BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig2531

Length=857
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009803135.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    273   1e-83   Nicotiana sylvestris
ref|XP_009602562.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    272   3e-83   Nicotiana tomentosiformis
dbj|BAL14273.1|  FK506-binding protein                                  272   3e-83   Nicotiana tabacum [American tobacco]
gb|EYU39186.1|  hypothetical protein MIMGU_mgv1a003614mg                267   3e-81   Erythranthe guttata [common monkey flower]
emb|CBI41091.3|  unnamed protein product                                259   7e-81   Vitis vinifera
ref|XP_002268161.3|  PREDICTED: peptidyl-prolyl cis-trans isomera...    259   1e-80   Vitis vinifera
emb|CDP03935.1|  unnamed protein product                                265   2e-80   Coffea canephora [robusta coffee]
ref|XP_012085200.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    265   2e-80   Jatropha curcas
ref|XP_011089642.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    265   2e-80   Sesamum indicum [beniseed]
ref|XP_004242423.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    264   5e-80   
gb|ACU23964.1|  unknown                                                 251   3e-79   Glycine max [soybeans]
ref|XP_009610546.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    261   6e-79   Nicotiana tomentosiformis
ref|XP_010247135.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    261   7e-79   Nelumbo nucifera [Indian lotus]
ref|XP_007049646.1|  Rotamase FKBP 1 isoform 1                          261   9e-79   
ref|XP_009787495.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    261   1e-78   Nicotiana sylvestris
ref|XP_002535081.1|  peptidylprolyl isomerase, putative                 260   1e-78   Ricinus communis
ref|XP_002301809.1|  hypothetical protein POPTR_0002s24970g             259   3e-78   Populus trichocarpa [western balsam poplar]
ref|XP_004510236.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    259   4e-78   Cicer arietinum [garbanzo]
gb|KJB08781.1|  hypothetical protein B456_001G103400                    259   4e-78   Gossypium raimondii
ref|XP_006352668.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    259   4e-78   Solanum tuberosum [potatoes]
ref|XP_011024591.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    258   5e-78   Populus euphratica
ref|XP_010247134.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    258   6e-78   Nelumbo nucifera [Indian lotus]
ref|XP_002263566.2|  PREDICTED: peptidyl-prolyl cis-trans isomera...    258   9e-78   Vitis vinifera
ref|XP_011024590.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    258   1e-77   Populus euphratica
gb|KDO40265.1|  hypothetical protein CISIN_1g008113mg                   257   3e-77   Citrus sinensis [apfelsine]
ref|XP_010036767.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    257   3e-77   Eucalyptus grandis [rose gum]
ref|XP_006437245.1|  hypothetical protein CICLE_v10031088mg             256   4e-77   Citrus clementina [clementine]
gb|KCW48408.1|  hypothetical protein EUGRSUZ_K02110                     254   4e-77   Eucalyptus grandis [rose gum]
gb|KJB42565.1|  hypothetical protein B456_007G157600                    254   5e-77   Gossypium raimondii
ref|XP_008792944.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    256   6e-77   Phoenix dactylifera
ref|XP_010905156.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    255   2e-76   Elaeis guineensis
gb|KHG19334.1|  Peptidyl-prolyl cis-trans isomerase FKBP62 -like ...    254   2e-76   Gossypium arboreum [tree cotton]
gb|KJB42563.1|  hypothetical protein B456_007G157600                    254   3e-76   Gossypium raimondii
ref|XP_004247044.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    254   3e-76   Solanum lycopersicum
ref|XP_010036768.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    254   3e-76   Eucalyptus grandis [rose gum]
ref|XP_003626943.1|  70 kDa peptidyl-prolyl isomerase                   254   3e-76   Medicago truncatula
ref|XP_003520990.2|  PREDICTED: peptidyl-prolyl cis-trans isomera...    254   6e-76   Glycine max [soybeans]
gb|KHN44911.1|  Peptidyl-prolyl cis-trans isomerase FKBP62              254   6e-76   Glycine soja [wild soybean]
ref|XP_009371084.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    243   1e-75   
gb|AFK35673.1|  unknown                                                 253   1e-75   Medicago truncatula
ref|XP_008794657.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    253   1e-75   Phoenix dactylifera
ref|XP_002534361.1|  peptidylprolyl isomerase, putative                 253   2e-75   
ref|XP_008778813.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    249   2e-75   
ref|XP_007200299.1|  hypothetical protein PRUPE_ppa003471mg             251   7e-75   Prunus persica
ref|XP_006363450.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    247   9e-75   Solanum tuberosum [potatoes]
ref|XP_010905157.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    250   1e-74   
ref|XP_008778812.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    250   1e-74   Phoenix dactylifera
ref|XP_009372201.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    249   2e-74   Pyrus x bretschneideri [bai li]
gb|KDO40264.1|  hypothetical protein CISIN_1g008113mg                   249   2e-74   Citrus sinensis [apfelsine]
ref|XP_010647328.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    250   2e-74   
ref|XP_008244682.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    249   3e-74   Prunus mume [ume]
ref|XP_006363451.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    248   5e-74   Solanum tuberosum [potatoes]
gb|EPS61356.1|  hypothetical protein M569_13437                         243   6e-74   Genlisea aurea
gb|KJB08784.1|  hypothetical protein B456_001G103400                    247   1e-73   Gossypium raimondii
ref|XP_009420312.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    247   1e-73   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007134161.1|  hypothetical protein PHAVU_010G024500g             247   1e-73   Phaseolus vulgaris [French bean]
gb|KJB42562.1|  hypothetical protein B456_007G157600                    246   2e-73   Gossypium raimondii
ref|XP_007034164.1|  FKBP-type peptidyl-prolyl cis-trans isomeras...    246   3e-73   
ref|XP_010926682.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    246   3e-73   Elaeis guineensis
ref|XP_006840897.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    246   6e-73   Amborella trichopoda
ref|XP_009371078.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    243   6e-73   
ref|XP_010532918.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    245   7e-73   Tarenaya hassleriana [spider flower]
ref|XP_008372538.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    245   9e-73   Malus domestica [apple tree]
gb|KHN25146.1|  Peptidyl-prolyl cis-trans isomerase FKBP62              242   1e-72   Glycine soja [wild soybean]
gb|KDO40263.1|  hypothetical protein CISIN_1g008113mg                   245   1e-72   Citrus sinensis [apfelsine]
ref|XP_011622061.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    245   1e-72   Amborella trichopoda
ref|XP_006437244.1|  hypothetical protein CICLE_v10031088mg             243   3e-72   
ref|XP_009406340.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    244   4e-72   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007034162.1|  FKBP-type peptidyl-prolyl cis-trans isomeras...    244   5e-72   
gb|KDO40262.1|  hypothetical protein CISIN_1g008113mg                   243   8e-72   Citrus sinensis [apfelsine]
gb|KDO40266.1|  hypothetical protein CISIN_1g008113mg                   242   9e-72   Citrus sinensis [apfelsine]
ref|XP_008382577.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    242   9e-72   
ref|XP_009410619.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    242   1e-71   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010466944.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    242   1e-71   Camelina sativa [gold-of-pleasure]
ref|XP_009385667.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    242   2e-71   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006418643.1|  hypothetical protein EUTSA_v10002468mg             241   2e-71   Eutrema salsugineum [saltwater cress]
ref|XP_010488634.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    241   2e-71   Camelina sativa [gold-of-pleasure]
ref|XP_010514063.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    241   2e-71   Camelina sativa [gold-of-pleasure]
ref|XP_011651108.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    241   2e-71   Cucumis sativus [cucumbers]
ref|XP_009373610.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    241   3e-71   Pyrus x bretschneideri [bai li]
ref|XP_008352304.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    241   3e-71   Malus domestica [apple tree]
ref|XP_004149324.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    241   3e-71   Cucumis sativus [cucumbers]
ref|XP_009349114.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    241   4e-71   Pyrus x bretschneideri [bai li]
ref|XP_008439052.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    240   8e-71   Cucumis melo [Oriental melon]
emb|CDP15134.1|  unnamed protein product                                240   8e-71   Coffea canephora [robusta coffee]
ref|XP_010550903.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    239   1e-70   Tarenaya hassleriana [spider flower]
ref|XP_009136108.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    239   1e-70   Brassica rapa
ref|XP_006358774.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    239   1e-70   Solanum tuberosum [potatoes]
sp|Q43207.1|FKB70_WHEAT  RecName: Full=70 kDa peptidyl-prolyl iso...    239   1e-70   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010685108.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    238   2e-70   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008458076.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    238   2e-70   Cucumis melo [Oriental melon]
ref|XP_010100792.1|  Peptidyl-prolyl cis-trans isomerase FKBP62         238   2e-70   
gb|KJB42559.1|  hypothetical protein B456_007G157600                    239   2e-70   Gossypium raimondii
ref|NP_189160.3|  rotamase FKBP 1                                       238   3e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004504386.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    238   4e-70   Cicer arietinum [garbanzo]
ref|XP_006492988.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...    238   5e-70   
ref|XP_008222791.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    238   5e-70   Prunus mume [ume]
gb|AAB82061.1|  rof1                                                    237   6e-70   Arabidopsis thaliana [mouse-ear cress]
emb|CDY52281.1|  BnaA03g57740D                                          237   6e-70   Brassica napus [oilseed rape]
ref|XP_002321107.2|  hypothetical protein POPTR_0014s14690g             238   8e-70   
ref|XP_004290160.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    237   1e-69   Fragaria vesca subsp. vesca
ref|XP_002883594.1|  peptidylprolyl isomerase                           236   1e-69   
ref|XP_007222365.1|  hypothetical protein PRUPE_ppa003399mg             237   1e-69   Prunus persica
dbj|BAB02082.1|  peptidylprolyl isomerase; FK506-binding protein        236   1e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007034163.1|  FKBP-type peptidyl-prolyl cis-trans isomeras...    238   1e-69   
gb|KEH20636.1|  peptidyl-prolyl cis-trans isomerase FKBP62-like p...    237   1e-69   Medicago truncatula
ref|NP_001149790.1|  LOC100283417                                       236   2e-69   Zea mays [maize]
gb|AIU40165.1|  peptidyl-prolyl cis-trans isomerase                     233   2e-69   Triticum aestivum [Canadian hard winter wheat]
emb|CDY15103.1|  BnaC03g44640D                                          236   2e-69   Brassica napus [oilseed rape]
tpg|DAA48152.1|  TPA: hypothetical protein ZEAMMB73_593378              236   3e-69   
ref|NP_001062292.1|  Os08g0525600                                       236   3e-69   
ref|XP_007153782.1|  hypothetical protein PHAVU_003G064500g             236   4e-69   Phaseolus vulgaris [French bean]
ref|XP_011000006.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    236   4e-69   Populus euphratica
gb|EYU40640.1|  hypothetical protein MIMGU_mgv1a003616mg                235   5e-69   Erythranthe guttata [common monkey flower]
ref|XP_003524915.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    235   5e-69   Glycine max [soybeans]
ref|NP_001118695.1|  rotamase FKBP 1                                    234   8e-69   Arabidopsis thaliana [mouse-ear cress]
dbj|BAK02378.1|  predicted protein                                      234   8e-69   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004504385.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    234   1e-68   
ref|XP_004973965.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    234   1e-68   
ref|XP_006659596.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    234   1e-68   Oryza brachyantha
gb|KJB42564.1|  hypothetical protein B456_007G157600                    233   2e-68   Gossypium raimondii
gb|KHN10949.1|  Peptidyl-prolyl cis-trans isomerase FKBP62              233   2e-68   Glycine soja [wild soybean]
ref|XP_003574798.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase        233   2e-68   Brachypodium distachyon [annual false brome]
ref|NP_199668.1|  peptidyl-prolyl cis-trans isomerase FKBP65            233   3e-68   Arabidopsis thaliana [mouse-ear cress]
dbj|BAE99990.1|  peptidylprolyl isomerase                               233   3e-68   Arabidopsis thaliana [mouse-ear cress]
gb|KJB08782.1|  hypothetical protein B456_001G103400                    231   4e-68   Gossypium raimondii
gb|AGT17361.1|  peptidylprolyl isomerase                                233   4e-68   Saccharum hybrid cultivar R570
ref|XP_012078436.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    233   4e-68   Jatropha curcas
ref|XP_004247908.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    232   1e-67   
ref|XP_010547132.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    231   2e-67   Tarenaya hassleriana [spider flower]
gb|EEC83911.1|  hypothetical protein OsI_29964                          231   2e-67   Oryza sativa Indica Group [Indian rice]
ref|NP_001052535.1|  Os04g0352400                                       231   3e-67   
ref|XP_003532733.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    230   4e-67   Glycine max [soybeans]
gb|EMT24309.1|  70 kDa peptidyl-prolyl isomerase                        231   5e-67   
gb|KHN12365.1|  Peptidyl-prolyl cis-trans isomerase FKBP65              230   6e-67   Glycine soja [wild soybean]
tpg|DAA48154.1|  TPA: hypothetical protein ZEAMMB73_593378              220   7e-67   
gb|ABK24451.1|  unknown                                                 229   7e-67   Picea sitchensis
ref|XP_002865651.1|  hypothetical protein ARALYDRAFT_494919             228   2e-66   
gb|ABK95085.1|  unknown                                                 229   2e-66   Populus trichocarpa [western balsam poplar]
ref|XP_003547780.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    228   2e-66   Glycine max [soybeans]
ref|XP_006375512.1|  hypothetical protein POPTR_0014s14690g             229   3e-66   
gb|AFK48238.1|  unknown                                                 228   3e-66   Lotus japonicus
ref|XP_004296967.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    228   3e-66   Fragaria vesca subsp. vesca
ref|XP_006395163.1|  hypothetical protein EUTSA_v10003906mg             228   3e-66   Eutrema salsugineum [saltwater cress]
dbj|BAK01956.1|  predicted protein                                      228   3e-66   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011000005.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    228   4e-66   Populus euphratica
gb|EMS57053.1|  70 kDa peptidyl-prolyl isomerase                        228   5e-66   Triticum urartu
ref|XP_003552100.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    226   6e-66   Glycine max [soybeans]
ref|XP_006652190.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    227   6e-66   
ref|XP_007140683.1|  hypothetical protein PHAVU_008G133100g             226   8e-66   Phaseolus vulgaris [French bean]
ref|XP_004975324.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    226   2e-65   Setaria italica
