BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig2715

Length=836
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006351772.1|  PREDICTED: uncharacterized protein LOC102578792    196   1e-55   
ref|XP_009790037.1|  PREDICTED: uncharacterized protein LOC104237564    194   6e-55   Nicotiana sylvestris
ref|XP_009615990.1|  PREDICTED: uncharacterized protein LOC104108615    192   3e-54   Nicotiana tomentosiformis
ref|XP_004230598.1|  PREDICTED: uncharacterized protein LOC101259293    190   2e-53   Solanum lycopersicum
gb|KJB32061.1|  hypothetical protein B456_005G221000                    169   1e-45   Gossypium raimondii
ref|XP_010030036.1|  PREDICTED: uncharacterized protein LOC104419903    168   3e-45   Eucalyptus grandis [rose gum]
gb|KHF99141.1|  hypothetical protein F383_18933                         167   4e-45   Gossypium arboreum [tree cotton]
gb|KHG29062.1|  1,8-cineole synthase, chloroplastic                     167   4e-45   Gossypium arboreum [tree cotton]
ref|XP_011087891.1|  PREDICTED: uncharacterized protein LOC105169231    168   1e-44   
emb|CDO97439.1|  unnamed protein product                                157   2e-43   Coffea canephora [robusta coffee]
gb|KJB77537.1|  hypothetical protein B456_012G142400                    161   5e-43   Gossypium raimondii
ref|XP_011041858.1|  PREDICTED: uncharacterized protein LOC105137724    162   5e-43   Populus euphratica
ref|XP_002323979.1|  hypothetical protein POPTR_0017s08030g             162   6e-43   
emb|CBI32985.3|  unnamed protein product                                154   2e-42   Vitis vinifera
gb|KDP40903.1|  hypothetical protein JCGZ_24902                         156   3e-41   Jatropha curcas
ref|XP_012069136.1|  PREDICTED: uncharacterized protein LOC105631579    156   6e-41   Jatropha curcas
ref|XP_002272705.1|  PREDICTED: uncharacterized protein LOC100261012    156   7e-41   Vitis vinifera
ref|XP_010690509.1|  PREDICTED: uncharacterized protein LOC104904034    155   8e-41   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007199902.1|  hypothetical protein PRUPE_ppa006716mg             156   8e-41   Prunus persica
ref|XP_009344578.1|  PREDICTED: uncharacterized protein LOC103936468    155   2e-40   Pyrus x bretschneideri [bai li]
gb|KJB77539.1|  hypothetical protein B456_012G142500                    154   4e-40   Gossypium raimondii
ref|XP_011459749.1|  PREDICTED: uncharacterized protein LOC101309613    154   5e-40   Fragaria vesca subsp. vesca
ref|XP_007042930.1|  Uncharacterized protein isoform 1                  153   1e-39   
ref|XP_004485586.1|  PREDICTED: uncharacterized protein LOC101515692    153   1e-39   Cicer arietinum [garbanzo]
gb|EYU18473.1|  hypothetical protein MIMGU_mgv1a025704mg                152   4e-39   Erythranthe guttata [common monkey flower]
ref|XP_004137277.1|  PREDICTED: uncharacterized protein LOC101222931    149   4e-38   Cucumis sativus [cucumbers]
ref|XP_008462861.1|  PREDICTED: uncharacterized protein LOC103501143    149   4e-38   Cucumis melo [Oriental melon]
ref|XP_009337874.1|  PREDICTED: uncharacterized protein LOC103930...    149   5e-38   Pyrus x bretschneideri [bai li]
ref|XP_009337875.1|  PREDICTED: uncharacterized protein LOC103930...    149   5e-38   Pyrus x bretschneideri [bai li]
ref|XP_003593210.1|  hypothetical protein MTR_2g008960                  148   8e-38   Medicago truncatula
ref|XP_010484194.1|  PREDICTED: uncharacterized protein LOC104762577    144   2e-36   Camelina sativa [gold-of-pleasure]
ref|XP_006423857.1|  hypothetical protein CICLE_v10028678mg             144   2e-36   Citrus clementina [clementine]
ref|XP_008348814.1|  PREDICTED: uncharacterized protein LOC103411982    144   2e-36   
gb|KJB77538.1|  hypothetical protein B456_012G142400                    142   3e-36   Gossypium raimondii
ref|XP_006493890.1|  PREDICTED: uncharacterized protein LOC102621...    143   4e-36   Citrus sinensis [apfelsine]
ref|XP_010461545.1|  PREDICTED: uncharacterized protein LOC104742256    143   6e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010444356.1|  PREDICTED: uncharacterized protein LOC104727054    142   1e-35   Camelina sativa [gold-of-pleasure]
gb|AAK93619.1|  unknown protein                                         139   2e-35   Arabidopsis thaliana [mouse-ear cress]
dbj|BAE71289.1|  hypothetical protein                                   141   3e-35   Trifolium pratense [peavine clover]
ref|XP_010520922.1|  PREDICTED: uncharacterized protein LOC104799930    140   4e-35   Tarenaya hassleriana [spider flower]
gb|KJB77540.1|  hypothetical protein B456_012G142500                    140   4e-35   Gossypium raimondii
ref|NP_568987.2|  uncharacterized protein                               139   8e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010269304.1|  PREDICTED: uncharacterized protein LOC104606004    137   1e-33   Nelumbo nucifera [Indian lotus]
ref|XP_004290342.1|  PREDICTED: uncharacterized protein LOC101311058    136   2e-33   Fragaria vesca subsp. vesca
ref|XP_007042934.1|  Uncharacterized protein TCM_007451                 128   7e-33   
gb|KDO49112.1|  hypothetical protein CISIN_1g0173161mg                  127   1e-32   Citrus sinensis [apfelsine]
ref|XP_006394183.1|  hypothetical protein EUTSA_v10004757mg             130   3e-32   Eutrema salsugineum [saltwater cress]
gb|KFK28114.1|  hypothetical protein AALP_AA8G474500                    130   1e-31   Arabis alpina [alpine rockcress]
ref|XP_010937432.1|  PREDICTED: uncharacterized protein LOC105056...    130   2e-31   Elaeis guineensis
ref|XP_002864888.1|  hypothetical protein ARALYDRAFT_496623             130   3e-31   
ref|XP_010939663.1|  PREDICTED: uncharacterized protein LOC105058425    127   5e-30   Elaeis guineensis
ref|XP_008790884.1|  PREDICTED: uncharacterized protein LOC103707937    127   5e-30   Phoenix dactylifera
dbj|BAB09854.1|  unnamed protein product                                126   7e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010937431.1|  PREDICTED: uncharacterized protein LOC105056...    121   3e-28   Elaeis guineensis
ref|XP_008778096.1|  PREDICTED: uncharacterized protein LOC103697933    121   6e-28   
emb|CDY31332.1|  BnaA02g34090D                                          117   7e-27   Brassica napus [oilseed rape]
ref|XP_009130442.1|  PREDICTED: uncharacterized protein LOC103855230    117   1e-26   Brassica rapa
ref|XP_009419802.1|  PREDICTED: uncharacterized protein LOC103999707    117   1e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006280766.1|  hypothetical protein CARUB_v10026735mg             115   3e-26   Capsella rubella
emb|CDY63725.1|  BnaC02g48850D                                          115   4e-26   Brassica napus [oilseed rape]
ref|XP_002525862.1|  hypothetical protein RCOM_0824750                  109   4e-26   
ref|XP_002454249.1|  hypothetical protein SORBIDRAFT_04g027520          114   9e-26   
ref|XP_004955218.1|  PREDICTED: uncharacterized protein LOC101770073    114   2e-25   
gb|EEC74030.1|  hypothetical protein OsI_08983                          111   5e-25   Oryza sativa Indica Group [Indian rice]
ref|XP_006649060.1|  PREDICTED: uncharacterized protein LOC102709344    107   2e-24   Oryza brachyantha
ref|NP_001048156.1|  Os02g0754600                                       110   3e-24   
ref|XP_003570616.2|  PREDICTED: LOW QUALITY PROTEIN: outer envelo...    113   3e-24   Brachypodium distachyon [annual false brome]
ref|XP_009399671.1|  PREDICTED: uncharacterized protein LOC103984006    108   1e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006847843.2|  PREDICTED: uncharacterized protein LOC18437576     104   2e-22   
gb|ADE77727.1|  unknown                                                 102   2e-21   Picea sitchensis
gb|ERN14647.1|  hypothetical protein AMTR_s00038p00200260               100   3e-21   Amborella trichopoda
ref|XP_006853180.2|  PREDICTED: uncharacterized protein LOC18442912     100   7e-21   Amborella trichopoda
ref|XP_002521651.1|  conserved hypothetical protein                   96.7    2e-19   Ricinus communis
ref|XP_006345317.1|  PREDICTED: uncharacterized protein LOC102606286  96.7    3e-19   
ref|XP_006437611.1|  hypothetical protein CICLE_v10033897mg           94.7    1e-18   
ref|XP_009793569.1|  PREDICTED: uncharacterized protein LOC104240425  94.4    1e-18   Nicotiana sylvestris
ref|XP_002270447.1|  PREDICTED: uncharacterized protein LOC100240757  94.0    2e-18   Vitis vinifera
ref|XP_006484584.1|  PREDICTED: uncharacterized protein LOC102623953  94.0    2e-18   Citrus sinensis [apfelsine]
emb|CBI29026.3|  unnamed protein product                              94.0    3e-18   Vitis vinifera
ref|XP_009590559.1|  PREDICTED: uncharacterized protein LOC104087710  92.4    5e-18   Nicotiana tomentosiformis
gb|KJB31863.1|  hypothetical protein B456_005G211600                  91.7    1e-17   Gossypium raimondii
ref|XP_004231494.1|  PREDICTED: uncharacterized protein LOC101263358  90.5    3e-17   Solanum lycopersicum
ref|XP_012072843.1|  PREDICTED: uncharacterized protein LOC105634579  90.5    3e-17   Jatropha curcas
ref|XP_010688666.1|  PREDICTED: uncharacterized protein LOC104902557  88.6    2e-16   Beta vulgaris subsp. vulgaris [field beet]
gb|KCW51322.1|  hypothetical protein EUGRSUZ_J00876                   84.7    3e-15   Eucalyptus grandis [rose gum]
ref|XP_010034289.1|  PREDICTED: uncharacterized protein LOC104423502  84.7    4e-15   Eucalyptus grandis [rose gum]
ref|XP_001768702.1|  predicted protein                                83.6    5e-15   
ref|XP_010940354.1|  PREDICTED: BTB/POZ domain-containing protein...  84.0    5e-15   Elaeis guineensis
ref|XP_007042933.1|  Uncharacterized protein isoform 4                82.8    6e-15   
ref|XP_008813455.1|  PREDICTED: uncharacterized protein LOC103724075  83.6    7e-15   Phoenix dactylifera
ref|XP_002885346.1|  hypothetical protein ARALYDRAFT_479510           82.8    1e-14   Arabidopsis lyrata subsp. lyrata
ref|XP_010508223.1|  PREDICTED: uncharacterized protein LOC104784...  82.8    1e-14   Camelina sativa [gold-of-pleasure]
ref|NP_188626.2|  uncharacterized protein                             82.8    1e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010487951.1|  PREDICTED: uncharacterized protein LOC104765...  82.8    1e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010508216.1|  PREDICTED: uncharacterized protein LOC104784...  83.2    1e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010487950.1|  PREDICTED: uncharacterized protein LOC104765...  82.8    1e-14   Camelina sativa [gold-of-pleasure]
ref|XP_006297645.1|  hypothetical protein CARUB_v10013663mg           82.8    2e-14   Capsella rubella
dbj|BAC43081.1|  unknown protein                                      82.4    2e-14   Arabidopsis thaliana [mouse-ear cress]
emb|CAN75502.1|  hypothetical protein VITISV_034157                   82.0    3e-14   Vitis vinifera
ref|XP_010466158.1|  PREDICTED: uncharacterized protein LOC104746...  82.0    3e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010466159.1|  PREDICTED: uncharacterized protein LOC104746...  81.6    3e-14   Camelina sativa [gold-of-pleasure]
gb|KFK39314.1|  hypothetical protein AALP_AA3G228700                  81.3    4e-14   Arabis alpina [alpine rockcress]
gb|KFK39313.1|  hypothetical protein AALP_AA3G228700                  81.6    4e-14   Arabis alpina [alpine rockcress]
ref|XP_006406441.1|  hypothetical protein EUTSA_v10022300mg           79.7    1e-13   Eutrema salsugineum [saltwater cress]
ref|XP_004143698.1|  PREDICTED: uncharacterized protein LOC101206051  79.3    2e-13   Cucumis sativus [cucumbers]
ref|XP_008445882.1|  PREDICTED: uncharacterized protein LOC103488768  79.3    2e-13   Cucumis melo [Oriental melon]
emb|CDY25358.1|  BnaA05g19260D                                        78.6    4e-13   Brassica napus [oilseed rape]
ref|XP_009135652.1|  PREDICTED: uncharacterized protein LOC103859827  78.2    4e-13   Brassica rapa
emb|CDY22946.1|  BnaC03g41230D                                        78.2    4e-13   Brassica napus [oilseed rape]
emb|CDY24594.1|  BnaC05g32780D                                        76.6    2e-12   Brassica napus [oilseed rape]
ref|XP_009145732.1|  PREDICTED: uncharacterized protein LOC103869...  74.3    9e-12   Brassica rapa
ref|XP_009145731.1|  PREDICTED: uncharacterized protein LOC103869...  74.7    9e-12   Brassica rapa
ref|XP_010541857.1|  PREDICTED: uncharacterized protein LOC104815236  73.6    2e-11   Tarenaya hassleriana [spider flower]
ref|XP_010096783.1|  hypothetical protein L484_004764                 72.8    3e-11   Morus notabilis
ref|XP_001766415.1|  predicted protein                                70.9    4e-11   
ref|XP_002980258.1|  hypothetical protein SELMODRAFT_112193           66.2    4e-09   
ref|XP_002963079.1|  hypothetical protein SELMODRAFT_404646           64.7    2e-08   Selaginella moellendorffii
gb|EMT16420.1|  Small glutamine-rich tetratricopeptide repeat-con...  56.2    1e-05   
ref|XP_002972832.1|  hypothetical protein SELMODRAFT_441994           54.3    5e-05   Selaginella moellendorffii
ref|XP_002984405.1|  hypothetical protein SELMODRAFT_423623           54.3    5e-05   Selaginella moellendorffii



>ref|XP_006351772.1| PREDICTED: uncharacterized protein LOC102578792 [Solanum tuberosum]
Length=411

 Score =   196 bits (497),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 106/124 (85%), Gaps = 1/124 (1%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGT  657
            S EPRLQG+LV VSAFL  Q+R++ K A++E    + LR+TNMNML+SWLPLLCRASNGT
Sbjct  283  SAEPRLQGSLVKVSAFLFKQSREIGKIAEDEESTKEHLRRTNMNMLMSWLPLLCRASNGT  342

Query  656  DTPVLSINKRAELERTLELIINTLD-EEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWC  480
            D PVLSI++RAELER LE II TL+ EEEQEKVLSLWL HFTYCPSSDWPNLHD YTRWC
Sbjct  343  DAPVLSISERAELERILEQIIGTLEQEEEQEKVLSLWLHHFTYCPSSDWPNLHDCYTRWC  402

Query  479  TASR  468
            TASR
Sbjct  403  TASR  406



>ref|XP_009790037.1| PREDICTED: uncharacterized protein LOC104237564 [Nicotiana sylvestris]
Length=398

