BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig2624

Length=749
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009603015.1|  PREDICTED: heat stress transcription factor ...    155   2e-41   Nicotiana tomentosiformis
ref|XP_006353396.1|  PREDICTED: heat stress transcription factor ...    154   6e-41   
ref|XP_009803855.1|  PREDICTED: heat stress transcription factor ...    154   7e-41   Nicotiana sylvestris
ref|XP_007038632.1|  Heat shock transcription factor B2A, putative      152   2e-40   
emb|CDP21507.1|  unnamed protein product                                151   8e-40   Coffea canephora [robusta coffee]
ref|XP_004234371.1|  PREDICTED: heat stress transcription factor ...    151   1e-39   Solanum lycopersicum
gb|AIG20087.1|  HSF20                                                   150   2e-39   Gossypium hirsutum [American cotton]
ref|XP_011076201.1|  PREDICTED: heat stress transcription factor ...    150   2e-39   Sesamum indicum [beniseed]
ref|XP_004515711.1|  PREDICTED: heat stress transcription factor ...    150   2e-39   Cicer arietinum [garbanzo]
gb|KJB39397.1|  hypothetical protein B456_007G010900                    148   9e-39   Gossypium raimondii
ref|XP_007218740.1|  hypothetical protein PRUPE_ppa009180mg             146   4e-38   Prunus persica
ref|XP_002321902.2|  hypothetical protein POPTR_0015s13390g             143   3e-37   Populus trichocarpa [western balsam poplar]
ref|XP_007152318.1|  hypothetical protein PHAVU_004G119600g             144   3e-37   Phaseolus vulgaris [French bean]
ref|XP_010061278.1|  PREDICTED: heat stress transcription factor ...    143   7e-37   Eucalyptus grandis [rose gum]
ref|XP_010278594.1|  PREDICTED: heat stress transcription factor ...    142   1e-36   Nelumbo nucifera [Indian lotus]
ref|XP_011048671.1|  PREDICTED: heat stress transcription factor ...    142   1e-36   Populus euphratica
ref|XP_002318823.2|  hypothetical protein POPTR_0012s13430g             142   1e-36   
gb|KDP25483.1|  hypothetical protein JCGZ_20639                         142   1e-36   Jatropha curcas
ref|XP_012086969.1|  PREDICTED: heat stress transcription factor ...    142   1e-36   Jatropha curcas
ref|XP_010035111.1|  PREDICTED: heat stress transcription factor ...    141   2e-36   Eucalyptus grandis [rose gum]
ref|XP_010255485.1|  PREDICTED: heat stress transcription factor ...    141   4e-36   Nelumbo nucifera [Indian lotus]
ref|XP_012090286.1|  PREDICTED: heat stress transcription factor ...    140   7e-36   Jatropha curcas
gb|AFP57460.1|  truncated heat shock factor B2a                         133   1e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010693477.1|  PREDICTED: heat stress transcription factor ...    140   1e-35   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003611134.1|  Heat stress transcription factor B-2b              140   1e-35   Medicago truncatula
gb|AFK40914.1|  unknown                                                 140   1e-35   Medicago truncatula
ref|XP_009371307.1|  PREDICTED: heat stress transcription factor ...    139   2e-35   
gb|KDO60052.1|  hypothetical protein CISIN_1g020146mg                   139   3e-35   Citrus sinensis [apfelsine]
ref|XP_006421885.1|  hypothetical protein CICLE_v10005403mg             139   3e-35   Citrus clementina [clementine]
ref|XP_003555375.1|  PREDICTED: heat stress transcription factor ...    138   3e-35   
ref|XP_010107420.1|  Heat stress transcription factor B-2a              138   4e-35   Morus notabilis
ref|NP_001281281.1|  heat shock factor protein 4                        137   5e-35   Malus domestica [apple tree]
ref|XP_009606739.1|  PREDICTED: heat stress transcription factor ...    138   7e-35   Nicotiana tomentosiformis
ref|XP_006440567.1|  hypothetical protein CICLE_v10021287mg             137   8e-35   Citrus clementina [clementine]
ref|XP_002283139.1|  PREDICTED: heat stress transcription factor ...    137   1e-34   Vitis vinifera
gb|KHM99149.1|  Heat stress transcription factor B-2a                   135   1e-34   Glycine soja [wild soybean]
ref|XP_002510816.1|  Heat shock factor protein, putative                137   1e-34   Ricinus communis
gb|ADC94861.1|  HSP transcription factor                                137   1e-34   Vitis pseudoreticulata
ref|XP_003533211.1|  PREDICTED: heat stress transcription factor ...    137   1e-34   
gb|AFQ93677.1|  heat shock transcription factor HSFB2a                  137   1e-34   Glycine max [soybeans]
gb|AFW65023.1|  hypothetical protein ZEAMMB73_676522                    138   1e-34   
ref|XP_006394443.1|  hypothetical protein EUTSA_v10004690mg             136   2e-34   Eutrema salsugineum [saltwater cress]
ref|XP_007143381.1|  hypothetical protein PHAVU_007G067800g             136   2e-34   Phaseolus vulgaris [French bean]
emb|CBI34728.3|  unnamed protein product                                136   2e-34   Vitis vinifera
ref|XP_006477425.1|  PREDICTED: heat stress transcription factor ...    136   2e-34   Citrus sinensis [apfelsine]
ref|XP_010940869.1|  PREDICTED: heat stress transcription factor ...    137   3e-34   Elaeis guineensis
ref|XP_010538799.1|  PREDICTED: heat stress transcription factor ...    136   5e-34   Tarenaya hassleriana [spider flower]
ref|XP_004511596.1|  PREDICTED: heat stress transcription factor ...    135   6e-34   
emb|CAN82265.1|  hypothetical protein VITISV_009283                     137   6e-34   Vitis vinifera
gb|KHG06980.1|  Heat stress transcription factor B-2b -like protein     135   7e-34   Gossypium arboreum [tree cotton]
gb|EPS62621.1|  hypothetical protein M569_12169                         134   7e-34   Genlisea aurea
ref|XP_010523506.1|  PREDICTED: heat stress transcription factor ...    135   8e-34   Tarenaya hassleriana [spider flower]
ref|XP_006590531.1|  PREDICTED: heat stress transcription factor ...    131   9e-34   
gb|KJB52056.1|  hypothetical protein B456_008G244400                    134   1e-33   Gossypium raimondii
gb|KCW72116.1|  hypothetical protein EUGRSUZ_E00555                     134   1e-33   Eucalyptus grandis [rose gum]
ref|XP_006590530.1|  PREDICTED: heat stress transcription factor ...    131   1e-33   Glycine max [soybeans]
ref|XP_004143930.1|  PREDICTED: heat stress transcription factor ...    134   2e-33   Cucumis sativus [cucumbers]
emb|CBI31816.3|  unnamed protein product                                134   2e-33   Vitis vinifera
ref|XP_007040151.1|  Winged-helix DNA-binding transcription facto...    134   2e-33   
ref|XP_003535620.1|  PREDICTED: heat stress transcription factor ...    133   2e-33   
ref|XP_010919270.1|  PREDICTED: heat stress transcription factor ...    134   2e-33   Elaeis guineensis
ref|XP_010055608.1|  PREDICTED: LOW QUALITY PROTEIN: heat stress ...    134   2e-33   
ref|XP_002273914.2|  PREDICTED: LOW QUALITY PROTEIN: heat stress ...    133   2e-33   
gb|EEC74457.1|  hypothetical protein OsI_09880                          128   2e-33   Oryza sativa Indica Group [Indian rice]
ref|XP_011029218.1|  PREDICTED: heat stress transcription factor ...    134   2e-33   Populus euphratica
ref|XP_008437221.1|  PREDICTED: heat stress transcription factor ...    134   3e-33   Cucumis melo [Oriental melon]
gb|KJB25779.1|  hypothetical protein B456_004G208800                    133   3e-33   Gossypium raimondii
gb|AII99903.1|  heat shock transcription factor                         133   5e-33   Gossypium hirsutum [American cotton]
ref|XP_006857851.1|  PREDICTED: heat stress transcription factor ...    133   5e-33   Amborella trichopoda
ref|NP_201008.2|  heat stress transcription factor B-2a                 132   5e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006590529.1|  PREDICTED: heat stress transcription factor ...    133   5e-33   Glycine max [soybeans]
gb|KEH17358.1|  heat shock transcription factor B2A                     133   6e-33   Medicago truncatula
ref|XP_008369462.1|  PREDICTED: heat stress transcription factor ...    133   7e-33   
ref|XP_006358879.1|  PREDICTED: heat stress transcription factor ...    132   7e-33   Solanum tuberosum [potatoes]
ref|XP_008677301.1|  PREDICTED: heat shock factor protein 7 isofo...    133   7e-33   Zea mays [maize]
gb|AFW65024.1|  heat shock factor protein 7                             133   7e-33   
ref|NP_001149902.1|  heat shock factor protein 7                        133   7e-33   Zea mays [maize]
ref|XP_009760921.1|  PREDICTED: heat stress transcription factor ...    132   7e-33   Nicotiana sylvestris
ref|XP_009345447.1|  PREDICTED: heat stress transcription factor ...    132   8e-33   Pyrus x bretschneideri [bai li]
ref|XP_002864765.1|  hypothetical protein ARALYDRAFT_919451             132   8e-33   Arabidopsis lyrata subsp. lyrata
ref|XP_010934470.1|  PREDICTED: heat stress transcription factor ...    133   9e-33   Elaeis guineensis
ref|XP_003517459.1|  PREDICTED: heat stress transcription factor ...    133   9e-33   Glycine max [soybeans]
gb|AFP57459.1|  truncated heat shock factor B1                          125   1e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007158472.1|  hypothetical protein PHAVU_002G155300g             132   1e-32   Phaseolus vulgaris [French bean]
ref|XP_004957415.1|  PREDICTED: heat stress transcription factor ...    133   1e-32   
emb|CDY00246.1|  BnaA06g21470D                                          131   1e-32   
ref|XP_009151322.1|  PREDICTED: heat stress transcription factor ...    131   2e-32   Brassica rapa
gb|EEE69104.1|  hypothetical protein OsJ_28173                          129   2e-32   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008800793.1|  PREDICTED: heat stress transcription factor ...    132   2e-32   Phoenix dactylifera
ref|XP_010933854.1|  PREDICTED: heat stress transcription factor ...    132   2e-32   Elaeis guineensis
ref|XP_006280765.1|  hypothetical protein CARUB_v10026734mg             131   3e-32   
ref|XP_010483895.1|  PREDICTED: heat stress transcription factor ...    130   3e-32   Camelina sativa [gold-of-pleasure]
ref|XP_010458062.1|  PREDICTED: heat stress transcription factor ...    130   4e-32   Camelina sativa [gold-of-pleasure]
ref|XP_008803040.1|  PREDICTED: heat stress transcription factor ...    131   4e-32   Phoenix dactylifera
ref|XP_004496590.1|  PREDICTED: heat stress transcription factor ...    129   4e-32   Cicer arietinum [garbanzo]
gb|ABG73443.1|  heat shock factor                                       132   4e-32   Oryza brachyantha
emb|CDX86938.1|  BnaC03g52080D                                          130   4e-32   
gb|KHG00724.1|  Heat stress transcription factor B-2b -like protein     129   7e-32   Gossypium arboreum [tree cotton]
ref|XP_003548209.1|  PREDICTED: heat stress transcription factor ...    130   7e-32   
gb|EMT20815.1|  Heat stress transcription factor B-2b                   130   7e-32   
ref|XP_008234272.1|  PREDICTED: heat stress transcription factor ...    129   7e-32   Prunus mume [ume]
ref|XP_011081009.1|  PREDICTED: heat stress transcription factor ...    129   8e-32   Sesamum indicum [beniseed]
ref|NP_001152384.1|  heat shock factor protein 7                        130   8e-32   
ref|XP_008680871.1|  PREDICTED: heat shock factor protein 7 isofo...    131   8e-32   
gb|EAZ07882.1|  hypothetical protein OsI_30138                          130   1e-31   Oryza sativa Indica Group [Indian rice]
ref|XP_008799550.1|  PREDICTED: heat stress transcription factor ...    129   1e-31   Phoenix dactylifera
ref|XP_002298053.1|  heat shock transcription factor HSF29 family...    130   1e-31   Populus trichocarpa [western balsam poplar]
ref|XP_008790507.1|  PREDICTED: heat stress transcription factor ...    129   1e-31   Phoenix dactylifera
ref|XP_009398726.1|  PREDICTED: heat stress transcription factor ...    130   1e-31   Musa acuminata subsp. malaccensis [pisang utan]
sp|Q6Z9C8.1|HFB2B_ORYSJ  RecName: Full=Heat stress transcription ...    130   1e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008652977.1|  PREDICTED: heat stress transcription factor ...    130   1e-31   Zea mays [maize]
gb|AFI61331.1|  HSF3                                                    129   1e-31   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010540690.1|  PREDICTED: heat stress transcription factor ...    129   1e-31   Tarenaya hassleriana [spider flower]
ref|XP_004957416.1|  PREDICTED: heat stress transcription factor ...    130   2e-31   
ref|XP_004957414.1|  PREDICTED: heat stress transcription factor ...    130   2e-31   Setaria italica
gb|AFQ93675.1|  heat shock transcription factor HSFB2b                  129   2e-31   Glycine max [soybeans]
ref|XP_008238806.1|  PREDICTED: heat stress transcription factor ...    129   2e-31   
gb|AJR10106.1|  heat-responsive transcription factor                    129   2e-31   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007209340.1|  hypothetical protein PRUPE_ppa008441mg             129   2e-31   Prunus persica
ref|XP_008376546.1|  PREDICTED: heat stress transcription factor ...    128   2e-31   Malus domestica [apple tree]
ref|XP_009130190.1|  PREDICTED: heat stress transcription factor ...    127   3e-31   Brassica rapa
gb|KFK27929.1|  hypothetical protein AALP_AA8G449200                    127   3e-31   Arabis alpina [alpine rockcress]
gb|EMS61082.1|  Heat stress transcription factor B-2b                   129   3e-31   Triticum urartu
gb|AEB26596.1|  heat shock factor B2c                                   129   3e-31   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006659656.1|  PREDICTED: heat stress transcription factor ...    129   4e-31   Oryza brachyantha
ref|XP_002509743.1|  Heat shock factor protein, putative                128   4e-31   Ricinus communis
gb|AII99900.1|  heat shock transcription factor                         127   4e-31   Gossypium hirsutum [American cotton]
ref|XP_004245637.1|  PREDICTED: heat stress transcription factor ...    127   4e-31   Solanum lycopersicum
ref|NP_001062423.1|  Os08g0546800                                       130   6e-31   
ref|XP_011084402.1|  PREDICTED: heat stress transcription factor ...    127   6e-31   Sesamum indicum [beniseed]
ref|XP_004974114.1|  PREDICTED: heat stress transcription factor ...    128   7e-31   Setaria italica
ref|XP_009389775.1|  PREDICTED: heat stress transcription factor ...    127   8e-31   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG11685.1|  Heat stress transcription factor B-2b -like protein     127   8e-31   Gossypium arboreum [tree cotton]
dbj|BAJ85352.1|  predicted protein                                      128   8e-31   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAD46358.1|  putative heat shock factor                             128   9e-31   Oryza sativa Japonica Group [Japonica rice]
dbj|BAK04233.1|  predicted protein                                      128   1e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB20712.1|  hypothetical protein B456_003G160600                    126   1e-30   Gossypium raimondii
ref|XP_010444038.1|  PREDICTED: heat stress transcription factor ...    126   1e-30   Camelina sativa [gold-of-pleasure]
gb|EAZ09820.1|  hypothetical protein OsI_32108                          128   1e-30   Oryza sativa Indica Group [Indian rice]
ref|XP_010676525.1|  PREDICTED: heat stress transcription factor ...    127   1e-30   Beta vulgaris subsp. vulgaris [field beet]
gb|KEH43737.1|  heat shock transcription factor B2A                     126   1e-30   Medicago truncatula
ref|XP_009138768.1|  PREDICTED: heat stress transcription factor B-1    125   2e-30   Brassica rapa
ref|NP_001063726.1|  Os09g0526600                                       127   2e-30   
ref|XP_003578478.1|  PREDICTED: heat stress transcription factor ...    127   2e-30   Brachypodium distachyon [annual false brome]
gb|EPS72138.1|  hypothetical protein M569_02618                         125   2e-30   Genlisea aurea
emb|CDY64186.1|  BnaC03g73070D                                          125   2e-30   Brassica napus [oilseed rape]
ref|XP_011030077.1|  PREDICTED: heat stress transcription factor ...    125   2e-30   Populus euphratica
ref|XP_006396868.1|  hypothetical protein EUTSA_v10028744mg             126   3e-30   Eutrema salsugineum [saltwater cress]
emb|CDX69274.1|  BnaC01g01790D                                          125   3e-30   
gb|ACN76855.1|  heat shock transcription factor                         124   3e-30   Cicer arietinum [garbanzo]
emb|CDY59386.1|  BnaC09g52680D                                          126   3e-30   Brassica napus [oilseed rape]
ref|XP_009124795.1|  PREDICTED: heat stress transcription factor ...    126   3e-30   Brassica rapa
emb|CDX86761.1|  BnaA09g21510D                                          126   3e-30   
gb|KFK31930.1|  hypothetical protein AALP_AA6G177400                    126   4e-30   Arabis alpina [alpine rockcress]
ref|XP_009415832.1|  PREDICTED: heat stress transcription factor ...    125   4e-30   
ref|XP_009397638.1|  PREDICTED: heat stress transcription factor ...    124   4e-30   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABV89640.1|  heat shock factor 4                                     124   4e-30   Brassica rapa
ref|XP_008439190.1|  PREDICTED: heat stress transcription factor ...    124   4e-30   Cucumis melo [Oriental melon]
ref|XP_004308106.1|  PREDICTED: heat stress transcription factor ...    124   8e-30   Fragaria vesca subsp. vesca
ref|XP_009134244.1|  PREDICTED: heat stress transcription factor ...    124   8e-30   Brassica rapa
emb|CDX90804.1|  BnaA03g24840D                                          124   1e-29   
ref|XP_010531239.1|  PREDICTED: heat stress transcription factor ...    122   1e-29   Tarenaya hassleriana [spider flower]
ref|XP_004140783.1|  PREDICTED: heat stress transcription factor ...    123   1e-29   Cucumis sativus [cucumbers]
ref|XP_010455582.1|  PREDICTED: heat stress transcription factor ...    124   2e-29   Camelina sativa [gold-of-pleasure]
ref|XP_010422122.1|  PREDICTED: heat stress transcription factor ...    124   2e-29   Camelina sativa [gold-of-pleasure]
ref|XP_010434580.1|  PREDICTED: heat stress transcription factor ...    124   2e-29   Camelina sativa [gold-of-pleasure]
emb|CAB63803.1|  heat shock factor 7                                    123   2e-29   Arabidopsis thaliana [mouse-ear cress]
ref|NP_192903.1|  heat stress transcription factor B-2b                 123   3e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002872608.1|  hypothetical protein ARALYDRAFT_911518             123   3e-29   Arabidopsis lyrata subsp. lyrata
emb|CDY67248.1|  BnaCnng54110D                                          121   4e-29   Brassica napus [oilseed rape]
ref|XP_009391581.1|  PREDICTED: heat stress transcription factor ...    122   4e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009130189.1|  PREDICTED: heat stress transcription factor ...    121   4e-29   Brassica rapa
ref|XP_006287969.1|  hypothetical protein CARUB_v10001204mg             123   5e-29   Capsella rubella
ref|NP_195416.1|  heat stress transcription factor B-1                  121   6e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002866968.1|  hypothetical protein ARALYDRAFT_490909             121   6e-29   
ref|XP_010432090.1|  PREDICTED: heat stress transcription factor ...    121   6e-29   Camelina sativa [gold-of-pleasure]
ref|XP_008241456.1|  PREDICTED: heat shock factor protein HSF24         121   6e-29   Prunus mume [ume]
ref|XP_004300764.1|  PREDICTED: heat stress transcription factor ...    122   7e-29   Fragaria vesca subsp. vesca
ref|XP_007202372.1|  hypothetical protein PRUPE_ppa009274mg             121   8e-29   Prunus persica
emb|CDY67770.1|  BnaCnng56320D                                          120   8e-29   Brassica napus [oilseed rape]
ref|XP_009138469.1|  PREDICTED: heat stress transcription factor ...    120   9e-29   Brassica rapa
emb|CDY42722.1|  BnaA03g53750D                                          120   9e-29   Brassica napus [oilseed rape]
emb|CAN61780.1|  hypothetical protein VITISV_028661                     122   9e-29   Vitis vinifera
ref|XP_010446698.1|  PREDICTED: heat stress transcription factor ...    120   1e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010437261.1|  PREDICTED: heat stress transcription factor ...    120   1e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010437260.1|  PREDICTED: heat stress transcription factor B-1    120   1e-28   Camelina sativa [gold-of-pleasure]
gb|ADL36733.1|  HSF domain class transcription factor                   120   1e-28   Malus domestica [apple tree]
ref|XP_008340075.1|  PREDICTED: heat shock factor protein HSF24         120   1e-28   
ref|XP_009367059.1|  PREDICTED: heat shock factor protein HSF24         120   2e-28   Pyrus x bretschneideri [bai li]
gb|AAC31756.1|  heat shock transcription factor 4                       119   3e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002982987.1|  hypothetical protein SELMODRAFT_15442              116   3e-28   
gb|KJB52055.1|  hypothetical protein B456_008G244400                    119   4e-28   Gossypium raimondii
ref|XP_006425894.1|  hypothetical protein CICLE_v10026058mg             119   4e-28   Citrus clementina [clementine]
ref|XP_006284246.1|  hypothetical protein CARUB_v10005408mg             119   4e-28   Capsella rubella
ref|XP_010269874.1|  PREDICTED: heat shock factor protein HSF24         119   5e-28   Nelumbo nucifera [Indian lotus]
ref|XP_002965510.1|  hypothetical protein SELMODRAFT_25564              116   6e-28   
ref|XP_009375707.1|  PREDICTED: heat stress transcription factor ...    119   6e-28   Pyrus x bretschneideri [bai li]
ref|XP_008338368.1|  PREDICTED: LOW QUALITY PROTEIN: heat stress ...    118   7e-28   
gb|KHN42077.1|  Heat stress transcription factor B-2c                   113   8e-28   Glycine soja [wild soybean]
ref|XP_010263545.1|  PREDICTED: heat shock factor protein HSF24-like    118   8e-28   Nelumbo nucifera [Indian lotus]
ref|XP_010061734.1|  PREDICTED: heat stress transcription factor ...    119   9e-28   Eucalyptus grandis [rose gum]
ref|XP_006425895.1|  hypothetical protein CICLE_v10026058mg             118   1e-27   Citrus clementina [clementine]
ref|XP_004288037.1|  PREDICTED: heat shock factor protein HSF24         117   1e-27   Fragaria vesca subsp. vesca
ref|XP_009400005.1|  PREDICTED: heat stress transcription factor ...    119   1e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010550365.1|  PREDICTED: heat shock factor protein HSF24-like    117   1e-27   
ref|XP_006466606.1|  PREDICTED: heat shock factor protein HSF24-like    117   1e-27   Citrus sinensis [apfelsine]
ref|XP_002277765.2|  PREDICTED: heat shock factor protein HSF24         117   2e-27   Vitis vinifera
ref|XP_008440278.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock f...    117   2e-27   
ref|XP_011043547.1|  PREDICTED: heat shock factor protein HSF24         117   2e-27   Populus euphratica
ref|XP_009589845.1|  PREDICTED: heat shock factor protein HSF24         117   2e-27   Nicotiana tomentosiformis
ref|XP_007047250.1|  Heat shock factor 4                                117   2e-27   
ref|XP_012079229.1|  PREDICTED: heat shock factor protein HSF24         117   2e-27   Jatropha curcas
ref|XP_009797839.1|  PREDICTED: heat shock factor protein HSF24         117   3e-27   Nicotiana sylvestris
ref|XP_010093647.1|  Heat shock factor protein HSF24                    118   3e-27   
ref|XP_006826240.1|  PREDICTED: heat shock factor protein HSF24         116   3e-27   Amborella trichopoda
ref|XP_004141916.1|  PREDICTED: heat shock factor protein HSF24         116   4e-27   Cucumis sativus [cucumbers]
gb|KJB17912.1|  hypothetical protein B456_003G023500                    116   5e-27   Gossypium raimondii
gb|KHG26651.1|  Heat shock factor HSF24                                 116   5e-27   Gossypium arboreum [tree cotton]
ref|XP_011099137.1|  PREDICTED: heat shock factor protein HSF24         115   5e-27   Sesamum indicum [beniseed]
ref|XP_002981332.1|  hypothetical protein SELMODRAFT_114534             116   6e-27   
ref|XP_002969726.1|  hypothetical protein SELMODRAFT_92634              116   6e-27   
ref|XP_010530513.1|  PREDICTED: heat stress transcription factor ...    117   6e-27   Tarenaya hassleriana [spider flower]
tpg|DAA63850.1|  TPA: hypothetical protein ZEAMMB73_974979              110   7e-27   
ref|XP_006380704.1|  hypothetical protein POPTR_0007s11030g             115   7e-27   
gb|KJB71094.1|  hypothetical protein B456_011G105700                    115   7e-27   Gossypium raimondii
sp|P22335.1|HSF24_SOLPE  RecName: Full=Heat shock factor protein ...    115   8e-27   Solanum peruvianum [Peruvian tomato]
gb|KJB71093.1|  hypothetical protein B456_011G105700                    115   8e-27   Gossypium raimondii
ref|XP_009611319.1|  PREDICTED: heat stress transcription factor B-4    116   8e-27   Nicotiana tomentosiformis
ref|XP_010547515.1|  PREDICTED: heat shock factor protein HSF24-like    114   8e-27   Tarenaya hassleriana [spider flower]
dbj|BAA83710.1|  heat shock factor                                      115   9e-27   Nicotiana tabacum [American tobacco]
ref|XP_004232034.1|  PREDICTED: heat shock factor protein HSF24         115   9e-27   
ref|XP_006829889.1|  PREDICTED: heat stress transcription factor B-4    116   1e-26   Amborella trichopoda
emb|CDP02491.1|  unnamed protein product                                117   1e-26   Coffea canephora [robusta coffee]
ref|XP_009399944.1|  PREDICTED: heat stress transcription factor ...    114   1e-26   
gb|KJB40253.1|  hypothetical protein B456_007G053900                    115   1e-26   Gossypium raimondii
gb|KHN28194.1|  Heat stress transcription factor B-4                    114   1e-26   Glycine soja [wild soybean]
gb|ERM98103.1|  hypothetical protein AMTR_s00095p00016160               115   1e-26   Amborella trichopoda
ref|XP_006658884.1|  PREDICTED: heat stress transcription factor ...    114   1e-26   Oryza brachyantha
gb|KHN36225.1|  Heat shock factor protein HSF24                         114   2e-26   Glycine soja [wild soybean]
ref|XP_006339901.1|  PREDICTED: heat shock factor protein HSF24-like    114   2e-26   Solanum tuberosum [potatoes]
ref|XP_008794230.1|  PREDICTED: heat stress transcription factor ...    114   2e-26   Phoenix dactylifera
ref|XP_004511933.1|  PREDICTED: heat stress transcription factor ...    114   2e-26   Cicer arietinum [garbanzo]
ref|XP_010673780.1|  PREDICTED: heat stress transcription factor ...    114   2e-26   Beta vulgaris subsp. vulgaris [field beet]
gb|AII99897.1|  heat shock transcription factor                         114   2e-26   Gossypium hirsutum [American cotton]
gb|AFK42633.1|  unknown                                                 114   2e-26   Medicago truncatula
ref|XP_004984281.1|  PREDICTED: heat stress transcription factor ...    114   2e-26   Setaria italica
ref|XP_010666616.1|  PREDICTED: heat shock factor protein HSF24         114   3e-26   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_001766517.1|  predicted protein                                  112   3e-26   
ref|XP_010922077.1|  PREDICTED: heat stress transcription factor ...    114   3e-26   Elaeis guineensis
ref|XP_003556931.1|  PREDICTED: heat stress transcription factor ...    113   3e-26   
gb|ACU21168.1|  unknown                                                 113   3e-26   Glycine max [soybeans]
ref|XP_002533289.1|  conserved hypothetical protein                     111   4e-26   
ref|XP_010269531.1|  PREDICTED: heat stress transcription factor ...    115   4e-26   Nelumbo nucifera [Indian lotus]
ref|XP_003611751.1|  Heat shock transcription factor                    115   4e-26   
ref|XP_011083880.1|  PREDICTED: heat stress transcription factor ...    114   5e-26   Sesamum indicum [beniseed]
ref|XP_009800135.1|  PREDICTED: heat stress transcription factor B-4    114   5e-26   Nicotiana sylvestris
ref|XP_002265293.1|  PREDICTED: heat stress transcription factor ...    113   6e-26   Vitis vinifera
gb|KJB14637.1|  hypothetical protein B456_002G135200                    114   6e-26   Gossypium raimondii
gb|EYU36312.1|  hypothetical protein MIMGU_mgv1a021807mg                114   6e-26   Erythranthe guttata [common monkey flower]
emb|CDP01323.1|  unnamed protein product                                113   6e-26   Coffea canephora [robusta coffee]
ref|XP_010541155.1|  PREDICTED: heat stress transcription factor ...    113   6e-26   Tarenaya hassleriana [spider flower]
ref|XP_010931521.1|  PREDICTED: heat stress transcription factor ...    112   6e-26   Elaeis guineensis
ref|NP_001241597.1|  heat shock factor                                  113   6e-26   Glycine max [soybeans]
ref|XP_004238144.1|  PREDICTED: heat stress transcription factor B-4    114   7e-26   Solanum lycopersicum
ref|XP_006651414.1|  PREDICTED: heat stress transcription factor ...    113   8e-26   
ref|XP_007015249.1|  Heat shock transcription factor B4                 112   8e-26   
ref|XP_009383247.1|  PREDICTED: heat stress transcription factor ...    112   8e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006354868.1|  PREDICTED: heat stress transcription factor ...    113   1e-25   Solanum tuberosum [potatoes]
ref|XP_003603058.1|  Heat stress transcription factor B-4               113   1e-25   Medicago truncatula
ref|XP_010675615.1|  PREDICTED: heat stress transcription factor ...    113   1e-25   Beta vulgaris subsp. vulgaris [field beet]
emb|CBI19505.3|  unnamed protein product                                112   1e-25   Vitis vinifera
ref|XP_007146140.1|  hypothetical protein PHAVU_006G015700g             112   1e-25   Phaseolus vulgaris [French bean]
gb|KJB29461.1|  hypothetical protein B456_005G102000                    113   1e-25   Gossypium raimondii
gb|EEE67672.1|  hypothetical protein OsJ_25309                          107   1e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010112180.1|  Heat stress transcription factor B-4               113   1e-25   Morus notabilis
ref|XP_010235376.1|  PREDICTED: heat stress transcription factor ...    113   1e-25   Brachypodium distachyon [annual false brome]
ref|XP_002465224.1|  hypothetical protein SORBIDRAFT_01g034500          112   1e-25   Sorghum bicolor [broomcorn]
gb|KCW54959.1|  hypothetical protein EUGRSUZ_I00929                     113   1e-25   Eucalyptus grandis [rose gum]
gb|EEC75327.1|  hypothetical protein OsI_11708                          112   1e-25   Oryza sativa Indica Group [Indian rice]
ref|XP_003617219.1|  Heat stress transcription factor B-4               111   1e-25   
dbj|BAI99728.1|  heat stress transcription factor                       112   1e-25   
ref|XP_006434743.1|  hypothetical protein CICLE_v10001482mg             113   1e-25   
ref|XP_004501560.1|  PREDICTED: heat stress transcription factor ...    113   2e-25   
ref|XP_007226488.1|  hypothetical protein PRUPE_ppa026635mg             113   2e-25   
ref|XP_010028256.1|  PREDICTED: heat shock factor protein HSF24         112   2e-25   
ref|XP_003537320.1|  PREDICTED: heat shock factor protein HSF24-like    112   2e-25   
ref|XP_010672196.1|  PREDICTED: putative disease resistance RPP13...    115   2e-25   
ref|XP_001754155.1|  predicted protein                                  107   2e-25   
ref|XP_007155926.1|  hypothetical protein PHAVU_003G244000g             111   2e-25   
ref|XP_008220242.1|  PREDICTED: heat stress transcription factor B-4    113   2e-25   
ref|XP_010088963.1|  Heat stress transcription factor B-4               112   2e-25   
ref|XP_006473306.1|  PREDICTED: heat stress transcription factor ...    113   2e-25   
ref|NP_001241604.1|  uncharacterized protein LOC100782841               112   2e-25   
emb|CAA87080.1|  heat shock transcription factor 5                      112   2e-25   
ref|XP_006374916.1|  hypothetical protein POPTR_0014s02700g             112   2e-25   
ref|XP_002284836.1|  PREDICTED: heat stress transcription factor B-4    112   2e-25   
gb|KJB58516.1|  hypothetical protein B456_009G213100                    112   2e-25   
ref|XP_011017186.1|  PREDICTED: heat stress transcription factor ...    112   2e-25   
ref|XP_002510200.1|  DNA binding protein, putative                      112   2e-25   
ref|XP_007160861.1|  hypothetical protein PHAVU_001G022900g             112   2e-25   
ref|XP_002301176.2|  hypothetical protein POPTR_0002s12640g             112   3e-25   
gb|EMT05224.1|  Heat stress transcription factor B-4b                   106   3e-25   
ref|XP_007017200.1|  Heat shock transcription factor B4                 112   3e-25   
ref|XP_012068333.1|  PREDICTED: heat stress transcription factor B-4    112   3e-25   
ref|XP_008786852.1|  PREDICTED: heat stress transcription factor ...    111   3e-25   
ref|XP_011029683.1|  PREDICTED: heat stress transcription factor ...    112   3e-25   
ref|XP_010263520.1|  PREDICTED: heat stress transcription factor ...    112   3e-25   
ref|XP_006374917.1|  heat shock transcription factor HSF31 family...    112   3e-25   
ref|XP_007136692.1|  hypothetical protein PHAVU_009G065800g             112   3e-25   
ref|XP_008444610.1|  PREDICTED: heat stress transcription factor B-4    112   3e-25   
ref|XP_011074417.1|  PREDICTED: LOW QUALITY PROTEIN: heat stress ...    112   3e-25   
ref|XP_003528294.1|  PREDICTED: heat stress transcription factor B-4    112   3e-25   
ref|XP_003550068.1|  PREDICTED: heat shock factor protein HSF24-like    111   3e-25   
ref|XP_002298460.1|  hypothetical protein POPTR_0001s28040g             110   3e-25   
ref|XP_008779895.1|  PREDICTED: heat stress transcription factor ...    111   4e-25   
gb|KCW51072.1|  hypothetical protein EUGRSUZ_J00680                     111   4e-25   
ref|XP_010943094.1|  PREDICTED: heat stress transcription factor ...    111   4e-25   
ref|XP_004143013.1|  PREDICTED: heat stress transcription factor B-4    112   4e-25   
ref|XP_010059922.1|  PREDICTED: heat stress transcription factor ...    111   4e-25   
ref|XP_009107442.1|  PREDICTED: heat stress transcription factor B-4    111   4e-25   
tpg|DAA63849.1|  TPA: hypothetical protein ZEAMMB73_974979              108   4e-25   
ref|XP_011024992.1|  PREDICTED: heat stress transcription factor ...    110   4e-25   
ref|XP_008452568.1|  PREDICTED: heat stress transcription factor ...    111   4e-25   
ref|XP_012065837.1|  PREDICTED: heat stress transcription factor ...    110   4e-25   
ref|XP_010031706.1|  PREDICTED: heat stress transcription factor ...    111   4e-25   
ref|XP_010248394.1|  PREDICTED: heat stress transcription factor ...    112   5e-25   
ref|XP_004141262.1|  PREDICTED: heat stress transcription factor ...    111   5e-25   
tpg|DAA45501.1|  TPA: hypothetical protein ZEAMMB73_255145              111   5e-25   
emb|CDY40844.1|  BnaC08g04780D                                          111   5e-25   
ref|XP_002463264.1|  hypothetical protein SORBIDRAFT_02g040790          110   6e-25   
ref|XP_004509144.1|  PREDICTED: heat shock factor protein HSF24-like    110   7e-25   
ref|NP_001288049.1|  heat stress transcription factor B-4               111   7e-25   
ref|XP_008357386.1|  PREDICTED: heat stress transcription factor ...    111   7e-25   
ref|XP_002314009.1|  hypothetical protein POPTR_0009s07220g             109   8e-25   
ref|XP_011036401.1|  PREDICTED: heat stress transcription factor ...    109   8e-25   
ref|XP_009359791.1|  PREDICTED: heat stress transcription factor B-4    111   8e-25   
gb|AII82334.1|  heat shock transcription factor                         110   9e-25   
gb|KJB63865.1|  hypothetical protein B456_010G020700                    110   1e-24   
emb|CDY06765.1|  BnaA10g05440D                                          110   1e-24   
ref|XP_003523945.1|  PREDICTED: heat stress transcription factor B-4    110   1e-24   
ref|XP_008656017.1|  PREDICTED: heat stress transcription factor ...    110   1e-24   
gb|KHG03540.1|  Heat stress transcription factor B-4 -like protein      110   1e-24   
ref|XP_010916598.1|  PREDICTED: heat stress transcription factor ...    111   1e-24   
ref|XP_001758292.1|  predicted protein                                  109   1e-24   
ref|XP_011620441.1|  PREDICTED: uncharacterized protein LOC18426138     112   1e-24   
ref|XP_004958473.1|  PREDICTED: heat stress transcription factor ...    109   1e-24   
ref|XP_010246178.1|  PREDICTED: heat stress transcription factor ...    109   1e-24   
ref|XP_003559898.1|  PREDICTED: heat stress transcription factor ...    109   1e-24   
ref|XP_004291096.2|  PREDICTED: heat stress transcription factor B-4    111   2e-24   
dbj|BAK08075.1|  predicted protein                                      109   2e-24   
gb|AHZ44772.1|  heat shock factor B4b                                   106   2e-24   
ref|XP_006393631.1|  hypothetical protein EUTSA_v10012033mg             109   2e-24   
gb|EAZ04872.1|  hypothetical protein OsI_27052                          109   2e-24   
ref|XP_007141514.1|  hypothetical protein PHAVU_008G202500g             108   2e-24   
gb|KHN01274.1|  Heat shock factor protein HSF24                         108   2e-24   
ref|XP_008244246.1|  PREDICTED: heat stress transcription factor B-3    108   2e-24   
ref|XP_009119797.1|  PREDICTED: heat stress transcription factor ...    109   2e-24   
ref|XP_009393520.1|  PREDICTED: heat stress transcription factor ...    110   2e-24   
ref|XP_004491224.1|  PREDICTED: heat stress transcription factor ...    108   3e-24   
ref|XP_010461505.1|  PREDICTED: heat stress transcription factor ...    109   3e-24   
ref|XP_002891331.1|  hypothetical protein ARALYDRAFT_473862             109   3e-24   
ref|XP_009611948.1|  PREDICTED: heat stress transcription factor ...    109   3e-24   
sp|Q10KX8.1|HFB4D_ORYSJ  RecName: Full=Heat stress transcription ...    108   3e-24   
gb|ACL52755.1|  unknown                                                 108   3e-24   
ref|NP_175142.1|  heat stress transcription factor SCHIZORIZA           109   3e-24   
ref|XP_010479105.1|  PREDICTED: heat stress transcription factor ...    109   3e-24   
gb|EPS66396.1|  heat shock transcription factor                         107   3e-24   
ref|XP_010943066.1|  PREDICTED: heat stress transcription factor ...    108   4e-24   
ref|XP_006305155.1|  hypothetical protein CARUB_v10009522mg             108   4e-24   
ref|XP_010242159.1|  PREDICTED: heat stress transcription factor ...    109   4e-24   
ref|XP_010500211.1|  PREDICTED: heat stress transcription factor B-4    108   4e-24   
ref|XP_006350178.1|  PREDICTED: heat stress transcription factor ...    107   4e-24   
gb|AHZ44771.1|  heat shock factor B4a                                   108   4e-24   
ref|XP_001694420.1|  heat shock transcription factor 1                  103   4e-24   
gb|AIG20081.1|  HSF14                                                   108   4e-24   
ref|XP_007202846.1|  hypothetical protein PRUPE_ppa014675mg             106   4e-24   
gb|KFK44645.1|  hypothetical protein AALP_AA1G285500                    108   5e-24   
ref|XP_009769104.1|  PREDICTED: heat stress transcription factor ...    108   5e-24   
gb|KGN53859.1|  hypothetical protein Csa_4G171490                       103   5e-24   
dbj|BAJ96942.1|  predicted protein                                      103   6e-24   
ref|NP_001060424.1|  Os07g0640900                                       108   6e-24   
gb|KHN12792.1|  Heat stress transcription factor B-4                    108   7e-24   
ref|XP_003550334.1|  PREDICTED: heat stress transcription factor ...    108   7e-24   
ref|XP_008670235.1|  PREDICTED: heat stress transcription factor ...    107   7e-24   
ref|XP_002879948.1|  AT-HSFB3                                           106   8e-24   
gb|KDO40095.1|  hypothetical protein CISIN_1g0101662mg                  102   9e-24   
ref|XP_004236602.1|  PREDICTED: heat stress transcription factor B-3    106   9e-24   
emb|CDY22535.1|  BnaC03g23450D                                          106   9e-24   
emb|CDY17098.1|  BnaC06g00310D                                          107   9e-24   
ref|XP_009796891.1|  PREDICTED: heat stress transcription factor ...    106   9e-24   
ref|XP_004303209.1|  PREDICTED: heat stress transcription factor ...    108   1e-23   
ref|XP_009617028.1|  PREDICTED: heat stress transcription factor B-3    106   1e-23   
gb|ACU16824.1|  unknown                                                 105   1e-23   
gb|KHN38397.1|  Heat stress transcription factor B-4                    106   1e-23   
gb|KHN12039.1|  Heat stress transcription factor B-4                    106   1e-23   
ref|XP_009417632.1|  PREDICTED: heat stress transcription factor ...    107   1e-23   
ref|XP_002960464.1|  hypothetical protein SELMODRAFT_39375              102   1e-23   
ref|XP_009395938.1|  PREDICTED: heat stress transcription factor ...    106   1e-23   
ref|XP_006348918.1|  PREDICTED: heat stress transcription factor ...    107   1e-23   
gb|ABL74450.1|  heat shock factor 1                                     110   1e-23   
ref|XP_010056944.1|  PREDICTED: heat stress transcription factor B-3    106   1e-23   
ref|XP_010105217.1|  Heat stress transcription factor B-3               105   1e-23   
ref|XP_003518479.1|  PREDICTED: heat stress transcription factor ...    106   2e-23   
ref|XP_003545167.1|  PREDICTED: heat stress transcription factor ...    106   2e-23   
ref|XP_001776501.1|  predicted protein                                  101   2e-23   
ref|XP_002323320.2|  Heat Stress Transcription Factor family protein    105   2e-23   
ref|XP_004304340.1|  PREDICTED: heat stress transcription factor B-3    105   2e-23   
ref|XP_010939421.1|  PREDICTED: heat stress transcription factor ...    106   2e-23   
emb|CBI29823.3|  unnamed protein product                                102   2e-23   
ref|XP_002987932.1|  hypothetical protein SELMODRAFT_39384              101   2e-23   
gb|EMS50138.1|  Heat stress transcription factor B-2a                   103   2e-23   
ref|XP_004136787.1|  PREDICTED: heat stress transcription factor ...    105   2e-23   
ref|XP_009381466.1|  PREDICTED: heat stress transcription factor ...    105   3e-23   
ref|XP_006654692.1|  PREDICTED: heat stress transcription factor ...    107   3e-23   
ref|XP_007216966.1|  hypothetical protein PRUPE_ppa015468mg             106   3e-23   
ref|XP_003521171.1|  PREDICTED: heat stress transcription factor ...    104   3e-23   
emb|CAN80282.1|  hypothetical protein VITISV_017449                     106   3e-23   
ref|XP_009370956.1|  PREDICTED: heat stress transcription factor ...    107   3e-23   
ref|XP_008228879.1|  PREDICTED: heat stress transcription factor ...    106   3e-23   
gb|AEB26593.1|  heat shock factor B1                                    101   3e-23   
ref|XP_009354248.1|  PREDICTED: heat stress transcription factor ...    106   4e-23   
ref|XP_002278037.1|  PREDICTED: heat stress transcription factor ...    106   4e-23   
ref|XP_009409313.1|  PREDICTED: heat stress transcription factor ...    105   4e-23   
ref|XP_007028662.1|  Heat shock factor protein, putative                104   4e-23   
ref|XP_010109197.1|  Heat stress transcription factor A-4b              106   4e-23   
ref|XP_009406764.1|  PREDICTED: heat stress transcription factor ...    106   4e-23   
ref|XP_004493479.1|  PREDICTED: LOW QUALITY PROTEIN: heat stress ...    104   4e-23   
ref|XP_008342767.1|  PREDICTED: heat stress transcription factor ...    106   4e-23   
ref|XP_006854048.2|  PREDICTED: heat stress transcription factor A-1    107   4e-23   
ref|XP_006653688.1|  PREDICTED: heat stress transcription factor ...    104   5e-23   
ref|NP_001281032.1|  heat stress transcription factor A-4b-like         106   5e-23   
gb|ERN15515.1|  hypothetical protein AMTR_s00048p00075850               107   5e-23   
ref|XP_008808108.1|  PREDICTED: heat stress transcription factor ...    105   5e-23   
ref|XP_006368372.1|  heat shock transcription factor family protein     107   5e-23   
ref|XP_004976526.1|  PREDICTED: heat stress transcription factor ...    105   5e-23   
ref|XP_008360667.1|  PREDICTED: heat stress transcription factor ...    104   5e-23   
ref|XP_010106176.1|  hypothetical protein L484_009600                   100   5e-23   
ref|XP_009363186.1|  PREDICTED: heat stress transcription factor ...    104   5e-23   
ref|XP_006492933.1|  PREDICTED: heat stress transcription factor ...    104   5e-23   
ref|XP_011028139.1|  PREDICTED: heat shock factor protein HSF8-like     107   6e-23   
gb|AEO91550.1|  heat shock transcription factor                         106   6e-23   
ref|XP_003554170.1|  PREDICTED: heat stress transcription factor ...    103   6e-23   
tpg|DAA61767.1|  TPA: hypothetical protein ZEAMMB73_394338              105   6e-23   
ref|XP_008381180.1|  PREDICTED: heat stress transcription factor ...    105   6e-23   
ref|XP_002303429.2|  heat shock transcription factor family protein     107   6e-23   
ref|XP_009363199.1|  PREDICTED: heat stress transcription factor ...    103   6e-23   
ref|NP_001150318.1|  heat shock factor protein 4                        105   6e-23   
ref|XP_002284216.1|  PREDICTED: heat stress transcription factor B-3    103   6e-23   
ref|XP_011013884.1|  PREDICTED: heat shock factor protein HSF8-like     106   7e-23   
ref|XP_007156806.1|  hypothetical protein PHAVU_002G019100g             104   7e-23   
ref|XP_009794990.1|  PREDICTED: heat stress transcription factor ...    104   7e-23   
ref|XP_006294789.1|  hypothetical protein CARUB_v10023839mg             104   7e-23   
ref|XP_004149402.1|  PREDICTED: heat stress transcription factor B-3    103   7e-23   
ref|XP_008238205.1|  PREDICTED: heat shock factor protein HSF8          106   7e-23   
gb|KDO48197.1|  hypothetical protein CISIN_1g025781mg                   103   7e-23   
ref|XP_006421321.1|  hypothetical protein CICLE_v10005649mg             104   8e-23   
ref|XP_009133506.1|  PREDICTED: heat stress transcription factor B-3    103   8e-23   
gb|KHG05479.1|  Heat stress transcription factor B-4 -like protein      104   8e-23   
gb|ADL36729.1|  HSF domain class transcription factor                   105   8e-23   
ref|XP_001760365.1|  predicted protein                                  103   8e-23   
ref|XP_009396840.1|  PREDICTED: heat stress transcription factor ...    106   8e-23   
ref|XP_011075335.1|  PREDICTED: heat stress transcription factor ...    103   8e-23   
ref|XP_009410099.1|  PREDICTED: heat stress transcription factor ...    104   8e-23   
gb|EAZ09370.1|  hypothetical protein OsI_31643                          100   8e-23   
ref|XP_006411432.1|  hypothetical protein EUTSA_v10017795mg             103   8e-23   
ref|XP_008387308.1|  PREDICTED: heat stress transcription factor ...    103   8e-23   
ref|XP_008792312.1|  PREDICTED: heat stress transcription factor ...    105   9e-23   
ref|XP_009365270.1|  PREDICTED: heat stress transcription factor ...    105   9e-23   
ref|XP_009409312.1|  PREDICTED: heat stress transcription factor ...    105   9e-23   
ref|XP_008661876.1|  PREDICTED: heat shock factor protein 4 isofo...    104   9e-23   
tpg|DAA61768.1|  TPA: heat shock factor protein 4                       104   1e-22   
ref|XP_011075334.1|  PREDICTED: heat stress transcription factor ...    103   1e-22   
ref|XP_012086190.1|  PREDICTED: heat stress transcription factor B-3    103   1e-22   
ref|XP_010096952.1|  Heat shock factor protein HSF8                     106   1e-22   
ref|XP_008387309.1|  PREDICTED: heat stress transcription factor ...    103   1e-22   
gb|EMT31202.1|  Heat stress transcription factor B-1                    104   1e-22   
ref|XP_004242136.1|  PREDICTED: heat stress transcription factor ...    105   1e-22   
gb|AII99899.1|  heat shock transcription factor                         103   1e-22   
gb|KJB75485.1|  hypothetical protein B456_012G044200                    104   1e-22   
ref|XP_011018512.1|  PREDICTED: heat stress transcription factor ...    105   1e-22   
ref|XP_004243245.1|  PREDICTED: heat stress transcription factor ...    104   1e-22   
gb|KJB19264.1|  hypothetical protein B456_003G091700                    103   1e-22   
gb|KDD73260.1|  heat shock factor-like DNA-binding protein              102   1e-22   
ref|XP_002525885.1|  Heat shock factor protein, putative                105   1e-22   
ref|XP_002308023.1|  Heat Stress Transcription Factor family protein    102   2e-22   
gb|KJB21125.1|  hypothetical protein B456_003G183900                    105   2e-22   
gb|KHG05169.1|  Heat shock factor HSF8                                  105   2e-22   
ref|XP_012081059.1|  PREDICTED: heat shock factor protein HSF8          105   2e-22   
ref|XP_011048077.1|  PREDICTED: heat stress transcription factor B-3    102   2e-22   
ref|XP_008797267.1|  PREDICTED: heat stress transcription factor ...    103   2e-22   
ref|XP_012070195.1|  PREDICTED: heat stress transcription factor ...    104   2e-22   
ref|XP_009339449.1|  PREDICTED: heat stress transcription factor ...    102   2e-22   
ref|XP_010554824.1|  PREDICTED: heat stress transcription factor ...    102   2e-22   
ref|XP_004148748.1|  PREDICTED: heat stress transcription factor ...    105   2e-22   
gb|KDP30379.1|  hypothetical protein JCGZ_17108                         105   2e-22   
gb|KHG04346.1|  Heat shock factor HSF8                                  105   2e-22   
ref|XP_002970172.1|  hypothetical protein SELMODRAFT_93081              101   2e-22   
ref|XP_002978339.1|  hypothetical protein SELMODRAFT_109000             101   2e-22   
ref|XP_009380920.1|  PREDICTED: heat stress transcription factor ...    103   2e-22   
ref|XP_010279495.1|  PREDICTED: heat stress transcription factor ...    102   2e-22   