emb|CAA68913.1|  peptidylprolyl isomerase                               225   3e-65   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010023594.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    225   6e-65   Eucalyptus grandis [rose gum]
ref|XP_008669632.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    224   6e-65   Zea mays [maize]
ref|XP_007034165.1|  FKBP-type peptidyl-prolyl cis-trans isomeras...    223   2e-64   
gb|EMT25795.1|  70 kDa peptidyl-prolyl isomerase                        223   2e-64   
gb|KHF97531.1|  Peptidyl-prolyl cis-trans isomerase FKBP65 -like ...    223   3e-64   Gossypium arboreum [tree cotton]
emb|CDX86295.1|  BnaA06g30120D                                          222   6e-64   
gb|KJB37901.1|  hypothetical protein B456_006G225400                    222   6e-64   Gossypium raimondii
ref|XP_004492269.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    221   6e-64   Cicer arietinum [garbanzo]
ref|XP_010023593.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    222   9e-64   Eucalyptus grandis [rose gum]
ref|XP_002436973.1|  hypothetical protein SORBIDRAFT_10g012970          221   1e-63   Sorghum bicolor [broomcorn]
gb|KEH22557.1|  FKBP-type peptidyl-prolyl cis-trans isomerase           220   1e-63   Medicago truncatula
ref|XP_003579568.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    221   2e-63   Brachypodium distachyon [annual false brome]
ref|XP_009151655.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    220   3e-63   Brassica rapa
ref|XP_011084142.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    221   7e-63   Sesamum indicum [beniseed]
ref|XP_004975323.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    220   2e-62   
gb|KJB28026.1|  hypothetical protein B456_005G022600                    216   3e-62   Gossypium raimondii
gb|KJB37905.1|  hypothetical protein B456_006G225400                    217   3e-62   Gossypium raimondii
ref|XP_006280236.1|  hypothetical protein CARUB_v10026151mg             216   9e-62   Capsella rubella
ref|XP_010442282.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    214   4e-61   
ref|XP_010482107.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    214   7e-61   Camelina sativa [gold-of-pleasure]
ref|XP_004952509.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    215   7e-61   Setaria italica
ref|XP_002453845.1|  hypothetical protein SORBIDRAFT_04g019590          214   2e-60   Sorghum bicolor [broomcorn]
ref|XP_010493687.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    212   4e-60   Camelina sativa [gold-of-pleasure]
ref|XP_002977259.1|  hypothetical protein SELMODRAFT_443450             210   1e-59   Selaginella moellendorffii
gb|AFW71473.2|  peptidyl-prolyl isomerase                               211   2e-59   
gb|ACN30883.1|  unknown                                                 211   5e-59   Zea mays [maize]
ref|NP_001151484.1|  LOC100285117                                       211   5e-59   Zea mays [maize]
emb|CDX85348.1|  BnaC07g26590D                                          207   1e-58   
ref|XP_001769063.1|  predicted protein                                  207   3e-58   
gb|KJB71963.1|  hypothetical protein B456_011G150600                    206   8e-58   Gossypium raimondii
gb|KHG01160.1|  Peptidyl-prolyl cis-trans isomerase FKBP65 -like ...    206   1e-57   Gossypium arboreum [tree cotton]
gb|KJB37904.1|  hypothetical protein B456_006G225400                    204   2e-57   Gossypium raimondii
ref|XP_002992143.1|  hypothetical protein SELMODRAFT_134839             205   2e-57   
gb|EEC73201.1|  hypothetical protein OsI_07270                          204   3e-57   Oryza sativa Indica Group [Indian rice]
gb|KJB71964.1|  hypothetical protein B456_011G150600                    204   4e-57   Gossypium raimondii
gb|EEE57017.1|  hypothetical protein OsJ_06790                          203   7e-57   Oryza sativa Japonica Group [Japonica rice]
gb|EMT19050.1|  70 kDa peptidyl-prolyl isomerase                        204   7e-57   
ref|NP_001046873.1|  Os02g0491400                                       203   2e-56   
ref|XP_002988507.1|  hypothetical protein SELMODRAFT_183937             199   1e-55   
ref|XP_002979133.1|  hypothetical protein SELMODRAFT_110584             199   1e-55   
ref|XP_006647293.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    199   2e-55   
ref|XP_003574982.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    198   1e-54   Brachypodium distachyon [annual false brome]
gb|KHN03897.1|  Peptidyl-prolyl cis-trans isomerase FKBP62              182   2e-53   Glycine soja [wild soybean]
gb|EMS49100.1|  70 kDa peptidyl-prolyl isomerase                        187   1e-50   Triticum urartu
dbj|BAJ95453.1|  predicted protein                                      186   4e-50   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010552023.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    181   6e-49   Tarenaya hassleriana [spider flower]
ref|XP_006857116.2|  PREDICTED: peptidyl-prolyl cis-trans isomera...    181   1e-48   Amborella trichopoda
gb|ERN18583.1|  hypothetical protein AMTR_s00065p00132670               181   1e-48   Amborella trichopoda
gb|KDO57438.1|  hypothetical protein CISIN_1g028428mg                   167   6e-47   Citrus sinensis [apfelsine]
gb|KDO52833.1|  hypothetical protein CISIN_1g036950mg                   172   3e-46   Citrus sinensis [apfelsine]
ref|XP_003544491.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    173   6e-46   Glycine max [soybeans]
ref|XP_007018460.1|  FKBP-type peptidyl-prolyl cis-trans isomeras...    172   2e-45   
ref|XP_006433656.1|  hypothetical protein CICLE_v10003372mg             171   6e-45   Citrus clementina [clementine]
gb|KEH40013.1|  FKBP-type peptidyl-prolyl cis-trans isomerase           166   7e-45   Medicago truncatula
ref|XP_009613899.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    166   8e-45   Nicotiana tomentosiformis
ref|XP_006472323.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    170   9e-45   Citrus sinensis [apfelsine]
ref|XP_006430496.1|  hypothetical protein CICLE_v10011447mg             169   1e-44   
ref|XP_010553661.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase ...    166   1e-44   Tarenaya hassleriana [spider flower]
gb|KEH40012.1|  FKBP-type peptidyl-prolyl cis-trans isomerase           166   1e-44   Medicago truncatula
ref|XP_009764363.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    166   1e-44   Nicotiana sylvestris
ref|XP_010273186.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    166   3e-44   Nelumbo nucifera [Indian lotus]
gb|KEH40011.1|  FKBP-type peptidyl-prolyl cis-trans isomerase           166   3e-44   Medicago truncatula
ref|XP_002510075.1|  peptidylprolyl isomerase, putative                 169   3e-44   Ricinus communis
ref|XP_010244430.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    168   3e-44   Nelumbo nucifera [Indian lotus]
ref|XP_006482027.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    168   4e-44   Citrus sinensis [apfelsine]
ref|XP_010653645.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    167   4e-44   Vitis vinifera
gb|KEH40010.1|  FKBP-type peptidyl-prolyl cis-trans isomerase           166   5e-44   Medicago truncatula
ref|XP_007162035.1|  hypothetical protein PHAVU_001G118200g             168   7e-44   Phaseolus vulgaris [French bean]
gb|KEH40009.1|  FKBP-type peptidyl-prolyl cis-trans isomerase           167   8e-44   Medicago truncatula
gb|KEH40014.1|  FKBP-type peptidyl-prolyl cis-trans isomerase           167   1e-43   Medicago truncatula
gb|AES59301.2|  FKBP-type peptidyl-prolyl cis-trans isomerase           167   1e-43   Medicago truncatula
ref|XP_003589050.1|  70 kDa peptidyl-prolyl isomerase                   167   2e-43   
ref|XP_010553659.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase ...    166   3e-43   Tarenaya hassleriana [spider flower]
ref|XP_009613898.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    166   3e-43   Nicotiana tomentosiformis
gb|KHG02788.1|  Peptidyl-prolyl cis-trans isomerase FKBP65 -like ...    166   3e-43   Gossypium arboreum [tree cotton]
ref|XP_010273182.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    166   3e-43   Nelumbo nucifera [Indian lotus]
ref|XP_009613897.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    166   4e-43   Nicotiana tomentosiformis
ref|XP_009764360.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    166   4e-43   Nicotiana sylvestris
ref|XP_002863790.1|  hypothetical protein ARALYDRAFT_917529             161   4e-43   
ref|XP_003550301.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    166   4e-43   Glycine max [soybeans]
ref|XP_009764362.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    165   4e-43   Nicotiana sylvestris
gb|KHN36977.1|  Peptidyl-prolyl cis-trans isomerase FKBP62              166   4e-43   Glycine soja [wild soybean]
ref|XP_010061642.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    165   8e-43   Eucalyptus grandis [rose gum]
ref|XP_006380967.1|  hypothetical protein POPTR_0006s03190g             164   1e-42   
ref|XP_010936157.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    163   3e-42   Elaeis guineensis
ref|XP_009360953.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    162   4e-42   Pyrus x bretschneideri [bai li]
ref|XP_012068192.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    161   6e-42   Jatropha curcas
ref|XP_012068191.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    162   6e-42   Jatropha curcas
ref|XP_011017099.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    162   8e-42   Populus euphratica
gb|KDO81465.1|  hypothetical protein CISIN_1g0137551mg                  154   8e-42   Citrus sinensis [apfelsine]
gb|KDO81464.1|  hypothetical protein CISIN_1g0137551mg                  154   9e-42   Citrus sinensis [apfelsine]
ref|XP_011013750.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    162   9e-42   Populus euphratica
ref|XP_012068190.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    162   9e-42   Jatropha curcas
ref|XP_011040722.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    160   1e-41   Populus euphratica
ref|XP_006576767.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    160   1e-41   Glycine max [soybeans]
ref|XP_004981889.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    158   1e-41   Setaria italica
ref|XP_003520475.2|  PREDICTED: peptidyl-prolyl cis-trans isomera...    160   1e-41   Glycine max [soybeans]
emb|CDP01264.1|  unnamed protein product                                161   2e-41   Coffea canephora [robusta coffee]
ref|XP_011040721.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    160   2e-41   Populus euphratica
ref|XP_004493326.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    160   2e-41   Cicer arietinum [garbanzo]
ref|XP_001771977.1|  predicted protein                                  160   2e-41   
ref|XP_002302401.1|  peptidyl-prolyl cis-trans isomerase FKBP-typ...    160   2e-41   
ref|XP_007221858.1|  hypothetical protein PRUPE_ppa019344mg             160   2e-41   Prunus persica
ref|XP_010096077.1|  Peptidyl-prolyl cis-trans isomerase FKBP65         160   3e-41   Morus notabilis
gb|AFK48961.1|  unknown                                                 159   3e-41   Medicago truncatula
ref|XP_008393705.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    160   4e-41   
gb|ACJ85592.1|  unknown                                                 159   4e-41   Medicago truncatula
ref|XP_008220384.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    159   4e-41   Prunus mume [ume]
gb|KDO57440.1|  hypothetical protein CISIN_1g028428mg                   150   7e-41   Citrus sinensis [apfelsine]
gb|KJB58679.1|  hypothetical protein B456_009G2211002                   152   8e-41   Gossypium raimondii
ref|XP_002283423.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase        159   9e-41   Vitis vinifera
ref|XP_010090815.1|  Peptidyl-prolyl cis-trans isomerase FKBP65         159   1e-40   Morus notabilis
ref|XP_010249734.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    157   2e-40   Nelumbo nucifera [Indian lotus]
ref|XP_012087707.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    157   3e-40   Jatropha curcas
ref|XP_008790247.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    157   6e-40   Phoenix dactylifera
ref|XP_010673091.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    156   7e-40   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009613900.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    148   8e-40   Nicotiana tomentosiformis
ref|XP_011013751.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    149   2e-39   Populus euphratica
gb|KDO40268.1|  hypothetical protein CISIN_1g008113mg                   154   2e-39   Citrus sinensis [apfelsine]
ref|XP_007049647.1|  Rotamase FKBP 1 isoform 2                          154   2e-39   
ref|XP_009596525.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    155   2e-39   Nicotiana tomentosiformis
ref|XP_007160928.1|  hypothetical protein PHAVU_001G029000g             154   3e-39   Phaseolus vulgaris [French bean]
tpg|DAA48153.1|  TPA: hypothetical protein ZEAMMB73_593378              153   6e-39   
gb|KCW44143.1|  hypothetical protein EUGRSUZ_L02444                     148   7e-39   Eucalyptus grandis [rose gum]
gb|KDO40267.1|  hypothetical protein CISIN_1g008113mg                   152   8e-39   Citrus sinensis [apfelsine]
ref|XP_009764949.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    153   8e-39   Nicotiana sylvestris
ref|XP_002526205.1|  peptidylprolyl isomerase, putative                 153   8e-39   
ref|XP_009596524.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    152   1e-38   
ref|XP_006302078.1|  hypothetical protein CARUB_v10020064mg             152   3e-38   
gb|KCW44141.1|  hypothetical protein EUGRSUZ_L02444                     148   3e-38   
ref|XP_010041714.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    148   4e-38   
ref|XP_011079092.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    151   4e-38   
ref|XP_009764945.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    150   6e-38   
ref|XP_010320295.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    147   8e-38   
ref|XP_006297572.1|  hypothetical protein CARUB_v10013595mg             149   8e-38   
ref|XP_006356849.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    150   9e-38   
ref|XP_010327743.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    150   1e-37   
ref|XP_010327744.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    149   1e-37   
ref|XP_009412296.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    150   1e-37   
ref|XP_002982601.1|  hypothetical protein SELMODRAFT_445274             149   2e-37   
ref|XP_002993334.1|  hypothetical protein SELMODRAFT_449100             149   3e-37   
ref|XP_010038854.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    149   3e-37   
ref|XP_012068193.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    141   6e-37   
ref|XP_002888213.1|  hypothetical protein ARALYDRAFT_338459             147   7e-37   
gb|EYU20825.1|  hypothetical protein MIMGU_mgv1a004220mg                147   7e-37   
ref|XP_004238080.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    147   2e-36   
ref|XP_011074340.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    145   6e-36   
gb|KDO36019.1|  hypothetical protein CISIN_1g046569mg                   137   2e-35   
ref|XP_006364803.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    141   9e-35   
ref|XP_011074339.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    140   4e-34   
ref|XP_010513402.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    140   5e-34   
emb|CDY00831.1|  BnaCnng00310D                                          128   3e-32   
ref|XP_006392291.1|  hypothetical protein EUTSA_v10024088mg             133   9e-32   
ref|NP_176141.1|  tetratricopeptide repeat 6                            125   2e-31   
gb|EPQ14397.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               129   1e-30   
ref|XP_005845726.1|  hypothetical protein CHLNCDRAFT_36304              130   1e-30   
ref|XP_008141950.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    129   1e-30   
ref|XP_005877096.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    129   2e-30   
ref|XP_006096160.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    129   2e-30   
ref|XP_007440166.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    127   4e-30   
ref|XP_005334048.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    127   5e-30   
ref|XP_006763604.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    127   7e-30   