 Score =   194 bits (492),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 107/124 (86%), Gaps = 1/124 (1%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGT  657
            S E RLQG+LV +SAFL  +AR++ K+A++E    + LR+TNMNML+SWLPLLCRASNGT
Sbjct  270  SAEARLQGSLVKLSAFLFKKAREIGKDAEDEESTKEHLRRTNMNMLMSWLPLLCRASNGT  329

Query  656  DTPVLSINKRAELERTLELIINTLD-EEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWC  480
            DTPVLSI++RAELER LE II TL+ EEEQEKVLSLWL HFTYCPSSDWPNLHD YTRWC
Sbjct  330  DTPVLSISERAELERVLEQIIGTLEQEEEQEKVLSLWLHHFTYCPSSDWPNLHDCYTRWC  389

Query  479  TASR  468
            TASR
Sbjct  390  TASR  393



>ref|XP_009615990.1| PREDICTED: uncharacterized protein LOC104108615 [Nicotiana tomentosiformis]
Length=401

 Score =   192 bits (487),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 107/124 (86%), Gaps = 1/124 (1%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGT  657
            S E +LQG+LV +SAFL  +AR++ K+A++E    + LR+TNMNML+SWLPLLCRASNGT
Sbjct  273  SAEAQLQGSLVKLSAFLFKKAREIGKDAEDEESTKEHLRRTNMNMLMSWLPLLCRASNGT  332

Query  656  DTPVLSINKRAELERTLELIINTLD-EEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWC  480
            DTPVLSI++RAELER LE II TL+ EEEQEKVLSLWL HFTYCPSSDWPNLHD YTRWC
Sbjct  333  DTPVLSISERAELERILEQIIGTLEQEEEQEKVLSLWLHHFTYCPSSDWPNLHDCYTRWC  392

Query  479  TASR  468
            TASR
Sbjct  393  TASR  396



>ref|XP_004230598.1| PREDICTED: uncharacterized protein LOC101259293 [Solanum lycopersicum]
Length=411

 Score =   190 bits (482),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 106/124 (85%), Gaps = 1/124 (1%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGT  657
            S EPRLQG+LV VSAFL  Q+R++ K A++E    +  R+TNMNML+SWLPLLCRASNGT
Sbjct  283  SAEPRLQGSLVKVSAFLFKQSREIVKIAEDEESTKEHRRRTNMNMLMSWLPLLCRASNGT  342

Query  656  DTPVLSINKRAELERTLELIINTLD-EEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWC  480
            D+PVLSI++RAELER LE II TL+ EEEQEKVLSLWL HFTYCPSSDWPNLHD YTRWC
Sbjct  343  DSPVLSISERAELERILEQIIWTLEQEEEQEKVLSLWLHHFTYCPSSDWPNLHDCYTRWC  402

Query  479  TASR  468
            TASR
Sbjct  403  TASR  406



>gb|KJB32061.1| hypothetical protein B456_005G221000 [Gossypium raimondii]
Length=392

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 91/122 (75%), Gaps = 1/122 (1%)
 Frame = -1

Query  830  EPRLQGALVXVSAFLLDQARQLWKEADEESMKYDE-LRQTNMNMLVSWLPLLCRASNGTD  654
            EPRLQG+LV VS FL  QAR +    DE    Y+E  RQT M ML SWLPLLCRASNGTD
Sbjct  265  EPRLQGSLVKVSTFLFKQARDMEMALDETEEFYEESRRQTKMKMLTSWLPLLCRASNGTD  324

Query  653  TPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCTA  474
             PVLSIN++AELE+ LE  I  LD EEQE+VLSLWL HF YC SSDWPNLH +Y RWCT 
Sbjct  325  MPVLSINEKAELEKVLEETIELLDHEEQEQVLSLWLHHFAYCSSSDWPNLHALYCRWCTN  384

Query  473  SR  468
            SR
Sbjct  385  SR  386



>ref|XP_010030036.1| PREDICTED: uncharacterized protein LOC104419903 [Eucalyptus grandis]
 gb|KCW56985.1| hypothetical protein EUGRSUZ_I02660 [Eucalyptus grandis]
Length=413

 Score =   168 bits (426),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 96/124 (77%), Gaps = 2/124 (2%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGT  657
            S EPRLQG+LV VSAFL  QA+ +  +  +ES K ++ RQT M ML+SWLPLLCRASNGT
Sbjct  285  SAEPRLQGSLVKVSAFLFKQAKDMGLDEIDES-KKEQQRQTRMKMLMSWLPLLCRASNGT  343

Query  656  DTPVLSINKRAELERTLELIINTLD-EEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWC  480
            D PVLS+++RAELER LE  I  L  EEEQE+VLS WL HF YCPSSDWPNLH  YTRWC
Sbjct  344  DAPVLSLSERAELERVLEQTIEMLGQEEEQEEVLSQWLHHFMYCPSSDWPNLHASYTRWC  403

Query  479  TASR  468
             ASR
Sbjct  404  AASR  407



>gb|KHF99141.1| hypothetical protein F383_18933 [Gossypium arboreum]
Length=392

 Score =   167 bits (424),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 91/122 (75%), Gaps = 1/122 (1%)
 Frame = -1

Query  830  EPRLQGALVXVSAFLLDQARQLWKEADEESMKYDE-LRQTNMNMLVSWLPLLCRASNGTD  654
            EPRLQG+LV VS FL  QAR +    DE    Y+E  R+T M ML SWLPLLCRASNGTD
Sbjct  265  EPRLQGSLVKVSTFLFKQARDMEMALDETEEFYEESRRETKMKMLTSWLPLLCRASNGTD  324

Query  653  TPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCTA  474
             PVLSIN++AELE+ LE  I  LD EEQE+VLSLWL HF YC SSDWPNLH +Y RWCT 
Sbjct  325  MPVLSINEKAELEKVLEETIELLDHEEQEQVLSLWLHHFAYCSSSDWPNLHALYCRWCTN  384

Query  473  SR  468
            SR
Sbjct  385  SR  386



>gb|KHG29062.1| 1,8-cineole synthase, chloroplastic [Gossypium arboreum]
Length=366

 Score =   167 bits (423),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 90/123 (73%), Gaps = 5/123 (4%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGT  657
            S EPRLQG+LV VSAFL  Q + +  EA EE       RQT M ML SWLPLLCR SNGT
Sbjct  240  SAEPRLQGSLVNVSAFLFKQMKDMDSEATEEGS-----RQTKMKMLTSWLPLLCRGSNGT  294

Query  656  DTPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCT  477
            D PVLS+++RAELE+ LE  I  L  EEQE+VLSLWL HFTYCPSSDWPNLH  Y RWCT
Sbjct  295  DMPVLSLSERAELEKILEDTIAMLQHEEQEQVLSLWLHHFTYCPSSDWPNLHASYARWCT  354

Query  476  ASR  468
             SR
Sbjct  355  TSR  357



>ref|XP_011087891.1| PREDICTED: uncharacterized protein LOC105169231 [Sesamum indicum]
Length=476

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 100/128 (78%), Gaps = 5/128 (4%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKE---ADEESMKYDE--LRQTNMNMLVSWLPLLCR  672
            S EPRLQG+LV VSAFL+ +A+++ K+    DE    +++  +R T M +L+SWLPLLCR
Sbjct  338  SAEPRLQGSLVKVSAFLIKEAKEMGKDNGNGDETDSPFEQQHIRHTKMKLLMSWLPLLCR  397

Query  671  ASNGTDTPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIY  492
            A+NGTD P+LS+ +RAELERTLE II TLDEEEQE VLSLWL HFTYCP+SDWPNL   Y
Sbjct  398  ANNGTDAPILSLGERAELERTLEEIIATLDEEEQEWVLSLWLHHFTYCPASDWPNLRLCY  457

Query  491  TRWCTASR  468
            TRW  ASR
Sbjct  458  TRWYNASR  465



>emb|CDO97439.1| unnamed protein product [Coffea canephora]
Length=161

 Score =   157 bits (396),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 96/124 (77%), Gaps = 2/124 (2%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGT  657
            + EPRLQG +V +SAFL  QA+ +  + D+E+ K ++  QT + ML+ W+PLLC+AS GT
Sbjct  26   ATEPRLQGFIVKISAFLFRQAKDMGTKKDDETKK-EQDTQTKLKMLLLWIPLLCQASMGT  84

Query  656  DTPVLSINKRAELERTLELIINTL-DEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWC  480
            D PVLSI +RAELE+ LE +I  L ++E+QEKVLSLWL HFTYCPSSDWPNL D YTRWC
Sbjct  85   DAPVLSIKERAELEKVLEDVIEALGNQEDQEKVLSLWLHHFTYCPSSDWPNLRDCYTRWC  144

Query  479  TASR  468
             ASR
Sbjct  145  IASR  148



>gb|KJB77537.1| hypothetical protein B456_012G142400 [Gossypium raimondii]
Length=370

 Score =   161 bits (408),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 90/123 (73%), Gaps = 5/123 (4%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGT  657
            S EPRLQG+LV +SAFL  Q + +  +  EE       RQT M ML SWLPLLCR SNGT
Sbjct  244  SAEPRLQGSLVKLSAFLFKQMKDMDSDETEEGS-----RQTKMKMLTSWLPLLCRGSNGT  298

Query  656  DTPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCT  477
            D PVLS+++RAELE+ LE  ++ L  +EQE+VLSLWL HFTYCPSSDWPNLH  Y RWCT
Sbjct  299  DMPVLSLSERAELEKILEDTVDMLQHKEQEQVLSLWLHHFTYCPSSDWPNLHASYARWCT  358

Query  476  ASR  468
             SR
Sbjct  359  TSR  361



>ref|XP_011041858.1| PREDICTED: uncharacterized protein LOC105137724 [Populus euphratica]
 ref|XP_011041859.1| PREDICTED: uncharacterized protein LOC105137724 [Populus euphratica]
Length=387

 Score =   162 bits (409),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 93/124 (75%), Gaps = 1/124 (1%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGT  657
            S E RLQG+LV VSAFL  QAR+L  +   E  +    RQT M ML+SWLPLLCRASNGT
Sbjct  258  SAEARLQGSLVKVSAFLFKQARELGLDEAGEGQRECTQRQTKMKMLMSWLPLLCRASNGT  317

Query  656  DTPVLSINKRAELERTLELIINTLD-EEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWC  480
            D PVLS+ +RAELE  LE +I+ L+ EEEQE+VLSLWL HFTY PSSDWPNL   Y RWC
Sbjct  318  DAPVLSMRERAELEIVLEEMIDMLEHEEEQEQVLSLWLHHFTYTPSSDWPNLRASYARWC  377

Query  479  TASR  468
            TASR
Sbjct  378  TASR  381



>ref|XP_002323979.1| hypothetical protein POPTR_0017s08030g [Populus trichocarpa]
 gb|EEF04112.1| hypothetical protein POPTR_0017s08030g [Populus trichocarpa]
Length=386

 Score =   162 bits (409),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 95/124 (77%), Gaps = 2/124 (2%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGT  657
            S E RLQG+LV VSAFLL QAR+L  +   E  +  + RQT M ML+SWLPLLCRASNGT
Sbjct  258  SAEARLQGSLVKVSAFLLKQARELGLDEAGEGQREPQ-RQTKMKMLLSWLPLLCRASNGT  316

Query  656  DTPVLSINKRAELERTLELIINTLD-EEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWC  480
            D PVLS+ +RAELE  LE +I+ L+ EEEQE+VLSLWL HFTY PSSDWPNL   Y RWC
Sbjct  317  DAPVLSMRERAELEIVLEEMIDMLEHEEEQEQVLSLWLHHFTYTPSSDWPNLRASYARWC  376

Query  479  TASR  468
            TASR
Sbjct  377  TASR  380



>emb|CBI32985.3| unnamed protein product [Vitis vinifera]
Length=154

 Score =   154 bits (388),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 100/124 (81%), Gaps = 2/124 (2%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGT  657
            S E RLQG+LV VSA L  QA+++ +E +EE++K ++ RQTNM ML+SWLPLLCR SNGT
Sbjct  26   SAEARLQGSLVKVSAHLFKQAKEMGRE-EEENIKKEQRRQTNMKMLMSWLPLLCRGSNGT  84

Query  656  DTPVLSINKRAELERTL-ELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWC  480
            DTPVLSI++RAELE+ L E+I     EEEQEKVLSLWL HFTYCPSSDWPNL   YTRWC
Sbjct  85   DTPVLSISERAELEKVLEEIIEMLEQEEEQEKVLSLWLHHFTYCPSSDWPNLLASYTRWC  144

Query  479  TASR  468
            T SR
Sbjct  145  TTSR  148



>gb|KDP40903.1| hypothetical protein JCGZ_24902 [Jatropha curcas]
Length=333

 Score =   156 bits (394),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 94/124 (76%), Gaps = 2/124 (2%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGT  657
            S EPRLQG+LV VSAFL  QA+ L  E  EES K ++ RQT   ML++WLPLLCRASNGT
Sbjct  205  SAEPRLQGSLVKVSAFLFKQAKDLGAEETEES-KKEQQRQTKKKMLMAWLPLLCRASNGT  263

Query  656  DTPVLSINKRAELERTLELIINTLD-EEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWC  480
            D PVL+ +++AELER LE +I  L+ E+EQE+VLSLWL HFT C SSDWPNL   Y RWC
Sbjct  264  DIPVLNTSQKAELERELEEMIGMLEHEDEQEQVLSLWLHHFTCCSSSDWPNLQASYDRWC  323

Query  479  TASR  468
             ASR
Sbjct  324  MASR  327



>ref|XP_012069136.1| PREDICTED: uncharacterized protein LOC105631579 [Jatropha curcas]
Length=381

 Score =   156 bits (395),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 94/124 (76%), Gaps = 2/124 (2%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGT  657
            S EPRLQG+LV VSAFL  QA+ L  E  EES K ++ RQT   ML++WLPLLCRASNGT
Sbjct  253  SAEPRLQGSLVKVSAFLFKQAKDLGAEETEESKK-EQQRQTKKKMLMAWLPLLCRASNGT  311

Query  656  DTPVLSINKRAELERTLELIINTLD-EEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWC  480
            D PVL+ +++AELER LE +I  L+ E+EQE+VLSLWL HFT C SSDWPNL   Y RWC
Sbjct  312  DIPVLNTSQKAELERELEEMIGMLEHEDEQEQVLSLWLHHFTCCSSSDWPNLQASYDRWC  371

Query  479  TASR  468
             ASR
Sbjct  372  MASR  375



>ref|XP_002272705.1| PREDICTED: uncharacterized protein LOC100261012 [Vitis vinifera]
Length=375

 Score =   156 bits (394),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 100/124 (81%), Gaps = 2/124 (2%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGT  657
            S E RLQG+LV VSA L  QA+++ +E +EE++K ++ RQTNM ML+SWLPLLCR SNGT
Sbjct  247  SAEARLQGSLVKVSAHLFKQAKEMGRE-EEENIKKEQRRQTNMKMLMSWLPLLCRGSNGT  305

Query  656  DTPVLSINKRAELERTL-ELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWC  480
            DTPVLSI++RAELE+ L E+I     EEEQEKVLSLWL HFTYCPSSDWPNL   YTRWC
Sbjct  306  DTPVLSISERAELEKVLEEIIEMLEQEEEQEKVLSLWLHHFTYCPSSDWPNLLASYTRWC  365

Query  479  TASR  468
            T SR
Sbjct  366  TTSR  369



>ref|XP_010690509.1| PREDICTED: uncharacterized protein LOC104904034 [Beta vulgaris 
subsp. vulgaris]
Length=369