>ref|XP_009603015.1| PREDICTED: heat stress transcription factor B-2b [Nicotiana tomentosiformis]
 ref|XP_009603016.1| PREDICTED: heat stress transcription factor B-2b [Nicotiana tomentosiformis]
 ref|XP_009603017.1| PREDICTED: heat stress transcription factor B-2b [Nicotiana tomentosiformis]
Length=333

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/82 (89%), Positives = 78/82 (95%), Gaps = 1/82 (1%)
 Frame = +2

Query  428  PPVERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFAR  607
            PP+ERNGGE+TAG E  RSVPTPFLTKT+QLV+D SIDDV+SWNEDGSSFIVWNPTEFAR
Sbjct  4    PPIERNGGESTAG-ETARSVPTPFLTKTYQLVEDPSIDDVVSWNEDGSSFIVWNPTEFAR  62

Query  608  DLLPKYFKHNNFSSFVRQLNTY  673
            DLLPKYFKHNNFSSFVRQLNTY
Sbjct  63   DLLPKYFKHNNFSSFVRQLNTY  84



>ref|XP_006353396.1| PREDICTED: heat stress transcription factor B-2c-like [Solanum 
tuberosum]
Length=335

 Score =   154 bits (389),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 78/81 (96%), Gaps = 1/81 (1%)
 Frame = +2

Query  431  PVERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARD  610
            P++RNGGETTAG E QRSVPTPFLTKT+QL++D+SIDDVISWNEDGS+FIVWNP EFA+D
Sbjct  5    PIDRNGGETTAG-ETQRSVPTPFLTKTYQLIEDQSIDDVISWNEDGSTFIVWNPAEFAKD  63

Query  611  LLPKYFKHNNFSSFVRQLNTY  673
            LLPKYFKHNNFSSFVRQLNTY
Sbjct  64   LLPKYFKHNNFSSFVRQLNTY  84



>ref|XP_009803855.1| PREDICTED: heat stress transcription factor B-2b-like [Nicotiana 
sylvestris]
 ref|XP_009803856.1| PREDICTED: heat stress transcription factor B-2b-like [Nicotiana 
sylvestris]
 ref|XP_009803857.1| PREDICTED: heat stress transcription factor B-2b-like [Nicotiana 
sylvestris]
Length=333

 Score =   154 bits (389),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 72/82 (88%), Positives = 78/82 (95%), Gaps = 1/82 (1%)
 Frame = +2

Query  428  PPVERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFAR  607
            PP+ERNGGE+TAG E  RSVPTPFLTKT+QLV+D SIDDV+SWNEDGS+FIVWNPTEFAR
Sbjct  4    PPIERNGGESTAG-ETARSVPTPFLTKTYQLVEDPSIDDVVSWNEDGSTFIVWNPTEFAR  62

Query  608  DLLPKYFKHNNFSSFVRQLNTY  673
            DLLPKYFKHNNFSSFVRQLNTY
Sbjct  63   DLLPKYFKHNNFSSFVRQLNTY  84



>ref|XP_007038632.1| Heat shock transcription factor B2A, putative [Theobroma cacao]
 gb|EOY23133.1| Heat shock transcription factor B2A, putative [Theobroma cacao]
Length=323

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/89 (83%), Positives = 80/89 (90%), Gaps = 4/89 (4%)
 Frame = +2

Query  413  MGPPVPPVERNGGETTAG--GEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVW  586
            M PP  PVE+NG ETTA   GE+QRSVPTPFLTKT+QLVDD +IDDVISWN+DGS+FIVW
Sbjct  1    MAPP--PVEQNGEETTAAAAGESQRSVPTPFLTKTYQLVDDHTIDDVISWNDDGSTFIVW  58

Query  587  NPTEFARDLLPKYFKHNNFSSFVRQLNTY  673
            NPT FARDLLPKYFKHNNFSSFVRQLNTY
Sbjct  59   NPTVFARDLLPKYFKHNNFSSFVRQLNTY  87



>emb|CDP21507.1| unnamed protein product [Coffea canephora]
Length=346

 Score =   151 bits (382),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 80/91 (88%), Gaps = 6/91 (7%)
 Frame = +2

Query  413  MGPPVPPVERNGGETTAG----GEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFI  580
            M PP  PVERNGGE+T      G+  RS+PTPFLTKT+QLVDDR+IDDVISWNEDGS+FI
Sbjct  1    MAPP--PVERNGGESTTTPPPPGDGPRSLPTPFLTKTYQLVDDRTIDDVISWNEDGSTFI  58

Query  581  VWNPTEFARDLLPKYFKHNNFSSFVRQLNTY  673
            VWNPTEFARDLLPKYFKHNNFSSFVRQLNTY
Sbjct  59   VWNPTEFARDLLPKYFKHNNFSSFVRQLNTY  89



>ref|XP_004234371.1| PREDICTED: heat stress transcription factor B-2a [Solanum lycopersicum]
Length=338

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 77/81 (95%), Gaps = 1/81 (1%)
 Frame = +2