gb|KFP49126.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               124   8e-30   
gb|EOB07103.1|  FK506-binding protein 4                                 126   8e-30   
ref|XP_005365346.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    126   1e-29   
pdb|1QZ2|A  Chain A, Crystal Structure Of Fkbp52 C-Terminal Domai...    124   2e-29   
ref|XP_005365347.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    125   3e-29   
ref|XP_009560748.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    125   3e-29   
ref|XP_005011717.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    125   3e-29   
gb|EFB25203.1|  hypothetical protein PANDA_002014                       125   3e-29   
ref|XP_002914155.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    125   4e-29   
ref|XP_008703128.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    125   4e-29   
gb|KFO77342.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               124   4e-29   
ref|XP_005387173.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    124   5e-29   
ref|XP_005610895.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    124   5e-29   
ref|XP_534923.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase ...    124   5e-29   
ref|XP_009703270.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    124   6e-29   
ref|XP_007092905.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...    124   6e-29   
ref|XP_006069092.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    124   6e-29   
ref|XP_009680598.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    124   6e-29   
gb|EHA99829.1|  FK506-binding protein 4                                 124   7e-29   
ref|XP_009422901.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    124   7e-29   
ref|XP_008109533.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    124   7e-29   
dbj|BAG36639.1|  unnamed protein product                                124   8e-29   
ref|XP_004610652.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    124   8e-29   
ref|XP_011519231.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    124   8e-29   
gb|KGL87283.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               124   8e-29   
ref|XP_001366229.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    124   8e-29   
ref|XP_005531080.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    124   8e-29   
ref|XP_009892410.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    124   8e-29   
gb|KFP34719.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               121   8e-29   
ref|NP_002005.1|  peptidyl-prolyl cis-trans isomerase FKBP4             124   8e-29   
ref|XP_011282040.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    124   8e-29   
ref|XP_004879626.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...    124   8e-29   
gb|AAX41123.1|  FK506 binding protein 4 59kDa                           124   9e-29   
ref|XP_003820401.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    124   9e-29   
ref|XP_006035185.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    124   9e-29   
gb|KFW78621.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               124   9e-29   
ref|XP_010139640.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    122   9e-29   
gb|KFO92954.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               122   9e-29   
gb|AAX29352.1|  FK506 binding protein 4                                 124   9e-29   
gb|KFV06541.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               123   9e-29   
ref|XP_508927.3|  PREDICTED: peptidyl-prolyl cis-trans isomerase ...    124   9e-29   
ref|XP_006265443.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    124   9e-29   
ref|XP_009990165.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    123   1e-28   
ref|XP_004778376.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    124   1e-28   
ref|XP_004869380.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    124   1e-28   
ref|XP_008919368.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    123   1e-28   
ref|XP_004668755.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    123   1e-28   
ref|XP_005084139.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    123   1e-28   
gb|KFP59742.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               123   1e-28   
ref|XP_004412005.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    123   1e-28   
ref|XP_005234451.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    123   1e-28   
ref|XP_006035184.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    123   1e-28   
gb|KFO05587.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               123   1e-28   
ref|XP_005150294.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    123   1e-28   
gb|EGV98481.1|  FK506-binding protein 4                                 123   1e-28   
ref|XP_002822814.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    123   2e-28   
gb|KGL77142.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               123   2e-28   
ref|XP_010304529.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    122   2e-28   
gb|KFR13332.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               123   2e-28   
gb|KFQ78136.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               123   2e-28   
ref|XP_010212783.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    122   2e-28   
ref|XP_009936154.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    122   2e-28   
ref|NP_001006250.1|  peptidyl-prolyl cis-trans isomerase FKBP4          123   2e-28   
ref|XP_010609847.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    123   2e-28   
ref|XP_004692603.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    122   2e-28   
ref|XP_010171761.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    122   2e-28   
ref|XP_009964273.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    122   2e-28   
gb|KFZ45558.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               122   2e-28   
ref|XP_009081721.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    122   2e-28   
ref|XP_004778377.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    123   2e-28   
ref|XP_004093054.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...    123   2e-28   
ref|XP_010117852.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    121   2e-28   
gb|KFO20215.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               123   2e-28   
gb|KFQ97847.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               122   2e-28   
ref|XP_005681093.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    122   2e-28   
gb|KFP72921.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               122   2e-28   
ref|XP_004438822.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    122   2e-28   
ref|XP_009464457.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    122   2e-28   
tpg|DAA29159.1|  TPA: peptidyl-prolyl cis-trans isomerase FKBP4         122   2e-28   
ref|XP_005907269.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    122   2e-28   
gb|ELR47986.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               122   3e-28   
ref|XP_010843315.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    122   3e-28   
ref|XP_007644424.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    122   3e-28   
ref|NP_001029494.1|  peptidyl-prolyl cis-trans isomerase FKBP4          122   3e-28   
ref|XP_012030959.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    122   3e-28   
gb|KFZ50188.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               122   3e-28   
ref|XP_010189777.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    122   3e-28   
gb|KFQ25475.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               122   3e-28   
gb|KFP94050.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               122   3e-28   
gb|AAM95632.1|  FK506 binding protein 4                                 122   3e-28   
ref|XP_011995934.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    122   3e-28   
gb|KFV49772.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               122   3e-28   
gb|KFQ42493.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               122   3e-28   
ref|XP_009916054.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    122   3e-28   
ref|XP_006987917.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    122   3e-28   
ref|XP_007627247.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    122   3e-28   
ref|XP_010573701.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    122   3e-28   
ref|XP_006265444.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    122   3e-28   
ref|XP_006035186.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    122   3e-28   
ref|NP_001178792.1|  peptidyl-prolyl cis-trans isomerase FKBP4          122   4e-28   
ref|XP_009807990.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    122   4e-28   
gb|KFV51946.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               122   4e-28   
ref|XP_009571977.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    122   4e-28   
gb|KFV90459.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               122   4e-28   
ref|XP_005955715.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    122   4e-28   
gb|KFV85108.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               121   4e-28   
ref|XP_010012633.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    121   4e-28   
ref|XP_010111217.1|  Peptidyl-prolyl cis-trans isomerase FKBP65         122   5e-28   
ref|NP_001182266.1|  peptidyl-prolyl cis-trans isomerase FKBP4          121   5e-28   
ref|XP_004052566.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    123   6e-28   
gb|KFV00236.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               121   6e-28   
ref|XP_010936158.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    122   6e-28   
ref|XP_006210886.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    121   6e-28   
ref|XP_010078563.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    121   7e-28   
ref|XP_003202649.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    121   7e-28   
ref|XP_010002427.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    120   8e-28   
ref|XP_001694809.1|  peptidyl-prolyl cis-trans isomerase, FKBP-type     122   9e-28   
gb|KFQ08028.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               120   9e-28   
ref|XP_009946194.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    120   9e-28   
gb|EMC82566.1|  FK506-binding protein 4                                 120   9e-28   
gb|KFQ25177.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               120   9e-28   
ref|XP_005509839.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    120   9e-28   
ref|XP_008933605.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    120   1e-27   
gb|KFU94539.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               120   1e-27   
ref|XP_010195865.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    119   1e-27   
gb|KFP29961.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               119   1e-27   
pdb|1P5Q|A  Chain A, Crystal Structure Of Fkbp52 C-Terminal Domain      119   1e-27   
ref|XP_006751438.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    120   1e-27   
gb|KFQ53636.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               120   1e-27   
ref|XP_009485459.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    120   1e-27   
gb|KFQ71375.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               120   2e-27   
gb|KFM02789.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               120   2e-27   
gb|KFP18432.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               120   2e-27   
gb|KFV91238.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               119   2e-27   
ref|XP_010144910.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    119   2e-27   
ref|XP_010280642.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    120   2e-27   
ref|XP_009640029.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    120   2e-27   
ref|XP_009289200.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    120   2e-27   
gb|KFP75101.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               119   2e-27   
ref|XP_009865281.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    119   2e-27   
gb|KFW73921.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               119   3e-27   
gb|AAH03447.1|  FK506 binding protein 4                                 119   3e-27   
ref|XP_010994731.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    119   3e-27   
gb|KFW71250.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               119   3e-27   
ref|XP_009328147.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    119   3e-27   
ref|XP_009513298.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    119   3e-27   
ref|XP_010962797.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    119   3e-27   
pir||S14538  transition protein - mouse                                 119   3e-27
ref|XP_009916053.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    119   3e-27   
ref|XP_010573703.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    119   4e-27   
ref|XP_004279047.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    119   4e-27   
ref|XP_004314450.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    119   4e-27   
ref|XP_009894963.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    119   4e-27   
gb|KFV64423.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               119   4e-27   
emb|CAC39452.1|  immunophilin FKBP-52                                   119   5e-27   
gb|EDK99886.1|  FK506 binding protein 4, isoform CRA_a                  118   6e-27   
ref|NP_034349.1|  peptidyl-prolyl cis-trans isomerase FKBP4             118   6e-27   
ref|XP_007170298.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    118   7e-27   
emb|CAA34914.1|  unknown protein                                        119   7e-27   
ref|XP_004456251.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    118   7e-27   
gb|ETE59333.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               117   7e-27   
gb|KFP08072.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               118   8e-27   
ref|XP_004314451.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    118   8e-27   
ref|XP_007117127.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    118   8e-27   
ref|XP_007526327.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    118   9e-27   
ref|XP_004381245.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    118   9e-27   
ref|XP_002947775.1|  hypothetical protein VOLCADRAFT_103560             119   9e-27   
ref|XP_008501444.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    117   1e-26   
ref|XP_006179007.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    119   1e-26   
ref|XP_006862758.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    117   1e-26   
gb|KDP24694.1|  hypothetical protein JCGZ_26469                         117   1e-26   
ref|XP_006862759.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    117   1e-26   
dbj|BAE35690.1|  unnamed protein product                                117   2e-26   
ref|XP_006923924.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    117   2e-26   
ref|XP_004710535.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    117   2e-26   
ref|XP_011366147.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    116   3e-26   
gb|ELK02594.1|  FK506-binding protein 4                                 116   4e-26   
ref|XP_007469524.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    116   4e-26   
ref|XP_007469523.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    116   4e-26   
ref|XP_006004522.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    115   5e-26   
ref|XP_007055741.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...    115   5e-26   
ref|XP_011397815.1|  Peptidyl-prolyl cis-trans isomerase FKBP62         116   7e-26   
ref|XP_005307901.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    115   7e-26   
ref|XP_006123078.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    115   1e-25   
ref|XP_009764944.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    115   1e-25   
gb|EMP39691.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               114   1e-25   