 Score =   155 bits (393),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 92/124 (74%), Gaps = 1/124 (1%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGT  657
            + EPR+Q +LV ++AFL+ QA+ + KE   E    + L+QTNM ML +WLPLLCRASNGT
Sbjct  239  AAEPRVQASLVKLTAFLIKQAKDISKEQQTEGGISERLKQTNMKMLTTWLPLLCRASNGT  298

Query  656  DTPVLSINKRAELERTLELIINTLDEEE-QEKVLSLWLQHFTYCPSSDWPNLHDIYTRWC  480
            D P LS  +R+ELER LE +I+ ++E+E QEKVLSLWL HF +C SSDWPNL+  Y RWC
Sbjct  299  DAPTLSTIERSELERALEKMIDMIEEKENQEKVLSLWLHHFAHCSSSDWPNLYGSYIRWC  358

Query  479  TASR  468
              SR
Sbjct  359  NVSR  362



>ref|XP_007199902.1| hypothetical protein PRUPE_ppa006716mg [Prunus persica]
 gb|EMJ01101.1| hypothetical protein PRUPE_ppa006716mg [Prunus persica]
Length=398

 Score =   156 bits (395),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 89/124 (72%), Gaps = 1/124 (1%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGT  657
            S EP LQ +LV VSA L   A+ +  +A ++    ++ +Q  M ML+SWLPLLCR SNGT
Sbjct  266  SVEPSLQASLVKVSALLFKHAKDMGTDAADDDESKEQQKQRKMQMLMSWLPLLCRGSNGT  325

Query  656  DTPVLSINKRAELERTLELIINTLD-EEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWC  480
            D PVLSI +RAELER LE  I  L+ EE+QEKVLSLWL HFTYC SSDWPNLH  Y RWC
Sbjct  326  DVPVLSIRERAELERVLEDTIEMLEKEEDQEKVLSLWLHHFTYCSSSDWPNLHASYARWC  385

Query  479  TASR  468
             ASR
Sbjct  386  NASR  389



>ref|XP_009344578.1| PREDICTED: uncharacterized protein LOC103936468 [Pyrus x bretschneideri]
Length=398

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 89/124 (72%), Gaps = 1/124 (1%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGT  657
            S EPRLQ +LV  SA L   A+Q+ K+  ++ +K ++ +QT M ML+SWLPLLCRASNGT
Sbjct  267  SVEPRLQASLVKTSALLFKHAKQVGKDEADDEIKKEQHKQTKMQMLMSWLPLLCRASNGT  326

Query  656  DTPVLSINKRAELERTLELIINTL-DEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWC  480
            D PVLSI +R ELER LE  I  L DEE QEKVLSLWL HFT+   SDWPNLH  Y RWC
Sbjct  327  DVPVLSIAERTELERVLEETIEMLEDEENQEKVLSLWLHHFTHSSFSDWPNLHASYARWC  386

Query  479  TASR  468
              SR
Sbjct  387  NTSR  390



>gb|KJB77539.1| hypothetical protein B456_012G142500 [Gossypium raimondii]
Length=374

 Score =   154 bits (389),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 89/121 (74%), Gaps = 1/121 (1%)
 Frame = -1

Query  830  EPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGTDT  651
            E R+QG+LV VSAFL  Q + +  E  E   K + LRQT M ML++WLP LCR +NGTD 
Sbjct  244  ENRVQGSLVKVSAFLFRQMKDIGLEETEGGNK-ERLRQTKMKMLITWLPFLCRGNNGTDI  302

Query  650  PVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCTAS  471
            PVLS+++RAELE+ LE  I+ L  EEQE+VLSLWL +FTY PSSDWPNLH  Y RWCT S
Sbjct  303  PVLSLSERAELEKILEDAIDMLQHEEQEQVLSLWLHNFTYFPSSDWPNLHASYARWCTTS  362

Query  470  R  468
            R
Sbjct  363  R  363



>ref|XP_011459749.1| PREDICTED: uncharacterized protein LOC101309613 [Fragaria vesca 
subsp. vesca]
Length=375

 Score =   154 bits (388),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 92/131 (70%), Gaps = 8/131 (6%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLW-KEADE----ESMKYDELRQTN---MNMLVSWLPL  681
            S EPRLQ +LV +SA LL  A+ +   E DE    ESMK  + R+     M MLV W+PL
Sbjct  237  SAEPRLQASLVKISALLLRYAKNMGGNEGDEDDDNESMKEQQQRKQGKMQMQMLVLWIPL  296

Query  680  LCRASNGTDTPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLH  501
            LC ASNGTD PVLSI++RAELER LE  I  L EE+QE+VLSLWL HFTYC SSDWPNLH
Sbjct  297  LCTASNGTDVPVLSISERAELERLLEETIEKLAEEDQERVLSLWLHHFTYCSSSDWPNLH  356

Query  500  DIYTRWCTASR  468
              Y RWC ASR
Sbjct  357  ASYARWCNASR  367



>ref|XP_007042930.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 ref|XP_007042931.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 ref|XP_007042932.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOX98761.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOX98762.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOX98763.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=384

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 95/124 (77%), Gaps = 1/124 (1%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKEADE-ESMKYDELRQTNMNMLVSWLPLLCRASNG  660
            S EPR+Q +LV VSAFL  QA+ +  E +E E    + LRQT + ML SWLPLLCRASNG
Sbjct  255  SAEPRVQCSLVKVSAFLFKQAKDMGLEVEETEEGNKENLRQTKLKMLTSWLPLLCRASNG  314

Query  659  TDTPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWC  480
            TD PVLSI++RAELE+ LE  I  L++EEQE+VLSLWL HFT+ PSSDWPNLH+ Y RWC
Sbjct  315  TDAPVLSISERAELEKLLEETIEMLEQEEQEQVLSLWLHHFTHSPSSDWPNLHESYARWC  374

Query  479  TASR  468
            T SR
Sbjct  375  TTSR  378



>ref|XP_004485586.1| PREDICTED: uncharacterized protein LOC101515692 [Cicer arietinum]
Length=387

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 90/123 (73%), Gaps = 1/123 (1%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGT  657
            S +PRLQ +LV ++AFL  + + +  +  EES K  +  Q  + ML +WLPLLCRASNGT
Sbjct  257  SADPRLQASLVKLAAFLFKEVKDMGVDEIEES-KMKQCLQVKLKMLQTWLPLLCRASNGT  315

Query  656  DTPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCT  477
            D P LSIN+RAELER LE II  L++E+QE+VLSLWL HFT+C SSDWPNLH  + RWC 
Sbjct  316  DAPALSINERAELERVLEGIIEGLEQEKQEQVLSLWLHHFTHCSSSDWPNLHSCFARWCC  375

Query  476  ASR  468
             SR
Sbjct  376  TSR  378



>gb|EYU18473.1| hypothetical protein MIMGU_mgv1a025704mg [Erythranthe guttata]
Length=399

 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 99/133 (74%), Gaps = 10/133 (8%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKEADEESMKY---------DELRQTNMNMLVSWLP  684
            S EPRLQG+LV VSAFL+ QA+++ KE +EE  +            +RQT M ML+SWLP
Sbjct  259  SAEPRLQGSLVKVSAFLIKQAKEMGKEEEEEEKEDQETNTPSEEQHIRQTKMKMLMSWLP  318

Query  683  LLCRASNGTDTPVLSINKRAELERTLELIINTLDEE-EQEKVLSLWLQHFTYCPSSDWPN  507
            LLCRA+NGTD P+LS+ +RAE+ER LE II+TL EE EQE VLSLWL HFTYCP+SDWPN
Sbjct  319  LLCRANNGTDAPILSMGERAEMERILEAIISTLREEDEQECVLSLWLHHFTYCPASDWPN  378

Query  506  LHDIYTRWCTASR  468
            L   YTRW + +R
Sbjct  379  LRSCYTRWYSVTR  391



>ref|XP_004137277.1| PREDICTED: uncharacterized protein LOC101222931 [Cucumis sativus]
 gb|KGN53714.1| hypothetical protein Csa_4G109030 [Cucumis sativus]
Length=390

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 88/123 (72%), Gaps = 0/123 (0%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGT  657
            S EPRLQ +LV V+ FL  Q R++ K+ DEE     +  Q  + ML+SWLPLLCR S+GT
Sbjct  260  SAEPRLQASLVKVAVFLFKQCREMGKDEDEEESVKQQQMQMKLKMLISWLPLLCRGSSGT  319

Query  656  DTPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCT  477
            D P+LSI +R ELE  LE +I TL ++EQE+VL+LWL +FTY  SSDWPNLH  Y RW +
Sbjct  320  DAPILSIGERRELELGLEEMIGTLQQDEQEQVLALWLHNFTYLSSSDWPNLHASYARWYS  379

Query  476  ASR  468
            ASR
Sbjct  380  ASR  382



>ref|XP_008462861.1| PREDICTED: uncharacterized protein LOC103501143 [Cucumis melo]
Length=394

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 88/123 (72%), Gaps = 0/123 (0%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGT  657
            S EPRLQ +LV V+ FL  Q R++ K+ D E  +  +  QT + ML+SWLPLLCR SNGT
Sbjct  264  SAEPRLQASLVKVAVFLFKQCREMGKDEDGEESEKQQQMQTKLKMLISWLPLLCRGSNGT  323

Query  656  DTPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCT  477
            D P+LSI +R ELE  LE +I TL ++EQE+VL+LWL +FTY   SDWPNLH  Y RW +
Sbjct  324  DAPILSIGERRELELGLEEMIGTLQQDEQEQVLALWLHNFTYSSLSDWPNLHASYARWYS  383

Query  476  ASR  468
            ASR
Sbjct  384  ASR  386



>ref|XP_009337874.1| PREDICTED: uncharacterized protein LOC103930287 isoform X1 [Pyrus 
x bretschneideri]
Length=402

 Score =   149 bits (375),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 89/124 (72%), Gaps = 1/124 (1%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGT  657
            S EP LQ  LV VSA L   A+ L  +  ++  K ++ +QT M ML+SWLPLLCRASNGT
Sbjct  271  SVEPHLQAFLVKVSALLFKHAKHLGMDETDDESKKEQHKQTKMQMLMSWLPLLCRASNGT  330

Query  656  DTPVLSINKRAELERTL-ELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWC  480
            D PVLSI +RAELER L E I    +E++QEKVLSLWL HFT+C SSDWPNLH  Y RWC
Sbjct  331  DVPVLSIKERAELERVLEETIEMLEEEKDQEKVLSLWLHHFTHCSSSDWPNLHASYARWC  390

Query  479  TASR  468
             ASR
Sbjct  391  NASR  394



>ref|XP_009337875.1| PREDICTED: uncharacterized protein LOC103930287 isoform X2 [Pyrus 
x bretschneideri]
Length=402

 Score =   149 bits (375),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 89/124 (72%), Gaps = 1/124 (1%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGT  657
            S EP LQ  LV VSA L   A+ L  +  ++  K ++ +QT M ML+SWLPLLCRASNGT
Sbjct  271  SVEPHLQAFLVKVSALLFKHAKHLGMDETDDESKKEQHKQTKMQMLMSWLPLLCRASNGT  330

Query  656  DTPVLSINKRAELERTL-ELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWC  480
            D PVLSI +RAELER L E I    +E++QEKVLSLWL HFT+C SSDWPNLH  Y RWC
Sbjct  331  DVPVLSIKERAELERVLEETIEMLEEEKDQEKVLSLWLHHFTHCSSSDWPNLHASYARWC  390

Query  479  TASR  468
             ASR
Sbjct  391  NASR  394



>ref|XP_003593210.1| hypothetical protein MTR_2g008960 [Medicago truncatula]
 gb|AES63461.1| transmembrane protein, putative [Medicago truncatula]
Length=374

 Score =   148 bits (373),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 89/123 (72%), Gaps = 1/123 (1%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGT  657
            + +PRLQ +LV ++AFL  +A+    +  EES K  +  Q  + ML +WLPLLCRASNG+
Sbjct  244  TADPRLQASLVKLAAFLFKEAKDFGADEIEES-KMKQCIQVKLKMLQTWLPLLCRASNGS  302

Query  656  DTPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCT  477
            D P LSIN+RAELER LE II  L++E+QE+VLSLWL HFT+C S+DWPNL   Y RWC 
Sbjct  303  DAPALSINERAELERVLEGIIERLEQEKQEQVLSLWLHHFTHCSSTDWPNLQSCYARWCC  362

Query  476  ASR  468
             SR
Sbjct  363  KSR  365



>ref|XP_010484194.1| PREDICTED: uncharacterized protein LOC104762577 [Camelina sativa]
Length=381

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 91/124 (73%), Gaps = 3/124 (2%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQ-LWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNG  660
            S EPRLQ +LV +SA L  +A++    E DEE    D+  +TN  MLVSW+PLLCRASNG
Sbjct  243  SSEPRLQSSLVQISALLFKEAKKDTEMERDEEKSTRDD--ETNKKMLVSWIPLLCRASNG  300

Query  659  TDTPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWC  480
             D PVL  ++RAELE+ LE +I+ L E+EQE+VLSLWL H+T+C SSDWP+L+  Y RWC
Sbjct  301  ADKPVLRSSERAELEKVLEKMISGLKEDEQERVLSLWLHHYTHCSSSDWPDLNGSYVRWC  360

Query  479  TASR  468
             +SR
Sbjct  361  HSSR  364



>ref|XP_006423857.1| hypothetical protein CICLE_v10028678mg [Citrus clementina]
 gb|ESR37097.1| hypothetical protein CICLE_v10028678mg [Citrus clementina]
Length=373

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 91/124 (73%), Gaps = 2/124 (2%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGT  657
            S EPRLQ +LV +SAF    A+ L  E  EE  K ++ R+TN  MLVSWLPLLCR SNG 
Sbjct  244  SAEPRLQSSLVKISAFFFKHAKDLSLEEPEEGKKEEQ-RKTNKKMLVSWLPLLCRGSNGV  302

Query  656  DTPVLSINKRAELERTLELIINTLDEE-EQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWC  480
            + PV+S+N+RAELE+ LE  I+ L++E EQE+VLSLWL HFTYC S+DWPNLH  Y RW 
Sbjct  303  NVPVMSLNERAELEKVLEETIDMLEQEDEQEQVLSLWLHHFTYCSSADWPNLHASYARWY  362

Query  479  TASR  468
             ASR
Sbjct  363  NASR  366



>ref|XP_008348814.1| PREDICTED: uncharacterized protein LOC103411982 [Malus domestica]
Length=401

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 92/125 (74%), Gaps = 4/125 (3%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLW-KEADEESMKYDELRQTNMNMLVSWLPLLCRASNG  660
            S EPRLQ +LV VSA L   A+ L   E D+ES K  + +QT M ML+SWLPLLCRASNG
Sbjct  271  SVEPRLQASLVKVSALLFKHAKHLGMDETDDESKK--QHKQTKMQMLMSWLPLLCRASNG  328

Query  659  TDTPVLSINKRAELERTL-ELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRW  483
            TD PVLSI +RAELER L E I    +EE+QEKVLSLWL HFT+C SSDWPNLH  Y RW
Sbjct  329  TDVPVLSIGERAELERVLEETIEMLEEEEDQEKVLSLWLHHFTHCSSSDWPNLHASYARW  388

Query  482  CTASR  468
            C ASR
Sbjct  389  CNASR  393



>gb|KJB77538.1| hypothetical protein B456_012G142400 [Gossypium raimondii]
Length=333