Query  431  PVERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARD  610
            P++RN GETTAG E  RSVPTPFLTKT+QL++D+SIDDVISWNEDGS+FIVWNPTEFARD
Sbjct  5    PIDRNKGETTAG-ETPRSVPTPFLTKTYQLIEDQSIDDVISWNEDGSTFIVWNPTEFARD  63

Query  611  LLPKYFKHNNFSSFVRQLNTY  673
            LLPKYFKHNNFSSFVRQLNTY
Sbjct  64   LLPKYFKHNNFSSFVRQLNTY  84



>gb|AIG20087.1| HSF20 [Gossypium hirsutum]
Length=326

 Score =   150 bits (378),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 77/87 (89%), Gaps = 2/87 (2%)
 Frame = +2

Query  413  MGPPVPPVERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNP  592
            M PP  PVE+NG  TT   E+QRS+PTPFLTKT+QLVDD +IDDVISWN+DGS+FIVWNP
Sbjct  1    MAPP--PVEQNGDATTGTAESQRSIPTPFLTKTYQLVDDHTIDDVISWNDDGSTFIVWNP  58

Query  593  TEFARDLLPKYFKHNNFSSFVRQLNTY  673
            T FARDLLPKYFKHNNFSSFVRQLNTY
Sbjct  59   TVFARDLLPKYFKHNNFSSFVRQLNTY  85



>ref|XP_011076201.1| PREDICTED: heat stress transcription factor B-2a-like [Sesamum 
indicum]
 ref|XP_011076202.1| PREDICTED: heat stress transcription factor B-2a-like [Sesamum 
indicum]
Length=346

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 77/87 (89%), Gaps = 2/87 (2%)
 Frame = +2

Query  413  MGPPVPPVERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNP  592
            M PP  PV+RNGG  +  G+  R++PTPFLTKT+QLVDD +IDDVISWNEDGS+FIVWNP
Sbjct  1    MAPP--PVDRNGGGESTAGDTPRTLPTPFLTKTYQLVDDHAIDDVISWNEDGSTFIVWNP  58

Query  593  TEFARDLLPKYFKHNNFSSFVRQLNTY  673
            TEFARDLLPKYFKHNNFSSFVRQLNTY
Sbjct  59   TEFARDLLPKYFKHNNFSSFVRQLNTY  85



>ref|XP_004515711.1| PREDICTED: heat stress transcription factor B-2b-like [Cicer 
arietinum]
Length=332

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/88 (81%), Positives = 79/88 (90%), Gaps = 1/88 (1%)
 Frame = +2

Query  413  MGPPVPPVERNGGETTAGG-EAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWN  589
            M PP+PPVE NG  TTA   E+QRS+PTPFLTKT+ LV+D+SIDDVISWN+DGS+FIVWN
Sbjct  1    MAPPLPPVENNGESTTASVLESQRSIPTPFLTKTYNLVEDQSIDDVISWNDDGSTFIVWN  60

Query  590  PTEFARDLLPKYFKHNNFSSFVRQLNTY  673
            PT FARDLLPKYFKHNNFSSFVRQLNTY
Sbjct  61   PTIFARDLLPKYFKHNNFSSFVRQLNTY  88



>gb|KJB39397.1| hypothetical protein B456_007G010900 [Gossypium raimondii]
Length=326

 Score =   148 bits (374),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 76/87 (87%), Gaps = 2/87 (2%)
 Frame = +2

Query  413  MGPPVPPVERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNP  592
            M PP  PVE+NG  TT   E+QRS+PTPFLTKT+QLVDD +IDDVISWN+DGS+FIVWNP
Sbjct  1    MAPP--PVEQNGDATTGTAESQRSIPTPFLTKTYQLVDDHTIDDVISWNDDGSTFIVWNP  58

Query  593  TEFARDLLPKYFKHNNFSSFVRQLNTY  673
              FARDLLPKYFKHNNFSSFVRQLNTY
Sbjct  59   MVFARDLLPKYFKHNNFSSFVRQLNTY  85



>ref|XP_007218740.1| hypothetical protein PRUPE_ppa009180mg [Prunus persica]
 gb|EMJ19939.1| hypothetical protein PRUPE_ppa009180mg [Prunus persica]
Length=303

 Score =   146 bits (368),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +2

Query  434  VERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDL  613
            VE NGGE+T+G  +QR++PTPFLTKT+QLVDD +IDDVISWN+DGSSF+VWNPT FARDL
Sbjct  6    VEPNGGESTSGESSQRALPTPFLTKTYQLVDDPTIDDVISWNDDGSSFVVWNPTVFARDL  65

Query  614  LPKYFKHNNFSSFVRQLNTY  673
            LPKYFKHNNFSSFVRQLNTY
Sbjct  66   LPKYFKHNNFSSFVRQLNTY  85



>ref|XP_002321902.2| hypothetical protein POPTR_0015s13390g [Populus trichocarpa]
 gb|EEF06029.2| hypothetical protein POPTR_0015s13390g [Populus trichocarpa]
Length=286

 Score =   143 bits (361),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/94 (73%), Positives = 78/94 (83%), Gaps = 8/94 (9%)
 Frame = +2

Query  413  MGPPVPPVERNGGET-------TAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGS  571
            M  P+P VE+N GET        AGGE  RS+PTPFLTKTF++VDD +IDDVISWNEDGS
Sbjct  1    MASPLP-VEQNSGETPPSPLAAAAGGETSRSIPTPFLTKTFKIVDDHTIDDVISWNEDGS  59

Query  572  SFIVWNPTEFARDLLPKYFKHNNFSSFVRQLNTY  673
            SF+VWNPT F+RDLLPK+FKHNNFSSFVRQLNTY
Sbjct  60   SFVVWNPTLFSRDLLPKFFKHNNFSSFVRQLNTY  93



>ref|XP_007152318.1| hypothetical protein PHAVU_004G119600g [Phaseolus vulgaris]
 gb|ESW24312.1| hypothetical protein PHAVU_004G119600g [Phaseolus vulgaris]
Length=340

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 75/85 (88%), Gaps = 3/85 (4%)
 Frame = +2

Query  428  PPVERNGGETT---AGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTE  598
            PPVE N   TT   A  ++QRS+PTPFLTKTFQLVDD+SIDDVISWN+DGS+FIVWNPT 
Sbjct  5    PPVEHNTDSTTTASAAADSQRSIPTPFLTKTFQLVDDQSIDDVISWNDDGSTFIVWNPTV  64

Query  599  FARDLLPKYFKHNNFSSFVRQLNTY  673
            FARDLLPKYFKHNNFSSFVRQLNTY
Sbjct  65   FARDLLPKYFKHNNFSSFVRQLNTY  89



>ref|XP_010061278.1| PREDICTED: heat stress transcription factor B-2b-like [Eucalyptus 
grandis]
 gb|KCW90728.1| hypothetical protein EUGRSUZ_A02804 [Eucalyptus grandis]
Length=329

 Score =   143 bits (361),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 76/87 (87%), Gaps = 2/87 (2%)
 Frame = +2

Query  413  MGPPVPPVERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNP  592
            M PP PP+E+ G   +  GE+QRS PTPFLTKT+QLVDD ++DDVISWN+DGS+F+VWNP
Sbjct  1    MAPPPPPLEQRG--DSPAGESQRSTPTPFLTKTYQLVDDPAVDDVISWNDDGSAFVVWNP  58

Query  593  TEFARDLLPKYFKHNNFSSFVRQLNTY  673
            T FARDLLPKYFKHNNFSSFVRQLNTY
Sbjct  59   TVFARDLLPKYFKHNNFSSFVRQLNTY  85



>ref|XP_010278594.1| PREDICTED: heat stress transcription factor B-2b-like [Nelumbo 
nucifera]
Length=318

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 75/87 (86%), Gaps = 4/87 (5%)
 Frame = +2

Query  413  MGPPVPPVERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNP  592
            M PP  PVE+ G  TT  G+ QRS+PTPFLTKT+QLVDD SIDDVISWNEDGS+FIVW P
Sbjct  1    MAPP--PVEQIGESTT--GDGQRSLPTPFLTKTYQLVDDPSIDDVISWNEDGSTFIVWRP  56

Query  593  TEFARDLLPKYFKHNNFSSFVRQLNTY  673
             EFARDLLPKYFKHNNFSSFVRQLNTY
Sbjct  57   AEFARDLLPKYFKHNNFSSFVRQLNTY  83



>ref|XP_011048671.1| PREDICTED: heat stress transcription factor B-2a-like [Populus 
euphratica]
Length=287

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 75/89 (84%), Gaps = 8/89 (9%)
 Frame = +2

Query  431  PVERNGGET--------TAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVW  586
            P+E+N GET         AGGE  RS+PTPFLTKTF++VDD +IDDVISWNEDGSSFIVW
Sbjct  6    PLEQNSGETPTSSLAPAAAGGETSRSIPTPFLTKTFKIVDDHTIDDVISWNEDGSSFIVW  65

Query  587  NPTEFARDLLPKYFKHNNFSSFVRQLNTY  673
            NPT F+RDLLPK+FKHNNFSSFVRQLNTY
Sbjct  66   NPTLFSRDLLPKFFKHNNFSSFVRQLNTY  94



>ref|XP_002318823.2| hypothetical protein POPTR_0012s13430g [Populus trichocarpa]
 gb|EEE97043.2| hypothetical protein POPTR_0012s13430g [Populus trichocarpa]
Length=301

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 77/89 (87%), Gaps = 3/89 (3%)
 Frame = +2

Query  413  MGPPVPPVERNGGET--TAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVW  586
            M PP P VE+N  +T  T GGE  R++PTPFLTKT+Q+VDD +IDDV+SWNEDGSSFIVW
Sbjct  1    MSPP-PLVEQNSTDTPTTGGGETSRTIPTPFLTKTYQIVDDHTIDDVVSWNEDGSSFIVW  59

Query  587  NPTEFARDLLPKYFKHNNFSSFVRQLNTY  673
            +PT FARDLLPKYFKHNNFSSFVRQLNTY
Sbjct  60   DPTVFARDLLPKYFKHNNFSSFVRQLNTY  88



>gb|KDP25483.1| hypothetical protein JCGZ_20639 [Jatropha curcas]
Length=332

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 73/84 (87%), Gaps = 3/84 (4%)
 Frame = +2

Query  431  PVERNGGETTAGGEA---QRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEF  601
            PVE+ G  T AGG A   QRS+PTPFLTKT+QLVDD S+DD+ISWNEDGS+FIVW P EF
Sbjct  4    PVEQTGESTAAGGGAGDSQRSLPTPFLTKTYQLVDDPSVDDLISWNEDGSTFIVWRPAEF  63

Query  602  ARDLLPKYFKHNNFSSFVRQLNTY  673
            ARDLLPKYFKHNNFSSFVRQLNTY
Sbjct  64   ARDLLPKYFKHNNFSSFVRQLNTY  87



>ref|XP_012086969.1| PREDICTED: heat stress transcription factor B-2b [Jatropha curcas]
 ref|XP_012086971.1| PREDICTED: heat stress transcription factor B-2b [Jatropha curcas]
 ref|XP_012086972.1| PREDICTED: heat stress transcription factor B-2b [Jatropha curcas]
Length=333

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 73/84 (87%), Gaps = 3/84 (4%)
 Frame = +2

Query  431  PVERNGGETTAGGEA---QRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEF  601
            PVE+ G  T AGG A   QRS+PTPFLTKT+QLVDD S+DD+ISWNEDGS+FIVW P EF
Sbjct  5    PVEQTGESTAAGGGAGDSQRSLPTPFLTKTYQLVDDPSVDDLISWNEDGSTFIVWRPAEF  64

Query  602  ARDLLPKYFKHNNFSSFVRQLNTY  673
            ARDLLPKYFKHNNFSSFVRQLNTY
Sbjct  65   ARDLLPKYFKHNNFSSFVRQLNTY  88



>ref|XP_010035111.1| PREDICTED: heat stress transcription factor B-2b [Eucalyptus 
grandis]
 gb|KCW46405.1| hypothetical protein EUGRSUZ_K00238 [Eucalyptus grandis]
Length=286

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/83 (81%), Positives = 74/83 (89%), Gaps = 2/83 (2%)
 Frame = +2

Query  425  VPPVERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFA  604
             PP E++G  + +GGE+QRSVPTPFLTKT+QLVDD +ID VISWN DGSSFIVWNPT FA
Sbjct  3    APPAEQSG--SASGGESQRSVPTPFLTKTYQLVDDPAIDAVISWNGDGSSFIVWNPTVFA  60

Query  605  RDLLPKYFKHNNFSSFVRQLNTY  673
            RDLLPKYFKHNNFSSFVRQLNTY
Sbjct  61   RDLLPKYFKHNNFSSFVRQLNTY  83



>ref|XP_010255485.1| PREDICTED: heat stress transcription factor B-2b-like [Nelumbo 
nucifera]
Length=314

 Score =   141 bits (355),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 71/87 (82%), Positives = 77/87 (89%), Gaps = 4/87 (5%)
 Frame = +2

Query  413  MGPPVPPVERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNP  592
            M PP  PVE+  GE+TAG + QRS+PTPFLTKT+QLVDD SIDDVISWNEDGS+FIVW P
Sbjct  1    MAPP--PVEQ-MGESTAG-DGQRSLPTPFLTKTYQLVDDPSIDDVISWNEDGSTFIVWRP  56

Query  593  TEFARDLLPKYFKHNNFSSFVRQLNTY  673
             EFARDLLPKYFKHNNFSSFVRQLNTY
Sbjct  57   AEFARDLLPKYFKHNNFSSFVRQLNTY  83



>ref|XP_012090286.1| PREDICTED: heat stress transcription factor B-2b [Jatropha curcas]
 gb|KDP22306.1| hypothetical protein JCGZ_26137 [Jatropha curcas]
Length=311

 Score =   140 bits (353),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 74/82 (90%), Gaps = 2/82 (2%)
 Frame = +2

Query  428  PPVERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFAR  607
            P  E+NG   TA  E+QRS+PTPFLTKT+QLVDD++IDDVISWNEDGS+FIVWNPT FAR
Sbjct  3    PSGEQNGDAVTA--ESQRSLPTPFLTKTYQLVDDQTIDDVISWNEDGSTFIVWNPTVFAR  60

Query  608  DLLPKYFKHNNFSSFVRQLNTY  673
            DLLPKYFKHNNFSSFVRQLNTY
Sbjct  61   DLLPKYFKHNNFSSFVRQLNTY  82



>gb|AFP57460.1| truncated heat shock factor B2a [Arabidopsis thaliana]
Length=85

 Score =   133 bits (335),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 71/83 (86%), Gaps = 3/83 (4%)
 Frame = +2

Query  428  PPVERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFAR  607
            PPV+      T    +QRS+PTPFLTKTF LV+D SIDDVISWNEDGSSFIVWNPT+FA+
Sbjct  4    PPVD---AMITGESSSQRSIPTPFLTKTFNLVEDSSIDDVISWNEDGSSFIVWNPTDFAK  60

Query  608  DLLPKYFKHNNFSSFVRQLNTYV  676
            DLLPK+FKHNNFSSFVRQLNTYV
Sbjct  61   DLLPKHFKHNNFSSFVRQLNTYV  83



>ref|XP_010693477.1| PREDICTED: heat stress transcription factor B-2a [Beta vulgaris 
subsp. vulgaris]
Length=325

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +2

Query  461  AGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNN  640
            +GGEAQRS+PTPFLTKT+QLV+D SIDDVISWN+DGSSFIVWNPT FARDLLP+YFKHNN
Sbjct  14   SGGEAQRSIPTPFLTKTYQLVEDPSIDDVISWNDDGSSFIVWNPTVFARDLLPRYFKHNN  73

Query  641  FSSFVRQLNTY  673
            FSSFVRQLNTY
Sbjct  74   FSSFVRQLNTY  84



>ref|XP_003611134.1| Heat stress transcription factor B-2b [Medicago truncatula]
 gb|ACJ85855.1| unknown [Medicago truncatula]
 gb|AES94092.1| heat shock transcription factor B2A [Medicago truncatula]
Length=359

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 72/81 (89%), Gaps = 2/81 (2%)
 Frame = +2

Query  431  PVERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARD  610
            PVE+ G   TA  E+QRS+PTPFLTKT+QLVDD S+DD++SWNEDG+SFIVW P EFARD
Sbjct  5    PVEQTGESATA--ESQRSIPTPFLTKTYQLVDDSSVDDLVSWNEDGTSFIVWKPAEFARD  62

Query  611  LLPKYFKHNNFSSFVRQLNTY  673
            LLPKYFKHNNFSSFVRQLNTY
Sbjct  63   LLPKYFKHNNFSSFVRQLNTY  83



>gb|AFK40914.1| unknown [Medicago truncatula]
Length=359

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 72/81 (89%), Gaps = 2/81 (2%)
 Frame = +2

Query  431  PVERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARD  610
            PVE+ G   TA  E+QRS+PTPFLTKT+QLVDD S+DD++SWNEDG+SFIVW P EFARD
Sbjct  5    PVEQTGESATA--ESQRSIPTPFLTKTYQLVDDSSVDDLVSWNEDGTSFIVWKPAEFARD  62

Query  611  LLPKYFKHNNFSSFVRQLNTY  673
            LLPKYFKHNNFSSFVRQLNTY
Sbjct  63   LLPKYFKHNNFSSFVRQLNTY  83



>ref|XP_009371307.1| PREDICTED: heat stress transcription factor B-2a [Pyrus x bretschneideri]
Length=297

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/75 (84%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = +2

Query  449  GETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYF  628
            GE+T+G  +QR++PTPFLTKT+QLVDD SIDDVISWN+DGSSF+VWNPT FARDLLPKYF
Sbjct  10   GESTSGESSQRALPTPFLTKTYQLVDDPSIDDVISWNDDGSSFVVWNPTVFARDLLPKYF  69

Query  629  KHNNFSSFVRQLNTY  673
            KHNNFSSFVRQLNTY
Sbjct  70   KHNNFSSFVRQLNTY  84



>gb|KDO60052.1| hypothetical protein CISIN_1g020146mg [Citrus sinensis]
Length=330

 Score =   139 bits (350),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/91 (70%), Positives = 77/91 (85%), Gaps = 4/91 (4%)
 Frame = +2

Query  413  MGPPVPPVERNGGET----TAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFI  580
            M PP   +E+NG  T    T   ++QRS+PTPFLTKT+QLVDD++IDDVISWN+DG++F+
Sbjct  1    MTPPPTAMEQNGDSTPSPTTTASDSQRSMPTPFLTKTYQLVDDQAIDDVISWNKDGTTFV  60

Query  581  VWNPTEFARDLLPKYFKHNNFSSFVRQLNTY  673
            VWNPT FARDLLP+YFKHNNFSSFVRQLNTY
Sbjct  61   VWNPTIFARDLLPRYFKHNNFSSFVRQLNTY  91



>ref|XP_006421885.1| hypothetical protein CICLE_v10005403mg [Citrus clementina]
 ref|XP_006490352.1| PREDICTED: heat stress transcription factor B-2a-like [Citrus 
sinensis]
 gb|ESR35125.1| hypothetical protein CICLE_v10005403mg [Citrus clementina]
Length=330

 Score =   139 bits (350),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/91 (70%), Positives = 77/91 (85%), Gaps = 4/91 (4%)
 Frame = +2

Query  413  MGPPVPPVERNGGET----TAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFI  580
            M PP   +E+NG  T    T   ++QRS+PTPFLTKT+QLVDD++IDDVISWN+DG++F+
Sbjct  1    MTPPPTAMEQNGDSTPSPTTTASDSQRSMPTPFLTKTYQLVDDQAIDDVISWNKDGTTFV  60

Query  581  VWNPTEFARDLLPKYFKHNNFSSFVRQLNTY  673
            VWNPT FARDLLP+YFKHNNFSSFVRQLNTY
Sbjct  61   VWNPTIFARDLLPRYFKHNNFSSFVRQLNTY  91



>ref|XP_003555375.1| PREDICTED: heat stress transcription factor B-2a-like [Glycine 
max]
Length=300

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 73/83 (88%), Gaps = 2/83 (2%)
 Frame = +2

Query  425  VPPVERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFA  604
             PP+E NG  T+  G++QRS+PTPFLTKT+QLVDD +IDDVISWN+ GSSFIVWN T FA
Sbjct  2    APPLEHNGVSTS--GDSQRSIPTPFLTKTYQLVDDHTIDDVISWNDSGSSFIVWNTTAFA  59

Query  605  RDLLPKYFKHNNFSSFVRQLNTY  673
            +DLLPKYFKHNNFSSFVRQLNTY
Sbjct  60   KDLLPKYFKHNNFSSFVRQLNTY  82



>ref|XP_010107420.1| Heat stress transcription factor B-2a [Morus notabilis]
 gb|EXC15958.1| Heat stress transcription factor B-2a [Morus notabilis]
Length=312

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +2

Query  458  TAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHN  637
            +A GE+QRS+PTPFLTKT+QLVDD++IDDVISWN+DGS+FIVWNPT FARDLLPKYFKHN
Sbjct  9    SASGESQRSLPTPFLTKTYQLVDDQAIDDVISWNDDGSTFIVWNPTVFARDLLPKYFKHN  68

Query  638  NFSSFVRQLNTY  673
            NFSSFVRQLNTY
Sbjct  69   NFSSFVRQLNTY  80



>ref|NP_001281281.1| heat shock factor protein 4 [Malus domestica]
 gb|ADL36731.1| HSF domain class transcription factor [Malus domestica]
Length=276

 Score =   137 bits (345),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 73/81 (90%), Gaps = 1/81 (1%)
 Frame = +2

Query  431  PVERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARD  610
            PVE NG E+T+G   QR++PTPFL KT+QLVDD SI+DVISWN+DGSSF+VWNPT FARD
Sbjct  5    PVEPNG-ESTSGESLQRALPTPFLIKTYQLVDDPSINDVISWNDDGSSFVVWNPTVFARD  63

Query  611  LLPKYFKHNNFSSFVRQLNTY  673
            LLPKYFKHNNFSSFVRQLNTY
Sbjct  64   LLPKYFKHNNFSSFVRQLNTY  84



>ref|XP_009606739.1| PREDICTED: heat stress transcription factor B-2b [Nicotiana tomentosiformis]
Length=322

 Score =   138 bits (347),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 75/81 (93%), Gaps = 2/81 (2%)
 Frame = +2

Query  431  PVERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARD  610
            PVE++G E+TAG E QRS+PTPFLTKT+QLVDD +IDD+ISWNEDG++FIVW P EFARD
Sbjct  5    PVEQSG-ESTAG-ENQRSLPTPFLTKTYQLVDDPAIDDLISWNEDGTTFIVWKPAEFARD  62

Query  611  LLPKYFKHNNFSSFVRQLNTY  673
            LLPKYFKHNNFSSFVRQLNTY
Sbjct  63   LLPKYFKHNNFSSFVRQLNTY  83



>ref|XP_006440567.1| hypothetical protein CICLE_v10021287mg [Citrus clementina]
 gb|ESR53807.1| hypothetical protein CICLE_v10021287mg [Citrus clementina]
Length=309

 Score =   137 bits (346),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = +2

Query  431  PVERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARD  610
            PVE+       GG++QRS+PTPFLTKT+QLVDD S+DD+I+WN DGS+FIVW P EFARD
Sbjct  3    PVEQTSESPATGGDSQRSLPTPFLTKTYQLVDDPSVDDLIAWNSDGSTFIVWRPAEFARD  62

Query  611  LLPKYFKHNNFSSFVRQLNTY  673
            LLPKYFKHNNFSSFVRQLNTY
Sbjct  63   LLPKYFKHNNFSSFVRQLNTY  83



>ref|XP_002283139.1| PREDICTED: heat stress transcription factor B-2b [Vitis vinifera]
 ref|XP_010661169.1| PREDICTED: heat stress transcription factor B-2b [Vitis vinifera]
Length=305

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 72/81 (89%), Gaps = 2/81 (2%)
 Frame = +2

Query  431  PVERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARD  610
            PVE+ G   +  GE+QRS+PTPFLTKT+QLVDD ++DD+ISWNEDGS+FIVW P EFARD
Sbjct  5    PVEQTG--ESLAGESQRSLPTPFLTKTYQLVDDPAVDDLISWNEDGSTFIVWRPAEFARD  62

Query  611  LLPKYFKHNNFSSFVRQLNTY  673
            LLPKYFKHNNFSSFVRQLNTY
Sbjct  63   LLPKYFKHNNFSSFVRQLNTY  83



>gb|KHM99149.1| Heat stress transcription factor B-2a [Glycine soja]
Length=238

 Score =   135 bits (340),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 74/88 (84%), Gaps = 7/88 (8%)
 Frame = +2

Query  431  PVERNGG-------ETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWN  589
            PVE NG          +A  E+QRS+PTPFLTKTFQLVDD+SIDDVISWN+DGS+FIVWN
Sbjct  5    PVEYNGDCATTASASASAAAESQRSIPTPFLTKTFQLVDDQSIDDVISWNDDGSTFIVWN  64

Query  590  PTEFARDLLPKYFKHNNFSSFVRQLNTY  673
            PT FARDLLPKYFKHNNFSSFVRQLNTY
Sbjct  65   PTVFARDLLPKYFKHNNFSSFVRQLNTY  92



>ref|XP_002510816.1| Heat shock factor protein, putative [Ricinus communis]
 gb|EEF51418.1| Heat shock factor protein, putative [Ricinus communis]
Length=323

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 73/82 (89%), Gaps = 2/82 (2%)
 Frame = +2

Query  428  PPVERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFAR  607
            PP E+NG    A  E+QRS+PTPFLTKT+QLVDD +IDDVISWN+DGS+FIVWNPT FAR
Sbjct  4    PPGEQNG--DAAMVESQRSIPTPFLTKTYQLVDDPAIDDVISWNDDGSTFIVWNPTVFAR  61

Query  608  DLLPKYFKHNNFSSFVRQLNTY  673
            DLLPKYFKHNNFSSFVRQLNTY
Sbjct  62   DLLPKYFKHNNFSSFVRQLNTY  83



>gb|ADC94861.1| HSP transcription factor [Vitis pseudoreticulata]
Length=305

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 72/81 (89%), Gaps = 2/81 (2%)
 Frame = +2

Query  431  PVERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARD  610
            PVE+ G   +  GE+QRS+PTPFLTKT+QLVDD ++DD+ISWNEDGS+FIVW P EFARD
Sbjct  5    PVEQTG--ESLAGESQRSLPTPFLTKTYQLVDDPAVDDLISWNEDGSTFIVWRPAEFARD  62

Query  611  LLPKYFKHNNFSSFVRQLNTY  673
            LLPKYFKHNNFSSFVRQLNTY
Sbjct  63   LLPKYFKHNNFSSFVRQLNTY  83



>ref|XP_003533211.1| PREDICTED: heat stress transcription factor B-2b-like [Glycine 
max]
Length=338

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 74/88 (84%), Gaps = 7/88 (8%)
 Frame = +2

Query  431  PVERNG-------GETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWN  589
            PVE NG          +A  E+QRS+PTPFLTKTFQLVDD+SIDDVISWN+DGS+FIVWN
Sbjct  5    PVEYNGDCATTASASASAAAESQRSIPTPFLTKTFQLVDDQSIDDVISWNDDGSTFIVWN  64

Query  590  PTEFARDLLPKYFKHNNFSSFVRQLNTY  673
            PT FARDLLPKYFKHNNFSSFVRQLNTY
Sbjct  65   PTVFARDLLPKYFKHNNFSSFVRQLNTY  92



>gb|AFQ93677.1| heat shock transcription factor HSFB2a [Glycine max]
Length=338

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 74/88 (84%), Gaps = 7/88 (8%)
 Frame = +2

Query  431  PVERNG-------GETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWN  589
            PVE NG          +A  E+QRS+PTPFLTKTFQLVDD+SIDDVISWN+DGS+FIVWN
Sbjct  5    PVEYNGDCATTASASASAAAESQRSIPTPFLTKTFQLVDDQSIDDVISWNDDGSTFIVWN  64

Query  590  PTEFARDLLPKYFKHNNFSSFVRQLNTY  673
            PT FARDLLPKYFKHNNFSSFVRQLNTY
Sbjct  65   PTVFARDLLPKYFKHNNFSSFVRQLNTY  92