>ref|XP_009803135.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Nicotiana 
sylvestris]
Length=573

 Score =   273 bits (699),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 172/199 (86%), Positives = 186/199 (93%), Gaps = 2/199 (1%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSFVK++ESWDMNTQEKIEAAGKKKEEGN LFKAGKY RASKRYEK AKFIEYDT
Sbjct  375  YEVELVSFVKDKESWDMNTQEKIEAAGKKKEEGNALFKAGKYTRASKRYEKAAKFIEYDT  434

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSEEEKKQSKALKISCNLNNAACKLKLKDYK+AEKLCTKVLELESTNVKALYRRAQAY+
Sbjct  435  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKQAEKLCTKVLELESTNVKALYRRAQAYM  494

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
            + AD DLAEFDIKKALEIDPDNR+VKLEYK LK+KVKE+NKKDAKFYGNMFAKL+K E  
Sbjct  495  NMADLDLAEFDIKKALEIDPDNRDVKLEYKALKDKVKEFNKKDAKFYGNMFAKLNKLETA  554

Query  313  SSNKSAPQEAE--AIDSKA  263
            +S+KSA +E E  +IDSKA
Sbjct  555  NSSKSASKEPEPMSIDSKA  573



>ref|XP_009602562.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Nicotiana 
tomentosiformis]
Length=573

 Score =   272 bits (696),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 171/199 (86%), Positives = 186/199 (93%), Gaps = 2/199 (1%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSFVK++ESWDMNT EKIEAAGKKKEEGN LFKAGKY RASKRYEK AKFIEYDT
Sbjct  375  YEVELVSFVKDKESWDMNTPEKIEAAGKKKEEGNALFKAGKYTRASKRYEKAAKFIEYDT  434

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSEEEKKQSKALKISCNLNNAACKLKLKDYK+AEKLCTKVLELESTNVKALYRRAQAY+
Sbjct  435  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKQAEKLCTKVLELESTNVKALYRRAQAYM  494

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
            + AD DLAEFDIKKALEIDP+NR+VKLEYK LK+KVKE+NKKDAKFYGNMFAKL+K E  
Sbjct  495  NMADLDLAEFDIKKALEIDPNNRDVKLEYKALKDKVKEFNKKDAKFYGNMFAKLNKLETA  554

Query  313  SSNKSAPQEAE--AIDSKA  263
            +S+KSAP+E E  +IDSKA
Sbjct  555  NSSKSAPKEPEPMSIDSKA  573



>dbj|BAL14273.1| FK506-binding protein [Nicotiana tabacum]
Length=573

 Score =   272 bits (696),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 171/199 (86%), Positives = 186/199 (93%), Gaps = 2/199 (1%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSFVK++ESWDMNT EKIEAAGKKKEEGN LFKAGKY RASKRYEK AKFIEYDT
Sbjct  375  YEVELVSFVKDKESWDMNTPEKIEAAGKKKEEGNALFKAGKYTRASKRYEKAAKFIEYDT  434

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSEEEKKQSKALKISCNLNNAACKLKLKDYK+AEKLCTKVLELESTNVKALYRRAQAY+
Sbjct  435  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKQAEKLCTKVLELESTNVKALYRRAQAYM  494

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
            + AD DLAEFDIKKALEIDP+NR+VKLEYK LK+KVKE+NKKDAKFYGNMFAKL+K E  
Sbjct  495  NMADLDLAEFDIKKALEIDPNNRDVKLEYKALKDKVKEFNKKDAKFYGNMFAKLNKLETA  554

Query  313  SSNKSAPQEAE--AIDSKA  263
            +S+KSAP+E E  +IDSKA
Sbjct  555  NSSKSAPKEPEPMSIDSKA  573



>gb|EYU39186.1| hypothetical protein MIMGU_mgv1a003614mg [Erythranthe guttata]
Length=574

 Score =   267 bits (683),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 167/199 (84%), Positives = 182/199 (91%), Gaps = 2/199 (1%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE ELVSFVK++ESWDMNT+EKIEAAGKKKEEGN LFKAGKY RASKRYEK AKFIEYDT
Sbjct  376  YEAELVSFVKDKESWDMNTEEKIEAAGKKKEEGNALFKAGKYLRASKRYEKAAKFIEYDT  435

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSEEEKKQSK LK++CNLNNAACKLKLK+YK+AEKLCTKVLELE TNVKALYRRAQAY+
Sbjct  436  SFSEEEKKQSKVLKVTCNLNNAACKLKLKEYKQAEKLCTKVLELEGTNVKALYRRAQAYM  495

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
            + AD DLAEFDIKKALEIDPDNR+VKLEYKVLKEKVKE NKKDAKFYGNMFAKL+K + F
Sbjct  496  NMADLDLAEFDIKKALEIDPDNRDVKLEYKVLKEKVKEINKKDAKFYGNMFAKLTKLQTF  555

Query  313  SSNKSAPQEAE--AIDSKA  263
             SN + P+E E  +IDSKA
Sbjct  556  DSNNATPKEVEPMSIDSKA  574



>emb|CBI41091.3| unnamed protein product [Vitis vinifera]
Length=342

 Score =   259 bits (663),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 161/199 (81%), Positives = 183/199 (92%), Gaps = 3/199 (2%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+EL SFVK++ESWDMNT+EKIEAAGKKKEEGNVLFKAGKYARASKRYEK AK+IEYD+
Sbjct  145  YEVELESFVKDKESWDMNTEEKIEAAGKKKEEGNVLFKAGKYARASKRYEKAAKYIEYDS  204

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SF EEEKKQ+K LK++CNLNNAACKLKLKDYKEAEKLCTKVL+++S NVKALYRRAQAYI
Sbjct  205  SFGEEEKKQAKTLKVTCNLNNAACKLKLKDYKEAEKLCTKVLDIQSKNVKALYRRAQAYI  264

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
            H AD DLAEFDIKKALEIDPDNR+VKLEY+ LKEK+KEYNKK+AKFYGNMFA+++K E  
Sbjct  265  HLADLDLAEFDIKKALEIDPDNRDVKLEYRTLKEKMKEYNKKEAKFYGNMFARMNKLEAL  324

Query  313  SSNKSAPQEAE--AIDSKA  263
             +NK A +EAE  +IDSKA
Sbjct  325  ETNK-ATKEAEPMSIDSKA  342



>ref|XP_002268161.3| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62, partial 
[Vitis vinifera]
Length=348

 Score =   259 bits (662),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 161/199 (81%), Positives = 183/199 (92%), Gaps = 3/199 (2%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+EL SFVK++ESWDMNT+EKIEAAGKKKEEGNVLFKAGKYARASKRYEK AK+IEYD+
Sbjct  151  YEVELESFVKDKESWDMNTEEKIEAAGKKKEEGNVLFKAGKYARASKRYEKAAKYIEYDS  210

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SF EEEKKQ+K LK++CNLNNAACKLKLKDYKEAEKLCTKVL+++S NVKALYRRAQAYI
Sbjct  211  SFGEEEKKQAKTLKVTCNLNNAACKLKLKDYKEAEKLCTKVLDIQSKNVKALYRRAQAYI  270

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
            H AD DLAEFDIKKALEIDPDNR+VKLEY+ LKEK+KEYNKK+AKFYGNMFA+++K E  
Sbjct  271  HLADLDLAEFDIKKALEIDPDNRDVKLEYRTLKEKMKEYNKKEAKFYGNMFARMNKLEAL  330

Query  313  SSNKSAPQEAE--AIDSKA  263
             +NK A +EAE  +IDSKA
Sbjct  331  ETNK-ATKEAEPMSIDSKA  348



>emb|CDP03935.1| unnamed protein product [Coffea canephora]
Length=575

 Score =   265 bits (678),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 168/199 (84%), Positives = 184/199 (92%), Gaps = 2/199 (1%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE ELVSFVKE+ESWDMNTQEKIEAAGKKKEEGN LFKAGKYARASKRYEK AK+IEYDT
Sbjct  377  YEAELVSFVKEKESWDMNTQEKIEAAGKKKEEGNALFKAGKYARASKRYEKAAKYIEYDT  436

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            +FSEEEKKQSK LKISCNLNNAACKLKLKDYK+AEKLC+KVLELES+NVKALYRR QAY+
Sbjct  437  TFSEEEKKQSKVLKISCNLNNAACKLKLKDYKQAEKLCSKVLELESSNVKALYRRGQAYM  496

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
            + AD DLAE DIKKALEIDP+NR+VKLEYKVLKEKVKEYNKKDAKFYGNMFAKL+K E  
Sbjct  497  NLADLDLAELDIKKALEIDPNNRDVKLEYKVLKEKVKEYNKKDAKFYGNMFAKLNKLESV  556

Query  313  SSNKSAPQEAE--AIDSKA  263
              NK+AP++AE  +IDS+A
Sbjct  557  DLNKTAPKDAEPISIDSQA  575



>ref|XP_012085200.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Jatropha 
curcas]
 gb|KDP45275.1| hypothetical protein JCGZ_15140 [Jatropha curcas]
Length=572

 Score =   265 bits (678),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 162/197 (82%), Positives = 178/197 (90%), Gaps = 0/197 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSFVKE+ESWDMNTQEKIEAAGKKKEEGNVLFKAGKY RASKRYEK  K+IEYD+
Sbjct  375  YEVELVSFVKEKESWDMNTQEKIEAAGKKKEEGNVLFKAGKYVRASKRYEKAVKYIEYDS  434

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSEEEKKQ+KALK++CNLNNAACKLKLKDYKEAEKLCTKVLELES NVKALYRRAQAYI
Sbjct  435  SFSEEEKKQAKALKVACNLNNAACKLKLKDYKEAEKLCTKVLELESRNVKALYRRAQAYI  494

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
              AD DLAEFDIKKALEIDPDNR+VKLEYK LKEK++EYNKK+AKFYGNMFAK++K  P 
Sbjct  495  QLADLDLAEFDIKKALEIDPDNRDVKLEYKTLKEKMREYNKKEAKFYGNMFAKMNKLGPL  554

Query  313  SSNKSAPQEAEAIDSKA  263
             SNKS  +E++    K 
Sbjct  555  DSNKSESEESQPTREKT  571



>ref|XP_011089642.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62 [Sesamum 
indicum]
Length=573

 Score =   265 bits (677),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 166/199 (83%), Positives = 184/199 (92%), Gaps = 2/199 (1%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            Y++ELVSFVKE+ESWDM+T EKIEAAGKKKEEGNVLFKAGKY RASKRYEK AK+IEYDT
Sbjct  375  YDVELVSFVKEKESWDMDTAEKIEAAGKKKEEGNVLFKAGKYVRASKRYEKAAKYIEYDT  434

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSEEEKKQSKALK++CNLN+AACKLKLKDYK+AEKLCTKVLELESTNVKALYRRAQAY+
Sbjct  435  SFSEEEKKQSKALKVTCNLNDAACKLKLKDYKQAEKLCTKVLELESTNVKALYRRAQAYM  494

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
            + AD DLAEFDIKKALE+DPDNREVKL YK LKEKVKEYNKKDAKFYGNMFAKL+K +PF
Sbjct  495  NMADLDLAEFDIKKALELDPDNREVKLVYKALKEKVKEYNKKDAKFYGNMFAKLNKLQPF  554

Query  313  SSNKSAPQE--AEAIDSKA  263
             SN +A +E    +I+SKA
Sbjct  555  DSNNTARKEDGPMSIESKA  573



>ref|XP_004242423.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Solanum 
lycopersicum]
Length=574

 Score =   264 bits (675),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 166/199 (83%), Positives = 183/199 (92%), Gaps = 2/199 (1%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSF+K++ESWDM+T EKIEAAGKKKEEGN LFKAGKYARASKRYEK AKFIEYDT
Sbjct  376  YEVELVSFLKDKESWDMSTPEKIEAAGKKKEEGNALFKAGKYARASKRYEKAAKFIEYDT  435

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            +FSEEEKKQSKALKI+CNLNNAACKLKLKDYK+AEKLCTKVLEL+S NVKALYRRAQAY+
Sbjct  436  NFSEEEKKQSKALKITCNLNNAACKLKLKDYKQAEKLCTKVLELDSANVKALYRRAQAYM  495

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
            + AD DLAEFDIKKALEIDPDNR+VKLEYK LKEKVKE NKKDAKFYGNMFAKL+K +  
Sbjct  496  NMADLDLAEFDIKKALEIDPDNRDVKLEYKALKEKVKEINKKDAKFYGNMFAKLNKQDSS  555

Query  313  SSNKSAPQEAE--AIDSKA  263
            +S  SAP+E E  +IDSKA
Sbjct  556  NSANSAPKEPEPMSIDSKA  574



>gb|ACU23964.1| unknown [Glycine max]
Length=235

 Score =   251 bits (642),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 161/199 (81%), Positives = 178/199 (89%), Gaps = 2/199 (1%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSF KE+ESWDM+T EKIEAAGKKKEEGN LFKAGKYARASKRYEK  KFIEYDT
Sbjct  37   YEVELVSFEKEKESWDMDTPEKIEAAGKKKEEGNALFKAGKYARASKRYEKAVKFIEYDT  96

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            +FSEEEKK SKALK++CNLNNAACKLKLKDYK+AEKLCTKVL+LESTNVKALYRRAQAYI
Sbjct  97   AFSEEEKKSSKALKVACNLNNAACKLKLKDYKQAEKLCTKVLDLESTNVKALYRRAQAYI  156

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
              AD DLAEFDIKKALEIDP+NR+VKLEYK LKEK+KEYNKK+AKFYG+MF KL K +  
Sbjct  157  QLADLDLAEFDIKKALEIDPNNRDVKLEYKTLKEKMKEYNKKEAKFYGDMFNKLHKLDSL  216

Query  313  SSNKSAPQEAEA--IDSKA  263
             SNK A ++A+   IDSKA
Sbjct  217  DSNKPASKDAQPMNIDSKA  235



>ref|XP_009610546.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Nicotiana 
tomentosiformis]
Length=565