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 80/111 (72%), Gaps = 5/111 (5%)
 Frame = -1

Query  800  VSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGTDTPVLSINKRAE  621
            ++AFL  Q + +  +  EE       RQT M ML SWLPLLCR SNGTD PVLS+++RAE
Sbjct  219  LAAFLFKQMKDMDSDETEEGS-----RQTKMKMLTSWLPLLCRGSNGTDMPVLSLSERAE  273

Query  620  LERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCTASR  468
            LE+ LE  ++ L  +EQE+VLSLWL HFTYCPSSDWPNLH  Y RWCT SR
Sbjct  274  LEKILEDTVDMLQHKEQEQVLSLWLHHFTYCPSSDWPNLHASYARWCTTSR  324



>ref|XP_006493890.1| PREDICTED: uncharacterized protein LOC102621648 isoform X1 [Citrus 
sinensis]
Length=373

 Score =   143 bits (361),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 90/124 (73%), Gaps = 2/124 (2%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGT  657
            S EPRLQ +LV +SAF    A+ L  E  EE  K ++ R+T   MLVSWLPLLCR SNG 
Sbjct  244  SAEPRLQSSLVKISAFFFKHAKDLSLEEPEEGKKEEQ-RKTKKKMLVSWLPLLCRGSNGV  302

Query  656  DTPVLSINKRAELERTLELIINTLDEE-EQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWC  480
            D PV+S+N+RAELE+ LE  I+ L++E EQE+VLSLWL HFTYC S+DWPNLH  Y RW 
Sbjct  303  DVPVMSLNERAELEKVLEETIDMLEQEDEQEQVLSLWLHHFTYCSSADWPNLHASYARWY  362

Query  479  TASR  468
             ASR
Sbjct  363  NASR  366



>ref|XP_010461545.1| PREDICTED: uncharacterized protein LOC104742256 [Camelina sativa]
Length=383

 Score =   143 bits (360),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 90/124 (73%), Gaps = 3/124 (2%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQ-LWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNG  660
            S EPRLQ +LV +SA L  +A++    E DEE    D+  +TN  MLVSW+PLLCRASNG
Sbjct  244  SSEPRLQSSLVQISALLFKEAKKDTEMERDEEKSTRDD--ETNKKMLVSWIPLLCRASNG  301

Query  659  TDTPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWC  480
             D PVL  ++R ELE+ LE +I+ L EEEQE+VLSLWL H+T+C SSDWP+L+  Y RWC
Sbjct  302  ADKPVLRSSEREELEKVLEKMISELKEEEQERVLSLWLHHYTHCSSSDWPDLNGSYVRWC  361

Query  479  TASR  468
             +SR
Sbjct  362  HSSR  365



>ref|XP_010444356.1| PREDICTED: uncharacterized protein LOC104727054 [Camelina sativa]
Length=379

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 90/124 (73%), Gaps = 3/124 (2%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQ-LWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNG  660
            S EPRLQ +LV +SA L  +A++    E DEE    D+  +TN  ML+SW+PLLCRASNG
Sbjct  241  SSEPRLQSSLVQISALLFKEAKKDTEMERDEEKSTRDD--ETNKKMLISWIPLLCRASNG  298

Query  659  TDTPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWC  480
             D PVL  ++R ELE+ LE +I+ L EEEQE+VLSLWL H+T+C SSDWP+L+  Y RWC
Sbjct  299  ADKPVLRSSEREELEKVLEKMISELKEEEQERVLSLWLHHYTHCSSSDWPDLNGSYVRWC  358

Query  479  TASR  468
             +SR
Sbjct  359  HSSR  362



>gb|AAK93619.1| unknown protein [Arabidopsis thaliana]
Length=271

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 90/123 (73%), Gaps = 0/123 (0%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGT  657
            S EPRLQ +L+ +SA L  +A+ + K ++EE  +  +LR+    ML+SW+PLLCRASNG 
Sbjct  143  SCEPRLQCSLIQISALLFKEAKDIKKGSEEEEGEEAKLREIKKKMLISWIPLLCRASNGA  202

Query  656  DTPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCT  477
            D PVL   +RA LE+ LE +I+ L EEEQE+VLSLWL H+T+C SSDWP+L+  Y RWC 
Sbjct  203  DKPVLRSAERAYLEKVLEKMISELKEEEQERVLSLWLHHYTHCASSDWPDLNGSYVRWCH  262

Query  476  ASR  468
            +SR
Sbjct  263  SSR  265



>dbj|BAE71289.1| hypothetical protein [Trifolium pratense]
Length=375

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 90/123 (73%), Gaps = 1/123 (1%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGT  657
            S +PRLQ +LV ++AFL  +A+ L  +  EES K  +  Q  + ML +WLPLLCRASNGT
Sbjct  245  SADPRLQSSLVKLAAFLFKEAKDLGVDEIEES-KIKQCMQVKLKMLQTWLPLLCRASNGT  303

Query  656  DTPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCT  477
            D P LSIN+RA LER LE II  L++E+QE++LSLWL HFT+C SSDWPNLH  Y RWC 
Sbjct  304  DAPALSINERAGLERVLEDIIEELEQEKQEQILSLWLHHFTHCSSSDWPNLHSCYARWCC  363

Query  476  ASR  468
             SR
Sbjct  364  KSR  366



>ref|XP_010520922.1| PREDICTED: uncharacterized protein LOC104799930 [Tarenaya hassleriana]
Length=371

 Score =   140 bits (354),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 85/121 (70%), Gaps = 3/121 (2%)
 Frame = -1

Query  830  EPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGTDT  651
            EPRLQG++V +SAFL  Q +++ K    E  + D+ R T   ML SWLPLLCRASNG + 
Sbjct  246  EPRLQGSMVQISAFLFKQVKEMGKG---EGGEKDKWRLTKKKMLTSWLPLLCRASNGAEK  302

Query  650  PVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCTAS  471
            P L   ++ +LER LE  I+ L  E+QE+VLSLWL HFT+C SSDWPNLH  Y RWC++S
Sbjct  303  PFLRTVEQTKLERVLEETISELKIEDQEQVLSLWLHHFTHCSSSDWPNLHASYARWCSSS  362

Query  470  R  468
            R
Sbjct  363  R  363



>gb|KJB77540.1| hypothetical protein B456_012G142500 [Gossypium raimondii]
Length=364

 Score =   140 bits (353),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 82/121 (68%), Gaps = 11/121 (9%)
 Frame = -1

Query  830  EPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGTDT  651
            E R+QG+LV VS              + E    + LRQT M ML++WLP LCR +NGTD 
Sbjct  244  ENRVQGSLVKVSGL-----------EETEGGNKERLRQTKMKMLITWLPFLCRGNNGTDI  292

Query  650  PVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCTAS  471
            PVLS+++RAELE+ LE  I+ L  EEQE+VLSLWL +FTY PSSDWPNLH  Y RWCT S
Sbjct  293  PVLSLSERAELEKILEDAIDMLQHEEQEQVLSLWLHNFTYFPSSDWPNLHASYARWCTTS  352

Query  470  R  468
            R
Sbjct  353  R  353



>ref|NP_568987.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AED97858.1| uncharacterized protein AT5G64230 [Arabidopsis thaliana]
Length=379

 Score =   139 bits (351),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 90/123 (73%), Gaps = 0/123 (0%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGT  657
            S EPRLQ +L+ +SA L  +A+ + K ++EE  +  +LR+    ML+SW+PLLCRASNG 
Sbjct  251  SCEPRLQCSLIQISALLFKEAKDIKKGSEEEEGEEAKLREIKKKMLISWIPLLCRASNGA  310

Query  656  DTPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCT  477
            D PVL   +RA LE+ LE +I+ L EEEQE+VLSLWL H+T+C SSDWP+L+  Y RWC 
Sbjct  311  DKPVLRSAERAYLEKVLEKMISELKEEEQERVLSLWLHHYTHCASSDWPDLNGSYVRWCH  370

Query  476  ASR  468
            +SR
Sbjct  371  SSR  373



>ref|XP_010269304.1| PREDICTED: uncharacterized protein LOC104606004 [Nelumbo nucifera]
Length=377

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 87/126 (69%), Gaps = 3/126 (2%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLW--KEADEESMKYDELRQTNMNMLVSWLPLLCRASN  663
            S  PRLQG+LV VSAFL    ++L   +E  ++  K ++     M +L++WLPLLCRASN
Sbjct  246  SAPPRLQGSLVKVSAFLFKHVKELGDGEEVKDDKDKREKEEGRKMKILMTWLPLLCRASN  305

Query  662  GTDTPVLSINKRAELERTLELIINTLD-EEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTR  486
            GTD P+LS  +R E+++ LE  I  L+ EEEQE+VL+LWL HF  CP+SDWPNL   Y R
Sbjct  306  GTDAPILSAKEREEVQKVLEETIEMLNREEEQEQVLALWLDHFISCPNSDWPNLQACYVR  365

Query  485  WCTASR  468
            WC ASR
Sbjct  366  WCDASR  371



>ref|XP_004290342.1| PREDICTED: uncharacterized protein LOC101311058 [Fragaria vesca 
subsp. vesca]
Length=392

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 90/130 (69%), Gaps = 7/130 (5%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWK----EADEESMKYDELR---QTNMNMLVSWLPLL  678
            S EPRLQ +LV +SA LL  A+ +      + D ES K  + R   +  M ML+ W+PLL
Sbjct  255  SAEPRLQASLVKLSALLLKYAKDMGVNEGIDDDTESKKEQQKRNEAKMQMQMLMLWIPLL  314

Query  677  CRASNGTDTPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHD  498
            C ASNGTD PVLS+ +RAELER +E  I TL+EE+QE VLSLWL HFTYC SSDWPNLH 
Sbjct  315  CIASNGTDVPVLSVGERAELERVMEETIETLEEEDQEGVLSLWLHHFTYCSSSDWPNLHA  374

Query  497  IYTRWCTASR  468
             Y RWC ASR
Sbjct  375  SYARWCNASR  384



>ref|XP_007042934.1| Uncharacterized protein TCM_007451 [Theobroma cacao]
 gb|EOX98765.1| Uncharacterized protein TCM_007451 [Theobroma cacao]
Length=141

 Score =   128 bits (322),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 78/107 (73%), Gaps = 1/107 (1%)
 Frame = -1

Query  800  VSAFLLDQARQLWKEADE-ESMKYDELRQTNMNMLVSWLPLLCRASNGTDTPVLSINKRA  624
            + AFL  QA+++  E +E E    + LRQT + ML SWLPLLCRA NGTD P L I++RA
Sbjct  15   LGAFLFKQAKEMGLEVEETEEGNKENLRQTKLKMLTSWLPLLCRARNGTDAPELRISERA  74

Query  623  ELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRW  483
            ELE+ LE  I  L++EEQE+VLSLWL HFT+ PSSDWPNLH+ Y  W
Sbjct  75   ELEKLLEETIEMLEKEEQEQVLSLWLHHFTHSPSSDWPNLHESYACW  121



>gb|KDO49112.1| hypothetical protein CISIN_1g0173161mg, partial [Citrus sinensis]
Length=115

 Score =   127 bits (318),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 69/86 (80%), Gaps = 1/86 (1%)
 Frame = -1

Query  722  RQTNMNMLVSWLPLLCRASNGTDTPVLSINKRAELERTLELIINTLDEE-EQEKVLSLWL  546
            R+TN  MLVSWLPLLCR SNG D PV+S+N+RAELE+ LE  I+ L++E EQE+VLSLWL
Sbjct  23   RKTNKKMLVSWLPLLCRGSNGVDVPVMSLNERAELEKVLEETIDMLEQEDEQEQVLSLWL  82

Query  545  QHFTYCPSSDWPNLHDIYTRWCTASR  468
             HFTYC S+DWPNLH  Y RW  ASR
Sbjct  83   HHFTYCSSADWPNLHASYARWYNASR  108



>ref|XP_006394183.1| hypothetical protein EUTSA_v10004757mg [Eutrema salsugineum]
 gb|ESQ31469.1| hypothetical protein EUTSA_v10004757mg [Eutrema salsugineum]
Length=275

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 85/121 (70%), Gaps = 1/121 (1%)
 Frame = -1

Query  830  EPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGTDT  651
            EPRLQ ++V +SA L  +AR +     EE  + ++ R+    ML SWLPLLCRASNG D 
Sbjct  143  EPRLQCSMVQISALLFKEARDI-GIGTEEEAEEEKWREIKKKMLTSWLPLLCRASNGADK  201

Query  650  PVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCTAS  471
            PVL   +RAELE+ LE +I+ L EEEQE+VLSLW+ H+T C SSDWP+L+  Y RWC +S
Sbjct  202  PVLRSVERAELEKVLEKMISKLKEEEQEQVLSLWIHHYTSCSSSDWPDLNGSYVRWCDSS  261

Query  470  R  468
            R
Sbjct  262  R  262



>gb|KFK28114.1| hypothetical protein AALP_AA8G474500 [Arabis alpina]
Length=367

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 88/123 (72%), Gaps = 6/123 (5%)
 Frame = -1

Query  830  EPRLQGALVXVSAFLLDQARQLW--KEADEESMKYDELRQTNMNMLVSWLPLLCRASNGT  657
            EPRLQ ++V +SA L  +A+ +   +EA+E+    ++ R+    M++SWLPLLCRASNG 
Sbjct  235  EPRLQCSMVQISALLFKEAKDMGMGREAEEK----EKWREIKKKMIISWLPLLCRASNGA  290

Query  656  DTPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCT  477
            D PVL   +RAE+E+ LE +I+ + EEEQE+VLSLWL H+T C  SDWP+L+  Y RWC 
Sbjct  291  DKPVLRSAERAEVEKVLEKMISEMKEEEQEQVLSLWLHHYTSCSYSDWPDLNGSYLRWCV  350

Query  476  ASR  468
            +SR
Sbjct  351  SSR  353



>ref|XP_010937432.1| PREDICTED: uncharacterized protein LOC105056811 isoform X2 [Elaeis 
guineensis]
Length=377

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 78/125 (62%), Gaps = 8/125 (6%)
 Frame = -1

Query  830  EPRLQGALVXVSAFLLDQARQL----WKEADEESMKYDELRQTNMNMLVSWLPLLCRASN  663
            EPRLQ AL  VSAFLL  A       WK   E+      +    M ML SWLPLLCRASN
Sbjct  252  EPRLQVALARVSAFLLKHANSTQMEEWKGEGEDG----SIAHYRMAMLTSWLPLLCRASN  307

Query  662  GTDTPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRW  483
            G  TP+LS  +R E+ R LE II  L  E+QE+VL+LWL HFT CP SDWPNL   YTRW
Sbjct  308  GVGTPILSSGERVEMVRVLEEIIEKLSWEQQEEVLALWLHHFTSCPDSDWPNLVSCYTRW  367

Query  482  CTASR  468
             + SR
Sbjct  368  YSESR  372



>ref|XP_002864888.1| hypothetical protein ARALYDRAFT_496623 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41147.1| hypothetical protein ARALYDRAFT_496623 [Arabidopsis lyrata subsp. 
lyrata]
Length=411

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 90/123 (73%), Gaps = 1/123 (1%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGT  657
            S EPRLQ +LV +SA L  +A+ + KE  EE  +   L++    ML+SW+PLLCRASNG 
Sbjct  277  SSEPRLQCSLVQISALLFKEAKDI-KEGKEEEAEEANLKEIKKKMLISWIPLLCRASNGA  335

