVADCTKKTYPD TFDVIYSRDTILHI
Sbjct  308   ENFDVEVVGIDLSINMISFALERAIGRKCSVEFEVADCTKKTYPDNTFDVIYSRDTILHI  367

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKP+LF+ F+KWLKPGGKVLI+DYCK+SG PSE+FAAYIKQRGYDLHD ++YGQMLRDA
Sbjct  368   QDKPSLFKGFFKWLKPGGKVLISDYCKKSGTPSEDFAAYIKQRGYDLHDVDDYGQMLRDA  427

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF +VIAEDRT+QF++VL+KELDAVEK+KEAFI DFS+EDY++IV GWK KL R+ +GEQ
Sbjct  428   GFHEVIAEDRTNQFLEVLQKELDAVEKDKEAFIHDFSQEDYDEIVSGWKAKLKRSWTGEQ  487

Query  910   RWGL  899
             RWGL
Sbjct  488   RWGL  491



>ref|XP_009104804.1| PREDICTED: phosphoethanolamine N-methyltransferase 3 [Brassica 
rapa]
Length=506

 Score =   428 bits (1101),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 203/244 (83%), Positives = 221/244 (91%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYERVFG G+VSTGGLETTKEFVAKLDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  257   DNVQYKSSGILRYERVFGQGFVSTGGLETTKEFVAKLDLKPGQKVLDVGCGIGGGDFYMA  316

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DV V+GIDLS NMI+ ALE AIGLKC+VEFEVADCTKK YPD TFDVIYSRDTILHI
Sbjct  317   ENFDVDVVGIDLSVNMISFALEHAIGLKCSVEFEVADCTKKEYPDNTFDVIYSRDTILHI  376

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFR+FYKWLKPGGKVLITDYC+    PS +FA YIKQRGYDLHD + YGQML+DA
Sbjct  377   QDKPALFRTFYKWLKPGGKVLITDYCRSPKTPSPDFANYIKQRGYDLHDVQAYGQMLKDA  436

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF++VIAEDRTDQFMKVLK+ELDAVEKEK+ FI DFS+EDY DIVGGW  KL R+SSGEQ
Sbjct  437   GFDEVIAEDRTDQFMKVLKRELDAVEKEKDDFISDFSKEDYEDIVGGWNSKLLRSSSGEQ  496

Query  910   RWGL  899
             +WGL
Sbjct  497   KWGL  500



>ref|XP_006451624.1| hypothetical protein CICLE_v10010749mg [Citrus clementina]
 ref|XP_006490770.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X1 [Citrus sinensis]
 gb|ESR64864.1| hypothetical protein CICLE_v10010749mg [Citrus clementina]
Length=492

 Score =   427 bits (1098),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 198/244 (81%), Positives = 226/244 (93%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK +GILRYERVFG G+VSTGG+ETTKEFVAKLDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  243   DNVQYKLNGILRYERVFGVGFVSTGGIETTKEFVAKLDLKPGQKVLDVGCGIGGGDFYMA  302

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             + +DVHV+GIDLS NMI+ ALERAIGLKC+VEFEVADCTKKTYP+ +FDVIYSRDTILHI
Sbjct  303   DKFDVHVVGIDLSINMISFALERAIGLKCSVEFEVADCTKKTYPENSFDVIYSRDTILHI  362

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALF+SF+KWLKPGG VLI+DYCK  G PS EF+ YIKQRGYDLHD + YGQML+DA
Sbjct  363   QDKPALFKSFFKWLKPGGTVLISDYCKSFGTPSVEFSEYIKQRGYDLHDVKSYGQMLKDA  422

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF D+IAEDRT+QF++VL++ELDA+EK+K+AFI+DFSEEDYNDIVGGWK KL RTS+GEQ
Sbjct  423   GFVDIIAEDRTEQFVQVLQRELDAIEKDKDAFIKDFSEEDYNDIVGGWKAKLIRTSAGEQ  482

Query  910   RWGL  899
             RWGL
Sbjct  483   RWGL  486



>ref|XP_006490771.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X2 [Citrus sinensis]
Length=489

 Score =   427 bits (1098),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 198/244 (81%), Positives = 226/244 (93%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK +GILRYERVFG G+VSTGG+ETTKEFVAKLDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  240   DNVQYKLNGILRYERVFGVGFVSTGGIETTKEFVAKLDLKPGQKVLDVGCGIGGGDFYMA  299

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             + +DVHV+GIDLS NMI+ ALERAIGLKC+VEFEVADCTKKTYP+ +FDVIYSRDTILHI
Sbjct  300   DKFDVHVVGIDLSINMISFALERAIGLKCSVEFEVADCTKKTYPENSFDVIYSRDTILHI  359

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALF+SF+KWLKPGG VLI+DYCK  G PS EF+ YIKQRGYDLHD + YGQML+DA
Sbjct  360   QDKPALFKSFFKWLKPGGTVLISDYCKSFGTPSVEFSEYIKQRGYDLHDVKSYGQMLKDA  419

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF D+IAEDRT+QF++VL++ELDA+EK+K+AFI+DFSEEDYNDIVGGWK KL RTS+GEQ
Sbjct  420   GFVDIIAEDRTEQFVQVLQRELDAIEKDKDAFIKDFSEEDYNDIVGGWKAKLIRTSAGEQ  479

Query  910   RWGL  899
             RWGL
Sbjct  480   RWGL  483



>ref|XP_010428286.1| PREDICTED: phosphoethanolamine N-methyltransferase 3 isoform 
X2 [Camelina sativa]
Length=492

 Score =   427 bits (1098),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 202/244 (83%), Positives = 220/244 (90%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYERVFG G+VSTGGLETTKEFV KLDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  243   DNVQYKSSGILRYERVFGQGFVSTGGLETTKEFVDKLDLKPGQKVLDVGCGIGGGDFYMA  302

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DV V+GIDLS NMI+ ALE AIGLKC+VEFEVADCTKK YPD TFDVIYSRDTILHI
Sbjct  303   ENFDVDVVGIDLSVNMISFALEHAIGLKCSVEFEVADCTKKEYPDNTFDVIYSRDTILHI  362

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFR+FYKWLKPGGK+LITDYC+    PS +FA YIKQRGYDLHD + YGQML+DA
Sbjct  363   QDKPALFRTFYKWLKPGGKILITDYCRSPKTPSPDFANYIKQRGYDLHDVQTYGQMLKDA  422

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GFE+VIAEDRTDQFMKVLK+ELDAVEKEK+ FI DFS+EDY DIVGGW  KL R+SSGEQ
Sbjct  423   GFEEVIAEDRTDQFMKVLKRELDAVEKEKDEFISDFSQEDYEDIVGGWNSKLLRSSSGEQ  482

Query  910   RWGL  899
             +WGL
Sbjct  483   KWGL  486



>ref|XP_007209942.1| hypothetical protein PRUPE_ppa004742mg [Prunus persica]
 gb|EMJ11141.1| hypothetical protein PRUPE_ppa004742mg [Prunus persica]
Length=491

 Score =   427 bits (1097),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 200/244 (82%), Positives = 223/244 (91%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK +GILRYERVFG G+VSTGG+ETTKEFVAKLDL+P QKVLDVGCGIGGGDFYMA
Sbjct  242   DNVQYKSNGILRYERVFGQGFVSTGGIETTKEFVAKLDLKPSQKVLDVGCGIGGGDFYMA  301

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
              NYDV V+GIDLS NMI+ ALERAIGLKCAVEFEVADCT+KTY D TFDVIYSRDTILHI
Sbjct  302   SNYDVEVVGIDLSVNMISFALERAIGLKCAVEFEVADCTQKTYADDTFDVIYSRDTILHI  361

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFRSFY+WLKPGGKVLI+DYC+ +G PS EFA YIKQRGYDLH+ + YGQML+DA
Sbjct  362   QDKPALFRSFYRWLKPGGKVLISDYCRSAGTPSAEFAEYIKQRGYDLHNVQAYGQMLKDA  421

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF++VIAEDRTDQF +VL++ELDAVEK+K+AFIQDFSEEDY+DIVGGWK KL R  SGEQ
Sbjct  422   GFDEVIAEDRTDQFKEVLQRELDAVEKDKDAFIQDFSEEDYDDIVGGWKAKLIRADSGEQ  481

Query  910   RWGL  899
             +WGL
Sbjct  482   KWGL  485



>ref|XP_010428285.1| PREDICTED: phosphoethanolamine N-methyltransferase 3 isoform 
X1 [Camelina sativa]
Length=504

 Score =   427 bits (1098),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 202/244 (83%), Positives = 220/244 (90%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYERVFG G+VSTGGLETTKEFV KLDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  255   DNVQYKSSGILRYERVFGQGFVSTGGLETTKEFVDKLDLKPGQKVLDVGCGIGGGDFYMA  314

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DV V+GIDLS NMI+ ALE AIGLKC+VEFEVADCTKK YPD TFDVIYSRDTILHI
Sbjct  315   ENFDVDVVGIDLSVNMISFALEHAIGLKCSVEFEVADCTKKEYPDNTFDVIYSRDTILHI  374

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFR+FYKWLKPGGK+LITDYC+    PS +FA YIKQRGYDLHD + YGQML+DA
Sbjct  375   QDKPALFRTFYKWLKPGGKILITDYCRSPKTPSPDFANYIKQRGYDLHDVQTYGQMLKDA  434

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GFE+VIAEDRTDQFMKVLK+ELDAVEKEK+ FI DFS+EDY DIVGGW  KL R+SSGEQ
Sbjct  435   GFEEVIAEDRTDQFMKVLKRELDAVEKEKDEFISDFSQEDYEDIVGGWNSKLLRSSSGEQ  494

Query  910   RWGL  899
             +WGL
Sbjct  495   KWGL  498



>ref|XP_002317876.2| hypothetical protein POPTR_0012s044901g, partial [Populus trichocarpa]
 gb|EEE96096.2| hypothetical protein POPTR_0012s044901g, partial [Populus trichocarpa]
Length=356

 Score =   421 bits (1083),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 202/245 (82%), Positives = 222/245 (91%), Gaps = 1/245 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGL-ETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYM  1454
             D VQYK +GILRYERVFG G+VSTGG+ ETTKEFV KLDL+PGQKVLDVGCGIGGGDFYM
Sbjct  106   DNVQYKSNGILRYERVFGQGFVSTGGMAETTKEFVEKLDLKPGQKVLDVGCGIGGGDFYM  165

Query  1453  AENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILH  1274
             AEN++V V+GIDLS NMI+ ALERAIGLKC+VEFEVADCT KTYPD TFDVIYSRDTILH
Sbjct  166   AENFEVEVVGIDLSVNMISFALERAIGLKCSVEFEVADCTTKTYPDNTFDVIYSRDTILH  225

Query  1273  IQDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRD  1094
             IQDKPALFRSF+KWLKPGGKVLI+DYCK +G PS EFA YIKQRGYDLHD + YGQMLRD
Sbjct  226   IQDKPALFRSFFKWLKPGGKVLISDYCKCAGTPSPEFAEYIKQRGYDLHDVKAYGQMLRD  285

Query  1093  AGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGE  914
             AGF++VIAEDRTDQF +VL +EL A+EKEK+ FI DFSEEDYNDIVGGWK KL R+SSGE
Sbjct  286   AGFDEVIAEDRTDQFNQVLLRELKAIEKEKDEFIHDFSEEDYNDIVGGWKAKLIRSSSGE  345

Query  913   QRWGL  899
             QRWGL
Sbjct  346   QRWGL  350



>ref|NP_177501.2| putative phosphoethanolamine N-methyltransferase 3 [Arabidopsis 
thaliana]
 sp|Q9C6B9.2|PEAM3_ARATH RecName: Full=Phosphoethanolamine N-methyltransferase 3 [Arabidopsis 
thaliana]
 gb|AEE35481.1| putative phosphoethanolamine N-methyltransferase 3 [Arabidopsis 
thaliana]
Length=490

 Score =   426 bits (1096),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 203/244 (83%), Positives = 219/244 (90%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYERVFG G+VSTGGLETTKEFV  LDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  241   DNVQYKSSGILRYERVFGEGFVSTGGLETTKEFVDMLDLKPGQKVLDVGCGIGGGDFYMA  300

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DV V+GIDLS NMI+ ALE AIGLKC+VEFEVADCTKK YPD TFDVIYSRDTILHI
Sbjct  301   ENFDVDVVGIDLSVNMISFALEHAIGLKCSVEFEVADCTKKEYPDNTFDVIYSRDTILHI  360

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFR FYKWLKPGGKVLITDYC+    PS +FA YIK+RGYDLHD + YGQMLRDA
Sbjct  361   QDKPALFRRFYKWLKPGGKVLITDYCRSPKTPSPDFAIYIKKRGYDLHDVQAYGQMLRDA  420

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GFE+VIAEDRTDQFMKVLK+ELDAVEKEKE FI DFS+EDY DI+GGWK KL R+SSGEQ
Sbjct  421   GFEEVIAEDRTDQFMKVLKRELDAVEKEKEEFISDFSKEDYEDIIGGWKSKLLRSSSGEQ  480

Query  910   RWGL  899
             +WGL
Sbjct  481   KWGL  484



>ref|XP_008453479.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Cucumis 
melo]
Length=500

 Score =   427 bits (1097),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 201/244 (82%), Positives = 219/244 (90%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             DTVQYKCSGILRYERVFG G+VSTGGLETTKEFVAKLDL+ GQ+VLDVGCGIGGGDFYMA
Sbjct  249   DTVQYKCSGILRYERVFGSGFVSTGGLETTKEFVAKLDLKAGQRVLDVGCGIGGGDFYMA  308

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DV V+GIDLS NMI++ALERAIGLKCAVEFEVADCTKK YPD TFDVIYSRDTILHI
Sbjct  309   ENFDVEVVGIDLSINMISLALERAIGLKCAVEFEVADCTKKVYPDNTFDVIYSRDTILHI  368

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFRSFYKW+KPGGK+LI+DYCK    PS EFA YIKQRGYDLHD + Y +ML +A
Sbjct  369   QDKPALFRSFYKWVKPGGKILISDYCKSGEVPSPEFAEYIKQRGYDLHDIKSYAKMLEEA  428

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF +V+AEDRTDQFM VL+KEL+ VEKEKEAFI DFSEEDYNDIVGGWK KL R   GEQ
Sbjct  429   GFSNVVAEDRTDQFMSVLQKELNIVEKEKEAFIHDFSEEDYNDIVGGWKAKLNRCWCGEQ  488

Query  910   RWGL  899
             +WGL
Sbjct  489   KWGL  492



>ref|NP_974139.2| putative phosphoethanolamine N-methyltransferase 3 [Arabidopsis 
thaliana]
 gb|AEE35480.1| putative phosphoethanolamine N-methyltransferase 3 [Arabidopsis 
thaliana]
Length=504

 Score =   426 bits (1096),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 203/244 (83%), Positives = 219/244 (90%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYERVFG G+VSTGGLETTKEFV  LDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  255   DNVQYKSSGILRYERVFGEGFVSTGGLETTKEFVDMLDLKPGQKVLDVGCGIGGGDFYMA  314

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DV V+GIDLS NMI+ ALE AIGLKC+VEFEVADCTKK YPD TFDVIYSRDTILHI
Sbjct  315   ENFDVDVVGIDLSVNMISFALEHAIGLKCSVEFEVADCTKKEYPDNTFDVIYSRDTILHI  374

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFR FYKWLKPGGKVLITDYC+    PS +FA YIK+RGYDLHD + YGQMLRDA
Sbjct  375   QDKPALFRRFYKWLKPGGKVLITDYCRSPKTPSPDFAIYIKKRGYDLHDVQAYGQMLRDA  434

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GFE+VIAEDRTDQFMKVLK+ELDAVEKEKE FI DFS+EDY DI+GGWK KL R+SSGEQ
Sbjct  435   GFEEVIAEDRTDQFMKVLKRELDAVEKEKEEFISDFSKEDYEDIIGGWKSKLLRSSSGEQ  494

Query  910   RWGL  899
             +WGL
Sbjct  495   KWGL  498



>gb|KJB30118.1| hypothetical protein B456_005G132000 [Gossypium raimondii]
Length=363

 Score =   421 bits (1082),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 196/244 (80%), Positives = 221/244 (91%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D+VQYK + ILRYERVFGPGYVSTGG+ETTKEFV KLDL+PGQKVLDVGCGIGGGD YMA
Sbjct  113   DSVQYKSNSILRYERVFGPGYVSTGGIETTKEFVGKLDLKPGQKVLDVGCGIGGGDIYMA  172

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E +DVHV+GIDLS NMI+ ALERA GLKC+VEFEVADCTKK YPD +FDVIYSRDTILHI
Sbjct  173   EEFDVHVVGIDLSVNMISFALERATGLKCSVEFEVADCTKKVYPDNSFDVIYSRDTILHI  232

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
              DKPALFRSFYKWLKPGGK+LI+DYCK S  PS EFAAYIKQRGYDLHD + YGQML DA
Sbjct  233   HDKPALFRSFYKWLKPGGKLLISDYCKSSKTPSTEFAAYIKQRGYDLHDVKSYGQMLEDA  292

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF+ ++AEDRTDQF++VL++EL+ VEKEK+AFI DFS+EDY++IVGGWK KL R+SSGEQ
Sbjct  293   GFDVILAEDRTDQFLQVLQRELNQVEKEKDAFISDFSKEDYDEIVGGWKAKLIRSSSGEQ  352

Query  910   RWGL  899
             RWGL
Sbjct  353   RWGL  356



>ref|XP_010678114.1| PREDICTED: phosphoethanolamine N-methyltransferase [Beta vulgaris 
subsp. vulgaris]
Length=494

 Score =   426 bits (1095),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 199/244 (82%), Positives = 222/244 (91%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D+ QYKC+ ILRYERVFGPGYVSTGG ETTKEFV+KLDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  245   DSSQYKCNSILRYERVFGPGYVSTGGFETTKEFVSKLDLKPGQKVLDVGCGIGGGDFYMA  304

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DV V+GIDLS NMI+ ALER+IGLKCAVEFEVADCTKKTYP+ +FDVIYSRDTILHI
Sbjct  305   ENFDVEVVGIDLSINMISFALERSIGLKCAVEFEVADCTKKTYPEQSFDVIYSRDTILHI  364

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFR+FY+WLKPGGKVLI+DYCK + PPS EFA YIKQRGYDLHD E YGQML+DA
Sbjct  365   QDKPALFRNFYEWLKPGGKVLISDYCKSARPPSPEFAMYIKQRGYDLHDVEAYGQMLKDA  424

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF DVIA+D+TDQF++VL+KELD++EKEK+ FI DFSE DYNDIV GWK KL RT  GEQ
Sbjct  425   GFVDVIAKDKTDQFIQVLQKELDSLEKEKDKFIADFSEGDYNDIVDGWKAKLIRTKVGEQ  484

Query  910   RWGL  899
             RWGL
Sbjct  485   RWGL  488



>gb|KFK36082.1| hypothetical protein AALP_AA4G075100 [Arabis alpina]
Length=492

 Score =   426 bits (1094),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 199/244 (82%), Positives = 222/244 (91%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK +GILRYERVFG GYVSTGG ETTKEFVAK+DL+PGQKVLDVGCGIGGGDFYMA
Sbjct  243   DNVQYKSNGILRYERVFGQGYVSTGGFETTKEFVAKMDLKPGQKVLDVGCGIGGGDFYMA  302

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DVHV+GIDLS NMI+ ALERAIGLKC+VEFEVADCT KTYPD +FDVIYSRDTILHI
Sbjct  303   ENFDVHVVGIDLSVNMISFALERAIGLKCSVEFEVADCTTKTYPDNSFDVIYSRDTILHI  362

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALF++F+KWLKPGGKVLITDYC+ +  PS  FA YIKQRGYDLHD + YGQML+DA
Sbjct  363   QDKPALFKTFFKWLKPGGKVLITDYCRNAETPSPIFAEYIKQRGYDLHDVQAYGQMLKDA  422

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF DVIAEDRTDQF++VL++EL+ VEKEKE FI DFSEEDYNDIVGGWK KL R++SGEQ
Sbjct  423   GFVDVIAEDRTDQFVQVLRRELERVEKEKEEFISDFSEEDYNDIVGGWKSKLERSTSGEQ  482

Query  910   RWGL  899
             +WGL
Sbjct  483   KWGL  486



>pir||H96762 hypothetical protein F6D5.1 [imported] - Arabidopsis thaliana
 gb|AAG51806.1|AC079676_1 phosphoethanolamine N-methyltransferase, putative; 6854-3993 
[Arabidopsis thaliana]
Length=555

 Score =   428 bits (1100),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 203/244 (83%), Positives = 219/244 (90%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYERVFG G+VSTGGLETTKEFV  LDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  306   DNVQYKSSGILRYERVFGEGFVSTGGLETTKEFVDMLDLKPGQKVLDVGCGIGGGDFYMA  365

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DV V+GIDLS NMI+ ALE AIGLKC+VEFEVADCTKK YPD TFDVIYSRDTILHI
Sbjct  366   ENFDVDVVGIDLSVNMISFALEHAIGLKCSVEFEVADCTKKEYPDNTFDVIYSRDTILHI  425

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFR FYKWLKPGGKVLITDYC+    PS +FA YIK+RGYDLHD + YGQMLRDA
Sbjct  426   QDKPALFRRFYKWLKPGGKVLITDYCRSPKTPSPDFAIYIKKRGYDLHDVQAYGQMLRDA  485

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GFE+VIAEDRTDQFMKVLK+ELDAVEKEKE FI DFS+EDY DI+GGWK KL R+SSGEQ
Sbjct  486   GFEEVIAEDRTDQFMKVLKRELDAVEKEKEEFISDFSKEDYEDIIGGWKSKLLRSSSGEQ  545

Query  910   RWGL  899
             +WGL
Sbjct  546   KWGL  549



>ref|XP_002887491.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63750.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=490

 Score =   425 bits (1093),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 202/244 (83%), Positives = 218/244 (89%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYERVFG G+VSTGGLETTKEFV  LDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  241   DNVQYKSSGILRYERVFGEGFVSTGGLETTKEFVDMLDLKPGQKVLDVGCGIGGGDFYMA  300

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DV V+GIDLS NMI+ ALE AIGLKC+VEFEVADCTKK YPD  FDVIYSRDTILHI
Sbjct  301   ENFDVDVVGIDLSVNMISFALEHAIGLKCSVEFEVADCTKKEYPDNIFDVIYSRDTILHI  360

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFR+FYKWLKPGGKVLITDYC+    PS +FA YIKQRGYDLHD + YGQMLRDA
Sbjct  361   QDKPALFRTFYKWLKPGGKVLITDYCRSPKTPSSDFANYIKQRGYDLHDVQAYGQMLRDA  420

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GFE+V AEDRTDQFMKVLK+ELDAVEKEKE FI DFS+EDY DI+GGWK KL R+SSGEQ
Sbjct  421   GFEEVTAEDRTDQFMKVLKRELDAVEKEKEEFISDFSKEDYEDIIGGWKSKLLRSSSGEQ  480

Query  910   RWGL  899
             +WGL
Sbjct  481   KWGL  484



>ref|XP_010471422.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Camelina sativa]
Length=490

 Score =   425 bits (1092),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 201/244 (82%), Positives = 219/244 (90%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYERVFG G+VSTGGLETTKEFV KLDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  241   DNVQYKSSGILRYERVFGQGFVSTGGLETTKEFVDKLDLKPGQKVLDVGCGIGGGDFYMA  300

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DV V+GIDLS NMI+ ALE AIGLKC+VEFEVADCTKK YPD TFDVIYSRDTILHI
Sbjct  301   ENFDVDVVGIDLSVNMISFALEHAIGLKCSVEFEVADCTKKEYPDNTFDVIYSRDTILHI  360

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFR+FYKWLKPGGK+LITDYC+    PS +FA YIKQRGYDLHD + YGQML+DA
Sbjct  361   QDKPALFRTFYKWLKPGGKILITDYCRSPKTPSPDFANYIKQRGYDLHDVQTYGQMLKDA  420

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GFE+VIAED TDQFMKVLK+ELDAVEKEK+ FI DFS+EDY DIVGGW  KL R+SSGEQ
Sbjct  421   GFEEVIAEDSTDQFMKVLKRELDAVEKEKDEFISDFSKEDYEDIVGGWNSKLLRSSSGEQ  480

Query  910   RWGL  899
             +WGL
Sbjct  481   KWGL  484



>ref|XP_006393387.1| hypothetical protein EUTSA_v10011451mg [Eutrema salsugineum]
 gb|ESQ30673.1| hypothetical protein EUTSA_v10011451mg [Eutrema salsugineum]
Length=475

 Score =   424 bits (1090),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 197/244 (81%), Positives = 222/244 (91%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK +GILRYERVFG GYVSTGG ETTKEFVAK+DL+PGQKVLDVGCGIGGGD YMA
Sbjct  226   DNVQYKSNGILRYERVFGQGYVSTGGFETTKEFVAKMDLKPGQKVLDVGCGIGGGDLYMA  285

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DVHV+GIDLS NMI+ ALERAIGLKC+VEFEVADCT KTYPD +FDVIYSRDTILHI
Sbjct  286   ENFDVHVVGIDLSVNMISFALERAIGLKCSVEFEVADCTTKTYPDHSFDVIYSRDTILHI  345

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALF++F+KWLKPGGKVLITDYC+ +  PS  FA YIKQRGYDLHD + YGQML+DA
Sbjct  346   QDKPALFKTFFKWLKPGGKVLITDYCRNAETPSPIFAEYIKQRGYDLHDVQAYGQMLKDA  405

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GFEDVIAEDRTDQF++VL++EL+ VEKEK+ FI DFSEEDYN+IVGGWK KL R++SGEQ
Sbjct  406   GFEDVIAEDRTDQFVQVLRRELERVEKEKDEFINDFSEEDYNEIVGGWKAKLERSTSGEQ  465

Query  910   RWGL  899
             +WGL
Sbjct  466   KWGL  469



>ref|XP_010416170.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like [Camelina 
sativa]
Length=490

 Score =   425 bits (1092),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 201/244 (82%), Positives = 221/244 (91%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYERVFG G+VSTGGLETTKEFV KLDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  241   DNVQYKSSGILRYERVFGQGFVSTGGLETTKEFVDKLDLKPGQKVLDVGCGIGGGDFYMA  300

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DV V+GIDLS NMI+ ALE AIGLKC+VEFEVADCTKK YPD TFDVIYSRDTILHI
Sbjct  301   ENFDVDVVGIDLSVNMISFALEHAIGLKCSVEFEVADCTKKEYPDKTFDVIYSRDTILHI  360

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFR+FYKWLKPGGK+LITDYC+    PS +FA YIKQRGYDLHD + YGQML+DA
Sbjct  361   QDKPALFRTFYKWLKPGGKILITDYCRSPKTPSPDFANYIKQRGYDLHDVQTYGQMLKDA  420

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GFE+VIAEDRTDQF+KVLK+ELDAVEKEK+ FI+DFS+EDY DIVGGW  KL R+SSGEQ
Sbjct  421   GFEEVIAEDRTDQFVKVLKRELDAVEKEKDEFIRDFSKEDYEDIVGGWNSKLLRSSSGEQ  480

Query  910   RWGL  899
             +WGL
Sbjct  481   KWGL  484



>ref|XP_010533969.1| PREDICTED: phosphomethylethanolamine N-methyltransferase [Tarenaya 
hassleriana]
Length=491

 Score =   424 bits (1091),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 198/244 (81%), Positives = 224/244 (92%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D+VQYK SGILRYERVFG G+VSTGG+ TTKEFVAKL+L+P QKVLDVGCGIGGGDFYMA
Sbjct  242   DSVQYKSSGILRYERVFGQGFVSTGGIVTTKEFVAKLELKPEQKVLDVGCGIGGGDFYMA  301

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DVHV+GIDLS NMI+ ALERAIGLKC+VEFEVADCT KTYPD +FDVIYSRDTILHI
Sbjct  302   ENFDVHVVGIDLSVNMISFALERAIGLKCSVEFEVADCTTKTYPDNSFDVIYSRDTILHI  361

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFR+F+KWLKPGGKVLI+DYC+ +  PS EFA YIKQRGYDLHD + YGQML+DA
Sbjct  362   QDKPALFRTFFKWLKPGGKVLISDYCRSAKTPSLEFAEYIKQRGYDLHDVQAYGQMLKDA  421

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF+DVIAEDRTDQFM+VL++ELD VE EKE FI+DFSEEDY+DIVGGWK KL R++SGEQ
Sbjct  422   GFDDVIAEDRTDQFMQVLQRELDKVEMEKEEFIRDFSEEDYDDIVGGWKAKLERSASGEQ  481

Query  910   RWGL  899
             +WGL
Sbjct  482   KWGL  485



>ref|XP_010471421.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Camelina sativa]
Length=504

 Score =   425 bits (1092),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 201/244 (82%), Positives = 219/244 (90%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYERVFG G+VSTGGLETTKEFV KLDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  255   DNVQYKSSGILRYERVFGQGFVSTGGLETTKEFVDKLDLKPGQKVLDVGCGIGGGDFYMA  314

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DV V+GIDLS NMI+ ALE AIGLKC+VEFEVADCTKK YPD TFDVIYSRDTILHI
Sbjct  315   ENFDVDVVGIDLSVNMISFALEHAIGLKCSVEFEVADCTKKEYPDNTFDVIYSRDTILHI  374

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFR+FYKWLKPGGK+LITDYC+    PS +FA YIKQRGYDLHD + YGQML+DA
Sbjct  375   QDKPALFRTFYKWLKPGGKILITDYCRSPKTPSPDFANYIKQRGYDLHDVQTYGQMLKDA  434

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GFE+VIAED TDQFMKVLK+ELDAVEKEK+ FI DFS+EDY DIVGGW  KL R+SSGEQ
Sbjct  435   GFEEVIAEDSTDQFMKVLKRELDAVEKEKDEFISDFSKEDYEDIVGGWNSKLLRSSSGEQ  494

Query  910   RWGL  899
             +WGL
Sbjct  495   KWGL  498



>dbj|BAE99185.1| putative phosphoethanolamine N-methyltransferase [Arabidopsis 
thaliana]
Length=504

 Score =   424 bits (1091),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 202/244 (83%), Positives = 218/244 (89%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYERVFG G+VSTGGLETTKEFV  LDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  255   DNVQYKSSGILRYERVFGEGFVSTGGLETTKEFVDMLDLKPGQKVLDVGCGIGGGDFYMA  314

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DV V+GIDLS NMI+ ALE AIGLKC+VEFEVADCTKK YPD TFDVIYSRDTILHI
Sbjct  315   ENFDVDVVGIDLSVNMISFALEHAIGLKCSVEFEVADCTKKEYPDNTFDVIYSRDTILHI  374

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFR FYKWLKPGGKVLI DYC+    PS +FA YIK+RGYDLHD + YGQMLRDA
Sbjct  375   QDKPALFRRFYKWLKPGGKVLIADYCRSPKTPSPDFAIYIKKRGYDLHDVQAYGQMLRDA  434

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GFE+VIAEDRTDQFMKVLK+ELDAVEKEKE FI DFS+EDY DI+GGWK KL R+SSGEQ
Sbjct  435   GFEEVIAEDRTDQFMKVLKRELDAVEKEKEEFISDFSKEDYEDIIGGWKSKLLRSSSGEQ  494

Query  910   RWGL  899
             +WGL
Sbjct  495   KWGL  498



>ref|XP_004137341.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Cucumis 
sativus]
Length=500

 Score =   424 bits (1091),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 200/244 (82%), Positives = 220/244 (90%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             DTVQYKCSGILRYERVFG G+VSTGGLETTKEFVAKLDL+ GQ+VLDVGCGIGGGDFYMA
Sbjct  249   DTVQYKCSGILRYERVFGSGFVSTGGLETTKEFVAKLDLKAGQRVLDVGCGIGGGDFYMA  308

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DV V+GIDLS NMI++ALERAIGLKCAVEFEVADCTKK Y D TFDVIYSRDTILHI
Sbjct  309   ENFDVEVVGIDLSINMISLALERAIGLKCAVEFEVADCTKKVYLDNTFDVIYSRDTILHI  368

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFRSFYKW+KPGGK+LI+DYCK  G PS EFA YI+QRGYDLHD + Y +ML +A
Sbjct  369   QDKPALFRSFYKWVKPGGKILISDYCKSGGVPSSEFAEYIEQRGYDLHDIKSYAKMLEEA  428

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF +V+AEDRTDQFM VL++ELD VEKEKEAFI DFSEEDYNDIVGGWK KL R+  GEQ
Sbjct  429   GFNNVVAEDRTDQFMSVLQRELDIVEKEKEAFILDFSEEDYNDIVGGWKAKLKRSWCGEQ  488

Query  910   RWGL  899
             +WGL
Sbjct  489   KWGL  492



>ref|XP_007036803.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 2 [Theobroma cacao]
 gb|EOY21304.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 2 [Theobroma cacao]
Length=494

 Score =   424 bits (1090),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 197/245 (80%), Positives = 225/245 (92%), Gaps = 1/245 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             DTVQYKCSGILRYERVFG G+VSTGG+ETTKEFV KLDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  244   DTVQYKCSGILRYERVFGEGFVSTGGIETTKEFVGKLDLKPGQKVLDVGCGIGGGDFYMA  303

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E +DVHV+GIDLS NMI+ ALERAIG+ C+VEFEVADCTKKTYPD +FDVIYSRDTILHI
Sbjct  304   EKFDVHVVGIDLSINMISFALERAIGMNCSVEFEVADCTKKTYPDNSFDVIYSRDTILHI  363

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYG-QMLRD  1094
             QDKPALFRSFYKWLKPGGKVLI+DYCK +G PS EFA YI+QRGYDLHD E YG Q+L D
Sbjct  364   QDKPALFRSFYKWLKPGGKVLISDYCKNAGTPSSEFAEYIEQRGYDLHDVEAYGQQILSD  423

Query  1093  AGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGE  914
             AGF++VIAEDRT+QF++VL++EL+ VEK+K+AF+  FS+EDY+DI+GGWK KL R+SSGE
Sbjct  424   AGFDEVIAEDRTEQFLQVLQRELNEVEKDKDAFVSSFSQEDYDDILGGWKAKLIRSSSGE  483

Query  913   QRWGL  899
             QRWGL
Sbjct  484   QRWGL  488



>gb|KFK41794.1| hypothetical protein AALP_AA2G173000 [Arabis alpina]
Length=505

 Score =   424 bits (1090),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 200/244 (82%), Positives = 219/244 (90%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYERVFG G+VSTGGLETTKEFV  LDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  256   DNVQYKSSGILRYERVFGEGFVSTGGLETTKEFVDMLDLKPGQKVLDVGCGIGGGDFYMA  315

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+D+ V+GIDLS NMI+ ALE AIGLKC+VEFEVADCTKK YPD TFDVIYSRDTILHI
Sbjct  316   ENFDLDVVGIDLSVNMISFALEHAIGLKCSVEFEVADCTKKEYPDNTFDVIYSRDTILHI  375

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFR+FYKWLKPGGKVLITDYC+    PS +FA YIKQRGYDLHD + YGQML+DA
Sbjct  376   QDKPALFRTFYKWLKPGGKVLITDYCRSPKTPSADFANYIKQRGYDLHDVQAYGQMLKDA  435

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF +VIAEDRTDQFMKVLK+ELDAVEKEK+ FI DFS+EDY DI+GGWK KL R+SSGEQ
Sbjct  436   GFNEVIAEDRTDQFMKVLKRELDAVEKEKDDFISDFSKEDYEDIIGGWKSKLLRSSSGEQ  495

Query  910   RWGL  899
             +WGL
Sbjct  496   KWGL  499



>ref|XP_002322102.2| hypothetical protein POPTR_0015s04540g [Populus trichocarpa]
 gb|EEF06229.2| hypothetical protein POPTR_0015s04540g [Populus trichocarpa]
Length=516

 Score =   424 bits (1090),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 201/244 (82%), Positives = 221/244 (91%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK +GILRYERVFG GYVSTGG+ETTKEFV KLDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  267   DNVQYKSNGILRYERVFGQGYVSTGGIETTKEFVGKLDLKPGQKVLDVGCGIGGGDFYMA  326

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DV V+GIDLS NMI+ ALERAIGLK +VEFEVADCT KTYPD TFDVIYSRDTILHI
Sbjct  327   ENFDVEVVGIDLSINMISFALERAIGLKYSVEFEVADCTTKTYPDNTFDVIYSRDTILHI  386

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFRSF+KWLKPGGKVLI+DYCK  G PS EFA YIKQRGYDLHD + YGQMLRDA
Sbjct  387   QDKPALFRSFFKWLKPGGKVLISDYCKCDGTPSPEFAEYIKQRGYDLHDVKAYGQMLRDA  446

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF++V+AEDRTDQF KVL++EL+A+EK+K+ FI DFSE DYNDIVGGWK KL R+SSGEQ
Sbjct  447   GFDEVVAEDRTDQFNKVLQRELNAIEKDKDEFIHDFSEGDYNDIVGGWKAKLIRSSSGEQ  506

Query  910   RWGL  899
             RWGL
Sbjct  507   RWGL  510



>sp|Q9M571.1|PEAMT_SPIOL RecName: Full=Phosphoethanolamine N-methyltransferase [Spinacia 
oleracea]
 gb|AAF61950.1|AF237633_1 phosphoethanolamine N-methyltransferase [Spinacia oleracea]
Length=494