 Score =   261 bits (667),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 169/199 (85%), Positives = 183/199 (92%), Gaps = 3/199 (2%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSFVKE+ESWDMNT EKIEAAGKKKEEGN LFKAGKYARASKRYEK AKFIEYDT
Sbjct  368  YEVELVSFVKEKESWDMNTPEKIEAAGKKKEEGNALFKAGKYARASKRYEKAAKFIEYDT  427

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            +FSEEEKKQSKALKI+CNLNNAACKLKLKDYK+AEKLCTKVLE ESTNVKALYRRAQ+YI
Sbjct  428  NFSEEEKKQSKALKITCNLNNAACKLKLKDYKQAEKLCTKVLETESTNVKALYRRAQSYI  487

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
            +  DFDLAEFDIKKALEIDP NR+VKLEYK LKEKVKEYNKKDAKFYGNMFAKL+K +  
Sbjct  488  NMVDFDLAEFDIKKALEIDPANRDVKLEYKALKEKVKEYNKKDAKFYGNMFAKLNKLD-V  546

Query  313  SSNKSAPQEAE--AIDSKA  263
            +SN SA +E +  +IDSKA
Sbjct  547  NSNNSASKEPQPMSIDSKA  565



>ref|XP_010247135.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X2 [Nelumbo nucifera]
Length=571

 Score =   261 bits (667),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 163/199 (82%), Positives = 181/199 (91%), Gaps = 2/199 (1%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+E+VSFVKE+ESWDMNT+EKIEAAG KKEEGNVLFKAGKYARASKRYEK AKFIEYD+
Sbjct  373  YEVEMVSFVKEKESWDMNTEEKIEAAGNKKEEGNVLFKAGKYARASKRYEKAAKFIEYDS  432

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            +F EEEKKQ+K LKI+CNLNNAACKLKLKDYK+AEKLCTKVLEL+  NVKALYRRAQAYI
Sbjct  433  TFGEEEKKQAKVLKITCNLNNAACKLKLKDYKQAEKLCTKVLELDGGNVKALYRRAQAYI  492

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
              AD DLAEFDIKKALEI+P+NR+VKLEYKVLKEKVKEYNKKDAKFYGNMFA++SK E  
Sbjct  493  QLADLDLAEFDIKKALEIEPNNRDVKLEYKVLKEKVKEYNKKDAKFYGNMFARMSKLEQL  552

Query  313  SSNKSAPQEAE--AIDSKA  263
             +N +A QE E  +IDSKA
Sbjct  553  EANGAAKQEPEPMSIDSKA  571



>ref|XP_007049646.1| Rotamase FKBP 1 isoform 1 [Theobroma cacao]
 gb|EOX93803.1| Rotamase FKBP 1 isoform 1 [Theobroma cacao]
Length=573

 Score =   261 bits (666),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 165/199 (83%), Positives = 182/199 (91%), Gaps = 2/199 (1%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSFVKE+ESWD+NTQEKIEAAGKKKEEGNVLFKAGKY RASKRYEK  K IEYD+
Sbjct  375  YEVELVSFVKEKESWDINTQEKIEAAGKKKEEGNVLFKAGKYVRASKRYEKALKCIEYDS  434

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSEEEKKQ+K LK++CNLNNAACKLKLKDYK+AEKLCTKVLELES NVKALYRRAQAYI
Sbjct  435  SFSEEEKKQAKVLKVACNLNNAACKLKLKDYKQAEKLCTKVLELESANVKALYRRAQAYI  494

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
            H AD DLAEFDIKKALE+DPDNREVKLEYKVLKEK+KEYNKK++KFYGNMFAK+ K E  
Sbjct  495  HLADLDLAEFDIKKALELDPDNREVKLEYKVLKEKMKEYNKKESKFYGNMFAKMKKMESI  554

Query  313  SSNKSAPQEAE--AIDSKA  263
             S+KSA +E E  ++DSKA
Sbjct  555  DSSKSAAKEPEPMSVDSKA  573



>ref|XP_009787495.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Nicotiana 
sylvestris]
Length=570

 Score =   261 bits (666),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 169/199 (85%), Positives = 183/199 (92%), Gaps = 3/199 (2%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSFVKE+ESWDMNT EKIEAAGKKKEEGN LFKAGKYARASKRYEK AKFIEYDT
Sbjct  373  YEVELVSFVKEKESWDMNTPEKIEAAGKKKEEGNALFKAGKYARASKRYEKAAKFIEYDT  432

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            +FSEEEKKQSKALKI+CNLNNAACKLKLKDYK+AEKLCTKVLE ESTNVKALYRRAQAYI
Sbjct  433  NFSEEEKKQSKALKITCNLNNAACKLKLKDYKQAEKLCTKVLETESTNVKALYRRAQAYI  492

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
            +  DFDLAEFDIKKALEIDP NR+VKLEYK LKEKVKEYNKKDAKFYGN+FAKL+K +  
Sbjct  493  NMVDFDLAEFDIKKALEIDPANRDVKLEYKALKEKVKEYNKKDAKFYGNIFAKLNKLD-V  551

Query  313  SSNKSAPQEAE--AIDSKA  263
            +SN SA +E +  +IDSKA
Sbjct  552  NSNNSASKEPQPMSIDSKA  570



>ref|XP_002535081.1| peptidylprolyl isomerase, putative [Ricinus communis]
 gb|EEF27302.1| peptidylprolyl isomerase, putative [Ricinus communis]
Length=574

 Score =   260 bits (665),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 159/199 (80%), Positives = 179/199 (90%), Gaps = 2/199 (1%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSFVKE+ESWDMNTQEKIEAAGKKKEEGN+LFKAGKYARASKRYEK  K IEYD+
Sbjct  376  YEVELVSFVKEKESWDMNTQEKIEAAGKKKEEGNILFKAGKYARASKRYEKAVKHIEYDS  435

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSEEEKKQ+KALK++CNLNNAACKL+LK+YKEAEKLCTKVL+LES NVKALYRRAQAYI
Sbjct  436  SFSEEEKKQAKALKVACNLNNAACKLRLKEYKEAEKLCTKVLDLESRNVKALYRRAQAYI  495

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
              AD DLAEFDIKKALEI+PDNR+VKLEY+ LK+K++E NKK+AKFYGNMFAK++K  P 
Sbjct  496  QLADLDLAEFDIKKALEIEPDNRDVKLEYRTLKDKMRELNKKEAKFYGNMFAKMNKLGPL  555

Query  313  SSNKSAPQEAE--AIDSKA  263
             SN S   EA   +IDSKA
Sbjct  556  DSNNSKSNEAGQMSIDSKA  574



>ref|XP_002301809.1| hypothetical protein POPTR_0002s24970g [Populus trichocarpa]
 gb|EEE81082.1| hypothetical protein POPTR_0002s24970g [Populus trichocarpa]
Length=575

 Score =   259 bits (663),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 163/199 (82%), Positives = 181/199 (91%), Gaps = 2/199 (1%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YEIELVSF KE+ESWDMNT EKIEAAGKKKEEGNVLFKAGKYA+ASKRYEK  K+IEYD+
Sbjct  377  YEIELVSFDKEKESWDMNTDEKIEAAGKKKEEGNVLFKAGKYAKASKRYEKAVKYIEYDS  436

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSEEEKKQ+KALK++CNLNNAACKLKLKDYK+AEKLCTKVLELES NVKALYRRAQAYI
Sbjct  437  SFSEEEKKQAKALKVACNLNNAACKLKLKDYKQAEKLCTKVLELESRNVKALYRRAQAYI  496

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
              AD DLAEFDIKKALEIDPDNR+VKLE+K LKEK+KEYNKK+AKFYGNMFAK+SK    
Sbjct  497  QLADLDLAEFDIKKALEIDPDNRDVKLEHKTLKEKMKEYNKKEAKFYGNMFAKMSKVGSL  556

Query  313  SSNKSAPQEAE--AIDSKA  263
             SNK+  +EAE  ++DS+A
Sbjct  557  ESNKAEAKEAEPMSVDSEA  575



>ref|XP_004510236.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Cicer 
arietinum]
Length=577

 Score =   259 bits (662),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 161/199 (81%), Positives = 183/199 (92%), Gaps = 2/199 (1%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSFVK++ESWDMNT+EKIEAAGKKKEEGN LFK GKYARASKRYEK  K+IEYDT
Sbjct  379  YELELVSFVKDKESWDMNTEEKIEAAGKKKEEGNALFKTGKYARASKRYEKAVKYIEYDT  438

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSEE+KK +KALK++CNLN+AACKLKLKDYK+AEKLCTKVLELEST+VKALYRRAQAYI
Sbjct  439  SFSEEQKKSAKALKVACNLNDAACKLKLKDYKQAEKLCTKVLELESTSVKALYRRAQAYI  498

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
              AD DLAEFDIKKALEIDPDNR+VKLEYKVLKEK+KE NKKDAKFYGNMF+K+ K +  
Sbjct  499  QLADLDLAEFDIKKALEIDPDNRDVKLEYKVLKEKMKEINKKDAKFYGNMFSKMKKLDSL  558

Query  313  SSNKSAPQEAE--AIDSKA  263
             ++KSAP++AE  +IDSKA
Sbjct  559  DNSKSAPKDAEPMSIDSKA  577



>gb|KJB08781.1| hypothetical protein B456_001G103400 [Gossypium raimondii]
 gb|KJB08783.1| hypothetical protein B456_001G103400 [Gossypium raimondii]
Length=572

 Score =   259 bits (662),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 164/199 (82%), Positives = 183/199 (92%), Gaps = 2/199 (1%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSFVKE+ESWD+NTQEKIEAAGKKKEEGNVLFKAGKY RASKRYEK  K+I+YDT
Sbjct  374  YEVELVSFVKEKESWDLNTQEKIEAAGKKKEEGNVLFKAGKYVRASKRYEKAVKYIDYDT  433

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSEEEKKQSKALK++CNLN+AACKLKLKDYK+AEKLCTKVLELES NVKALYRRAQAYI
Sbjct  434  SFSEEEKKQSKALKVACNLNDAACKLKLKDYKQAEKLCTKVLELESANVKALYRRAQAYI  493

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
            + AD DLAE DIKKALE+DPDNREVKLEYK LKEK+KEYNKK+AKFYGNMFAK++K +  
Sbjct  494  NLADLDLAELDIKKALELDPDNREVKLEYKALKEKIKEYNKKEAKFYGNMFAKMNKMDSG  553

Query  313  SSNKSAPQEAE--AIDSKA  263
             S+KSA +E E  +IDSKA
Sbjct  554  DSSKSAAKEPEPMSIDSKA  572



>ref|XP_006352668.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Solanum 
tuberosum]
Length=574

 Score =   259 bits (662),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 168/199 (84%), Positives = 182/199 (91%), Gaps = 2/199 (1%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSFVK++ESWDMNT EKIEAAGKKKEEGN LFKAGKYARASKRYEK AKFIEYDT
Sbjct  376  YEVELVSFVKDKESWDMNTPEKIEAAGKKKEEGNALFKAGKYARASKRYEKAAKFIEYDT  435

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSEEEKKQSKALKI+CNLNNAACKLKLKDYK+AEKLCTKVLEL+S NVKALYRRAQAY+
Sbjct  436  SFSEEEKKQSKALKITCNLNNAACKLKLKDYKQAEKLCTKVLELDSANVKALYRRAQAYM  495

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
            + AD DLAEFDIKKALEIDPDNR+VKLEYK LKEKVKE NKKDAKFYGNMFAKL+K +  
Sbjct  496  NMADLDLAEFDIKKALEIDPDNRDVKLEYKALKEKVKEINKKDAKFYGNMFAKLNKQDAA  555

Query  313  SSNKSAPQEAE--AIDSKA  263
            +S  SA +E E  +IDSKA
Sbjct  556  NSANSAAKEPEPMSIDSKA  574



>ref|XP_011024591.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X2 [Populus euphratica]
Length=526

 Score =   258 bits (658),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 162/199 (81%), Positives = 181/199 (91%), Gaps = 2/199 (1%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YEIELVSF KE+ESWDMNT EKIEAAGKKKEEGN+LFKAGKYA+ASKRYEK  K+IEYD+
Sbjct  328  YEIELVSFDKEKESWDMNTDEKIEAAGKKKEEGNLLFKAGKYAKASKRYEKAVKYIEYDS  387

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSEEEKKQ+KALK++CNLNNAACKLKLKDYK+AEKLCTKVLELES NVKALYRRAQAYI
Sbjct  388  SFSEEEKKQAKALKVACNLNNAACKLKLKDYKQAEKLCTKVLELESRNVKALYRRAQAYI  447

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
              AD DLAEFDIKKALEIDPDNR+VKLE+K LKEK+KEYNKK+AKFYGNMFAK+SK    
Sbjct  448  QLADLDLAEFDIKKALEIDPDNRDVKLEHKALKEKMKEYNKKEAKFYGNMFAKMSKLGSL  507

Query  313  SSNKSAPQEAE--AIDSKA  263
             SNK+  +EAE  ++DS+A
Sbjct  508  ESNKAEAKEAEPMSVDSEA  526



>ref|XP_010247134.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X1 [Nelumbo nucifera]
Length=572