>gb|AFW65023.1| hypothetical protein ZEAMMB73_676522 [Zea mays]
Length=383

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = +2

Query  428  PPVERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFAR  607
            PP      E       QRSVPTPFL+KT+QLVDD ++DD+ISWN+DGS+FIVW P EFAR
Sbjct  14   PPATSQPAEGVTAAAGQRSVPTPFLSKTYQLVDDPAVDDIISWNDDGSAFIVWRPAEFAR  73

Query  608  DLLPKYFKHNNFSSFVRQLNTYVSSISPNLY  700
            DLLPKYFKHNNFSSFVRQLNTYVS+ S  ++
Sbjct  74   DLLPKYFKHNNFSSFVRQLNTYVSAPSRCIH  104



>ref|XP_006394443.1| hypothetical protein EUTSA_v10004690mg [Eutrema salsugineum]
 gb|ESQ31729.1| hypothetical protein EUTSA_v10004690mg [Eutrema salsugineum]
Length=296

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/75 (84%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  449  GETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYF  628
            G+    GE+QRSVPTPFL KTF LV+D SIDDVISWNEDGSSFIVWNPT+FARDLLPK+F
Sbjct  9    GDAMVNGESQRSVPTPFLNKTFNLVEDPSIDDVISWNEDGSSFIVWNPTDFARDLLPKHF  68

Query  629  KHNNFSSFVRQLNTY  673
            KHNNFSSFVRQLNTY
Sbjct  69   KHNNFSSFVRQLNTY  83



>ref|XP_007143381.1| hypothetical protein PHAVU_007G067800g [Phaseolus vulgaris]
 gb|ESW15375.1| hypothetical protein PHAVU_007G067800g [Phaseolus vulgaris]
Length=304

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 72/83 (87%), Gaps = 2/83 (2%)
 Frame = +2

Query  425  VPPVERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFA  604
             PP+E N   T+A  E+QRS+PTPFLTKT+QLVDD +IDDVISWN+ GSSFIVWN T FA
Sbjct  2    APPLEHNSDSTSA--ESQRSIPTPFLTKTYQLVDDPAIDDVISWNDSGSSFIVWNTTVFA  59

Query  605  RDLLPKYFKHNNFSSFVRQLNTY  673
            RDLLPKYFKHNNFSSFVRQLNTY
Sbjct  60   RDLLPKYFKHNNFSSFVRQLNTY  82



>emb|CBI34728.3| unnamed protein product [Vitis vinifera]
Length=306

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 72/81 (89%), Gaps = 2/81 (2%)
 Frame = +2

Query  431  PVERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARD  610
            PVE+ G   +  GE+QRS+PTPFLTKT+QLVDD ++DD+ISWNEDGS+FIVW P EFARD
Sbjct  5    PVEQTG--ESLAGESQRSLPTPFLTKTYQLVDDPAVDDLISWNEDGSTFIVWRPAEFARD  62

Query  611  LLPKYFKHNNFSSFVRQLNTY  673
            LLPKYFKHNNFSSFVRQLNTY
Sbjct  63   LLPKYFKHNNFSSFVRQLNTY  83



>ref|XP_006477425.1| PREDICTED: heat stress transcription factor B-2b-like isoform 
X1 [Citrus sinensis]
 ref|XP_006477426.1| PREDICTED: heat stress transcription factor B-2b-like isoform 
X2 [Citrus sinensis]
Length=309

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = +2

Query  431  PVERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARD  610
            P+E+       GG++QRS+PTPFLTKT+QLVDD S+DD+I+WN DGS+FIVW P EFARD
Sbjct  3    PLEQTSESPATGGDSQRSLPTPFLTKTYQLVDDPSVDDLIAWNSDGSTFIVWRPAEFARD  62

Query  611  LLPKYFKHNNFSSFVRQLNTY  673
            LLPKYFKHNNFSSFVRQLNTY
Sbjct  63   LLPKYFKHNNFSSFVRQLNTY  83



>ref|XP_010940869.1| PREDICTED: heat stress transcription factor B-2b-like [Elaeis 
guineensis]
Length=358

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 72/92 (78%), Gaps = 5/92 (5%)
 Frame = +2

Query  413  MGPPVPPVERNGGETTAGGE-----AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSF  577
            M PP+ P     GE+    +      QRS+PTPFLTKT+QLVDD S+DD+ISWN+DGS+F
Sbjct  1    MAPPMAPAREQAGESPPAQQPPPEGGQRSLPTPFLTKTYQLVDDSSVDDIISWNDDGSAF  60

Query  578  IVWNPTEFARDLLPKYFKHNNFSSFVRQLNTY  673
            IVW P EFARDLLPKYFKHNNFSSFVRQLNTY
Sbjct  61   IVWRPAEFARDLLPKYFKHNNFSSFVRQLNTY  92



>ref|XP_010538799.1| PREDICTED: heat stress transcription factor B-2b-like [Tarenaya 
hassleriana]
Length=336

 Score =   136 bits (342),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 74/82 (90%), Gaps = 1/82 (1%)
 Frame = +2

Query  431  PVERNG-GETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFAR  607
            P E+ G   TTAGG++QRS+PTPFLTKT+QLVDD ++D++ISWNEDGSSFIVW P EFAR
Sbjct  2    PGEQTGESPTTAGGDSQRSLPTPFLTKTYQLVDDPTVDELISWNEDGSSFIVWRPAEFAR  61

Query  608  DLLPKYFKHNNFSSFVRQLNTY  673
            D+LPK+FKHNNFSSFVRQLNTY
Sbjct  62   DILPKFFKHNNFSSFVRQLNTY  83



>ref|XP_004511596.1| PREDICTED: heat stress transcription factor B-2b-like isoform 
X1 [Cicer arietinum]
 ref|XP_004511597.1| PREDICTED: heat stress transcription factor B-2b-like isoform 
X2 [Cicer arietinum]
Length=337

 Score =   135 bits (341),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 70/81 (86%), Gaps = 2/81 (2%)
 Frame = +2

Query  431  PVERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARD  610
            PVE+ G   T   ++QRS+PTPFLTKT+QLVDD S DD+ISWNEDG+SFIVW P EFARD
Sbjct  5    PVEQTGESATT--DSQRSIPTPFLTKTYQLVDDPSADDLISWNEDGTSFIVWKPAEFARD  62

Query  611  LLPKYFKHNNFSSFVRQLNTY  673
            LLPKYFKHNNFSSFVRQLNTY
Sbjct  63   LLPKYFKHNNFSSFVRQLNTY  83



>emb|CAN82265.1| hypothetical protein VITISV_009283 [Vitis vinifera]
Length=477

 Score =   137 bits (346),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 76/92 (83%), Gaps = 4/92 (4%)
 Frame = +2

Query  398  LILEFMGPPVPPVERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSF  577
            L  + M P   PVE+ G   +  GE+QRS+PTPFLTKT+QLVDD ++DD+ISWNEDGS+F
Sbjct  168  LRAKLMAPL--PVEQTG--ESLAGESQRSLPTPFLTKTYQLVDDPAVDDLISWNEDGSTF  223

Query  578  IVWNPTEFARDLLPKYFKHNNFSSFVRQLNTY  673
            IVW P EFARDLLPKYFKHNNFSSFVRQLNTY
Sbjct  224  IVWRPAEFARDLLPKYFKHNNFSSFVRQLNTY  255



>gb|KHG06980.1| Heat stress transcription factor B-2b -like protein [Gossypium 
arboreum]
Length=311

 Score =   135 bits (339),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 69/76 (91%), Gaps = 2/76 (3%)
 Frame = +2

Query  452  ETTAGGEA--QRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKY  625
            E+TA G A  QRS+PTPFLTKT+QLVDD S+DD+ISWNEDGS+FIVW P EFARDLLPKY
Sbjct  11   ESTASGAADSQRSLPTPFLTKTYQLVDDPSVDDMISWNEDGSTFIVWRPAEFARDLLPKY  70

Query  626  FKHNNFSSFVRQLNTY  673
            FKHNNFSSFVRQLNTY
Sbjct  71   FKHNNFSSFVRQLNTY  86



>gb|EPS62621.1| hypothetical protein M569_12169, partial [Genlisea aurea]
Length=284

 Score =   134 bits (337),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 69/72 (96%), Gaps = 2/72 (3%)
 Frame = +2

Query  464  GGEAQ--RSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHN  637
            GGE+   RS+PTPFL+KT+QLVDDR++DDVISWNEDGS+FIVWNPTEFARDLLPK+FKHN
Sbjct  1    GGESDTARSMPTPFLSKTYQLVDDRTVDDVISWNEDGSTFIVWNPTEFARDLLPKFFKHN  60

Query  638  NFSSFVRQLNTY  673
            NFSSFVRQLNTY
Sbjct  61   NFSSFVRQLNTY  72



>ref|XP_010523506.1| PREDICTED: heat stress transcription factor B-2a [Tarenaya hassleriana]
Length=322

 Score =   135 bits (339),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +2

Query  455  TTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKH  634
             T  GE+QRSVPTPFLTKT+QLVDD S+D+VISWNEDGSSF+VWNPT FA DLLP+YFKH
Sbjct  18   ATVSGESQRSVPTPFLTKTYQLVDDHSLDNVISWNEDGSSFVVWNPTVFASDLLPRYFKH  77

Query  635  NNFSSFVRQLNTY  673
            NNFSSFVRQLNTY
Sbjct  78   NNFSSFVRQLNTY  90



>ref|XP_006590531.1| PREDICTED: heat stress transcription factor B-2b-like isoform 
X3 [Glycine max]
Length=167

 Score =   131 bits (329),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 69/81 (85%), Gaps = 2/81 (2%)
 Frame = +2

Query  431  PVERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARD  610
            P E+ G   +A  E QRS+PTPFLTKT+QLVDD S DD+ISWNEDG+SFIVW P EFARD
Sbjct  5    PAEQTG--ESAPTELQRSIPTPFLTKTYQLVDDPSADDLISWNEDGTSFIVWRPAEFARD  62

Query  611  LLPKYFKHNNFSSFVRQLNTY  673
            LLPKYFKHNNFSSFVRQLNTY
Sbjct  63   LLPKYFKHNNFSSFVRQLNTY  83



>gb|KJB52056.1| hypothetical protein B456_008G244400 [Gossypium raimondii]
Length=311

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = +2

Query  446  GGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKY  625
            G   +A  ++QRS+PTPFL KT+QLVDD S+DD+ISWNEDGS+FIVW+P EFARDLLP+Y
Sbjct  4    GSTASAAADSQRSLPTPFLAKTYQLVDDPSVDDLISWNEDGSAFIVWHPAEFARDLLPRY  63

Query  626  FKHNNFSSFVRQLNTY  673
            FKHNNFSSFVRQLNTY
Sbjct  64   FKHNNFSSFVRQLNTY  79



>gb|KCW72116.1| hypothetical protein EUGRSUZ_E00555 [Eucalyptus grandis]
Length=316

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  449  GETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYF  628
            G++   G++QRS+PTPFLTKT+QLVDD  +DD+ISWNEDG++FIVW P EFARDLLPKYF
Sbjct  7    GDSPVAGDSQRSLPTPFLTKTYQLVDDPGVDDLISWNEDGTTFIVWRPAEFARDLLPKYF  66

Query  629  KHNNFSSFVRQLNTY  673
            KHNNFSSFVRQLNTY
Sbjct  67   KHNNFSSFVRQLNTY  81



>ref|XP_006590530.1| PREDICTED: heat stress transcription factor B-2b-like isoform 
X2 [Glycine max]
Length=189

 Score =   131 bits (330),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 69/81 (85%), Gaps = 2/81 (2%)
 Frame = +2

Query  431  PVERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARD  610
            P E+ G   +A  E QRS+PTPFLTKT+QLVDD S DD+ISWNEDG+SFIVW P EFARD
Sbjct  5    PAEQTG--ESAPTELQRSIPTPFLTKTYQLVDDPSADDLISWNEDGTSFIVWRPAEFARD  62

Query  611  LLPKYFKHNNFSSFVRQLNTY  673
            LLPKYFKHNNFSSFVRQLNTY
Sbjct  63   LLPKYFKHNNFSSFVRQLNTY  83



>ref|XP_004143930.1| PREDICTED: heat stress transcription factor B-2b [Cucumis sativus]
 gb|KGN50137.1| hypothetical protein Csa_5G155480 [Cucumis sativus]
Length=341

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 73/88 (83%), Gaps = 6/88 (7%)
 Frame = +2

Query  413  MGP-PVPPVERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWN  589
            M P P  P+  +G      G++QRS+PTPFLTKT+QLVDD ++DD+ISWNEDGS+FIVW 
Sbjct  1    MAPSPAEPIGDSGT-----GDSQRSIPTPFLTKTYQLVDDPAVDDLISWNEDGSTFIVWR  55

Query  590  PTEFARDLLPKYFKHNNFSSFVRQLNTY  673
            P EFARDLLPKYFKHNNFSSFVRQLNTY
Sbjct  56   PAEFARDLLPKYFKHNNFSSFVRQLNTY  83



>emb|CBI31816.3| unnamed protein product [Vitis vinifera]
Length=296

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 72/82 (88%), Gaps = 6/82 (7%)
 Frame = +2

Query  428  PPVERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFAR  607
            PPVE+      +GGE+Q+S+PTPFLTKT+QLV+DR++DDVISWNEDGS+F+VWN    AR
Sbjct  4    PPVEQ------SGGESQKSLPTPFLTKTYQLVEDRTVDDVISWNEDGSAFVVWNTAVLAR  57

Query  608  DLLPKYFKHNNFSSFVRQLNTY  673
            DLLPKYFKHNNFSSFVRQLNTY
Sbjct  58   DLLPKYFKHNNFSSFVRQLNTY  79



>ref|XP_007040151.1| Winged-helix DNA-binding transcription factor family protein, 
putative isoform 1 [Theobroma cacao]
 gb|EOY24652.1| Winged-helix DNA-binding transcription factor family protein, 
putative isoform 1 [Theobroma cacao]
Length=314

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +2

Query  422  PVPPVERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEF  601
            P+P  +     T+A  ++QRS+PTPFLTKT+QLVDD S+DD+ISWN+DGS+FIVW P EF
Sbjct  3    PLPADQPCESPTSAASDSQRSLPTPFLTKTYQLVDDPSVDDLISWNDDGSTFIVWRPAEF  62

Query  602  ARDLLPKYFKHNNFSSFVRQLNTY  673
            ARDLLPKYFKHNNFSSFVRQLNTY
Sbjct  63   ARDLLPKYFKHNNFSSFVRQLNTY  86



>ref|XP_003535620.1| PREDICTED: heat stress transcription factor B-2a-like [Glycine 
max]
Length=289

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 71/83 (86%), Gaps = 2/83 (2%)
 Frame = +2

Query  425  VPPVERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFA  604
             PP+E NG  T+  G++ RS+PTPFLTKTFQLVDD +ID VISWN+ GSSFIVWN T FA
Sbjct  2    APPLEHNGVSTS--GDSLRSIPTPFLTKTFQLVDDHTIDHVISWNDSGSSFIVWNTTAFA  59

Query  605  RDLLPKYFKHNNFSSFVRQLNTY  673
            +DLLPKYFKHNNFSSFVRQLNTY
Sbjct  60   KDLLPKYFKHNNFSSFVRQLNTY  82



>ref|XP_010919270.1| PREDICTED: heat stress transcription factor B-2c-like [Elaeis 
guineensis]
Length=326

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 71/88 (81%), Gaps = 2/88 (2%)
 Frame = +2

Query  413  MGPPVPPVE-RNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWN  589
            M PP P VE       T   + QRS+PTPFLTKT+QLVDD +IDDVISWNEDG++FIVW 
Sbjct  1    MAPP-PAVEGEQPAAATVAADGQRSMPTPFLTKTYQLVDDPAIDDVISWNEDGTTFIVWR  59

Query  590  PTEFARDLLPKYFKHNNFSSFVRQLNTY  673
            P EFARDLLPKYFKHNNFSSFVRQLNTY
Sbjct  60   PAEFARDLLPKYFKHNNFSSFVRQLNTY  87



>ref|XP_010055608.1| PREDICTED: LOW QUALITY PROTEIN: heat stress transcription factor 
B-2b [Eucalyptus grandis]
Length=340

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  449  GETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYF  628
            G++   G++QRS+PTPFLTKT+QLVDD  +DD+ISWNEDG++FIVW P EFARDLLPKYF
Sbjct  7    GDSPVAGDSQRSLPTPFLTKTYQLVDDPGVDDLISWNEDGTTFIVWRPAEFARDLLPKYF  66

Query  629  KHNNFSSFVRQLNTY  673
            KHNNFSSFVRQLNTY
Sbjct  67   KHNNFSSFVRQLNTY  81



>ref|XP_002273914.2| PREDICTED: LOW QUALITY PROTEIN: heat stress transcription factor 
B-2a [Vitis vinifera]
Length=306

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 72/82 (88%), Gaps = 6/82 (7%)
 Frame = +2

Query  428  PPVERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFAR  607
            PPVE+      +GGE+Q+S+PTPFLTKT+QLV+DR++DDVISWNEDGS+F+VWN    AR
Sbjct  4    PPVEQ------SGGESQKSLPTPFLTKTYQLVEDRTVDDVISWNEDGSAFVVWNTAVLAR  57

Query  608  DLLPKYFKHNNFSSFVRQLNTY  673
            DLLPKYFKHNNFSSFVRQLNTY
Sbjct  58   DLLPKYFKHNNFSSFVRQLNTY  79



>gb|EEC74457.1| hypothetical protein OsI_09880 [Oryza sativa Indica Group]
Length=110

 Score =   128 bits (321),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = +2

Query  428  PPVERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFAR  607
            PP              QRS+PTPFLTKT+QLV+D ++DDVISWNEDGS+F+VW P EFAR
Sbjct  16   PPAAAVMTAAAEALAGQRSLPTPFLTKTYQLVEDPAVDDVISWNEDGSTFVVWRPAEFAR  75

Query  608  DLLPKYFKHNNFSSFVRQLNTYVS  679
            DLLPKYFKHNNFSSFVRQLNTY+S
Sbjct  76   DLLPKYFKHNNFSSFVRQLNTYLS  99



>ref|XP_011029218.1| PREDICTED: heat stress transcription factor B-2b [Populus euphratica]
 ref|XP_011029219.1| PREDICTED: heat stress transcription factor B-2b [Populus euphratica]
Length=340

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = +2

Query  455  TTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKH  634
            T+  G++QRS+PTPFLTKT+QLVDD S+DD+ISWN+DGS+FIVW P EFARDLLPKYFKH
Sbjct  26   TSGSGDSQRSLPTPFLTKTYQLVDDPSVDDLISWNDDGSTFIVWRPAEFARDLLPKYFKH  85

Query  635  NNFSSFVRQLNTY  673
            NNFSSFVRQLNTY
Sbjct  86   NNFSSFVRQLNTY  98



>ref|XP_008437221.1| PREDICTED: heat stress transcription factor B-2b [Cucumis melo]
Length=339

 Score =   134 bits (336),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 73/88 (83%), Gaps = 6/88 (7%)
 Frame = +2

Query  413  MGP-PVPPVERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWN  589
            M P P  P+  +G      G++QRS+PTPFLTKT+QLVDD ++DD+ISWNEDGS+FIVW 
Sbjct  1    MAPSPAEPIGDSGT-----GDSQRSIPTPFLTKTYQLVDDPAVDDLISWNEDGSTFIVWR  55

Query  590  PTEFARDLLPKYFKHNNFSSFVRQLNTY  673
            P EFARDLLPKYFKHNNFSSFVRQLNTY
Sbjct  56   PAEFARDLLPKYFKHNNFSSFVRQLNTY  83



>gb|KJB25779.1| hypothetical protein B456_004G208800 [Gossypium raimondii]
Length=311

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 69/76 (91%), Gaps = 2/76 (3%)
 Frame = +2

Query  452  ETTAGGEA--QRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKY  625
            E+TA G A  QRS+PTPFLTKT+QLVDD S++D+ISWNEDGS+FIVW P EFARDLLPKY
Sbjct  11   ESTASGAADSQRSLPTPFLTKTYQLVDDPSVNDMISWNEDGSTFIVWRPAEFARDLLPKY  70

Query  626  FKHNNFSSFVRQLNTY  673
            FKHNNFSSFVRQLNTY
Sbjct  71   FKHNNFSSFVRQLNTY  86



>gb|AII99903.1| heat shock transcription factor [Gossypium hirsutum]
Length=311

 Score =   133 bits (334),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 69/76 (91%), Gaps = 2/76 (3%)
 Frame = +2

Query  452  ETTAGGEA--QRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKY  625
            E+TA G A  QRS+PTPFLTKT+QLVDD S++D+ISWNEDGS+FIVW P EFARDLLPKY
Sbjct  11   ESTASGAADSQRSLPTPFLTKTYQLVDDPSVNDMISWNEDGSTFIVWRPAEFARDLLPKY  70

Query  626  FKHNNFSSFVRQLNTY  673
            FKHNNFSSFVRQLNTY
Sbjct  71   FKHNNFSSFVRQLNTY  86



>ref|XP_006857851.1| PREDICTED: heat stress transcription factor B-2b [Amborella trichopoda]
 gb|ERN19318.1| hypothetical protein AMTR_s00069p00068180 [Amborella trichopoda]
Length=326

 Score =   133 bits (334),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 72/89 (81%), Gaps = 8/89 (9%)
 Frame = +2

Query  413  MGPPVPPVERNGGETTAGG--EAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVW  586
            M PP       G  +T  G  EAQRS+PTPFLTKT+QLVDD ++DDVISWNEDGS+FIVW
Sbjct  1    MAPPA------GEHSTMVGTSEAQRSLPTPFLTKTYQLVDDPTVDDVISWNEDGSTFIVW  54

Query  587  NPTEFARDLLPKYFKHNNFSSFVRQLNTY  673
             P EFARDLLPKYFKHNNFSSFVRQLNTY
Sbjct  55   RPAEFARDLLPKYFKHNNFSSFVRQLNTY  83



>ref|NP_201008.2| heat stress transcription factor B-2a [Arabidopsis thaliana]
 sp|Q9SCW4.1|HFB2A_ARATH RecName: Full=Heat stress transcription factor B-2a; Short=AtHsfB2a; 
AltName: Full=AtHsf-22; AltName: Full=Heat shock factor 
protein 6; Short=HSF 6; AltName: Full=Heat shock transcription 
factor 6; Short=HSTF 6 [Arabidopsis thaliana]
 emb|CAB63802.1| heat shock factor 6 [Arabidopsis thaliana]
 dbj|BAB10163.1| heat shock factor 6 [Arabidopsis thaliana]
 gb|AAP40369.1| putative heat shock factor 6 [Arabidopsis thaliana]
 gb|AAP40470.1| putative heat shock factor 6 [Arabidopsis thaliana]
 dbj|BAF01530.1| heat shock factor 6 [Arabidopsis thaliana]
 dbj|BAH30646.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED97552.1| heat stress transcription factor B-2a [Arabidopsis thaliana]
Length=299

 Score =   132 bits (333),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 70/82 (85%), Gaps = 3/82 (4%)
 Frame = +2

Query  428  PPVERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFAR  607
            PPV+      T    +QRS+PTPFLTKTF LV+D SIDDVISWNEDGSSFIVWNPT+FA+
Sbjct  4    PPVD---AMITGESSSQRSIPTPFLTKTFNLVEDSSIDDVISWNEDGSSFIVWNPTDFAK  60

Query  608  DLLPKYFKHNNFSSFVRQLNTY  673
            DLLPK+FKHNNFSSFVRQLNTY
Sbjct  61   DLLPKHFKHNNFSSFVRQLNTY  82



>ref|XP_006590529.1| PREDICTED: heat stress transcription factor B-2b-like isoform 
X1 [Glycine max]
Length=355

 Score =   133 bits (335),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 69/81 (85%), Gaps = 2/81 (2%)
 Frame = +2

Query  431  PVERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARD  610
            P E+ G   +A  E QRS+PTPFLTKT+QLVDD S DD+ISWNEDG+SFIVW P EFARD
Sbjct  5    PAEQTG--ESAPTELQRSIPTPFLTKTYQLVDDPSADDLISWNEDGTSFIVWRPAEFARD  62

Query  611  LLPKYFKHNNFSSFVRQLNTY  673
            LLPKYFKHNNFSSFVRQLNTY
Sbjct  63   LLPKYFKHNNFSSFVRQLNTY  83



>gb|KEH17358.1| heat shock transcription factor B2A [Medicago truncatula]
Length=341

 Score =   133 bits (334),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 74/92 (80%), Gaps = 5/92 (5%)
 Frame = +2

Query  413  MGPPVPPVERNGGETTAGG-----EAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSF  577
            M P   PVE NG  TT        E+QRS+PTPFLTKT+ LVDD+SID+VISWNEDGS+F
Sbjct  1    MAPSPAPVENNGETTTTTVATPTLESQRSIPTPFLTKTYNLVDDKSIDEVISWNEDGSTF  60

Query  578  IVWNPTEFARDLLPKYFKHNNFSSFVRQLNTY  673
            IVWNPT FA +LLPKYFKHNNFSSFVRQLNTY
Sbjct  61   IVWNPTVFASNLLPKYFKHNNFSSFVRQLNTY  92



>ref|XP_008369462.1| PREDICTED: heat stress transcription factor B-2b [Malus domestica]
 ref|XP_008369463.1| PREDICTED: heat stress transcription factor B-2b [Malus domestica]
 ref|XP_008369464.1| PREDICTED: heat stress transcription factor B-2b [Malus domestica]
Length=337

 Score =   133 bits (334),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 72/86 (84%), Gaps = 5/86 (6%)
 Frame = +2

Query  431  PVERNGGETTAGG-----EAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPT  595
            P E+NG    AG      ++QRS+PTPFLTKT+QLVDD S+DD+ISW+EDGS+FIVW P 
Sbjct  5    PAEQNGDSAPAGSGGGGGDSQRSLPTPFLTKTYQLVDDPSVDDLISWSEDGSAFIVWRPA  64

Query  596  EFARDLLPKYFKHNNFSSFVRQLNTY  673
            EFARDLLPKYFKHNNFSSFVRQLNTY
Sbjct  65   EFARDLLPKYFKHNNFSSFVRQLNTY  90



>ref|XP_006358879.1| PREDICTED: heat stress transcription factor B-2b-like [Solanum 
tuberosum]
 ref|XP_006368078.1| PREDICTED: heat stress transcription factor B-2b-like [Solanum 
tuberosum]
Length=317

 Score =   132 bits (332),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 72/83 (87%), Gaps = 1/83 (1%)
 Frame = +2

Query  425  VPPVERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFA  604
            VP    + GE+ A GE QRS+PTPFLTKT+QLVDD ++D++ISWN+DG++FIVW P EFA
Sbjct  2    VPSSIEHSGES-ASGENQRSLPTPFLTKTYQLVDDSAMDELISWNDDGTTFIVWKPAEFA  60

Query  605  RDLLPKYFKHNNFSSFVRQLNTY  673
            RDLLPKYFKHNNFSSFVRQLNTY
Sbjct  61   RDLLPKYFKHNNFSSFVRQLNTY  83



>ref|XP_008677301.1| PREDICTED: heat shock factor protein 7 isoform X1 [Zea mays]
Length=370

 Score =   133 bits (335),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = +2

Query  428  PPVERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFAR  607
            PP      E       QRSVPTPFL+KT+QLVDD ++DD+ISWN+DGS+FIVW P EFAR
Sbjct  14   PPATSQPAEGVTAAAGQRSVPTPFLSKTYQLVDDPAVDDIISWNDDGSAFIVWRPAEFAR  73

Query  608  DLLPKYFKHNNFSSFVRQLNTY  673
            DLLPKYFKHNNFSSFVRQLNTY
Sbjct  74   DLLPKYFKHNNFSSFVRQLNTY  95



>gb|AFW65024.1| heat shock factor protein 7 [Zea mays]
 gb|AIB04895.1| HSF transcription factor, partial [Zea mays]
Length=370

 Score =   133 bits (335),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = +2

Query  428  PPVERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFAR  607
            PP      E       QRSVPTPFL+KT+QLVDD ++DD+ISWN+DGS+FIVW P EFAR
Sbjct  14   PPATSQPAEGVTAAAGQRSVPTPFLSKTYQLVDDPAVDDIISWNDDGSAFIVWRPAEFAR  73

Query  608  DLLPKYFKHNNFSSFVRQLNTY  673
            DLLPKYFKHNNFSSFVRQLNTY
Sbjct  74   DLLPKYFKHNNFSSFVRQLNTY  95



>ref|NP_001149902.1| heat shock factor protein 7 [Zea mays]
 gb|ACG37151.1| heat shock factor protein 7 [Zea mays]
Length=371