 Score =   423 bits (1088),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 198/244 (81%), Positives = 224/244 (92%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D+ QYK + ILRYERVFGPGYVSTGGLETTKEFV+KLDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  245   DSSQYKFNSILRYERVFGPGYVSTGGLETTKEFVSKLDLKPGQKVLDVGCGIGGGDFYMA  304

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             ENYDV V+GIDLS NMI+ ALER+IGLKCAVEFEVADCTKK YP+ +FDVIYSRDTILHI
Sbjct  305   ENYDVEVVGIDLSINMISFALERSIGLKCAVEFEVADCTKKDYPENSFDVIYSRDTILHI  364

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFRSF+KWLKPGGKVLI+DYCK +G PS EFAAYI+QRGYDLHD + YG+ML+DA
Sbjct  365   QDKPALFRSFHKWLKPGGKVLISDYCKSAGTPSAEFAAYIRQRGYDLHDVKAYGKMLKDA  424

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF +VIAE+RTDQF++VL+KELDA+E+EK+ FI DFSEEDYNDIV GWK KL RT+ GEQ
Sbjct  425   GFVEVIAENRTDQFIQVLQKELDALEQEKDDFIDDFSEEDYNDIVDGWKAKLVRTTEGEQ  484

Query  910   RWGL  899
             +WGL
Sbjct  485   QWGL  488



>ref|XP_008393424.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Malus 
domestica]
Length=492

 Score =   423 bits (1087),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 198/244 (81%), Positives = 223/244 (91%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK +GILRYERVFG G+VSTGG+ETTKEFVAKLDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  243   DNVQYKNNGILRYERVFGRGFVSTGGIETTKEFVAKLDLKPGQKVLDVGCGIGGGDFYMA  302

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
              N+DV VIGIDLS NMI+ ALE++IGLKCAVEFEVADCTKKTYPD TFDVIYSRDTILHI
Sbjct  303   SNFDVEVIGIDLSVNMISFALEQSIGLKCAVEFEVADCTKKTYPDNTFDVIYSRDTILHI  362

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFRSFY+WLKPGGKVLI+DYC+  G PSE FA YIKQRGYDLHD + YGQML+DA
Sbjct  363   QDKPALFRSFYEWLKPGGKVLISDYCRCVGTPSENFAEYIKQRGYDLHDVKAYGQMLKDA  422

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF++VIAEDRTDQF  VL++ELDAVEK+K++F+QDFS+EDY+DI+GGWK KL R  SGEQ
Sbjct  423   GFDEVIAEDRTDQFKAVLERELDAVEKDKDSFVQDFSQEDYDDIIGGWKAKLIRVDSGEQ  482

Query  910   RWGL  899
             +WGL
Sbjct  483   KWGL  486



>ref|XP_010519218.1| PREDICTED: phosphoethanolamine N-methyltransferase 3 isoform 
X1 [Tarenaya hassleriana]
Length=510

 Score =   424 bits (1089),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 200/244 (82%), Positives = 221/244 (91%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYERVFG GYVSTGG+ETTKEFV KLDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  252   DNVQYKSSGILRYERVFGQGYVSTGGIETTKEFVGKLDLKPGQKVLDVGCGIGGGDFYMA  311

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DV V+GIDLS NMI+ ALERAIGLKC+VEFEVADCTKK+YP  TFDVIYSRDTILHI
Sbjct  312   ENFDVDVVGIDLSINMISFALERAIGLKCSVEFEVADCTKKSYPVNTFDVIYSRDTILHI  371

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFR+FYKWLKPGGKVLI+DYC+    PS +FA YI+QRGYDLHD + YGQML+DA
Sbjct  372   QDKPALFRTFYKWLKPGGKVLISDYCRSPKAPSPDFAEYIEQRGYDLHDIQAYGQMLKDA  431

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF++V AEDRTDQFM+VLK+ELDAVEKEKE FI DFS+EDY +IVGGWK KL R+SSGEQ
Sbjct  432   GFDEVTAEDRTDQFMQVLKRELDAVEKEKEEFILDFSKEDYEEIVGGWKAKLMRSSSGEQ  491

Query  910   RWGL  899
             RWGL
Sbjct  492   RWGL  495



>ref|XP_008360927.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 [Malus domestica]
Length=492

 Score =   423 bits (1087),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 198/244 (81%), Positives = 223/244 (91%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK +GILRYERVFG G+VSTGG+ETTKEFVAKLDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  243   DNVQYKNNGILRYERVFGRGFVSTGGIETTKEFVAKLDLKPGQKVLDVGCGIGGGDFYMA  302

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
              N+DV VIGIDLS NMI+ ALE++IGLKCAVEFEVADCTKKTYPD TFDVIYSRDTILHI
Sbjct  303   SNFDVEVIGIDLSVNMISFALEQSIGLKCAVEFEVADCTKKTYPDNTFDVIYSRDTILHI  362

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFRSFY+WLKPGGKVLI+DYC+  G PSE FA YIKQRGYDLHD + YGQML+DA
Sbjct  363   QDKPALFRSFYEWLKPGGKVLISDYCRCVGTPSENFAEYIKQRGYDLHDVKAYGQMLKDA  422

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF++VIAEDRTDQF  VL++ELDAVEK+K++F+QDFS+EDY+DI+GGWK KL R  SGEQ
Sbjct  423   GFDEVIAEDRTDQFKAVLERELDAVEKDKDSFVQDFSQEDYDDIIGGWKAKLIRVDSGEQ  482

Query  910   RWGL  899
             +WGL
Sbjct  483   KWGL  486



>ref|XP_006390538.1| hypothetical protein EUTSA_v10018431mg [Eutrema salsugineum]
 gb|ESQ27824.1| hypothetical protein EUTSA_v10018431mg [Eutrema salsugineum]
Length=504

 Score =   423 bits (1088),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 200/244 (82%), Positives = 219/244 (90%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYERVFG G+VSTGGLETTKEFV  LDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  255   DNVQYKSSGILRYERVFGQGFVSTGGLETTKEFVGMLDLKPGQKVLDVGCGIGGGDFYMA  314

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DV V+GIDLS NMI+ ALE +IGLKC+VEFEVADCTKK YPD TFDVIYSRDTILHI
Sbjct  315   ENFDVDVVGIDLSVNMISFALEHSIGLKCSVEFEVADCTKKEYPDNTFDVIYSRDTILHI  374

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFR+FYKWLKPGGKVLITDYC+    PS +FA YIKQRGYDLHD + YGQML+DA
Sbjct  375   QDKPALFRTFYKWLKPGGKVLITDYCRSPKTPSPDFANYIKQRGYDLHDVQAYGQMLKDA  434

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF+DVIAEDRTDQFMKVLK+ELDAVEKEK+ FI DFS+EDY +IVGGW  KL R+SSGEQ
Sbjct  435   GFDDVIAEDRTDQFMKVLKRELDAVEKEKKEFISDFSKEDYEEIVGGWNSKLLRSSSGEQ  494

Query  910   RWGL  899
             +WGL
Sbjct  495   KWGL  498



>emb|CDX95799.1| BnaC05g35500D [Brassica napus]
Length=481

 Score =   422 bits (1086),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 196/244 (80%), Positives = 220/244 (90%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYERVFG G+VSTGG+ETTKEFV K+DL+PGQKVLDVGCGIGGGDFYMA
Sbjct  232   DNVQYKSSGILRYERVFGQGFVSTGGIETTKEFVEKMDLKPGQKVLDVGCGIGGGDFYMA  291

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DVHV+GIDLS NMI+ ALERAIGL C+VEFEVADCT K YP+ +FDVIYSRDTILHI
Sbjct  292   ENFDVHVVGIDLSVNMISFALERAIGLNCSVEFEVADCTTKHYPENSFDVIYSRDTILHI  351

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFR+F+KWLKPGGKVLI+DYCK S  PS EF+ YIKQRGYDLHD + YGQML+DA
Sbjct  352   QDKPALFRTFFKWLKPGGKVLISDYCKSSETPSPEFSEYIKQRGYDLHDVQAYGQMLKDA  411

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF DVIAEDRTDQFM+VL++EL+ VEKEKE FI DFS+EDY DIVGGWK KL R++SGEQ
Sbjct  412   GFNDVIAEDRTDQFMQVLRRELERVEKEKEEFISDFSKEDYEDIVGGWKAKLERSASGEQ  471

Query  910   RWGL  899
             +WGL
Sbjct  472   KWGL  475



>ref|XP_010461683.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Camelina sativa]
Length=492

 Score =   423 bits (1087),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 196/244 (80%), Positives = 220/244 (90%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYERVFG GYVSTGG ETTKEFVAK+DL+PGQKVLDVGCGI GGDFYMA
Sbjct  243   DNVQYKSSGILRYERVFGEGYVSTGGAETTKEFVAKMDLKPGQKVLDVGCGIAGGDFYMA  302

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
              N+DVHV+GIDLS NMI+ ALERAIGL C+VEFEVADCT KTYPD +FDVIYSRDTILHI
Sbjct  303   ANFDVHVVGIDLSVNMISFALERAIGLNCSVEFEVADCTTKTYPDNSFDVIYSRDTILHI  362

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFR+F+KWLKPGGKVLITDYC+ +  PS EFA YIKQRGYDLHD + YG+ML++A
Sbjct  363   QDKPALFRTFFKWLKPGGKVLITDYCRSAETPSPEFAEYIKQRGYDLHDVQAYGKMLKEA  422

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GFEDVIAEDRTDQF++VL++EL+ VE+EKE FI DFS+EDYNDIVGGW  KL RT+SGEQ
Sbjct  423   GFEDVIAEDRTDQFVQVLRRELEKVEREKEEFISDFSQEDYNDIVGGWTAKLERTASGEQ  482

Query  910   RWGL  899
             +WGL
Sbjct  483   KWGL  486



>ref|XP_010519219.1| PREDICTED: phosphoethanolamine N-methyltransferase 3 isoform 
X2 [Tarenaya hassleriana]
Length=499

 Score =   423 bits (1088),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 200/244 (82%), Positives = 221/244 (91%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYERVFG GYVSTGG+ETTKEFV KLDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  241   DNVQYKSSGILRYERVFGQGYVSTGGIETTKEFVGKLDLKPGQKVLDVGCGIGGGDFYMA  300

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DV V+GIDLS NMI+ ALERAIGLKC+VEFEVADCTKK+YP  TFDVIYSRDTILHI
Sbjct  301   ENFDVDVVGIDLSINMISFALERAIGLKCSVEFEVADCTKKSYPVNTFDVIYSRDTILHI  360

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFR+FYKWLKPGGKVLI+DYC+    PS +FA YI+QRGYDLHD + YGQML+DA
Sbjct  361   QDKPALFRTFYKWLKPGGKVLISDYCRSPKAPSPDFAEYIEQRGYDLHDIQAYGQMLKDA  420

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF++V AEDRTDQFM+VLK+ELDAVEKEKE FI DFS+EDY +IVGGWK KL R+SSGEQ
Sbjct  421   GFDEVTAEDRTDQFMQVLKRELDAVEKEKEEFILDFSKEDYEEIVGGWKAKLMRSSSGEQ  480

Query  910   RWGL  899
             RWGL
Sbjct  481   RWGL  484



>gb|KJB30120.1| hypothetical protein B456_005G132000 [Gossypium raimondii]
Length=465

 Score =   422 bits (1084),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 196/244 (80%), Positives = 221/244 (91%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D+VQYK + ILRYERVFGPGYVSTGG+ETTKEFV KLDL+PGQKVLDVGCGIGGGD YMA
Sbjct  215   DSVQYKSNSILRYERVFGPGYVSTGGIETTKEFVGKLDLKPGQKVLDVGCGIGGGDIYMA  274

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E +DVHV+GIDLS NMI+ ALERA GLKC+VEFEVADCTKK YPD +FDVIYSRDTILHI
Sbjct  275   EEFDVHVVGIDLSVNMISFALERATGLKCSVEFEVADCTKKVYPDNSFDVIYSRDTILHI  334

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
              DKPALFRSFYKWLKPGGK+LI+DYCK S  PS EFAAYIKQRGYDLHD + YGQML DA
Sbjct  335   HDKPALFRSFYKWLKPGGKLLISDYCKSSKTPSTEFAAYIKQRGYDLHDVKSYGQMLEDA  394

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF+ ++AEDRTDQF++VL++EL+ VEKEK+AFI DFS+EDY++IVGGWK KL R+SSGEQ
Sbjct  395   GFDVILAEDRTDQFLQVLQRELNQVEKEKDAFISDFSKEDYDEIVGGWKAKLIRSSSGEQ  454

Query  910   RWGL  899
             RWGL
Sbjct  455   RWGL  458



>ref|XP_010263678.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Nelumbo 
nucifera]
Length=489

 Score =   422 bits (1086),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 197/244 (81%), Positives = 221/244 (91%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYKC+GILRYERVFG G+VSTGG++TTKEFVAKL+L PGQKVLDVGCGIGGGDFYMA
Sbjct  241   DNVQYKCNGILRYERVFGEGFVSTGGIDTTKEFVAKLELTPGQKVLDVGCGIGGGDFYMA  300

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DV V GIDLS NM++ ALERAIG KC VEFEVADCTKK YP+ TFDVIYSRDTILHI
Sbjct  301   ENFDVEVFGIDLSINMVSFALERAIGRKCLVEFEVADCTKKAYPNNTFDVIYSRDTILHI  360

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             +DKPALF+SF+KWLKPGGKVLI+DYCKR+G PS+EFA YI+QRGYDLHD E YGQMLRDA
Sbjct  361   KDKPALFKSFFKWLKPGGKVLISDYCKRAGSPSKEFAEYIEQRGYDLHDVEAYGQMLRDA  420

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF++V AEDRTDQF+KVL++ELDAVEK +  FI DFSEEDYN+IVGGWK KL R+S GEQ
Sbjct  421   GFKEVNAEDRTDQFIKVLQRELDAVEKARGTFIYDFSEEDYNEIVGGWKAKLVRSSMGEQ  480

Query  910   RWGL  899
             RWGL
Sbjct  481   RWGL  484



>gb|KJB30122.1| hypothetical protein B456_005G132000 [Gossypium raimondii]
Length=491

 Score =   422 bits (1085),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 196/244 (80%), Positives = 221/244 (91%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D+VQYK + ILRYERVFGPGYVSTGG+ETTKEFV KLDL+PGQKVLDVGCGIGGGD YMA
Sbjct  241   DSVQYKSNSILRYERVFGPGYVSTGGIETTKEFVGKLDLKPGQKVLDVGCGIGGGDIYMA  300

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E +DVHV+GIDLS NMI+ ALERA GLKC+VEFEVADCTKK YPD +FDVIYSRDTILHI
Sbjct  301   EEFDVHVVGIDLSVNMISFALERATGLKCSVEFEVADCTKKVYPDNSFDVIYSRDTILHI  360

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
              DKPALFRSFYKWLKPGGK+LI+DYCK S  PS EFAAYIKQRGYDLHD + YGQML DA
Sbjct  361   HDKPALFRSFYKWLKPGGKLLISDYCKSSKTPSTEFAAYIKQRGYDLHDVKSYGQMLEDA  420

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF+ ++AEDRTDQF++VL++EL+ VEKEK+AFI DFS+EDY++IVGGWK KL R+SSGEQ
Sbjct  421   GFDVILAEDRTDQFLQVLQRELNQVEKEKDAFISDFSKEDYDEIVGGWKAKLIRSSSGEQ  480

Query  910   RWGL  899
             RWGL
Sbjct  481   RWGL  484



>ref|XP_006302164.1| hypothetical protein CARUB_v10020173mg [Capsella rubella]
 gb|EOA35062.1| hypothetical protein CARUB_v10020173mg [Capsella rubella]
Length=503

 Score =   422 bits (1086),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 200/244 (82%), Positives = 218/244 (89%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYERVFG G+VSTGGLETT EFV  LDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  254   DNVQYKSSGILRYERVFGQGFVSTGGLETTMEFVDMLDLKPGQKVLDVGCGIGGGDFYMA  313

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DV V+GIDLS NMI+ ALE AIGLKC+VEFEVADCTKK YPD TFDVIYSRDTILHI
Sbjct  314   ENFDVDVVGIDLSVNMISFALEHAIGLKCSVEFEVADCTKKEYPDNTFDVIYSRDTILHI  373

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFR+FYKWLKPGGK+LITDYC+    PS +FA YIKQRGYDLHD + YGQML+DA
Sbjct  374   QDKPALFRTFYKWLKPGGKILITDYCRSPKTPSSDFANYIKQRGYDLHDVQAYGQMLKDA  433

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GFE+VIAEDRTDQFMKVLK+ELDAVEKEK+ FI DFS+EDY DIVGGW  KL R+SSGEQ
Sbjct  434   GFEEVIAEDRTDQFMKVLKRELDAVEKEKDEFISDFSKEDYEDIVGGWSSKLLRSSSGEQ  493

Query  910   RWGL  899
             +WGL
Sbjct  494   KWGL  497



>ref|XP_008464197.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Cucumis 
melo]
Length=493

 Score =   422 bits (1085),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 196/244 (80%), Positives = 219/244 (90%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYKC+GILRYERVFG G+VSTGG+ETTKEFV+KL+L+PGQKVLDVGCGIGGGDFYMA
Sbjct  244   DNVQYKCNGILRYERVFGQGFVSTGGIETTKEFVSKLELKPGQKVLDVGCGIGGGDFYMA  303

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DV V+GIDLS NMI+ ALERAIG KC VEFEVADCT KTYPD TFDVIYSRDTILHI
Sbjct  304   ENFDVEVVGIDLSINMISFALERAIGRKCPVEFEVADCTTKTYPDNTFDVIYSRDTILHI  363

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALF+SFYKWLKPGGKVLI+DYC+  G P+EEF+ YIKQRGYDLHD + YGQML+D 
Sbjct  364   QDKPALFKSFYKWLKPGGKVLISDYCRSDGTPTEEFSEYIKQRGYDLHDVKAYGQMLQDV  423

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF DVIAEDRTDQF++VL++EL   EKEKE FIQDFS EDYN+IV GWK KL R+S+GEQ
Sbjct  424   GFHDVIAEDRTDQFIRVLERELSTTEKEKEEFIQDFSVEDYNEIVDGWKAKLVRSSTGEQ  483

Query  910   RWGL  899
             RWGL
Sbjct  484   RWGL  487



>gb|KJB30117.1| hypothetical protein B456_005G132000 [Gossypium raimondii]
Length=494

 Score =   422 bits (1085),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 196/244 (80%), Positives = 221/244 (91%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D+VQYK + ILRYERVFGPGYVSTGG+ETTKEFV KLDL+PGQKVLDVGCGIGGGD YMA
Sbjct  244   DSVQYKSNSILRYERVFGPGYVSTGGIETTKEFVGKLDLKPGQKVLDVGCGIGGGDIYMA  303

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E +DVHV+GIDLS NMI+ ALERA GLKC+VEFEVADCTKK YPD +FDVIYSRDTILHI
Sbjct  304   EEFDVHVVGIDLSVNMISFALERATGLKCSVEFEVADCTKKVYPDNSFDVIYSRDTILHI  363

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
              DKPALFRSFYKWLKPGGK+LI+DYCK S  PS EFAAYIKQRGYDLHD + YGQML DA
Sbjct  364   HDKPALFRSFYKWLKPGGKLLISDYCKSSKTPSTEFAAYIKQRGYDLHDVKSYGQMLEDA  423

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF+ ++AEDRTDQF++VL++EL+ VEKEK+AFI DFS+EDY++IVGGWK KL R+SSGEQ
Sbjct  424   GFDVILAEDRTDQFLQVLQRELNQVEKEKDAFISDFSKEDYDEIVGGWKAKLIRSSSGEQ  483

Query  910   RWGL  899
             RWGL
Sbjct  484   RWGL  487



>ref|XP_010921161.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Elaeis 
guineensis]
Length=494

 Score =   421 bits (1083),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 197/244 (81%), Positives = 220/244 (90%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYERVFG G+VSTGG+ETTKEFVAKL L PGQKVLDVGCGIGGGDFYMA
Sbjct  245   DNVQYKSSGILRYERVFGEGFVSTGGIETTKEFVAKLALNPGQKVLDVGCGIGGGDFYMA  304

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN DV V+GIDLS NMI+ ALERAIG KC++EFEVADCTKKTYPD TFDVIYSRDTILHI
Sbjct  305   ENLDVDVVGIDLSINMISFALERAIGRKCSIEFEVADCTKKTYPDNTFDVIYSRDTILHI  364

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKP LFRSF+KWLKPGGK+LITDYCK SG PSE FA YIKQRGYDLHD E YGQML+DA
Sbjct  365   QDKPMLFRSFFKWLKPGGKILITDYCKSSGTPSEAFAEYIKQRGYDLHDVEAYGQMLKDA  424

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF + +AEDRTDQF++VL++ELDAVEK+K+AF+Q+FS+EDY++IV GWK KL R+S GEQ
Sbjct  425   GFYEAVAEDRTDQFLEVLQRELDAVEKDKDAFVQEFSKEDYDEIVSGWKAKLKRSSFGEQ  484

Query  910   RWGL  899
             RWGL
Sbjct  485   RWGL  488



>ref|XP_009145948.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 [Brassica 
rapa]
Length=492

 Score =   421 bits (1083),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 195/244 (80%), Positives = 220/244 (90%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYERVFG G+VSTGG+ETTKEFV K+DL+PGQKVLDVGCGIGGGDFYMA
Sbjct  243   DNVQYKSSGILRYERVFGQGFVSTGGIETTKEFVEKMDLKPGQKVLDVGCGIGGGDFYMA  302

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DVHV+GIDLS NMI+ ALERAIGL C+VEFEVADCT K YP+ +FDVIYSRDTILHI
Sbjct  303   ENFDVHVVGIDLSVNMISFALERAIGLNCSVEFEVADCTTKHYPENSFDVIYSRDTILHI  362

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFR+F+KWLKPGGKVLI+DYCK S  PS EF+ YIKQRGYDLHD + YGQML++A
Sbjct  363   QDKPALFRTFFKWLKPGGKVLISDYCKSSETPSPEFSEYIKQRGYDLHDVQAYGQMLKEA  422

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF DVIAEDRTDQFM+VL++EL+ VEKEKE FI DFS+EDY DIVGGWK KL R++SGEQ
Sbjct  423   GFNDVIAEDRTDQFMQVLRRELERVEKEKEEFISDFSKEDYEDIVGGWKAKLERSASGEQ  482

Query  910   RWGL  899
             +WGL
Sbjct  483   KWGL  486



>dbj|BAD80838.1| phosphoethanolamine N-methyltransferase [Atriplex nummularia]
Length=503

 Score =   422 bits (1084),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 199/244 (82%), Positives = 220/244 (90%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D+ QYK + ILRYERVFGPGYVSTGG+ETTKEFV+KLDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  254   DSSQYKFNSILRYERVFGPGYVSTGGVETTKEFVSKLDLKPGQKVLDVGCGIGGGDFYMA  313

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             ENYDV V+GIDLS NMI+ ALER+IGLKCAVEFEVADCTKK YP+ +FDVIYSRDTILHI
Sbjct  314   ENYDVEVVGIDLSINMISFALERSIGLKCAVEFEVADCTKKDYPENSFDVIYSRDTILHI  373

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFRSF KWLKPGGKVLI+DYCK + PPS EFAAYIKQRGYDLHD + YGQML+DA
Sbjct  374   QDKPALFRSFLKWLKPGGKVLISDYCKSAVPPSSEFAAYIKQRGYDLHDVKAYGQMLKDA  433

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF +VIAEDRTDQF+KVL++ELDA+E EK+ FI DFSE+DYNDIV GWK KL RT   EQ
Sbjct  434   GFIEVIAEDRTDQFIKVLQRELDALETEKDEFIADFSEQDYNDIVDGWKAKLVRTKGDEQ  493

Query  910   RWGL  899
             RWGL
Sbjct  494   RWGL  497



>ref|XP_004137500.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Cucumis 
sativus]
 gb|KGN64173.1| hypothetical protein Csa_1G042800 [Cucumis sativus]
Length=493

 Score =   421 bits (1081),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 195/244 (80%), Positives = 219/244 (90%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYKC+GILRYERVFG G+VSTGG+ETTKEFV+KL+L+PGQKVLDVGCGIGGGDFYMA
Sbjct  244   DNVQYKCNGILRYERVFGQGFVSTGGIETTKEFVSKLELKPGQKVLDVGCGIGGGDFYMA  303

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+D  V+GIDLS NMI+ ALERAIG KC VEFEVADCT KTYPD TFDVIYSRDTILHI
Sbjct  304   ENFDAEVVGIDLSINMISFALERAIGRKCPVEFEVADCTTKTYPDNTFDVIYSRDTILHI  363

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALF+SFYKWLKPGGKVLI+DYC+    P+EEF+ YIKQRGYDLHD + YGQML+DA
Sbjct  364   QDKPALFKSFYKWLKPGGKVLISDYCRSDETPTEEFSEYIKQRGYDLHDVKAYGQMLQDA  423

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF DVIAEDRTDQF++VL++EL  +EKEKE FIQDFS EDYN+IV GWK KL R+S+GEQ
Sbjct  424   GFHDVIAEDRTDQFIRVLERELSTIEKEKEEFIQDFSVEDYNEIVDGWKAKLVRSSTGEQ  483

Query  910   RWGL  899
             RWGL
Sbjct  484   RWGL  487



>ref|XP_009360079.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Pyrus 
x bretschneideri]
Length=492

 Score =   421 bits (1081),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 198/244 (81%), Positives = 221/244 (91%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK +GILRYERVFG G+VSTGG+ETTKEFVAKLDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  243   DNVQYKNNGILRYERVFGRGFVSTGGIETTKEFVAKLDLKPGQKVLDVGCGIGGGDFYMA  302

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
              N+DV VIGIDLS NMI+ ALE++IGLKCAVEFEVADCTKKTYPD TFDVIYSRDTILHI
Sbjct  303   SNFDVEVIGIDLSVNMISFALEQSIGLKCAVEFEVADCTKKTYPDNTFDVIYSRDTILHI  362

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFRSFYKWLKPGGKVLI+DYC+ +G PSE FA YIKQRGYDLHD + YGQML DA
Sbjct  363   QDKPALFRSFYKWLKPGGKVLISDYCRGAGTPSENFAEYIKQRGYDLHDVKAYGQMLEDA  422

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF +VIAEDRTDQF  VL++ELDA+EK+K++F+QDFS+ DY+DIVGGWK KL R  SGEQ
Sbjct  423   GFYEVIAEDRTDQFKAVLERELDAIEKDKDSFVQDFSQGDYDDIVGGWKAKLIRVDSGEQ  482

Query  910   RWGL  899
             +WGL
Sbjct  483   KWGL  486



>gb|KHG16117.1| Phosphoethanolamine N-methyltransferase 1 -like protein [Gossypium 
arboreum]
Length=486

 Score =   420 bits (1080),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 195/244 (80%), Positives = 220/244 (90%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D+VQYK + ILRYERVFGPGYVSTGG+ETTKEFV KLDL+PGQKVLDVGCGIGGGD YMA
Sbjct  235   DSVQYKSNSILRYERVFGPGYVSTGGIETTKEFVGKLDLKPGQKVLDVGCGIGGGDIYMA  294

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E +DVHV+GIDLS NMI+ ALERA GLKC+VEFEVADCTKK YPD +FDVIYSRDTILHI
Sbjct  295   EEFDVHVVGIDLSVNMISFALERATGLKCSVEFEVADCTKKVYPDNSFDVIYSRDTILHI  354

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
              DKPALFRSFYKWLKPGGK+LI+DYCK S  PS EFA YIKQRGYDLHD + YGQML DA
Sbjct  355   HDKPALFRSFYKWLKPGGKLLISDYCKSSKTPSREFAEYIKQRGYDLHDVKSYGQMLEDA  414

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF+ ++AEDRTDQF++VL++EL+ VEKEK+AFI DFS+EDY++IVGGWK KL R+SSGEQ
Sbjct  415   GFDVILAEDRTDQFLQVLRRELNQVEKEKDAFISDFSKEDYDEIVGGWKAKLIRSSSGEQ  474

Query  910   RWGL  899
             RWGL
Sbjct  475   RWGL  478



>ref|XP_009356042.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Pyrus 
x bretschneideri]
Length=492

 Score =   420 bits (1080),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 198/244 (81%), Positives = 221/244 (91%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK +GILRYERVFG G+VSTGG+ETTKEFVAKLDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  243   DNVQYKNTGILRYERVFGQGFVSTGGIETTKEFVAKLDLKPGQKVLDVGCGIGGGDFYMA  302

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
              N+DV VIGIDLS NMI+ ALE++IGLKCAVEFEVADCTKKTYPD TFDVIYSRDTILHI
Sbjct  303   SNFDVEVIGIDLSVNMISFALEQSIGLKCAVEFEVADCTKKTYPDNTFDVIYSRDTILHI  362

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFRSFYKWLKPGGKVLI+DYC+ +G P E FA YIKQRGYDLHD + YGQML+DA
Sbjct  363   QDKPALFRSFYKWLKPGGKVLISDYCRCAGTPLENFADYIKQRGYDLHDVKAYGQMLKDA  422

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF++VIAEDRTDQF  VL +EL AVEK+K++F+QDFS+EDY+DIVGGWK KL R  SGEQ
Sbjct  423   GFDEVIAEDRTDQFKAVLARELAAVEKDKDSFVQDFSQEDYDDIVGGWKAKLIRVDSGEQ  482

Query  910   RWGL  899
             +WGL
Sbjct  483   KWGL  486



>emb|CDX92181.1| BnaA05g22260D [Brassica napus]
Length=464

 Score =   419 bits (1076),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 194/244 (80%), Positives = 220/244 (90%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYERVFG G+VSTGG+ETTKEFV K+DL+PGQKVLDVGCGIGGGDFYMA
Sbjct  215   DNVQYKSSGILRYERVFGQGFVSTGGIETTKEFVEKMDLKPGQKVLDVGCGIGGGDFYMA  274

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DVHV+GIDLS NMI+ ALERAIGL C+VEFEVADCT K YP+ +FDVIYSRDTILHI
Sbjct  275   ENFDVHVVGIDLSVNMISFALERAIGLNCSVEFEVADCTTKHYPENSFDVIYSRDTILHI  334

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFR+F+KWLKPGGKVLI+DYCK S  PS EF+ YIKQRGYDLHD + YGQML++A
Sbjct  335   QDKPALFRTFFKWLKPGGKVLISDYCKSSETPSPEFSEYIKQRGYDLHDVQAYGQMLKEA  394

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF DVIA+DRTDQFM+VL++EL+ VEKEKE FI DFS+EDY DIVGGWK KL R++SGEQ
Sbjct  395   GFNDVIADDRTDQFMQVLRRELERVEKEKEEFISDFSKEDYEDIVGGWKAKLERSASGEQ  454

Query  910   RWGL  899
             +WGL
Sbjct  455   KWGL  458



>gb|AEY75253.1| phosphoethanolamine N-methyltransferase [Atriplex canescens]
Length=494

 Score =   419 bits (1078),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 199/244 (82%), Positives = 220/244 (90%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D+ QYK + ILRYERVFGPGYVSTGG+ETTKEFV+KLDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  245   DSSQYKFNSILRYERVFGPGYVSTGGVETTKEFVSKLDLKPGQKVLDVGCGIGGGDFYMA  304

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             ENYDV V+GIDLS NMI+ ALER+IGLK AVEFEVADCTKK YP+ +FDVIYSRDTILHI
Sbjct  305   ENYDVEVVGIDLSINMISFALERSIGLKYAVEFEVADCTKKDYPENSFDVIYSRDTILHI  364

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFRSF KWLKPGGKVLI+DYCK +GPPS EFAAYIKQRGYDLHD + YGQML+DA
Sbjct  365   QDKPALFRSFLKWLKPGGKVLISDYCKSAGPPSSEFAAYIKQRGYDLHDVKAYGQMLKDA  424

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF +VIAEDRTDQF+KVL++EL A+E EK+ FI DFSE+DYNDIV GWK KL RT  GEQ
Sbjct  425   GFIEVIAEDRTDQFIKVLQRELYALEMEKDEFIADFSEQDYNDIVDGWKAKLVRTKGGEQ  484

Query  910   RWGL  899
             RWGL
Sbjct  485   RWGL  488



>ref|XP_008364653.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Malus 
domestica]
Length=492

 Score =   419 bits (1078),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 198/244 (81%), Positives = 221/244 (91%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK +GILRYERVFG G+VSTGG+ETTKEFVAKLDL+PGQKVLDV CGIGGGDFYMA
Sbjct  243   DNVQYKNTGILRYERVFGRGFVSTGGIETTKEFVAKLDLKPGQKVLDVXCGIGGGDFYMA  302

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
              N+DV VIGIDLS NMI+ ALE+AIGLKCAVEFEVADCTKKTYPD TFDVIYSRDTILHI
Sbjct  303   SNFDVEVIGIDLSVNMISFALEQAIGLKCAVEFEVADCTKKTYPDNTFDVIYSRDTILHI  362

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFRSFYKWLKPGGKVLI+DYC+ +G PSE FA YIKQRGYDLHD + YGQML+DA
Sbjct  363   QDKPALFRSFYKWLKPGGKVLISDYCRCAGTPSENFADYIKQRGYDLHDVKAYGQMLKDA  422

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF++VIAEDRTDQF  VL++EL  VEK+K++F+QDFS+EDY+DIVGGWK KL R  SGEQ
Sbjct  423   GFDEVIAEDRTDQFKAVLERELAXVEKDKDSFVQDFSQEDYDDIVGGWKAKLIRVDSGEQ  482

Query  910   RWGL  899
             +WGL
Sbjct  483   KWGL  486



>ref|XP_010921197.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X2 [Elaeis guineensis]
Length=499

 Score =   419 bits (1077),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 197/244 (81%), Positives = 222/244 (91%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYERVFG G+VSTGG+ETTKEFVAKL+L+PGQKVLDVGCGIGGGDFYMA
Sbjct  245   DNVQYKSSGILRYERVFGEGFVSTGGIETTKEFVAKLELKPGQKVLDVGCGIGGGDFYMA  304

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DV V+GIDLS NMI+ ALERAIG KC+VEFEVADCTKK Y D TF VIYSRDTILHI
Sbjct  305   ENFDVDVVGIDLSINMISFALERAIGCKCSVEFEVADCTKKIYSDNTFAVIYSRDTILHI  364

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKP LFRSF+KWLKPGGK+LITDYCKRSG PSEEFA YIKQRGYDLHD E YGQML+DA
Sbjct  365   QDKPMLFRSFFKWLKPGGKLLITDYCKRSGTPSEEFAEYIKQRGYDLHDVEAYGQMLKDA  424

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF +V AEDRT QF++VL++ELDAVEK+++AFI++FS+EDY++IVGGWK KL R+S GEQ
Sbjct  425   GFYEVTAEDRTTQFLEVLQRELDAVEKDRDAFIKEFSKEDYDEIVGGWKAKLKRSSVGEQ  484

Query  910   RWGL  899
             RWGL
Sbjct  485   RWGL  488



>gb|KFK39125.1| hypothetical protein AALP_AA3G204100 [Arabis alpina]
Length=491

 Score =   419 bits (1076),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 195/244 (80%), Positives = 219/244 (90%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYERVFG G+VSTGGLETTKEFV K+DL+PGQKVLDVGCGIGGGDFYMA
Sbjct  242   DNVQYKSSGILRYERVFGQGFVSTGGLETTKEFVEKMDLKPGQKVLDVGCGIGGGDFYMA  301

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E +DVHV+GIDLS NMI+ ALERAIGLKC+VEFEVADCT K YPD +FDVIYSRDTILHI
Sbjct  302   EKFDVHVVGIDLSVNMISFALERAIGLKCSVEFEVADCTTKHYPDNSFDVIYSRDTILHI  361

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFR+F+KWLKPGGKVLI+DYC+    PS EF+ YIKQRGYDLHD + YGQML+DA
Sbjct  362   QDKPALFRTFFKWLKPGGKVLISDYCRSPKTPSAEFSEYIKQRGYDLHDVQAYGQMLKDA  421

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF DVIA DRTDQF++VL++EL+ VEKEKE FI DFS+EDY+DIVGGWK KL RT+SGEQ
Sbjct  422   GFNDVIAADRTDQFVQVLRRELERVEKEKEEFIADFSKEDYDDIVGGWKAKLERTASGEQ  481

Query  910   RWGL  899
             +WGL
Sbjct  482   KWGL  485



>ref|XP_010921205.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X3 [Elaeis guineensis]
 ref|XP_010921212.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X3 [Elaeis guineensis]
 ref|XP_010921222.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X3 [Elaeis guineensis]
 ref|XP_010921230.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X3 [Elaeis guineensis]
 ref|XP_010921238.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X3 [Elaeis guineensis]
Length=480

 Score =   418 bits (1075),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 197/244 (81%), Positives = 222/244 (91%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYERVFG G+VSTGG+ETTKEFVAKL+L+PGQKVLDVGCGIGGGDFYMA
Sbjct  226   DNVQYKSSGILRYERVFGEGFVSTGGIETTKEFVAKLELKPGQKVLDVGCGIGGGDFYMA  285

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DV V+GIDLS NMI+ ALERAIG KC+VEFEVADCTKK Y D TF VIYSRDTILHI
Sbjct  286   ENFDVDVVGIDLSINMISFALERAIGCKCSVEFEVADCTKKIYSDNTFAVIYSRDTILHI  345

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKP LFRSF+KWLKPGGK+LITDYCKRSG PSEEFA YIKQRGYDLHD E YGQML+DA
Sbjct  346   QDKPMLFRSFFKWLKPGGKLLITDYCKRSGTPSEEFAEYIKQRGYDLHDVEAYGQMLKDA  405