 Score =   258 bits (660),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 164/200 (82%), Positives = 181/200 (91%), Gaps = 3/200 (2%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+E+VSFVKE+ESWDMNT+EKIEAAG KKEEGNVLFKAGKYARASKRYEK AKFIEYD+
Sbjct  373  YEVEMVSFVKEKESWDMNTEEKIEAAGNKKEEGNVLFKAGKYARASKRYEKAAKFIEYDS  432

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            +F EEEKKQ+K LKI+CNLNNAACKLKLKDYK+AEKLCTKVLEL+  NVKALYRRAQAYI
Sbjct  433  TFGEEEKKQAKVLKITCNLNNAACKLKLKDYKQAEKLCTKVLELDGGNVKALYRRAQAYI  492

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
              AD DLAEFDIKKALEI+P+NR+VKLEYKVLKEKVKEYNKKDAKFYGNMFA++SK E  
Sbjct  493  QLADLDLAEFDIKKALEIEPNNRDVKLEYKVLKEKVKEYNKKDAKFYGNMFARMSKLEQL  552

Query  313  SSNKSAP-QEAE--AIDSKA  263
             +NK A  QE E  +IDSKA
Sbjct  553  EANKGAAKQEPEPMSIDSKA  572



>ref|XP_002263566.2| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62 isoform 
X1 [Vitis vinifera]
 emb|CBI29552.3| unnamed protein product [Vitis vinifera]
Length=571

 Score =   258 bits (659),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 161/199 (81%), Positives = 183/199 (92%), Gaps = 3/199 (2%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+EL SFVK++ESWDMNT+EKIEAAGKKKEEGNVLFKAGKYARASKRYEK AK+IEYD+
Sbjct  374  YEVELESFVKDKESWDMNTEEKIEAAGKKKEEGNVLFKAGKYARASKRYEKAAKYIEYDS  433

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SF EEEKKQ+K LK++CNLNNAACKLKLKDYKEAEKLCTKVL+++S NVKALYRRAQAYI
Sbjct  434  SFGEEEKKQAKTLKVTCNLNNAACKLKLKDYKEAEKLCTKVLDIQSKNVKALYRRAQAYI  493

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
            H AD DLAEFDIKKALEIDPDNR+VKLEY+ LKEK+KEYNKK+AKFYGNMFA+++K E  
Sbjct  494  HLADLDLAEFDIKKALEIDPDNRDVKLEYRTLKEKMKEYNKKEAKFYGNMFARMNKLEAL  553

Query  313  SSNKSAPQEAE--AIDSKA  263
             +NK A +EAE  +IDSKA
Sbjct  554  ETNK-ATKEAEPMSIDSKA  571



>ref|XP_011024590.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X1 [Populus euphratica]
Length=575

 Score =   258 bits (658),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 162/199 (81%), Positives = 181/199 (91%), Gaps = 2/199 (1%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YEIELVSF KE+ESWDMNT EKIEAAGKKKEEGN+LFKAGKYA+ASKRYEK  K+IEYD+
Sbjct  377  YEIELVSFDKEKESWDMNTDEKIEAAGKKKEEGNLLFKAGKYAKASKRYEKAVKYIEYDS  436

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSEEEKKQ+KALK++CNLNNAACKLKLKDYK+AEKLCTKVLELES NVKALYRRAQAYI
Sbjct  437  SFSEEEKKQAKALKVACNLNNAACKLKLKDYKQAEKLCTKVLELESRNVKALYRRAQAYI  496

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
              AD DLAEFDIKKALEIDPDNR+VKLE+K LKEK+KEYNKK+AKFYGNMFAK+SK    
Sbjct  497  QLADLDLAEFDIKKALEIDPDNRDVKLEHKALKEKMKEYNKKEAKFYGNMFAKMSKLGSL  556

Query  313  SSNKSAPQEAE--AIDSKA  263
             SNK+  +EAE  ++DS+A
Sbjct  557  ESNKAEAKEAEPMSVDSEA  575



>gb|KDO40265.1| hypothetical protein CISIN_1g008113mg [Citrus sinensis]
Length=572

 Score =   257 bits (656),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 160/199 (80%), Positives = 180/199 (90%), Gaps = 2/199 (1%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSF KE+ESWDMNT+EKIEAAGKKKE+GN LFKAGKYARASKRYEK  K+IEYDT
Sbjct  374  YEVELVSFEKEKESWDMNTEEKIEAAGKKKEQGNTLFKAGKYARASKRYEKAVKYIEYDT  433

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SF +EEKKQ+KALK++CNLNNAACKLKLKDYK+AEKLCTKVL+L+S NVKALYRRAQAYI
Sbjct  434  SFGDEEKKQAKALKVACNLNNAACKLKLKDYKQAEKLCTKVLDLDSRNVKALYRRAQAYI  493

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
              AD DLAEFDIKKALEIDPDNR+VKLEYK LKEK+KEYNKK+AKFYGNMFAK+S     
Sbjct  494  QMADLDLAEFDIKKALEIDPDNRDVKLEYKTLKEKMKEYNKKEAKFYGNMFAKMSMFGSA  553

Query  313  SSNKSAPQEAE--AIDSKA  263
             SNK+ P+EAE  ++DSKA
Sbjct  554  ESNKAEPKEAEPMSVDSKA  572



>ref|XP_010036767.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X1 [Eucalyptus grandis]
 gb|KCW48407.1| hypothetical protein EUGRSUZ_K02110 [Eucalyptus grandis]
Length=576

 Score =   257 bits (656),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 161/199 (81%), Positives = 182/199 (91%), Gaps = 2/199 (1%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSFVK++ESWDMNT+EKIEAAGKKKEEGNV+FKAGKYA+ASKRYEK  K+IEYDT
Sbjct  378  YEVELVSFVKDKESWDMNTEEKIEAAGKKKEEGNVIFKAGKYAKASKRYEKAVKYIEYDT  437

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSE+EKKQ+KALK++CNLN+AACKLKLKDY +AEKLCTKVLEL+S NVKALYRRAQAYI
Sbjct  438  SFSEDEKKQAKALKVACNLNDAACKLKLKDYNQAEKLCTKVLELDSRNVKALYRRAQAYI  497

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
              +D DLAEFDIKKALEIDP NR+VKLEYKVLKEKVKE+NKKDAKFYGNMFAK+SK EP 
Sbjct  498  ELSDLDLAEFDIKKALEIDPHNRDVKLEYKVLKEKVKEFNKKDAKFYGNMFAKMSKLEPV  557

Query  313  SSNKSAPQEAE--AIDSKA  263
               K+A +E E  +IDSKA
Sbjct  558  EMQKTAAKEPEPMSIDSKA  576



>ref|XP_006437245.1| hypothetical protein CICLE_v10031088mg [Citrus clementina]
 ref|XP_006484806.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Citrus 
sinensis]
 gb|ESR50485.1| hypothetical protein CICLE_v10031088mg [Citrus clementina]
Length=572

 Score =   256 bits (655),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 160/199 (80%), Positives = 180/199 (90%), Gaps = 2/199 (1%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSF KE+ESWDMNT+EKIEAAGKKKE+GN LFKAGKYARASKRYEK  K+IEYDT
Sbjct  374  YEVELVSFEKEKESWDMNTEEKIEAAGKKKEQGNTLFKAGKYARASKRYEKAVKYIEYDT  433

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SF +EEKKQ+KALK++CNLNNAACKLKLKDYK+AEKLCTKVL+L+S NVKALYRRAQAYI
Sbjct  434  SFGDEEKKQAKALKVACNLNNAACKLKLKDYKQAEKLCTKVLDLDSRNVKALYRRAQAYI  493

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
              AD DLAEFDIKKALEIDPDNR+VKLEYK LKEK+KEYNKK+AKFYGNMFAK+S     
Sbjct  494  QMADLDLAEFDIKKALEIDPDNRDVKLEYKTLKEKMKEYNKKEAKFYGNMFAKMSMFGSA  553

Query  313  SSNKSAPQEAE--AIDSKA  263
             SNK+ P+EAE  ++DSKA
Sbjct  554  ESNKAEPKEAEPMSVDSKA  572



>gb|KCW48408.1| hypothetical protein EUGRSUZ_K02110 [Eucalyptus grandis]
Length=468

 Score =   254 bits (648),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 158/197 (80%), Positives = 178/197 (90%), Gaps = 0/197 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSFVK++ESWDMNT+EKIEAAGKKKEEGNV+FKAGKYA+ASKRYEK  K+IEYDT
Sbjct  272  YEVELVSFVKDKESWDMNTEEKIEAAGKKKEEGNVIFKAGKYAKASKRYEKAVKYIEYDT  331

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSE+EKKQ+KALK++CNLN+AACKLKLKDY +AEKLCTKVLEL+S NVKALYRRAQAYI
Sbjct  332  SFSEDEKKQAKALKVACNLNDAACKLKLKDYNQAEKLCTKVLELDSRNVKALYRRAQAYI  391

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
              +D DLAEFDIKKALEIDP NR+VKLEYKVLKEKVKE+NKKDAKFYGNMFAK+SK EP 
Sbjct  392  ELSDLDLAEFDIKKALEIDPHNRDVKLEYKVLKEKVKEFNKKDAKFYGNMFAKMSKLEPV  451

Query  313  SSNKSAPQEAEAIDSKA  263
                +   E  +IDSKA
Sbjct  452  EKTAAKEPEPMSIDSKA  468



>gb|KJB42565.1| hypothetical protein B456_007G157600 [Gossypium raimondii]
Length=478

 Score =   254 bits (648),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 156/199 (78%), Positives = 181/199 (91%), Gaps = 10/199 (5%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+E+VSF+K++ESWDMNT EKIEAAGKKKEEGNVLFK+GKYARASKRYEK  K+I+YD+
Sbjct  288  YEVEMVSFIKDKESWDMNTPEKIEAAGKKKEEGNVLFKSGKYARASKRYEKAVKYIDYDS  347

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSEEEKKQ+KALK++CNLNNAACKLKLKD+K+AEKLCTKVLE+ES+NVKALYRRAQAYI
Sbjct  348  SFSEEEKKQAKALKVACNLNNAACKLKLKDFKQAEKLCTKVLEIESSNVKALYRRAQAYI  407

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
            H AD DLAEFD+KKALEIDPDNRE+K+EYK+LKEK+KEYNKK+AKFYGNMFAK+      
Sbjct  408  HLADLDLAEFDVKKALEIDPDNREIKMEYKLLKEKMKEYNKKEAKFYGNMFAKM------  461

Query  313  SSNKSAPQEAE--AIDSKA  263
              NK+AP+E     IDSKA
Sbjct  462  --NKTAPKEPAPMTIDSKA  478



>ref|XP_008792944.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Phoenix dactylifera]
Length=574

 Score =   256 bits (654),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 165/201 (82%), Positives = 179/201 (89%), Gaps = 3/201 (1%)
 Frame = -2

Query  856  SYEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYD  677
            +YE+ELVSFVKE+ESWDMN  EKIEAAGKKKEEGN LFK GKY RASKRYEKGAKFIEYD
Sbjct  374  TYEVELVSFVKEKESWDMNNAEKIEAAGKKKEEGNALFKVGKYVRASKRYEKGAKFIEYD  433

Query  676  TSFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAY  497
            +SFS+EEKKQSK LKI+CNLNNAACKLKLKDYK+AEKLCTKVLEL+S NVKALYRRAQAY
Sbjct  434  SSFSDEEKKQSKVLKITCNLNNAACKLKLKDYKQAEKLCTKVLELDSRNVKALYRRAQAY  493

Query  496  IHFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEP  317
            I  AD DLAE DIKKALEIDPDNR+VKLEYK LKEKV+EYNKKDAKFYGNMFAK+SK E 
Sbjct  494  IQLADLDLAEVDIKKALEIDPDNRDVKLEYKTLKEKVREYNKKDAKFYGNMFAKMSKLEH  553

Query  316  FSSNKSAPQ-EAE--AIDSKA  263
              +NKSA + EAE  +ID  A
Sbjct  554  AEANKSASKPEAEPMSIDGAA  574



>ref|XP_010905156.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X1 [Elaeis 
guineensis]
Length=574

 Score =   255 bits (651),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 161/200 (81%), Positives = 176/200 (88%), Gaps = 3/200 (2%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSFVKE+ESWDMN  EKIEAAGKKKEEGN LFK GKY RASKRYEKGAKFIEYD+
Sbjct  375  YEVELVSFVKEKESWDMNNAEKIEAAGKKKEEGNALFKVGKYERASKRYEKGAKFIEYDS  434

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFS+EEKKQSK LKI+CNLNNAACKLKLKDYK+AEKLCTKVLEL+  NVKALYRRAQAYI
Sbjct  435  SFSDEEKKQSKVLKITCNLNNAACKLKLKDYKQAEKLCTKVLELDGRNVKALYRRAQAYI  494

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
              AD DLAE DIKKALEIDPDNR+VKLEY+ LKEKVKEYNKKDAKFYGNMFAK+SK E  
Sbjct  495  QLADLDLAEVDIKKALEIDPDNRDVKLEYRTLKEKVKEYNKKDAKFYGNMFAKMSKLENV  554

Query  313  SSNKSAPQ---EAEAIDSKA  263
             ++K AP+   E  ++DS A
Sbjct  555  EAHKDAPKPETEPMSVDSAA  574



>gb|KHG19334.1| Peptidyl-prolyl cis-trans isomerase FKBP62 -like protein [Gossypium 
arboreum]
Length=564