 Score =   133 bits (335),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = +2

Query  428  PPVERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFAR  607
            PP      E       QRSVPTPFL+KT+QLVDD ++DD+ISWN+DGS+FIVW P EFAR
Sbjct  14   PPATSQPAEGVTAAAGQRSVPTPFLSKTYQLVDDPAVDDIISWNDDGSAFIVWRPAEFAR  73

Query  608  DLLPKYFKHNNFSSFVRQLNTY  673
            DLLPKYFKHNNFSSFVRQLNTY
Sbjct  74   DLLPKYFKHNNFSSFVRQLNTY  95



>ref|XP_009760921.1| PREDICTED: heat stress transcription factor B-2b [Nicotiana sylvestris]
Length=332

 Score =   132 bits (333),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 61/75 (81%), Positives = 70/75 (93%), Gaps = 1/75 (1%)
 Frame = +2

Query  449  GETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYF  628
            GE+TAG E Q+S+PTPFLTKT+QLVDD +ID++ISWNEDG++FIVW P EFARDLLPKYF
Sbjct  10   GESTAG-ENQKSLPTPFLTKTYQLVDDPAIDELISWNEDGTTFIVWKPAEFARDLLPKYF  68

Query  629  KHNNFSSFVRQLNTY  673
            KHNNFSSFVRQLNTY
Sbjct  69   KHNNFSSFVRQLNTY  83



>ref|XP_009345447.1| PREDICTED: heat stress transcription factor B-2b [Pyrus x bretschneideri]
 ref|XP_009345448.1| PREDICTED: heat stress transcription factor B-2b [Pyrus x bretschneideri]
 ref|XP_009345449.1| PREDICTED: heat stress transcription factor B-2b [Pyrus x bretschneideri]
Length=335

 Score =   132 bits (333),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 72/86 (84%), Gaps = 5/86 (6%)
 Frame = +2

Query  431  PVERNGGETTAGG-----EAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPT  595
            P E+NG    AG      ++QRS+PTPFLTKT+QLVDD S+DD+ISW+EDGS+FIVW P 
Sbjct  5    PAEQNGDSAPAGSGGGGGDSQRSLPTPFLTKTYQLVDDPSVDDLISWSEDGSAFIVWRPA  64

Query  596  EFARDLLPKYFKHNNFSSFVRQLNTY  673
            EFARDLLPKYFKHNNFSSFVRQLNTY
Sbjct  65   EFARDLLPKYFKHNNFSSFVRQLNTY  90



>ref|XP_002864765.1| hypothetical protein ARALYDRAFT_919451 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41024.1| hypothetical protein ARALYDRAFT_919451 [Arabidopsis lyrata subsp. 
lyrata]
Length=299

 Score =   132 bits (331),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 70/82 (85%), Gaps = 3/82 (4%)
 Frame = +2

Query  428  PPVERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFAR  607
            PPV+      T    +QRS+PTPFLTKT+ LV+D SIDDVISWNEDGSSFIVWNPT+FA+
Sbjct  4    PPVD---AMITGESSSQRSIPTPFLTKTYNLVEDSSIDDVISWNEDGSSFIVWNPTDFAK  60

Query  608  DLLPKYFKHNNFSSFVRQLNTY  673
            DLLPK+FKHNNFSSFVRQLNTY
Sbjct  61   DLLPKHFKHNNFSSFVRQLNTY  82



>ref|XP_010934470.1| PREDICTED: heat stress transcription factor B-2b-like [Elaeis 
guineensis]
Length=358

 Score =   133 bits (334),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 74/91 (81%), Gaps = 5/91 (5%)
 Frame = +2

Query  413  MGPPVPPVERNGGETT----AGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFI  580
            M PP+ P     GE      A G +QRS+PTPFLTKT+QLVDD ++DD+ISWN+DGS+FI
Sbjct  1    MAPPMAPAGDQAGEQPPPLPAEG-SQRSIPTPFLTKTYQLVDDPAVDDIISWNDDGSTFI  59

Query  581  VWNPTEFARDLLPKYFKHNNFSSFVRQLNTY  673
            VW+P +FARDLLPKYFKHNNFSSFVRQLNTY
Sbjct  60   VWHPADFARDLLPKYFKHNNFSSFVRQLNTY  90



>ref|XP_003517459.1| PREDICTED: heat stress transcription factor B-2b-like isoform 
X1 [Glycine max]
 ref|XP_006573765.1| PREDICTED: heat stress transcription factor B-2b-like isoform 
X2 [Glycine max]
 ref|XP_006573766.1| PREDICTED: heat stress transcription factor B-2b-like isoform 
X3 [Glycine max]
Length=355

 Score =   133 bits (334),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 69/81 (85%), Gaps = 2/81 (2%)
 Frame = +2

Query  431  PVERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARD  610
            P E+ G   +A  E QRS+PTPFLTKT+QLVDD S DD+ISWNEDG+SFIVW P EFARD
Sbjct  5    PAEQTG--ESAPTELQRSIPTPFLTKTYQLVDDPSADDLISWNEDGTSFIVWRPAEFARD  62

Query  611  LLPKYFKHNNFSSFVRQLNTY  673
            LLPKYFKHNN+SSFVRQLNTY
Sbjct  63   LLPKYFKHNNYSSFVRQLNTY  83



>gb|AFP57459.1| truncated heat shock factor B1 [Arabidopsis thaliana]
Length=86

 Score =   125 bits (315),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +2

Query  458  TAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHN  637
            TA   AQRSVP PFL+KT+QLVDD S DDV+SWNE+G++F+VW   EFA+DLLP+YFKHN
Sbjct  2    TAVTAAQRSVPAPFLSKTYQLVDDHSTDDVVSWNEEGTAFVVWKTAEFAKDLLPQYFKHN  61

Query  638  NFSSFVRQLNTYVS  679
            NFSSF+RQLNTYVS
Sbjct  62   NFSSFIRQLNTYVS  75



>ref|XP_007158472.1| hypothetical protein PHAVU_002G155300g [Phaseolus vulgaris]
 gb|ESW30466.1| hypothetical protein PHAVU_002G155300g [Phaseolus vulgaris]
Length=356

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 69/80 (86%), Gaps = 2/80 (3%)
 Frame = +2

Query  434  VERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDL  613
            VE+ G   +A  + QRS+PTPFLTKT+QLVDD S DD+ISWNEDG+SFIVW P EFARDL
Sbjct  6    VEQTG--ESAPADLQRSIPTPFLTKTYQLVDDPSADDLISWNEDGTSFIVWRPAEFARDL  63

Query  614  LPKYFKHNNFSSFVRQLNTY  673
            LPKYFKHNNFSSFVRQLNTY
Sbjct  64   LPKYFKHNNFSSFVRQLNTY  83



>ref|XP_004957415.1| PREDICTED: heat stress transcription factor B-2c-like isoform 
X2 [Setaria italica]
Length=400

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
             QRS+PTPFLTKT+QLVDD ++DDVISWNEDGS+F+VW P EFARDLLPKYFKHNNFSSF
Sbjct  33   GQRSLPTPFLTKTYQLVDDPAVDDVISWNEDGSTFVVWRPAEFARDLLPKYFKHNNFSSF  92

Query  653  VRQLNTYVSSISP  691
            VRQLNTY     P
Sbjct  93   VRQLNTYEDRAGP  105



>emb|CDY00246.1| BnaA06g21470D [Brassica napus]
Length=293

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +2

Query  470  EAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSS  649
            E+QRSVPTPFL KTF LV+D SIDDVISWNEDGSSF+VWNPT+FARDLLPK+FKHNNFSS
Sbjct  15   ESQRSVPTPFLIKTFNLVEDPSIDDVISWNEDGSSFVVWNPTDFARDLLPKHFKHNNFSS  74

Query  650  FVRQLNTY  673
            FVRQLNTY
Sbjct  75   FVRQLNTY  82



>ref|XP_009151322.1| PREDICTED: heat stress transcription factor B-2a [Brassica rapa]
Length=302

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +2

Query  470  EAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSS  649
            E+QRSVPTPFL KTF LV+D SIDDVISWNEDGSSF+VWNPT+FARDLLPK+FKHNNFSS
Sbjct  15   ESQRSVPTPFLIKTFNLVEDPSIDDVISWNEDGSSFVVWNPTDFARDLLPKHFKHNNFSS  74

Query  650  FVRQLNTY  673
            FVRQLNTY
Sbjct  75   FVRQLNTY  82



>gb|EEE69104.1| hypothetical protein OsJ_28173 [Oryza sativa Japonica Group]
Length=211

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  467  GEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFS  646
            G+ QR+VPTPFLTKT+QLVDD ++DDVISWN+DGS+F+VW P EFARDLLPKYFKHNNFS
Sbjct  21   GQQQRTVPTPFLTKTYQLVDDPAVDDVISWNDDGSTFVVWRPAEFARDLLPKYFKHNNFS  80

Query  647  SFVRQLNTY  673
            SFVRQLNTY
Sbjct  81   SFVRQLNTY  89



>ref|XP_008800793.1| PREDICTED: heat stress transcription factor B-2b-like [Phoenix 
dactylifera]
Length=338

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 69/85 (81%), Gaps = 9/85 (11%)
 Frame = +2

Query  419  PPVPPVERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTE  598
            PP PP+   G         QRS+PTPFLTKT+QLVDD S+DDVISWN+DGS+FIVW P +
Sbjct  15   PPAPPLPEGG---------QRSLPTPFLTKTYQLVDDPSVDDVISWNDDGSAFIVWRPAD  65

Query  599  FARDLLPKYFKHNNFSSFVRQLNTY  673
            FARDLLPKYFKHNNFSSFVRQLNTY
Sbjct  66   FARDLLPKYFKHNNFSSFVRQLNTY  90



>ref|XP_010933854.1| PREDICTED: heat stress transcription factor B-2c [Elaeis guineensis]
Length=348

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 71/94 (76%), Gaps = 7/94 (7%)
 Frame = +2

Query  413  MGPPVPPVERNG-------GETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGS  571
            M P  PPVE              A  + QRS+PTPFLTKT+QLVDD +IDDVISWNEDG+
Sbjct  1    MAPYPPPVEGEQLAPATVVAAVPAPADGQRSMPTPFLTKTYQLVDDPAIDDVISWNEDGT  60

Query  572  SFIVWNPTEFARDLLPKYFKHNNFSSFVRQLNTY  673
            +FIVW P EFARDLLPKYFKHNNFSSFVRQLNTY
Sbjct  61   TFIVWRPAEFARDLLPKYFKHNNFSSFVRQLNTY  94



>ref|XP_006280765.1| hypothetical protein CARUB_v10026734mg, partial [Capsella rubella]
 gb|EOA13663.1| hypothetical protein CARUB_v10026734mg, partial [Capsella rubella]
Length=339

 Score =   131 bits (329),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 76/92 (83%), Gaps = 5/92 (5%)
 Frame = +2

Query  401  ILEFM-GPPVPPVERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSF  577
            I+  M  PPV  +   G E+++    QRS+PTPFLTKT+ LV+D SI+DVISWNEDGSSF
Sbjct  28   IVSIMNSPPVDAMMTGGVESSS----QRSIPTPFLTKTYNLVEDSSINDVISWNEDGSSF  83

Query  578  IVWNPTEFARDLLPKYFKHNNFSSFVRQLNTY  673
            IVWNPT+FA+DLLPK+FKHNNFSSFVRQLNTY
Sbjct  84   IVWNPTDFAKDLLPKHFKHNNFSSFVRQLNTY  115



>ref|XP_010483895.1| PREDICTED: heat stress transcription factor B-2a-like [Camelina 
sativa]
Length=320

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 71/82 (87%), Gaps = 3/82 (4%)
 Frame = +2

Query  428  PPVERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFAR  607
            PPV+     TT    +QRS+PTPFLTKT+ LV+D SI+DVISWNEDGSSFIVWNPT+FA+
Sbjct  4    PPVD---AMTTGESLSQRSIPTPFLTKTYNLVEDSSINDVISWNEDGSSFIVWNPTDFAK  60

Query  608  DLLPKYFKHNNFSSFVRQLNTY  673
            DLLPK+FKHNNFSSFVRQLNTY
Sbjct  61   DLLPKHFKHNNFSSFVRQLNTY  82



>ref|XP_010458062.1| PREDICTED: heat stress transcription factor B-2a-like [Camelina 
sativa]
Length=314

 Score =   130 bits (327),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 71/82 (87%), Gaps = 3/82 (4%)
 Frame = +2

Query  428  PPVERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFAR  607
            PPV+     TT    +QRS+PTPFLTKT+ LV+D SI+DVISWNEDGSSFIVWNPT+FA+
Sbjct  4    PPVD---AMTTGESLSQRSIPTPFLTKTYNLVEDSSINDVISWNEDGSSFIVWNPTDFAK  60

Query  608  DLLPKYFKHNNFSSFVRQLNTY  673
            DLLPK+FKHNNFSSFVRQLNTY
Sbjct  61   DLLPKHFKHNNFSSFVRQLNTY  82



>ref|XP_008803040.1| PREDICTED: heat stress transcription factor B-2c-like [Phoenix 
dactylifera]
Length=341

 Score =   131 bits (329),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 71/92 (77%), Gaps = 7/92 (8%)
 Frame = +2

Query  413  MGPPVPPVERNGGE-----TTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSF  577
            M  P+ P     GE     T  GG  QRS+PTPFLTKT+QLVDD  +DD+ISWN+DGS+F
Sbjct  1    MASPMAPATEEAGESPSRQTPEGG--QRSLPTPFLTKTYQLVDDSFVDDIISWNDDGSAF  58

Query  578  IVWNPTEFARDLLPKYFKHNNFSSFVRQLNTY  673
            IVW P EFARDLLPKYFKHNNFSSFVRQLNTY
Sbjct  59   IVWRPAEFARDLLPKYFKHNNFSSFVRQLNTY  90



>ref|XP_004496590.1| PREDICTED: heat stress transcription factor B-2b-like [Cicer 
arietinum]
Length=267

 Score =   129 bits (325),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 69/83 (83%), Gaps = 2/83 (2%)
 Frame = +2

Query  425  VPPVERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFA  604
             P  E N   +TA  ++QRS PTPFL KT+ LVDDR+IDDVISWN+ G++FIVWNPT FA
Sbjct  2    APSAEHNADSSTA--DSQRSSPTPFLIKTYDLVDDRTIDDVISWNDTGTTFIVWNPTVFA  59

Query  605  RDLLPKYFKHNNFSSFVRQLNTY  673
            +DLLPKYFKHNNFSSFVRQLNTY
Sbjct  60   KDLLPKYFKHNNFSSFVRQLNTY  82



>gb|ABG73443.1| heat shock factor [Oryza brachyantha]
Length=408

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 70/84 (83%), Gaps = 4/84 (5%)
 Frame = +2

Query  422  PVPPVERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEF  601
            P PPV     E  AG   QRS+PTPFLTKT+QLVDD ++DDVISWNEDGS+F+VW P EF
Sbjct  17   PPPPVT-AAAEALAG---QRSLPTPFLTKTYQLVDDPAVDDVISWNEDGSTFVVWRPAEF  72

Query  602  ARDLLPKYFKHNNFSSFVRQLNTY  673
            ARDLLPKYFKHNNFSSFVRQLNTY
Sbjct  73   ARDLLPKYFKHNNFSSFVRQLNTY  96



>emb|CDX86938.1| BnaC03g52080D [Brassica napus]
Length=300

 Score =   130 bits (326),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +2

Query  470  EAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSS  649
            E+QR+VPTPFL KTF LV+D SIDDVISWNEDGSSF+VWNPT+FARDLLPK+FKHNNFSS
Sbjct  15   ESQRTVPTPFLIKTFNLVEDPSIDDVISWNEDGSSFVVWNPTDFARDLLPKHFKHNNFSS  74

Query  650  FVRQLNTY  673
            FVRQLNTY
Sbjct  75   FVRQLNTY  82



>gb|KHG00724.1| Heat stress transcription factor B-2b -like protein [Gossypium 
arboreum]
Length=287

 Score =   129 bits (324),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = +2

Query  446  GGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKY  625
            G   +A  ++QR +PTPFL KT+ LVDD ++DD+ISWNEDGS+FIVW+P EFARDLLP+Y
Sbjct  32   GSTASATADSQRPLPTPFLAKTYHLVDDPAVDDLISWNEDGSAFIVWHPAEFARDLLPRY  91

Query  626  FKHNNFSSFVRQLNTY  673
            FKHNNFSSFVRQLNTY
Sbjct  92   FKHNNFSSFVRQLNTY  107



>ref|XP_003548209.1| PREDICTED: heat stress transcription factor B-2b-like [Glycine 
max]
Length=348

 Score =   130 bits (327),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 73/92 (79%), Gaps = 6/92 (7%)
 Frame = +2

Query  413  MGPPVPPVERNGGETTAGGEAQRS-----VPTPFLTKTFQLVDDRSIDDVISWNEDGSSF  577
            M PP PPVE NG        +  +     +PTPFLTKT+QLVDD+SIDDVISWN+DGS+F
Sbjct  1    MAPP-PPVEHNGDSAATASASASAESQRSIPTPFLTKTYQLVDDQSIDDVISWNDDGSTF  59

Query  578  IVWNPTEFARDLLPKYFKHNNFSSFVRQLNTY  673
            IVWNPT FARDLLPK+FKHNNFSSFVRQLNTY
Sbjct  60   IVWNPTVFARDLLPKFFKHNNFSSFVRQLNTY  91



>gb|EMT20815.1| Heat stress transcription factor B-2b [Aegilops tauschii]
Length=375

 Score =   130 bits (328),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +2

Query  467  GEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFS  646
            G  QRS+PTPFL KT+QLVDD ++DDVISW+EDGS+FIVW P EFARDLLPKYFKHNNFS
Sbjct  22   GVGQRSLPTPFLNKTYQLVDDPAVDDVISWSEDGSAFIVWRPAEFARDLLPKYFKHNNFS  81

Query  647  SFVRQLNTYV  676
            SFVRQLNTYV
Sbjct  82   SFVRQLNTYV  91



>ref|XP_008234272.1| PREDICTED: heat stress transcription factor B-2a [Prunus mume]
Length=303

 Score =   129 bits (325),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +2

Query  434  VERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDL  613
            VE NGGE+T+   + R++PTPFLTKT+QLVDD +IDDVISWN+DGSSF+VWNPT FARDL
Sbjct  6    VEPNGGESTSSESSHRALPTPFLTKTYQLVDDPTIDDVISWNDDGSSFVVWNPTVFARDL  65

Query  614  LPKYFKHNNFSSFVRQLNTY  673
            LPKYFKHNNFSSFVRQLNTY
Sbjct  66   LPKYFKHNNFSSFVRQLNTY  85



>ref|XP_011081009.1| PREDICTED: heat stress transcription factor B-2b [Sesamum indicum]
Length=311

 Score =   129 bits (325),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 59/66 (89%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +2

Query  476  QRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSFV  655
            QRSVPTPFLTKT+QLVDD SIDD ISWNEDG++FIVW P EFARDLLPKYFKHNNFSSFV
Sbjct  21   QRSVPTPFLTKTYQLVDDPSIDDFISWNEDGTTFIVWRPAEFARDLLPKYFKHNNFSSFV  80

Query  656  RQLNTY  673
            RQLNTY
Sbjct  81   RQLNTY  86



>ref|NP_001152384.1| heat shock factor protein 7 [Zea mays]
 gb|ACG47338.1| heat shock factor protein 7 [Zea mays]
Length=377

 Score =   130 bits (328),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
             QRSVPTPFLTKT+QLVDD ++DDVISWN+DGS+FIVW P EFARDLLPKYFKHNNFSSF
Sbjct  29   GQRSVPTPFLTKTYQLVDDPAVDDVISWNDDGSAFIVWRPAEFARDLLPKYFKHNNFSSF  88

Query  653  VRQLNTY  673
            VRQLNTY
Sbjct  89   VRQLNTY  95



>ref|XP_008680871.1| PREDICTED: heat shock factor protein 7 isoform X1 [Zea mays]
 tpg|DAA48372.1| TPA: heat shock factor protein 7 [Zea mays]
 gb|AIB04797.1| HSF transcription factor, partial [Zea mays]
Length=414

 Score =   131 bits (329),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
             QRSVPTPFLTKT+QLVDD ++DDVISWN+DGS+FIVW P EFARDLLPKYFKHNNFSSF
Sbjct  64   GQRSVPTPFLTKTYQLVDDPAVDDVISWNDDGSAFIVWRPAEFARDLLPKYFKHNNFSSF  123

Query  653  VRQLNTY  673
            VRQLNTY
Sbjct  124  VRQLNTY  130



>gb|EAZ07882.1| hypothetical protein OsI_30138 [Oryza sativa Indica Group]
Length=373

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  467  GEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFS  646
            G+ QR+VPTPFLTKT+QLVDD ++DDVISWN+DGS+F+VW P EFARDLLPKYFKHNNFS
Sbjct  21   GQQQRTVPTPFLTKTYQLVDDPAVDDVISWNDDGSTFVVWRPAEFARDLLPKYFKHNNFS  80

Query  647  SFVRQLNTY  673
            SFVRQLNTY
Sbjct  81   SFVRQLNTY  89



>ref|XP_008799550.1| PREDICTED: heat stress transcription factor B-2b [Phoenix dactylifera]
Length=324

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = +2

Query  455  TTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKH  634
             T   + QRS+PTPFLTKT+QLVDD +IDDVISWNEDG++F+VW P EFARDLLPKYFKH
Sbjct  17   VTVVADGQRSMPTPFLTKTYQLVDDPAIDDVISWNEDGNTFVVWRPAEFARDLLPKYFKH  76

Query  635  NNFSSFVRQLNTY  673
            NNFSSFVRQLNTY
Sbjct  77   NNFSSFVRQLNTY  89



>ref|XP_002298053.1| heat shock transcription factor HSF29 family protein [Populus 
trichocarpa]
 gb|EEE82858.1| heat shock transcription factor HSF29 family protein [Populus 
trichocarpa]
Length=343

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +2

Query  470  EAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSS  649
            ++QRS+PTPFLTKT+QLVDD S+DD+ISWN+DGS+FIVW P EFARDLLPKYFKHNNFSS
Sbjct  31   DSQRSLPTPFLTKTYQLVDDPSVDDLISWNDDGSTFIVWRPAEFARDLLPKYFKHNNFSS  90

Query  650  FVRQLNTY  673
            FVRQLNTY
Sbjct  91   FVRQLNTY  98



>ref|XP_008790507.1| PREDICTED: heat stress transcription factor B-2b-like [Phoenix 
dactylifera]
Length=329

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +2

Query  470  EAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSS  649
            + QRS+PTPFLTKT+QLVDD + DDVISWNEDGS+FIVW P EFARDLLPKYFKHNNFSS
Sbjct  24   DGQRSMPTPFLTKTYQLVDDPTTDDVISWNEDGSTFIVWRPAEFARDLLPKYFKHNNFSS  83

Query  650  FVRQLNTY  673
            FVRQLNTY
Sbjct  84   FVRQLNTY  91



>ref|XP_009398726.1| PREDICTED: heat stress transcription factor B-2c-like [Musa acuminata 
subsp. malaccensis]
Length=350

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +2

Query  470  EAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSS  649
            + QRS+PTPFLTKT+QLVDD S+DD+ISWNEDGS+F+VW P EFARDLLPKYFKHNNFSS
Sbjct  21   DGQRSLPTPFLTKTYQLVDDPSVDDMISWNEDGSTFVVWRPAEFARDLLPKYFKHNNFSS  80

Query  650  FVRQLNTY  673
            FVRQLNTY
Sbjct  81   FVRQLNTY  88



>sp|Q6Z9C8.1|HFB2B_ORYSJ RecName: Full=Heat stress transcription factor B-2b; AltName: 
Full=Heat stress transcription factor 2; Short=rHsf2; AltName: 
Full=Heat stress transcription factor 21; Short=OsHsf-21 
[Oryza sativa Japonica Group]
 dbj|BAD09238.1| putative heat shock factor RHSF2 [Oryza sativa Japonica Group]
 dbj|BAD09926.1| putative heat shock factor RHSF2 [Oryza sativa Japonica Group]
 dbj|BAG95195.1| unnamed protein product [Oryza sativa Japonica Group]
Length=390

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  467  GEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFS  646
            G+ QR+VPTPFLTKT+QLVDD ++DDVISWN+DGS+F+VW P EFARDLLPKYFKHNNFS
Sbjct  39   GQQQRTVPTPFLTKTYQLVDDPAVDDVISWNDDGSTFVVWRPAEFARDLLPKYFKHNNFS  98

Query  647  SFVRQLNTY  673
            SFVRQLNTY
Sbjct  99   SFVRQLNTY  107



>ref|XP_008652977.1| PREDICTED: heat stress transcription factor B-2c-like [Zea mays]
 tpg|DAA62420.1| TPA: hypothetical protein ZEAMMB73_805208 [Zea mays]
 gb|AIB04896.1| HSF transcription factor, partial [Zea mays]
Length=394

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/67 (85%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
             QRS+PTPFLTKT+QLVDD ++DDVISWNEDGS+F+VW P EFARDLLPKYFKHNNFSSF
Sbjct  37   GQRSLPTPFLTKTYQLVDDPAVDDVISWNEDGSTFVVWRPAEFARDLLPKYFKHNNFSSF  96

Query  653  VRQLNTY  673
            VRQLNTY
Sbjct  97   VRQLNTY  103



>gb|AFI61331.1| HSF3 [Triticum aestivum]
Length=314

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 67/80 (84%), Gaps = 5/80 (6%)
 Frame = +2

Query  449  GETTAGGE-----AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDL  613
            GET A  E      QRS+PTPFL KT+QLVDD ++DDVISW+EDGS+FIVW P EFARDL
Sbjct  11   GETPATAEVGTGLGQRSLPTPFLNKTYQLVDDPAVDDVISWSEDGSAFIVWRPAEFARDL  70

Query  614  LPKYFKHNNFSSFVRQLNTY  673
            LPKYFKHNNFSSFVRQLNTY
Sbjct  71   LPKYFKHNNFSSFVRQLNTY  90



>ref|XP_010540690.1| PREDICTED: heat stress transcription factor B-2b [Tarenaya hassleriana]
Length=356

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +2

Query  470  EAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSS  649
            ++QRS+PTPFLTKT+QLVDD S+DD+ISWNEDG++FIVW P EFARDLLPKYFKHNNFSS
Sbjct  41   DSQRSLPTPFLTKTYQLVDDPSVDDLISWNEDGTTFIVWRPAEFARDLLPKYFKHNNFSS  100

Query  650  FVRQLNTY  673
            FVRQLNTY
Sbjct  101  FVRQLNTY  108



>ref|XP_004957416.1| PREDICTED: heat stress transcription factor B-2c-like isoform 
X3 [Setaria italica]
Length=395

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/67 (85%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
             QRS+PTPFLTKT+QLVDD ++DDVISWNEDGS+F+VW P EFARDLLPKYFKHNNFSSF
Sbjct  33   GQRSLPTPFLTKTYQLVDDPAVDDVISWNEDGSTFVVWRPAEFARDLLPKYFKHNNFSSF  92

Query  653  VRQLNTY  673
            VRQLNTY
Sbjct  93   VRQLNTY  99



>ref|XP_004957414.1| PREDICTED: heat stress transcription factor B-2c-like isoform 
X1 [Setaria italica]
Length=401

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/67 (85%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
             QRS+PTPFLTKT+QLVDD ++DDVISWNEDGS+F+VW P EFARDLLPKYFKHNNFSSF
Sbjct  33   GQRSLPTPFLTKTYQLVDDPAVDDVISWNEDGSTFVVWRPAEFARDLLPKYFKHNNFSSF  92

Query  653  VRQLNTY  673
            VRQLNTY
Sbjct  93   VRQLNTY  99



>gb|AFQ93675.1| heat shock transcription factor HSFB2b [Glycine max]
Length=339

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/66 (86%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +2

Query  476  QRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSFV  655
            QRS+PTPFLTKT+QLVDD S DD+ISWNEDG+SFIVW P EFARDLLPKYFKHNN+SSFV
Sbjct  2    QRSIPTPFLTKTYQLVDDPSADDLISWNEDGTSFIVWRPAEFARDLLPKYFKHNNYSSFV  61