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF +V AEDRT QF++VL++ELDAVEK+++AFI++FS+EDY++IVGGWK KL R+S GEQ
Sbjct  406   GFYEVTAEDRTTQFLEVLQRELDAVEKDRDAFIKEFSKEDYDEIVGGWKAKLKRSSVGEQ  465

Query  910   RWGL  899
             RWGL
Sbjct  466   RWGL  469



>gb|AER10512.1| phosphoethanolamine N-methyltransferase [Pyrus betulifolia]
 gb|AER10513.1| phosphoethanolamine N-methyltransferase [Pyrus betulifolia]
Length=492

 Score =   419 bits (1076),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 196/244 (80%), Positives = 222/244 (91%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK +GILRYERVFG G+VSTGG+ETTKEFVAKLDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  243   DNVQYKNNGILRYERVFGLGFVSTGGIETTKEFVAKLDLKPGQKVLDVGCGIGGGDFYMA  302

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
              N+DV VIGIDLS NMI+ ALE++IGLKCAVEFEVADCTKKTYPD +FDVIYSRDTILHI
Sbjct  303   SNFDVEVIGIDLSVNMISFALEQSIGLKCAVEFEVADCTKKTYPDNSFDVIYSRDTILHI  362

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFRSFY+WLKPGGKVLI+DYC+ +G PSE FA YIKQRGYDLHD + YGQML+DA
Sbjct  363   QDKPALFRSFYEWLKPGGKVLISDYCRCAGTPSENFAEYIKQRGYDLHDVKAYGQMLKDA  422

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF +VIAEDRTDQF  VL++ELDA+EK+K++F+QDFS+ DY+DIVGGWK KL R  SGEQ
Sbjct  423   GFYEVIAEDRTDQFKAVLERELDAIEKDKDSFVQDFSQGDYDDIVGGWKAKLIRVESGEQ  482

Query  910   RWGL  899
             +WGL
Sbjct  483   KWGL  486



>ref|XP_002441466.1| hypothetical protein SORBIDRAFT_09g027360 [Sorghum bicolor]
 gb|EES19896.1| hypothetical protein SORBIDRAFT_09g027360 [Sorghum bicolor]
Length=510

 Score =   419 bits (1076),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 194/244 (80%), Positives = 218/244 (89%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYERVFG GYVSTGG+ETTKEFV  LDL+PG+KVLDVGCGIGGGDFYMA
Sbjct  262   DNVQYKTSGILRYERVFGEGYVSTGGIETTKEFVGMLDLKPGKKVLDVGCGIGGGDFYMA  321

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             ENYDVHV+GIDLS NM++ A+ERAIG KC+VEFEVADCT K YP+ +FDVIYSRDTILHI
Sbjct  322   ENYDVHVLGIDLSVNMVSFAIERAIGRKCSVEFEVADCTTKDYPEDSFDVIYSRDTILHI  381

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFRSF+KWLKPGGKVLI+DYCK  G PSEEFAAYIKQRGYDLHD + YGQML+DA
Sbjct  382   QDKPALFRSFFKWLKPGGKVLISDYCKNPGKPSEEFAAYIKQRGYDLHDVKAYGQMLKDA  441

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF DVIAEDRT+QF+ VL++EL  VEK KEAF+ DF++EDY+DIV GW  KL R+S+GEQ
Sbjct  442   GFHDVIAEDRTEQFLNVLRRELGEVEKNKEAFLADFTQEDYDDIVNGWNAKLKRSSAGEQ  501

Query  910   RWGL  899
             RWGL
Sbjct  502   RWGL  505



>ref|XP_010540184.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like, partial 
[Tarenaya hassleriana]
Length=457

 Score =   417 bits (1071),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 194/244 (80%), Positives = 220/244 (90%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D +QYK SGILRYERVFG G+VSTGG+ETTKEFV KLDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  207   DNIQYKSSGILRYERVFGEGFVSTGGIETTKEFVGKLDLKPGQKVLDVGCGIGGGDFYMA  266

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DV V+GIDLS NMI+ ALERAIGLKC+VEFEVADCTKK+Y D TFDVIYSRDTILHI
Sbjct  267   ENFDVDVVGIDLSVNMISFALERAIGLKCSVEFEVADCTKKSYSDNTFDVIYSRDTILHI  326

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKP LF++FYKWLKPGGKVLI+DYC+    PS +FA YIKQRGYDLHD + YGQML+DA
Sbjct  327   QDKPTLFKTFYKWLKPGGKVLISDYCRSPKAPSPDFAEYIKQRGYDLHDIQTYGQMLKDA  386

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF +VIAEDRT+QFM+VLK+ELDAVEKEKE FIQDFS+E+Y ++VGGW+ KL R+S GEQ
Sbjct  387   GFNEVIAEDRTNQFMQVLKRELDAVEKEKEEFIQDFSKEEYEEMVGGWRAKLQRSSRGEQ  446

Query  910   RWGL  899
             RWGL
Sbjct  447   RWGL  450



>gb|EMT21187.1| Phosphoethanolamine N-methyltransferase 1 [Aegilops tauschii]
Length=503

 Score =   418 bits (1075),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 196/244 (80%), Positives = 217/244 (89%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYERVFG G+VSTGG+ETTKEFV  LDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  255   DNVQYKTSGILRYERVFGQGFVSTGGIETTKEFVDLLDLKPGQKVLDVGCGIGGGDFYMA  314

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             ENYDVHV+GIDLS NM++ ALE AIG KCAVEFEVADCT KTYPD TFDVIYSRDTILHI
Sbjct  315   ENYDVHVVGIDLSINMVSFALEHAIGRKCAVEFEVADCTTKTYPDNTFDVIYSRDTILHI  374

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFRSF+KWLKPGGKVLI+DYC+  G PSEEFAAYIKQRGYDLH+ E YGQML++A
Sbjct  375   QDKPALFRSFFKWLKPGGKVLISDYCRSPGKPSEEFAAYIKQRGYDLHNVEAYGQMLQNA  434

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF DVIAEDRTDQF+KVL++EL  VEK K+ F+ DF +EDY+DIV GW  KL R+S+GEQ
Sbjct  435   GFHDVIAEDRTDQFLKVLQRELAEVEKNKDEFLADFGQEDYDDIVTGWNAKLQRSSAGEQ  494

Query  910   RWGL  899
             RWGL
Sbjct  495   RWGL  498



>emb|CDM83845.1| unnamed protein product [Triticum aestivum]
Length=504

 Score =   418 bits (1075),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 195/244 (80%), Positives = 218/244 (89%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYERVFG G+VSTGG+ETTKEFV  LDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  256   DNVQYKTSGILRYERVFGQGFVSTGGIETTKEFVDLLDLKPGQKVLDVGCGIGGGDFYMA  315

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             ENYDVHV+GIDLS NM++ ALE AIG KCAVEFEVADCT KTYPD+TFDVIYSRDTILHI
Sbjct  316   ENYDVHVVGIDLSINMVSFALEHAIGRKCAVEFEVADCTTKTYPDSTFDVIYSRDTILHI  375

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKP+LFRSF+KWLKPGGKVLI+DYC+  G PSEEFAAYIKQRGYDLHD E YGQML++A
Sbjct  376   QDKPSLFRSFFKWLKPGGKVLISDYCRSPGKPSEEFAAYIKQRGYDLHDVEAYGQMLQNA  435

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF DVIAE+RTDQF+KVL++EL  VEK K+ F+ DF +EDY+DIV GW  KL R+S+GEQ
Sbjct  436   GFHDVIAEERTDQFLKVLQRELAEVEKNKDEFLADFGQEDYDDIVTGWNAKLQRSSAGEQ  495

Query  910   RWGL  899
             RWGL
Sbjct  496   RWGL  499



>gb|EMS54147.1| Phosphoethanolamine N-methyltransferase 1 [Triticum urartu]
Length=504

 Score =   418 bits (1075),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 195/244 (80%), Positives = 217/244 (89%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYERVFG G+VSTGG+ETTKEFV  LDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  256   DNVQYKTSGILRYERVFGQGFVSTGGIETTKEFVDLLDLKPGQKVLDVGCGIGGGDFYMA  315

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             ENYDVHV+GIDLS NM++ ALE AIG KCAVEFEVADCT KTYPD TFDVIYSRDTILHI
Sbjct  316   ENYDVHVVGIDLSINMVSFALEHAIGRKCAVEFEVADCTTKTYPDNTFDVIYSRDTILHI  375

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFRSF+KWLKPGGKVLI+DYC+  G PSEEFAAYIKQRGYDLH+ E YGQML++A
Sbjct  376   QDKPALFRSFFKWLKPGGKVLISDYCRSPGKPSEEFAAYIKQRGYDLHNVETYGQMLQNA  435

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF DV+AEDRTDQF+KVL++EL  VEK K+ F+ DF +EDY+DIV GW  KL R+S+GEQ
Sbjct  436   GFHDVVAEDRTDQFLKVLQRELAEVEKNKDEFLADFGQEDYDDIVTGWNAKLQRSSAGEQ  495

Query  910   RWGL  899
             RWGL
Sbjct  496   RWGL  499



>ref|XP_008799222.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X3 [Phoenix dactylifera]
Length=482

 Score =   417 bits (1073),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 196/244 (80%), Positives = 218/244 (89%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYERVFG G+VSTGG+ TTKEFV KL L PGQKVLDVGCGIGGGDFYMA
Sbjct  233   DNVQYKSSGILRYERVFGEGFVSTGGIVTTKEFVGKLALNPGQKVLDVGCGIGGGDFYMA  292

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN++V V+GIDLS NMI+ ALERAIG KCAVEFEVADCT+KTYPD TFDVIYSRDTILHI
Sbjct  293   ENFEVDVVGIDLSINMISFALERAIGRKCAVEFEVADCTRKTYPDNTFDVIYSRDTILHI  352

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKP LFRSF+KWLKPGGK+LITDYCK S  PSE FA YIKQRGYDLHD E Y QML+DA
Sbjct  353   QDKPMLFRSFFKWLKPGGKILITDYCKSSETPSEAFAEYIKQRGYDLHDVEAYSQMLKDA  412

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF +V+AEDRTDQF++VL++ELD VEK+K+AFIQ+FS+EDYN+IV GWK KL R+SSGEQ
Sbjct  413   GFYEVVAEDRTDQFLEVLQRELDVVEKDKDAFIQEFSKEDYNEIVSGWKAKLKRSSSGEQ  472

Query  910   RWGL  899
             RWGL
Sbjct  473   RWGL  476



>gb|ACV89824.1| S-adenosyl-L-methionine:phosphoethanolamine N-methyltransferase 
[Triticum aestivum]
Length=505

 Score =   418 bits (1074),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 195/244 (80%), Positives = 217/244 (89%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYERVFG G+VSTGG+ETTKEFV  LDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  257   DNVQYKTSGILRYERVFGQGFVSTGGIETTKEFVDLLDLKPGQKVLDVGCGIGGGDFYMA  316

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             ENYDVHV+GIDLS NM++ ALE AIG KCAVEFEVADCT KTYPD TFDVIYSRDTILHI
Sbjct  317   ENYDVHVVGIDLSINMVSFALEHAIGRKCAVEFEVADCTTKTYPDNTFDVIYSRDTILHI  376

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFRSF+KWLKPGGKVLI+DYC+  G PSEEFAAYIKQRGYDLH+ E YGQML++A
Sbjct  377   QDKPALFRSFFKWLKPGGKVLISDYCRSPGKPSEEFAAYIKQRGYDLHNVETYGQMLQNA  436

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF DV+AEDRTDQF+KVL++EL  VEK K+ F+ DF +EDY+DIV GW  KL R+S+GEQ
Sbjct  437   GFHDVVAEDRTDQFLKVLQRELAEVEKNKDEFLADFGQEDYDDIVTGWNAKLQRSSAGEQ  496

Query  910   RWGL  899
             RWGL
Sbjct  497   RWGL  500



>ref|XP_008799221.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X2 [Phoenix dactylifera]
Length=492

 Score =   417 bits (1073),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 196/244 (80%), Positives = 218/244 (89%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYERVFG G+VSTGG+ TTKEFV KL L PGQKVLDVGCGIGGGDFYMA
Sbjct  243   DNVQYKSSGILRYERVFGEGFVSTGGIVTTKEFVGKLALNPGQKVLDVGCGIGGGDFYMA  302

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN++V V+GIDLS NMI+ ALERAIG KCAVEFEVADCT+KTYPD TFDVIYSRDTILHI
Sbjct  303   ENFEVDVVGIDLSINMISFALERAIGRKCAVEFEVADCTRKTYPDNTFDVIYSRDTILHI  362

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKP LFRSF+KWLKPGGK+LITDYCK S  PSE FA YIKQRGYDLHD E Y QML+DA
Sbjct  363   QDKPMLFRSFFKWLKPGGKILITDYCKSSETPSEAFAEYIKQRGYDLHDVEAYSQMLKDA  422

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF +V+AEDRTDQF++VL++ELD VEK+K+AFIQ+FS+EDYN+IV GWK KL R+SSGEQ
Sbjct  423   GFYEVVAEDRTDQFLEVLQRELDVVEKDKDAFIQEFSKEDYNEIVSGWKAKLKRSSSGEQ  482

Query  910   RWGL  899
             RWGL
Sbjct  483   RWGL  486



>ref|XP_008799219.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X1 [Phoenix dactylifera]
Length=494

 Score =   417 bits (1073),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 196/244 (80%), Positives = 218/244 (89%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYERVFG G+VSTGG+ TTKEFV KL L PGQKVLDVGCGIGGGDFYMA
Sbjct  245   DNVQYKSSGILRYERVFGEGFVSTGGIVTTKEFVGKLALNPGQKVLDVGCGIGGGDFYMA  304

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN++V V+GIDLS NMI+ ALERAIG KCAVEFEVADCT+KTYPD TFDVIYSRDTILHI
Sbjct  305   ENFEVDVVGIDLSINMISFALERAIGRKCAVEFEVADCTRKTYPDNTFDVIYSRDTILHI  364

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKP LFRSF+KWLKPGGK+LITDYCK S  PSE FA YIKQRGYDLHD E Y QML+DA
Sbjct  365   QDKPMLFRSFFKWLKPGGKILITDYCKSSETPSEAFAEYIKQRGYDLHDVEAYSQMLKDA  424

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF +V+AEDRTDQF++VL++ELD VEK+K+AFIQ+FS+EDYN+IV GWK KL R+SSGEQ
Sbjct  425   GFYEVVAEDRTDQFLEVLQRELDVVEKDKDAFIQEFSKEDYNEIVSGWKAKLKRSSSGEQ  484

Query  910   RWGL  899
             RWGL
Sbjct  485   RWGL  488



>gb|EPS65842.1| hypothetical protein M569_08933, partial [Genlisea aurea]
Length=487

 Score =   417 bits (1071),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 195/244 (80%), Positives = 220/244 (90%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             DTVQYK SGILRYE VFG G+VSTGG++TT+EFVAKLDLQPGQKVLDVGCGIGGGDFYMA
Sbjct  238   DTVQYKSSGILRYEHVFGEGFVSTGGIDTTREFVAKLDLQPGQKVLDVGCGIGGGDFYMA  297

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             + YDVHV+GIDLS NM++ ALERAIGL CAVEFEVADCTKK YPDA+FDVIYSRDTILHI
Sbjct  298   DTYDVHVVGIDLSINMVSFALERAIGLNCAVEFEVADCTKKHYPDASFDVIYSRDTILHI  357

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
              DKP+LF+SFYKWLKPGGKVLI+DYCK    PS EFA YIK+RGYDLHD E YGQMLRDA
Sbjct  358   HDKPSLFKSFYKWLKPGGKVLISDYCKGVDAPSAEFAGYIKERGYDLHDVEAYGQMLRDA  417

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF++V AEDRT+QF+ VLKKE+DAVEK+KE FI +FS+EDY++IVGGWK KL+R+  GEQ
Sbjct  418   GFDEVTAEDRTEQFVNVLKKEVDAVEKDKERFIDNFSKEDYDEIVGGWKSKLSRSCGGEQ  477

Query  910   RWGL  899
             RWGL
Sbjct  478   RWGL  481



>dbj|BAC57960.1| phosphoethanolamine N-methyltransferase [Aster tripolium]
Length=493

 Score =   417 bits (1072),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 196/244 (80%), Positives = 221/244 (91%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D  QYK SGILRYER+FGPG+VSTGGL+ TKEF A LDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  244   DNGQYKSSGILRYERIFGPGFVSTGGLDPTKEFGALLDLKPGQKVLDVGCGIGGGDFYMA  303

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             +N+DV VIGIDLS NMI  ALER+IGL+C+VEFEVADCTKK+YPD +FDVIYSRDTILHI
Sbjct  304   DNFDVDVIGIDLSVNMIAFALERSIGLQCSVEFEVADCTKKSYPDNSFDVIYSRDTILHI  363

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFR+FYKWLKPGGKVLI+DYC++SG PSE+FA YIKQRGYDLHD E YG+ML+DA
Sbjct  364   QDKPALFRTFYKWLKPGGKVLISDYCRKSGKPSEDFAEYIKQRGYDLHDVETYGKMLKDA  423

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF +VIAEDRT QF++VL++EL+ VEKEKE FIQDF+E DYNDIVGGWK KL RT SGEQ
Sbjct  424   GFGEVIAEDRTKQFIEVLQRELERVEKEKEEFIQDFTEGDYNDIVGGWKAKLVRTGSGEQ  483

Query  910   RWGL  899
             RWGL
Sbjct  484   RWGL  487



>ref|XP_002883100.1| N-methyltransferase 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59359.1| N-methyltransferase 1 [Arabidopsis lyrata subsp. lyrata]
Length=491

 Score =   417 bits (1072),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 195/244 (80%), Positives = 217/244 (89%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYERVFG G+VSTGGLETTKEFV K++L+PGQKVLDVGCGIGGGDFYMA
Sbjct  242   DNVQYKSSGILRYERVFGQGFVSTGGLETTKEFVEKMNLKPGQKVLDVGCGIGGGDFYMA  301

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E +DVHV+GIDLS NMI+ ALERAIGL C+VEFEVADCT K YPD +FDVIYSRDTILHI
Sbjct  302   EKFDVHVVGIDLSVNMISFALERAIGLNCSVEFEVADCTTKHYPDNSFDVIYSRDTILHI  361

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFR+F+KWLKPGGKVLI+DYC+    PS EF+ YIKQRGYDLHD + YGQML+DA
Sbjct  362   QDKPALFRTFFKWLKPGGKVLISDYCRSPKTPSAEFSEYIKQRGYDLHDVQAYGQMLKDA  421

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF DVIAEDRTDQFM+VLK+ELD VEKEKE FI DFS+EDY+DIVGGWK KL R +S EQ
Sbjct  422   GFTDVIAEDRTDQFMQVLKRELDRVEKEKEEFISDFSKEDYDDIVGGWKAKLERCASDEQ  481

Query  910   RWGL  899
             +WGL
Sbjct  482   KWGL  485



>ref|XP_007209943.1| hypothetical protein PRUPE_ppa004742mg [Prunus persica]
 gb|EMJ11142.1| hypothetical protein PRUPE_ppa004742mg [Prunus persica]
Length=493

 Score =   417 bits (1071),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 198/246 (80%), Positives = 221/246 (90%), Gaps = 2/246 (1%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK +GILRYERVFG G+VSTGG+ETTKEFVAKLDL+P QKVLDVGCGIGGGDFYMA
Sbjct  242   DNVQYKSNGILRYERVFGQGFVSTGGIETTKEFVAKLDLKPSQKVLDVGCGIGGGDFYMA  301

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
              NYDV V+GIDLS NMI+ ALERAIGLKCAVEFEVADCT+KTY D TFDVIYSRDTILHI
Sbjct  302   SNYDVEVVGIDLSVNMISFALERAIGLKCAVEFEVADCTQKTYADDTFDVIYSRDTILHI  361

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFRSFY+WLKPGGKVLI+DYC+ +G PS EFA YIKQRGYDLH+ + YGQML+DA
Sbjct  362   QDKPALFRSFYRWLKPGGKVLISDYCRSAGTPSAEFAEYIKQRGYDLHNVQAYGQMLKDA  421

Query  1090  GFEDVIAEDRTDQ--FMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSG  917
             GF++VIAEDRTDQ     +L++ELDAVEK+K+AFIQDFSEEDY+DIVGGWK KL R  SG
Sbjct  422   GFDEVIAEDRTDQVCIRLLLQRELDAVEKDKDAFIQDFSEEDYDDIVGGWKAKLIRADSG  481

Query  916   EQRWGL  899
             EQ+WGL
Sbjct  482   EQKWGL  487



>ref|XP_004969638.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Setaria 
italica]
Length=499

 Score =   417 bits (1072),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 195/244 (80%), Positives = 215/244 (88%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYER+FG GYVSTGG+ETTKEFV KLDL+PG KVLDVGCGIGGGDFYMA
Sbjct  251   DNVQYKTSGILRYERIFGEGYVSTGGIETTKEFVDKLDLKPGHKVLDVGCGIGGGDFYMA  310

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E YD HVIGIDLS NMI+ ALERAIG  C+VEFEVADCT KTYPD TFDVIYSRDTILHI
Sbjct  311   EKYDAHVIGIDLSINMISFALERAIGRSCSVEFEVADCTTKTYPDNTFDVIYSRDTILHI  370

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKP+LF++F+KWLKPGGKVLI+DYC+  G PSEEFAAYIKQRGYDLHD E YGQML+DA
Sbjct  371   QDKPSLFKTFFKWLKPGGKVLISDYCRNPGKPSEEFAAYIKQRGYDLHDVEAYGQMLKDA  430

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF DVIAEDRTDQF+ VL+KEL   EK K+ F+ DFS+EDY+DIV GWK KL R+S+GEQ
Sbjct  431   GFHDVIAEDRTDQFLCVLEKELAKFEKNKDDFLSDFSQEDYDDIVNGWKAKLQRSSAGEQ  490

Query  910   RWGL  899
             RWGL
Sbjct  491   RWGL  494



>ref|NP_188427.2| phosphoethanolamine N-methyltransferase 1 [Arabidopsis thaliana]
 sp|Q9FR44.1|PEAM1_ARATH RecName: Full=Phosphoethanolamine N-methyltransferase 1; Short=AtNMT1; 
Short=PEAMT 1; AltName: Full=Protein XIPOTL 1 [Arabidopsis 
thaliana]
 gb|AAG41121.1|AF197940_1 SAM:phospho-ethanolamine N-methyltransferase [Arabidopsis thaliana]
 gb|AAK32886.1|AF367299_1 AT3g18000/MEB5_22 [Arabidopsis thaliana]
 gb|AAL25589.1| AT3g18000/MEB5_22 [Arabidopsis thaliana]
 gb|AAM10282.1| AT3g18000/MEB5_22 [Arabidopsis thaliana]
 gb|AEE76033.1| phosphoethanolamine N-methyltransferase 1 [Arabidopsis thaliana]
Length=491

 Score =   417 bits (1071),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 195/244 (80%), Positives = 217/244 (89%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYERVFG G+VSTGGLETTKEFV K++L+PGQKVLDVGCGIGGGDFYMA
Sbjct  242   DNVQYKSSGILRYERVFGQGFVSTGGLETTKEFVEKMNLKPGQKVLDVGCGIGGGDFYMA  301

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E +DVHV+GIDLS NMI+ ALERAIGL C+VEFEVADCT K YPD +FDVIYSRDTILHI
Sbjct  302   EKFDVHVVGIDLSVNMISFALERAIGLSCSVEFEVADCTTKHYPDNSFDVIYSRDTILHI  361

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFR+F+KWLKPGGKVLI+DYC+    PS EF+ YIKQRGYDLHD + YGQML+DA
Sbjct  362   QDKPALFRTFFKWLKPGGKVLISDYCRSPKTPSAEFSEYIKQRGYDLHDVQAYGQMLKDA  421

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF DVIAEDRTDQFM+VLK+ELD VEKEKE FI DFS+EDY+DIVGGWK KL R +S EQ
Sbjct  422   GFTDVIAEDRTDQFMQVLKRELDRVEKEKEKFISDFSKEDYDDIVGGWKSKLERCASDEQ  481

Query  910   RWGL  899
             +WGL
Sbjct  482   KWGL  485



>dbj|BAB02720.1| methyl transferase-like protein [Arabidopsis thaliana]
Length=498

 Score =   417 bits (1071),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 195/244 (80%), Positives = 217/244 (89%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYERVFG G+VSTGGLETTKEFV K++L+PGQKVLDVGCGIGGGDFYMA
Sbjct  249   DNVQYKSSGILRYERVFGQGFVSTGGLETTKEFVEKMNLKPGQKVLDVGCGIGGGDFYMA  308

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E +DVHV+GIDLS NMI+ ALERAIGL C+VEFEVADCT K YPD +FDVIYSRDTILHI
Sbjct  309   EKFDVHVVGIDLSVNMISFALERAIGLSCSVEFEVADCTTKHYPDNSFDVIYSRDTILHI  368

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFR+F+KWLKPGGKVLI+DYC+    PS EF+ YIKQRGYDLHD + YGQML+DA
Sbjct  369   QDKPALFRTFFKWLKPGGKVLISDYCRSPKTPSAEFSEYIKQRGYDLHDVQAYGQMLKDA  428

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF DVIAEDRTDQFM+VLK+ELD VEKEKE FI DFS+EDY+DIVGGWK KL R +S EQ
Sbjct  429   GFTDVIAEDRTDQFMQVLKRELDRVEKEKEKFISDFSKEDYDDIVGGWKSKLERCASDEQ  488

Query  910   RWGL  899
             +WGL
Sbjct  489   KWGL  492



>ref|XP_010921188.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X1 [Elaeis guineensis]
Length=537

 Score =   418 bits (1074),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 197/244 (81%), Positives = 222/244 (91%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYERVFG G+VSTGG+ETTKEFVAKL+L+PGQKVLDVGCGIGGGDFYMA
Sbjct  283   DNVQYKSSGILRYERVFGEGFVSTGGIETTKEFVAKLELKPGQKVLDVGCGIGGGDFYMA  342

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DV V+GIDLS NMI+ ALERAIG KC+VEFEVADCTKK Y D TF VIYSRDTILHI
Sbjct  343   ENFDVDVVGIDLSINMISFALERAIGCKCSVEFEVADCTKKIYSDNTFAVIYSRDTILHI  402

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKP LFRSF+KWLKPGGK+LITDYCKRSG PSEEFA YIKQRGYDLHD E YGQML+DA
Sbjct  403   QDKPMLFRSFFKWLKPGGKLLITDYCKRSGTPSEEFAEYIKQRGYDLHDVEAYGQMLKDA  462

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF +V AEDRT QF++VL++ELDAVEK+++AFI++FS+EDY++IVGGWK KL R+S GEQ
Sbjct  463   GFYEVTAEDRTTQFLEVLQRELDAVEKDRDAFIKEFSKEDYDEIVGGWKAKLKRSSVGEQ  522

Query  910   RWGL  899
             RWGL
Sbjct  523   RWGL  526



>gb|AFW78991.1| hypothetical protein ZEAMMB73_932976 [Zea mays]
Length=356

 Score =   411 bits (1056),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 190/244 (78%), Positives = 217/244 (89%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYERVFG G+VSTGG+ETTKEFV  LDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  108   DNVQYKTSGILRYERVFGEGFVSTGGIETTKEFVGMLDLKPGQKVLDVGCGIGGGDFYMA  167

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
              NYDVHV+GIDLS NM++ A+ERAIG KC+VEFEVADCT K YP+ +FDVIYSRDTILHI
Sbjct  168   ANYDVHVLGIDLSVNMVSFAIERAIGRKCSVEFEVADCTTKDYPENSFDVIYSRDTILHI  227

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFRSF+KWLKPGGKVLI+DYCK  G PSEEFAAYIKQRGYDLHD + YGQML+DA
Sbjct  228   QDKPALFRSFFKWLKPGGKVLISDYCKNPGKPSEEFAAYIKQRGYDLHDVKAYGQMLKDA  287

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF +VIAEDRT+QF+ VL++E+  VEK K+AF+ DF++EDY+DIV GW  KL R+S+GEQ
Sbjct  288   GFHNVIAEDRTEQFLNVLQREIGEVEKNKDAFLADFTQEDYDDIVNGWNAKLKRSSAGEQ  347

Query  910   RWGL  899
             RWGL
Sbjct  348   RWGL  351



>gb|AAP83582.1| phosphoethanolamine N-methyltransferase [Brassica napus]
Length=491

 Score =   416 bits (1068),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 193/244 (79%), Positives = 218/244 (89%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYERVFG G+VSTGG+ETTKEFV K+DL+PGQKVLDVGCGIGGGDFYMA
Sbjct  242   DNVQYKSSGILRYERVFGQGFVSTGGIETTKEFVEKMDLKPGQKVLDVGCGIGGGDFYMA  301

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DVHV+GIDLS NMI+ ALERAIGL C+VEFEVADCT K YP+ + DVIYSRDTILHI
Sbjct  302   ENFDVHVVGIDLSVNMISFALERAIGLNCSVEFEVADCTTKHYPENSXDVIYSRDTILHI  361

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFR+F+KWLKPGGKVLI+DYCK S  PS EF+ YIKQRGYDLHD + YGQML+ A
Sbjct  362   QDKPALFRTFFKWLKPGGKVLISDYCKSSETPSPEFSEYIKQRGYDLHDVQAYGQMLKXA  421

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF DVIA+DRTDQFM+VL++EL+ VEKEKE FI DFS+EDY DIVGGWK KL R++SGEQ
Sbjct  422   GFNDVIADDRTDQFMQVLRRELERVEKEKEEFISDFSKEDYEDIVGGWKAKLERSASGEQ  481

Query  910   RWGL  899
             +WGL
Sbjct  482   KWGL  485



>ref|NP_175293.1| phosphoethanolamine N-methyltransferase 2 [Arabidopsis thaliana]
 gb|AAL16223.1|AF428454_1 At1g48600/T1N15_20 [Arabidopsis thaliana]
 gb|AAL36222.1| putative phosphoethanolamine N-methyltransferase [Arabidopsis 
thaliana]
 gb|AAM91745.1| putative phosphoethanolamine N-methyltransferase [Arabidopsis 
thaliana]
 gb|AEE32324.1| putative phosphoethanolamine N-methyltransferase 2 [Arabidopsis 
thaliana]
Length=475

 Score =   415 bits (1067),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 202/244 (83%), Positives = 223/244 (91%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYERVFG GYVSTGG ETTKEFVAK+DL+PGQKVLDVGCGIGGGDFYMA
Sbjct  226   DNVQYKSSGILRYERVFGEGYVSTGGFETTKEFVAKMDLKPGQKVLDVGCGIGGGDFYMA  285

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DVHV+GIDLS NMI+ ALERAIGLKC+VEFEVADCT KTYPD +FDVIYSRDTILHI
Sbjct  286   ENFDVHVVGIDLSVNMISFALERAIGLKCSVEFEVADCTTKTYPDNSFDVIYSRDTILHI  345

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFR+F+KWLKPGGKVLITDYC+ +  PS EFA YIKQRGYDLHD + YGQML+DA
Sbjct  346   QDKPALFRTFFKWLKPGGKVLITDYCRSAETPSPEFAEYIKQRGYDLHDVQAYGQMLKDA  405

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF+DVIAEDRTDQF++VL++EL+ VEKEKE FI DFSEEDYNDIVGGW  KL RT+SGEQ
Sbjct  406   GFDDVIAEDRTDQFVQVLRRELEKVEKEKEEFISDFSEEDYNDIVGGWSAKLERTASGEQ  465

Query  910   RWGL  899
             +WGL
Sbjct  466   KWGL  469



>ref|XP_010097563.1| hypothetical protein L484_017373 [Morus notabilis]
 gb|EXB69095.1| hypothetical protein L484_017373 [Morus notabilis]
Length=503

 Score =   416 bits (1069),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 195/241 (81%), Positives = 217/241 (90%), Gaps = 0/241 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             DTVQYKC+GILRYERVFG G+VSTGG+ETTKEFVAKLDL+P Q+VLDVGCGIGGGDFYMA
Sbjct  247   DTVQYKCNGILRYERVFGSGFVSTGGIETTKEFVAKLDLEPSQRVLDVGCGIGGGDFYMA  306

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DV V+GIDLS NMI++ALERAIGLKC+VEFEVADCTKKTYP+ +FDVIYSRDTILHI
Sbjct  307   ENFDVEVVGIDLSINMISLALERAIGLKCSVEFEVADCTKKTYPENSFDVIYSRDTILHI  366

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
              DKPALFRSFYKWLKPGGKVLI+DYC+ +G PS EFA YIKQRGYDLHD E YGQMLRDA
Sbjct  367   DDKPALFRSFYKWLKPGGKVLISDYCQSAGTPSPEFAKYIKQRGYDLHDVEAYGQMLRDA  426

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GFE+VIAEDRT QF++VL++EL  +EKEK  FI DFSEEDY DIVGGWK KL RT+S   
Sbjct  427   GFEEVIAEDRTGQFIEVLQRELSVIEKEKNEFISDFSEEDYYDIVGGWKAKLIRTTSVAA  486

Query  910   R  908
             R
Sbjct  487   R  487



>ref|XP_009404071.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Musa acuminata subsp. malaccensis]
Length=497

 Score =   415 bits (1067),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 193/244 (79%), Positives = 222/244 (91%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK +GILRYERVFG G+VSTGG+ETTKEFVAKL+L+PGQKVLDVGCGIGGGDFYMA
Sbjct  248   DNVQYKSNGILRYERVFGDGFVSTGGIETTKEFVAKLELKPGQKVLDVGCGIGGGDFYMA  307

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DV V+GIDLS NM++ ALERAIG KCAVEFEVADCTKKTYP+ TFDVIYSRDTILHI
Sbjct  308   ENFDVDVVGIDLSINMVSFALERAIGRKCAVEFEVADCTKKTYPENTFDVIYSRDTILHI  367

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKP LFRSF+KWLKPGGK+LI+DYCK+ G PS++FAAYIKQRGYDLHD + YGQML++A
Sbjct  368   QDKPTLFRSFFKWLKPGGKLLISDYCKKLGTPSDDFAAYIKQRGYDLHDVDAYGQMLKNA  427

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF  VIAEDRT+QF++VL++ELDAVE  KE FI+DFS+EDY++IV GWK KL R+S GEQ
Sbjct  428   GFNKVIAEDRTNQFLEVLQRELDAVEMGKEGFIRDFSQEDYDEIVNGWKAKLKRSSVGEQ  487

Query  910   RWGL  899
             RWGL
Sbjct  488   RWGL  491



>ref|NP_973993.1| phosphoethanolamine N-methyltransferase 2 [Arabidopsis thaliana]
 sp|Q944H0.2|PEAM2_ARATH RecName: Full=Phosphomethylethanolamine N-methyltransferase; 
Short=AtPMEAMT; AltName: Full=Phosphoethanolamine N-methyltransferase 
2 [Arabidopsis thaliana]
 gb|AEE32323.1| putative phosphoethanolamine N-methyltransferase 2 [Arabidopsis 
thaliana]
Length=491

 Score =   415 bits (1066),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 202/244 (83%), Positives = 223/244 (91%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYERVFG GYVSTGG ETTKEFVAK+DL+PGQKVLDVGCGIGGGDFYMA
Sbjct  242   DNVQYKSSGILRYERVFGEGYVSTGGFETTKEFVAKMDLKPGQKVLDVGCGIGGGDFYMA  301

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DVHV+GIDLS NMI+ ALERAIGLKC+VEFEVADCT KTYPD +FDVIYSRDTILHI
Sbjct  302   ENFDVHVVGIDLSVNMISFALERAIGLKCSVEFEVADCTTKTYPDNSFDVIYSRDTILHI  361

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFR+F+KWLKPGGKVLITDYC+ +  PS EFA YIKQRGYDLHD + YGQML+DA
Sbjct  362   QDKPALFRTFFKWLKPGGKVLITDYCRSAETPSPEFAEYIKQRGYDLHDVQAYGQMLKDA  421

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF+DVIAEDRTDQF++VL++EL+ VEKEKE FI DFSEEDYNDIVGGW  KL RT+SGEQ
Sbjct  422   GFDDVIAEDRTDQFVQVLRRELEKVEKEKEEFISDFSEEDYNDIVGGWSAKLERTASGEQ  481

Query  910   RWGL  899
             +WGL
Sbjct  482   KWGL  485



>ref|XP_010097561.1| Phosphoethanolamine N-methyltransferase 1 [Morus notabilis]
 gb|EXB69093.1| Phosphoethanolamine N-methyltransferase 1 [Morus notabilis]
Length=519

 Score =   416 bits (1068),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 201/267 (75%), Positives = 222/267 (83%), Gaps = 23/267 (9%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYKCSGILRYERVFGPGYVSTGGLETTKEFV KL+L+P QKVLDVGCGIGGGDFYMA
Sbjct  247   DNVQYKCSGILRYERVFGPGYVSTGGLETTKEFVEKLELKPDQKVLDVGCGIGGGDFYMA  306

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             ENYDV V+GIDLS NMI++ALE AIGLKC+VEFEVADCTKK YP+++FDVIYSRDTILHI
Sbjct  307   ENYDVEVVGIDLSINMISLALENAIGLKCSVEFEVADCTKKEYPESSFDVIYSRDTILHI  366

Query  1270  -----------------------QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFA  1160
                                    QDKPALFRSF+KWLKPGGKVLI+DYCK  G PS EF 
Sbjct  367   QYSTLLLVPVAQVLLHMTFEPPPQDKPALFRSFFKWLKPGGKVLISDYCKSPGTPSVEFV  426