 Score =   254 bits (649),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 157/199 (79%), Positives = 181/199 (91%), Gaps = 10/199 (5%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+E+VSF+K++ESWDMNT EKIEAAGKKKEEGNVLFK+GKYARASKRYEK  K+I+YD+
Sbjct  374  YEVEMVSFIKDKESWDMNTPEKIEAAGKKKEEGNVLFKSGKYARASKRYEKAVKYIDYDS  433

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSEEEKKQ+KALK++CNLNNAACKLKLKDYK+AE+LCTKVLE+ES+NVKALYRRAQAYI
Sbjct  434  SFSEEEKKQAKALKVACNLNNAACKLKLKDYKQAEELCTKVLEIESSNVKALYRRAQAYI  493

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
            H AD DLAEFD+KKALEIDPDNRE+K+EYKVLKEK+KEYNKK+AKFYGNMFAK+      
Sbjct  494  HLADLDLAEFDVKKALEIDPDNREIKMEYKVLKEKMKEYNKKEAKFYGNMFAKM------  547

Query  313  SSNKSAPQEAE--AIDSKA  263
              NK+AP+E     IDSKA
Sbjct  548  --NKTAPKEPAPMTIDSKA  564



>gb|KJB42563.1| hypothetical protein B456_007G157600 [Gossypium raimondii]
Length=564

 Score =   254 bits (648),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 156/199 (78%), Positives = 181/199 (91%), Gaps = 10/199 (5%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+E+VSF+K++ESWDMNT EKIEAAGKKKEEGNVLFK+GKYARASKRYEK  K+I+YD+
Sbjct  374  YEVEMVSFIKDKESWDMNTPEKIEAAGKKKEEGNVLFKSGKYARASKRYEKAVKYIDYDS  433

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSEEEKKQ+KALK++CNLNNAACKLKLKD+K+AEKLCTKVLE+ES+NVKALYRRAQAYI
Sbjct  434  SFSEEEKKQAKALKVACNLNNAACKLKLKDFKQAEKLCTKVLEIESSNVKALYRRAQAYI  493

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
            H AD DLAEFD+KKALEIDPDNRE+K+EYK+LKEK+KEYNKK+AKFYGNMFAK+      
Sbjct  494  HLADLDLAEFDVKKALEIDPDNREIKMEYKLLKEKMKEYNKKEAKFYGNMFAKM------  547

Query  313  SSNKSAPQEAE--AIDSKA  263
              NK+AP+E     IDSKA
Sbjct  548  --NKTAPKEPAPMTIDSKA  564



>ref|XP_004247044.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Solanum 
lycopersicum]
Length=557

 Score =   254 bits (648),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 157/176 (89%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSFVKE+ESWDMNTQEKIEA GKKKEEGN LFKAGKYARASKRYEK AKFIEYDT
Sbjct  376  YEVELVSFVKEKESWDMNTQEKIEATGKKKEEGNALFKAGKYARASKRYEKAAKFIEYDT  435

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
             FSEEEKKQ+KALKISCNLN+AACKLKLKDYK+AEKLCTKVLE ESTNVKALYRRAQAY+
Sbjct  436  DFSEEEKKQAKALKISCNLNDAACKLKLKDYKQAEKLCTKVLETESTNVKALYRRAQAYM  495

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSK  326
            + AD DLAEFDIKKALEIDP+NR+VKLEYK LKEKVKE+NKKDAKFYGNMFAKL+K
Sbjct  496  NMADLDLAEFDIKKALEIDPNNRDVKLEYKALKEKVKEFNKKDAKFYGNMFAKLNK  551



>ref|XP_010036768.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X2 [Eucalyptus grandis]
 gb|KCW48406.1| hypothetical protein EUGRSUZ_K02110 [Eucalyptus grandis]
Length=574

 Score =   254 bits (649),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 158/197 (80%), Positives = 178/197 (90%), Gaps = 0/197 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSFVK++ESWDMNT+EKIEAAGKKKEEGNV+FKAGKYA+ASKRYEK  K+IEYDT
Sbjct  378  YEVELVSFVKDKESWDMNTEEKIEAAGKKKEEGNVIFKAGKYAKASKRYEKAVKYIEYDT  437

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSE+EKKQ+KALK++CNLN+AACKLKLKDY +AEKLCTKVLEL+S NVKALYRRAQAYI
Sbjct  438  SFSEDEKKQAKALKVACNLNDAACKLKLKDYNQAEKLCTKVLELDSRNVKALYRRAQAYI  497

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
              +D DLAEFDIKKALEIDP NR+VKLEYKVLKEKVKE+NKKDAKFYGNMFAK+SK EP 
Sbjct  498  ELSDLDLAEFDIKKALEIDPHNRDVKLEYKVLKEKVKEFNKKDAKFYGNMFAKMSKLEPV  557

Query  313  SSNKSAPQEAEAIDSKA  263
                +   E  +IDSKA
Sbjct  558  EKTAAKEPEPMSIDSKA  574



>ref|XP_003626943.1| 70 kDa peptidyl-prolyl isomerase [Medicago truncatula]
 gb|AET01419.1| peptidyl-prolyl cis-trans isomerase FKBP62-like protein [Medicago 
truncatula]
Length=575

 Score =   254 bits (649),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 156/199 (78%), Positives = 179/199 (90%), Gaps = 2/199 (1%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSF+K++ESWDM T EK+EAAGKKKEEGN LFK GKYA+ASKRYEK  KFIEYDT
Sbjct  377  YEVELVSFIKDKESWDMTTGEKVEAAGKKKEEGNALFKTGKYAKASKRYEKAVKFIEYDT  436

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            S+++E+KK +KALKI+CNLN+AACKLKLKDYK+AEKLCTKVLE ESTNVKALYRRAQAYI
Sbjct  437  SYTDEQKKSAKALKIACNLNDAACKLKLKDYKQAEKLCTKVLEFESTNVKALYRRAQAYI  496

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
              ADFDLAEFDIKKALEIDP+NR+VKLEYK LKEKVKE NKKDAKFYGNMF+K++K +  
Sbjct  497  QLADFDLAEFDIKKALEIDPNNRDVKLEYKTLKEKVKEINKKDAKFYGNMFSKMTKLDSL  556

Query  313  SSNKSAPQEAE--AIDSKA  263
              NKSAP++ E  +IDSKA
Sbjct  557  DINKSAPKDVEPMSIDSKA  575



>ref|XP_003520990.2| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62 [Glycine 
max]
Length=582

 Score =   254 bits (648),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 162/199 (81%), Positives = 178/199 (89%), Gaps = 2/199 (1%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSF KE+ESWDM+T EKIEAAGKKKEEGN LFKAGKYARASKRYEK  KFIEYDT
Sbjct  384  YEVELVSFEKEKESWDMDTPEKIEAAGKKKEEGNALFKAGKYARASKRYEKAVKFIEYDT  443

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            +FSEEEKK SKALK++CNLNNAACKLKLKDYK+AEKLCTKVL+LESTNVKALYRRAQAYI
Sbjct  444  AFSEEEKKSSKALKVACNLNNAACKLKLKDYKQAEKLCTKVLDLESTNVKALYRRAQAYI  503

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
              AD DLAEFDIKKALEIDP+NR+VKLEYK LKEK+KEYNKK+AKFYGNMF KL K +  
Sbjct  504  QLADLDLAEFDIKKALEIDPNNRDVKLEYKTLKEKMKEYNKKEAKFYGNMFNKLHKLDSL  563

Query  313  SSNKSAPQEAEA--IDSKA  263
             SNK A ++A+   IDSKA
Sbjct  564  DSNKPASKDAQPMNIDSKA  582



>gb|KHN44911.1| Peptidyl-prolyl cis-trans isomerase FKBP62 [Glycine soja]
Length=582

 Score =   254 bits (648),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 162/199 (81%), Positives = 178/199 (89%), Gaps = 2/199 (1%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSF KE+ESWDM+T EKIEAAGKKKEEGN LFKAGKYARASKRYEK  KFIEYDT
Sbjct  384  YEVELVSFEKEKESWDMDTPEKIEAAGKKKEEGNALFKAGKYARASKRYEKAVKFIEYDT  443

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            +FSEEEKK SKALK++CNLNNAACKLKLKDYK+AEKLCTKVL+LESTNVKALYRRAQAYI
Sbjct  444  AFSEEEKKSSKALKVACNLNNAACKLKLKDYKQAEKLCTKVLDLESTNVKALYRRAQAYI  503

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
              AD DLAEFDIKKALEIDP+NR+VKLEYK LKEK+KEYNKK+AKFYGNMF KL K +  
Sbjct  504  QLADLDLAEFDIKKALEIDPNNRDVKLEYKTLKEKMKEYNKKEAKFYGNMFNKLHKLDSL  563

Query  313  SSNKSAPQEAEA--IDSKA  263
             SNK A ++A+   IDSKA
Sbjct  564  DSNKPASKDAQPMNIDSKA  582



>ref|XP_009371084.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP65-like [Pyrus 
x bretschneideri]
Length=241

 Score =   243 bits (619),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 151/197 (77%), Positives = 172/197 (87%), Gaps = 9/197 (5%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSFVK++ESWDMNTQEKIE AGKKKEEGNVLFKAGKY RASKRYEK  + IEYD+
Sbjct  54   YEVELVSFVKDKESWDMNTQEKIETAGKKKEEGNVLFKAGKYERASKRYEKAVRLIEYDS  113

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            +FS+EEK+Q+KALKI+CNLN+AACKLKLKDYK+AEKLCTKVL+L+S NVKALYRRAQAYI
Sbjct  114  TFSDEEKQQAKALKITCNLNDAACKLKLKDYKQAEKLCTKVLDLDSRNVKALYRRAQAYI  173

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
               D DLAE DIKKALEIDPDNR+VKLEYKVLK+KV+EYNKKDA+FYGN+FAK++K EP 
Sbjct  174  QLVDLDLAELDIKKALEIDPDNRDVKLEYKVLKQKVREYNKKDAQFYGNIFAKMNKQEPV  233

Query  313  SSNKSAPQEAEAIDSKA  263
                        IDSKA
Sbjct  234  PM---------TIDSKA  241



>gb|AFK35673.1| unknown [Medicago truncatula]
Length=575

 Score =   253 bits (645),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 156/199 (78%), Positives = 179/199 (90%), Gaps = 2/199 (1%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSF+K++ESWDM T EK+EAAGKKKEEGN LFK GKYA+ASKRYEK  KFIEYDT
Sbjct  377  YEVELVSFIKDKESWDMTTGEKVEAAGKKKEEGNALFKTGKYAKASKRYEKAVKFIEYDT  436

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            S+++E+KK +KALKI+CNLN+AACKLKLKDYK+AEKLCTKVLE ESTNVKALYRRAQAYI
Sbjct  437  SYTDEQKKSAKALKIACNLNDAACKLKLKDYKQAEKLCTKVLEFESTNVKALYRRAQAYI  496

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
              ADFDLAEFDIKKALEIDP+NR+VKLEYK LKEKVKE NKKDAKFYGNMF+K++K +  
Sbjct  497  QLADFDLAEFDIKKALEIDPNNRDVKLEYKTLKEKVKEINKKDAKFYGNMFSKMTKLDFL  556

Query  313  SSNKSAPQEAE--AIDSKA  263
              NKSAP++ E  +IDSKA
Sbjct  557  DINKSAPKDVEPMSIDSKA  575



>ref|XP_008794657.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Phoenix dactylifera]
Length=573

 Score =   253 bits (645),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 160/199 (80%), Positives = 178/199 (89%), Gaps = 2/199 (1%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSF+KE+ESWDMN  EKIEAAGKKKEEGN LFKAGKYARASKRYEKGAKFIEYD+
Sbjct  375  YEVELVSFLKEKESWDMNNAEKIEAAGKKKEEGNALFKAGKYARASKRYEKGAKFIEYDS  434

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFS+EEK+QSK LKI+CNLN+AACKLKLKDYK+AEKLCTKVLEL+S NVKALYRRAQAYI
Sbjct  435  SFSDEEKQQSKVLKITCNLNDAACKLKLKDYKQAEKLCTKVLELDSRNVKALYRRAQAYI  494

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
              AD DLAE DIKKALEIDPDNR+VKLEY+ LKEKVKEYNKKDAKFYGNMFAK+SK E  
Sbjct  495  QLADLDLAELDIKKALEIDPDNRDVKLEYRTLKEKVKEYNKKDAKFYGNMFAKMSKLENM  554

Query  313  SSNKSAPQEAE--AIDSKA  263
             ++ ++  E E  +IDS A
Sbjct  555  EAHAASKPETERMSIDSAA  573



>ref|XP_002534361.1| peptidylprolyl isomerase, putative [Ricinus communis]
 gb|EEF28026.1| peptidylprolyl isomerase, putative [Ricinus communis]
Length=583

 Score =   253 bits (645),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 152/185 (82%), Positives = 171/185 (92%), Gaps = 0/185 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSFVKE+ESWDMNTQEKIEAAGKKKEEGN+LFKAGKYARASKRYEK  K IEYD+
Sbjct  376  YEVELVSFVKEKESWDMNTQEKIEAAGKKKEEGNILFKAGKYARASKRYEKAVKHIEYDS  435

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSEEEKKQ+KALK++CNLNNAACKL+LK+YKEAEKLCTKVL+LES NVKALYRRAQAYI
Sbjct  436  SFSEEEKKQAKALKVACNLNNAACKLRLKEYKEAEKLCTKVLDLESRNVKALYRRAQAYI  495