Query  656  DTPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCT  477
            D PVL   +RA+LE+ LE +I+ L+EEEQE+VLSLWL H+T+C SSDWP+L+  Y RWC 
Sbjct  336  DKPVLRSAERADLEKVLEKMISELNEEEQERVLSLWLHHYTHCSSSDWPDLNGSYVRWCH  395

Query  476  ASR  468
            +SR
Sbjct  396  SSR  398



>ref|XP_010939663.1| PREDICTED: uncharacterized protein LOC105058425 [Elaeis guineensis]
Length=388

 Score =   127 bits (318),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 77/123 (63%), Gaps = 0/123 (0%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGT  657
            S E RLQ A V VS FL   A     EA +   +   +    M ML SWLPLLCRASNGT
Sbjct  261  SAEVRLQVAFVRVSVFLFKHANSKQMEAWKGEGEDRSIAHCQMAMLTSWLPLLCRASNGT  320

Query  656  DTPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCT  477
            DTP+LS  +RAE+ R LE +I  L  E+QE+V++LWL HF  CP SDWPNL   Y RW +
Sbjct  321  DTPILSSGERAEMVRVLEEMIEQLGWEQQEEVMALWLYHFMSCPDSDWPNLESCYIRWYS  380

Query  476  ASR  468
             SR
Sbjct  381  ESR  383



>ref|XP_008790884.1| PREDICTED: uncharacterized protein LOC103707937 [Phoenix dactylifera]
Length=393

 Score =   127 bits (318),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 79/127 (62%), Gaps = 8/127 (6%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQAR----QLWKEADEESMKYDELRQTNMNMLVSWLPLLCRA  669
            S EPRLQ A V VSAFL   A+    + WK  DE+      +    M ML SWLPLLC A
Sbjct  266  SAEPRLQVAFVRVSAFLFKHAKSKEMEEWKGEDEDG----SVANCQMAMLTSWLPLLCHA  321

Query  668  SNGTDTPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYT  489
            SNGTDT +LS  +RAE+   LE +I  L  E+QE+V++LWL HF  CP SDWPNL   Y 
Sbjct  322  SNGTDTAILSSGERAEMVMLLEEMIKKLGWEQQEEVMALWLHHFMSCPDSDWPNLESCYI  381

Query  488  RWCTASR  468
            RW + SR
Sbjct  382  RWYSESR  388



>dbj|BAB09854.1| unnamed protein product [Arabidopsis thaliana]
Length=403

 Score =   126 bits (317),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 90/147 (61%), Gaps = 24/147 (16%)
 Frame = -1

Query  836  SXEPRLQGALVXVS------------------------AFLLDQARQLWKEADEESMKYD  729
            S EPRLQ +L+ +S                        A L  +A+ + K ++EE  +  
Sbjct  251  SCEPRLQCSLIQISGYSFFILYDKNILTFQNKFHFYCEALLFKEAKDIKKGSEEEEGEEA  310

Query  728  ELRQTNMNMLVSWLPLLCRASNGTDTPVLSINKRAELERTLELIINTLDEEEQEKVLSLW  549
            +LR+    ML+SW+PLLCRASNG D PVL   +RA LE+ LE +I+ L EEEQE+VLSLW
Sbjct  311  KLREIKKKMLISWIPLLCRASNGADKPVLRSAERAYLEKVLEKMISELKEEEQERVLSLW  370

Query  548  LQHFTYCPSSDWPNLHDIYTRWCTASR  468
            L H+T+C SSDWP+L+  Y RWC +SR
Sbjct  371  LHHYTHCASSDWPDLNGSYVRWCHSSR  397



>ref|XP_010937431.1| PREDICTED: uncharacterized protein LOC105056811 isoform X1 [Elaeis 
guineensis]
Length=390

 Score =   121 bits (304),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 78/138 (57%), Gaps = 21/138 (15%)
 Frame = -1

Query  830  EPRLQGALVXVSA-------------FLLDQARQL----WKEADEESMKYDELRQTNMNM  702
            EPRLQ AL  VSA             FLL  A       WK   E+      +    M M
Sbjct  252  EPRLQVALARVSAKPNAQSKSFFHAAFLLKHANSTQMEEWKGEGEDG----SIAHYRMAM  307

Query  701  LVSWLPLLCRASNGTDTPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPS  522
            L SWLPLLCRASNG  TP+LS  +R E+ R LE II  L  E+QE+VL+LWL HFT CP 
Sbjct  308  LTSWLPLLCRASNGVGTPILSSGERVEMVRVLEEIIEKLSWEQQEEVLALWLHHFTSCPD  367

Query  521  SDWPNLHDIYTRWCTASR  468
            SDWPNL   YTRW + SR
Sbjct  368  SDWPNLVSCYTRWYSESR  385



>ref|XP_008778096.1| PREDICTED: uncharacterized protein LOC103697933 [Phoenix dactylifera]
Length=390

 Score =   121 bits (303),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 80/130 (62%), Gaps = 11/130 (8%)
 Frame = -1

Query  836  SXEPRLQGALVXV---SAFLLDQA--RQL--WKEADEESMKYDELRQTNMNMLVSWLPLL  678
            S EPRLQ ALV     +AFL   A  +Q+  WK   E+      +    M ML SWLPLL
Sbjct  260  SAEPRLQVALVRTFFGAAFLFKHANSKQMEEWKGEGEDG----SIAHYRMAMLTSWLPLL  315

Query  677  CRASNGTDTPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHD  498
            CRASNG   P++S  +R E+ R LE II  L  E+QE++L+LWL HFT CP SDWPNL  
Sbjct  316  CRASNGVGAPIMSSGERVEMLRVLEEIIEKLSWEQQEEILALWLHHFTSCPDSDWPNLVS  375

Query  497  IYTRWCTASR  468
             YTRW + SR
Sbjct  376  CYTRWYSESR  385



>emb|CDY31332.1| BnaA02g34090D [Brassica napus]
Length=369

 Score =   117 bits (294),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 85/121 (70%), Gaps = 10/121 (8%)
 Frame = -1

Query  830  EPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGTDT  651
            EPRLQ ++V +SA L       +KEA     K+ E+++    ML SWLPLLCRASNG D 
Sbjct  242  EPRLQCSMVQISALL-------FKEAAAGGEKWGEIKK---KMLTSWLPLLCRASNGADK  291

Query  650  PVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCTAS  471
            PVL   +RAELE+ LE +I+ L+EEEQE+VLSLWL H+T C SSDWP+L+  Y RWC +S
Sbjct  292  PVLRGAERAELEKVLEKMISELEEEEQEQVLSLWLHHYTACSSSDWPDLNGSYVRWCHSS  351

Query  470  R  468
            R
Sbjct  352  R  352



>ref|XP_009130442.1| PREDICTED: uncharacterized protein LOC103855230 [Brassica rapa]
Length=369

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 85/121 (70%), Gaps = 10/121 (8%)
 Frame = -1

Query  830  EPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGTDT  651
            EPRLQ ++V +SA L       +KEA     K+ E+++    ML SWLPLLCRASNG D 
Sbjct  242  EPRLQCSMVQISALL-------FKEAAGGEEKWGEIKK---KMLTSWLPLLCRASNGADK  291

Query  650  PVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCTAS  471
            PVL   +RAELE+ LE +I+ L+EEEQE+VLSLWL H+T C SSDWP+L+  Y RWC +S
Sbjct  292  PVLRSAERAELEKVLEKMISELEEEEQEQVLSLWLHHYTACSSSDWPDLNGSYVRWCHSS  351

Query  470  R  468
            R
Sbjct  352  R  352



>ref|XP_009419802.1| PREDICTED: uncharacterized protein LOC103999707 [Musa acuminata 
subsp. malaccensis]
Length=387

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 77/125 (62%), Gaps = 5/125 (4%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKEADEESMKYDE---LRQTNMNMLVSWLPLLCRAS  666
            S  PRLQ ALV V AF+   A    K  DE  ++ +E   L    M ML SWLPL+C+A 
Sbjct  261  SAVPRLQVALVRVCAFMFKHANS--KNFDEVKVREEEESHLAIFQMAMLKSWLPLICQAC  318

Query  665  NGTDTPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTR  486
            NG DTP+LS   RAE+   LE +I  L  ++QE+VLSLWL HFT CP SDWPNL   Y R
Sbjct  319  NGVDTPILSSRVRAEMVSMLEEMIEKLSWDQQEEVLSLWLHHFTECPDSDWPNLESCYMR  378

Query  485  WCTAS  471
            W + S
Sbjct  379  WYSES  383



>ref|XP_006280766.1| hypothetical protein CARUB_v10026735mg [Capsella rubella]
 gb|EOA13664.1| hypothetical protein CARUB_v10026735mg [Capsella rubella]
Length=339

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 79/124 (64%), Gaps = 12/124 (10%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGT  657
            S EPRLQ  LV + A +            +E+ + +   +T   ML SW+PLLCRASNG 
Sbjct  219  SSEPRLQSCLVQICALMF-----------KEAKEMEREEETKKKMLASWIPLLCRASNGA  267

Query  656  DTPVLSINKRAELERTLELIINTLD-EEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWC  480
            D PVL   +RAELE+ LE +I+ L  EEEQE +LSLWL H+T C SSDWP+L+  Y RWC
Sbjct  268  DKPVLRSAERAELEKVLEEMISQLKREEEQEVILSLWLHHYTLCSSSDWPDLNASYLRWC  327

Query  479  TASR  468
             +SR
Sbjct  328  HSSR  331



>emb|CDY63725.1| BnaC02g48850D [Brassica napus]
Length=371

 Score =   115 bits (289),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 86/121 (71%), Gaps = 10/121 (8%)
 Frame = -1

Query  830  EPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGTDT  651
            EPRLQ ++V +SA L  +A      A EE  K+ E+++    M  SWLPLLCRASNG+D 
Sbjct  244  EPRLQCSMVQISALLFKEA-----AAGEE--KWGEIKK---KMFTSWLPLLCRASNGSDK  293

Query  650  PVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCTAS  471
            PVL   +RAELE+ LE +I+ L+EEEQE+VLSLWL H+T C +SDWP+L+  Y RWC +S
Sbjct  294  PVLRSVERAELEKVLEKMISELEEEEQEQVLSLWLHHYTACSASDWPDLNGSYVRWCNSS  353

Query  470  R  468
            R
Sbjct  354  R  354



>ref|XP_002525862.1| hypothetical protein RCOM_0824750 [Ricinus communis]
 gb|EEF36556.1| hypothetical protein RCOM_0824750 [Ricinus communis]
Length=92

 Score =   109 bits (272),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 63/85 (74%), Gaps = 1/85 (1%)
 Frame = -1

Query  719  QTNMNMLVSWLPLLCRASNGTDTPVLSINKRAELERTLELIINTLDEEE-QEKVLSLWLQ  543
            Q+   ML++W+PLLCR SN TD  VLS  +RAELER LE +I  L+EEE QE+VLS+WL 
Sbjct  2    QSKKKMLMAWVPLLCRGSNSTDISVLSTIERAELERILEELIGMLEEEEDQEQVLSIWLH  61

Query  542  HFTYCPSSDWPNLHDIYTRWCTASR  468
            HFTY P+ DWPNL   Y+ WCT SR
Sbjct  62   HFTYSPTCDWPNLRASYSHWCTTSR  86



>ref|XP_002454249.1| hypothetical protein SORBIDRAFT_04g027520 [Sorghum bicolor]
 gb|EES07225.1| hypothetical protein SORBIDRAFT_04g027520 [Sorghum bicolor]
Length=381

 Score =   114 bits (286),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 78/124 (63%), Gaps = 5/124 (4%)
 Frame = -1

Query  830  EPRLQGALVXVSAFLLDQARQLWKEADEESMKYDE---LRQTNMNMLVSWLPLLCRASNG  660
            EP LQ +L+ ++ FLL  A    +E ++ +   D+   + +  M ML SWLPLLCR SNG
Sbjct  256  EPALQVSLLRLAVFLLKHANS--REFEQSAGGKDDKAAVAEQRMAMLRSWLPLLCRGSNG  313

Query  659  TDTPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWC  480
            TD PVL+  +R E+   LE +I+ L  E+QE+ LSLWL HF  CP +DWPNL   YTRW 
Sbjct  314  TDAPVLTSRERPEMVAVLEDMIDKLSWEQQEEALSLWLHHFAACPDTDWPNLESCYTRWY  373

Query  479  TASR  468
              SR
Sbjct  374  AESR  377



>ref|XP_004955218.1| PREDICTED: uncharacterized protein LOC101770073 [Setaria italica]
Length=438

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 72/121 (60%), Gaps = 0/121 (0%)
 Frame = -1

Query  830  EPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGTDT  651
            EP LQ +L+ ++ FL   A     E          + +  M ML SWLPLLCR SNGTD 
Sbjct  314  EPALQVSLLRLAVFLFQHANSREFEQGAGGKDTGAVAEQRMAMLRSWLPLLCRGSNGTDA  373

Query  650  PVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCTAS  471
            PVL+  +R E+   LE +I+ L  E++E+VLSLWL HF  CP +DWPNL   YTRW   S
Sbjct  374  PVLTGREREEMVAVLEDLIDKLSWEQREEVLSLWLHHFAACPDTDWPNLESSYTRWYVES  433

Query  470  R  468
            R
Sbjct  434  R  434



>gb|EEC74030.1| hypothetical protein OsI_08983 [Oryza sativa Indica Group]
Length=304

 Score =   111 bits (278),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 76/125 (61%), Gaps = 7/125 (6%)
 Frame = -1

Query  830  EPRLQGALVXVSAFLLDQAR----QLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASN  663
            EP LQ AL+ ++ FL   A     +L    +E+     E R   +++L SWLPLLCR SN
Sbjct  179  EPTLQVALLRLAVFLFKHANSREFELSPGGNEDKGAIAEQR---VSLLRSWLPLLCRGSN  235

Query  662  GTDTPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRW  483
            GTD PVLS  +R E+   L+ +I  L  E+QE++L+LWL HF  CP +DWPNL   YTRW
Sbjct  236  GTDAPVLSSKERTEMVAVLDELIGKLGWEQQEEILALWLHHFAACPDTDWPNLESCYTRW  295

Query  482  CTASR  468
               SR
Sbjct  296  YAESR  300



>ref|XP_006649060.1| PREDICTED: uncharacterized protein LOC102709344 [Oryza brachyantha]
Length=179

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 75/125 (60%), Gaps = 7/125 (6%)
 Frame = -1

Query  830  EPRLQGALVXVSAFLLDQAR----QLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASN  663
            +P LQ AL+ ++ FL   A     +L    +EE     E R   +++L SWL LLCR SN
Sbjct  54   DPTLQVALLRLAVFLFKHANSREFELCPGGNEEKGAIAEQR---VSLLRSWLALLCRGSN  110

Query  662  GTDTPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRW  483
            GTD PVLS  +R E+   L+ +I  L  E+QE+VL+LWL HF  CP +DWPNL   YTRW
Sbjct  111  GTDAPVLSCKERTEMVAVLDDLIGKLPWEQQEEVLALWLHHFAACPDTDWPNLESCYTRW  170

Query  482  CTASR  468
               SR
Sbjct  171  YAESR  175



>ref|NP_001048156.1| Os02g0754600 [Oryza sativa Japonica Group]
 dbj|BAD17241.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF10070.1| Os02g0754600 [Oryza sativa Japonica Group]
 gb|EEE57829.1| hypothetical protein OsJ_08427 [Oryza sativa Japonica Group]
Length=380

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 75/122 (61%), Gaps = 1/122 (1%)
 Frame = -1