Query  656  RQLNTY  673
            RQLNTY
Sbjct  62   RQLNTY  67



>ref|XP_008238806.1| PREDICTED: heat stress transcription factor B-2b [Prunus mume]
 ref|XP_008238807.1| PREDICTED: heat stress transcription factor B-2b [Prunus mume]
 ref|XP_008238808.1| PREDICTED: heat stress transcription factor B-2b [Prunus mume]
Length=332

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +2

Query  470  EAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSS  649
            ++QR++PTPFLTKT+QLVDD S+DD+ISW+EDGS+FIVW P EFARDLLPKYFKHNNFSS
Sbjct  23   DSQRTLPTPFLTKTYQLVDDPSVDDLISWSEDGSAFIVWRPAEFARDLLPKYFKHNNFSS  82

Query  650  FVRQLNTY  673
            FVRQLNTY
Sbjct  83   FVRQLNTY  90



>gb|AJR10106.1| heat-responsive transcription factor [Triticum aestivum]
Length=374

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 67/80 (84%), Gaps = 5/80 (6%)
 Frame = +2

Query  449  GETTAGGE-----AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDL  613
            GET A  E      QRS+PTPFL KT+QLVDD ++DDVISW+EDGS+FIVW P EFARDL
Sbjct  11   GETPATAEVGTGLGQRSLPTPFLNKTYQLVDDPAVDDVISWSEDGSAFIVWRPAEFARDL  70

Query  614  LPKYFKHNNFSSFVRQLNTY  673
            LPKYFKHNNFSSFVRQLNTY
Sbjct  71   LPKYFKHNNFSSFVRQLNTY  90



>ref|XP_007209340.1| hypothetical protein PRUPE_ppa008441mg [Prunus persica]
 gb|EMJ10539.1| hypothetical protein PRUPE_ppa008441mg [Prunus persica]
Length=331

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +2

Query  470  EAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSS  649
            ++QR++PTPFLTKT+QLVDD S+DD+ISW+EDGS+FIVW P EFARDLLPKYFKHNNFSS
Sbjct  23   DSQRTLPTPFLTKTYQLVDDPSVDDLISWSEDGSAFIVWRPAEFARDLLPKYFKHNNFSS  82

Query  650  FVRQLNTY  673
            FVRQLNTY
Sbjct  83   FVRQLNTY  90



>ref|XP_008376546.1| PREDICTED: heat stress transcription factor B-2a-like [Malus 
domestica]
Length=297

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/66 (88%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = +2

Query  476  QRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSFV  655
            QR++PTPFLTKT+QLVDD SIDDVISW++DGSSF+VWNPT FARDLLPKYFKHNNFSSFV
Sbjct  19   QRALPTPFLTKTYQLVDDPSIDDVISWSDDGSSFVVWNPTVFARDLLPKYFKHNNFSSFV  78

Query  656  RQLNTY  673
            RQLNTY
Sbjct  79   RQLNTY  84



>ref|XP_009130190.1| PREDICTED: heat stress transcription factor B-2a-like [Brassica 
rapa]
Length=266

 Score =   127 bits (318),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 69/87 (79%), Gaps = 4/87 (5%)
 Frame = +2

Query  413  MGPPVPPVERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNP  592
            M PP      N   T A  E+QR+ PTPFLTKTF LV+D S +DVISWNEDGSSF+VWN 
Sbjct  1    MSPP----SDNSYTTMATNESQRTAPTPFLTKTFNLVEDPSTNDVISWNEDGSSFVVWNQ  56

Query  593  TEFARDLLPKYFKHNNFSSFVRQLNTY  673
            T+FA+DLLPK+FKHNNFSSFVRQLNTY
Sbjct  57   TDFAKDLLPKHFKHNNFSSFVRQLNTY  83



>gb|KFK27929.1| hypothetical protein AALP_AA8G449200 [Arabis alpina]
Length=293

 Score =   127 bits (320),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +2

Query  413  MGPPVPPVERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNP  592
            M P +   + +        E+QRSVPTPFL KTF LV+D SI+D+ISWNEDGSSFIVWNP
Sbjct  1    MNPTLDHSDNSESAMVTVTESQRSVPTPFLIKTFNLVEDPSINDIISWNEDGSSFIVWNP  60

Query  593  TEFARDLLPKYFKHNNFSSFVRQLNTY  673
            T+FA+DLLPK+FKHNNFSSFVRQLNTY
Sbjct  61   TDFAKDLLPKHFKHNNFSSFVRQLNTY  87



>gb|EMS61082.1| Heat stress transcription factor B-2b [Triticum urartu]
Length=365

 Score =   129 bits (323),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +2

Query  467  GEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFS  646
            G  QRS+PTPFL KT+QLVDD ++DDVISW+EDGS+FIVW P EFARDLLPKYFKHNNFS
Sbjct  30   GLGQRSLPTPFLNKTYQLVDDPAVDDVISWSEDGSAFIVWRPAEFARDLLPKYFKHNNFS  89

Query  647  SFVRQLNTYV  676
            SFVRQLNTYV
Sbjct  90   SFVRQLNTYV  99



>gb|AEB26596.1| heat shock factor B2c [Hordeum vulgare subsp. vulgare]
Length=362

 Score =   129 bits (323),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +2

Query  446  GGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKY  625
            G   TA    QRS+PTPFLTKT+QLV+D ++DDVISW EDGS+F+VW P EFARDLLPKY
Sbjct  10   GLAATADAAGQRSLPTPFLTKTYQLVEDPAVDDVISWGEDGSTFVVWRPAEFARDLLPKY  69

Query  626  FKHNNFSSFVRQLNTY  673
            FKHNNFSSFVRQLNTY
Sbjct  70   FKHNNFSSFVRQLNTY  85



>ref|XP_006659656.1| PREDICTED: heat stress transcription factor B-2b-like [Oryza 
brachyantha]
Length=371

 Score =   129 bits (323),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 57/66 (86%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +2

Query  476  QRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSFV  655
            QRSVPTPFLTKT+QLVDD ++DDVISWN+DGS+F+VW P EFARDLLPKYFKHNNFSSFV
Sbjct  34   QRSVPTPFLTKTYQLVDDPAVDDVISWNDDGSTFVVWRPAEFARDLLPKYFKHNNFSSFV  93

Query  656  RQLNTY  673
            RQLNTY
Sbjct  94   RQLNTY  99



>ref|XP_002509743.1| Heat shock factor protein, putative [Ricinus communis]
 gb|EEF51130.1| Heat shock factor protein, putative [Ricinus communis]
Length=337

 Score =   128 bits (321),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +2

Query  470  EAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSS  649
            ++QRS+PTPFLTKT+QLVDD S DD+ISWN+DGS+FIVW P EFARDLLPKYFKHNNFSS
Sbjct  25   DSQRSIPTPFLTKTYQLVDDPSYDDLISWNDDGSTFIVWRPAEFARDLLPKYFKHNNFSS  84

Query  650  FVRQLNTY  673
            FVRQLNTY
Sbjct  85   FVRQLNTY  92



>gb|AII99900.1| heat shock transcription factor [Gossypium hirsutum]
Length=310

 Score =   127 bits (320),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 70/85 (82%), Gaps = 2/85 (2%)
 Frame = +2

Query  419  PPVPPVERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTE  598
            P   P E +     A  ++QRS+PTPFL+KT+QLVD+ S+DD+ISWN+DGS+FIVW P E
Sbjct  5    PADQPCESHASGAVA--DSQRSLPTPFLSKTYQLVDNSSVDDLISWNDDGSTFIVWRPAE  62

Query  599  FARDLLPKYFKHNNFSSFVRQLNTY  673
            FARDLLPKYFKHNNFSSFVRQLNTY
Sbjct  63   FARDLLPKYFKHNNFSSFVRQLNTY  87



>ref|XP_004245637.1| PREDICTED: heat stress transcription factor B-2b [Solanum lycopersicum]
Length=325

 Score =   127 bits (320),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +2

Query  458  TAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHN  637
            +A GE QRS+PTPFLTKT+QLVDD ++D++ISWNEDG++FIVW P EFARDLLPK FKHN
Sbjct  12   SATGENQRSLPTPFLTKTYQLVDDPAMDELISWNEDGTTFIVWKPAEFARDLLPKCFKHN  71

Query  638  NFSSFVRQLNTY  673
            NFSSFVRQLNTY
Sbjct  72   NFSSFVRQLNTY  83



>ref|NP_001062423.1| Os08g0546800 [Oryza sativa Japonica Group]
 gb|AAQ23056.1| heat shock factor RHSF2 [Oryza sativa Japonica Group]
 dbj|BAF24337.1| Os08g0546800 [Oryza sativa Japonica Group]
Length=616

 Score =   130 bits (327),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  467  GEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFS  646
            G+ QR+VPTPFLTKT+QLVDD ++DDVISWN+DGS+F+VW P EFARDLLPKYFKHNNFS
Sbjct  182  GQQQRTVPTPFLTKTYQLVDDPAVDDVISWNDDGSTFVVWRPAEFARDLLPKYFKHNNFS  241

Query  647  SFVRQLNTY  673
            SFVRQLNTY
Sbjct  242  SFVRQLNTY  250



>ref|XP_011084402.1| PREDICTED: heat stress transcription factor B-2b-like [Sesamum 
indicum]
Length=302

 Score =   127 bits (318),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  464  GGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNF  643
              +A R + TPFLTKT+QLVDD +IDDVISWN DGS+FIVWNPTEFARDLLPKYFKHNNF
Sbjct  2    AADAPRLLATPFLTKTYQLVDDHAIDDVISWNIDGSAFIVWNPTEFARDLLPKYFKHNNF  61

Query  644  SSFVRQLNTY  673
            SSF+RQLNTY
Sbjct  62   SSFIRQLNTY  71



>ref|XP_004974114.1| PREDICTED: heat stress transcription factor B-2b-like isoform 
X2 [Setaria italica]
Length=415

 Score =   128 bits (322),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 57/66 (86%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +2

Query  476  QRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSFV  655
            QRSVPTPFLTKT+QLVDD ++DDVISWN+DGS+F+VW P EFARDLLPKYFKHNNFSSFV
Sbjct  38   QRSVPTPFLTKTYQLVDDPAVDDVISWNDDGSAFVVWRPAEFARDLLPKYFKHNNFSSFV  97

Query  656  RQLNTY  673
            RQLNTY
Sbjct  98   RQLNTY  103



>ref|XP_009389775.1| PREDICTED: heat stress transcription factor B-2b-like [Musa acuminata 
subsp. malaccensis]
Length=304

 Score =   127 bits (318),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +2

Query  470  EAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSS  649
            E QR +PTPFLTKT+QLVDD ++DDVISWNEDGS+F+VW P EFARD+LPK+FKHNNFSS
Sbjct  28   EGQRVMPTPFLTKTYQLVDDPAMDDVISWNEDGSTFVVWRPAEFARDVLPKFFKHNNFSS  87

Query  650  FVRQLNTY  673
            FVRQLNTY
Sbjct  88   FVRQLNTY  95



>gb|KHG11685.1| Heat stress transcription factor B-2b -like protein [Gossypium 
arboreum]
Length=313

 Score =   127 bits (318),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 70/85 (82%), Gaps = 2/85 (2%)
 Frame = +2

Query  419  PPVPPVERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTE  598
            P   P E +     A  ++QRS+PTPFL+KT+QLVD+ S+DD+ISWN+DGS+FIVW P E
Sbjct  5    PADQPCESHASGAVA--DSQRSLPTPFLSKTYQLVDNPSVDDLISWNDDGSTFIVWRPAE  62

Query  599  FARDLLPKYFKHNNFSSFVRQLNTY  673
            FARDLLPKYFKHNNFSSFVRQLNTY
Sbjct  63   FARDLLPKYFKHNNFSSFVRQLNTY  87



>dbj|BAJ85352.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=402

 Score =   128 bits (321),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +2

Query  458  TAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHN  637
            TA    QRS+PTPFLTKT+QLV+D ++DDVISW EDGS+F+VW P EFARDLLPKYFKHN
Sbjct  31   TADAAGQRSLPTPFLTKTYQLVEDPAVDDVISWGEDGSTFVVWRPAEFARDLLPKYFKHN  90

Query  638  NFSSFVRQLNTY  673
            NFSSFVRQLNTY
Sbjct  91   NFSSFVRQLNTY  102



>dbj|BAD46358.1| putative heat shock factor [Oryza sativa Japonica Group]
Length=414

 Score =   128 bits (321),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 56/67 (84%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
             QRS+PTPFLTKT+QLV+D ++DDVISWNEDGS+F+VW P EFARDLLPKYFKHNNFSSF
Sbjct  31   GQRSLPTPFLTKTYQLVEDPAVDDVISWNEDGSTFVVWRPAEFARDLLPKYFKHNNFSSF  90

Query  653  VRQLNTY  673
            VRQLNTY
Sbjct  91   VRQLNTY  97



>dbj|BAK04233.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=390

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 67/80 (84%), Gaps = 5/80 (6%)
 Frame = +2

Query  449  GETTAGGE-----AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDL  613
            GET A  E      QRS+PTPFL KT+QLVDD ++DDVISW+EDGS+F+VW P EFARDL
Sbjct  27   GETPAQAEVGTGVGQRSLPTPFLNKTYQLVDDPAVDDVISWSEDGSAFVVWRPAEFARDL  86

Query  614  LPKYFKHNNFSSFVRQLNTY  673
            LPKYFKHNNFSSFVRQLNTY
Sbjct  87   LPKYFKHNNFSSFVRQLNTY  106



>gb|KJB20712.1| hypothetical protein B456_003G160600 [Gossypium raimondii]
 gb|KJB20713.1| hypothetical protein B456_003G160600 [Gossypium raimondii]
Length=310

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 70/85 (82%), Gaps = 2/85 (2%)
 Frame = +2

Query  419  PPVPPVERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTE  598
            P   P E +     A  ++QRS+PTPFL+KT+QLVD+ S+DD+ISWN+DGS+FIVW P E
Sbjct  5    PADQPCESHASGAVA--DSQRSLPTPFLSKTYQLVDNPSVDDLISWNDDGSTFIVWRPAE  62

Query  599  FARDLLPKYFKHNNFSSFVRQLNTY  673
            FARDLLPKYFKHNNFSSFVRQLNTY
Sbjct  63   FARDLLPKYFKHNNFSSFVRQLNTY  87



>ref|XP_010444038.1| PREDICTED: heat stress transcription factor B-2a-like [Camelina 
sativa]
Length=316

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +2

Query  455  TTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKH  634
            TT    +QRS+PTPF+TKT+ LV+D SI++VISWNEDGSSFIVWNPT+FA+DLLPK+FKH
Sbjct  10   TTGESLSQRSIPTPFVTKTYNLVEDSSINEVISWNEDGSSFIVWNPTDFAKDLLPKHFKH  69

Query  635  NNFSSFVRQLNTY  673
            NNFSSFVRQLNTY
Sbjct  70   NNFSSFVRQLNTY  82



>gb|EAZ09820.1| hypothetical protein OsI_32108 [Oryza sativa Indica Group]
Length=446

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/67 (84%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
             QRS+PTPFLTKT+QLV+D ++DDVISWNEDGS+F+VW P EFARDLLPKYFKHNNFSSF
Sbjct  31   GQRSLPTPFLTKTYQLVEDPAVDDVISWNEDGSTFVVWRPAEFARDLLPKYFKHNNFSSF  90

Query  653  VRQLNTY  673
            VRQLNTY
Sbjct  91   VRQLNTY  97



>ref|XP_010676525.1| PREDICTED: heat stress transcription factor B-2b-like [Beta vulgaris 
subsp. vulgaris]
Length=337

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +2

Query  476  QRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSFV  655
            QR++PTPFLTKT+QLVDD S+D++ISWN+DGSSFIVW P EFARDLLPKYFKHNNFSSFV
Sbjct  27   QRTLPTPFLTKTYQLVDDPSVDELISWNDDGSSFIVWRPAEFARDLLPKYFKHNNFSSFV  86

Query  656  RQLNTY  673
            RQLNTY
Sbjct  87   RQLNTY  92



>gb|KEH43737.1| heat shock transcription factor B2A [Medicago truncatula]
Length=303

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 67/83 (81%), Gaps = 7/83 (8%)
 Frame = +2

Query  425  VPPVERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFA  604
             P VE NG       E+Q+S PTPFLTKT+ LVD+ + DDVISWN+ G+SFIVWNPT FA
Sbjct  2    APSVEHNG-------ESQKSTPTPFLTKTYHLVDEIATDDVISWNDTGTSFIVWNPTIFA  54

Query  605  RDLLPKYFKHNNFSSFVRQLNTY  673
            RDLLPKYFKHNNFSSFVRQLNTY
Sbjct  55   RDLLPKYFKHNNFSSFVRQLNTY  77



>ref|XP_009138768.1| PREDICTED: heat stress transcription factor B-1 [Brassica rapa]
 emb|CDY71121.1| BnaAnng36200D [Brassica napus]
Length=286

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
            AQRSVP PFL+KT+QLVDD+S DDV+SWNEDGS+F+VW   EFA+DLLP+YFKHNNFSSF
Sbjct  4    AQRSVPAPFLSKTYQLVDDQSTDDVVSWNEDGSAFVVWKTAEFAKDLLPQYFKHNNFSSF  63

Query  653  VRQLNTY  673
            +RQLNTY
Sbjct  64   IRQLNTY  70



>ref|NP_001063726.1| Os09g0526600 [Oryza sativa Japonica Group]
 sp|Q652B0.1|HFB2C_ORYSJ RecName: Full=Heat stress transcription factor B-2c; AltName: 
Full=Heat stress transcription factor 24; Short=OsHsf-24 [Oryza 
sativa Japonica Group]
 dbj|BAD46357.1| putative heat shock factor [Oryza sativa Japonica Group]
 dbj|BAF25640.1| Os09g0526600 [Oryza sativa Japonica Group]
Length=454

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/67 (84%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
             QRS+PTPFLTKT+QLV+D ++DDVISWNEDGS+F+VW P EFARDLLPKYFKHNNFSSF
Sbjct  31   GQRSLPTPFLTKTYQLVEDPAVDDVISWNEDGSTFVVWRPAEFARDLLPKYFKHNNFSSF  90

Query  653  VRQLNTY  673
            VRQLNTY
Sbjct  91   VRQLNTY  97



>ref|XP_003578478.1| PREDICTED: heat stress transcription factor B-2c [Brachypodium 
distachyon]
Length=399

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/67 (84%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
             QRS+PTPFLTKT+QLV+D ++DDVISWNEDGS+F+VW P EFARDLLPKYFKHNNFSSF
Sbjct  36   GQRSLPTPFLTKTYQLVEDPAVDDVISWNEDGSTFVVWRPAEFARDLLPKYFKHNNFSSF  95

Query  653  VRQLNTY  673
            VRQLNTY
Sbjct  96   VRQLNTY  102



>gb|EPS72138.1| hypothetical protein M569_02618 [Genlisea aurea]
Length=280

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +2

Query  458  TAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHN  637
               GE+QRS+ TPFL+KT+ +VDD ++DD+ISWNE+G++FIVW P EFARDLLPKYFKHN
Sbjct  5    AGAGESQRSITTPFLSKTYLMVDDSAVDDLISWNEEGTAFIVWRPAEFARDLLPKYFKHN  64

Query  638  NFSSFVRQLNTY  673
            NFSSFVRQLNTY
Sbjct  65   NFSSFVRQLNTY  76



>emb|CDY64186.1| BnaC03g73070D [Brassica napus]
Length=310

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = +2

Query  476  QRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSFV  655
            QRS+PTPFLTKT+QLVDD   D++ISWNEDGS+FIVW P EFARDLLPKYFKHNNFSSFV
Sbjct  30   QRSIPTPFLTKTYQLVDDPVYDELISWNEDGSTFIVWKPAEFARDLLPKYFKHNNFSSFV  89

Query  656  RQLNTY  673
            RQLNTY
Sbjct  90   RQLNTY  95



>ref|XP_011030077.1| PREDICTED: heat stress transcription factor B-2a [Populus euphratica]
 ref|XP_011012366.1| PREDICTED: heat stress transcription factor B-2a-like [Populus 
euphratica]
Length=294

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 73/90 (81%), Gaps = 4/90 (4%)
 Frame = +2

Query  413  MGPPVPPVERNGGETTAGGEAQRS---VPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIV  583
            M PP P VE+N  +T   G    +   +PTPFLTKT+Q+VDD +IDDV+SWNEDGSSFIV
Sbjct  1    MSPP-PLVEQNSTDTPTTGGGGETSRTIPTPFLTKTYQIVDDHTIDDVVSWNEDGSSFIV  59

Query  584  WNPTEFARDLLPKYFKHNNFSSFVRQLNTY  673
            W+PT FARDLLPKYFKHNNFSSFVRQLNTY
Sbjct  60   WDPTVFARDLLPKYFKHNNFSSFVRQLNTY  89



>ref|XP_006396868.1| hypothetical protein EUTSA_v10028744mg [Eutrema salsugineum]
 gb|ESQ38321.1| hypothetical protein EUTSA_v10028744mg [Eutrema salsugineum]
Length=370

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +2

Query  470  EAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSS  649
            ++QRS+PTPFLTKT+QLVDD   D++ISWNEDGS+FIVW P EFARDLLPKYFKHNNFSS
Sbjct  46   DSQRSIPTPFLTKTYQLVDDPVYDELISWNEDGSTFIVWRPAEFARDLLPKYFKHNNFSS  105

Query  650  FVRQLNTY  673
            FVRQLNTY
Sbjct  106  FVRQLNTY  113



>emb|CDX69274.1| BnaC01g01790D [Brassica napus]
Length=284

 Score =   125 bits (313),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
            AQRSVP PFL+KT+QLVDD+S DDV+SWNEDGS+F+VW   EFA+DLLP+YFKHNNFSSF
Sbjct  4    AQRSVPAPFLSKTYQLVDDQSTDDVVSWNEDGSAFVVWKTAEFAKDLLPQYFKHNNFSSF  63

Query  653  VRQLNTY  673
            +RQLNTY
Sbjct  64   IRQLNTY  70



>gb|ACN76855.1| heat shock transcription factor [Cicer arietinum]
Length=267

 Score =   124 bits (312),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 67/80 (84%), Gaps = 2/80 (3%)
 Frame = +2

Query  434  VERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDL  613
             E N   +TA  ++QRS PTPFL KT+ LVDDR+IDDVISWN+ G++FIVWNPT FA+DL
Sbjct  5    AEHNADSSTA--DSQRSSPTPFLIKTYDLVDDRTIDDVISWNDTGTTFIVWNPTVFAKDL  62

Query  614  LPKYFKHNNFSSFVRQLNTY  673
            LPKYFKHNN SSFVRQLNTY
Sbjct  63   LPKYFKHNNSSSFVRQLNTY  82



>emb|CDY59386.1| BnaC09g52680D [Brassica napus]
Length=361

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +2

Query  470  EAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSS  649
            ++QRS+PTPFLTKT+QLVDD   DD+ISWN+DGS+FIVW P EFARDLLPKYFKHNNFSS
Sbjct  40   DSQRSIPTPFLTKTYQLVDDPVYDDLISWNDDGSTFIVWRPAEFARDLLPKYFKHNNFSS  99

Query  650  FVRQLNTY  673
            FVRQLNTY
Sbjct  100  FVRQLNTY  107



>ref|XP_009124795.1| PREDICTED: heat stress transcription factor B-2b [Brassica rapa]
Length=357

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +2

Query  470  EAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSS  649
            ++QRS+PTPFLTKT+QLVDD   DD+ISWN+DGS+FIVW P EFARDLLPKYFKHNNFSS
Sbjct  40   DSQRSIPTPFLTKTYQLVDDPVYDDLISWNDDGSTFIVWRPAEFARDLLPKYFKHNNFSS  99

Query  650  FVRQLNTY  673
            FVRQLNTY
Sbjct  100  FVRQLNTY  107



>emb|CDX86761.1| BnaA09g21510D [Brassica napus]
Length=361

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +2

Query  470  EAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSS  649
            ++QRS+PTPFLTKT+QLVDD   DD+ISWN+DGS+FIVW P EFARDLLPKYFKHNNFSS
Sbjct  40   DSQRSIPTPFLTKTYQLVDDPVYDDLISWNDDGSTFIVWRPAEFARDLLPKYFKHNNFSS  99

Query  650  FVRQLNTY  673
            FVRQLNTY
Sbjct  100  FVRQLNTY  107



>gb|KFK31930.1| hypothetical protein AALP_AA6G177400 [Arabis alpina]
Length=378

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +2

Query  470  EAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSS  649
            ++QRS+PTPFLTKT+QLVDD   D++ISWNEDG+SFIVW P EFARDLLPKYFKHNNFSS
Sbjct  47   DSQRSIPTPFLTKTYQLVDDPVYDELISWNEDGTSFIVWRPAEFARDLLPKYFKHNNFSS  106

Query  650  FVRQLNTY  673
            FVRQLNTY
Sbjct  107  FVRQLNTY  114



>ref|XP_009415832.1| PREDICTED: heat stress transcription factor B-2a-like [Musa acuminata 
subsp. malaccensis]
Length=346

 Score =   125 bits (315),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 55/66 (83%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +2

Query  476  QRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSFV  655
            QR++PTPFLTKT+QLVDD  +DDVISWNEDGS+F+VW P EFARDLLPK+FKHNNFSSFV
Sbjct  17   QRALPTPFLTKTYQLVDDPEMDDVISWNEDGSTFVVWRPAEFARDLLPKHFKHNNFSSFV  76

Query  656  RQLNTY  673
            RQLNTY
Sbjct  77   RQLNTY  82



>ref|XP_009397638.1| PREDICTED: heat stress transcription factor B-2b-like [Musa acuminata 
subsp. malaccensis]
Length=294

 Score =   124 bits (312),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +2

Query  470  EAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSS  649
            E QR++PTPFLTKT+QLVDD   DDVISWNEDGS+F+VW P EFARD+LPK FKHNNFSS
Sbjct  22   EGQRTIPTPFLTKTYQLVDDPYFDDVISWNEDGSTFVVWQPAEFARDVLPKNFKHNNFSS  81

Query  650  FVRQLNTY  673
            FVRQLNTY
Sbjct  82   FVRQLNTY  89



>gb|ABV89640.1| heat shock factor 4 [Brassica rapa]
Length=285

 Score =   124 bits (312),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
            AQRSVP PFL+KT+QLVDD+S DDV+SWNEDG++F+VW   EFA+DLLP+YFKHNNFSSF
Sbjct  3    AQRSVPAPFLSKTYQLVDDQSTDDVVSWNEDGTAFVVWKTAEFAKDLLPQYFKHNNFSSF  62

Query  653  VRQLNTY  673
            +RQLNTY
Sbjct  63   IRQLNTY  69



>ref|XP_008439190.1| PREDICTED: heat stress transcription factor B-2b-like [Cucumis 
melo]
Length=297

 Score =   124 bits (312),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = +2

Query  455  TTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKH  634
            TT G ++ RSVPTPFLTKT+QLVDD SID VISWN+DGS+FIVWN   FA+D LPKYFKH
Sbjct  15   TTTGNDSYRSVPTPFLTKTYQLVDDESIDHVISWNDDGSTFIVWNTMAFAKDFLPKYFKH  74

Query  635  NNFSSFVRQLNTY  673
            NNF+SF+RQLNTY
Sbjct  75   NNFTSFLRQLNTY  87



>ref|XP_004308106.1| PREDICTED: heat stress transcription factor B-2a [Fragaria vesca 
subsp. vesca]
Length=289

 Score =   124 bits (310),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 72/85 (85%), Gaps = 5/85 (6%)
 Frame = +2

Query  431  PVERNGGETTAG----GEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTE  598
            PVE+NG E+T+G     + QR  PTPFL+KT+QLVDD +IDD+I+W+ DGSSF+V NPT 
Sbjct  5    PVEQNG-ESTSGESTQQQQQRGSPTPFLSKTYQLVDDPAIDDIIAWSGDGSSFVVKNPTV  63

Query  599  FARDLLPKYFKHNNFSSFVRQLNTY  673
            FARDLLPKYFKHNNFSSFVRQLNTY
Sbjct  64   FARDLLPKYFKHNNFSSFVRQLNTY  88



>ref|XP_009134244.1| PREDICTED: heat stress transcription factor B-2b-like [Brassica 
rapa]
Length=316