Query  1159  AYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFS  980
              YIKQR YDLHD E YGQMLR AGFEDV+AEDRTDQF++VL++ELD VEK+K+ FI DFS
Sbjct  427   KYIKQREYDLHDVEAYGQMLRAAGFEDVVAEDRTDQFIQVLQRELDVVEKDKDEFIADFS  486

Query  979   EEDYNDIVGGWKLKLTRTSSGEQRWGL  899
             EEDYN+IVGGWK KL R++SGEQRWGL
Sbjct  487   EEDYNEIVGGWKAKLIRSTSGEQRWGL  513



>ref|XP_002456194.1| hypothetical protein SORBIDRAFT_03g031950 [Sorghum bicolor]
 gb|EES01314.1| hypothetical protein SORBIDRAFT_03g031950 [Sorghum bicolor]
Length=501

 Score =   415 bits (1066),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 192/244 (79%), Positives = 215/244 (88%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYER+FG GYVSTGG+ETTKEFV KLDL+PG KVLDVGCGIGGGDFYMA
Sbjct  253   DNVQYKTSGILRYERIFGEGYVSTGGIETTKEFVDKLDLKPGHKVLDVGCGIGGGDFYMA  312

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             ENYD HV+GIDLS NM++ ALERAIG  C+VEFEVADCT KTYP+ TFDVIYSRDTILHI
Sbjct  313   ENYDAHVVGIDLSINMVSFALERAIGRSCSVEFEVADCTTKTYPENTFDVIYSRDTILHI  372

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKP+LF+SF+KWLKPGGKVLI+DYC+  G PSEEFAAYIKQRGYDLHD E YGQML+ A
Sbjct  373   QDKPSLFKSFFKWLKPGGKVLISDYCRSPGKPSEEFAAYIKQRGYDLHDVEAYGQMLKSA  432

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF DVIAEDRTDQF+ VL+KEL   EK K+ F+ DF++EDY+DIV GWK KL R+S+GEQ
Sbjct  433   GFRDVIAEDRTDQFLGVLEKELAKFEKNKDDFLSDFTQEDYDDIVNGWKAKLQRSSAGEQ  492

Query  910   RWGL  899
             RWGL
Sbjct  493   RWGL  496



>gb|AAM13092.1| unknown protein [Arabidopsis thaliana]
Length=491

 Score =   414 bits (1063),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 194/244 (80%), Positives = 216/244 (89%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYERVFG G+VSTGGLETTKEFV K++L+PGQKVLDVGCGIGGGDFYMA
Sbjct  242   DNVQYKSSGILRYERVFGQGFVSTGGLETTKEFVEKMNLKPGQKVLDVGCGIGGGDFYMA  301

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E +DVHV+GIDLS NMI+ ALERAIGL C+V FEVADCT K YPD +FDVIYSRDTILHI
Sbjct  302   EKFDVHVVGIDLSVNMISFALERAIGLSCSVGFEVADCTTKHYPDNSFDVIYSRDTILHI  361

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFR+F+KWLKPGGKVLI+DYC+    PS EF+ YIKQRGYDLHD + YGQML+DA
Sbjct  362   QDKPALFRTFFKWLKPGGKVLISDYCRSPKTPSAEFSEYIKQRGYDLHDVQAYGQMLKDA  421

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF DVIAEDRTDQFM+VLK+ELD VEKEKE FI DFS+EDY+DIVGGWK KL R +S EQ
Sbjct  422   GFTDVIAEDRTDQFMQVLKRELDRVEKEKEKFISDFSKEDYDDIVGGWKSKLERCASDEQ  481

Query  910   RWGL  899
             +WGL
Sbjct  482   KWGL  485



>ref|XP_006297517.1| hypothetical protein CARUB_v10013541mg [Capsella rubella]
 gb|EOA30415.1| hypothetical protein CARUB_v10013541mg [Capsella rubella]
Length=491

 Score =   414 bits (1063),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 192/244 (79%), Positives = 218/244 (89%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK +GILRYERVFG G+VSTGGLETTKEFV K++L+PGQKVLDVGCGIGGGDFYMA
Sbjct  242   DNVQYKSNGILRYERVFGQGFVSTGGLETTKEFVEKMNLKPGQKVLDVGCGIGGGDFYMA  301

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E +DVHV+GIDLS NMI+ ALERAIGL C+VEFEVADCT K YPD +FDVIYSRDTILHI
Sbjct  302   EKFDVHVVGIDLSVNMISFALERAIGLNCSVEFEVADCTTKHYPDNSFDVIYSRDTILHI  361

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFR+F+KWLKPGGKVLI+DYC+    PS EF+ YIKQRGYDLHD + YGQML+DA
Sbjct  362   QDKPALFRTFFKWLKPGGKVLISDYCRSPKTPSAEFSEYIKQRGYDLHDVQAYGQMLKDA  421

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF+DVIAEDRTDQFM+VL++EL+ VEKEKE FI DFS+EDY+DIVGGWK KL R +S EQ
Sbjct  422   GFKDVIAEDRTDQFMQVLRRELERVEKEKEEFIADFSKEDYDDIVGGWKAKLERCASDEQ  481

Query  910   RWGL  899
             +WGL
Sbjct  482   KWGL  485



>ref|XP_010487709.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X1 [Camelina sativa]
Length=494

 Score =   414 bits (1063),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 191/244 (78%), Positives = 218/244 (89%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYERVFG G+VSTGGLETTKEFV K++L+PGQKVLDVGCGIGGGDFYMA
Sbjct  245   DNVQYKSSGILRYERVFGQGFVSTGGLETTKEFVEKMNLKPGQKVLDVGCGIGGGDFYMA  304

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E +D+HV+GIDLS NMI+ ALERAIGL C+VEFEVADCT K YPD +FDVIYSRDTILHI
Sbjct  305   EKFDIHVVGIDLSVNMISFALERAIGLNCSVEFEVADCTTKHYPDNSFDVIYSRDTILHI  364

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFR+F+KWLKPGGKVLI+DYC+    PS EF+ YIKQRGYDLHD + YGQML+DA
Sbjct  365   QDKPALFRTFFKWLKPGGKVLISDYCRSPKTPSAEFSEYIKQRGYDLHDVQAYGQMLKDA  424

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF+DVIAEDRTDQF +VL++EL++VEKEKE FI DFS+EDY+DIVGGWK KL R +S EQ
Sbjct  425   GFKDVIAEDRTDQFTQVLRRELESVEKEKEEFISDFSKEDYDDIVGGWKAKLERCASDEQ  484

Query  910   RWGL  899
             +WGL
Sbjct  485   KWGL  488



>ref|XP_010487710.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X2 [Camelina sativa]
Length=491

 Score =   413 bits (1062),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 191/244 (78%), Positives = 218/244 (89%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYERVFG G+VSTGGLETTKEFV K++L+PGQKVLDVGCGIGGGDFYMA
Sbjct  242   DNVQYKSSGILRYERVFGQGFVSTGGLETTKEFVEKMNLKPGQKVLDVGCGIGGGDFYMA  301

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E +D+HV+GIDLS NMI+ ALERAIGL C+VEFEVADCT K YPD +FDVIYSRDTILHI
Sbjct  302   EKFDIHVVGIDLSVNMISFALERAIGLNCSVEFEVADCTTKHYPDNSFDVIYSRDTILHI  361

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFR+F+KWLKPGGKVLI+DYC+    PS EF+ YIKQRGYDLHD + YGQML+DA
Sbjct  362   QDKPALFRTFFKWLKPGGKVLISDYCRSPKTPSAEFSEYIKQRGYDLHDVQAYGQMLKDA  421

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF+DVIAEDRTDQF +VL++EL++VEKEKE FI DFS+EDY+DIVGGWK KL R +S EQ
Sbjct  422   GFKDVIAEDRTDQFTQVLRRELESVEKEKEEFISDFSKEDYDDIVGGWKAKLERCASDEQ  481

Query  910   RWGL  899
             +WGL
Sbjct  482   KWGL  485



>ref|XP_010465872.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Camelina 
sativa]
Length=491

 Score =   413 bits (1062),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 192/244 (79%), Positives = 218/244 (89%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYERVFG G+VSTGGLETTKEFV K++L+PGQKVLDVGCGIGGGDFYMA
Sbjct  242   DNVQYKSSGILRYERVFGQGFVSTGGLETTKEFVEKMNLKPGQKVLDVGCGIGGGDFYMA  301

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E +DVHV+GIDLS NMI+ ALERAIGL C+VEFEVADCT K YPD +FDVIYSRDTILHI
Sbjct  302   EKFDVHVVGIDLSVNMISFALERAIGLNCSVEFEVADCTTKHYPDNSFDVIYSRDTILHI  361

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFR+F+KWLKPGGKVLI+DYC+    PS EF+ YIKQRGYDLHD + YGQML+DA
Sbjct  362   QDKPALFRTFFKWLKPGGKVLISDYCRSPKTPSVEFSEYIKQRGYDLHDVQAYGQMLKDA  421

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF+DVIAEDRTDQF +VL++EL++VEKEKE FI DFS+EDY+DIVGGWK KL R +S EQ
Sbjct  422   GFKDVIAEDRTDQFTQVLRRELESVEKEKEEFISDFSKEDYDDIVGGWKAKLERCASDEQ  481

Query  910   RWGL  899
             +WGL
Sbjct  482   KWGL  485



>ref|NP_001169597.1| uncharacterized LOC100383478 [Zea mays]
 gb|ABF83429.1| S-adenosyl-L-methionine: phosphoethanolamine N-methyltransferase 
[Zea mays]
 gb|ACN34220.1| unknown [Zea mays]
 gb|AFW78993.1| S-adenosyl-L-methionine: phosphoethanolamine N-methyltransferase 
[Zea mays]
Length=501

 Score =   413 bits (1062),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 190/244 (78%), Positives = 217/244 (89%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYERVFG G+VSTGG+ETTKEFV  LDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  253   DNVQYKTSGILRYERVFGEGFVSTGGIETTKEFVGMLDLKPGQKVLDVGCGIGGGDFYMA  312

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
              NYDVHV+GIDLS NM++ A+ERAIG KC+VEFEVADCT K YP+ +FDVIYSRDTILHI
Sbjct  313   ANYDVHVLGIDLSVNMVSFAIERAIGRKCSVEFEVADCTTKDYPENSFDVIYSRDTILHI  372

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFRSF+KWLKPGGKVLI+DYCK  G PSEEFAAYIKQRGYDLHD + YGQML+DA
Sbjct  373   QDKPALFRSFFKWLKPGGKVLISDYCKNPGKPSEEFAAYIKQRGYDLHDVKAYGQMLKDA  432

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF +VIAEDRT+QF+ VL++E+  VEK K+AF+ DF++EDY+DIV GW  KL R+S+GEQ
Sbjct  433   GFHNVIAEDRTEQFLNVLQREIGEVEKNKDAFLADFTQEDYDDIVNGWNAKLKRSSAGEQ  492

Query  910   RWGL  899
             RWGL
Sbjct  493   RWGL  496



>dbj|BAH01482.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64589.1| hypothetical protein OsJ_19441 [Oryza sativa Japonica Group]
Length=495

 Score =   413 bits (1061),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 192/244 (79%), Positives = 215/244 (88%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK +GILRYERVFG GYVSTGG+ETTKEFV KLDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  247   DNVQYKTTGILRYERVFGEGYVSTGGIETTKEFVDKLDLKPGQKVLDVGCGIGGGDFYMA  306

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             ENYD HV+GIDLS NM++ A+ERAIG KC+VEFEVADCT KTY   TFDVIYSRDTILHI
Sbjct  307   ENYDAHVLGIDLSINMVSFAIERAIGRKCSVEFEVADCTTKTYAPNTFDVIYSRDTILHI  366

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
              DKPALFRSF+KWLKPGGKVLI+DYC+  G PSEEFAAYIKQRGYDLHD + YG+ML DA
Sbjct  367   HDKPALFRSFFKWLKPGGKVLISDYCRNPGKPSEEFAAYIKQRGYDLHDVKTYGKMLEDA  426

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF  VIAEDRTDQF++VL++EL  VEK KEAF+ DF++EDY+DIV GW  KL R+S+GEQ
Sbjct  427   GFHHVIAEDRTDQFLRVLQRELAEVEKNKEAFMADFTQEDYDDIVNGWNAKLKRSSAGEQ  486

Query  910   RWGL  899
             RWGL
Sbjct  487   RWGL  490



>ref|NP_001043957.1| Os01g0695100 [Oryza sativa Japonica Group]
 dbj|BAF05871.1| Os01g0695100 [Oryza sativa Japonica Group]
Length=499

 Score =   412 bits (1060),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 192/244 (79%), Positives = 215/244 (88%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYER+FG G+VSTGG+ETTKEFV +LDL+PGQ VLDVGCGIGGGDFYMA
Sbjct  251   DNVQYKASGILRYERIFGEGFVSTGGIETTKEFVDRLDLKPGQNVLDVGCGIGGGDFYMA  310

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             + YDVHV+GIDLS NM++ ALERAIG KC+VEFEVADCTKKTYPD TFDVIYSRDTILHI
Sbjct  311   DKYDVHVVGIDLSINMVSFALERAIGRKCSVEFEVADCTKKTYPDNTFDVIYSRDTILHI  370

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKP+LF+SF+KWLKPGGKVLI+DYCK  G PSEEFAAYIKQRGYDLHD   YGQML +A
Sbjct  371   QDKPSLFKSFFKWLKPGGKVLISDYCKCPGKPSEEFAAYIKQRGYDLHDVRAYGQMLENA  430

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF DVIAEDRTDQF+ VL++EL  VEK K  F+ DFS+EDY+ IV GWK KL R+S+GEQ
Sbjct  431   GFHDVIAEDRTDQFLDVLERELAKVEKNKNEFVSDFSQEDYDAIVNGWKAKLQRSSAGEQ  490

Query  910   RWGL  899
             RWGL
Sbjct  491   RWGL  494



>ref|XP_010506234.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 isoform 
X1 [Camelina sativa]
Length=494

 Score =   412 bits (1060),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 191/244 (78%), Positives = 218/244 (89%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYERVFG G+VSTGGLETTKEFV K++L+PGQKVLDVGCGIGGGDFYMA
Sbjct  245   DNVQYKSSGILRYERVFGQGFVSTGGLETTKEFVEKMNLKPGQKVLDVGCGIGGGDFYMA  304

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E +DVHV+GIDLS NMI+ ALERAIGL C+VEFEVADCT K YPD +FDVIYSRDTILHI
Sbjct  305   EKFDVHVVGIDLSVNMISFALERAIGLNCSVEFEVADCTTKHYPDNSFDVIYSRDTILHI  364

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFR+F+KWLKPGGKVLI+DYC+    PS EF+ YIKQRGYDLHD + YGQML+DA
Sbjct  365   QDKPALFRTFFKWLKPGGKVLISDYCRSPKTPSAEFSEYIKQRGYDLHDVQAYGQMLKDA  424

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF+DVIAEDRTDQF +VL++EL++VEKEKE FI DFS+EDY+DIVGGWK +L R +S EQ
Sbjct  425   GFKDVIAEDRTDQFTQVLRRELESVEKEKEEFISDFSKEDYDDIVGGWKAELERCASDEQ  484

Query  910   RWGL  899
             +WGL
Sbjct  485   KWGL  488



>ref|XP_004961340.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Setaria 
italica]
Length=498

 Score =   412 bits (1060),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 190/244 (78%), Positives = 216/244 (89%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK +GILRYER+FG GYVSTGG+ETTKEFV  LDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  250   DNVQYKTNGILRYERIFGEGYVSTGGVETTKEFVDMLDLKPGQKVLDVGCGIGGGDFYMA  309

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             ENYDVHV+GIDLS NM++ A+ERAIG KC+VEFEVADCT K YP+ +FDVIYSRDTILHI
Sbjct  310   ENYDVHVLGIDLSVNMVSFAMERAIGRKCSVEFEVADCTTKDYPENSFDVIYSRDTILHI  369

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFRSF+KWLKPGGKVLI+DYCK  G PSEEFAAYIKQRGYDLHD + YG+ML  A
Sbjct  370   QDKPALFRSFFKWLKPGGKVLISDYCKNPGKPSEEFAAYIKQRGYDLHDVKAYGKMLEGA  429

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF DVIAEDRT+QF+ VL++EL  VEK K+AF+ DF++EDY+DIV GW  KL R+S+GEQ
Sbjct  430   GFHDVIAEDRTEQFLSVLRRELAEVEKNKDAFVADFTQEDYDDIVNGWNAKLKRSSAGEQ  489

Query  910   RWGL  899
             RWGL
Sbjct  490   RWGL  493



>dbj|BAJ97525.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=508

 Score =   412 bits (1060),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 193/244 (79%), Positives = 215/244 (88%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYERVFG G+VSTGG+ETTKEFV  LDL+PGQKVLDVGCGIGGGDF+MA
Sbjct  260   DNVQYKTSGILRYERVFGQGFVSTGGIETTKEFVDLLDLKPGQKVLDVGCGIGGGDFFMA  319

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             ENYDVHV+GIDLS NM++ ALE AIG KCAVEFEVADCT KTYPD TFDVIYSRDTILHI
Sbjct  320   ENYDVHVVGIDLSINMVSFALEHAIGRKCAVEFEVADCTTKTYPDNTFDVIYSRDTILHI  379

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFRSF+KWLKPGGKVLI+DYC+  G PSEEFA+YIKQRGYDLHD E YGQML +A
Sbjct  380   QDKPALFRSFFKWLKPGGKVLISDYCRSPGKPSEEFASYIKQRGYDLHDVETYGQMLENA  439

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF DVIAED +DQF+KVL++EL  VEK K+ F+ DF +EDY+DIV GW  KL R+S+GEQ
Sbjct  440   GFHDVIAEDHSDQFLKVLQRELAEVEKNKDDFLADFGQEDYDDIVTGWNAKLHRSSAGEQ  499

Query  910   RWGL  899
             RWGL
Sbjct  500   RWGL  503



>ref|XP_010506242.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 isoform 
X2 [Camelina sativa]
Length=491

 Score =   412 bits (1058),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 191/244 (78%), Positives = 218/244 (89%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYERVFG G+VSTGGLETTKEFV K++L+PGQKVLDVGCGIGGGDFYMA
Sbjct  242   DNVQYKSSGILRYERVFGQGFVSTGGLETTKEFVEKMNLKPGQKVLDVGCGIGGGDFYMA  301

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E +DVHV+GIDLS NMI+ ALERAIGL C+VEFEVADCT K YPD +FDVIYSRDTILHI
Sbjct  302   EKFDVHVVGIDLSVNMISFALERAIGLNCSVEFEVADCTTKHYPDNSFDVIYSRDTILHI  361

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFR+F+KWLKPGGKVLI+DYC+    PS EF+ YIKQRGYDLHD + YGQML+DA
Sbjct  362   QDKPALFRTFFKWLKPGGKVLISDYCRSPKTPSAEFSEYIKQRGYDLHDVQAYGQMLKDA  421

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF+DVIAEDRTDQF +VL++EL++VEKEKE FI DFS+EDY+DIVGGWK +L R +S EQ
Sbjct  422   GFKDVIAEDRTDQFTQVLRRELESVEKEKEEFISDFSKEDYDDIVGGWKAELERCASDEQ  481

Query  910   RWGL  899
             +WGL
Sbjct  482   KWGL  485



>gb|EEC79642.1| hypothetical protein OsI_20868 [Oryza sativa Indica Group]
Length=504

 Score =   412 bits (1059),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 192/244 (79%), Positives = 215/244 (88%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK +GILRYERVFG GYVSTGG+ETTKEFV KLDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  256   DNVQYKTTGILRYERVFGEGYVSTGGIETTKEFVDKLDLKPGQKVLDVGCGIGGGDFYMA  315

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             ENYD HV+GIDLS NM++ A+ERAIG KC+VEFEVADCT KTY   TFDVIYSRDTILHI
Sbjct  316   ENYDAHVLGIDLSINMVSFAIERAIGRKCSVEFEVADCTTKTYAPNTFDVIYSRDTILHI  375

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
              DKPALFRSF+KWLKPGGKVLI+DYC+  G PSEEFAAYIKQRGYDLHD + YG+ML DA
Sbjct  376   HDKPALFRSFFKWLKPGGKVLISDYCRNPGKPSEEFAAYIKQRGYDLHDVKTYGKMLEDA  435

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF  VIAEDRTDQF++VL++EL  VEK KEAF+ DF++EDY+DIV GW  KL R+S+GEQ
Sbjct  436   GFHHVIAEDRTDQFLRVLQRELAEVEKNKEAFLADFTQEDYDDIVNGWNAKLKRSSAGEQ  495

Query  910   RWGL  899
             RWGL
Sbjct  496   RWGL  499



>ref|XP_010461752.1| PREDICTED: phosphomethylethanolamine N-methyltransferase [Camelina 
sativa]
Length=492

 Score =   412 bits (1058),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 200/244 (82%), Positives = 223/244 (91%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYERVFG GYVSTGG ETTKEFVAK+DL+PGQKVLDVGCGIGGGDFYMA
Sbjct  243   DNVQYKSSGILRYERVFGEGYVSTGGAETTKEFVAKMDLKPGQKVLDVGCGIGGGDFYMA  302

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DVHV+GIDLS NMI+ ALERAIGLKC+VEFEVADCT KTYPD +FDVIYSRDTILHI
Sbjct  303   ENFDVHVVGIDLSVNMISFALERAIGLKCSVEFEVADCTTKTYPDNSFDVIYSRDTILHI  362

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFR+F+KWLKPGGKVLITDYC+ +  PS EFA YIKQRGYDLHD + YG+ML++A
Sbjct  363   QDKPALFRTFFKWLKPGGKVLITDYCRSAETPSPEFAEYIKQRGYDLHDVQAYGKMLKEA  422

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GFEDVIAEDRTDQF++VL++EL+ VEKEKE FI DFS+EDYNDIVGGW  KL RT+SGEQ
Sbjct  423   GFEDVIAEDRTDQFVQVLRRELEKVEKEKEEFISDFSQEDYNDIVGGWTAKLERTASGEQ  482

Query  910   RWGL  899
             +WGL
Sbjct  483   KWGL  486



>ref|XP_006303987.1| hypothetical protein CARUB_v10008968mg [Capsella rubella]
 gb|EOA36885.1| hypothetical protein CARUB_v10008968mg [Capsella rubella]
Length=491

 Score =   411 bits (1057),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 200/244 (82%), Positives = 221/244 (91%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYERVFG GYVSTGG ETTKEFVA +DL+PGQKVLDVGCGIGGGDFYMA
Sbjct  242   DNVQYKSSGILRYERVFGEGYVSTGGFETTKEFVAMMDLKPGQKVLDVGCGIGGGDFYMA  301

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DVHV+GIDLS NMI+ ALERAIGL C+VEFEVADCT KTYPD +FDVIYSRDTILHI
Sbjct  302   ENFDVHVVGIDLSVNMISFALERAIGLNCSVEFEVADCTTKTYPDNSFDVIYSRDTILHI  361

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFR+F+KWLKPGGKVLITDYC+ +  PS EFA YIKQRGYDLHD + YG+ML+DA
Sbjct  362   QDKPALFRTFFKWLKPGGKVLITDYCRSAETPSPEFAEYIKQRGYDLHDVQAYGKMLKDA  421

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GFEDVIAEDRTDQF++VL++EL+ VEKEKE FI DFSEEDYNDIVGGW  KL RT+SGEQ
Sbjct  422   GFEDVIAEDRTDQFVEVLRRELEKVEKEKEEFINDFSEEDYNDIVGGWSAKLERTASGEQ  481

Query  910   RWGL  899
             +WGL
Sbjct  482   KWGL  485



>gb|AAS57723.1| phosphoethanolamine N-methyltransferase [Oryza sativa]
Length=499

 Score =   411 bits (1057),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 191/244 (78%), Positives = 214/244 (88%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYER+FG G+VSTGG+ETTKEFV +LDL+PGQ VLDVGCGIGGGDFYMA
Sbjct  251   DNVQYKASGILRYERIFGEGFVSTGGIETTKEFVDRLDLKPGQNVLDVGCGIGGGDFYMA  310

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             + YDVHV+GIDLS NM++ ALERAIG KC+VEFEVADCTKKTYPD TFDVIYSRDTILHI
Sbjct  311   DKYDVHVVGIDLSINMVSFALERAIGRKCSVEFEVADCTKKTYPDNTFDVIYSRDTILHI  370

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKP+LF+SF+KWLKPGGKVLI+DYCK  G PSEEFAAYIKQRGYDLHD   YGQML +A
Sbjct  371   QDKPSLFKSFFKWLKPGGKVLISDYCKCPGKPSEEFAAYIKQRGYDLHDVRAYGQMLENA  430

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF DVIAEDRTDQF+ VL++EL  VEK    F+ DFS+EDY+ IV GWK KL R+S+GEQ
Sbjct  431   GFHDVIAEDRTDQFLDVLERELAKVEKNNNEFVSDFSQEDYDAIVNGWKAKLQRSSAGEQ  490

Query  910   RWGL  899
             RWGL
Sbjct  491   RWGL  494



>ref|XP_010231068.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X2 [Brachypodium distachyon]
Length=472

 Score =   409 bits (1052),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 189/244 (77%), Positives = 216/244 (89%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYERVFG GYVSTGG ETTKEFV KLDL+PGQKVLDVGCGIGGGDFYM+
Sbjct  224   DNVQYKSSGILRYERVFGEGYVSTGGFETTKEFVDKLDLKPGQKVLDVGCGIGGGDFYMS  283

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E YDVHV+GIDLS NM++ A+ERAIG KC+VEFEVADCT K YP+ TFDVIYSRDTILHI
Sbjct  284   ETYDVHVLGIDLSINMVSFAIERAIGRKCSVEFEVADCTTKEYPENTFDVIYSRDTILHI  343

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFR+F+KWLKPGGKVLI+DYC+  G PSE+FAAYIKQRGYDLHD + YG+ML +A
Sbjct  344   QDKPALFRNFFKWLKPGGKVLISDYCRSPGKPSEDFAAYIKQRGYDLHDVKTYGKMLENA  403

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF DVIAEDRTDQF++VL++EL   EK KEAF+ DF++EDY+DIV GW  KL R+S+GEQ
Sbjct  404   GFHDVIAEDRTDQFLRVLERELAETEKNKEAFLADFTQEDYDDIVNGWSAKLKRSSAGEQ  463

Query  910   RWGL  899
             +WGL
Sbjct  464   KWGL  467



>ref|XP_003567962.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X1 [Brachypodium distachyon]
Length=501

 Score =   410 bits (1054),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 189/244 (77%), Positives = 216/244 (89%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYERVFG GYVSTGG ETTKEFV KLDL+PGQKVLDVGCGIGGGDFYM+
Sbjct  253   DNVQYKSSGILRYERVFGEGYVSTGGFETTKEFVDKLDLKPGQKVLDVGCGIGGGDFYMS  312

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E YDVHV+GIDLS NM++ A+ERAIG KC+VEFEVADCT K YP+ TFDVIYSRDTILHI
Sbjct  313   ETYDVHVLGIDLSINMVSFAIERAIGRKCSVEFEVADCTTKEYPENTFDVIYSRDTILHI  372

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFR+F+KWLKPGGKVLI+DYC+  G PSE+FAAYIKQRGYDLHD + YG+ML +A
Sbjct  373   QDKPALFRNFFKWLKPGGKVLISDYCRSPGKPSEDFAAYIKQRGYDLHDVKTYGKMLENA  432

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF DVIAEDRTDQF++VL++EL   EK KEAF+ DF++EDY+DIV GW  KL R+S+GEQ
Sbjct  433   GFHDVIAEDRTDQFLRVLERELAETEKNKEAFLADFTQEDYDDIVNGWSAKLKRSSAGEQ  492

Query  910   RWGL  899
             +WGL
Sbjct  493   KWGL  496



>ref|XP_003569614.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Brachypodium 
distachyon]
Length=502

 Score =   409 bits (1051),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 190/244 (78%), Positives = 214/244 (88%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK S ILRYERVFG G+VSTGG+ETTKEFV  LDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  254   DNVQYKTSAILRYERVFGEGFVSTGGIETTKEFVDLLDLKPGQKVLDVGCGIGGGDFYMA  313

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             ENYDVHV+GIDLS NM++ ALE +IG KCAVEFEVADCT KTYPD TFDVIYSRDTILHI
Sbjct  314   ENYDVHVVGIDLSINMVSFALENSIGRKCAVEFEVADCTTKTYPDKTFDVIYSRDTILHI  373

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKP+LFRSF+KWLKPGGKVLI+DYC+  G PSEEFAAYI+QRGYDLHD + YGQML++A
Sbjct  374   QDKPSLFRSFFKWLKPGGKVLISDYCRSPGKPSEEFAAYIEQRGYDLHDVQAYGQMLKNA  433

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF DVIA+DRTDQF+ VL++EL  VEK K+ F+ DF +EDY+DIV GW  KL R S+GEQ
Sbjct  434   GFHDVIADDRTDQFLTVLQRELGEVEKNKDDFLADFGQEDYDDIVNGWNAKLERCSAGEQ  493

Query  910   RWGL  899
             RWGL
Sbjct  494   RWGL  497



>ref|XP_006644536.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Oryza 
brachyantha]
Length=499

 Score =   409 bits (1050),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 188/244 (77%), Positives = 213/244 (87%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK +GILRYER+FG G+VSTGG+ETTKEFV KLDL+P Q VLDVGCGIGGGDFYMA
Sbjct  251   DNVQYKTNGILRYERIFGEGFVSTGGIETTKEFVDKLDLRPAQSVLDVGCGIGGGDFYMA  310

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E YDVHV+GIDLS NM++ ALERAIG  C+VEFEVADCT KTYPD TFDVIYSRDTILHI
Sbjct  311   EKYDVHVVGIDLSINMVSFALERAIGRSCSVEFEVADCTTKTYPDNTFDVIYSRDTILHI  370

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKP+LF+SF+ WLKPGGKVLI+DYCK  G PSEEFAAYIKQRGYDLHD + YG+ML +A
Sbjct  371   QDKPSLFKSFFNWLKPGGKVLISDYCKCPGKPSEEFAAYIKQRGYDLHDVKAYGKMLENA  430

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF DV+AEDRTDQF+ VL++EL  VEK K  F+ DFS+EDY+DIV GWK KL R+S+GEQ
Sbjct  431   GFHDVVAEDRTDQFLNVLQRELAEVEKNKNEFVSDFSQEDYDDIVNGWKAKLQRSSAGEQ  490

Query  910   RWGL  899
             RWGL
Sbjct  491   RWGL  494



>gb|KJB53040.1| hypothetical protein B456_008G289900 [Gossypium raimondii]
Length=489

 Score =   408 bits (1049),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 193/244 (79%), Positives = 216/244 (89%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             DTVQYK + ILRYER FG G+VSTGG+ETTKEFVAKLDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  240   DTVQYKANSILRYERTFGEGFVSTGGIETTKEFVAKLDLKPGQKVLDVGCGIGGGDFYMA  299

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             + + V+V+GIDLS NMI+ ALERA GL C+VEFEVADCT KTYPD +FDVIYSRDTILHI
Sbjct  300   KEFGVYVVGIDLSINMISFALERANGLNCSVEFEVADCTTKTYPDNSFDVIYSRDTILHI  359

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFR FYKWLKPGGKVLI+DYCK +G  S EFA YIKQRGYDLHD + YGQML DA
Sbjct  360   QDKPALFRYFYKWLKPGGKVLISDYCKSAGASSPEFAEYIKQRGYDLHDVKAYGQMLTDA  419

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF+ VIAEDRTDQF++VL++ELD VEK+K+ FI DFS+EDY+DIVGGWK KL RT SGEQ
Sbjct  420   GFDQVIAEDRTDQFIQVLQRELDKVEKDKDTFITDFSQEDYDDIVGGWKAKLIRTRSGEQ  479

Query  910   RWGL  899
             RWGL
Sbjct  480   RWGL  483



>gb|KJB53039.1| hypothetical protein B456_008G289900 [Gossypium raimondii]
Length=488

 Score =   408 bits (1049),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 193/244 (79%), Positives = 216/244 (89%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             DTVQYK + ILRYER FG G+VSTGG+ETTKEFVAKLDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  239   DTVQYKANSILRYERTFGEGFVSTGGIETTKEFVAKLDLKPGQKVLDVGCGIGGGDFYMA  298

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             + + V+V+GIDLS NMI+ ALERA GL C+VEFEVADCT KTYPD +FDVIYSRDTILHI
Sbjct  299   KEFGVYVVGIDLSINMISFALERANGLNCSVEFEVADCTTKTYPDNSFDVIYSRDTILHI  358

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFR FYKWLKPGGKVLI+DYCK +G  S EFA YIKQRGYDLHD + YGQML DA
Sbjct  359   QDKPALFRYFYKWLKPGGKVLISDYCKSAGASSPEFAEYIKQRGYDLHDVKAYGQMLTDA  418

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF+ VIAEDRTDQF++VL++ELD VEK+K+ FI DFS+EDY+DIVGGWK KL RT SGEQ
Sbjct  419   GFDQVIAEDRTDQFIQVLQRELDKVEKDKDTFITDFSQEDYDDIVGGWKAKLIRTRSGEQ  478

Query  910   RWGL  899
             RWGL
Sbjct  479   RWGL  482



>gb|AFW83642.1| phosphoethanolamine N-methyltransferase [Zea mays]
Length=502

 Score =   409 bits (1050),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 190/244 (78%), Positives = 211/244 (86%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYER+FG GYVSTGG+ETTKEFV KLDL+PG KVLDVGCGIGGGDFYMA
Sbjct  254   DNVQYKASGILRYERIFGEGYVSTGGVETTKEFVDKLDLKPGHKVLDVGCGIGGGDFYMA  313

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E YD HV+GIDLS NM++ ALERAIG  C+VEFEVADCT KTYPD TFDVIYSRDTILHI
Sbjct  314   EKYDAHVVGIDLSINMVSFALERAIGRSCSVEFEVADCTTKTYPDNTFDVIYSRDTILHI  373

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
              DKP+LF+SF+KWLKPGGKVLI+DYC+  G PSEEFAAYIKQRGYDLH  E YGQML+ A
Sbjct  374   HDKPSLFKSFFKWLKPGGKVLISDYCRSPGKPSEEFAAYIKQRGYDLHAVEAYGQMLKSA  433

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF DVIAEDRTDQF+ VL KEL   EK K+ F+ DF++EDY+DIV GWK KL R+S+GEQ
Sbjct  434   GFRDVIAEDRTDQFLGVLDKELAEFEKNKDDFLSDFTQEDYDDIVNGWKAKLQRSSAGEQ  493

Query  910   RWGL  899
             RWGL
Sbjct  494   RWGL  497



>ref|NP_001148925.1| LOC100282545 [Zea mays]
 gb|ACG33501.1| phosphoethanolamine N-methyltransferase [Zea mays]
Length=502

 Score =   407 bits (1047),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 189/244 (77%), Positives = 210/244 (86%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYER+FG GYVSTGG+ETTKEFV KLDL+PG KVLDVGCGIGGGDFYMA
Sbjct  254   DNVQYKASGILRYERIFGEGYVSTGGVETTKEFVDKLDLKPGHKVLDVGCGIGGGDFYMA  313

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E YD HV+GIDLS NM++ ALERAIG  C+VEFEVADCT KTYPD TFDVIYSRDTILHI
Sbjct  314   EKYDAHVVGIDLSINMVSFALERAIGRSCSVEFEVADCTTKTYPDNTFDVIYSRDTILHI  373

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
              DKP+LF+SF+ WLKPGGKVLI+DYC+  G PSEEFAAYIKQRGYDLH  E YGQML+ A
Sbjct  374   HDKPSLFKSFFNWLKPGGKVLISDYCRSPGKPSEEFAAYIKQRGYDLHAVEAYGQMLKSA  433

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF DVIAEDRTDQF+ VL KEL   EK K+ F+ DF++EDY+DIV GWK KL R+S+GEQ
Sbjct  434   GFRDVIAEDRTDQFLGVLDKELAEFEKNKDDFLSDFTQEDYDDIVNGWKAKLQRSSAGEQ  493

Query  910   RWGL  899
             RWGL
Sbjct  494   RWGL  497



>ref|XP_012088548.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X3 [Jatropha curcas]
 gb|KDP23922.1| hypothetical protein JCGZ_27082 [Jatropha curcas]
Length=510

 Score =   408 bits (1048),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 194/244 (80%), Positives = 218/244 (89%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             DTVQYK SGI+RYERVFG G+VSTGG ETTKEFVA+LDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  261   DTVQYKYSGIMRYERVFGHGFVSTGGFETTKEFVARLDLKPGQKVLDVGCGIGGGDFYMA  320

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E YDV V+GIDLS NMI+ AL+RAIGLKCAVEFE+AD TKKTYP+ TFDVIY+RDT+LHI
Sbjct  321   EEYDVEVVGIDLSINMISFALDRAIGLKCAVEFELADITKKTYPNNTFDVIYTRDTMLHI  380

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             +DKPALFRSFYKWLKPGGK LI+DYCK +G PSEEFA YIKQRGY LH+ + Y QML DA
Sbjct  381   KDKPALFRSFYKWLKPGGKFLISDYCKSAGTPSEEFAEYIKQRGYYLHEVKPYVQMLTDA  440

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF+DVIAEDRTDQF +VLK+ELDAVEKEK+ FI DFSE+D+NDIV GWK KL R+S+GEQ
Sbjct  441   GFDDVIAEDRTDQFNRVLKRELDAVEKEKDEFIHDFSEKDFNDIVDGWKAKLIRSSAGEQ  500