Query  830  EPRLQGALVXVSAFLLDQARQL-WKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGTD  654
            EP LQ AL+ ++ FL   A    ++ +   +     + +  +++L SWLPLLCR SNGTD
Sbjct  255  EPTLQVALLRLAVFLFKHANSREFEPSPGGNEDKGAIAEQRVSLLRSWLPLLCRGSNGTD  314

Query  653  TPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCTA  474
             PVLS  +R E+   L+ +I  L  E+QE++L+LWL HF  CP +DWPNL   YTRW   
Sbjct  315  APVLSSKERTEMVAVLDELIGKLGWEQQEEILALWLHHFAACPDTDWPNLESCYTRWYAE  374

Query  473  SR  468
            SR
Sbjct  375  SR  376



>ref|XP_003570616.2| PREDICTED: LOW QUALITY PROTEIN: outer envelope protein 64, mitochondrial-like 
[Brachypodium distachyon]
Length=1016

 Score =   113 bits (283),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 70/121 (58%), Gaps = 2/121 (2%)
 Frame = -1

Query  830   EPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGTDT  651
             EP LQ AL+ ++ FLL  A     E D          +  M ML SWLPLLCR SNGTD 
Sbjct  891   EPSLQVALLRLAVFLLRHANS--AEFDAGGEDEGNKAEQRMAMLRSWLPLLCRGSNGTDA  948

Query  650   PVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCTAS  471
             P LS  +RAE    LE ++  L  E+QE+ ++LWL HF  CP +DWPNL   YTRW   S
Sbjct  949   PALSGKERAETVSVLEELVEKLRREQQEEAMALWLHHFAACPYTDWPNLEQCYTRWYAQS  1008

Query  470   R  468
             R
Sbjct  1009  R  1009



>ref|XP_009399671.1| PREDICTED: uncharacterized protein LOC103984006 [Musa acuminata 
subsp. malaccensis]
Length=382

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 74/118 (63%), Gaps = 3/118 (3%)
 Frame = -1

Query  830  EPRLQGALVXVSAFLLDQA--RQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGT  657
            EPRLQ A+V V AF+   A  +QL +E   E  +   L    +++L SWLPLLC A +G 
Sbjct  256  EPRLQVAIVRVCAFMFIHASSKQLEEECGAEKGE-TSLASHQISLLKSWLPLLCCACSGV  314

Query  656  DTPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRW  483
            D P+LS  +RAE+   L  +I   + ++QE+VLSLWL HFT CP SDWPNL   Y RW
Sbjct  315  DAPILSSKERAEMVSLLGDMIGKFNWDQQEEVLSLWLYHFTNCPDSDWPNLESCYIRW  372



>ref|XP_006847843.2| PREDICTED: uncharacterized protein LOC18437576 [Amborella trichopoda]
Length=386

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 75/119 (63%), Gaps = 10/119 (8%)
 Frame = -1

Query  824  RLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGTDTPV  645
            R+QG++V +SA L+ +           S + +  RQ    +L+ WLPLLC ASNG   P+
Sbjct  274  RVQGSIVKLSAILIREV---------ASREIETCRQVKFRLLIQWLPLLCYASNGVAYPI  324

Query  644  LSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCTASR  468
            LS  +R E+ER +E II +L + +QE +LS WLQ FT+C SSDWPNL   + RWC ++R
Sbjct  325  LSRTERREVERAIEEIIESLPDCDQEIILSNWLQDFTFC-SSDWPNLQSSFDRWCHSTR  382



>gb|ADE77727.1| unknown [Picea sitchensis]
Length=425

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/123 (44%), Positives = 73/123 (59%), Gaps = 10/123 (8%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGT  657
            S  PR+QG+LV +SA L  +  +           +D   Q     L+ WLPLLC A NG 
Sbjct  310  SAHPRVQGSLVKISALLFKEMAK---------GDFDISDQARFKALILWLPLLCYAMNGV  360

Query  656  DTPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCT  477
            D+PVLS  ++AE+ER LE  I++L   +QE VL+ WL  +T+  +SDWPNL + Y  WC 
Sbjct  361  DSPVLSALEKAEVERVLEKTISSLSRLDQELVLANWLHDYTFS-ASDWPNLQNCYDAWCD  419

Query  476  ASR  468
            ASR
Sbjct  420  ASR  422



>gb|ERN14647.1| hypothetical protein AMTR_s00038p00200260 [Amborella trichopoda]
Length=263

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 75/120 (63%), Gaps = 11/120 (9%)
 Frame = -1

Query  824  RLQGALVXVSAFLLDQARQLWKEA-DEESMKYDELRQTNMNMLVSWLPLLCRASNGTDTP  648
            RLQ +++ V+ FLL + R++ +   DE SM           MLV W+PLLC ASNG D+P
Sbjct  148  RLQASILNVTVFLLRKMREMEEGVMDEASMA---------KMLVGWMPLLCHASNGLDSP  198

Query  647  VLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCTASR  468
            VL+ +++ E+E  LE+++  L + ++E VLSLWL  +    SSDWPNL   YT WC  SR
Sbjct  199  VLTSSQKREIEGVLEVLMEKLLDRDREAVLSLWLSQYAR-SSSDWPNLQAYYTHWCAVSR  257



>ref|XP_006853180.2| PREDICTED: uncharacterized protein LOC18442912 [Amborella trichopoda]
Length=379

 Score =   100 bits (249),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 75/120 (63%), Gaps = 11/120 (9%)
 Frame = -1

Query  824  RLQGALVXVSAFLLDQARQLWKEA-DEESMKYDELRQTNMNMLVSWLPLLCRASNGTDTP  648
            RLQ +++ V+ FLL + R++ +   DE SM           MLV W+PLLC ASNG D+P
Sbjct  264  RLQASILNVTVFLLRKMREMEEGVMDEASMA---------KMLVGWMPLLCHASNGLDSP  314

Query  647  VLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCTASR  468
            VL+ +++ E+E  LE+++  L + ++E VLSLWL  +    SSDWPNL   YT WC  SR
Sbjct  315  VLTSSQKREIEGVLEVLMEKLLDRDREAVLSLWLSQYAR-SSSDWPNLQAYYTHWCAVSR  373



>ref|XP_002521651.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40758.1| conserved hypothetical protein [Ricinus communis]
Length=433

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 72/123 (59%), Gaps = 10/123 (8%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGT  657
            S  PR+QG +V +SA LL         AD    K +  RQ    +L  W+PL C A+NG 
Sbjct  317  SANPRVQGYIVKISAILL---------ADLSGDKVEVPRQVKFGLLALWIPLFCYANNGI  367

Query  656  DTPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCT  477
              P L+  ++ ++ER ++ +I+TL  ++QE +L+ WLQ FT C +SDWP+L   Y RWC 
Sbjct  368  SYPFLTSFEKMQVERAMDEVISTLPAKDQEIILTNWLQDFTVC-ASDWPDLQVSYDRWCR  426

Query  476  ASR  468
             +R
Sbjct  427  YTR  429



>ref|XP_006345317.1| PREDICTED: uncharacterized protein LOC102606286 [Solanum tuberosum]
Length=454

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 71/119 (60%), Gaps = 10/119 (8%)
 Frame = -1

Query  824  RLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGTDTPV  645
            R+QG +V ++A L+ +  ++         KY+  RQ   N+LV W+PLLC A NG   PV
Sbjct  326  RVQGFIVKITAILIGELNKV---------KYEVPRQVKFNILVLWIPLLCYAENGVSYPV  376

Query  644  LSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCTASR  468
            LS  ++ E+E+ +  +I TL   +QE +L  W+Q F    SSDWPNLH+ Y  WC ++R
Sbjct  377  LSGYEKVEMEKAMNELIRTLPSIDQEVILINWMQDF-MTASSDWPNLHNSYDHWCHSTR  434



>ref|XP_006437611.1| hypothetical protein CICLE_v10033897mg [Citrus clementina]
 gb|ESR50851.1| hypothetical protein CICLE_v10033897mg [Citrus clementina]
Length=434

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 72/124 (58%), Gaps = 12/124 (10%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKEADEESMKYDEL-RQTNMNMLVSWLPLLCRASNG  660
            +  PR+QG +V +SA L     Q          +YDE+ R+    +LV WLPL C A NG
Sbjct  318  TASPRVQGLIVRISAILFGDLNQ----------EYDEVTREVKFKILVLWLPLFCHARNG  367

Query  659  TDTPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWC  480
               P+L+  ++ E+ERT+  +I++L   +QE +L+ W+Q F    +SDWPNL   Y RWC
Sbjct  368  LSYPILTSYEKFEIERTMNEVISSLPAMDQEVILTNWVQDFA-ITASDWPNLQPSYDRWC  426

Query  479  TASR  468
             ++R
Sbjct  427  QSAR  430



>ref|XP_009793569.1| PREDICTED: uncharacterized protein LOC104240425 [Nicotiana sylvestris]
Length=424

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 73/123 (59%), Gaps = 10/123 (8%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGT  657
            S   R+QG +V ++A L  + ++         MK +  RQ   N+LV WLPL C A NG 
Sbjct  308  SSNSRVQGFIVKITAILFGELKR---------MKNEVPRQVKFNILVLWLPLFCYADNGL  358

Query  656  DTPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCT  477
              PVL+  ++ E+E+T++ +I++L   +QE +L+ WLQ FT   SSDWPNL   Y  WC 
Sbjct  359  SYPVLTGYEKVEMEKTMDELISSLPTIDQEVILTNWLQDFT-TTSSDWPNLQKSYDLWCQ  417

Query  476  ASR  468
            ++R
Sbjct  418  STR  420



>ref|XP_002270447.1| PREDICTED: uncharacterized protein LOC100240757 [Vitis vinifera]
Length=420

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 73/123 (59%), Gaps = 10/123 (8%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGT  657
            +  PR+QG++V +SA L+++  ++          ++  RQ    ++  WLPL C A NG 
Sbjct  304  TANPRVQGSIVKISAILVEELSRV---------DFEVPRQVKFRLIGLWLPLFCFAGNGL  354

Query  656  DTPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCT  477
              P L+  ++AE ER L+ +I+TL   +QE +L+ WLQ FT   +SDWPNL   Y RWC 
Sbjct  355  AFPFLTGYEKAETERALDRVISTLPATDQEVILTNWLQDFTIS-ASDWPNLQVSYDRWCR  413

Query  476  ASR  468
            ++R
Sbjct  414  STR  416



>ref|XP_006484584.1| PREDICTED: uncharacterized protein LOC102623953 [Citrus sinensis]
 gb|KDO52703.1| hypothetical protein CISIN_1g013787mg [Citrus sinensis]
Length=436

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 72/124 (58%), Gaps = 12/124 (10%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKEADEESMKYDEL-RQTNMNMLVSWLPLLCRASNG  660
            +  PR+QG +V +SA L     Q          +YDE+ R+    +LV WLPL C A NG
Sbjct  320  TASPRVQGLIVRISAILFGDLNQ----------EYDEVTREVKFKILVLWLPLFCHARNG  369

Query  659  TDTPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWC  480
               P+L+  ++ ++ERT+  +I++L   +QE +L+ W+Q F    +SDWPNL   Y RWC
Sbjct  370  LSYPILTSYEKFQIERTMNEVISSLPAMDQEVILTNWVQDFA-ITASDWPNLQPSYDRWC  428

Query  479  TASR  468
             ++R
Sbjct  429  QSAR  432



>emb|CBI29026.3| unnamed protein product [Vitis vinifera]
Length=481

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 73/123 (59%), Gaps = 10/123 (8%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGT  657
            +  PR+QG++V +SA L+++  ++          ++  RQ    ++  WLPL C A NG 
Sbjct  365  TANPRVQGSIVKISAILVEELSRV---------DFEVPRQVKFRLIGLWLPLFCFAGNGL  415

Query  656  DTPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCT  477
              P L+  ++AE ER L+ +I+TL   +QE +L+ WLQ FT   +SDWPNL   Y RWC 
Sbjct  416  AFPFLTGYEKAETERALDRVISTLPATDQEVILTNWLQDFTIS-ASDWPNLQVSYDRWCR  474

Query  476  ASR  468
            ++R
Sbjct  475  STR  477



>ref|XP_009590559.1| PREDICTED: uncharacterized protein LOC104087710 [Nicotiana tomentosiformis]
Length=417

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 72/123 (59%), Gaps = 10/123 (8%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGT  657
            S   R+QG +V ++A L  + +          MK +  RQ   N+LV WLPL C A NG 
Sbjct  301  SSNSRVQGFIVKITAILFGELKL---------MKNEVPRQVKFNILVLWLPLFCYADNGL  351

Query  656  DTPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCT  477
              PVL+  ++ E+E+T++ +I++L   +QE +L+ WLQ FT   SSDWPNL   Y  WC 
Sbjct  352  SYPVLTGFEKVEMEKTMDELISSLPTIDQEVILTNWLQDFT-TTSSDWPNLQKSYDLWCQ  410

Query  476  ASR  468
            ++R
Sbjct  411  STR  413



>gb|KJB31863.1| hypothetical protein B456_005G211600 [Gossypium raimondii]
Length=424

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 72/121 (60%), Gaps = 10/121 (8%)
 Frame = -1

Query  830  EPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGTDT  651
             PR+QG++V +SAFL    R+L ++  E        RQ    +LV W PL C ASNG   
Sbjct  309  SPRVQGSVVKISAFLF---RELTRKDLEIP------RQVKFRLLVLWTPLFCHASNGHAY  359

Query  650  PVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCTAS  471
            P+L+  ++AE+ER ++ +I+     EQE +L+ WL+++     SDWPNL   Y RWC ++
Sbjct  360  PILTSFQKAEIERAMDEVISNFPAMEQELILTTWLENYA-VSVSDWPNLGLAYDRWCQST  418

Query  470  R  468
            R
Sbjct  419  R  419



>ref|XP_004231494.1| PREDICTED: uncharacterized protein LOC101263358 [Solanum lycopersicum]
Length=427

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 71/119 (60%), Gaps = 10/119 (8%)
 Frame = -1

Query  824  RLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGTDTPV  645
            R+QG +V ++A L+ +  ++  E           RQ   N+LV W+P+LC A NG   PV
Sbjct  298  RVQGLIVTITAMLIGELNKVKDEVP---------RQVKFNILVLWIPVLCFAENGVPYPV  348

Query  644  LSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCTASR  468
            L+  +R E+E+T+  +I+TL   +QE +L+ W+Q F    SSDWPNL + Y  WC ++R
Sbjct  349  LTGYERLEIEKTMNNLISTLPSIDQEVILTNWMQDF-MTTSSDWPNLQESYDHWCHSTR  406



>ref|XP_012072843.1| PREDICTED: uncharacterized protein LOC105634579 [Jatropha curcas]
 gb|KDP37537.1| hypothetical protein JCGZ_05976 [Jatropha curcas]
Length=427

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 68/123 (55%), Gaps = 10/123 (8%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGT  657
            S  PR+QG LV +SA L+          D  + K +   Q    +LV W+PL C A+NG 
Sbjct  311  SANPRVQGYLVKISAILI---------GDLTNNKVEVSMQVMFRLLVLWIPLFCHANNGL  361

Query  656  DTPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCT  477
              P L+  ++ E+E  ++ +I+ L   +QE +L  WLQ FT C +SDWPNL   Y RWC 
Sbjct  362  SYPFLTSFEKMEVESAIDEVISILPATDQEVILINWLQDFTVC-ASDWPNLQVSYDRWCR  420

Query  476  ASR  468
             +R
Sbjct  421  CTR  423



>ref|XP_010688666.1| PREDICTED: uncharacterized protein LOC104902557 [Beta vulgaris 
subsp. vulgaris]
Length=521