 Score =   124 bits (311),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +2

Query  470  EAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSS  649
            E QRS+PTPFLTKT+QLVDD   D++ISWNEDGS+FIVW   EFARDLLPKYFKHNNFSS
Sbjct  29   EPQRSIPTPFLTKTYQLVDDPVYDELISWNEDGSTFIVWKAAEFARDLLPKYFKHNNFSS  88

Query  650  FVRQLNTY  673
            FVRQLNTY
Sbjct  89   FVRQLNTY  96



>emb|CDX90804.1| BnaA03g24840D [Brassica napus]
Length=320

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +2

Query  470  EAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSS  649
            E QRS+PTPFLTKT+QLVDD   D++ISWNEDGS+FIVW   EFARDLLPKYFKHNNFSS
Sbjct  29   EPQRSIPTPFLTKTYQLVDDPVYDELISWNEDGSTFIVWKAAEFARDLLPKYFKHNNFSS  88

Query  650  FVRQLNTY  673
            FVRQLNTY
Sbjct  89   FVRQLNTY  96



>ref|XP_010531239.1| PREDICTED: heat stress transcription factor B-1-like [Tarenaya 
hassleriana]
Length=249

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
            AQRSVP PFLTKT+QLVDD S DDV+SWNEDG++F+VW   EFA+DLLP+YFKHNNFSSF
Sbjct  4    AQRSVPAPFLTKTYQLVDDASTDDVVSWNEDGTAFVVWKTAEFAKDLLPQYFKHNNFSSF  63

Query  653  VRQLNTY  673
            +RQLNTY
Sbjct  64   IRQLNTY  70



>ref|XP_004140783.1| PREDICTED: heat stress transcription factor B-2b-like [Cucumis 
sativus]
 gb|KGN57358.1| hypothetical protein Csa_3G181940 [Cucumis sativus]
Length=293

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +2

Query  479  RSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSFVR  658
            RSVPTPFLTKT+QLVDDRSID VISWN+DGS+FIVWN   FA+DLLPKYFKHNNF+SF+R
Sbjct  17   RSVPTPFLTKTYQLVDDRSIDHVISWNDDGSTFIVWNTMAFAKDLLPKYFKHNNFTSFLR  76

Query  659  QLNTY  673
            QLNTY
Sbjct  77   QLNTY  81



>ref|XP_010455582.1| PREDICTED: heat stress transcription factor B-2b-like [Camelina 
sativa]
Length=375

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +2

Query  470  EAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSS  649
            ++QRS+PTPFLTKT+QLVDD   D++ISWN+DG+SFIVW P EFARDLLPKYFKHNNFSS
Sbjct  51   DSQRSIPTPFLTKTYQLVDDPVYDELISWNDDGTSFIVWRPAEFARDLLPKYFKHNNFSS  110

Query  650  FVRQLNTY  673
            FVRQLNTY
Sbjct  111  FVRQLNTY  118



>ref|XP_010422122.1| PREDICTED: heat stress transcription factor B-2b [Camelina sativa]
Length=370

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +2

Query  470  EAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSS  649
            ++QRS+PTPFLTKT+QLVDD   D++ISWN+DG+SFIVW P EFARDLLPKYFKHNNFSS
Sbjct  43   DSQRSIPTPFLTKTYQLVDDPVYDELISWNDDGTSFIVWRPAEFARDLLPKYFKHNNFSS  102

Query  650  FVRQLNTY  673
            FVRQLNTY
Sbjct  103  FVRQLNTY  110



>ref|XP_010434580.1| PREDICTED: heat stress transcription factor B-2b-like [Camelina 
sativa]
Length=375

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +2

Query  470  EAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSS  649
            ++QRS+PTPFLTKT+QLVDD   D++ISWN+DG+SFIVW P EFARDLLPKYFKHNNFSS
Sbjct  50   DSQRSIPTPFLTKTYQLVDDPVYDELISWNDDGTSFIVWRPAEFARDLLPKYFKHNNFSS  109

Query  650  FVRQLNTY  673
            FVRQLNTY
Sbjct  110  FVRQLNTY  117



>emb|CAB63803.1| heat shock factor 7 [Arabidopsis thaliana]
Length=328

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +2

Query  470  EAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSS  649
            ++QRS+PTPFLTKT+QLV+D   D++ISWNEDG++FIVW P EFARDLLPKYFKHNNFSS
Sbjct  2    DSQRSIPTPFLTKTYQLVEDPVYDELISWNEDGTTFIVWRPAEFARDLLPKYFKHNNFSS  61

Query  650  FVRQLNTY  673
            FVRQLNTY
Sbjct  62   FVRQLNTY  69



>ref|NP_192903.1| heat stress transcription factor B-2b [Arabidopsis thaliana]
 sp|Q9T0D3.1|HFB2B_ARATH RecName: Full=Heat stress transcription factor B-2b; Short=AtHsfB2b; 
AltName: Full=AtHsf-11; AltName: Full=Heat shock factor 
protein 7; Short=HSF 7; AltName: Full=Heat shock transcription 
factor 7; Short=HSTF 7 [Arabidopsis thaliana]
 emb|CAB39937.1| heat shock transcription factor-like protein [Arabidopsis thaliana]
 emb|CAB78209.1| heat shock transcription factor-like protein [Arabidopsis thaliana]
 gb|AAM13205.1| heat shock transcription factor-like protein [Arabidopsis thaliana]
 gb|AAP37830.1| At4g11660 [Arabidopsis thaliana]
 gb|AEE83036.1| heat stress transcription factor B-2b [Arabidopsis thaliana]
Length=377

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +2

Query  470  EAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSS  649
            ++QRS+PTPFLTKT+QLV+D   D++ISWNEDG++FIVW P EFARDLLPKYFKHNNFSS
Sbjct  51   DSQRSIPTPFLTKTYQLVEDPVYDELISWNEDGTTFIVWRPAEFARDLLPKYFKHNNFSS  110

Query  650  FVRQLNTY  673
            FVRQLNTY
Sbjct  111  FVRQLNTY  118



>ref|XP_002872608.1| hypothetical protein ARALYDRAFT_911518 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48867.1| hypothetical protein ARALYDRAFT_911518 [Arabidopsis lyrata subsp. 
lyrata]
Length=377

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +2

Query  470  EAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSS  649
            ++QRS+PTPFLTKT+QLV+D   D++ISWNEDG++FIVW P EFARDLLPKYFKHNNFSS
Sbjct  51   DSQRSIPTPFLTKTYQLVEDPVYDELISWNEDGTTFIVWRPAEFARDLLPKYFKHNNFSS  110

Query  650  FVRQLNTY  673
            FVRQLNTY
Sbjct  111  FVRQLNTY  118



>emb|CDY67248.1| BnaCnng54110D [Brassica napus]
Length=252

 Score =   121 bits (303),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = +2

Query  455  TTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKH  634
             T   ++QR+ PTPFLTKTF LV+D S +DVISWNEDGSSF+VWN T+FA+DLLPK+FKH
Sbjct  2    ATNESQSQRTAPTPFLTKTFNLVEDPSTNDVISWNEDGSSFVVWNQTDFAKDLLPKHFKH  61

Query  635  NNFSSFVRQLNTY  673
            NNFSSFVRQLNTY
Sbjct  62   NNFSSFVRQLNTY  74



>ref|XP_009391581.1| PREDICTED: heat stress transcription factor B-2b-like [Musa acuminata 
subsp. malaccensis]
Length=293

 Score =   122 bits (305),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = +2

Query  476  QRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSFV  655
            QR+VPTPFL KT+QLVDD SIDDVISWNEDGS+F+VW P EF+ D+LP YFKHNNFSSFV
Sbjct  23   QRTVPTPFLAKTYQLVDDPSIDDVISWNEDGSAFVVWRPAEFSLDVLPNYFKHNNFSSFV  82

Query  656  RQLNTY  673
            RQLNTY
Sbjct  83   RQLNTY  88



>ref|XP_009130189.1| PREDICTED: heat stress transcription factor B-2a-like [Brassica 
rapa]
Length=255

 Score =   121 bits (303),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +2

Query  458  TAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHN  637
            T   ++QR+ PTPFLTKTF LV+D S +DVISWNEDGSSF+VWN T+FA+DLLPK+FKHN
Sbjct  3    TNESQSQRTAPTPFLTKTFNLVEDPSTNDVISWNEDGSSFVVWNQTDFAKDLLPKHFKHN  62

Query  638  NFSSFVRQLNTY  673
            NFSSFVRQLNTY
Sbjct  63   NFSSFVRQLNTY  74



>ref|XP_006287969.1| hypothetical protein CARUB_v10001204mg [Capsella rubella]
 gb|EOA20867.1| hypothetical protein CARUB_v10001204mg [Capsella rubella]
Length=372

 Score =   123 bits (308),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +2

Query  470  EAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSS  649
            ++QRS+PTPFLTKT+QLVDD   D++ISWN+DG++FIVW P EFARDLLPKYFKHNNFSS
Sbjct  51   DSQRSIPTPFLTKTYQLVDDPVYDELISWNDDGTTFIVWRPAEFARDLLPKYFKHNNFSS  110

Query  650  FVRQLNTY  673
            FVRQLNTY
Sbjct  111  FVRQLNTY  118



>ref|NP_195416.1| heat stress transcription factor B-1 [Arabidopsis thaliana]
 sp|Q96320.2|HSFB1_ARATH RecName: Full=Heat stress transcription factor B-1; Short=AtHsfB1; 
AltName: Full=AtHsf-16; AltName: Full=Heat shock factor 
protein 4; Short=HSF 4; AltName: Full=Heat shock transcription 
factor 4; Short=HSTF 4 [Arabidopsis thaliana]
 emb|CAB16764.1| heat shock transcription factor HSF4 [Arabidopsis thaliana]
 emb|CAA74398.1| Heat Shock Factor 4 [Arabidopsis thaliana]
 emb|CAB80365.1| heat shock transcription factor HSF4 [Arabidopsis thaliana]
 gb|AAM53318.1| heat shock transcription factor HSF4 [Arabidopsis thaliana]
 gb|AAO30002.1| heat shock transcription factor HSF4 [Arabidopsis thaliana]
 dbj|BAH30561.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE86732.1| heat stress transcription factor B-1 [Arabidopsis thaliana]
Length=284

 Score =   121 bits (303),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +2

Query  458  TAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHN  637
            TA   AQRSVP PFL+KT+QLVDD S DDV+SWNE+G++F+VW   EFA+DLLP+YFKHN
Sbjct  2    TAVTAAQRSVPAPFLSKTYQLVDDHSTDDVVSWNEEGTAFVVWKTAEFAKDLLPQYFKHN  61

Query  638  NFSSFVRQLNTY  673
            NFSSF+RQLNTY
Sbjct  62   NFSSFIRQLNTY  73



>ref|XP_002866968.1| hypothetical protein ARALYDRAFT_490909 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43227.1| hypothetical protein ARALYDRAFT_490909 [Arabidopsis lyrata subsp. 
lyrata]
Length=282

 Score =   121 bits (303),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +2

Query  458  TAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHN  637
            TA   AQRSVP PFL+KT+QLVDD S DDV+SWNE+G++F+VW   EFA+DLLP+YFKHN
Sbjct  2    TAVTAAQRSVPAPFLSKTYQLVDDHSTDDVVSWNEEGTAFVVWKTAEFAKDLLPQYFKHN  61

Query  638  NFSSFVRQLNTY  673
            NFSSF+RQLNTY
Sbjct  62   NFSSFIRQLNTY  73



>ref|XP_010432090.1| PREDICTED: heat stress transcription factor B-1-like [Camelina 
sativa]
Length=288

 Score =   121 bits (303),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
            AQRSVP PFL+KT+QLVDD + DDV+SWNEDG++F+VW   EFA+DLLP+YFKHNNFSSF
Sbjct  4    AQRSVPAPFLSKTYQLVDDHNTDDVVSWNEDGTAFVVWKTAEFAKDLLPQYFKHNNFSSF  63

Query  653  VRQLNTY  673
            +RQLNTY
Sbjct  64   IRQLNTY  70



>ref|XP_008241456.1| PREDICTED: heat shock factor protein HSF24 [Prunus mume]
Length=288

 Score =   121 bits (303),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
            AQRSVP PFLTKT+QLVDD S DDVISWNE G++F+VW   +FARD+LPKYFKHNNFSSF
Sbjct  2    AQRSVPAPFLTKTYQLVDDPSWDDVISWNESGTTFVVWKTVDFARDMLPKYFKHNNFSSF  61

Query  653  VRQLNTY  673
            VRQLNTY
Sbjct  62   VRQLNTY  68



>ref|XP_004300764.1| PREDICTED: heat stress transcription factor B-2b [Fragaria vesca 
subsp. vesca]
 ref|XP_011463820.1| PREDICTED: heat stress transcription factor B-2b [Fragaria vesca 
subsp. vesca]
 ref|XP_011463821.1| PREDICTED: heat stress transcription factor B-2b [Fragaria vesca 
subsp. vesca]
 ref|XP_011463822.1| PREDICTED: heat stress transcription factor B-2b [Fragaria vesca 
subsp. vesca]
 ref|XP_011463823.1| PREDICTED: heat stress transcription factor B-2b [Fragaria vesca 
subsp. vesca]
Length=355

 Score =   122 bits (306),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +2

Query  470  EAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSS  649
            E+QR++PTPFLTKT++LVDD   DD+ISW+E GS+F+VW P EFARD+LPKYFKHNNFSS
Sbjct  20   ESQRTIPTPFLTKTYELVDDPEADDMISWSEGGSTFVVWRPAEFARDILPKYFKHNNFSS  79

Query  650  FVRQLNTY  673
            FVRQLNTY
Sbjct  80   FVRQLNTY  87



>ref|XP_007202372.1| hypothetical protein PRUPE_ppa009274mg [Prunus persica]
 gb|EMJ03571.1| hypothetical protein PRUPE_ppa009274mg [Prunus persica]
Length=299

 Score =   121 bits (303),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
            AQRSVP PFLTKT+QLVDD S DDVISWNE G++F+VW   +FARD+LPKYFKHNNFSSF
Sbjct  2    AQRSVPAPFLTKTYQLVDDPSWDDVISWNESGTTFVVWKTVDFARDMLPKYFKHNNFSSF  61

Query  653  VRQLNTY  673
            VRQLNTY
Sbjct  62   VRQLNTY  68



>emb|CDY67770.1| BnaCnng56320D [Brassica napus]
Length=272

 Score =   120 bits (302),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
            AQRSVP PFL+KT+QLVDD S D V+SWNEDG++F+VW   EFA+DLLPKYFKHNNFSSF
Sbjct  4    AQRSVPAPFLSKTYQLVDDHSTDGVVSWNEDGTAFVVWETAEFAKDLLPKYFKHNNFSSF  63

Query  653  VRQLNTY  673
            +RQLNTY
Sbjct  64   IRQLNTY  70



>ref|XP_009138469.1| PREDICTED: heat stress transcription factor B-1-like [Brassica 
rapa]
Length=271

 Score =   120 bits (301),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
            AQR+VP PFL+KT+QLVDD S D V+SWNEDG++F+VW   EFA+DLLPKYFKHNNFSSF
Sbjct  4    AQRTVPAPFLSKTYQLVDDHSTDGVVSWNEDGTAFVVWETAEFAKDLLPKYFKHNNFSSF  63

Query  653  VRQLNTY  673
            +RQLNTY
Sbjct  64   IRQLNTY  70



>emb|CDY42722.1| BnaA03g53750D [Brassica napus]
Length=271

 Score =   120 bits (301),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
            AQR+VP PFL+KT+QLVDD S D V+SWNEDG++F+VW   EFA+DLLPKYFKHNNFSSF
Sbjct  4    AQRTVPAPFLSKTYQLVDDHSTDGVVSWNEDGTAFVVWETAEFAKDLLPKYFKHNNFSSF  63

Query  653  VRQLNTY  673
            +RQLNTY
Sbjct  64   IRQLNTY  70



>emb|CAN61780.1| hypothetical protein VITISV_028661 [Vitis vinifera]
Length=354

 Score =   122 bits (305),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
            AQRSVP PFLTKT+QLVDD S DDVISW+E G++F+VW   +FA+DLLP YFKHNNFSSF
Sbjct  2    AQRSVPAPFLTKTYQLVDDPSTDDVISWSESGNTFVVWKTADFAKDLLPNYFKHNNFSSF  61

Query  653  VRQLNTYVSSISPNLYGKLF  712
            VRQLNTYV  +S +L    F
Sbjct  62   VRQLNTYVRHLSSSLCSHTF  81



>ref|XP_010446698.1| PREDICTED: heat stress transcription factor B-1-like [Camelina 
sativa]
Length=289

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
            AQRSVP PFL+KT+QLVDD + DDV+SWNEDG++F+VW   EFA+DLLP+YFKHNNFSSF
Sbjct  4    AQRSVPAPFLSKTYQLVDDHNTDDVVSWNEDGTAFVVWKTAEFAKDLLPQYFKHNNFSSF  63

Query  653  VRQLNTY  673
            +RQLNTY
Sbjct  64   IRQLNTY  70



>ref|XP_010437261.1| PREDICTED: heat stress transcription factor B-1-like [Camelina 
sativa]
Length=286

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
            AQRSVP PFL+KT+QLVDD + DDV+SWNEDG++F+VW   EFA+DLLP+YFKHNNFSSF
Sbjct  4    AQRSVPAPFLSKTYQLVDDHNTDDVVSWNEDGTAFVVWKTAEFAKDLLPQYFKHNNFSSF  63

Query  653  VRQLNTY  673
            +RQLNTY
Sbjct  64   IRQLNTY  70



>ref|XP_010437260.1| PREDICTED: heat stress transcription factor B-1 [Camelina sativa]
Length=287

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
            AQRSVP PFL+KT+QLVDD + DDV+SWNEDG++F+VW   EFA+DLLP+YFKHNNFSSF
Sbjct  4    AQRSVPAPFLSKTYQLVDDHNTDDVVSWNEDGTAFVVWKTAEFAKDLLPQYFKHNNFSSF  63

Query  653  VRQLNTY  673
            +RQLNTY
Sbjct  64   IRQLNTY  70



>gb|ADL36733.1| HSF domain class transcription factor [Malus domestica]
Length=294

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
            AQRSVP PFLTKT+ LVDD S+DDVISWNE G++F+VW   +FARDLLPKYFKHNNFSSF
Sbjct  2    AQRSVPAPFLTKTYLLVDDPSLDDVISWNESGTTFVVWKTVDFARDLLPKYFKHNNFSSF  61

Query  653  VRQLNTY  673
            VRQLNTY
Sbjct  62   VRQLNTY  68



>ref|XP_008340075.1| PREDICTED: heat shock factor protein HSF24 [Malus domestica]
Length=294

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
            AQRSVP PFLTKT+ LVDD S+DDVISWNE G++F+VW   +FARDLLPKYFKHNNFSSF
Sbjct  2    AQRSVPAPFLTKTYLLVDDPSLDDVISWNESGTTFVVWKTXDFARDLLPKYFKHNNFSSF  61

Query  653  VRQLNTY  673
            VRQLNTY
Sbjct  62   VRQLNTY  68



>ref|XP_009367059.1| PREDICTED: heat shock factor protein HSF24 [Pyrus x bretschneideri]
Length=294

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
            AQRSVP PFLTKT+ LVDD S+DDVISWNE G++F+VW   +FARDLLPKYFKHNNFSSF
Sbjct  2    AQRSVPAPFLTKTYLLVDDPSLDDVISWNESGTTFVVWKTVDFARDLLPKYFKHNNFSSF  61

Query  653  VRQLNTY  673
            VRQLNTY
Sbjct  62   VRQLNTY  68



>gb|AAC31756.1| heat shock transcription factor 4 [Arabidopsis thaliana]
Length=284

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = +2

Query  458  TAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHN  637
            TA   AQRSVP PFL+KT+QLVDD   DDV+SWNE+G++F+VW   EFA+DLLP+YFKHN
Sbjct  2    TAVTAAQRSVPAPFLSKTYQLVDDHRTDDVVSWNEEGTAFVVWKTAEFAKDLLPQYFKHN  61

Query  638  NFSSFVRQLNTY  673
            NFSSF+RQLNTY
Sbjct  62   NFSSFIRQLNTY  73



>ref|XP_002982987.1| hypothetical protein SELMODRAFT_15442, partial [Selaginella moellendorffii]
 gb|EFJ15796.1| hypothetical protein SELMODRAFT_15442, partial [Selaginella moellendorffii]
Length=178

 Score =   116 bits (291),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
            + RSVP PFLTKTF LVDD S DDV+SW+EDG++FIVW P EFA+D+LP YFKHNNFSSF
Sbjct  1    SHRSVPAPFLTKTFHLVDDSSTDDVVSWSEDGTTFIVWRPPEFAKDILPNYFKHNNFSSF  60

Query  653  VRQLNTY  673
            VRQLNTY
Sbjct  61   VRQLNTY  67



>gb|KJB52055.1| hypothetical protein B456_008G244400 [Gossypium raimondii]
Length=304

 Score =   119 bits (298),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = +2

Query  446  GGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKY  625
            G   +A  ++QRS+PTPFL KT+QLVDD S+DD+ISWNEDGS+FIVW+P EFARDLLP+Y
Sbjct  4    GSTASAAADSQRSLPTPFLAKTYQLVDDPSVDDLISWNEDGSAFIVWHPAEFARDLLPRY  63

Query  626  FKHNNFSSF  652
            FKHNNFSSF
Sbjct  64   FKHNNFSSF  72



>ref|XP_006425894.1| hypothetical protein CICLE_v10026058mg [Citrus clementina]
 gb|ESR39134.1| hypothetical protein CICLE_v10026058mg [Citrus clementina]
Length=270

 Score =   119 bits (297),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
            AQRSVP PFL KT+QLVDD S DDVISWNE G++FIVW   +FA+DLLP YFKHNNFSSF
Sbjct  2    AQRSVPAPFLMKTYQLVDDPSTDDVISWNESGATFIVWKTADFAKDLLPNYFKHNNFSSF  61

Query  653  VRQLNTY  673
            VRQLNTY
Sbjct  62   VRQLNTY  68



>ref|XP_006284246.1| hypothetical protein CARUB_v10005408mg [Capsella rubella]
 gb|EOA17144.1| hypothetical protein CARUB_v10005408mg [Capsella rubella]
Length=288

 Score =   119 bits (297),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +2

Query  458  TAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHN  637
            TA   AQRSVP PFL+KT+QLVDD + DDV+SWNE+G++F+VW   EF++DLLP+YFKHN
Sbjct  2    TAVTAAQRSVPAPFLSKTYQLVDDHNTDDVVSWNEEGTAFVVWKTAEFSKDLLPQYFKHN  61

Query  638  NFSSFVRQLNTY  673
            NFSSF+RQLNTY
Sbjct  62   NFSSFIRQLNTY  73



>ref|XP_010269874.1| PREDICTED: heat shock factor protein HSF24 [Nelumbo nucifera]
Length=303

 Score =   119 bits (298),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
            A RSVP PFLTKT+QLV+D S DDVISWN++G++F+VW P +FARDLLP YFKHNNFSSF
Sbjct  2    AHRSVPAPFLTKTYQLVEDASTDDVISWNDNGTTFVVWKPADFARDLLPNYFKHNNFSSF  61

Query  653  VRQLNTY  673
            VRQLNTY
Sbjct  62   VRQLNTY  68



>ref|XP_002965510.1| hypothetical protein SELMODRAFT_25564, partial [Selaginella moellendorffii]
 gb|EFJ32930.1| hypothetical protein SELMODRAFT_25564, partial [Selaginella moellendorffii]
Length=178

 Score =   116 bits (290),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
            + RSVP PFLTKTF LVDD S DDV+SW+EDG++F+VW P EFA+D+LP YFKHNNFSSF
Sbjct  1    SHRSVPAPFLTKTFHLVDDSSTDDVVSWSEDGTTFVVWRPPEFAKDILPNYFKHNNFSSF  60

Query  653  VRQLNTY  673
            VRQLNTY
Sbjct  61   VRQLNTY  67



>ref|XP_009375707.1| PREDICTED: heat stress transcription factor B-1-like [Pyrus x 
bretschneideri]
 ref|XP_009350716.1| PREDICTED: heat stress transcription factor B-1-like [Pyrus x 
bretschneideri]
Length=295

 Score =   119 bits (297),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
            AQRSVP PFL KT+QLVDD S DDVISWNE G++F+VW   +FARD+LPKYFKHNNFSSF
Sbjct  2    AQRSVPAPFLMKTYQLVDDPSSDDVISWNESGTTFVVWKTVDFARDMLPKYFKHNNFSSF  61

Query  653  VRQLNTY  673
            VRQLNTY
Sbjct  62   VRQLNTY  68



>ref|XP_008338368.1| PREDICTED: LOW QUALITY PROTEIN: heat stress transcription factor 
B-1-like [Malus domestica]
Length=294

 Score =   118 bits (296),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
            AQRSVP PFL KT+QLVDD S DDVISWNE G++F+VW   +FARD+LPKYFKHNNFSSF
Sbjct  2    AQRSVPAPFLMKTYQLVDDPSSDDVISWNESGTTFVVWKTVDFARDMLPKYFKHNNFSSF  61

Query  653  VRQLNTY  673
            VRQLNTY
Sbjct  62   VRQLNTY  68



>gb|KHN42077.1| Heat stress transcription factor B-2c [Glycine soja]
Length=101

 Score =   113 bits (282),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +2

Query  476  QRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSFV  655
            QRSVP PFLTKT+QLV+D   D+VISW E G++F+VW   +FA+DLLPKYFKHNNFSSFV
Sbjct  4    QRSVPAPFLTKTYQLVEDPGTDEVISWGESGNTFVVWKHADFAKDLLPKYFKHNNFSSFV  63

Query  656  RQLNTYVSSIS  688
            RQLNTYV  I 
Sbjct  64   RQLNTYVCFIC  74



>ref|XP_010263545.1| PREDICTED: heat shock factor protein HSF24-like [Nelumbo nucifera]
Length=291

 Score =   118 bits (296),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
            A +SVP PFLTKTFQLV+DRS DD+ISWN++G++F+VWNP +FARDLLP YFKH+NFSSF
Sbjct  2    AHKSVPAPFLTKTFQLVEDRSTDDMISWNDNGTTFVVWNPADFARDLLPNYFKHSNFSSF  61

Query  653  VRQLNTY  673
            VRQLN Y
Sbjct  62   VRQLNIY  68



>ref|XP_010061734.1| PREDICTED: heat stress transcription factor B-4-like [Eucalyptus 
grandis]
 gb|KCW68721.1| hypothetical protein EUGRSUZ_F02327 [Eucalyptus grandis]
Length=365

 Score =   119 bits (298),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +2

Query  434  VERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDL  613
            V++ G       EAQ++VP PFLTKT+QLVDD S D ++SW +D S+F+VW P EFARDL
Sbjct  6    VDKCGEGLLVAVEAQKAVPAPFLTKTYQLVDDPSTDHIVSWGDDDSTFVVWRPPEFARDL  65

Query  614  LPKYFKHNNFSSFVRQLNTY  673
            LP YFKHNNFSSFVRQLNTY
Sbjct  66   LPNYFKHNNFSSFVRQLNTY  85



>ref|XP_006425895.1| hypothetical protein CICLE_v10026058mg [Citrus clementina]
 gb|ESR39135.1| hypothetical protein CICLE_v10026058mg [Citrus clementina]
Length=329

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
            AQRSVP PFL KT+QLVDD S DDVISWNE G++FIVW   +FA+DLLP YFKHNNFSSF
Sbjct  2    AQRSVPAPFLMKTYQLVDDPSTDDVISWNESGATFIVWKTADFAKDLLPNYFKHNNFSSF  61

Query  653  VRQLNTY  673
            VRQLNTY
Sbjct  62   VRQLNTY  68



>ref|XP_004288037.1| PREDICTED: heat shock factor protein HSF24 [Fragaria vesca subsp. 
vesca]
Length=290

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
            AQRSVP PFL KTFQLVDD + DDVISWNE G++F+VW   +FARD+LP YFKHNNFSSF
Sbjct  2    AQRSVPAPFLMKTFQLVDDPASDDVISWNESGTAFVVWKTVDFARDMLPNYFKHNNFSSF  61

Query  653  VRQLNTY  673
            VRQLNTY
Sbjct  62   VRQLNTY  68



>ref|XP_009400005.1| PREDICTED: heat stress transcription factor B-2b-like [Musa acuminata 
subsp. malaccensis]
Length=354

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 74/92 (80%), Gaps = 5/92 (5%)
 Frame = +2