Query  910   RWGL  899
              W L
Sbjct  501   LWIL  504



>ref|XP_008675144.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X1 [Zea mays]
 ref|XP_008675145.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X2 [Zea mays]
Length=501

 Score =   407 bits (1045),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 189/244 (77%), Positives = 211/244 (86%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK +GILRYER+FG GYVSTGG ETTKEFV KL+L+PGQKVLDVGCGIGGGDFYMA
Sbjct  253   DNVQYKATGILRYERIFGDGYVSTGGAETTKEFVEKLNLKPGQKVLDVGCGIGGGDFYMA  312

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E Y  HV+GIDLS NMI  ALER+IG KC VEFEVADCT KTYPD  FDVIYSRDTILHI
Sbjct  313   EKYGTHVVGIDLSINMIMFALERSIGCKCLVEFEVADCTTKTYPDHMFDVIYSRDTILHI  372

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKP+LF+SF+KWLKPGGKVLI+DYCK  G PSEEFA YIKQRGYDLHD E YGQML++A
Sbjct  373   QDKPSLFKSFFKWLKPGGKVLISDYCKSPGKPSEEFATYIKQRGYDLHDVEAYGQMLKNA  432

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF  VIAEDRTDQF+ VL+KELD  EK K+ F+ +F++EDY+DIV GWK KL R+S+GEQ
Sbjct  433   GFSHVIAEDRTDQFLSVLQKELDKFEKNKDDFLSEFAQEDYDDIVNGWKAKLQRSSAGEQ  492

Query  910   RWGL  899
             RWGL
Sbjct  493   RWGL  496



>ref|XP_004969637.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Setaria 
italica]
Length=499

 Score =   406 bits (1044),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 189/244 (77%), Positives = 213/244 (87%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYER+FG GYVSTGG+ETTKEFV +LDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  251   DNVQYKASGILRYERIFGDGYVSTGGVETTKEFVDRLDLKPGQKVLDVGCGIGGGDFYMA  310

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E Y  HV+GIDLS NMI  ALERA+G KC+VEFEVADCT KTYPD TFDVIYSRDTILHI
Sbjct  311   EEYGTHVVGIDLSINMILFALERAVGRKCSVEFEVADCTTKTYPDHTFDVIYSRDTILHI  370

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKP+LF+SF+KWLKPGGKVLI+DYC+  G PSEEFAAYIKQRGYDLHD + YGQML++A
Sbjct  371   QDKPSLFKSFFKWLKPGGKVLISDYCRSPGKPSEEFAAYIKQRGYDLHDVDAYGQMLKNA  430

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF  VIAEDRTDQF+ +L+KELD  EK K  F+ DFS+ DY+DIV GWK K+ R+S+GEQ
Sbjct  431   GFSHVIAEDRTDQFLGILQKELDKFEKSKADFLSDFSQGDYDDIVNGWKAKVQRSSAGEQ  490

Query  910   RWGL  899
             RWGL
Sbjct  491   RWGL  494



>ref|XP_004137342.1| PREDICTED: phosphomethylethanolamine N-methyltransferase [Cucumis 
sativus]
 gb|KGN63873.1| hypothetical protein Csa_1G025050 [Cucumis sativus]
Length=468

 Score =   405 bits (1041),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 188/244 (77%), Positives = 217/244 (89%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             DTVQYK SGIL+YERVFG G++S GGLETTKEFVAKLDL+P Q+VLDVGCGIGG DFYMA
Sbjct  218   DTVQYKSSGILKYERVFGHGFISPGGLETTKEFVAKLDLKPRQRVLDVGCGIGGADFYMA  277

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+ V V+GIDLS NMI++ALERAIGL C+VEFEVADCTKKTYPD TFDVIYSRDTILHI
Sbjct  278   ENFSVEVVGIDLSVNMISLALERAIGLACSVEFEVADCTKKTYPDHTFDVIYSRDTILHI  337

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKP+LFRSFYKWLKPGGK+ ITDYC+ +G  S EFA YIKQRGYDLHD + YGQM+ DA
Sbjct  338   QDKPSLFRSFYKWLKPGGKLFITDYCRNAGTSSPEFAEYIKQRGYDLHDVKAYGQMIEDA  397

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF +V++EDRT+QF++VL++EL+AVE++K+ FI DFSEE YNDIV GWK KL R+ SGEQ
Sbjct  398   GFGEVVSEDRTNQFIQVLQQELEAVEEQKDRFILDFSEEGYNDIVCGWKAKLNRSLSGEQ  457

Query  910   RWGL  899
             RWGL
Sbjct  458   RWGL  461



>tpg|DAA57997.1| TPA: putative phosphoethanolamine N-methyltransferase [Zea mays]
Length=498

 Score =   406 bits (1043),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 189/244 (77%), Positives = 211/244 (86%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK +GILRYER+FG GYVSTGG ETTKEFV KL+L+PGQKVLDVGCGIGGGDFYMA
Sbjct  250   DNVQYKATGILRYERIFGDGYVSTGGAETTKEFVEKLNLKPGQKVLDVGCGIGGGDFYMA  309

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E Y  HV+GIDLS NMI  ALER+IG KC VEFEVADCT KTYPD  FDVIYSRDTILHI
Sbjct  310   EKYGTHVVGIDLSINMIMFALERSIGCKCLVEFEVADCTTKTYPDHMFDVIYSRDTILHI  369

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKP+LF+SF+KWLKPGGKVLI+DYCK  G PSEEFA YIKQRGYDLHD E YGQML++A
Sbjct  370   QDKPSLFKSFFKWLKPGGKVLISDYCKSPGKPSEEFATYIKQRGYDLHDVEAYGQMLKNA  429

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF  VIAEDRTDQF+ VL+KELD  EK K+ F+ +F++EDY+DIV GWK KL R+S+GEQ
Sbjct  430   GFSHVIAEDRTDQFLSVLQKELDKFEKNKDDFLSEFAQEDYDDIVNGWKAKLQRSSAGEQ  489

Query  910   RWGL  899
             RWGL
Sbjct  490   RWGL  493



>gb|AAV67950.1| putative phosphoethanolamine N-methyltransferase [Zea mays]
Length=495

 Score =   406 bits (1043),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 188/244 (77%), Positives = 211/244 (86%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK +GILRYER+FG GYVSTGG ETTKEFV KL+L+PGQKVLDVGCGIGGGDFYMA
Sbjct  247   DNVQYKATGILRYERIFGDGYVSTGGAETTKEFVEKLNLKPGQKVLDVGCGIGGGDFYMA  306

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E Y  HV+GIDLS NMI  ALER+IG KC VEFEVADCT KTYPD  FDVIYSRDTILHI
Sbjct  307   EKYGTHVVGIDLSINMIMFALERSIGCKCLVEFEVADCTTKTYPDHMFDVIYSRDTILHI  366

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKP+LF+SF+KWLKPGGKVLI+DYCK  G PSEEFA YIKQRGYDLHD E YGQML+DA
Sbjct  367   QDKPSLFKSFFKWLKPGGKVLISDYCKSPGKPSEEFATYIKQRGYDLHDVEAYGQMLKDA  426

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF +VIAEDRT+QF+ VL++E+  VEK K+AF+ DF++EDY+DIV GW  KL R+S GEQ
Sbjct  427   GFHNVIAEDRTEQFLNVLQREIGEVEKNKDAFLADFTQEDYDDIVNGWNAKLKRSSGGEQ  486

Query  910   RWGL  899
             RWGL
Sbjct  487   RWGL  490



>ref|XP_006655550.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Oryza 
brachyantha]
Length=495

 Score =   405 bits (1041),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 187/244 (77%), Positives = 213/244 (87%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYERVFG G+VSTGG+ETTKEFV KLDL+PG KVLDVGCGIGGGDFYMA
Sbjct  247   DNVQYKTSGILRYERVFGEGFVSTGGIETTKEFVEKLDLKPGHKVLDVGCGIGGGDFYMA  306

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             ENYD HV+GIDLS NM++ A+ERAIG KC+VEFEVADCT K+Y   TFDVIYSRDTILHI
Sbjct  307   ENYDAHVLGIDLSINMVSFAIERAIGRKCSVEFEVADCTTKSYQPNTFDVIYSRDTILHI  366

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
              DKPALFRSF+KWLKPGGKVLI+DYC+  G PSEEFAAYIKQRGYDLHD + YG+ML DA
Sbjct  367   HDKPALFRSFFKWLKPGGKVLISDYCRSPGKPSEEFAAYIKQRGYDLHDVKTYGKMLEDA  426

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF  V AEDRTDQF++VL++EL  VEK K+AF+ DF++EDY+DIV GW  KL R+S+GEQ
Sbjct  427   GFHHVTAEDRTDQFLRVLQRELAEVEKNKDAFLADFTQEDYDDIVNGWNAKLKRSSAGEQ  486

Query  910   RWGL  899
             +WGL
Sbjct  487   KWGL  490



>ref|XP_002456193.1| hypothetical protein SORBIDRAFT_03g031940 [Sorghum bicolor]
 gb|EES01313.1| hypothetical protein SORBIDRAFT_03g031940 [Sorghum bicolor]
Length=499

 Score =   405 bits (1042),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 190/244 (78%), Positives = 212/244 (87%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK +GILRYER+FG GYVSTGG+ETTKEFV KLDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  251   DNVQYKATGILRYERIFGDGYVSTGGVETTKEFVDKLDLKPGQKVLDVGCGIGGGDFYMA  310

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E Y  HV+GIDLS NMI  ALER+IG KC+VEFEVADCT KTYPD  FDVIYSRDTILHI
Sbjct  311   EKYGTHVVGIDLSINMILFALERSIGRKCSVEFEVADCTTKTYPDHMFDVIYSRDTILHI  370

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKP+LF+SF+KWLKPGGKVLI+DYCK  G PSEEFAAYIKQRGYDLHD E YGQML++A
Sbjct  371   QDKPSLFKSFFKWLKPGGKVLISDYCKSPGKPSEEFAAYIKQRGYDLHDVEAYGQMLKNA  430

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF  VIAEDRTDQF+ VL+KELD  EK K+ F+ +F++ DY+DIV GWK KL RTS+ EQ
Sbjct  431   GFSHVIAEDRTDQFLSVLQKELDKFEKNKDDFLSEFAQGDYDDIVNGWKAKLQRTSAREQ  490

Query  910   RWGL  899
             RWGL
Sbjct  491   RWGL  494



>gb|AFW04224.1| phosphoethanolamine N-methyl transferase [Suaeda maritima]
Length=494

 Score =   404 bits (1039),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 199/244 (82%), Positives = 220/244 (90%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             DT QYKC+ ILRYERVFGPGYVSTGG ETTKEFV+ LDL+PGQKVL VGCGIGGGDFYMA
Sbjct  245   DTSQYKCNSILRYERVFGPGYVSTGGYETTKEFVSMLDLKPGQKVLGVGCGIGGGDFYMA  304

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E +DV V+G DLS NMI+ ALER+IG KCAVEFEVADCTK  YPD +FDVIYSRDTILHI
Sbjct  305   ETFDVEVVGFDLSVNMISFALERSIGPKCAVEFEVADCTKINYPDNSFDVIYSRDTILHI  364

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFRSFYKWLKPGGKVLI+DYCK++GPPS EFAAYIKQRGYDLHD +EYGQML+DA
Sbjct  365   QDKPALFRSFYKWLKPGGKVLISDYCKKAGPPSPEFAAYIKQRGYDLHDVKEYGQMLKDA  424

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF DV+AEDRT+QF++VL+KEL+ VEKEK+ FI DFSEEDYNDIVGGW  KL RT+ GEQ
Sbjct  425   GFVDVLAEDRTEQFIRVLRKELETVEKEKDVFISDFSEEDYNDIVGGWNDKLRRTAKGEQ  484

Query  910   RWGL  899
             RWGL
Sbjct  485   RWGL  488



>gb|EEE55232.1| hypothetical protein OsJ_03109 [Oryza sativa Japonica Group]
Length=509

 Score =   405 bits (1040),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 192/254 (76%), Positives = 215/254 (85%), Gaps = 10/254 (4%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGL----------ETTKEFVAKLDLQPGQKVLDVGC  1481
             D VQYK SGILRYER+FG G+VSTGG+          ETTKEFV +LDL+PGQ VLDVGC
Sbjct  251   DNVQYKASGILRYERIFGEGFVSTGGIVCLFFYLRSPETTKEFVDRLDLKPGQNVLDVGC  310

Query  1480  GIGGGDFYMAENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDV  1301
             GIGGGDFYMA+ YDVHV+GIDLS NM++ ALERAIG KC+VEFEVADCTKKTYPD TFDV
Sbjct  311   GIGGGDFYMADKYDVHVVGIDLSINMVSFALERAIGRKCSVEFEVADCTKKTYPDNTFDV  370

Query  1300  IYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDT  1121
             IYSRDTILHIQDKP+LF+SF+KWLKPGGKVLI+DYCK  G PSEEFAAYIKQRGYDLHD 
Sbjct  371   IYSRDTILHIQDKPSLFKSFFKWLKPGGKVLISDYCKCPGKPSEEFAAYIKQRGYDLHDV  430

Query  1120  EEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKL  941
               YGQML +AGF DVIAEDRTDQF+ VL++EL  VEK K  F+ DFS+EDY+ IV GWK 
Sbjct  431   RAYGQMLENAGFHDVIAEDRTDQFLDVLERELAKVEKNKNEFVSDFSQEDYDAIVNGWKA  490

Query  940   KLTRTSSGEQRWGL  899
             KL R+S+GEQRWGL
Sbjct  491   KLQRSSAGEQRWGL  504



>gb|EMT23240.1| Phosphoethanolamine N-methyltransferase 1 [Aegilops tauschii]
Length=497

 Score =   404 bits (1038),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 187/244 (77%), Positives = 213/244 (87%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK +GILRYERVFG GYVSTGG ETTKEFV KLDL+ GQKVLDVGCGIGGGDFYMA
Sbjct  249   DNVQYKSTGILRYERVFGEGYVSTGGFETTKEFVDKLDLKAGQKVLDVGCGIGGGDFYMA  308

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E YDVHV+GIDLS NM++ A+ERAIG  C+VEFEVADCT K Y + TFDVIYSRDTILHI
Sbjct  309   ETYDVHVLGIDLSINMVSFAIERAIGRSCSVEFEVADCTTKEYAENTFDVIYSRDTILHI  368

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFR+F+KWLKPGGKVLI+DYC+  G PSEEFAAYIKQRGYDLHD + YG+ML DA
Sbjct  369   QDKPALFRNFFKWLKPGGKVLISDYCRSPGTPSEEFAAYIKQRGYDLHDVKTYGKMLEDA  428

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF DV+AEDRTDQF++VL++ELD  EK KEAF+ DF++ED +DIV GW  KL R+S+GEQ
Sbjct  429   GFHDVVAEDRTDQFLRVLERELDGTEKSKEAFLADFTQEDSDDIVNGWSAKLKRSSAGEQ  488

Query  910   RWGL  899
             +WGL
Sbjct  489   KWGL  492



>gb|AGO59019.1| heat responsive transcription factor protein, partial [Triticum 
aestivum]
Length=460

 Score =   402 bits (1034),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 187/244 (77%), Positives = 213/244 (87%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK +GILRYERVFG GYVSTGG ETTKEFV KLDL+ GQKVLDVGCGIGGGDFYMA
Sbjct  216   DNVQYKSTGILRYERVFGEGYVSTGGFETTKEFVDKLDLKAGQKVLDVGCGIGGGDFYMA  275

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E YDVHV+GIDLS NM++ A+ERAIG  C+VEFEVADCT K Y + TFDVIYSRDTILHI
Sbjct  276   ETYDVHVLGIDLSINMVSFAIERAIGRSCSVEFEVADCTTKEYAENTFDVIYSRDTILHI  335

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFR+F+KWLKPGGKVLI+DYC+  G PSEEFAAYIKQRGYDLHD + YG+ML DA
Sbjct  336   QDKPALFRNFFKWLKPGGKVLISDYCRSPGTPSEEFAAYIKQRGYDLHDVKTYGKMLEDA  395

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF DV+AEDRTDQF++VL++EL   EK KEAF+ DF++EDY+DIV GW  KL R+S+GEQ
Sbjct  396   GFHDVVAEDRTDQFLRVLERELGETEKNKEAFLADFTQEDYDDIVNGWSAKLKRSSAGEQ  455

Query  910   RWGL  899
             +WGL
Sbjct  456   KWGL  459



>gb|AAL40895.1| phosphoethanolamine methyltransferase [Triticum aestivum]
Length=498

 Score =   404 bits (1037),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 187/244 (77%), Positives = 213/244 (87%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK +GILRYERVFG GYVSTGG ETTKEFV KLDL+ GQKVLDVGCGIGGGDFYMA
Sbjct  250   DNVQYKSTGILRYERVFGEGYVSTGGFETTKEFVDKLDLKAGQKVLDVGCGIGGGDFYMA  309

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E YDVHV+GIDLS NM++ A+ERAIG  C+VEFEVADCT K Y + TFDVIYSRDTILHI
Sbjct  310   ETYDVHVLGIDLSINMVSFAIERAIGRSCSVEFEVADCTTKEYAENTFDVIYSRDTILHI  369

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFR+F+KWLKPGGKVLI+DYC+  G PSEEFAAYIKQRGYDLHD + YG+ML DA
Sbjct  370   QDKPALFRNFFKWLKPGGKVLISDYCRSPGTPSEEFAAYIKQRGYDLHDVKTYGKMLEDA  429

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF DV+AEDRTDQF++VL++EL   EK KEAF+ DF++EDY+DIV GW  KL R+S+GEQ
Sbjct  430   GFHDVVAEDRTDQFLRVLERELGETEKNKEAFLADFTQEDYDDIVNGWSAKLKRSSAGEQ  489

Query  910   RWGL  899
             +WGL
Sbjct  490   KWGL  493



>gb|EMT23241.1| Phosphoethanolamine N-methyltransferase 1 [Aegilops tauschii]
Length=553

 Score =   402 bits (1032),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 186/244 (76%), Positives = 212/244 (87%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK +GILRYERVFG GYVSTGG ETTKEFV KLDL+ GQKVLDVGCGIGGGDFYMA
Sbjct  305   DNVQYKSTGILRYERVFGEGYVSTGGFETTKEFVDKLDLKAGQKVLDVGCGIGGGDFYMA  364

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E YDVHV+GIDLS NM++ A+ERAIG  C+VEFEVADCT K Y + TFDVIY RDTILHI
Sbjct  365   ETYDVHVLGIDLSINMVSFAIERAIGRSCSVEFEVADCTTKEYAENTFDVIYCRDTILHI  424

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFR+F+KWLKPGGKVLI+DYC+  G PSEEFAAYIKQRGYDLHD + YG+ML DA
Sbjct  425   QDKPALFRNFFKWLKPGGKVLISDYCRSPGTPSEEFAAYIKQRGYDLHDVKTYGKMLEDA  484

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF DV+AEDRTDQF++VL++EL   EK KEAF+ DF++EDY+DIV GW  KL R+S+GEQ
Sbjct  485   GFHDVVAEDRTDQFLRVLERELGETEKNKEAFLADFTQEDYDDIVNGWSAKLKRSSAGEQ  544

Query  910   RWGL  899
             +WGL
Sbjct  545   KWGL  548



>emb|CDX93681.1| BnaA06g03670D [Brassica napus]
Length=473

 Score =   399 bits (1024),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 197/244 (81%), Positives = 218/244 (89%), Gaps = 2/244 (1%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK +GILRYERVFG GYVSTGG ETTKEFVAK++L+PGQKVLDVGCGIGGGDFYMA
Sbjct  226   DNVQYKSNGILRYERVFGQGYVSTGGFETTKEFVAKMELKPGQKVLDVGCGIGGGDFYMA  285

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E +DVHV+GIDLS NMI+ ALERAIGL C+VEFEVADCT KTYPD +FDVIYSRDTILHI
Sbjct  286   ETFDVHVVGIDLSVNMISFALERAIGLNCSVEFEVADCTTKTYPDNSFDVIYSRDTILHI  345

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALF+SF+KWLKPGG+VLITDYCK +  PS  FA YIKQRGYDLHD + YGQML+DA
Sbjct  346   QDKPALFKSFFKWLKPGGRVLITDYCKSAETPSPTFAEYIKQRGYDLHDVQAYGQMLKDA  405

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GFEDVIAEDRTDQF++VL++EL+ VEKEKE FI DFSEEDYNDIVGGWK KL R  S EQ
Sbjct  406   GFEDVIAEDRTDQFVQVLRRELEKVEKEKEEFISDFSEEDYNDIVGGWKAKLER--SDEQ  463

Query  910   RWGL  899
             +WGL
Sbjct  464   KWGL  467



>ref|XP_009147956.1| PREDICTED: phosphomethylethanolamine N-methyltransferase [Brassica 
rapa]
Length=489

 Score =   399 bits (1024),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 197/244 (81%), Positives = 218/244 (89%), Gaps = 2/244 (1%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK +GILRYERVFG GYVSTGG ETTKEFVAK++L+PGQKVLDVGCGIGGGDFYMA
Sbjct  242   DNVQYKSNGILRYERVFGQGYVSTGGFETTKEFVAKMELKPGQKVLDVGCGIGGGDFYMA  301

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E +DVHV+GIDLS NMI+ ALERAIGL C+VEFEVADCT KTYPD +FDVIYSRDTILHI
Sbjct  302   ETFDVHVVGIDLSVNMISFALERAIGLNCSVEFEVADCTTKTYPDNSFDVIYSRDTILHI  361

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALF+SF+KWLKPGG+VLITDYCK +  PS  FA YIKQRGYDLHD + YGQML+DA
Sbjct  362   QDKPALFKSFFKWLKPGGRVLITDYCKSAETPSPTFAEYIKQRGYDLHDVQAYGQMLKDA  421

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GFEDVIAEDRTDQF++VL++EL+ VEKEKE FI DFSEEDYNDIVGGWK KL R  S EQ
Sbjct  422   GFEDVIAEDRTDQFVQVLRRELEKVEKEKEEFISDFSEEDYNDIVGGWKAKLER--SDEQ  479

Query  910   RWGL  899
             +WGL
Sbjct  480   KWGL  483



>emb|CDM83854.1| unnamed protein product [Triticum aestivum]
Length=396

 Score =   395 bits (1014),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 184/231 (80%), Positives = 207/231 (90%), Gaps = 0/231 (0%)
 Frame = -1

Query  1591  ERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMAENYDVHVIGIDLS  1412
             ERVFG G+VSTGG+ETTKEFV  LDL+PGQKVLDVGCGIGGGDFYMAENYDVHV+GIDLS
Sbjct  161   ERVFGQGFVSTGGIETTKEFVDLLDLKPGQKVLDVGCGIGGGDFYMAENYDVHVVGIDLS  220

Query  1411  TNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKW  1232
              NM++ ALE AIG KCAVEFEVADCT KTYPD+TFDVIYSRDTILHIQDKP+LFRSF+KW
Sbjct  221   INMVSFALEHAIGRKCAVEFEVADCTTKTYPDSTFDVIYSRDTILHIQDKPSLFRSFFKW  280

Query  1231  LKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQ  1052
             LKPGGKVLI+DYC+  G PSEEFAAYIKQRGYDLHD E YGQML++AGF DVIAE+RTDQ
Sbjct  281   LKPGGKVLISDYCRSPGKPSEEFAAYIKQRGYDLHDVEAYGQMLQNAGFHDVIAEERTDQ  340

Query  1051  FMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  899
             F+KVL++EL  VEK K+ F+ DF +EDY+DIV GW  KL R+S+GEQRWGL
Sbjct  341   FLKVLQRELAEVEKNKDEFLADFGQEDYDDIVTGWNAKLQRSSAGEQRWGL  391



>ref|XP_006406666.1| hypothetical protein EUTSA_v10020595mg [Eutrema salsugineum]
 gb|ESQ48119.1| hypothetical protein EUTSA_v10020595mg [Eutrema salsugineum]
Length=491

 Score =   397 bits (1021),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 194/244 (80%), Positives = 219/244 (90%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGILRYERVFG G+VSTGG+ETTKEFV K+DL+PGQKVLDVGCGIGGGDFYMA
Sbjct  242   DNVQYKASGILRYERVFGQGFVSTGGIETTKEFVEKMDLKPGQKVLDVGCGIGGGDFYMA  301

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DVHV+GIDLS NMI+ ALERAIGLKC+VEFEVADCT K YPD +FDVIYSRDTILHI
Sbjct  302   ENFDVHVVGIDLSVNMISFALERAIGLKCSVEFEVADCTTKQYPDNSFDVIYSRDTILHI  361

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFR+F+KWLKPGGKVLI+DYC+    PS EF+ YIKQRGYDLHD + YGQML+D 
Sbjct  362   QDKPALFRTFFKWLKPGGKVLISDYCRSPKTPSPEFSEYIKQRGYDLHDVQAYGQMLKDV  421

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF DVIAEDRTDQFM+VL++EL+ VE+EKE FI DFS+EDY+DIVGGWK KL R +SGEQ
Sbjct  422   GFSDVIAEDRTDQFMQVLRRELERVEREKEEFISDFSKEDYDDIVGGWKAKLERVASGEQ  481

Query  910   RWGL  899
             +WGL
Sbjct  482   KWGL  485



>emb|CDY40594.1| BnaC06g02100D [Brassica napus]
Length=473

 Score =   394 bits (1011),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 195/244 (80%), Positives = 217/244 (89%), Gaps = 2/244 (1%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK +GILRYERVFG GYVSTGG ETTKEFVAK++L+PGQKVLDVGCGIGGGDFYMA
Sbjct  226   DNVQYKSNGILRYERVFGQGYVSTGGFETTKEFVAKMELKPGQKVLDVGCGIGGGDFYMA  285

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E +DVHV+GIDLS NMI+ ALERAIGL C+VEFEVADCT KTYPD +FDVIYSRDTILHI
Sbjct  286   ETFDVHVVGIDLSVNMISFALERAIGLNCSVEFEVADCTTKTYPDNSFDVIYSRDTILHI  345

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALF++F+KWLKPGG+VLITDYCK +  PS  FA YIKQRGYDLHD + YGQML+DA
Sbjct  346   QDKPALFKAFFKWLKPGGRVLITDYCKSAETPSPVFAEYIKQRGYDLHDVQAYGQMLKDA  405

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GFE VIAEDRTDQF++VL++EL+ VEKEKE FI DFSEEDYNDIVGGWK KL R  S EQ
Sbjct  406   GFEYVIAEDRTDQFIQVLRRELEKVEKEKEEFISDFSEEDYNDIVGGWKAKLER--SDEQ  463

Query  910   RWGL  899
             +WGL
Sbjct  464   KWGL  467



>ref|XP_012088547.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X2 [Jatropha curcas]
Length=519

 Score =   393 bits (1010),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 194/272 (71%), Positives = 218/272 (80%), Gaps = 28/272 (10%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             DTVQYK SGI+RYERVFG G+VSTGG ETTKEFVA+LDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  242   DTVQYKYSGIMRYERVFGHGFVSTGGFETTKEFVARLDLKPGQKVLDVGCGIGGGDFYMA  301

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E YDV V+GIDLS NMI+ AL+RAIGLKCAVEFE+AD TKKTYP+ TFDVIY+RDT+LHI
Sbjct  302   EEYDVEVVGIDLSINMISFALDRAIGLKCAVEFELADITKKTYPNNTFDVIYTRDTMLHI  361

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             +DKPALFRSFYKWLKPGGK LI+DYCK +G PSEEFA YIKQRGY LH+ + Y QML DA
Sbjct  362   KDKPALFRSFYKWLKPGGKFLISDYCKSAGTPSEEFAEYIKQRGYYLHEVKPYVQMLTDA  421

Query  1090  GFEDVIAEDRTD----------------------------QFMKVLKKELDAVEKEKEAF  995
             GF+DVIAEDRTD                            QF +VLK+ELDAVEKEK+ F
Sbjct  422   GFDDVIAEDRTDQVFFKPFITLKDAYIYFVISSQKLILVLQFNRVLKRELDAVEKEKDEF  481

Query  994   IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  899
             I DFSE+D+NDIV GWK KL R+S+GEQ W L
Sbjct  482   IHDFSEKDFNDIVDGWKAKLIRSSAGEQLWIL  513



>ref|XP_010481025.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Camelina sativa]
Length=427

 Score =   390 bits (1001),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 181/244 (74%), Positives = 209/244 (86%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGIL YERVFG GY STGG ETTKEFVAK+DL+PGQKVLDVGCGIGGGDFYMA
Sbjct  178   DNVQYKSSGILLYERVFGEGYNSTGGFETTKEFVAKMDLKPGQKVLDVGCGIGGGDFYMA  237

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DVHV+GIDLS NMI+ ALERAIGLKC+VEFEVADCT KTYPD +FDVIYSRDT LH+
Sbjct  238   ENFDVHVVGIDLSVNMISFALERAIGLKCSVEFEVADCTTKTYPDNSFDVIYSRDTFLHV  297

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFR F+KWLKPGGK+LITD+C+ +G PS E AAY+++R YDLH  + YG ML++A
Sbjct  298   QDKPALFRKFFKWLKPGGKILITDFCRSAGTPSLEVAAYMERRRYDLHGVQAYGNMLKEA  357

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GFEDVIAEDRTDQF +VL++EL+ V+ EKE +I DFSE DYNDIV  W  KL + +S E 
Sbjct  358   GFEDVIAEDRTDQFAQVLRRELEKVKNEKEEYISDFSEGDYNDIVRVWTAKLRKAASDEL  417

Query  910   RWGL  899
             +WGL
Sbjct  418   KWGL  421



>ref|XP_012088546.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X1 [Jatropha curcas]
Length=538

 Score =   393 bits (1010),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 194/272 (71%), Positives = 218/272 (80%), Gaps = 28/272 (10%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             DTVQYK SGI+RYERVFG G+VSTGG ETTKEFVA+LDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  261   DTVQYKYSGIMRYERVFGHGFVSTGGFETTKEFVARLDLKPGQKVLDVGCGIGGGDFYMA  320

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E YDV V+GIDLS NMI+ AL+RAIGLKCAVEFE+AD TKKTYP+ TFDVIY+RDT+LHI
Sbjct  321   EEYDVEVVGIDLSINMISFALDRAIGLKCAVEFELADITKKTYPNNTFDVIYTRDTMLHI  380

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             +DKPALFRSFYKWLKPGGK LI+DYCK +G PSEEFA YIKQRGY LH+ + Y QML DA
Sbjct  381   KDKPALFRSFYKWLKPGGKFLISDYCKSAGTPSEEFAEYIKQRGYYLHEVKPYVQMLTDA  440

Query  1090  GFEDVIAEDRTD----------------------------QFMKVLKKELDAVEKEKEAF  995
             GF+DVIAEDRTD                            QF +VLK+ELDAVEKEK+ F
Sbjct  441   GFDDVIAEDRTDQVFFKPFITLKDAYIYFVISSQKLILVLQFNRVLKRELDAVEKEKDEF  500

Query  994   IQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  899
             I DFSE+D+NDIV GWK KL R+S+GEQ W L
Sbjct  501   IHDFSEKDFNDIVDGWKAKLIRSSAGEQLWIL  532



>gb|KJB53038.1| hypothetical protein B456_008G289900 [Gossypium raimondii]
Length=480

 Score =   389 bits (998),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 187/244 (77%), Positives = 209/244 (86%), Gaps = 9/244 (4%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             DTVQYK + ILRYER FG G+VSTGG+ETTKEFVAKLDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  240   DTVQYKANSILRYERTFGEGFVSTGGIETTKEFVAKLDLKPGQKVLDVGCGIGGGDFYMA  299

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             + + V+V+GIDLS NMI+ ALERA GL C+VEFEVADCT KTYPD +FDVIYSRDTILHI
Sbjct  300   KEFGVYVVGIDLSINMISFALERANGLNCSVEFEVADCTTKTYPDNSFDVIYSRDTILHI  359

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFR FYKWLKPGGKVLI+DYCK +G  S EFA YIKQRGYDLHD + YGQ     
Sbjct  360   QDKPALFRYFYKWLKPGGKVLISDYCKSAGASSPEFAEYIKQRGYDLHDVKAYGQ-----  414

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
                 VIAEDRTDQF++VL++ELD VEK+K+ FI DFS+EDY+DIVGGWK KL RT SGEQ
Sbjct  415   ----VIAEDRTDQFIQVLQRELDKVEKDKDTFITDFSQEDYDDIVGGWKAKLIRTRSGEQ  470

Query  910   RWGL  899
             RWGL
Sbjct  471   RWGL  474



>gb|AAF79705.1|AC020889_13 T1N15.23 [Arabidopsis thaliana]
Length=374

 Score =   385 bits (988),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 202/303 (67%), Positives = 223/303 (74%), Gaps = 59/303 (19%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGL------------------------------ETT  1541
             D VQYK SGILRYERVFG GYVSTGG                               ETT
Sbjct  66    DNVQYKSSGILRYERVFGEGYVSTGGFGNSILTLLSSYGHTYLYCLSVIFMFLFSLTETT  125

Query  1540  KEFVAKLDLQPGQKVLDVGCGIGGGDFYMAENYDVHVIGIDLSTNMITIALERAIGLKCA  1361
             KEFVAK+DL+PGQKVLDVGCGIGGGDFYMAEN+DVHV+GIDLS NMI+ ALERAIGLKC+
Sbjct  126   KEFVAKMDLKPGQKVLDVGCGIGGGDFYMAENFDVHVVGIDLSVNMISFALERAIGLKCS  185

Query  1360  VEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCKRSG  1181
             VEFEVADCT KTYPD +FDVIYSRDTILHIQDKPALFR+F+KWLKPGGKVLITDYC+ + 
Sbjct  186   VEFEVADCTTKTYPDNSFDVIYSRDTILHIQDKPALFRTFFKWLKPGGKVLITDYCRSAE  245

Query  1180  PPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKE  1001
              PS EFA YIKQRGYDLHD + YGQML+DAGF+DVIAEDRTDQF++VL++EL+ VEKEKE
Sbjct  246   TPSPEFAEYIKQRGYDLHDVQAYGQMLKDAGFDDVIAEDRTDQFVQVLRRELEKVEKEKE  305

Query  1000  AFIQDFSE-----------------------------EDYNDIVGGWKLKLTRTSSGEQR  908
              FI DFSE                             EDYNDIVGGW  KL RT+SGEQ+
Sbjct  306   EFISDFSEVKTFLTTNSFEQNTCLLCSHIDHKILLLQEDYNDIVGGWSAKLERTASGEQK  365

Query  907   WGL  899
             WGL
Sbjct  366   WGL  368



>ref|XP_006303561.1| hypothetical protein CARUB_v10011038mg [Capsella rubella]
 gb|EOA36459.1| hypothetical protein CARUB_v10011038mg [Capsella rubella]
Length=475

 Score =   386 bits (991),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 181/244 (74%), Positives = 208/244 (85%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQY  SGIL YERVFG GY STGG ETTKEFVA +DL+PGQKVLDVGCGIGGGDFYMA
Sbjct  223   DNVQYTSSGILLYERVFGEGYNSTGGFETTKEFVAMMDLKPGQKVLDVGCGIGGGDFYMA  282

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DVHV+GIDLS NMI++ALERAIGLKC+VEFEVADC  KTYPD +FDVIYSRDT LH+
Sbjct  283   ENFDVHVVGIDLSVNMISLALERAIGLKCSVEFEVADCNTKTYPDNSFDVIYSRDTFLHV  342

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALF+ F+KWLKPGGKVLITDYC+ +  PS EF  Y+ +R YDLH  + YG+ML++A
Sbjct  343   QDKPALFKKFFKWLKPGGKVLITDYCRIADTPSLEFQEYMVRRRYDLHGVQAYGKMLKEA  402

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GFEDVIA+DRTDQF++VL++EL  VEKEKE +I DFSEEDYN IV  W  KL +T SGEQ
Sbjct  403   GFEDVIADDRTDQFVQVLRRELAKVEKEKEEYINDFSEEDYNGIVRVWTAKLRKTLSGEQ  462

Query  910   RWGL  899
             +WGL
Sbjct  463   KWGL  466



>gb|ABX10444.1| phosphoethanolamine N-methyltransferase [Gossypium hirsutum]
Length=475

 Score =   385 bits (988),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 179/231 (77%), Positives = 206/231 (89%), Gaps = 0/231 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D+VQYK + ILRYERVFGPGYVSTGG+ET+K+FV KLDL+PGQK LDVGCGIGGGD YMA
Sbjct  244   DSVQYKSNSILRYERVFGPGYVSTGGIETSKDFVGKLDLKPGQKGLDVGCGIGGGDIYMA  303

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E +DVHV+G DLS NMI+ ALERA GLKC+VEFEVADCTKK YPD +FDVIYSRDTILHI
Sbjct  304   EEFDVHVVGNDLSVNMISFALERATGLKCSVEFEVADCTKKVYPDNSFDVIYSRDTILHI  363

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
              DKPALFRSFYKWLKPGGK+LI+DYCK S  PS EFA YIKQRGYDLHD + YGQML DA
Sbjct  364   HDKPALFRSFYKWLKPGGKLLISDYCKSSKTPSREFAEYIKQRGYDLHDVKSYGQMLEDA  423

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLK  938
             GF+ ++AEDRTDQF++VL++EL+ VEKEK+AFI DFS+EDY++IVGGW+ K
Sbjct  424   GFDVILAEDRTDQFLQVLRRELNQVEKEKDAFISDFSKEDYDEIVGGWEGK  474