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 67/121 (55%), Gaps = 12/121 (10%)
 Frame = -1

Query  827  PRLQGALVXVSAFLL-DQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGTDT  651
            PRLQ  L+ +SA LL D AR  +K             Q    +LV WLPL C AS     
Sbjct  408  PRLQALLIKISASLLGDIARAEFKVPT----------QVQYRLLVLWLPLFCYASTSLRY  457

Query  650  PVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCTAS  471
            PVLS  ++ ++E+T+E +I  L   EQE VL  WLQ F  C +SDWPNL   Y RWC +S
Sbjct  458  PVLSSYEKIDVEKTMERMIAGLSAMEQEIVLRNWLQDFAIC-ASDWPNLRPSYDRWCQSS  516

Query  470  R  468
            R
Sbjct  517  R  517



>gb|KCW51322.1| hypothetical protein EUGRSUZ_J00876, partial [Eucalyptus grandis]
Length=432

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 67/120 (56%), Gaps = 10/120 (8%)
 Frame = -1

Query  827  PRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGTDTP  648
            PR+QG ++ + A L  + RQ      E +    E++     +L  WLPL C  SNG   P
Sbjct  320  PRVQGFIIKIFAILSSELRQ------ESAFISSEVK---FGLLSLWLPLCCHGSNGLAYP  370

Query  647  VLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCTASR  468
            V++  ++ E ER ++ +I++L   +QE +L+ W Q FT   SSDWPNL   Y RWC  +R
Sbjct  371  VMTGLEKVEAERAMDEVISSLPAFDQEVILTNWFQEFT-VSSSDWPNLQASYNRWCQFTR  429



>ref|XP_010034289.1| PREDICTED: uncharacterized protein LOC104423502 [Eucalyptus grandis]
Length=441

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 67/120 (56%), Gaps = 10/120 (8%)
 Frame = -1

Query  827  PRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGTDTP  648
            PR+QG ++ + A L  + RQ      E +    E++     +L  WLPL C  SNG   P
Sbjct  329  PRVQGFIIKIFAILSSELRQ------ESAFISSEVK---FGLLSLWLPLCCHGSNGLAYP  379

Query  647  VLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCTASR  468
            V++  ++ E ER ++ +I++L   +QE +L+ W Q FT   SSDWPNL   Y RWC  +R
Sbjct  380  VMTGLEKVEAERAMDEVISSLPAFDQEVILTNWFQEFT-VSSSDWPNLQASYNRWCQFTR  438



>ref|XP_001768702.1| predicted protein [Physcomitrella patens]
 gb|EDQ66434.1| predicted protein [Physcomitrella patens]
Length=377

 Score = 83.6 bits (205),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 70/120 (58%), Gaps = 11/120 (9%)
 Frame = -1

Query  827  PRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGTDTP  648
            PR+Q  LV +SA L              + K+   R+T + ++++WLPLLC A++G D P
Sbjct  252  PRVQMYLVRLSALLCKDLLG--------NTKFP--RETCLQLVLTWLPLLCNANHGGDGP  301

Query  647  VLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCTASR  468
            + S  ++   ER LE +++ L E +QE+VLS WLQ +     SDWPNL + +  WC ASR
Sbjct  302  IFSSQEKENAERELERLVSALPEMDQEQVLSTWLQAYAMS-QSDWPNLINCFHTWCLASR  360



>ref|XP_010940354.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Elaeis 
guineensis]
Length=421

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 69/124 (56%), Gaps = 12/124 (10%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQ-ARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNG  660
            +  PR+QG +V ++  LL + AR  W+ A          R+    +L  WLPLLC AS G
Sbjct  305  TAHPRVQGLIVKITVVLLRELARGEWEAA----------REVRFGILALWLPLLCYASQG  354

Query  659  TDTPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWC  480
               PVL+  +R E+ER +E ++  L  ++QE +L  WL+ F+    SDWPNL   + RWC
Sbjct  355  VTAPVLTGMERWEMERVIEDLLAGLPLDDQEIILRNWLEDFS-ASDSDWPNLSRAFDRWC  413

Query  479  TASR  468
              +R
Sbjct  414  RYAR  417



>ref|XP_007042933.1| Uncharacterized protein isoform 4, partial [Theobroma cacao]
 gb|EOX98764.1| Uncharacterized protein isoform 4, partial [Theobroma cacao]
Length=343

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 50/69 (72%), Gaps = 1/69 (1%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKEADE-ESMKYDELRQTNMNMLVSWLPLLCRASNG  660
            S EPR+Q +LV VSAFL  QA+ +  E +E E    + LRQT + ML SWLPLLCRASNG
Sbjct  255  SAEPRVQCSLVKVSAFLFKQAKDMGLEVEETEEGNKENLRQTKLKMLTSWLPLLCRASNG  314

Query  659  TDTPVLSIN  633
            TD PVLSI+
Sbjct  315  TDAPVLSIS  323



>ref|XP_008813455.1| PREDICTED: uncharacterized protein LOC103724075 [Phoenix dactylifera]
Length=421

 Score = 83.6 bits (205),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 71/124 (57%), Gaps = 12/124 (10%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQ-ARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNG  660
            +  PR+QG +V ++  LL + AR  W+ A          R+    +L  W+PLLC AS+G
Sbjct  305  TAHPRVQGPIVKITVVLLRELARGEWETA----------REVRFGILALWMPLLCHASHG  354

Query  659  TDTPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWC  480
              +PVL+  ++ E+ER +E ++  L  E+QE +L  WL+ F+    SDWPNL   + RWC
Sbjct  355  VTSPVLTGMEKWEMERIIEDLVIGLPWEDQEIILRNWLEDFS-ASDSDWPNLSRPFDRWC  413

Query  479  TASR  468
              +R
Sbjct  414  RYTR  417



>ref|XP_002885346.1| hypothetical protein ARALYDRAFT_479510 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61605.1| hypothetical protein ARALYDRAFT_479510 [Arabidopsis lyrata subsp. 
lyrata]
Length=416

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 71/123 (58%), Gaps = 10/123 (8%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGT  657
            +  PR+QG +V +SA L+ +   L +++ +         Q    +L +WLPL   A NG 
Sbjct  300  TAAPRVQGLMVKISALLIGE---LARDSTQVP------GQVTFRLLANWLPLFSHARNGL  350

Query  656  DTPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCT  477
              PVL+  +R E+ER ++  I+TL   +QE +L+ WLQ F+   +S+WPNL   Y RWC 
Sbjct  351  AFPVLTGYERVEVERAIDKAISTLPALDQEILLTNWLQDFS-VSASEWPNLQPAYDRWCH  409

Query  476  ASR  468
            ++R
Sbjct  410  STR  412



>ref|XP_010508223.1| PREDICTED: uncharacterized protein LOC104784823 isoform X2 [Camelina 
sativa]
Length=415

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 71/123 (58%), Gaps = 10/123 (8%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGT  657
            +  PR+QG +V +SA L+ +   L +++ +         Q    +L +WLPL   A NG 
Sbjct  299  TAAPRVQGLMVKISALLIGE---LARDSTQVP------GQVTFRLLANWLPLFSHARNGL  349

Query  656  DTPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCT  477
              PVL+  +R E+ER ++  I+TL   +QE +L+ WLQ F+   +S+WPNL   Y RWC 
Sbjct  350  AFPVLTGYERVEVERAIDKAISTLPALDQEILLTNWLQDFS-VSASEWPNLQPAYDRWCH  408

Query  476  ASR  468
            ++R
Sbjct  409  STR  411



>ref|NP_188626.2| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB01307.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE76308.1| uncharacterized protein AT3G19920 [Arabidopsis thaliana]
Length=416

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 71/123 (58%), Gaps = 10/123 (8%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGT  657
            +  PR+QG +V +SA L+ +   L +++ +         Q    +L +WLPL   A NG 
Sbjct  300  TAAPRVQGLMVKISALLIGE---LARDSTQVP------GQVTFRLLANWLPLFSHARNGL  350

Query  656  DTPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCT  477
              PVL+  +R E+ER ++  I+TL   +QE +L+ WLQ F+   +S+WPNL   Y RWC 
Sbjct  351  AFPVLTGYERVEVERAIDKAISTLPALDQEILLTNWLQDFS-VSASEWPNLQPAYDRWCH  409

Query  476  ASR  468
            ++R
Sbjct  410  STR  412



>ref|XP_010487951.1| PREDICTED: uncharacterized protein LOC104765866 isoform X2 [Camelina 
sativa]
Length=416

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 70/120 (58%), Gaps = 10/120 (8%)
 Frame = -1

Query  827  PRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGTDTP  648
            PR+QG +V +SA L+ +   L +++ +         Q    +L +WLPL   A NG   P
Sbjct  303  PRVQGLMVKISALLIGE---LARDSTQVP------GQVTFRLLANWLPLFSHARNGLAFP  353

Query  647  VLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCTASR  468
            VL+  +R E+ER ++  I+TL   +QE +L+ WLQ F+   +S+WPNL   Y RWC ++R
Sbjct  354  VLTGYERVEVERAIDKAISTLPALDQEILLTNWLQDFS-VSASEWPNLQPAYDRWCHSTR  412



>ref|XP_010508216.1| PREDICTED: uncharacterized protein LOC104784823 isoform X1 [Camelina 
sativa]
Length=460

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 69/123 (56%), Gaps = 10/123 (8%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGT  657
            +  PR+QG +V +SA L+        E   +S +     Q    +L +WLPL   A NG 
Sbjct  344  TAAPRVQGLMVKISALLIG-------ELARDSTQVPG--QVTFRLLANWLPLFSHARNGL  394

Query  656  DTPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCT  477
              PVL+  +R E+ER ++  I+TL   +QE +L+ WLQ F+   +S+WPNL   Y RWC 
Sbjct  395  AFPVLTGYERVEVERAIDKAISTLPALDQEILLTNWLQDFSVS-ASEWPNLQPAYDRWCH  453

Query  476  ASR  468
            ++R
Sbjct  454  STR  456



>ref|XP_010487950.1| PREDICTED: uncharacterized protein LOC104765866 isoform X1 [Camelina 
sativa]
Length=459

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 69/123 (56%), Gaps = 10/123 (8%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGT  657
            +  PR+QG +V +SA L+        E   +S +     Q    +L +WLPL   A NG 
Sbjct  343  TTAPRVQGLMVKISALLIG-------ELARDSTQVPG--QVTFRLLANWLPLFSHARNGL  393

Query  656  DTPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCT  477
              PVL+  +R E+ER ++  I+TL   +QE +L+ WLQ F+   +S+WPNL   Y RWC 
Sbjct  394  AFPVLTGYERVEVERAIDKAISTLPALDQEILLTNWLQDFSVS-ASEWPNLQPAYDRWCH  452

Query  476  ASR  468
            ++R
Sbjct  453  STR  455



>ref|XP_006297645.1| hypothetical protein CARUB_v10013663mg [Capsella rubella]
 gb|EOA30543.1| hypothetical protein CARUB_v10013663mg [Capsella rubella]
Length=458

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 69/123 (56%), Gaps = 10/123 (8%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGT  657
            +  PR+QG +V +SA L+        E   +S +     Q    +L +WLPL   A NG 
Sbjct  342  TAAPRVQGLMVKISALLIG-------ELARDSTQVPG--QVTFRLLANWLPLFSHARNGL  392

Query  656  DTPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCT  477
              PVL+  +R E+ER ++  I+TL   +QE +L+ WLQ F+   +S+WPNL   Y RWC 
Sbjct  393  AFPVLTGYERVEVERAIDKAISTLPALDQEILLTNWLQDFS-VSASEWPNLQPAYDRWCH  451

Query  476  ASR  468
            ++R
Sbjct  452  STR  454



>dbj|BAC43081.1| unknown protein [Arabidopsis thaliana]
 gb|AAO63425.1| At3g19920 [Arabidopsis thaliana]
Length=416

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 71/123 (58%), Gaps = 10/123 (8%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGT  657
            +  PR+QG +V +SA L+ +   L +++ +         Q    +L +WLPL   A NG 
Sbjct  300  TAAPRVQGLMVKISALLIGE---LARDSTQVP------GQVAFRLLANWLPLFSHARNGL  350

Query  656  DTPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCT  477
              PVL+  +R E+ER ++  I+TL   +QE +L+ WLQ F+   +S+WPNL   Y RWC 
Sbjct  351  AFPVLTGYERVEVERAIDKAISTLPALDQEILLTNWLQDFS-VSASEWPNLQPAYDRWCH  409

Query  476  ASR  468
            ++R
Sbjct  410  STR  412



>emb|CAN75502.1| hypothetical protein VITISV_034157 [Vitis vinifera]
Length=428

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 66/112 (59%), Gaps = 10/112 (9%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGT  657
            +  PR+QG++V +SA L+++  ++          ++  RQ    ++  WLPL C A NG 
Sbjct  304  TANPRVQGSIVKISAILVEELSRV---------DFEVPRQVKFRLIGLWLPLFCFAGNGL  354

Query  656  DTPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLH  501
              P L+  ++AE ER L+ +I+TL   +QE +L+ WLQ FT   +SDWPNL 
Sbjct  355  AFPFLTGYEKAETERALDRVISTLPATDQEVILTNWLQDFTIS-ASDWPNLQ  405



>ref|XP_010466158.1| PREDICTED: uncharacterized protein LOC104746394 isoform X1 [Camelina 
sativa]
Length=459

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 69/123 (56%), Gaps = 10/123 (8%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGT  657
            +  PR+QG +V +SA L+ +  +     D   +      Q    +L +WLPL   A NG 
Sbjct  343  TAAPRVQGLMVKISALLIGELAR-----DNTQVP----GQVTFRLLANWLPLFSHARNGL  393

Query  656  DTPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCT  477
              PVL+  +R E+ER ++  I+TL   +QE +L+ WLQ F+   +S+WPNL   Y RWC 
Sbjct  394  AFPVLTGYERVEVERAIDKAISTLPALDQEILLTNWLQDFSVS-ASEWPNLQPAYDRWCH  452

Query  476  ASR  468
            ++R
Sbjct  453  STR  455



>ref|XP_010466159.1| PREDICTED: uncharacterized protein LOC104746394 isoform X2 [Camelina 
sativa]
 ref|XP_010466160.1| PREDICTED: uncharacterized protein LOC104746394 isoform X3 [Camelina 
sativa]
Length=416

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 69/123 (56%), Gaps = 10/123 (8%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGT  657
            +  PR+QG +V +SA L+ +  +     D   +      Q    +L +WLPL   A NG 
Sbjct  300  TAAPRVQGLMVKISALLIGELAR-----DNTQVP----GQVTFRLLANWLPLFSHARNGL  350

Query  656  DTPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCT  477
              PVL+  +R E+ER ++  I+TL   +QE +L+ WLQ F+   +S+WPNL   Y RWC 
Sbjct  351  AFPVLTGYERVEVERAIDKAISTLPALDQEILLTNWLQDFS-VSASEWPNLQPAYDRWCH  409

Query  476  ASR  468
            ++R
Sbjct  410  STR  412



>gb|KFK39314.1| hypothetical protein AALP_AA3G228700 [Arabis alpina]
Length=413

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 68/120 (57%), Gaps = 10/120 (8%)
 Frame = -1

Query  827  PRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGTDTP  648
            PR+QG +V +SA L+ +  +     D   +      Q    +L +WLPL   A NG   P
Sbjct  300  PRVQGLMVKISALLIGELAR-----DNTQVP----GQVKFRLLANWLPLFSHARNGLAFP  350