Query  413  MG-PPVPPVERNGGETTAGG----EAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSF  577
            MG PP+PP      ETT+      E QR +PTPFLTKT+QLVDD S+DDV+SWNEDGS+F
Sbjct  1    MGSPPLPPASEKADETTSAAAGHPEGQRPLPTPFLTKTYQLVDDPSVDDVVSWNEDGSTF  60

Query  578  IVWNPTEFARDLLPKYFKHNNFSSFVRQLNTY  673
            +VW P EFARDLLPKYFKHNNFSSFVRQLNTY
Sbjct  61   VVWRPAEFARDLLPKYFKHNNFSSFVRQLNTY  92



>ref|XP_010550365.1| PREDICTED: heat shock factor protein HSF24-like [Tarenaya hassleriana]
Length=281

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = +2

Query  476  QRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSFV  655
            QRSVP PFL KT+QLVDD + DDV+SWNEDGS+F+VW   +F+RDLLP++FKHNNFSSFV
Sbjct  6    QRSVPAPFLVKTYQLVDDPTTDDVVSWNEDGSAFVVWKTADFSRDLLPRFFKHNNFSSFV  65

Query  656  RQLNTY  673
            RQLNTY
Sbjct  66   RQLNTY  71



>ref|XP_006466606.1| PREDICTED: heat shock factor protein HSF24-like [Citrus sinensis]
Length=270

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
            AQRSVP PFL KT+QLVDD S DDVISWNE G++FIVW   +F++DLLP YFKHNNFSSF
Sbjct  2    AQRSVPAPFLMKTYQLVDDPSTDDVISWNESGATFIVWKTADFSKDLLPNYFKHNNFSSF  61

Query  653  VRQLNTY  673
            VRQLNTY
Sbjct  62   VRQLNTY  68



>ref|XP_002277765.2| PREDICTED: heat shock factor protein HSF24 [Vitis vinifera]
 emb|CBI21429.3| unnamed protein product [Vitis vinifera]
Length=286

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
            AQRSVP PFLTKT+QLVDD S DDVISW+E G++F+VW   +FA+DLLP YFKHNNFSSF
Sbjct  2    AQRSVPAPFLTKTYQLVDDPSTDDVISWSESGNTFVVWKTADFAKDLLPNYFKHNNFSSF  61

Query  653  VRQLNTY  673
            VRQLNTY
Sbjct  62   VRQLNTY  68



>ref|XP_008440278.1| PREDICTED: LOW QUALITY PROTEIN: heat shock factor protein HSF24 
[Cucumis melo]
Length=290

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
            AQRS+P PFLTKT+QLVDD + DDV+SWN+ GS+FIVW   +FARDLLP YFKHNNFSSF
Sbjct  2    AQRSLPAPFLTKTYQLVDDPATDDVVSWNQSGSTFIVWKTADFARDLLPNYFKHNNFSSF  61

Query  653  VRQLNTY  673
            VRQLNTY
Sbjct  62   VRQLNTY  68



>ref|XP_011043547.1| PREDICTED: heat shock factor protein HSF24 [Populus euphratica]
Length=288

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
            AQRS P PFLTKT+QLVDD S DDVISWNE G++F+VW   +FA+DLLP YFKHNNFSSF
Sbjct  2    AQRSAPAPFLTKTYQLVDDPSTDDVISWNETGTTFVVWKTADFAKDLLPNYFKHNNFSSF  61

Query  653  VRQLNTY  673
            VRQLNTY
Sbjct  62   VRQLNTY  68



>ref|XP_009589845.1| PREDICTED: heat shock factor protein HSF24 [Nicotiana tomentosiformis]
Length=296

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
            +QR+VP PFLTKT+QLVDD + DDV+SWNE G++F+VW   EFA+DLLP YFKHNNFSSF
Sbjct  2    SQRTVPAPFLTKTYQLVDDATTDDVVSWNESGTTFVVWKTAEFAKDLLPTYFKHNNFSSF  61

Query  653  VRQLNTY  673
            VRQLNTY
Sbjct  62   VRQLNTY  68



>ref|XP_007047250.1| Heat shock factor 4 [Theobroma cacao]
 gb|EOX91407.1| Heat shock factor 4 [Theobroma cacao]
Length=299

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
            AQRSVP PFLTKT+QLVDD   DDVISWNE+G++F+VW   +FA+DLLP YFKHNNFSSF
Sbjct  2    AQRSVPAPFLTKTYQLVDDPITDDVISWNENGTTFVVWKTADFAKDLLPNYFKHNNFSSF  61

Query  653  VRQLNTY  673
            VRQLNTY
Sbjct  62   VRQLNTY  68



>ref|XP_012079229.1| PREDICTED: heat shock factor protein HSF24 [Jatropha curcas]
 gb|KDP31930.1| hypothetical protein JCGZ_12391 [Jatropha curcas]
Length=288

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
            AQRSVP PFLTKT+QLVDD   DDVISWNE G++F+VW   +FA+DLLP YFKHNNFSSF
Sbjct  2    AQRSVPAPFLTKTYQLVDDPITDDVISWNESGTTFVVWKTADFAKDLLPNYFKHNNFSSF  61

Query  653  VRQLNTY  673
            VRQLNTY
Sbjct  62   VRQLNTY  68



>ref|XP_009797839.1| PREDICTED: heat shock factor protein HSF24 [Nicotiana sylvestris]
Length=292

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
            +QR+VP PFLTKT+QLVDD + DDV+SWNE G++F+VW   EFA+DLLP YFKHNNFSSF
Sbjct  2    SQRTVPAPFLTKTYQLVDDATTDDVVSWNESGTTFVVWKTAEFAKDLLPTYFKHNNFSSF  61

Query  653  VRQLNTY  673
            VRQLNTY
Sbjct  62   VRQLNTY  68



>ref|XP_010093647.1| Heat shock factor protein HSF24 [Morus notabilis]
 gb|EXB54408.1| Heat shock factor protein HSF24 [Morus notabilis]
Length=406

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
            AQRSVP PFL KT+QLV+D S +DVISWNE G+SF+VW   +FARDLLPKYFKHNNFSSF
Sbjct  2    AQRSVPAPFLMKTYQLVEDPSTNDVISWNEAGTSFVVWKTADFARDLLPKYFKHNNFSSF  61

Query  653  VRQLNTY  673
            VRQLNTY
Sbjct  62   VRQLNTY  68



>ref|XP_006826240.1| PREDICTED: heat shock factor protein HSF24 [Amborella trichopoda]
 gb|ERM93477.1| hypothetical protein AMTR_s00132p00118400 [Amborella trichopoda]
Length=278

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = +2

Query  479  RSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSFVR  658
            R VP PFL+KT+QLVDD + D+V+SWNE+GS+F+VW P EFARDLLP YFKHNNFSSFVR
Sbjct  9    RQVPAPFLSKTYQLVDDPATDEVVSWNEEGSTFVVWRPAEFARDLLPNYFKHNNFSSFVR  68

Query  659  QLNTY  673
            QLNTY
Sbjct  69   QLNTY  73



>ref|XP_004141916.1| PREDICTED: heat shock factor protein HSF24 [Cucumis sativus]
 gb|KGN48523.1| hypothetical protein Csa_6G490870 [Cucumis sativus]
Length=290

 Score =   116 bits (290),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
            AQRS+P PFLTKT+QLVDD + DDV+SWN  GS+FIVW   +FARDLLP YFKHNNFSSF
Sbjct  2    AQRSLPAPFLTKTYQLVDDPATDDVVSWNPSGSTFIVWKTADFARDLLPNYFKHNNFSSF  61

Query  653  VRQLNTY  673
            VRQLNTY
Sbjct  62   VRQLNTY  68



>gb|KJB17912.1| hypothetical protein B456_003G023500 [Gossypium raimondii]
Length=295

 Score =   116 bits (290),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
            AQRSVP PFL KT+QLVDD   DDVISWNE+G+SF+VW   +FA+DLLP YFKHNNFSSF
Sbjct  2    AQRSVPAPFLIKTYQLVDDPITDDVISWNENGTSFVVWKTADFAKDLLPNYFKHNNFSSF  61

Query  653  VRQLNTY  673
            VRQLNTY
Sbjct  62   VRQLNTY  68



>gb|KHG26651.1| Heat shock factor HSF24 [Gossypium arboreum]
Length=284

 Score =   116 bits (290),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
            AQRSVP PFLTKT+QLVDD   D+VISWNE+G+SF+VW   +FA+DLLP YFKHNNFSSF
Sbjct  2    AQRSVPAPFLTKTYQLVDDPITDNVISWNENGTSFVVWKTADFAKDLLPTYFKHNNFSSF  61

Query  653  VRQLNTY  673
            +RQLNTY
Sbjct  62   IRQLNTY  68



>ref|XP_011099137.1| PREDICTED: heat shock factor protein HSF24 [Sesamum indicum]
Length=271

 Score =   115 bits (289),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
             QRSVP PFLTKT+ LVDD   DDVISWNE G++F+VW   EFA+DLLP YFKHNNFSSF
Sbjct  2    GQRSVPAPFLTKTYHLVDDPKTDDVISWNEAGTTFVVWKTAEFAKDLLPNYFKHNNFSSF  61

Query  653  VRQLNTY  673
            VRQLNTY
Sbjct  62   VRQLNTY  68



>ref|XP_002981332.1| hypothetical protein SELMODRAFT_114534 [Selaginella moellendorffii]
 gb|EFJ17520.1| hypothetical protein SELMODRAFT_114534 [Selaginella moellendorffii]
Length=320

 Score =   116 bits (291),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +2

Query  470  EAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSS  649
            ++ R VP PFLTKT+QLVDD + +D++SW EDGS+F+VW P EFARDLLP YFKHNNFSS
Sbjct  16   DSHRVVPAPFLTKTYQLVDDAASNDIVSWGEDGSTFVVWRPPEFARDLLPNYFKHNNFSS  75

Query  650  FVRQLNTY  673
            FVRQLNTY
Sbjct  76   FVRQLNTY  83



>ref|XP_002969726.1| hypothetical protein SELMODRAFT_92634 [Selaginella moellendorffii]
 gb|EFJ28850.1| hypothetical protein SELMODRAFT_92634 [Selaginella moellendorffii]
Length=319

 Score =   116 bits (291),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +2

Query  470  EAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSS  649
            ++ R VP PFLTKT+QLVDD + +D++SW EDGS+F+VW P EFARDLLP YFKHNNFSS
Sbjct  16   DSHRVVPAPFLTKTYQLVDDAASNDIVSWGEDGSTFVVWRPPEFARDLLPNYFKHNNFSS  75

Query  650  FVRQLNTY  673
            FVRQLNTY
Sbjct  76   FVRQLNTY  83



>ref|XP_010530513.1| PREDICTED: heat stress transcription factor B-4-like [Tarenaya 
hassleriana]
Length=374

 Score =   117 bits (292),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 65/84 (77%), Gaps = 4/84 (5%)
 Frame = +2

Query  434  VERNGGE----TTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEF  601
            +E  GGE     TA  EA ++VP PFLTKT+QLVDD + D ++SW +D S+F+VW P EF
Sbjct  5    MESYGGEERMVLTAETEAGKAVPAPFLTKTYQLVDDPTTDQIVSWGDDDSTFVVWRPPEF  64

Query  602  ARDLLPKYFKHNNFSSFVRQLNTY  673
            ARDLLP YFKHNNFSSFVRQLNTY
Sbjct  65   ARDLLPNYFKHNNFSSFVRQLNTY  88



>tpg|DAA63850.1| TPA: hypothetical protein ZEAMMB73_974979 [Zea mays]
Length=88

 Score =   110 bits (275),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 63/85 (74%), Gaps = 3/85 (4%)
 Frame = +2

Query  434  VERNGGETTAGGEA--QRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFAR  607
            VER  GE     E+   + VP PFLTKT+QLVDD   D ++SW +D ++F+VW P EFAR
Sbjct  5    VER-CGEMVVSMESPHAKPVPAPFLTKTYQLVDDPCTDHIVSWGDDDTTFVVWRPPEFAR  63

Query  608  DLLPKYFKHNNFSSFVRQLNTYVSS  682
            DLLP YFKHNNFSSFVRQLNTYV +
Sbjct  64   DLLPNYFKHNNFSSFVRQLNTYVRT  88



>ref|XP_006380704.1| hypothetical protein POPTR_0007s11030g, partial [Populus trichocarpa]
 gb|ERP58501.1| hypothetical protein POPTR_0007s11030g, partial [Populus trichocarpa]
Length=275

 Score =   115 bits (288),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
            AQRS P PFLTKT+QLVDD S DDVISWNE G++F+VW   +FA+DLLP YFKHNNFSSF
Sbjct  2    AQRSAPAPFLTKTYQLVDDPSTDDVISWNETGTTFVVWKTADFAKDLLPNYFKHNNFSSF  61

Query  653  VRQLNTY  673
            VRQLNTY
Sbjct  62   VRQLNTY  68



>gb|KJB71094.1| hypothetical protein B456_011G105700 [Gossypium raimondii]
Length=276

 Score =   115 bits (288),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
            AQRSVP PFLTKT+QLVDD + D+VISWNE G+SF+VW   +F++DLLP YFKHNNFSSF
Sbjct  2    AQRSVPAPFLTKTYQLVDDPNTDNVISWNESGTSFVVWKTADFSKDLLPTYFKHNNFSSF  61

Query  653  VRQLNTY  673
            VRQLNTY
Sbjct  62   VRQLNTY  68



>sp|P22335.1|HSF24_SOLPE RecName: Full=Heat shock factor protein HSF24; AltName: Full=Heat 
shock transcription factor 24; Short=HSTF 24; AltName: 
Full=Heat stress transcription factor [Solanum peruvianum]
 emb|CAA39034.1| heat stress transcription factor [Solanum peruvianum]
Length=301

 Score =   115 bits (289),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
            +QR+ P PFL KT+QLVDD + DDVISWNE G++F+VW   EFA+DLLPKYFKHNNFSSF
Sbjct  2    SQRTAPAPFLLKTYQLVDDAATDDVISWNEIGTTFVVWKTAEFAKDLLPKYFKHNNFSSF  61

Query  653  VRQLNTY  673
            VRQLNTY
Sbjct  62   VRQLNTY  68



>gb|KJB71093.1| hypothetical protein B456_011G105700 [Gossypium raimondii]
Length=284

 Score =   115 bits (288),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
            AQRSVP PFLTKT+QLVDD + D+VISWNE G+SF+VW   +F++DLLP YFKHNNFSSF
Sbjct  2    AQRSVPAPFLTKTYQLVDDPNTDNVISWNESGTSFVVWKTADFSKDLLPTYFKHNNFSSF  61

Query  653  VRQLNTY  673
            VRQLNTY
Sbjct  62   VRQLNTY  68



>ref|XP_009611319.1| PREDICTED: heat stress transcription factor B-4 [Nicotiana tomentosiformis]
Length=352

 Score =   116 bits (291),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +2

Query  470  EAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSS  649
            ++Q+SVP PFLTKT+QLVDD + D V+SW ED S+FIVW P EFARDLLP YFKHNNFSS
Sbjct  16   DSQKSVPAPFLTKTYQLVDDPTTDHVVSWGEDDSTFIVWRPPEFARDLLPNYFKHNNFSS  75

Query  650  FVRQLNTY  673
            FVRQLNTY
Sbjct  76   FVRQLNTY  83



>ref|XP_010547515.1| PREDICTED: heat shock factor protein HSF24-like [Tarenaya hassleriana]
Length=242

 Score =   114 bits (286),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
             QRSVP PFLTKT+QLVDD + DDV+SWN+DG++F+VW   +FARDLLP +FKHNNF+SF
Sbjct  5    GQRSVPAPFLTKTYQLVDDPTTDDVVSWNQDGTAFVVWKIADFARDLLPCFFKHNNFASF  64

Query  653  VRQLNTY  673
            VRQLNTY
Sbjct  65   VRQLNTY  71



>dbj|BAA83710.1| heat shock factor [Nicotiana tabacum]
Length=292

 Score =   115 bits (288),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
            +QR+VP PFLTKT+QLVDD + DDV+SWNE G++F+VW   EFA+DL+P YFKHNNFSSF
Sbjct  2    SQRTVPAPFLTKTYQLVDDATTDDVVSWNESGTTFVVWKTAEFAKDLVPTYFKHNNFSSF  61

Query  653  VRQLNTY  673
            VRQLNTY
Sbjct  62   VRQLNTY  68



>ref|XP_004232034.1| PREDICTED: heat shock factor protein HSF24 [Solanum lycopersicum]
Length=301

 Score =   115 bits (289),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
            +QR+ P PFL KT+QLVDD + DDVISWNE G++F+VW   EFA+DLLPKYFKHNNFSSF
Sbjct  2    SQRTAPAPFLLKTYQLVDDATTDDVISWNEIGTTFVVWKTAEFAKDLLPKYFKHNNFSSF  61

Query  653  VRQLNTY  673
            VRQLNTY
Sbjct  62   VRQLNTY  68



>ref|XP_006829889.1| PREDICTED: heat stress transcription factor B-4 [Amborella trichopoda]
 gb|ERM97305.1| hypothetical protein AMTR_s00073p00033500 [Amborella trichopoda]
Length=341

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +2

Query  470  EAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSS  649
            E+ +SVP PFLTKT+QLVDD S D ++SW ED S+F+VW P EFARDLLP YFKHNNFSS
Sbjct  16   ESHKSVPAPFLTKTYQLVDDPSTDHIVSWGEDHSTFVVWRPPEFARDLLPNYFKHNNFSS  75

Query  650  FVRQLNTY  673
            FVRQLNTY
Sbjct  76   FVRQLNTY  83



>emb|CDP02491.1| unnamed protein product [Coffea canephora]
Length=532

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
             QR+VP PFLTKT+QLVDD   DDVISWNE G++F+VW   EFA+DLLP YFKHNNFSSF
Sbjct  2    CQRTVPAPFLTKTYQLVDDPCSDDVISWNESGTTFVVWKTAEFAKDLLPNYFKHNNFSSF  61

Query  653  VRQLNTY  673
            VRQLNTY
Sbjct  62   VRQLNTY  68



>ref|XP_009399944.1| PREDICTED: heat stress transcription factor B-4b-like [Musa acuminata 
subsp. malaccensis]
Length=260

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 61/80 (76%), Gaps = 1/80 (1%)
 Frame = +2

Query  434  VERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDL  613
            VER  GE  A   + R VP PFLTKT+Q+VDD   D ++SW ED ++F+VW P EFARDL
Sbjct  5    VER-CGEMAASMVSHRPVPAPFLTKTYQIVDDPDTDHIVSWGEDETTFVVWRPPEFARDL  63

Query  614  LPKYFKHNNFSSFVRQLNTY  673
            LP YFKHNNFSSFVRQLNTY
Sbjct  64   LPNYFKHNNFSSFVRQLNTY  83



>gb|KJB40253.1| hypothetical protein B456_007G053900 [Gossypium raimondii]
Length=295

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = +2

Query  476  QRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSFV  655
            QR VP PFLTKT++LVDD   DDVISWNE+G+SF+VWN  +FA+DLLPKYFKH+NFSSFV
Sbjct  3    QRCVPAPFLTKTYKLVDDPITDDVISWNENGTSFVVWNIADFAKDLLPKYFKHDNFSSFV  62

Query  656  RQLNTY  673
            RQLNTY
Sbjct  63   RQLNTY  68



>gb|KHN28194.1| Heat stress transcription factor B-4 [Glycine soja]
Length=255

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +2

Query  470  EAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSS  649
            E+Q+SVP PFLTKT+QLVDD   D ++SW ED ++F+VW P EFARDLLP YFKHNNFSS
Sbjct  6    ESQKSVPAPFLTKTYQLVDDPHTDHIVSWGEDETTFVVWKPPEFARDLLPNYFKHNNFSS  65

Query  650  FVRQLNTY  673
            FVRQLNTY
Sbjct  66   FVRQLNTY  73



>gb|ERM98103.1| hypothetical protein AMTR_s00095p00016160 [Amborella trichopoda]
Length=291

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 59/75 (79%), Gaps = 0/75 (0%)
 Frame = +2

Query  449  GETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYF  628
            GE     E Q++VP PFLTKT+QLV+D   D ++SW ED +SF+VW P EFARDLLP YF
Sbjct  9    GEMLVSLENQKAVPAPFLTKTYQLVNDPCTDHIVSWGEDDTSFVVWRPPEFARDLLPNYF  68

Query  629  KHNNFSSFVRQLNTY  673
            KHNNFSSFVRQLNTY
Sbjct  69   KHNNFSSFVRQLNTY  83



>ref|XP_006658884.1| PREDICTED: heat stress transcription factor B-4b-like [Oryza 
brachyantha]
Length=261

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = +2

Query  464  GGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNF  643
            GG   + VP PFLTKT+QLVDD   D ++SW ED ++F+VW P EFARDLLP YFKHNNF
Sbjct  24   GGAPAKPVPAPFLTKTYQLVDDPCTDHIVSWGEDDATFVVWRPPEFARDLLPNYFKHNNF  83

Query  644  SSFVRQLNTY  673
            SSFVRQLNTY
Sbjct  84   SSFVRQLNTY  93



>gb|KHN36225.1| Heat shock factor protein HSF24 [Glycine soja]
Length=269

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
            +QRSVP PFLTKT+QLV+D+  D VISW E G++F+VW   +FA+DLLPKYFKHNNFSSF
Sbjct  2    SQRSVPAPFLTKTYQLVEDQGTDQVISWGESGNTFVVWKHADFAKDLLPKYFKHNNFSSF  61

Query  653  VRQLNTYVSSIS  688
            VRQLNTY +  S
Sbjct  62   VRQLNTYTNGNS  73



>ref|XP_006339901.1| PREDICTED: heat shock factor protein HSF24-like [Solanum tuberosum]
Length=302

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
            +QR+ P PFL KT+QLVDD   DDVISWNE G++F+VW   EFA+DLLPKYFKHNNFSSF
Sbjct  2    SQRTAPAPFLLKTYQLVDDAVTDDVISWNEIGTTFVVWKTAEFAKDLLPKYFKHNNFSSF  61

Query  653  VRQLNTY  673
            VRQLNTY
Sbjct  62   VRQLNTY  68



>ref|XP_008794230.1| PREDICTED: heat stress transcription factor B-4b-like [Phoenix 
dactylifera]
Length=282

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 61/80 (76%), Gaps = 1/80 (1%)
 Frame = +2

Query  434  VERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDL  613
            VER  GE     ++ + VP PFLTKT+QLVDD   D ++SW ED ++F+VW P EFARDL
Sbjct  5    VER-CGEMMVSVDSHKPVPAPFLTKTYQLVDDPCTDHIVSWGEDETTFVVWRPPEFARDL  63

Query  614  LPKYFKHNNFSSFVRQLNTY  673
            LP YFKHNNFSSFVRQLNTY
Sbjct  64   LPNYFKHNNFSSFVRQLNTY  83



>ref|XP_004511933.1| PREDICTED: heat stress transcription factor B-1-like [Cicer arietinum]
Length=285

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
            +QRSVP PFLTKT+++VDD + +DVISW+E G SF+VW   +FARDLLPKYFKHNNFSSF
Sbjct  2    SQRSVPAPFLTKTYEMVDDTATEDVISWSESGESFVVWKHADFARDLLPKYFKHNNFSSF  61

Query  653  VRQLNTY  673
            VRQLNTY
Sbjct  62   VRQLNTY  68



>ref|XP_010673780.1| PREDICTED: heat stress transcription factor B-4-like [Beta vulgaris 
subsp. vulgaris]
Length=300

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = +2

Query  467  GEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFS  646
             E+Q+SVP PFLTKT+QLVDD   D ++SW ED +SF+VW P EFARDLLP YFKHNNFS
Sbjct  37   SESQKSVPAPFLTKTYQLVDDPRTDHIVSWGEDETSFVVWRPPEFARDLLPNYFKHNNFS  96

Query  647  SFVRQLNTY  673
            SFVRQLNTY
Sbjct  97   SFVRQLNTY  105



>gb|AII99897.1| heat shock transcription factor [Gossypium hirsutum]
Length=295

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
            AQRSVP PFL KT+QLVDD   D+VISWNE+G+SF+VW   +FA+DLLP YFKHNNFSSF
Sbjct  2    AQRSVPAPFLIKTYQLVDDPITDNVISWNENGTSFVVWKTADFAKDLLPNYFKHNNFSSF  61

Query  653  VRQLNTY  673
            VRQLNTY
Sbjct  62   VRQLNTY  68



>gb|AFK42633.1| unknown [Medicago truncatula]
 gb|AFK47571.1| unknown [Medicago truncatula]
 gb|AES94709.2| heat shock transcription factor [Medicago truncatula]
Length=288

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
            +QRS P PFL KT+Q+VDD + DDVISW+E G SF+VW   +FARDLLPKYFKHNNFSSF
Sbjct  2    SQRSAPAPFLLKTYQMVDDLATDDVISWSESGESFVVWKHADFARDLLPKYFKHNNFSSF  61

Query  653  VRQLNTY  673
            VRQLNTY
Sbjct  62   VRQLNTY  68



>ref|XP_004984281.1| PREDICTED: heat stress transcription factor B-4d-like [Setaria 
italica]
Length=312

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 63/92 (68%), Gaps = 12/92 (13%)
 Frame = +2

Query  434  VERN---GGETTAG---------GEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSF  577
            VER    GGET              A+  VP PFLTKTFQLVDD   D V+SW EDGS+F
Sbjct  5    VERGSGGGGETVVSKAMEMEMMSSHAKPVVPAPFLTKTFQLVDDPRTDHVVSWGEDGSTF  64

Query  578  IVWNPTEFARDLLPKYFKHNNFSSFVRQLNTY  673
            +VW P EFARDLLP YFKHNNFSSFVRQLNTY
Sbjct  65   VVWRPPEFARDLLPNYFKHNNFSSFVRQLNTY  96



>ref|XP_010666616.1| PREDICTED: heat shock factor protein HSF24 [Beta vulgaris subsp. 
vulgaris]
Length=270

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  473  AQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSSF  652
             QRS+P PFLTKT+++VDD S +DVISW E G +F+VW   EFA+DLLPKYFKHNNFSSF
Sbjct  2    GQRSIPAPFLTKTYKMVDDESTNDVISWGEKGITFVVWKTAEFAKDLLPKYFKHNNFSSF  61

Query  653  VRQLNTY  673
            VRQLNTY
Sbjct  62   VRQLNTY  68



>ref|XP_001766517.1| predicted protein [Physcomitrella patens]
 gb|EDQ68582.1| predicted protein [Physcomitrella patens]
Length=230

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +2

Query  470  EAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSS  649
            +  RSVP PFLTKT+ LV+D + +D++SW EDG++F+VW P EFARDLLP YFKHNNFSS
Sbjct  5    DCHRSVPAPFLTKTYHLVNDPATNDIVSWGEDGTTFVVWRPPEFARDLLPNYFKHNNFSS  64

Query  650  FVRQLNTY  673
            FVRQLNTY
Sbjct  65   FVRQLNTY  72



>ref|XP_010922077.1| PREDICTED: heat stress transcription factor B-4b-like [Elaeis 
guineensis]
Length=281

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 61/80 (76%), Gaps = 1/80 (1%)
 Frame = +2

Query  434  VERNGGETTAGGEAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDL  613
            VER  GE     ++ + VP PFLTKT+QLVDD   D ++SW ED ++F+VW P EFARDL
Sbjct  5    VER-CGEMMVSVDSHKPVPAPFLTKTYQLVDDPCTDHIVSWGEDETTFVVWRPPEFARDL  63

Query  614  LPKYFKHNNFSSFVRQLNTY  673
            LP YFKHNNFSSFVRQLNTY
Sbjct  64   LPNYFKHNNFSSFVRQLNTY  83



>ref|XP_003556931.1| PREDICTED: heat stress transcription factor B-4-like [Glycine 
max]
 gb|KHN27366.1| Heat stress transcription factor B-4 [Glycine soja]
Length=271

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +2

Query  470  EAQRSVPTPFLTKTFQLVDDRSIDDVISWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSS  649
            E+Q+SVP PFLTKT+QLVDD   D ++SW ED ++F+VW P EFARDLLP YFKHNNFSS
Sbjct  17   ESQKSVPAPFLTKTYQLVDDPHTDHIVSWGEDETTFVVWRPPEFARDLLPNYFKHNNFSS  76

Query  650  FVRQLNTY  673
            FVRQLNTY
Sbjct  77   FVRQLNTY  84



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1427800438025