>ref|XP_001763293.1| predicted protein [Physcomitrella patens]
 gb|EDQ71823.1| predicted protein [Physcomitrella patens]
Length=491

 Score =   379 bits (972),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 176/244 (72%), Positives = 205/244 (84%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             DT QY  +GILRYER+FG G+VSTGG+ETTK FV+ LDL+PGQ+VLDVGCGIGGGDFYMA
Sbjct  241   DTQQYTSTGILRYERIFGEGFVSTGGIETTKAFVSMLDLKPGQRVLDVGCGIGGGDFYMA  300

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E YD  V+GIDLS NMI+ ALER+IG KCAVEFEV DCTK  YP A+FDVIYSRDTILHI
Sbjct  301   EEYDAEVVGIDLSLNMISFALERSIGRKCAVEFEVGDCTKINYPHASFDVIYSRDTILHI  360

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALF+ FYKWLKPGG+VLI+DYC+    PS EFAAYI+QRGYDLH  ++YG+ML DA
Sbjct  361   QDKPALFQRFYKWLKPGGRVLISDYCRAPQTPSAEFAAYIQQRGYDLHSVQKYGEMLEDA  420

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF +V+AEDRTDQF++VL++EL   E  ++ FI DFSEEDYN IV GWK KL R S+ EQ
Sbjct  421   GFVEVVAEDRTDQFIEVLQRELATTEAGRDQFINDFSEEDYNYIVSGWKSKLKRCSNDEQ  480

Query  910   RWGL  899
             +WGL
Sbjct  481   KWGL  484



>ref|XP_002969650.1| hypothetical protein SELMODRAFT_146547 [Selaginella moellendorffii]
 gb|EFJ29738.1| hypothetical protein SELMODRAFT_146547 [Selaginella moellendorffii]
Length=495

 Score =   378 bits (970),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 177/244 (73%), Positives = 202/244 (83%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQY   GILRYER+FG G+VSTGGLETTKEFV  L L+ GQKVLDVGCGIGGGDFYMA
Sbjct  245   DNVQYTQRGILRYERIFGEGFVSTGGLETTKEFVESLKLEAGQKVLDVGCGIGGGDFYMA  304

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E++DV V+GIDLS NM++IALER+IG KC VEFEVADCT+K +P  +FDVIYSRDTILHI
Sbjct  305   EDFDVQVVGIDLSVNMVSIALERSIGRKCFVEFEVADCTEKNFPAESFDVIYSRDTILHI  364

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALF     WLKPGGK+LITDYC+     S EF  YIK+RGYDLHD + YGQMLRDA
Sbjct  365   QDKPALFARLLSWLKPGGKLLITDYCRSKDEVSAEFLEYIKKRGYDLHDVDHYGQMLRDA  424

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF DV+AEDRTDQF+++L KELDAVE+ K++F+QDFSEEDY DIV GWK KL R   G Q
Sbjct  425   GFVDVVAEDRTDQFVRILTKELDAVERNKKSFLQDFSEEDYEDIVHGWKSKLVRCGQGHQ  484

Query  910   RWGL  899
             +WGL
Sbjct  485   KWGL  488



>gb|KDO63824.1| hypothetical protein CISIN_1g043471mg [Citrus sinensis]
Length=485

 Score =   377 bits (969),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 175/218 (80%), Positives = 202/218 (93%), Gaps = 0/218 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK +GILRYERVFG G+VSTGG+ETTKEFVAKLDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  243   DNVQYKLNGILRYERVFGVGFVSTGGIETTKEFVAKLDLKPGQKVLDVGCGIGGGDFYMA  302

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             + +DVHV+GIDLS NMI+ ALERAIGLKC+VEFEVADCTKKTYP+ +FDVIYSRDTILHI
Sbjct  303   DKFDVHVVGIDLSINMISFALERAIGLKCSVEFEVADCTKKTYPENSFDVIYSRDTILHI  362

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALF+SF+KWLKPGG VLI+DYCK  G PS EF+ YIKQRGYDLHD + YGQML+DA
Sbjct  363   QDKPALFKSFFKWLKPGGTVLISDYCKSFGTPSVEFSEYIKQRGYDLHDVKSYGQMLKDA  422

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSE  977
             GF D+IAEDRT+QF++VL++ELDA+EK+K+AFI+DFSE
Sbjct  423   GFVDIIAEDRTEQFVQVLQRELDAIEKDKDAFIKDFSE  460



>gb|KJB30123.1| hypothetical protein B456_005G132000 [Gossypium raimondii]
Length=464

 Score =   376 bits (966),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 175/218 (80%), Positives = 197/218 (90%), Gaps = 0/218 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D+VQYK + ILRYERVFGPGYVSTGG+ETTKEFV KLDL+PGQKVLDVGCGIGGGD YMA
Sbjct  244   DSVQYKSNSILRYERVFGPGYVSTGGIETTKEFVGKLDLKPGQKVLDVGCGIGGGDIYMA  303

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E +DVHV+GIDLS NMI+ ALERA GLKC+VEFEVADCTKK YPD +FDVIYSRDTILHI
Sbjct  304   EEFDVHVVGIDLSVNMISFALERATGLKCSVEFEVADCTKKVYPDNSFDVIYSRDTILHI  363

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
              DKPALFRSFYKWLKPGGK+LI+DYCK S  PS EFAAYIKQRGYDLHD + YGQML DA
Sbjct  364   HDKPALFRSFYKWLKPGGKLLISDYCKSSKTPSTEFAAYIKQRGYDLHDVKSYGQMLEDA  423

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSE  977
             GF+ ++AEDRTDQF++VL++EL+ VEKEK+AFI DFS+
Sbjct  424   GFDVILAEDRTDQFLQVLQRELNQVEKEKDAFISDFSK  461



>ref|XP_002970912.1| hypothetical protein SELMODRAFT_270875 [Selaginella moellendorffii]
 gb|EFJ28238.1| hypothetical protein SELMODRAFT_270875 [Selaginella moellendorffii]
Length=495

 Score =   375 bits (964),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 176/244 (72%), Positives = 201/244 (82%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQY   GILRYER+FG G+VSTGGLETTKEFV  L L+ GQKVLDVGCGIGGGDFYMA
Sbjct  245   DNVQYTQRGILRYERIFGEGFVSTGGLETTKEFVESLKLEAGQKVLDVGCGIGGGDFYMA  304

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E++DV V+GIDLS NM++IALER+IG KC VEFEVADCT+K +P  +FDVIYSRDTILHI
Sbjct  305   EDFDVQVVGIDLSVNMVSIALERSIGRKCFVEFEVADCTEKNFPAESFDVIYSRDTILHI  364

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALF     WLKPGGK+LITDYC+     S EF  YIK+RGYDLHD + YGQMLRDA
Sbjct  365   QDKPALFARLLSWLKPGGKLLITDYCRSRDEVSAEFLEYIKKRGYDLHDVDHYGQMLRDA  424

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF DV+AEDRTDQF+++L KELD VE+ K++F+QDFSEEDY DIV GWK KL R   G Q
Sbjct  425   GFVDVVAEDRTDQFVRILTKELDTVERNKKSFLQDFSEEDYEDIVQGWKSKLVRCGQGHQ  484

Query  910   RWGL  899
             +WGL
Sbjct  485   KWGL  488



>ref|XP_010500398.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Camelina sativa]
Length=474

 Score =   368 bits (944),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 177/244 (73%), Positives = 207/244 (85%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK SGIL YERVFG GY STGG ETTKEFVAK+DL+PGQKVLDVGCGIGGGDFYMA
Sbjct  225   DNVQYKSSGILLYERVFGDGYNSTGGFETTKEFVAKMDLKPGQKVLDVGCGIGGGDFYMA  284

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DVHV+GIDLS NMI+ ALERAIGLKC+VEF+VADCT KTYPD +FDVIYSRDT LH+
Sbjct  285   ENFDVHVVGIDLSVNMISFALERAIGLKCSVEFDVADCTTKTYPDNSFDVIYSRDTFLHV  344

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
              DKP LFR+F+KWLKPGGK+LITD+C+ +G PS E   Y+++R YDLH  + YG ML++A
Sbjct  345   HDKPPLFRTFFKWLKPGGKILITDFCRSAGTPSLEVVEYMERRRYDLHGVQAYGNMLKEA  404

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GFEDVIAEDRTDQF++VL +EL+ V+KEKE +I DFSE DYNDIV  W  KL + +S E 
Sbjct  405   GFEDVIAEDRTDQFIQVLSRELEKVKKEKEEYISDFSEGDYNDIVRVWTAKLRKAASNEL  464

Query  910   RWGL  899
             +WGL
Sbjct  465   KWGL  468



>ref|XP_008675146.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X3 [Zea mays]
Length=483

 Score =   365 bits (938),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 175/244 (72%), Positives = 195/244 (80%), Gaps = 18/244 (7%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK +GILRYER+FG GYVSTGG ETTKEFV KL+L+PGQKVLDVGCGIGGGDFYMA
Sbjct  253   DNVQYKATGILRYERIFGDGYVSTGGAETTKEFVEKLNLKPGQKVLDVGCGIGGGDFYMA  312

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E Y  HV+GIDLS NMI  ALER+IG KC VEFEVADCT KTYPD  FDVIYSRDTILHI
Sbjct  313   EKYGTHVVGIDLSINMIMFALERSIGCKCLVEFEVADCTTKTYPDHMFDVIYSRDTILHI  372

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKP+LF+SF+KWLKPGGKVLI+DYCK  G PSEEFA YIKQRGYDLHD E YG      
Sbjct  373   QDKPSLFKSFFKWLKPGGKVLISDYCKSPGKPSEEFATYIKQRGYDLHDVEAYG------  426

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
                         QF+ VL+KELD  EK K+ F+ +F++EDY+DIV GWK KL R+S+GEQ
Sbjct  427   ------------QFLSVLQKELDKFEKNKDDFLSEFAQEDYDDIVNGWKAKLQRSSAGEQ  474

Query  910   RWGL  899
             RWGL
Sbjct  475   RWGL  478



>gb|EAY75471.1| hypothetical protein OsI_03371 [Oryza sativa Indica Group]
Length=456

 Score =   362 bits (929),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 177/254 (70%), Positives = 199/254 (78%), Gaps = 28/254 (11%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGL----------ETTKEFVAKLDLQPGQKVLDVGC  1481
             D VQYK SGILRYER+FG G+VSTGG+          ETTKEFV +LDL+PGQ VLDVGC
Sbjct  216   DNVQYKASGILRYERIFGEGFVSTGGIVCLFFYLRSPETTKEFVDRLDLKPGQNVLDVGC  275

Query  1480  GIGGGDFYMAENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDV  1301
             GIGGGDFYMA+ YDVHV+GIDLS NM++ ALERAIG KC+VEFEVADCTKKTYPD TFDV
Sbjct  276   GIGGGDFYMADKYDVHVVGIDLSINMVSFALERAIGRKCSVEFEVADCTKKTYPDNTFDV  335

Query  1300  IYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDT  1121
             IYSRDTILHIQDKP+LF+SF+KWLKPGGKVLI+DYCK  G PSEEFAAYIKQRGYDLHD 
Sbjct  336   IYSRDTILHIQDKPSLFKSFFKWLKPGGKVLISDYCKCPGKPSEEFAAYIKQRGYDLHDV  395

Query  1120  EEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKL  941
               YG                  QF+ VL++EL  VEK K  F+ DFS+EDY+ IV GWK 
Sbjct  396   RAYG------------------QFLDVLERELAKVEKNKNEFVSDFSQEDYDAIVNGWKA  437

Query  940   KLTRTSSGEQRWGL  899
             KL R+S+GEQRWGL
Sbjct  438   KLQRSSAGEQRWGL  451



>ref|XP_008799258.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Phoenix dactylifera]
Length=447

 Score =   360 bits (924),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 168/217 (77%), Positives = 194/217 (89%), Gaps = 0/217 (0%)
 Frame = -1

Query  1549  ETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMAENYDVHVIGIDLSTNMITIALERAIGL  1370
             ETTKEF AKL+L+PGQKVLDVGCGIGGGDFYMA+N++V V+GID S NMI+ ALERAIG 
Sbjct  220   ETTKEFAAKLELKPGQKVLDVGCGIGGGDFYMAKNFNVDVVGIDFSINMISFALERAIGC  279

Query  1369  KCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCK  1190
             KC+VEFEVADCTKK YPD TFDVIYSRDTILHIQDKP LFRSF+KWLKPGGK+LITDYCK
Sbjct  280   KCSVEFEVADCTKKIYPDDTFDVIYSRDTILHIQDKPMLFRSFFKWLKPGGKLLITDYCK  339

Query  1189  RSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEK  1010
             RSG PSEEF  YIKQRGYDL+D E Y QML+ AGF +V AEDRT QF++VL++ELDAVEK
Sbjct  340   RSGTPSEEFTEYIKQRGYDLYDVEAYVQMLQGAGFYEVTAEDRTTQFLEVLQRELDAVEK  399

Query  1009  EKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  899
             +++AFI++FS+EDY++IV GWK KL R+S GEQRWGL
Sbjct  400   DRDAFIKEFSKEDYDEIVSGWKAKLKRSSVGEQRWGL  436



>gb|ABK24808.1| unknown [Picea sitchensis]
Length=472

 Score =   357 bits (915),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 169/229 (74%), Positives = 196/229 (86%), Gaps = 3/229 (1%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQY  +GILRYER+FG G+VSTGG+ETTKEFV KL+L+ GQKVLDVGCGIGGGDFYMA
Sbjct  240   DNVQYTLTGILRYERIFGEGFVSTGGIETTKEFVDKLELKAGQKVLDVGCGIGGGDFYMA  299

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             + +DV V+ IDLS NMI+ ALERAIG +CAVEFEV+DCTKK YP+ TFDVIYSRDTILHI
Sbjct  300   DTFDVEVMAIDLSINMISFALERAIGRQCAVEFEVSDCTKKEYPEGTFDVIYSRDTILHI  359

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKP LF+ FYKWLKPGG++LI+DYCK  G  S EF AYIKQRGYDLHD + YGQMLRDA
Sbjct  360   QDKPVLFQKFYKWLKPGGRLLISDYCKEHGTASLEFHAYIKQRGYDLHDVDAYGQMLRDA  419

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYN---DIVG  953
             GF+DV+AEDRTDQF+K+L+KEL + EK+K+AFI+DFSE   N    IVG
Sbjct  420   GFDDVVAEDRTDQFIKILQKELSSAEKDKDAFIRDFSEVSLNSNLSIVG  468



>ref|XP_003534138.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Glycine 
max]
 gb|KHN43631.1| Phosphoethanolamine N-methyltransferase [Glycine soja]
Length=490

 Score =   353 bits (907),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 168/244 (69%), Positives = 200/244 (82%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D+V+Y    IL YE VFG G+VSTGGLETTKEFVAKL L+PGQKVLDVGCG GGGD YMA
Sbjct  241   DSVEYNHKDILLYESVFGQGFVSTGGLETTKEFVAKLGLKPGQKVLDVGCGTGGGDIYMA  300

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DV V+GIDLS N+I++A+ERAIGLKC+VEFE ADCTKKTYP+ TFDVIYSRDT+LHI
Sbjct  301   ENFDVEVVGIDLSINVISLAIERAIGLKCSVEFECADCTKKTYPENTFDVIYSRDTLLHI  360

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             +DKP LFRSFYKWLK GG ++ITDYCK  G PS  +A YIK+ GY +HD + Y QML +A
Sbjct  361   KDKPPLFRSFYKWLKRGGTLIITDYCKSEGSPSLGYAEYIKKGGYHIHDMKTYCQMLENA  420

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF+DV+AEDRT+ FMK L++EL+A+E +K+ FI +FSEEDYN I   WK K  R + GEQ
Sbjct  421   GFDDVVAEDRTNLFMKTLQQELNALESKKDDFIDEFSEEDYNGITERWKAKQMRGADGEQ  480

Query  910   RWGL  899
              WGL
Sbjct  481   IWGL  484



>ref|NP_001056231.2| Os05g0548900 [Oryza sativa Japonica Group]
 dbj|BAF18145.2| Os05g0548900, partial [Oryza sativa Japonica Group]
Length=208

 Score =   343 bits (879),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 158/203 (78%), Positives = 178/203 (88%), Gaps = 0/203 (0%)
 Frame = -1

Query  1507  GQKVLDVGCGIGGGDFYMAENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKK  1328
             GQKVLDVGCGIGGGDFYMAENYD HV+GIDLS NM++ A+ERAIG KC+VEFEVADCT K
Sbjct  1     GQKVLDVGCGIGGGDFYMAENYDAHVLGIDLSINMVSFAIERAIGRKCSVEFEVADCTTK  60

Query  1327  TYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIK  1148
             TY   TFDVIYSRDTILHI DKPALFRSF+KWLKPGGKVLI+DYC+  G PSEEFAAYIK
Sbjct  61    TYAPNTFDVIYSRDTILHIHDKPALFRSFFKWLKPGGKVLISDYCRNPGKPSEEFAAYIK  120

Query  1147  QRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDY  968
             QRGYDLHD + YG+ML DAGF  VIAEDRTDQF++VL++EL  VEK KEAF+ DF++EDY
Sbjct  121   QRGYDLHDVKTYGKMLEDAGFHHVIAEDRTDQFLRVLQRELAEVEKNKEAFMADFTQEDY  180

Query  967   NDIVGGWKLKLTRTSSGEQRWGL  899
             +DIV GW  KL R+S+GEQRWGL
Sbjct  181   DDIVNGWNAKLKRSSAGEQRWGL  203



>ref|XP_003619840.1| Phosphoethanolamine N-methyltransferase [Medicago truncatula]
Length=419

 Score =   349 bits (896),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 168/244 (69%), Positives = 199/244 (82%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D+V+Y    IL YE V+G G+VSTGGLETT+E VAKL L+PGQKVLDVGCGIGGGDFYMA
Sbjct  170   DSVEYNHKDILLYEHVYGHGFVSTGGLETTREIVAKLGLKPGQKVLDVGCGIGGGDFYMA  229

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DV V+ IDLS NMI++A+ERAIGLK AVEFE  DCTKK+YPD TFDVIYSRDT+LHI
Sbjct  230   ENFDVEVVAIDLSINMISLAIERAIGLKYAVEFECVDCTKKSYPDKTFDVIYSRDTLLHI  289

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             +DKP LFRSFYKWLKPGG +LITDYCK  G  S E+A YIK+RGY +HD + Y QML +A
Sbjct  290   KDKPTLFRSFYKWLKPGGTLLITDYCKSVGSLSVEYAEYIKKRGYYIHDMKAYFQMLENA  349

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF+DVIA D+T+ F+K L+ EL+A+E +K  FI DFSE+DYN+IV  WK K  R  +GEQ
Sbjct  350   GFDDVIAVDQTNLFLKTLQMELNALENKKVDFIDDFSEDDYNEIVERWKAKQMRGVAGEQ  409

Query  910   RWGL  899
              WGL
Sbjct  410   IWGL  413



>ref|XP_003619836.1| Phosphoethanolamine N-methyltransferase [Medicago truncatula]
 gb|AES76054.1| phosphoethanolamine N-methyltransferase [Medicago truncatula]
Length=497

 Score =   351 bits (901),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 168/244 (69%), Positives = 199/244 (82%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D+V+Y    IL YE V+G G+VSTGGLETT+E VAKL L+PGQKVLDVGCGIGGGDFYMA
Sbjct  248   DSVEYNHKDILLYEHVYGHGFVSTGGLETTREIVAKLGLKPGQKVLDVGCGIGGGDFYMA  307

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DV V+ IDLS NMI++A+ERAIGLK AVEFE  DCTKK+YPD TFDVIYSRDT+LHI
Sbjct  308   ENFDVEVVAIDLSINMISLAIERAIGLKYAVEFECVDCTKKSYPDKTFDVIYSRDTLLHI  367

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             +DKP LFRSFYKWLKPGG +LITDYCK  G  S E+A YIK+RGY +HD + Y QML +A
Sbjct  368   KDKPTLFRSFYKWLKPGGTLLITDYCKSVGSLSVEYAEYIKKRGYYIHDMKAYFQMLENA  427

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF+DVIA D+T+ F+K L+ EL+A+E +K  FI DFSE+DYN+IV  WK K  R  +GEQ
Sbjct  428   GFDDVIAVDQTNLFLKTLQMELNALENKKVDFIDDFSEDDYNEIVERWKAKQMRGVAGEQ  487

Query  910   RWGL  899
              WGL
Sbjct  488   IWGL  491



>gb|KHN10536.1| Phosphoethanolamine N-methyltransferase [Glycine soja]
Length=466

 Score =   349 bits (895),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 177/244 (73%), Positives = 208/244 (85%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D V+Y    ILRYER++GPG+VSTGGLETTKEFVAKL L+PGQKVLDVGCG+GGGDFYMA
Sbjct  217   DRVEYSHKSILRYERMYGPGFVSTGGLETTKEFVAKLGLKPGQKVLDVGCGVGGGDFYMA  276

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DV VIGIDLS NMI++A+ERAIGL  AVEF+ ADC +KTYP+ TFDVIY+RDT+LH+
Sbjct  277   ENFDVEVIGIDLSINMISLAIERAIGLNYAVEFDCADCYRKTYPENTFDVIYTRDTMLHV  336

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             +DKP LFRSFYKWLKPGGK+LITDYCK +G PS EFA YIK+ GY LHD + Y QML DA
Sbjct  337   KDKPTLFRSFYKWLKPGGKILITDYCKSAGSPSLEFAEYIKKGGYYLHDIKAYRQMLEDA  396

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF+DVIAEDRTDQF+  L++EL+A+E +K+ FI DFSEEDYN+IV  WK K TR +S EQ
Sbjct  397   GFDDVIAEDRTDQFVNTLQQELNALENKKDDFIGDFSEEDYNEIVERWKAKQTRGASREQ  456

Query  910   RWGL  899
              WGL
Sbjct  457   MWGL  460



>ref|XP_003525185.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Glycine 
max]
Length=488

 Score =   349 bits (896),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 177/244 (73%), Positives = 208/244 (85%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D V+Y    ILRYER++GPG+VSTGGLETTKEFVAKL L+PGQKVLDVGCG+GGGDFYMA
Sbjct  239   DRVEYSHKSILRYERMYGPGFVSTGGLETTKEFVAKLGLKPGQKVLDVGCGVGGGDFYMA  298

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DV VIGIDLS NMI++A+ERAIGL  AVEF+ ADC +KTYP+ TFDVIY+RDT+LH+
Sbjct  299   ENFDVEVIGIDLSINMISLAIERAIGLNYAVEFDCADCYRKTYPENTFDVIYTRDTMLHV  358

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             +DKP LFRSFYKWLKPGGK+LITDYCK +G PS EFA YIK+ GY LHD + Y QML DA
Sbjct  359   KDKPTLFRSFYKWLKPGGKILITDYCKSAGSPSLEFAEYIKKGGYYLHDIKAYRQMLEDA  418

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF+DVIAEDRTDQF+  L++EL+A+E +K+ FI DFSEEDYN+IV  WK K TR +S EQ
Sbjct  419   GFDDVIAEDRTDQFVNTLQQELNALENKKDDFIGDFSEEDYNEIVERWKAKQTRGASREQ  478

Query  910   RWGL  899
              WGL
Sbjct  479   MWGL  482



>ref|XP_004512744.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X1 [Cicer arietinum]
Length=497

 Score =   347 bits (891),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 165/244 (68%), Positives = 200/244 (82%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D+V+Y    IL YE+V+G G+VSTGGLETTKEFVAKL L+PGQKVLDVGCG+GGGDFYMA
Sbjct  248   DSVEYNHKDILIYEKVYGQGFVSTGGLETTKEFVAKLGLKPGQKVLDVGCGLGGGDFYMA  307

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DV VI IDLS NMI++A+ERAIGLK AVEFE  DCTKKTYP+ TFDVIY+RDT+LHI
Sbjct  308   ENFDVEVIAIDLSINMISLAIERAIGLKYAVEFECVDCTKKTYPEKTFDVIYTRDTLLHI  367

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             +DKP LFRSFYKWLKPGG +LI+DYCK  G  S E+A YIK+RGY +HD   Y QML +A
Sbjct  368   KDKPTLFRSFYKWLKPGGTLLISDYCKSVGNLSIEYAEYIKKRGYYIHDMNAYCQMLENA  427

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF+ VI +D+T+ F+K L+KEL+++E +K  FI +FSE+DYN+IV  WK K  R  +GEQ
Sbjct  428   GFDYVIDQDQTNLFLKTLQKELNSLENKKVDFINEFSEDDYNEIVERWKAKKMRGEAGEQ  487

Query  910   RWGL  899
              WGL
Sbjct  488   IWGL  491



>ref|XP_004512745.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X2 [Cicer arietinum]
Length=496

 Score =   347 bits (891),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 165/244 (68%), Positives = 200/244 (82%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D+V+Y    IL YE+V+G G+VSTGGLETTKEFVAKL L+PGQKVLDVGCG+GGGDFYMA
Sbjct  247   DSVEYNHKDILIYEKVYGQGFVSTGGLETTKEFVAKLGLKPGQKVLDVGCGLGGGDFYMA  306

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DV VI IDLS NMI++A+ERAIGLK AVEFE  DCTKKTYP+ TFDVIY+RDT+LHI
Sbjct  307   ENFDVEVIAIDLSINMISLAIERAIGLKYAVEFECVDCTKKTYPEKTFDVIYTRDTLLHI  366

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             +DKP LFRSFYKWLKPGG +LI+DYCK  G  S E+A YIK+RGY +HD   Y QML +A
Sbjct  367   KDKPTLFRSFYKWLKPGGTLLISDYCKSVGNLSIEYAEYIKKRGYYIHDMNAYCQMLENA  426

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF+ VI +D+T+ F+K L+KEL+++E +K  FI +FSE+DYN+IV  WK K  R  +GEQ
Sbjct  427   GFDYVIDQDQTNLFLKTLQKELNSLENKKVDFINEFSEDDYNEIVERWKAKKMRGEAGEQ  486

Query  910   RWGL  899
              WGL
Sbjct  487   IWGL  490



>ref|XP_007209941.1| hypothetical protein PRUPE_ppa004742mg [Prunus persica]
 gb|EMJ11140.1| hypothetical protein PRUPE_ppa004742mg [Prunus persica]
Length=463

 Score =   344 bits (883),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 177/193 (92%), Gaps = 0/193 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D VQYK +GILRYERVFG G+VSTGG+ETTKEFVAKLDL+P QKVLDVGCGIGGGDFYMA
Sbjct  242   DNVQYKSNGILRYERVFGQGFVSTGGIETTKEFVAKLDLKPSQKVLDVGCGIGGGDFYMA  301

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
              NYDV V+GIDLS NMI+ ALERAIGLKCAVEFEVADCT+KTY D TFDVIYSRDTILHI
Sbjct  302   SNYDVEVVGIDLSVNMISFALERAIGLKCAVEFEVADCTQKTYADDTFDVIYSRDTILHI  361

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFRSFY+WLKPGGKVLI+DYC+ +G PS EFA YIKQRGYDLH+ + YGQML+DA
Sbjct  362   QDKPALFRSFYRWLKPGGKVLISDYCRSAGTPSAEFAEYIKQRGYDLHNVQAYGQMLKDA  421

Query  1090  GFEDVIAEDRTDQ  1052
             GF++VIAEDRTDQ
Sbjct  422   GFDEVIAEDRTDQ  434



>gb|KJB30119.1| hypothetical protein B456_005G132000 [Gossypium raimondii]
Length=443

 Score =   343 bits (879),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 159/193 (82%), Positives = 174/193 (90%), Gaps = 0/193 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D+VQYK + ILRYERVFGPGYVSTGG+ETTKEFV KLDL+PGQKVLDVGCGIGGGD YMA
Sbjct  244   DSVQYKSNSILRYERVFGPGYVSTGGIETTKEFVGKLDLKPGQKVLDVGCGIGGGDIYMA  303

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E +DVHV+GIDLS NMI+ ALERA GLKC+VEFEVADCTKK YPD +FDVIYSRDTILHI
Sbjct  304   EEFDVHVVGIDLSVNMISFALERATGLKCSVEFEVADCTKKVYPDNSFDVIYSRDTILHI  363

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
              DKPALFRSFYKWLKPGGK+LI+DYCK S  PS EFAAYIKQRGYDLHD + YGQML DA
Sbjct  364   HDKPALFRSFYKWLKPGGKLLISDYCKSSKTPSTEFAAYIKQRGYDLHDVKSYGQMLEDA  423

Query  1090  GFEDVIAEDRTDQ  1052
             GF+ ++AEDRTDQ
Sbjct  424   GFDVILAEDRTDQ  436



>ref|XP_003528975.2| PREDICTED: phosphoethanolamine N-methyltransferase-like [Glycine 
max]
 gb|KHN44632.1| Phosphoethanolamine N-methyltransferase [Glycine soja]
Length=531

 Score =   345 bits (885),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 165/244 (68%), Positives = 197/244 (81%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D+V+Y    IL YE VFG G+VSTGGLETTKEFVAKL L+PGQKVLDVGCG GGGD YMA
Sbjct  283   DSVEYNHKDILLYESVFGQGFVSTGGLETTKEFVAKLGLKPGQKVLDVGCGTGGGDIYMA  342

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DV V+GIDLS N+I++A+ERAIGLKC VEFE ADCTKKT+P  TFDVIYSRDT+LHI
Sbjct  343   ENFDVEVVGIDLSINIISLAIERAIGLKCCVEFECADCTKKTFPVNTFDVIYSRDTLLHI  402

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             +DKP+LFRSFYKWLK GG +LITDYCK  G  S  +A YIK+ GY +HD + Y +ML +A
Sbjct  403   KDKPSLFRSFYKWLKRGGTLLITDYCKSEGSLSLGYAEYIKKGGYYIHDMKTYCRMLENA  462

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF+DV+AEDRT+ FMK L++EL+A+  +K+ FI DFSEEDYN+I   WK K  R + GEQ
Sbjct  463   GFDDVVAEDRTNLFMKTLQQELNALHSKKDDFIDDFSEEDYNEITERWKAKQMRGADGEQ  522

Query  910   RWGL  899
              W L
Sbjct  523   IWSL  526



>ref|XP_007160542.1| hypothetical protein PHAVU_002G330400g [Phaseolus vulgaris]
 gb|ESW32536.1| hypothetical protein PHAVU_002G330400g [Phaseolus vulgaris]
Length=496

 Score =   342 bits (877),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 173/244 (71%), Positives = 208/244 (85%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D V+Y    ILRYE+++GPG+VSTGGLETT+EFVAKL L+PGQKVLDVGCG+GGGDFYMA
Sbjct  247   DRVEYSHKSILRYEQMYGPGFVSTGGLETTEEFVAKLGLKPGQKVLDVGCGVGGGDFYMA  306

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DV V+GIDLS NMI++A+ERAIGL  AVEF+ ADC KK+YPD TFDVIY+RDT+LH+
Sbjct  307   ENFDVEVVGIDLSINMISLAIERAIGLNYAVEFDCADCFKKSYPDNTFDVIYTRDTMLHV  366

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             +DKP LFRSFYK LKPGGK+LITDYCK +  PS EFA YIK+ GY LHD + Y +ML DA
Sbjct  367   KDKPTLFRSFYKGLKPGGKILITDYCKSAQSPSSEFAEYIKKGGYYLHDMKAYEKMLEDA  426

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF+D+IAEDRTDQF+K L+KELDA+E +K+ FI+DFSEEDYN+IV  WK K +R +S EQ
Sbjct  427   GFDDLIAEDRTDQFVKTLQKELDALENKKDDFIRDFSEEDYNEIVERWKAKQSRGASKEQ  486

Query  910   RWGL  899
              WGL
Sbjct  487   MWGL  490



>emb|CAN75113.1| hypothetical protein VITISV_043577 [Vitis vinifera]
Length=431

 Score =   336 bits (862),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 165/220 (75%), Positives = 184/220 (84%), Gaps = 7/220 (3%)
 Frame = -1

Query  1558  GGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMAENYDVHVIGIDLSTNMITIALERA  1379
             G  +TTKEFVAKL+L+PGQKVLDVGCGIGGGDFYMAE+++V V+GIDLS NMI+IAL+RA
Sbjct  211   GFQQTTKEFVAKLELKPGQKVLDVGCGIGGGDFYMAEDFNVEVVGIDLSINMISIALDRA  270

Query  1378  IGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLITD  1199
             IG    VEFEVADCTKKTYPD+TFDVIYSRDTILHIQDKPALFRSF+KWLKPGGKVLI+D
Sbjct  271   IGRNRLVEFEVADCTKKTYPDSTFDVIYSRDTILHIQDKPALFRSFFKWLKPGGKVLISD  330

Query  1198  YCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDA  1019
             YCKRSGPPS EF AYI QRGYDLHD E YGQML+DAGF++VIAEDRTDQ    +   +D 
Sbjct  331   YCKRSGPPSPEFEAYIGQRGYDLHDVEAYGQMLKDAGFDEVIAEDRTDQPXSEVLFNIDI  390

Query  1018  VEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  899
                     I   S+EDY DIVGGWK KL R+S GEQRWGL
Sbjct  391   X-------ILIPSQEDYKDIVGGWKSKLVRSSMGEQRWGL  423



>ref|XP_007152684.1| hypothetical protein PHAVU_004G150500g [Phaseolus vulgaris]
 gb|ESW24678.1| hypothetical protein PHAVU_004G150500g [Phaseolus vulgaris]
Length=497

 Score =   335 bits (859),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 161/244 (66%), Positives = 194/244 (80%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D+V+Y    IL YE VFG G+VSTGGLETTKEFVAKL L+ GQKVLDVGCG GGGD YMA
Sbjct  248   DSVEYNHKDILLYETVFGQGFVSTGGLETTKEFVAKLGLKAGQKVLDVGCGTGGGDIYMA  307

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DV V+GIDLS NMI++A+ER IGLKC+VEFE ADCTKK+YP+ TFDVIYSRDT+LHI
Sbjct  308   ENFDVEVVGIDLSINMISLAIERVIGLKCSVEFECADCTKKSYPENTFDVIYSRDTLLHI  367

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             +DKP+LFRSFYKWLKPGG +LITDYCK  G  S  +A YI++ GY +H+ + Y QML  A
Sbjct  368   KDKPSLFRSFYKWLKPGGTLLITDYCKSVGSLSVGYANYIQKGGYYIHEMKTYSQMLEFA  427

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF DVIA D+++ FMK L++EL+ +E +K+ FI  FS+EDYN I   WK K  R + GEQ
Sbjct  428   GFNDVIAMDQSNLFMKTLQQELNDLESKKDDFIDYFSKEDYNKISERWKAKQMRGADGEQ  487

Query  910   RWGL  899
              WGL
Sbjct  488   IWGL  491



>gb|KJB53041.1| hypothetical protein B456_008G289900 [Gossypium raimondii]
Length=448

 Score =   330 bits (845),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 156/193 (81%), Positives = 171/193 (89%), Gaps = 0/193 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             DTVQYK + ILRYER FG G+VSTGG+ETTKEFVAKLDL+PGQKVLDVGCGIGGGDFYMA
Sbjct  240   DTVQYKANSILRYERTFGEGFVSTGGIETTKEFVAKLDLKPGQKVLDVGCGIGGGDFYMA  299

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             + + V+V+GIDLS NMI+ ALERA GL C+VEFEVADCT KTYPD +FDVIYSRDTILHI
Sbjct  300   KEFGVYVVGIDLSINMISFALERANGLNCSVEFEVADCTTKTYPDNSFDVIYSRDTILHI  359

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALFR FYKWLKPGGKVLI+DYCK +G  S EFA YIKQRGYDLHD + YGQML DA
Sbjct  360   QDKPALFRYFYKWLKPGGKVLISDYCKSAGASSPEFAEYIKQRGYDLHDVKAYGQMLTDA  419

Query  1090  GFEDVIAEDRTDQ  1052
             GF+ VIAEDRTDQ
Sbjct  420   GFDQVIAEDRTDQ  432



>gb|AFK45429.1| unknown [Medicago truncatula]
Length=341

 Score =   320 bits (821),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 163/244 (67%), Positives = 202/244 (83%), Gaps = 1/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D V+Y    ILRYERV+G G++STGGLETTKE VAKL+L+PGQKVLDVGCG+GGGDFYMA
Sbjct  93    DRVEYSEKSILRYERVYGHGFISTGGLETTKELVAKLELKPGQKVLDVGCGVGGGDFYMA  152

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DV V+G+DLS N+I+ A+ERAIGLK  VEF+ ADC+KKTYP+ T+DVIY+RD +L+I
Sbjct  153   ENFDVEVVGVDLSINVISRAIERAIGLKYTVEFDCADCSKKTYPEKTYDVIYTRDAMLYI  212

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             +DKP LFRSF+KWLKPGG++LITDYCK +G PS EFA YIK+ GY +HD +EY QML +A
Sbjct  213   KDKPTLFRSFFKWLKPGGQLLITDYCKSAGSPSSEFAEYIKEGGYYIHDMKEYEQMLENA  272

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF DVI EDRTDQF+K L++EL  +E +K+ FI DFS +DY++IV  WK K  R   GEQ
Sbjct  273   GF-DVIVEDRTDQFVKTLQQELITLESQKDDFISDFSNDDYDEIVERWKAKQIRGERGEQ  331

Query  910   RWGL  899
             +WGL
Sbjct  332   KWGL  335



>ref|XP_004503268.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Cicer 
arietinum]
Length=490