Query  647  VLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCTASR  468
            VL+  +R E+ER ++  I+TL   +QE +L+ WLQ F+   +S+WPNL   Y RWC ++R
Sbjct  351  VLTGYERVEVERAIDKAISTLPALDQEILLTNWLQDFS-VSASEWPNLTPAYDRWCQSTR  409



>gb|KFK39313.1| hypothetical protein AALP_AA3G228700 [Arabis alpina]
Length=451

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 69/123 (56%), Gaps = 10/123 (8%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGT  657
            +  PR+QG +V +SA L+ +  +     D   +      Q    +L +WLPL   A NG 
Sbjct  335  TAAPRVQGLMVKISALLIGELAR-----DNTQVP----GQVKFRLLANWLPLFSHARNGL  385

Query  656  DTPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCT  477
              PVL+  +R E+ER ++  I+TL   +QE +L+ WLQ F+   +S+WPNL   Y RWC 
Sbjct  386  AFPVLTGYERVEVERAIDKAISTLPALDQEILLTNWLQDFS-VSASEWPNLTPAYDRWCQ  444

Query  476  ASR  468
            ++R
Sbjct  445  STR  447



>ref|XP_006406441.1| hypothetical protein EUTSA_v10022300mg [Eutrema salsugineum]
 gb|ESQ47894.1| hypothetical protein EUTSA_v10022300mg [Eutrema salsugineum]
Length=418

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 69/123 (56%), Gaps = 10/123 (8%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGT  657
            +  PR+QG +V ++A L+ +  +     D   +      Q    +L +WLPL   A NG 
Sbjct  302  TAAPRVQGLMVKITALLIGELAR-----DNTQVP----GQVKFRLLANWLPLFSHARNGL  352

Query  656  DTPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCT  477
              PVL+  +R E+ER ++  I+TL   +QE +L+ WLQ F+   +S+WPNL   Y RWC 
Sbjct  353  AFPVLTGYERVEVERAIDKAISTLPALDQEILLTNWLQDFSIS-ASEWPNLTPAYDRWCH  411

Query  476  ASR  468
            ++R
Sbjct  412  STR  414



>ref|XP_004143698.1| PREDICTED: uncharacterized protein LOC101206051 [Cucumis sativus]
 gb|KGN50446.1| hypothetical protein Csa_5G175700 [Cucumis sativus]
Length=459

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 63/125 (50%), Gaps = 17/125 (14%)
 Frame = -1

Query  827  PRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQT-----NMNMLVSWLPLLCRASN  663
            PR+Q   V +SA L            +E M+  E+ +T        ML  WLPLLC A N
Sbjct  343  PRIQWCFVKISAMLF-----------QELMRSKEMEETVRPEVKFRMLSLWLPLLCHARN  391

Query  662  GTDTPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRW  483
            G   P L   ++ E ER +  II TL   +QE +L+ WL  +   P S+WPNL   Y RW
Sbjct  392  GFTFPALMRFEKDETERAVNHIIGTLSPIDQEVILTNWLHDYAISP-SEWPNLQPSYDRW  450

Query  482  CTASR  468
            C ++R
Sbjct  451  CNSTR  455



>ref|XP_008445882.1| PREDICTED: uncharacterized protein LOC103488768 [Cucumis melo]
Length=459

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 63/120 (53%), Gaps = 8/120 (7%)
 Frame = -1

Query  827  PRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGTDTP  648
            PR+Q   V +SA        L+KE   + M+     +    ML  WLPLLC A NG   P
Sbjct  344  PRIQWCFVKISA-------MLFKELTSKEMEKMVRPEVKFRMLSLWLPLLCHARNGFTFP  396

Query  647  VLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCTASR  468
             L   ++ E ER +  II TL   +QE +L+ WLQ +    +S+WPNL   Y RWC ++R
Sbjct  397  ALMRFEKDETERAVNHIIGTLSPIDQELILTNWLQDYAIS-ASEWPNLQPSYDRWCNSTR  455



>emb|CDY25358.1| BnaA05g19260D [Brassica napus]
Length=413

 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 67/123 (54%), Gaps = 10/123 (8%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGT  657
            +  PR+QG LV +SA L+ +  +   +            Q    +L +WLPL   A  G 
Sbjct  297  TAAPRVQGLLVKISALLIGEMARDGTQVPG---------QVKFRLLANWLPLFSHARLGL  347

Query  656  DTPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCT  477
              PVL+  +R E+ER ++  I+TL   +QE +L+ WLQ F+   +++WPNL   Y RWC 
Sbjct  348  AFPVLTGYERVEVERAIDKAISTLPALDQEILLANWLQDFS-VSATEWPNLTPAYDRWCN  406

Query  476  ASR  468
            ++R
Sbjct  407  STR  409



>ref|XP_009135652.1| PREDICTED: uncharacterized protein LOC103859827 [Brassica rapa]
 emb|CDX82278.1| BnaA03g35430D [Brassica napus]
Length=416

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 67/121 (55%), Gaps = 12/121 (10%)
 Frame = -1

Query  827  PRLQGALVXVSAFLLDQ-ARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGTDT  651
            PR+QG +V +SA L+ + AR   +             Q    +L +WLPL   A NG   
Sbjct  303  PRVQGLMVKISALLIGELARDTTQVPG----------QVKFRLLANWLPLFSHARNGLAF  352

Query  650  PVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCTAS  471
            PVL+  +R E+ER ++  I+TL   +QE +L+ WLQ F+   +S+WP+L   Y RWC + 
Sbjct  353  PVLTGYERVEVERAIDKAISTLPALDQEILLTNWLQDFS-VSASEWPDLTPAYDRWCHSI  411

Query  470  R  468
            R
Sbjct  412  R  412



>emb|CDY22946.1| BnaC03g41230D [Brassica napus]
Length=416

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 67/121 (55%), Gaps = 12/121 (10%)
 Frame = -1

Query  827  PRLQGALVXVSAFLLDQ-ARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGTDT  651
            PR+QG +V +SA L+ + AR   +             Q    +L +WLPL   A NG   
Sbjct  303  PRVQGLMVKISALLIGELARDTTQVPG----------QVKFRLLANWLPLFSHARNGLAF  352

Query  650  PVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCTAS  471
            PVL+  +R E+ER ++  I+TL   +QE +L+ WLQ F+   +S+WP+L   Y RWC + 
Sbjct  353  PVLTGYERVEVERAIDKAISTLPALDQEILLTNWLQDFS-VSASEWPDLTPAYDRWCHSI  411

Query  470  R  468
            R
Sbjct  412  R  412



>emb|CDY24594.1| BnaC05g32780D [Brassica napus]
Length=407

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 66/123 (54%), Gaps = 10/123 (8%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGT  657
            +  PR+QG LV +SA L+ +  +   +            Q    +L +WLPL   A  G 
Sbjct  291  TAAPRVQGLLVKISALLIGEMARDGTQVPG---------QVKFRLLANWLPLFSHARLGL  341

Query  656  DTPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCT  477
              PVL+  +R E+ER ++  I+TL   +QE +L+ WLQ F+   + +WPNL   Y RWC 
Sbjct  342  AFPVLTGYERVEVERAIDKAISTLPALDQEILLTNWLQDFS-VSAIEWPNLIPAYDRWCN  400

Query  476  ASR  468
            ++R
Sbjct  401  STR  403



>ref|XP_009145732.1| PREDICTED: uncharacterized protein LOC103869408 isoform X2 [Brassica 
rapa]
Length=413

 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 66/123 (54%), Gaps = 10/123 (8%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGT  657
            +  PR+QG LV +SA L+        E   +S K     Q    +L + LPL   A  G 
Sbjct  297  TAAPRVQGLLVKISALLIG-------EMARDSTKVPG--QVKFRLLANCLPLFSHARLGL  347

Query  656  DTPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCT  477
              PVL   +R E+ER ++  I+TL   +QE +L+ WLQ F+   +++WPNL   Y RWC 
Sbjct  348  AFPVLIGYERVEVERAIDKAISTLPALDQEILLTNWLQDFS-VSATEWPNLTPAYDRWCN  406

Query  476  ASR  468
            ++R
Sbjct  407  STR  409



>ref|XP_009145731.1| PREDICTED: uncharacterized protein LOC103869408 isoform X1 [Brassica 
rapa]
Length=454

 Score = 74.7 bits (182),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 66/123 (54%), Gaps = 10/123 (8%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGT  657
            +  PR+QG LV +SA L+        E   +S K     Q    +L + LPL   A  G 
Sbjct  338  TAAPRVQGLLVKISALLIG-------EMARDSTKVPG--QVKFRLLANCLPLFSHARLGL  388

Query  656  DTPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCT  477
              PVL   +R E+ER ++  I+TL   +QE +L+ WLQ F+   +++WPNL   Y RWC 
Sbjct  389  AFPVLIGYERVEVERAIDKAISTLPALDQEILLTNWLQDFS-VSATEWPNLTPAYDRWCN  447

Query  476  ASR  468
            ++R
Sbjct  448  STR  450



>ref|XP_010541857.1| PREDICTED: uncharacterized protein LOC104815236 [Tarenaya hassleriana]
Length=453

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 66/121 (55%), Gaps = 12/121 (10%)
 Frame = -1

Query  827  PRLQGALVXVSAFLL-DQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGTDT  651
            PR+QG LV +SA L+ D AR + +             Q    +L    PL   A NG   
Sbjct  340  PRVQGLLVKISALLVVDLARDITQVPG----------QVKFRLLGHPQPLFSHARNGLTF  389

Query  650  PVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCTAS  471
            PVL+  ++ ++ER ++  ++TL   +QE +LS WLQ F+   +S+WPNL   Y RWC ++
Sbjct  390  PVLTGFEKVKVERAIDQTLSTLPSLDQEVLLSNWLQDFS-VSASEWPNLQPAYERWCNST  448

Query  470  R  468
            R
Sbjct  449  R  449



>ref|XP_010096783.1| hypothetical protein L484_004764 [Morus notabilis]
 gb|EXB65805.1| hypothetical protein L484_004764 [Morus notabilis]
Length=469

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 71/126 (56%), Gaps = 16/126 (13%)
 Frame = -1

Query  836  SXEPRLQGALVXVSAFLLDQARQLWKEADEESMKYDEL---RQTNMNMLVSWLPLLCRAS  666
            + +PRLQG +V +SA L               M ++EL   R+    +L+ WLPL C A 
Sbjct  353  TTDPRLQGLIVKISAMLFGD------------MNHEELEISREVKFRLLLLWLPLFCHAG  400

Query  665  NGTDTPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTR  486
            NG   PVL+  ++AE+ER ++  I +L   +QE +L+ W+Q +    +SDWPNL   Y R
Sbjct  401  NGFAYPVLTFFEKAEVERAVDEAIWSLPAMDQEVILTNWIQDYA-ISASDWPNLQISYDR  459

Query  485  WCTASR  468
            WC ++R
Sbjct  460  WCQSTR  465



>ref|XP_001766415.1| predicted protein [Physcomitrella patens]
 gb|EDQ68743.1| predicted protein, partial [Physcomitrella patens]
Length=252

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = -1

Query  677  CRASNGTDTPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHD  498
            C A++G D P+ +  ++ E ER LEL++ +L E +QE++LS WLQ +     SDWPNL +
Sbjct  167  CNATHGGDGPIFNSAEKGEAERQLELLVASLPETDQEQILSTWLQEYAM-SQSDWPNLQN  225

Query  497  IYTRWCTASR  468
             Y  WC  +R
Sbjct  226  CYNTWCYTTR  235



>ref|XP_002980258.1| hypothetical protein SELMODRAFT_112193, partial [Selaginella 
moellendorffii]
 gb|EFJ18518.1| hypothetical protein SELMODRAFT_112193, partial [Selaginella 
moellendorffii]
Length=315

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 43/71 (61%), Gaps = 1/71 (1%)
 Frame = -1

Query  680  LCRASNGTDTPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLH  501
             CR+++G D  + +  ++ E ER LE  I  L + +QE VL+LWL  F +  SSDWPNL 
Sbjct  199  FCRSTHGIDATMFTSAEKHEAERVLERTIKLLPDAQQELVLALWLNEFVHS-SSDWPNLE  257

Query  500  DIYTRWCTASR  468
              Y  WC A+R
Sbjct  258  SCYDAWCYATR  268



>ref|XP_002963079.1| hypothetical protein SELMODRAFT_404646 [Selaginella moellendorffii]
 gb|EFJ36542.1| hypothetical protein SELMODRAFT_404646 [Selaginella moellendorffii]
Length=440

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 43/71 (61%), Gaps = 1/71 (1%)
 Frame = -1

Query  680  LCRASNGTDTPVLSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLH  501
             CR+++G D  + +  ++ E ER LE  I  L + +QE VL+LWL  F +  SS+WPNL 
Sbjct  324  FCRSTHGIDATMFTSAEKHEAERVLERTIKLLPDAQQELVLALWLNEFVHS-SSNWPNLE  382

Query  500  DIYTRWCTASR  468
              Y  WC A+R
Sbjct  383  GCYDAWCYATR  393



>gb|EMT16420.1| Small glutamine-rich tetratricopeptide repeat-containing protein 
beta [Aegilops tauschii]
Length=677

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = -1

Query  578  EEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCTASR  468
            E+QE+ L+LWL HF  CP +DWPNL   YTRW   SR
Sbjct  637  EQQEEALALWLHHFAACPDTDWPNLERCYTRWYAESR  673



>ref|XP_002972832.1| hypothetical protein SELMODRAFT_441994 [Selaginella moellendorffii]
 gb|EFJ26053.1| hypothetical protein SELMODRAFT_441994 [Selaginella moellendorffii]
Length=356

 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 63/119 (53%), Gaps = 10/119 (8%)
 Frame = -1

Query  824  RLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGTDTPV  645
            R+Q  LV +SAFL          A   S+  +   +  + +L+ WLPLLCR S+  D   
Sbjct  244  RVQKLLVKLSAFLC---------AGLVSLDVELQPEVTLRLLLLWLPLLCRTSHAIDETT  294

Query  644  LSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCTASR  468
            LS + + + E+ L  +I  L +  QE VL++WL  +    SSDWPN+   Y  WC ++R
Sbjct  295  LSSSDKIDTEQILSKVIQRLPDSYQELVLAMWLTEYVG-SSSDWPNIQGCYHGWCQSTR  352



>ref|XP_002984405.1| hypothetical protein SELMODRAFT_423623 [Selaginella moellendorffii]
 gb|EFJ14455.1| hypothetical protein SELMODRAFT_423623 [Selaginella moellendorffii]
Length=357

 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 63/119 (53%), Gaps = 10/119 (8%)
 Frame = -1

Query  824  RLQGALVXVSAFLLDQARQLWKEADEESMKYDELRQTNMNMLVSWLPLLCRASNGTDTPV  645
            R+Q  LV +SAFL          A   S+  +   +  + +L+ WLPLLCR S+  D   
Sbjct  245  RVQKLLVKLSAFLC---------AGLVSLDVELQPEVTLRLLLLWLPLLCRTSHAIDETT  295

Query  644  LSINKRAELERTLELIINTLDEEEQEKVLSLWLQHFTYCPSSDWPNLHDIYTRWCTASR  468
            LS + + + E+ L  +I  L +  QE VL++WL  +    SSDWPN+   Y  WC ++R
Sbjct  296  LSSSDKIDTEQILSKVIQRLPDSYQELVLAMWLTEYVG-SSSDWPNIQGCYHGWCQSTR  353



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1785100074290