 Score =   322 bits (826),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 163/244 (67%), Positives = 203/244 (83%), Gaps = 0/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D V+Y    ILRYERV+G G++STGGLETTKE VAKL+L+PGQKVLDVGCG+GGGDFYMA
Sbjct  241   DRVEYSEKSILRYERVYGQGFISTGGLETTKELVAKLELKPGQKVLDVGCGVGGGDFYMA  300

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DV V+G+DLS NMI+ A+ERAIGLK  VEF+ ADC+KKTYP+ TFDVIY+RD++L+I
Sbjct  301   ENFDVEVVGVDLSINMISHAIERAIGLKYTVEFDCADCSKKTYPEKTFDVIYTRDSMLYI  360

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             +DK  LFRSFYKWLKPGG++LITDYCK +G PS EFA YIK+ GY +HD +EY QML +A
Sbjct  361   KDKSTLFRSFYKWLKPGGQLLITDYCKCAGSPSSEFAKYIKEGGYHIHDMKEYEQMLENA  420

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF+ V+ EDRTDQF+K L++EL A+E +K+ FI + S++DYN+IV  WK K  R   GEQ
Sbjct  421   GFDVVVVEDRTDQFVKTLEQELIALESKKDDFICELSDDDYNEIVERWKGKQIRGECGEQ  480

Query  910   RWGL  899
             +WGL
Sbjct  481   KWGL  484



>ref|XP_003631125.1| Phosphoethanolamine N-methyltransferase [Medicago truncatula]
 gb|AET05601.1| phosphoethanolamine N-methyltransferase [Medicago truncatula]
Length=488

 Score =   321 bits (823),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 163/244 (67%), Positives = 202/244 (83%), Gaps = 1/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D V+Y    ILRYERV+G G++STGGLETTKE VAKL+L+PGQKVLDVGCG+GGGDFYMA
Sbjct  240   DRVEYSEKSILRYERVYGHGFISTGGLETTKELVAKLELKPGQKVLDVGCGVGGGDFYMA  299

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DV V+G+DLS N+I+ A+ERAIGLK  VEF+ ADC+KKTYP+ T+DVIY+RD +L+I
Sbjct  300   ENFDVEVVGVDLSINVISRAIERAIGLKYTVEFDCADCSKKTYPEKTYDVIYTRDAMLYI  359

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             +DKP LFRSF+KWLKPGG++LITDYCK +G PS EFA YIK+ GY +HD +EY QML +A
Sbjct  360   KDKPTLFRSFFKWLKPGGQLLITDYCKSAGSPSSEFAEYIKEGGYYIHDMKEYEQMLENA  419

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF DVI EDRTDQF+K L++EL  +E +K+ FI DFS +DY++IV  WK K  R   GEQ
Sbjct  420   GF-DVIVEDRTDQFVKTLQQELITLESQKDDFISDFSNDDYDEIVERWKAKQIRGERGEQ  478

Query  910   RWGL  899
             +WGL
Sbjct  479   KWGL  482



>gb|AET05600.2| phosphoethanolamine N-methyltransferase [Medicago truncatula]
Length=494

 Score =   321 bits (822),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 163/244 (67%), Positives = 202/244 (83%), Gaps = 1/244 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D V+Y    ILRYERV+G G++STGGLETTKE VAKL+L+PGQKVLDVGCG+GGGDFYMA
Sbjct  246   DRVEYSEKSILRYERVYGHGFISTGGLETTKELVAKLELKPGQKVLDVGCGVGGGDFYMA  305

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DV V+G+DLS N+I+ A+ERAIGLK  VEF+ ADC+KKTYP+ T+DVIY+RD +L+I
Sbjct  306   ENFDVEVVGVDLSINVISRAIERAIGLKYTVEFDCADCSKKTYPEKTYDVIYTRDAMLYI  365

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             +DKP LFRSF+KWLKPGG++LITDYCK +G PS EFA YIK+ GY +HD +EY QML +A
Sbjct  366   KDKPTLFRSFFKWLKPGGQLLITDYCKSAGSPSSEFAEYIKEGGYYIHDMKEYEQMLENA  425

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF DVI EDRTDQF+K L++EL  +E +K+ FI DFS +DY++IV  WK K  R   GEQ
Sbjct  426   GF-DVIVEDRTDQFVKTLQQELITLESQKDDFISDFSNDDYDEIVERWKAKQIRGERGEQ  484

Query  910   RWGL  899
             +WGL
Sbjct  485   KWGL  488



>ref|XP_010774827.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like [Notothenia 
coriiceps]
Length=438

 Score =   317 bits (813),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 153/245 (62%), Positives = 192/245 (78%), Gaps = 1/245 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D  QY    ILRYE++FG GYVSTGG  TTKEFV  L+L+PGQKVLDVGCGIGGGDFYMA
Sbjct  188   DNQQYSNRSILRYEKMFGAGYVSTGGPSTTKEFVDLLNLKPGQKVLDVGCGIGGGDFYMA  247

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKC-AVEFEVADCTKKTYPDATFDVIYSRDTILH  1274
             +N+ V V+G+DLS NM+  A+ERAI  K  +V+FEVAD TK+++PDA+FDVIYSRDTILH
Sbjct  248   KNFGVEVLGLDLSDNMVDTAMERAITEKLPSVQFEVADATKRSFPDASFDVIYSRDTILH  307

Query  1273  IQDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRD  1094
             I+DK ALF+ F+ WLKPGGK+LI+DYC      +  F AY+KQRGY LH   +YGQ +++
Sbjct  308   IEDKLALFKRFHSWLKPGGKLLISDYCCGEKSWTPAFQAYVKQRGYVLHTPSQYGQFIQE  367

Query  1093  AGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGE  914
             AGF +V +EDRT QF++V+K EL   E  ++ FIQ+FSEEDY  IV GW+ KL R++SG+
Sbjct  368   AGFCNVRSEDRTAQFIQVIKTELQRAELIRDEFIQEFSEEDYLAIVKGWREKLERSNSGD  427

Query  913   QRWGL  899
             QRWGL
Sbjct  428   QRWGL  432



>gb|KJB30121.1| hypothetical protein B456_005G132000 [Gossypium raimondii]
Length=422

 Score =   315 bits (808),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 146/179 (82%), Positives = 160/179 (89%), Gaps = 0/179 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D+VQYK + ILRYERVFGPGYVSTGG+ETTKEFV KLDL+PGQKVLDVGCGIGGGD YMA
Sbjct  244   DSVQYKSNSILRYERVFGPGYVSTGGIETTKEFVGKLDLKPGQKVLDVGCGIGGGDIYMA  303

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E +DVHV+GIDLS NMI+ ALERA GLKC+VEFEVADCTKK YPD +FDVIYSRDTILHI
Sbjct  304   EEFDVHVVGIDLSVNMISFALERATGLKCSVEFEVADCTKKVYPDNSFDVIYSRDTILHI  363

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRD  1094
              DKPALFRSFYKWLKPGGK+LI+DYCK S  PS EFAAYIKQRGYDLHD + YGQ+  +
Sbjct  364   HDKPALFRSFYKWLKPGGKLLISDYCKSSKTPSTEFAAYIKQRGYDLHDVKSYGQVYSN  422



>gb|AAI35513.1| LOC100124841 protein [Xenopus (Silurana) tropicalis]
Length=486

 Score =   317 bits (813),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 153/245 (62%), Positives = 189/245 (77%), Gaps = 1/245 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D  QY   GILRYE++FG G+VSTGGLETTKEF++ L+L+PGQ+V+DVGCGIGGGDFYMA
Sbjct  231   DNQQYSRRGILRYEKIFGEGFVSTGGLETTKEFISMLNLRPGQRVVDVGCGIGGGDFYMA  290

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCA-VEFEVADCTKKTYPDATFDVIYSRDTILH  1274
             + Y V V+G+DLS+NM+ IA+ERAI  K   V+FE+ D TK+++ +A+FDV+YSRDTILH
Sbjct  291   KTYGVEVLGMDLSSNMVEIAMERAIIEKIPLVQFEIGDATKRSFSEASFDVVYSRDTILH  350

Query  1273  IQDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRD  1094
             I DK ALFR FY WLKPGGK+LITDYC    P S  F  Y+KQRGY L+  +EYGQ L  
Sbjct  351   INDKEALFRRFYTWLKPGGKLLITDYCCGERPWSPVFQEYVKQRGYILYTPQEYGQFLEK  410

Query  1093  AGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGE  914
             AGF +V A+DRT+QF+ VL KEL   +  K+ FI+ FSEEDYN I+ GWK K  R S G+
Sbjct  411   AGFVNVQAQDRTEQFVNVLNKELGRTQDIKKEFIESFSEEDYNYIIDGWKEKQHRCSLGD  470

Query  913   QRWGL  899
             QRWGL
Sbjct  471   QRWGL  475


 Score = 62.8 bits (151),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 55/184 (30%), Positives = 84/184 (46%), Gaps = 10/184 (5%)
 Frame = -1

Query  1552  LETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMAENYDVHVIGIDLSTNMITIALERAIG  1373
             LE   E +  L    G  VL++G GIG    ++A+    HV  +D   N I    ++  G
Sbjct  28    LEEKPEIILLLPCLDGHSVLELGAGIGRYTGHLAK-LASHVTAVDFMQNFIEKN-QKDNG  85

Query  1372  LKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKP--ALFRSFYKWLKPGGKVLITD  1199
              +  + F  AD T    P+ +FD I+S    +++ D    AL +    WLKPGG +   +
Sbjct  86    FRGNITFLQADVTNLDLPNESFDFIFSNWLFMYLTDAELLALIQKMLGWLKPGGYLFFRE  145

Query  1198  YC-KRSGPPSEEF--AAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKE  1028
              C  +SG    +F    Y     Y+L  T     +  D+GFE V++  R+ Q    LKK 
Sbjct  146   SCFFQSGDKQRKFNPTVYRTPAQYNLLLTSA-ASVSGDSGFEIVMS--RSVQTYIKLKKN  202

Query  1027  LDAV  1016
              + V
Sbjct  203   QNQV  206



>ref|XP_011608845.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Takifugu rubripes]
Length=491

 Score =   317 bits (812),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 151/245 (62%), Positives = 191/245 (78%), Gaps = 1/245 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D  QY   GILRYE++FG GYVSTGG  TTKEFV  L+L+PGQKVLDVGCGIGGGDFYMA
Sbjct  241   DNQQYTNRGILRYEKMFGAGYVSTGGPSTTKEFVDMLNLKPGQKVLDVGCGIGGGDFYMA  300

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKC-AVEFEVADCTKKTYPDATFDVIYSRDTILH  1274
             + + V VIG+DLS NM+ IA+ERAI  K  +V+FEVAD TK+ +PD +FDVIYSRDTILH
Sbjct  301   KTFGVEVIGLDLSENMVNIAMERAIAEKLPSVQFEVADATKRMFPDCSFDVIYSRDTILH  360

Query  1273  IQDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRD  1094
             I +KPALF+ F+ WLKPGG++LI+DYC    P +  F  Y+KQRGY L+   +YG+ L +
Sbjct  361   IDNKPALFKRFHSWLKPGGQLLISDYCCGEKPWTPVFETYVKQRGYILYTPPQYGKFLTE  420

Query  1093  AGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGE  914
             AGF +V+AEDRT QF++V++ EL+  E  ++ FI++FS+EDY  IV GWK KL R+ SG+
Sbjct  421   AGFCNVLAEDRTAQFIQVIETELERAEAIRKEFIEEFSDEDYLAIVNGWKEKLARSKSGD  480

Query  913   QRWGL  899
             QRWGL
Sbjct  481   QRWGL  485



>ref|NP_001096276.2| phosphoethanolamine methyltransferase [Xenopus (Silurana) tropicalis]
Length=494

 Score =   317 bits (812),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 153/245 (62%), Positives = 189/245 (77%), Gaps = 1/245 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D  QY   GILRYE++FG G+VSTGGLETTKEF++ L+L+PGQ+V+DVGCGIGGGDFYMA
Sbjct  239   DNQQYSRRGILRYEKIFGEGFVSTGGLETTKEFISMLNLRPGQRVVDVGCGIGGGDFYMA  298

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCA-VEFEVADCTKKTYPDATFDVIYSRDTILH  1274
             + Y V V+G+DLS+NM+ IA+ERAI  K   V+FE+ D TK+++ +A+FDV+YSRDTILH
Sbjct  299   KTYGVEVLGMDLSSNMVEIAMERAIIEKIPLVQFEIGDATKRSFSEASFDVVYSRDTILH  358

Query  1273  IQDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRD  1094
             I DK ALFR FY WLKPGGK+LITDYC    P S  F  Y+KQRGY L+  +EYGQ L  
Sbjct  359   INDKEALFRRFYTWLKPGGKLLITDYCCGERPWSPVFQEYVKQRGYILYTPQEYGQFLEK  418

Query  1093  AGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGE  914
             AGF +V A+DRT+QF+ VL KEL   +  K+ FI+ FSEEDYN I+ GWK K  R S G+
Sbjct  419   AGFVNVQAQDRTEQFVNVLNKELGRTQDIKKEFIESFSEEDYNYIIDGWKEKQHRCSLGD  478

Query  913   QRWGL  899
             QRWGL
Sbjct  479   QRWGL  483


 Score = 62.4 bits (150),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 55/184 (30%), Positives = 84/184 (46%), Gaps = 10/184 (5%)
 Frame = -1

Query  1552  LETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMAENYDVHVIGIDLSTNMITIALERAIG  1373
             LE   E +  L    G  VL++G GIG    ++A+    HV  +D   N I    ++  G
Sbjct  36    LEEKPEIILLLPCLDGHSVLELGAGIGRYTGHLAK-LASHVTAVDFMQNFIEKN-QKDNG  93

Query  1372  LKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKP--ALFRSFYKWLKPGGKVLITD  1199
              +  + F  AD T    P+ +FD I+S    +++ D    AL +    WLKPGG +   +
Sbjct  94    FRGNITFLQADVTNLDLPNESFDFIFSNWLFMYLTDAELLALIQKMLGWLKPGGYLFFRE  153

Query  1198  YC-KRSGPPSEEF--AAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKE  1028
              C  +SG    +F    Y     Y+L  T     +  D+GFE V++  R+ Q    LKK 
Sbjct  154   SCFFQSGDKQRKFNPTVYRTPAQYNLLLTSA-ASVSGDSGFEIVMS--RSVQTYIKLKKN  210

Query  1027  LDAV  1016
              + V
Sbjct  211   QNQV  214



>ref|XP_011608844.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Takifugu rubripes]
Length=524

 Score =   318 bits (814),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 151/245 (62%), Positives = 191/245 (78%), Gaps = 1/245 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D  QY   GILRYE++FG GYVSTGG  TTKEFV  L+L+PGQKVLDVGCGIGGGDFYMA
Sbjct  274   DNQQYTNRGILRYEKMFGAGYVSTGGPSTTKEFVDMLNLKPGQKVLDVGCGIGGGDFYMA  333

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKC-AVEFEVADCTKKTYPDATFDVIYSRDTILH  1274
             + + V VIG+DLS NM+ IA+ERAI  K  +V+FEVAD TK+ +PD +FDVIYSRDTILH
Sbjct  334   KTFGVEVIGLDLSENMVNIAMERAIAEKLPSVQFEVADATKRMFPDCSFDVIYSRDTILH  393

Query  1273  IQDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRD  1094
             I +KPALF+ F+ WLKPGG++LI+DYC    P +  F  Y+KQRGY L+   +YG+ L +
Sbjct  394   IDNKPALFKRFHSWLKPGGQLLISDYCCGEKPWTPVFETYVKQRGYILYTPPQYGKFLTE  453

Query  1093  AGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGE  914
             AGF +V+AEDRT QF++V++ EL+  E  ++ FI++FS+EDY  IV GWK KL R+ SG+
Sbjct  454   AGFCNVLAEDRTAQFIQVIETELERAEAIRKEFIEEFSDEDYLAIVNGWKEKLARSKSGD  513

Query  913   QRWGL  899
             QRWGL
Sbjct  514   QRWGL  518



>ref|XP_003631124.1| Phosphoethanolamine N-methyltransferase [Medicago truncatula]
Length=495

 Score =   317 bits (811),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 163/245 (67%), Positives = 202/245 (82%), Gaps = 2/245 (1%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D V+Y    ILRYERV+G G++STGGLETTKE VAKL+L+PGQKVLDVGCG+GGGDFYMA
Sbjct  246   DRVEYSEKSILRYERVYGHGFISTGGLETTKELVAKLELKPGQKVLDVGCGVGGGDFYMA  305

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DV V+G+DLS N+I+ A+ERAIGLK  VEF+ ADC+KKTYP+ T+DVIY+RD +L+I
Sbjct  306   ENFDVEVVGVDLSINVISRAIERAIGLKYTVEFDCADCSKKTYPEKTYDVIYTRDAMLYI  365

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             +DKP LFRSF+KWLKPGG++LITDYCK +G PS EFA YIK+ GY +HD +EY QML +A
Sbjct  366   KDKPTLFRSFFKWLKPGGQLLITDYCKSAGSPSSEFAEYIKEGGYYIHDMKEYEQMLENA  425

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSE-EDYNDIVGGWKLKLTRTSSGE  914
             GF DVI EDRTDQF+K L++EL  +E +K+ FI DFS  +DY++IV  WK K  R   GE
Sbjct  426   GF-DVIVEDRTDQFVKTLQQELITLESQKDDFISDFSNVDDYDEIVERWKAKQIRGERGE  484

Query  913   QRWGL  899
             Q+WGL
Sbjct  485   QKWGL  489



>ref|XP_004073222.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Oryzias 
latipes]
Length=485

 Score =   313 bits (803),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 151/245 (62%), Positives = 190/245 (78%), Gaps = 1/245 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D  QY    ILRYE++FG GYVSTGG  TTKEFV  L+L+PGQKVLDVGCGIGGGDFYMA
Sbjct  235   DNQQYTRRSILRYEKMFGAGYVSTGGPSTTKEFVDLLNLKPGQKVLDVGCGIGGGDFYMA  294

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKC-AVEFEVADCTKKTYPDATFDVIYSRDTILH  1274
             + + V V+G+DLS NM+ IA ERA+  K   V+FEVAD TK+T+P+ +FDV+YSRDTILH
Sbjct  295   KTFGVEVLGLDLSDNMVEIAAERALTEKLPTVQFEVADATKRTFPEGSFDVVYSRDTILH  354

Query  1273  IQDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRD  1094
             I DK ALFR F+ WLKPGG++LI+DYC    P S+ F +Y+KQRGY L+   +YG+ +++
Sbjct  355   IDDKLALFRRFHSWLKPGGQLLISDYCCGEKPWSQAFESYVKQRGYILYTPAQYGKFIQE  414

Query  1093  AGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGE  914
             AGF +V AEDRT QF++V+K EL   E  KE FIQ+FSEEDY  +V GWK KL R+++G+
Sbjct  415   AGFCEVRAEDRTSQFIQVIKDELKKAEAIKEEFIQEFSEEDYLAVVNGWKEKLERSNTGD  474

Query  913   QRWGL  899
             QRWGL
Sbjct  475   QRWGL  479



>ref|NP_001070105.1| phosphoethanolamine methyltransferase [Danio rerio]
 gb|AAI24222.1| Zgc:153034 [Danio rerio]
Length=489

 Score =   313 bits (802),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 149/245 (61%), Positives = 189/245 (77%), Gaps = 1/245 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D  QY   GILRYE++FG G+VSTGGL+TTKEFV  L+L  GQKVLDVGCGIGGGDFYMA
Sbjct  239   DNQQYTRRGILRYEKMFGCGFVSTGGLQTTKEFVDMLNLSAGQKVLDVGCGIGGGDFYMA  298

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCA-VEFEVADCTKKTYPDATFDVIYSRDTILH  1274
             + + V V+G+DLS+NM+ IA+ERA+  K   V+FEV+D TK+ +PDA FDV+YSRDTILH
Sbjct  299   KTFGVEVLGMDLSSNMVEIAMERAVKEKLPLVQFEVSDATKRRFPDAAFDVVYSRDTILH  358

Query  1273  IQDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRD  1094
             I+DK  LF +FY W+KPGGK+LI+DYC    P S  F  Y+KQRGY L+  + YGQ LR+
Sbjct  359   IRDKLHLFTNFYSWMKPGGKLLISDYCCGEKPWSPAFQDYVKQRGYILYTPQRYGQFLRE  418

Query  1093  AGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGE  914
              GF +V AEDRT+QF++V+K EL   E+ K+ FIQ+FS+ED++ IV GW  KL R  +G+
Sbjct  419   VGFSNVRAEDRTEQFIQVIKSELQRAEEMKDEFIQEFSKEDFDAIVSGWTEKLQRCETGD  478

Query  913   QRWGL  899
             QRWGL
Sbjct  479   QRWGL  483


 Score = 54.3 bits (129),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 66/141 (47%), Gaps = 22/141 (16%)
 Frame = -1

Query  1546  TTKEFVAKLDLQPGQK---VLDVGCGIGGGDFYMAENYDVHVIGIDLSTNMITIALERAI  1376
             T  E    LDL P      VL++G GIG         Y  H+IG       +   +E+ +
Sbjct  27    TQHELPEILDLLPALSESCVLELGAGIG--------RYTKHLIGRARHVTAVDF-MEKFV  77

Query  1375  -------GLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDK--PALFRSFYKWLKP  1223
                    G   +VEF  AD TK  +P+ +FD+++S   ++++ D+    L   F +WL+P
Sbjct  78    EKNRQDNGHLGSVEFIQADVTKLDFPEHSFDLVFSNWLLMYLSDQELQLLAEKFLRWLRP  137

Query  1222  GGKVLITDYC-KRSGPPSEEF  1163
             GG +   + C  +SG    +F
Sbjct  138   GGFLFFRESCFHQSGDCKRDF  158



>ref|XP_008324913.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Cynoglossus semilaevis]
Length=491

 Score =   312 bits (800),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 151/245 (62%), Positives = 188/245 (77%), Gaps = 1/245 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D  QY   GIL YER+FG GYVSTGG  TTKEFV  L+L+PGQKVLDVGCGIGGGDFYMA
Sbjct  241   DNQQYTKRGILCYERIFGAGYVSTGGPSTTKEFVDMLNLKPGQKVLDVGCGIGGGDFYMA  300

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKC-AVEFEVADCTKKTYPDATFDVIYSRDTILH  1274
             + + V V+G+DLS NM+ IA+ERA+     +V+FEVAD TK+T+P+ +FDVIYSRDTILH
Sbjct  301   KTFGVKVLGLDLSENMVEIAMERALKENLPSVQFEVADATKRTFPEGSFDVIYSRDTILH  360

Query  1273  IQDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRD  1094
             I DK ALF+ F+ WLKPGGK+LI+DYC    P + EF AY+K+RGY L+   +YG+++ +
Sbjct  361   IDDKLALFQRFHSWLKPGGKLLISDYCCGEKPWNPEFEAYVKKRGYILYTPSQYGKVIEE  420

Query  1093  AGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGE  914
             AGF +V A DRT+QF++VLK EL   +  K  FIQ+FSEEDY  IV GW  KL R++SG 
Sbjct  421   AGFRNVQATDRTEQFIQVLKTELQRAQAMKTQFIQEFSEEDYFAIVNGWSDKLKRSNSGA  480

Query  913   QRWGL  899
             QRWGL
Sbjct  481   QRWGL  485


 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 58/190 (31%), Positives = 86/190 (45%), Gaps = 31/190 (16%)
 Frame = -1

Query  1546  TTKEFVAKLDLQP---GQKVLDVGCGIGGGDFYMAE--NYDVHVIGIDLSTNMITIALER  1382
             T +E    L L P   G KVL++G GIG    Y ++      HV  +D   + I    E 
Sbjct  34    TQQEMPEILSLLPRLTGYKVLELGAGIGR---YTSQLLTKAAHVTAVDFMESFIEKNRE-  89

Query  1381  AIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDK--PALFRSFYKWLKPGGKVL  1208
               G    V F  AD TK   P  + D I+S   ++++ D     L +    WL+PGG + 
Sbjct  90    VNGHHKNVTFLHADVTKLEIPKTSLDFIFSNWLLMYLSDDEIQPLMKKMLSWLRPGGFLF  149

Query  1207  ITDYCK-RSGPPSEEFAAYIKQRGYD--LHDTEE-YGQMLRDAGFEDVIAEDRTDQ---F  1049
               + C  RSG          K+R +D  ++ +E+ Y Q++     E    E+ TDQ   F
Sbjct  150   FRESCNHRSGD---------KKRNFDPTIYRSEDWYSQLVTSVHME----ENNTDQKFGF  196

Query  1048  MKVLKKELDA  1019
               VLKK++ A
Sbjct  197   DIVLKKKVYA  206



>ref|XP_008324912.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Cynoglossus semilaevis]
Length=495

 Score =   312 bits (800),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 151/249 (61%), Positives = 188/249 (76%), Gaps = 5/249 (2%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D  QY   GIL YER+FG GYVSTGG  TTKEFV  L+L+PGQKVLDVGCGIGGGDFYMA
Sbjct  241   DNQQYTKRGILCYERIFGAGYVSTGGPSTTKEFVDMLNLKPGQKVLDVGCGIGGGDFYMA  300

Query  1450  ENYDVHVIGIDLSTNMITIALERAI-----GLKCAVEFEVADCTKKTYPDATFDVIYSRD  1286
             + + V V+G+DLS NM+ IA+ERA+      +   V+FEVAD TK+T+P+ +FDVIYSRD
Sbjct  301   KTFGVKVLGLDLSENMVEIAMERALKENLPSVHLNVQFEVADATKRTFPEGSFDVIYSRD  360

Query  1285  TILHIQDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQ  1106
             TILHI DK ALF+ F+ WLKPGGK+LI+DYC    P + EF AY+K+RGY L+   +YG+
Sbjct  361   TILHIDDKLALFQRFHSWLKPGGKLLISDYCCGEKPWNPEFEAYVKKRGYILYTPSQYGK  420

Query  1105  MLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRT  926
             ++ +AGF +V A DRT+QF++VLK EL   +  K  FIQ+FSEEDY  IV GW  KL R+
Sbjct  421   VIEEAGFRNVQATDRTEQFIQVLKTELQRAQAMKTQFIQEFSEEDYFAIVNGWSDKLKRS  480

Query  925   SSGEQRWGL  899
             +SG QRWGL
Sbjct  481   NSGAQRWGL  489


 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 58/190 (31%), Positives = 86/190 (45%), Gaps = 31/190 (16%)
 Frame = -1

Query  1546  TTKEFVAKLDLQP---GQKVLDVGCGIGGGDFYMAE--NYDVHVIGIDLSTNMITIALER  1382
             T +E    L L P   G KVL++G GIG    Y ++      HV  +D   + I    E 
Sbjct  34    TQQEMPEILSLLPRLTGYKVLELGAGIGR---YTSQLLTKAAHVTAVDFMESFIEKNRE-  89

Query  1381  AIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDK--PALFRSFYKWLKPGGKVL  1208
               G    V F  AD TK   P  + D I+S   ++++ D     L +    WL+PGG + 
Sbjct  90    VNGHHKNVTFLHADVTKLEIPKTSLDFIFSNWLLMYLSDDEIQPLMKKMLSWLRPGGFLF  149

Query  1207  ITDYCK-RSGPPSEEFAAYIKQRGYD--LHDTEE-YGQMLRDAGFEDVIAEDRTDQ---F  1049
               + C  RSG          K+R +D  ++ +E+ Y Q++     E    E+ TDQ   F
Sbjct  150   FRESCNHRSGD---------KKRNFDPTIYRSEDWYSQLVTSVHME----ENNTDQKFGF  196

Query  1048  MKVLKKELDA  1019
               VLKK++ A
Sbjct  197   DIVLKKKVYA  206



>ref|XP_008324914.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X3 [Cynoglossus semilaevis]
 ref|XP_008324916.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X3 [Cynoglossus semilaevis]
 ref|XP_008324917.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X3 [Cynoglossus semilaevis]
Length=488

 Score =   311 bits (798),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 151/249 (61%), Positives = 188/249 (76%), Gaps = 5/249 (2%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D  QY   GIL YER+FG GYVSTGG  TTKEFV  L+L+PGQKVLDVGCGIGGGDFYMA
Sbjct  234   DNQQYTKRGILCYERIFGAGYVSTGGPSTTKEFVDMLNLKPGQKVLDVGCGIGGGDFYMA  293

Query  1450  ENYDVHVIGIDLSTNMITIALERAI-----GLKCAVEFEVADCTKKTYPDATFDVIYSRD  1286
             + + V V+G+DLS NM+ IA+ERA+      +   V+FEVAD TK+T+P+ +FDVIYSRD
Sbjct  294   KTFGVKVLGLDLSENMVEIAMERALKENLPSVHLNVQFEVADATKRTFPEGSFDVIYSRD  353

Query  1285  TILHIQDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQ  1106
             TILHI DK ALF+ F+ WLKPGGK+LI+DYC    P + EF AY+K+RGY L+   +YG+
Sbjct  354   TILHIDDKLALFQRFHSWLKPGGKLLISDYCCGEKPWNPEFEAYVKKRGYILYTPSQYGK  413

Query  1105  MLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRT  926
             ++ +AGF +V A DRT+QF++VLK EL   +  K  FIQ+FSEEDY  IV GW  KL R+
Sbjct  414   VIEEAGFRNVQATDRTEQFIQVLKTELQRAQAMKTQFIQEFSEEDYFAIVNGWSDKLKRS  473

Query  925   SSGEQRWGL  899
             +SG QRWGL
Sbjct  474   NSGAQRWGL  482


 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 58/190 (31%), Positives = 86/190 (45%), Gaps = 31/190 (16%)
 Frame = -1

Query  1546  TTKEFVAKLDLQP---GQKVLDVGCGIGGGDFYMAE--NYDVHVIGIDLSTNMITIALER  1382
             T +E    L L P   G KVL++G GIG    Y ++      HV  +D   + I    E 
Sbjct  27    TQQEMPEILSLLPRLTGYKVLELGAGIGR---YTSQLLTKAAHVTAVDFMESFIEKNRE-  82

Query  1381  AIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDK--PALFRSFYKWLKPGGKVL  1208
               G    V F  AD TK   P  + D I+S   ++++ D     L +    WL+PGG + 
Sbjct  83    VNGHHKNVTFLHADVTKLEIPKTSLDFIFSNWLLMYLSDDEIQPLMKKMLSWLRPGGFLF  142

Query  1207  ITDYCK-RSGPPSEEFAAYIKQRGYD--LHDTEE-YGQMLRDAGFEDVIAEDRTDQ---F  1049
               + C  RSG          K+R +D  ++ +E+ Y Q++     E    E+ TDQ   F
Sbjct  143   FRESCNHRSGD---------KKRNFDPTIYRSEDWYSQLVTSVHME----ENNTDQKFGF  189

Query  1048  MKVLKKELDA  1019
               VLKK++ A
Sbjct  190   DIVLKKKVYA  199



>ref|XP_004545582.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Maylandia zebra]
Length=491

 Score =   311 bits (797),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 152/245 (62%), Positives = 189/245 (77%), Gaps = 1/245 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D  QY   GILRYE++FG GYVSTGG  TTKEFV  L+L+PGQKVLDVGCGIGGGDFYMA
Sbjct  241   DNQQYTKRGILRYEKMFGAGYVSTGGPSTTKEFVDLLNLKPGQKVLDVGCGIGGGDFYMA  300

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKC-AVEFEVADCTKKTYPDATFDVIYSRDTILH  1274
             + + V V+G+DLS NM+ IA+ERA      +V FEVAD TK+T+P+ +FDVIYSRDTILH
Sbjct  301   KAFGVEVLGLDLSDNMVDIAIERAKAENVPSVRFEVADATKRTFPEDSFDVIYSRDTILH  360

Query  1273  IQDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRD  1094
             I DK ALF+ F+ WLKPGG++LI+DYC    P +  F AY+KQRGY L+   EYG+ +++
Sbjct  361   IDDKLALFKRFHSWLKPGGQLLISDYCCGKKPWTPAFEAYVKQRGYVLYTPSEYGKFIQE  420

Query  1093  AGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGE  914
             AGF  V AEDRT QF++V+K EL   E  K+ FI++FSEEDY +IV GWK KL R++SG+
Sbjct  421   AGFSKVRAEDRTAQFIEVIKTELQRAEVIKDEFIKEFSEEDYFEIVNGWKEKLERSNSGD  480

Query  913   QRWGL  899
             QRWGL
Sbjct  481   QRWGL  485



>ref|XP_005643867.1| S-adenosyl-L-methionine-dependent methyltransferase [Coccomyxa 
subellipsoidea C-169]
 gb|EIE19323.1| S-adenosyl-L-methionine-dependent methyltransferase [Coccomyxa 
subellipsoidea C-169]
Length=498

 Score =   311 bits (797),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 149/244 (61%), Positives = 182/244 (75%), Gaps = 3/244 (1%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             DT QY  +GI RYER+FGPG+VSTGGLETTKEFV  L L+P ++VLDVGCGIGGGDFYMA
Sbjct  251   DTQQYSSNGIARYERIFGPGFVSTGGLETTKEFVDMLGLKPDERVLDVGCGIGGGDFYMA  310

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
               +   V G+DLS NM+T ALER +    +V FE+AD T       ++DV+YSRDTILHI
Sbjct  311   AKFGAFVHGVDLSVNMVTTALERTVS---SVSFEIADITTCEMAKESYDVVYSRDTILHI  367

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
              DKPALF+ F   LKPGG++LI+DYC+  G PS++FAAYI QRGYDLH  ++YG+ML  A
Sbjct  368   HDKPALFKRFLDVLKPGGRLLISDYCRAPGSPSDKFAAYIAQRGYDLHSVDDYGRMLTKA  427

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQ  911
             GF DV AEDRT QF   LKKE++A E  +E F++DFS  D++ IV GW+ KL R   GEQ
Sbjct  428   GFVDVKAEDRTWQFEACLKKEVEAAEAGREEFVRDFSAADHDAIVSGWRDKLVRVGEGEQ  487

Query  910   RWGL  899
             RWGL
Sbjct  488   RWGL  491



>ref|XP_004545581.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Maylandia zebra]
Length=492

 Score =   311 bits (797),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 152/245 (62%), Positives = 189/245 (77%), Gaps = 1/245 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D  QY   GILRYE++FG GYVSTGG  TTKEFV  L+L+PGQKVLDVGCGIGGGDFYMA
Sbjct  242   DNQQYTKRGILRYEKMFGAGYVSTGGPSTTKEFVDLLNLKPGQKVLDVGCGIGGGDFYMA  301

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKC-AVEFEVADCTKKTYPDATFDVIYSRDTILH  1274
             + + V V+G+DLS NM+ IA+ERA      +V FEVAD TK+T+P+ +FDVIYSRDTILH
Sbjct  302   KAFGVEVLGLDLSDNMVDIAIERAKAENVPSVRFEVADATKRTFPEDSFDVIYSRDTILH  361

Query  1273  IQDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRD  1094
             I DK ALF+ F+ WLKPGG++LI+DYC    P +  F AY+KQRGY L+   EYG+ +++
Sbjct  362   IDDKLALFKRFHSWLKPGGQLLISDYCCGKKPWTPAFEAYVKQRGYVLYTPSEYGKFIQE  421

Query  1093  AGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGE  914
             AGF  V AEDRT QF++V+K EL   E  K+ FI++FSEEDY +IV GWK KL R++SG+
Sbjct  422   AGFSKVRAEDRTAQFIEVIKTELQRAEVIKDEFIKEFSEEDYFEIVNGWKEKLERSNSGD  481

Query  913   QRWGL  899
             QRWGL
Sbjct  482   QRWGL  486



>ref|XP_005723169.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X3 [Pundamilia nyererei]
Length=485

 Score =   311 bits (796),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 152/245 (62%), Positives = 188/245 (77%), Gaps = 1/245 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D  QY   GILRYE++FG GYVSTGG  TTKEFV  L+L+PGQKVLDVGCGIGGGDFYMA
Sbjct  235   DNQQYTKRGILRYEKMFGAGYVSTGGPSTTKEFVDLLNLKPGQKVLDVGCGIGGGDFYMA  294

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKC-AVEFEVADCTKKTYPDATFDVIYSRDTILH  1274
             + + V V+G+DLS NM+ IA+ERA      +V FEVAD TK+T+P+ +FDVIYSRDTILH
Sbjct  295   KAFGVEVLGLDLSDNMVDIAIERAKAENVPSVRFEVADATKRTFPEDSFDVIYSRDTILH  354

Query  1273  IQDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRD  1094
             I DK ALF+ F+ WLKPGG++LI+DYC    P +  F AY+KQRGY L+   EYG+ +++
Sbjct  355   IDDKLALFKRFHSWLKPGGQLLISDYCCGKKPWTPAFEAYVKQRGYVLYTPSEYGKFIQE  414

Query  1093  AGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGE  914
             AGF  V AEDRT QF++V+K EL   E  K+ FI++FSEEDY  IV GWK KL R++SG+
Sbjct  415   AGFSKVRAEDRTAQFIEVIKTELQRAEAIKDEFIKEFSEEDYFAIVNGWKEKLERSNSGD  474

Query  913   QRWGL  899
             QRWGL
Sbjct  475   QRWGL  479



>ref|XP_005723168.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Pundamilia nyererei]
Length=491

 Score =   311 bits (796),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 152/245 (62%), Positives = 188/245 (77%), Gaps = 1/245 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D  QY   GILRYE++FG GYVSTGG  TTKEFV  L+L+PGQKVLDVGCGIGGGDFYMA
Sbjct  241   DNQQYTKRGILRYEKMFGAGYVSTGGPSTTKEFVDLLNLKPGQKVLDVGCGIGGGDFYMA  300

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKC-AVEFEVADCTKKTYPDATFDVIYSRDTILH  1274
             + + V V+G+DLS NM+ IA+ERA      +V FEVAD TK+T+P+ +FDVIYSRDTILH
Sbjct  301   KAFGVEVLGLDLSDNMVDIAIERAKAENVPSVRFEVADATKRTFPEDSFDVIYSRDTILH  360

Query  1273  IQDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRD  1094
             I DK ALF+ F+ WLKPGG++LI+DYC    P +  F AY+KQRGY L+   EYG+ +++
Sbjct  361   IDDKLALFKRFHSWLKPGGQLLISDYCCGKKPWTPAFEAYVKQRGYVLYTPSEYGKFIQE  420

Query  1093  AGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGE  914
             AGF  V AEDRT QF++V+K EL   E  K+ FI++FSEEDY  IV GWK KL R++SG+
Sbjct  421   AGFSKVRAEDRTAQFIEVIKTELQRAEAIKDEFIKEFSEEDYFAIVNGWKEKLERSNSGD  480

Query  913   QRWGL  899
             QRWGL
Sbjct  481   QRWGL  485



>ref|XP_005723167.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Pundamilia nyererei]
Length=492

 Score =   311 bits (796),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 152/245 (62%), Positives = 188/245 (77%), Gaps = 1/245 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D  QY   GILRYE++FG GYVSTGG  TTKEFV  L+L+PGQKVLDVGCGIGGGDFYMA
Sbjct  242   DNQQYTKRGILRYEKMFGAGYVSTGGPSTTKEFVDLLNLKPGQKVLDVGCGIGGGDFYMA  301

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKC-AVEFEVADCTKKTYPDATFDVIYSRDTILH  1274
             + + V V+G+DLS NM+ IA+ERA      +V FEVAD TK+T+P+ +FDVIYSRDTILH
Sbjct  302   KAFGVEVLGLDLSDNMVDIAIERAKAENVPSVRFEVADATKRTFPEDSFDVIYSRDTILH  361

Query  1273  IQDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRD  1094
             I DK ALF+ F+ WLKPGG++LI+DYC    P +  F AY+KQRGY L+   EYG+ +++
Sbjct  362   IDDKLALFKRFHSWLKPGGQLLISDYCCGKKPWTPAFEAYVKQRGYVLYTPSEYGKFIQE  421

Query  1093  AGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGE  914
             AGF  V AEDRT QF++V+K EL   E  K+ FI++FSEEDY  IV GWK KL R++SG+
Sbjct  422   AGFSKVRAEDRTAQFIEVIKTELQRAEAIKDEFIKEFSEEDYFAIVNGWKEKLERSNSGD  481

Query  913   QRWGL  899
             QRWGL
Sbjct  482   QRWGL  486



>ref|XP_005467627.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Oreochromis niloticus]
 ref|XP_005467628.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X3 [Oreochromis niloticus]
Length=492

 Score =   310 bits (795),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 152/245 (62%), Positives = 189/245 (77%), Gaps = 1/245 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D  QY   GILRYE++FG GYVSTGG  TTKEFV  L+L+PGQKVLDVGCGIGGGDFYMA
Sbjct  242   DNQQYTKRGILRYEKMFGAGYVSTGGPSTTKEFVDLLNLKPGQKVLDVGCGIGGGDFYMA  301

Query  1450  ENYDVHVIGIDLSTNMITIALERA-IGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILH  1274
             + + V V+G+DLS NM+ IA+ERA +    +V FEVAD TK+T+P+ +FDVIYSRDTILH
Sbjct  302   KAFGVEVLGLDLSDNMVDIAIERAKVENVPSVRFEVADATKRTFPEDSFDVIYSRDTILH  361

Query  1273  IQDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRD  1094
             I DK ALF+ F+ WLKPGG++LI+DYC    P +  F AY+KQRGY L+   EYG+ +++
Sbjct  362   IDDKLALFKRFHSWLKPGGQLLISDYCCGKKPWTPAFEAYVKQRGYVLYTPSEYGKFIQE  421

Query  1093  AGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGE  914
             AGF  V AEDRT QF++V+K EL   E  K+ FI++FSEEDY  IV GWK KL R++SG+
Sbjct  422   AGFSKVRAEDRTAQFIEVIKTELQRAEAIKDEFIKEFSEEDYFAIVNGWKEKLERSTSGD  481

Query  913   QRWGL  899
             QRWGL
Sbjct  482   QRWGL  486



>ref|XP_005467629.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X4 [Oreochromis niloticus]
Length=485

 Score =   310 bits (795),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 152/245 (62%), Positives = 189/245 (77%), Gaps = 1/245 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D  QY   GILRYE++FG GYVSTGG  TTKEFV  L+L+PGQKVLDVGCGIGGGDFYMA
Sbjct  235   DNQQYTKRGILRYEKMFGAGYVSTGGPSTTKEFVDLLNLKPGQKVLDVGCGIGGGDFYMA  294

Query  1450  ENYDVHVIGIDLSTNMITIALERA-IGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILH  1274
             + + V V+G+DLS NM+ IA+ERA +    +V FEVAD TK+T+P+ +FDVIYSRDTILH
Sbjct  295   KAFGVEVLGLDLSDNMVDIAIERAKVENVPSVRFEVADATKRTFPEDSFDVIYSRDTILH  354

Query  1273  IQDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRD  1094
             I DK ALF+ F+ WLKPGG++LI+DYC    P +  F AY+KQRGY L+   EYG+ +++
Sbjct  355   IDDKLALFKRFHSWLKPGGQLLISDYCCGKKPWTPAFEAYVKQRGYVLYTPSEYGKFIQE  414

Query  1093  AGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGE  914
             AGF  V AEDRT QF++V+K EL   E  K+ FI++FSEEDY  IV GWK KL R++SG+
Sbjct  415   AGFSKVRAEDRTAQFIEVIKTELQRAEAIKDEFIKEFSEEDYFAIVNGWKEKLERSTSGD  474

Query  913   QRWGL  899
             QRWGL
Sbjct  475   QRWGL  479



>ref|XP_003444639.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Oreochromis niloticus]
Length=493

 Score =   310 bits (795),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 152/245 (62%), Positives = 189/245 (77%), Gaps = 1/245 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D  QY   GILRYE++FG GYVSTGG  TTKEFV  L+L+PGQKVLDVGCGIGGGDFYMA
Sbjct  243   DNQQYTKRGILRYEKMFGAGYVSTGGPSTTKEFVDLLNLKPGQKVLDVGCGIGGGDFYMA  302

Query  1450  ENYDVHVIGIDLSTNMITIALERA-IGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILH  1274
             + + V V+G+DLS NM+ IA+ERA +    +V FEVAD TK+T+P+ +FDVIYSRDTILH
Sbjct  303   KAFGVEVLGLDLSDNMVDIAIERAKVENVPSVRFEVADATKRTFPEDSFDVIYSRDTILH  362

Query  1273  IQDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRD  1094
             I DK ALF+ F+ WLKPGG++LI+DYC    P +  F AY+KQRGY L+   EYG+ +++
Sbjct  363   IDDKLALFKRFHSWLKPGGQLLISDYCCGKKPWTPAFEAYVKQRGYVLYTPSEYGKFIQE  422

Query  1093  AGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGE  914
             AGF  V AEDRT QF++V+K EL   E  K+ FI++FSEEDY  IV GWK KL R++SG+
Sbjct  423   AGFSKVRAEDRTAQFIEVIKTELQRAEAIKDEFIKEFSEEDYFAIVNGWKEKLERSTSGD  482

Query  913   QRWGL  899
             QRWGL
Sbjct  483   QRWGL  487



>ref|XP_005913450.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Haplochromis burtoni]
Length=492

 Score =   310 bits (794),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 152/245 (62%), Positives = 189/245 (77%), Gaps = 1/245 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D  QY   GILRYE++FG GYVSTGG  TTKEFV  L+L+PGQKVLDVGCGIGGGDFYMA
Sbjct  242   DNQQYTKRGILRYEKMFGAGYVSTGGPSTTKEFVDLLNLKPGQKVLDVGCGIGGGDFYMA  301

Query  1450  ENYDVHVIGIDLSTNMITIALERA-IGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILH  1274
             + + V V+G+DLS NM+ IA+ERA +    +V FEVAD TK+T+P+ +FDVIYSRDTILH
Sbjct  302   KAFGVEVLGLDLSDNMVDIAIERAKVENVPSVRFEVADATKRTFPEDSFDVIYSRDTILH  361

Query  1273  IQDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRD  1094
             I DK ALF+ F+ WLKPGG++LI+DYC    P +  F AY+KQRGY L+   EYG+ +++
Sbjct  362   IDDKLALFKRFHSWLKPGGQLLISDYCCGKKPWTPAFEAYVKQRGYVLYTPSEYGKFIQE  421

Query  1093  AGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGE  914
             AGF  V AEDRT QF++V+K EL   E  K+ FI++FSEEDY  IV GWK KL R++SG+
Sbjct  422   AGFSKVRAEDRTAQFIEVIKTELQRAEAIKDEFIKEFSEEDYFAIVNGWKEKLERSNSGD  481

Query  913   QRWGL  899
             QRWGL
Sbjct  482   QRWGL  486



>ref|XP_005913451.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Haplochromis burtoni]
Length=485

 Score =   310 bits (794),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 152/245 (62%), Positives = 189/245 (77%), Gaps = 1/245 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D  QY   GILRYE++FG GYVSTGG  TTKEFV  L+L+PGQKVLDVGCGIGGGDFYMA
Sbjct  235   DNQQYTKRGILRYEKMFGAGYVSTGGPSTTKEFVDLLNLKPGQKVLDVGCGIGGGDFYMA  294

Query  1450  ENYDVHVIGIDLSTNMITIALERA-IGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILH  1274
             + + V V+G+DLS NM+ IA+ERA +    +V FEVAD TK+T+P+ +FDVIYSRDTILH
Sbjct  295   KAFGVEVLGLDLSDNMVDIAIERAKVENVPSVRFEVADATKRTFPEDSFDVIYSRDTILH  354

Query  1273  IQDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRD  1094
             I DK ALF+ F+ WLKPGG++LI+DYC    P +  F AY+KQRGY L+   EYG+ +++
Sbjct  355   IDDKLALFKRFHSWLKPGGQLLISDYCCGKKPWTPAFEAYVKQRGYVLYTPSEYGKFIQE  414

Query  1093  AGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGE  914
             AGF  V AEDRT QF++V+K EL   E  K+ FI++FSEEDY  IV GWK KL R++SG+
Sbjct  415   AGFSKVRAEDRTAQFIEVIKTELQRAEAIKDEFIKEFSEEDYFAIVNGWKEKLERSNSGD  474

Query  913   QRWGL  899
             QRWGL
Sbjct  475   QRWGL  479



>ref|XP_008278560.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Stegastes partitus]
 ref|XP_008278561.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Stegastes partitus]
Length=492

 Score =   309 bits (792),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 148/245 (60%), Positives = 190/245 (78%), Gaps = 1/245 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D  QY   GILRYE++FG GYVSTGG  TTKEFV  L+L+PGQKVLDVGCGIGGGDFYMA
Sbjct  242   DNQQYTRRGILRYEKMFGAGYVSTGGSSTTKEFVDLLNLKPGQKVLDVGCGIGGGDFYMA  301

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLK-CAVEFEVADCTKKTYPDATFDVIYSRDTILH  1274
             + + V V+G+DLS NM+ IA+ERAI  K  +V+FEV+D TK+ +P+ +FDVIYSRDTILH
Sbjct  302   KTFGVEVLGMDLSDNMVDIAMERAIAEKLTSVQFEVSDATKRMFPEGSFDVIYSRDTILH  361

Query  1273  IQDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRD  1094
             I DK ALF+ F+ WLKPGG++LI+DYC    P +  F AY+KQRGY L+   +YG+ +++
Sbjct  362   IDDKLALFKRFHSWLKPGGQLLISDYCCGEKPWTPAFEAYVKQRGYVLYTPTQYGKFIQE  421

Query  1093  AGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGE  914
             AGF +V A+DRT  F++V+K EL   E  K+ +I++FSEEDY  IV GWK KL R++SG+
Sbjct  422   AGFSNVRADDRTGHFIQVIKTELQRAEAIKDDYIKEFSEEDYFAIVNGWKEKLERSNSGD  481

Query  913   QRWGL  899
             QRWGL
Sbjct  482   QRWGL  486



>ref|XP_006781399.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like [Neolamprologus 
brichardi]
Length=492

 Score =   309 bits (792),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 151/245 (62%), Positives = 189/245 (77%), Gaps = 1/245 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D  QY   GILRYE++FG GYVSTGG  TTKEFV  L+L+PGQKVLDVGCGIGGGDFYMA
Sbjct  242   DNQQYTKRGILRYEKMFGAGYVSTGGPSTTKEFVDLLNLKPGQKVLDVGCGIGGGDFYMA  301

Query  1450  ENYDVHVIGIDLSTNMITIALERA-IGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILH  1274
             + + V V+G+DLS NM+ IA+ERA +    +V FEVAD TK+T+P+ +FDVIYSRDTILH
Sbjct  302   KAFGVEVLGLDLSDNMVDIAIERAKVENVPSVRFEVADATKRTFPEDSFDVIYSRDTILH  361

Query  1273  IQDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRD  1094
             I DK ALF+ F+ WLKPGG++LI+DYC    P +  F AY+KQRGY L+   EYG+ +++
Sbjct  362   IDDKLALFKRFHSWLKPGGQLLISDYCCGKKPWTPAFEAYVKQRGYVLYTPSEYGKFIQE  421

Query  1093  AGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGE  914
             AGF  V AEDRT QF++V+K EL   E  K+ F+++FSEEDY  IV GWK KL R++SG+
Sbjct  422   AGFSKVRAEDRTAQFIEVIKTELQRAEAIKDEFVKEFSEEDYFAIVNGWKEKLGRSNSGD  481

Query  913   QRWGL  899
             QRWGL
Sbjct  482   QRWGL  486



>ref|XP_010730439.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X1 [Larimichthys crocea]
Length=506

 Score =   310 bits (793),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 150/245 (61%), Positives = 189/245 (77%), Gaps = 1/245 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D  QY   GILRYE++FG GYVSTGG  TTKEFV  L+L+PGQKVLDVGCGIGGGDFYMA
Sbjct  256   DNQQYTSRGILRYEKMFGAGYVSTGGPSTTKEFVDLLNLKPGQKVLDVGCGIGGGDFYMA  315

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKC-AVEFEVADCTKKTYPDATFDVIYSRDTILH  1274
             + + V V+G+DLS NM+ IA+ERAI  K  +V+FEVAD TK+T+P+ +FDVIYSRDTILH
Sbjct  316   KTFGVEVLGLDLSDNMVDIAMERAITEKLPSVQFEVADATKRTFPEDSFDVIYSRDTILH  375

Query  1273  IQDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRD  1094
             I DK ALF+ F+ WLKPGG++LI+DYC    P +  F AY+KQRGY L+   +YG+ L +
Sbjct  376   IDDKLALFKRFHSWLKPGGQLLISDYCCGEKPWTPVFEAYVKQRGYILYTPSQYGKFLEE  435

Query  1093  AGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGE  914
             AGF +V AEDRT QF++V++ EL   E  K+ F + FSEEDY  I+ GW+ KL R++SG+
Sbjct  436   AGFCNVRAEDRTAQFIQVIETELQRAEAIKDEFTEQFSEEDYFAIINGWREKLGRSNSGD  495

Query  913   QRWGL  899
             QRWGL
Sbjct  496   QRWGL  500



>ref|XP_010730440.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X2 [Larimichthys crocea]
Length=500

 Score =   309 bits (792),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 150/245 (61%), Positives = 189/245 (77%), Gaps = 1/245 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D  QY   GILRYE++FG GYVSTGG  TTKEFV  L+L+PGQKVLDVGCGIGGGDFYMA
Sbjct  250   DNQQYTSRGILRYEKMFGAGYVSTGGPSTTKEFVDLLNLKPGQKVLDVGCGIGGGDFYMA  309

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKC-AVEFEVADCTKKTYPDATFDVIYSRDTILH  1274
             + + V V+G+DLS NM+ IA+ERAI  K  +V+FEVAD TK+T+P+ +FDVIYSRDTILH
Sbjct  310   KTFGVEVLGLDLSDNMVDIAMERAITEKLPSVQFEVADATKRTFPEDSFDVIYSRDTILH  369

Query  1273  IQDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRD  1094
             I DK ALF+ F+ WLKPGG++LI+DYC    P +  F AY+KQRGY L+   +YG+ L +
Sbjct  370   IDDKLALFKRFHSWLKPGGQLLISDYCCGEKPWTPVFEAYVKQRGYILYTPSQYGKFLEE  429

Query  1093  AGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGE  914
             AGF +V AEDRT QF++V++ EL   E  K+ F + FSEEDY  I+ GW+ KL R++SG+
Sbjct  430   AGFCNVRAEDRTAQFIQVIETELQRAEAIKDEFTEQFSEEDYFAIINGWREKLGRSNSGD  489

Query  913   QRWGL  899
             QRWGL
Sbjct  490   QRWGL  494



>ref|XP_008278559.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Stegastes partitus]
Length=510

 Score =   310 bits (793),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 148/245 (60%), Positives = 190/245 (78%), Gaps = 1/245 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D  QY   GILRYE++FG GYVSTGG  TTKEFV  L+L+PGQKVLDVGCGIGGGDFYMA
Sbjct  260   DNQQYTRRGILRYEKMFGAGYVSTGGSSTTKEFVDLLNLKPGQKVLDVGCGIGGGDFYMA  319

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLK-CAVEFEVADCTKKTYPDATFDVIYSRDTILH  1274
             + + V V+G+DLS NM+ IA+ERAI  K  +V+FEV+D TK+ +P+ +FDVIYSRDTILH
Sbjct  320   KTFGVEVLGMDLSDNMVDIAMERAIAEKLTSVQFEVSDATKRMFPEGSFDVIYSRDTILH  379

Query  1273  IQDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRD  1094
             I DK ALF+ F+ WLKPGG++LI+DYC    P +  F AY+KQRGY L+   +YG+ +++
Sbjct  380   IDDKLALFKRFHSWLKPGGQLLISDYCCGEKPWTPAFEAYVKQRGYVLYTPTQYGKFIQE  439

Query  1093  AGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGE  914
             AGF +V A+DRT  F++V+K EL   E  K+ +I++FSEEDY  IV GWK KL R++SG+
Sbjct  440   AGFSNVRADDRTGHFIQVIKTELQRAEAIKDDYIKEFSEEDYFAIVNGWKEKLERSNSGD  499

Query  913   QRWGL  899
             QRWGL
Sbjct  500   QRWGL  504



>ref|XP_007550439.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like [Poecilia 
formosa]
Length=492

 Score =   308 bits (790),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 151/245 (62%), Positives = 189/245 (77%), Gaps = 1/245 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D  QY   GILRYE++FG GYVSTGG  TTKEFV  L+L+ GQKVLDVGCGIGGGDFYMA
Sbjct  242   DNQQYTRRGILRYEKMFGAGYVSTGGPSTTKEFVDLLNLKRGQKVLDVGCGIGGGDFYMA  301

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKC-AVEFEVADCTKKTYPDATFDVIYSRDTILH  1274
             + + V V+G+DLS NM+ IA+ERA   K  +V+FEVAD TK+T+P+ +FDVIYSRDTILH
Sbjct  302   KMFGVEVLGLDLSDNMVDIAIERARAEKLPSVQFEVADATKRTFPEGSFDVIYSRDTILH  361

Query  1273  IQDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRD  1094
             I DK ALF+ F+ WLKPGG++LI+DYC    P +  F AY+KQRGY L+   EYG+ +++
Sbjct  362   IDDKVALFKRFHSWLKPGGQLLISDYCCGEKPWTPVFEAYVKQRGYILYTPSEYGKFIQE  421

Query  1093  AGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGE  914
             AGF +V  EDRT QF++V++ EL   E  KE FIQ+FSEEDY+ IV GW+ KL R+ SG+
Sbjct  422   AGFCNVRVEDRTAQFIQVIQTELQRAEDIKEEFIQEFSEEDYSAIVNGWREKLDRSKSGD  481

Query  913   QRWGL  899
             QRWGL
Sbjct  482   QRWGL  486



>ref|NP_001087172.1| phosphoethanolamine methyltransferase [Xenopus laevis]
 gb|AAH78119.1| MGC83638 protein [Xenopus laevis]
Length=494

 Score =   308 bits (788),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 146/245 (60%), Positives = 184/245 (75%), Gaps = 1/245 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D  QY   GILRYE++FG G+VSTGGLETTKEF++ L+L+PGQ+V+DVGCGIGGGDFYMA
Sbjct  239   DNQQYSRRGILRYEKIFGEGFVSTGGLETTKEFISMLNLRPGQRVIDVGCGIGGGDFYMA  298

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCA-VEFEVADCTKKTYPDATFDVIYSRDTILH  1274
             + Y V V+G+DLS+NM+ IA+ERA   K   V+FE+ D T++ + + +FDV+YSRDTILH
Sbjct  299   KTYGVEVLGMDLSSNMVEIAMERAFTEKTPLVQFEIGDATRRCFSEGSFDVVYSRDTILH  358

Query  1273  IQDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRD  1094
             I DK ALFR FY W+KPGGK+LITDYC    P +  F  Y+KQRGY L+  +EYGQ L  
Sbjct  359   INDKEALFRRFYSWIKPGGKLLITDYCCGERPWAPVFQEYVKQRGYILYTPQEYGQFLEK  418

Query  1093  AGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGE  914
             AGF +V A+DRT+QF+ VL  EL      K+ FI++FSEEDY  I+ GWK K  R S G+
Sbjct  419   AGFVNVQAQDRTEQFVNVLNTELSRTRDIKQQFIENFSEEDYKYIIDGWKEKQHRCSLGD  478

Query  913   QRWGL  899
             QRWGL
Sbjct  479   QRWGL  483


 Score = 57.0 bits (136),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 79/180 (44%), Gaps = 9/180 (5%)
 Frame = -1

Query  1552  LETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMAENYDVHVIGIDLSTNMITIALERAIG  1373
             LE   E +  L    G  VL++G G+G    ++A+    HV  +D   N I    E   G
Sbjct  36    LEEKPEIILLLPCLDGLSVLELGAGMGRYTGHLAK-LASHVTAVDFMPNFIEKNREDN-G  93

Query  1372  LKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKP--ALFRSFYKWLKPGGKVLITD  1199
              +  + F  AD T    P  +FD I+S    +++ D    AL +    WLKPGG +   +
Sbjct  94    FRGNITFLQADVTNLDLPKESFDFIFSNWLFMYLTDAELVALTQKLLAWLKPGGYLFFRE  153

Query  1198  YC-KRSGPPSEEF--AAYIKQRGYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKE  1028
              C  +SG     F    Y     Y+L  T     +  D+GFE V++      ++K+ K +
Sbjct  154   SCFFQSGDKERTFNPTVYRTPAQYNLLLTSA-TSVSGDSGFEIVMSRS-VQTYIKIKKNQ  211



>ref|XP_007160543.1| hypothetical protein PHAVU_002G330400g [Phaseolus vulgaris]
 gb|ESW32537.1| hypothetical protein PHAVU_002G330400g [Phaseolus vulgaris]
Length=517

 Score =   308 bits (789),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 157/218 (72%), Positives = 189/218 (87%), Gaps = 0/218 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D V+Y    ILRYE+++GPG+VSTGGLETT+EFVAKL L+PGQKVLDVGCG+GGGDFYMA
Sbjct  247   DRVEYSHKSILRYEQMYGPGFVSTGGLETTEEFVAKLGLKPGQKVLDVGCGVGGGDFYMA  306

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             EN+DV V+GIDLS NMI++A+ERAIGL  AVEF+ ADC KK+YPD TFDVIY+RDT+LH+
Sbjct  307   ENFDVEVVGIDLSINMISLAIERAIGLNYAVEFDCADCFKKSYPDNTFDVIYTRDTMLHV  366

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             +DKP LFRSFYK LKPGGK+LITDYCK +  PS EFA YIK+ GY LHD + Y +ML DA
Sbjct  367   KDKPTLFRSFYKGLKPGGKILITDYCKSAQSPSSEFAEYIKKGGYYLHDMKAYEKMLEDA  426

Query  1090  GFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSE  977
             GF+D+IAEDRTDQF+K L+KELDA+E +K+ FI+DFSE
Sbjct  427   GFDDLIAEDRTDQFVKTLQKELDALENKKDDFIRDFSE  464



>emb|CDX74572.1| BnaA04g08170D [Brassica napus]
Length=381

 Score =   303 bits (777),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 142/198 (72%), Positives = 162/198 (82%), Gaps = 0/198 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             + VQYK +GILRYE V G GYVS  G ETTKEFVAK++L+ GQKVLDV CGIGGGDFYMA
Sbjct  156   NNVQYKSNGILRYECVVGQGYVSPRGFETTKEFVAKMELKLGQKVLDVDCGIGGGDFYMA  215

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHI  1271
             E +DVHV+GIDL  NM++ A ERAIGL C+VEFEVADCT  TYPD +FDVIYS  TI HI
Sbjct  216   ETFDVHVVGIDLLVNMMSFAFERAIGLNCSVEFEVADCTTNTYPDNSFDVIYSSATIFHI  275

Query  1270  QDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDA  1091
             QDKPALF++F+KWLKPGG+VLITDYCK    PS  FA  IKQRGYD+HD + Y QML+DA
Sbjct  276   QDKPALFKTFFKWLKPGGRVLITDYCKSDETPSPLFAEVIKQRGYDIHDVQAYEQMLKDA  335

Query  1090  GFEDVIAEDRTDQFMKVL  1037
             GFEDVIAEDR DQ+  +L
Sbjct  336   GFEDVIAEDRIDQYFYIL  353



>ref|NP_001167350.1| phosphoethanolamine N-methyltransferase 3 [Salmo salar]
 gb|ACN11445.1| phosphoethanolamine N-methyltransferase 3 [Salmo salar]
Length=495

 Score =   304 bits (779),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 146/245 (60%), Positives = 186/245 (76%), Gaps = 1/245 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D  QY   GILRYE++FG GYVSTGG  TTKEFV  L+L+PG KVLDVGCGIGGG+FYMA
Sbjct  245   DNQQYTRKGILRYEKMFGAGYVSTGGPSTTKEFVDLLNLKPGMKVLDVGCGIGGGNFYMA  304

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKC-AVEFEVADCTKKTYPDATFDVIYSRDTILH  1274
             + + V V+G+DLS NM+ IA+ERA+  K  +V FEVAD TK+ +P+A+FDV+YSRDTILH
Sbjct  305   KAFGVEVLGLDLSANMVDIAIERAMEEKLPSVHFEVADATKREFPEASFDVVYSRDTILH  364

Query  1273  IQDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRD  1094
             I +K ALF+ F+ WLKPGG+VLI+DYC    P + +F  Y+KQRGY L+   +YG+ L+ 
Sbjct  365   IDEKLALFKRFHSWLKPGGQVLISDYCCGEKPWTPQFQEYVKQRGYILYTPPQYGKFLQQ  424

Query  1093  AGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGE  914
             AGF +V AEDRT QFM+V++ EL+     K+ FI++FSEEDY  IV GW  KL R  +G+
Sbjct  425   AGFSNVRAEDRTAQFMQVIQTELERAAAMKDEFIKEFSEEDYLAIVNGWSDKLKRCKTGD  484

Query  913   QRWGL  899
             QRWGL
Sbjct  485   QRWGL  489



>ref|XP_005806845.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like [Xiphophorus 
maculatus]
Length=492

 Score =   304 bits (778),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 150/245 (61%), Positives = 187/245 (76%), Gaps = 1/245 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D  QY   GILRYE++FG GYVSTGG  TTKEFV  L+L+ GQKVLDVGCGIGGGDFYMA
Sbjct  242   DNQQYTRRGILRYEKMFGAGYVSTGGPSTTKEFVDLLNLKHGQKVLDVGCGIGGGDFYMA  301

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKC-AVEFEVADCTKKTYPDATFDVIYSRDTILH  1274
             + + V V+G+DLS NM+ IA+ERA   K  +V+FEVAD TK+T+P+  FDVIYSRDTILH
Sbjct  302   KMFGVEVLGLDLSDNMVDIAIERARAEKLPSVQFEVADATKRTFPEGLFDVIYSRDTILH  361

Query  1273  IQDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRD  1094
             I DK  LF+ F+ WLKPGG++LI+DYC    P +  F AY+KQRGY L+   EYG+ +++
Sbjct  362   IDDKLDLFKRFHSWLKPGGQLLISDYCCGEKPWTPVFEAYVKQRGYILYTPSEYGKFIQE  421

Query  1093  AGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGE  914
             AGF +V  EDRT QF++V++ EL   E  KE FIQ+FSEEDY+ IV GW+ KL R+ SG+
Sbjct  422   AGFCNVRVEDRTAQFIQVIQTELQRAEDIKEEFIQEFSEEDYSAIVDGWREKLDRSKSGD  481

Query  913   QRWGL  899
             QRWGL
Sbjct  482   QRWGL  486



>ref|XP_010864863.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like [Esox 
lucius]
Length=495

 Score =   303 bits (776),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 145/245 (59%), Positives = 184/245 (75%), Gaps = 1/245 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D  QY  +GILRYE++FG GYVSTGG  TTKEFV  L+L+PG KVLD+GCGIGGG+FYMA
Sbjct  245   DNQQYTRNGILRYEKMFGAGYVSTGGPSTTKEFVDMLNLKPGMKVLDIGCGIGGGNFYMA  304

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKC-AVEFEVADCTKKTYPDATFDVIYSRDTILH  1274
             + + V V+G+DLS NM+ IA+ERA+  K  +V FEVAD TK+ +P  +FDV+YSRDTILH
Sbjct  305   KTFGVEVLGLDLSANMVEIAVERAVKEKLPSVHFEVADATKRDFPQGSFDVVYSRDTILH  364

Query  1273  IQDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRD  1094
             I DK ALF+ F+ WLKPGG+VLI+DYC    P + +F  Y+KQRGY L+   +YG+ L  
Sbjct  365   IDDKLALFKRFHSWLKPGGQVLISDYCCGEKPWTPQFQEYVKQRGYILYTPPQYGKFLEQ  424

Query  1093  AGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGE  914
             AGF DV AEDRT QFM+V++ EL      K+ FI++FSEEDY  I+ GW  KL R ++G+
Sbjct  425   AGFSDVRAEDRTAQFMQVIEMELARAVPIKDEFIKEFSEEDYLAIINGWSEKLQRCTTGD  484

Query  913   QRWGL  899
             QRWGL
Sbjct  485   QRWGL  489



>ref|XP_009832411.1| hypothetical protein H257_08283 [Aphanomyces astaci]
 gb|ETV78074.1| hypothetical protein H257_08283 [Aphanomyces astaci]
Length=507

 Score =   303 bits (776),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 146/245 (60%), Positives = 178/245 (73%), Gaps = 1/245 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D+ QY    I RYE++FG GYVSTGG ETT EFVAKL L+ G++VLDVGCGIGGGDFYMA
Sbjct  257   DSQQYSTGSIARYEKIFGEGYVSTGGQETTTEFVAKLGLKAGERVLDVGCGIGGGDFYMA  316

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKCA-VEFEVADCTKKTYPDATFDVIYSRDTILH  1274
             + + V V+GIDLSTNM+  ALE+++      VEFEV D T K YP  +FDVIYSRDTILH
Sbjct  317   KTFGVSVVGIDLSTNMVHRALEQSVADPTVDVEFEVCDATTKEYPAGSFDVIYSRDTILH  376

Query  1273  IQDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRD  1094
             IQDK  LF  FY+WLKPGG+VLI+DYC+   P S+ F AY+  RGY L    +YG +L  
Sbjct  377   IQDKLGLFEKFYRWLKPGGRVLISDYCRGDQPQSDRFQAYVASRGYHLLSPSQYGGVLTA  436

Query  1093  AGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGE  914
             AGF DV+AEDRT+ F  VL+ EL      ++ FI   SE+DY DIVGGW+ KLTR + G+
Sbjct  437   AGFADVVAEDRTEHFTNVLEAELARTVANRDEFIAQTSEKDYQDIVGGWESKLTRCADGD  496

Query  913   QRWGL  899
             Q+WGL
Sbjct  497   QKWGL  501



>ref|XP_008418600.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Poecilia reticulata]
Length=492

 Score =   303 bits (775),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 149/245 (61%), Positives = 187/245 (76%), Gaps = 1/245 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D  QY   GILRYE++FG GYVSTGG  TTKEFV  L+L+ GQKVLDVGCGIGGGDFYMA
Sbjct  242   DNQQYTRRGILRYEKMFGAGYVSTGGPSTTKEFVDLLNLKRGQKVLDVGCGIGGGDFYMA  301

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKC-AVEFEVADCTKKTYPDATFDVIYSRDTILH  1274
             + + V V+G+DLS NM+ IA+ERA   K  +V+FEVAD TK+ +P+ +FDVIYSRDTILH
Sbjct  302   KMFGVEVLGLDLSDNMVDIAIERARAEKLPSVQFEVADATKRMFPEGSFDVIYSRDTILH  361

Query  1273  IQDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRD  1094
             I DK ALF+ F+ WLKPGG++LI+DYC    P +  F AY+KQRGY L+   EYG+ +++
Sbjct  362   IDDKLALFKRFHSWLKPGGQLLISDYCCGEKPWTPVFEAYVKQRGYILYTPSEYGKFVQE  421

Query  1093  AGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGE  914
             AGF +V  EDRT QF++V++ EL   E  K+ FIQ+FSEEDY  IV GW+ KL R+ SG+
Sbjct  422   AGFCNVRVEDRTAQFIEVIQTELQRAEDIKDEFIQEFSEEDYLAIVNGWREKLDRSKSGD  481

Query  913   QRWGL  899
             QRWGL
Sbjct  482   QRWGL  486



>ref|XP_008418601.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Poecilia reticulata]
Length=491

 Score =   303 bits (775),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 149/245 (61%), Positives = 187/245 (76%), Gaps = 1/245 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D  QY   GILRYE++FG GYVSTGG  TTKEFV  L+L+ GQKVLDVGCGIGGGDFYMA
Sbjct  241   DNQQYTRRGILRYEKMFGAGYVSTGGPSTTKEFVDLLNLKRGQKVLDVGCGIGGGDFYMA  300

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKC-AVEFEVADCTKKTYPDATFDVIYSRDTILH  1274
             + + V V+G+DLS NM+ IA+ERA   K  +V+FEVAD TK+ +P+ +FDVIYSRDTILH
Sbjct  301   KMFGVEVLGLDLSDNMVDIAIERARAEKLPSVQFEVADATKRMFPEGSFDVIYSRDTILH  360

Query  1273  IQDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRD  1094
             I DK ALF+ F+ WLKPGG++LI+DYC    P +  F AY+KQRGY L+   EYG+ +++
Sbjct  361   IDDKLALFKRFHSWLKPGGQLLISDYCCGEKPWTPVFEAYVKQRGYILYTPSEYGKFVQE  420

Query  1093  AGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGE  914
             AGF +V  EDRT QF++V++ EL   E  K+ FIQ+FSEEDY  IV GW+ KL R+ SG+
Sbjct  421   AGFCNVRVEDRTAQFIEVIQTELQRAEDIKDEFIQEFSEEDYLAIVNGWREKLDRSKSGD  480

Query  913   QRWGL  899
             QRWGL
Sbjct  481   QRWGL  485



>ref|XP_007228349.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like [Astyanax 
mexicanus]
Length=551

 Score =   304 bits (778),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 145/245 (59%), Positives = 184/245 (75%), Gaps = 1/245 (0%)
 Frame = -1

Query  1630  DTVQYKCSGILRYERVFGPGYVSTGGLETTKEFVAKLDLQPGQKVLDVGCGIGGGDFYMA  1451
             D  QY   GILRYE++FG G+VSTGG  TTKEFV  L+L PGQKVLDVGCGIGGGDFYMA
Sbjct  301   DNQQYTRRGILRYEKMFGSGFVSTGGPSTTKEFVDLLNLSPGQKVLDVGCGIGGGDFYMA  360

Query  1450  ENYDVHVIGIDLSTNMITIALERAIGLKC-AVEFEVADCTKKTYPDATFDVIYSRDTILH  1274
             +N+ V V+G+DLS NM+ IA+ERA+  K  +V+FEV+D TK+ +P+ +FDV+YSRDTILH
Sbjct  361   KNFGVEVLGMDLSGNMVEIAMERAVQEKLPSVQFEVSDATKRIFPEGSFDVVYSRDTILH  420

Query  1273  IQDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRD  1094
             I DK  LFR F+ WL+PGGK+LI+DYC    P +  F  Y+ QRGY L+  + YGQ L +
Sbjct  421   ISDKLELFRKFHSWLRPGGKLLISDYCCGEKPWTPAFQDYVNQRGYILYTPQRYGQFLEE  480

Query  1093  AGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGE  914
             AGF  V AEDRT QF++V+K EL   E+ +  FIQ+FS+EDY+ IV GW  KL R  +G+
Sbjct  481   AGFTKVRAEDRTAQFIQVIKDELKRAEEIQNEFIQEFSQEDYDAIVNGWTEKLQRCEAGD  540

Query  913   QRWGL  899
             Q+WGL
Sbjct  541   QQWGL  545



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5150480793968