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
              AD DLAEFDIKKALEI+PDNR+VKLEY+ LK+K++E NKK+AKFYGNMFAK++K  P 
Sbjct  496  QLADLDLAEFDIKKALEIEPDNRDVKLEYRTLKDKMRELNKKEAKFYGNMFAKMNKLGPL  555

Query  313  SSNKS  299
             SN S
Sbjct  556  DSNVS  560



>ref|XP_008778813.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X2 [Phoenix 
dactylifera]
 ref|XP_008779083.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X2 [Phoenix 
dactylifera]
Length=473

 Score =   249 bits (637),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 162/203 (80%), Positives = 176/203 (87%), Gaps = 6/203 (3%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSF KE+ESWDMN  EKIEAAGKKKEEGN LFK GKYARASK+YEK AKF+EYD+
Sbjct  271  YEVELVSFEKEKESWDMNNGEKIEAAGKKKEEGNALFKLGKYARASKKYEKAAKFVEYDS  330

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSEEEKKQS+ALK++CNLNNAACKLKLKD+K+AEKLCTKVLE+ES NVKALYRRAQAYI
Sbjct  331  SFSEEEKKQSRALKVTCNLNNAACKLKLKDFKQAEKLCTKVLEIESKNVKALYRRAQAYI  390

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
              AD DLAE DIKKALEIDPDNR+VKLEYK LKEKVKE+NKKDAKFYGNMFAK  K E  
Sbjct  391  QLADLDLAEVDIKKALEIDPDNRDVKLEYKTLKEKVKEFNKKDAKFYGNMFAKWRKLEHM  450

Query  313  SSNKSA----PQEAE--AIDSKA  263
             SNKS     P+EAE   IDS A
Sbjct  451  ESNKSGNQAMPEEAEPMTIDSAA  473



>ref|XP_007200299.1| hypothetical protein PRUPE_ppa003471mg [Prunus persica]
 gb|EMJ01498.1| hypothetical protein PRUPE_ppa003471mg [Prunus persica]
Length=572

 Score =   251 bits (640),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 156/199 (78%), Positives = 180/199 (90%), Gaps = 2/199 (1%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSF K++ESWDMNT+EKIEAAGKKKEEGN LFKAGKYARASKRYEK  K+I+YDT
Sbjct  374  YEVELVSFEKDKESWDMNTEEKIEAAGKKKEEGNALFKAGKYARASKRYEKAVKYIDYDT  433

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSEE+KKQSK LK++CNLNNAACKLKLKDYK+AEKLC+KVLE+E  NVKALYRRAQAYI
Sbjct  434  SFSEEDKKQSKVLKVACNLNNAACKLKLKDYKQAEKLCSKVLEIEGRNVKALYRRAQAYI  493

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
              AD DLAE DIKKALEIDP+NR+VKLEYK LKEK+KE+NKK+AKFYGNMFAKL+K +  
Sbjct  494  QLADLDLAELDIKKALEIDPNNRDVKLEYKTLKEKMKEFNKKEAKFYGNMFAKLTKSDSP  553

Query  313  SSNKSAPQEAE--AIDSKA  263
             SNK+A ++AE  ++DSKA
Sbjct  554  DSNKTAAKDAEPMSVDSKA  572



>ref|XP_006363450.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X1 [Solanum tuberosum]
Length=453

 Score =   247 bits (631),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 154/176 (88%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSFVKE+ESWDMNTQEKIEAA KKKEEGN LFKAGKYARAS RYEK AKFIE DT
Sbjct  274  YEVELVSFVKEKESWDMNTQEKIEAAVKKKEEGNALFKAGKYARASTRYEKAAKFIEDDT  333

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
             FSEEEKKQ+KALKISCNLNNAACKLKLKDYK+AEKLCTKVLE ESTNVKALYRRAQAY+
Sbjct  334  DFSEEEKKQAKALKISCNLNNAACKLKLKDYKQAEKLCTKVLETESTNVKALYRRAQAYM  393

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSK  326
            +  D DLAEFDIKKALEIDP+NR+VKLEYK LKEKVKE+NKKDAKFYGNMFA+L+K
Sbjct  394  NMTDLDLAEFDIKKALEIDPNNRDVKLEYKALKEKVKEFNKKDAKFYGNMFARLNK  449



>ref|XP_010905157.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X2 [Elaeis 
guineensis]
Length=573

 Score =   250 bits (639),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 159/199 (80%), Positives = 174/199 (87%), Gaps = 2/199 (1%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSFVKE+ESWDMN  EKIEAAGKKKEEGN LFK GKY RASKRYEKGAKFIEYD+
Sbjct  375  YEVELVSFVKEKESWDMNNAEKIEAAGKKKEEGNALFKVGKYERASKRYEKGAKFIEYDS  434

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFS+EEKKQSK LKI+CNLNNAACKLKLKDYK+AEKLCTKVLEL+  NVKALYRRAQAYI
Sbjct  435  SFSDEEKKQSKVLKITCNLNNAACKLKLKDYKQAEKLCTKVLELDGRNVKALYRRAQAYI  494

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
              AD DLAE DIKKALEIDPDNR+VKLEY+ LKEKVKEYNKKDAKFYGNMFAK+SK E  
Sbjct  495  QLADLDLAEVDIKKALEIDPDNRDVKLEYRTLKEKVKEYNKKDAKFYGNMFAKMSKLENV  554

Query  313  SSNKSAPQEAE--AIDSKA  263
             ++ +   E E  ++DS A
Sbjct  555  EAHDAPKPETEPMSVDSAA  573



>ref|XP_008778812.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008779082.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X1 [Phoenix 
dactylifera]
Length=578

 Score =   250 bits (638),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 162/203 (80%), Positives = 176/203 (87%), Gaps = 6/203 (3%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSF KE+ESWDMN  EKIEAAGKKKEEGN LFK GKYARASK+YEK AKF+EYD+
Sbjct  376  YEVELVSFEKEKESWDMNNGEKIEAAGKKKEEGNALFKLGKYARASKKYEKAAKFVEYDS  435

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSEEEKKQS+ALK++CNLNNAACKLKLKD+K+AEKLCTKVLE+ES NVKALYRRAQAYI
Sbjct  436  SFSEEEKKQSRALKVTCNLNNAACKLKLKDFKQAEKLCTKVLEIESKNVKALYRRAQAYI  495

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
              AD DLAE DIKKALEIDPDNR+VKLEYK LKEKVKE+NKKDAKFYGNMFAK  K E  
Sbjct  496  QLADLDLAEVDIKKALEIDPDNRDVKLEYKTLKEKVKEFNKKDAKFYGNMFAKWRKLEHM  555

Query  313  SSNKSA----PQEAE--AIDSKA  263
             SNKS     P+EAE   IDS A
Sbjct  556  ESNKSGNQAMPEEAEPMTIDSAA  578



>ref|XP_009372201.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Pyrus 
x bretschneideri]
Length=572

 Score =   249 bits (637),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 157/200 (79%), Positives = 179/200 (90%), Gaps = 2/200 (1%)
 Frame = -2

Query  856  SYEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYD  677
            +YE+ELVSF K++ESWDMNT+EKIEAAGKKKEEGN LFKAGKYARASKRYEK  K+I+YD
Sbjct  373  NYEVELVSFEKDKESWDMNTEEKIEAAGKKKEEGNALFKAGKYARASKRYEKAVKYIDYD  432

Query  676  TSFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAY  497
            TSF EEEKKQ+K LK++CNLN+AACKLKLKDYK+AEKLCTKVLELE  NVKALYRRAQAY
Sbjct  433  TSFGEEEKKQAKVLKVACNLNDAACKLKLKDYKQAEKLCTKVLELEGRNVKALYRRAQAY  492

Query  496  IHFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEP  317
            I  AD DLAE DIKKALEIDP+NR+VKLEYK LKEK+KEYNKK+AKFYGNMFAKL+K + 
Sbjct  493  IQLADLDLAELDIKKALEIDPNNRDVKLEYKTLKEKMKEYNKKEAKFYGNMFAKLTKSDS  552

Query  316  FSSNKSAPQEAE--AIDSKA  263
              SNK A ++AE  ++DSKA
Sbjct  553  PDSNKEAAKDAEPMSVDSKA  572



>gb|KDO40264.1| hypothetical protein CISIN_1g008113mg [Citrus sinensis]
Length=562

 Score =   249 bits (636),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 172/189 (91%), Gaps = 3/189 (2%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSF KE+ESWDMNT+EKIEAAGKKKE+GN LFKAGKYARASKRYEK  K+IEYDT
Sbjct  374  YEVELVSFEKEKESWDMNTEEKIEAAGKKKEQGNTLFKAGKYARASKRYEKAVKYIEYDT  433

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SF +EEKKQ+KALK++CNLNNAACKLKLKDYK+AEKLCTKVL+L+S NVKALYRRAQAYI
Sbjct  434  SFGDEEKKQAKALKVACNLNNAACKLKLKDYKQAEKLCTKVLDLDSRNVKALYRRAQAYI  493

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKP---  323
              AD DLAEFDIKKALEIDPDNR+VKLEYK LKEK+KEYNKK+AKFYGNMFAK+++P   
Sbjct  494  QMADLDLAEFDIKKALEIDPDNRDVKLEYKTLKEKMKEYNKKEAKFYGNMFAKMTEPKEA  553

Query  322  EPFSSNKSA  296
            EP S +  A
Sbjct  554  EPMSVDSKA  562



>ref|XP_010647328.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62 isoform 
X2 [Vitis vinifera]
Length=595

 Score =   250 bits (638),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 151/185 (82%), Positives = 173/185 (94%), Gaps = 0/185 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+EL SFVK++ESWDMNT+EKIEAAGKKKEEGNVLFKAGKYARASKRYEK AK+IEYD+
Sbjct  374  YEVELESFVKDKESWDMNTEEKIEAAGKKKEEGNVLFKAGKYARASKRYEKAAKYIEYDS  433

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SF EEEKKQ+K LK++CNLNNAACKLKLKDYKEAEKLCTKVL+++S NVKALYRRAQAYI
Sbjct  434  SFGEEEKKQAKTLKVTCNLNNAACKLKLKDYKEAEKLCTKVLDIQSKNVKALYRRAQAYI  493

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
            H AD DLAEFDIKKALEIDPDNR+VKLEY+ LKEK+KEYNKK+AKFYGNMFA+++K E  
Sbjct  494  HLADLDLAEFDIKKALEIDPDNRDVKLEYRTLKEKMKEYNKKEAKFYGNMFARMNKLEAL  553

Query  313  SSNKS  299
             +N++
Sbjct  554  ETNRN  558



>ref|XP_008244682.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62 [Prunus 
mume]
Length=572

 Score =   249 bits (636),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 156/199 (78%), Positives = 179/199 (90%), Gaps = 2/199 (1%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSF K++ESWDMNT+EKIEAAGKKKEEGN LFKAGKYARASKRYEK  K+I+YDT
Sbjct  374  YEVELVSFEKDKESWDMNTEEKIEAAGKKKEEGNALFKAGKYARASKRYEKAVKYIDYDT  433

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSEE+KKQ+K LK++CNLNNAACKLKLKDYK+AEKLC+KVLE+E  NVKALYRRAQAYI
Sbjct  434  SFSEEDKKQAKVLKVACNLNNAACKLKLKDYKQAEKLCSKVLEIEGRNVKALYRRAQAYI  493

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
              AD DLAE DIKKALEIDP NR+VKLEYK LKEK+KE+NKK+AKFYGNMFAKLSK +  
Sbjct  494  QLADLDLAELDIKKALEIDPKNRDVKLEYKTLKEKMKEFNKKEAKFYGNMFAKLSKSDSP  553

Query  313  SSNKSAPQEAE--AIDSKA  263
             SNK+A ++AE  ++DSKA
Sbjct  554  DSNKTAAKDAEPVSVDSKA  572



>ref|XP_006363451.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X2 [Solanum tuberosum]
Length=555

 Score =   248 bits (633),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 154/176 (88%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSFVKE+ESWDMNTQEKIEAA KKKEEGN LFKAGKYARAS RYEK AKFIE DT
Sbjct  376  YEVELVSFVKEKESWDMNTQEKIEAAVKKKEEGNALFKAGKYARASTRYEKAAKFIEDDT  435

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
             FSEEEKKQ+KALKISCNLNNAACKLKLKDYK+AEKLCTKVLE ESTNVKALYRRAQAY+
Sbjct  436  DFSEEEKKQAKALKISCNLNNAACKLKLKDYKQAEKLCTKVLETESTNVKALYRRAQAYM  495

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSK  326
            +  D DLAEFDIKKALEIDP+NR+VKLEYK LKEKVKE+NKKDAKFYGNMFA+L+K
Sbjct  496  NMTDLDLAEFDIKKALEIDPNNRDVKLEYKALKEKVKEFNKKDAKFYGNMFARLNK  551



>gb|EPS61356.1| hypothetical protein M569_13437, partial [Genlisea aurea]
Length=382

 Score =   243 bits (620),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 158/197 (80%), Positives = 175/197 (89%), Gaps = 7/197 (4%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSF KE+ESWDM+T EKIEAAGKKKEEGNVLFKAGKY RASKRYEK AK+IEYDT
Sbjct  193  YEVELVSFDKEKESWDMSTPEKIEAAGKKKEEGNVLFKAGKYTRASKRYEKAAKYIEYDT  252

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFS++EKKQSKALK++CNLNNAACKLKLK+YKEAEKLCTKVLE+ES NVKALYRRAQ+YI
Sbjct  253  SFSDDEKKQSKALKVTCNLNNAACKLKLKEYKEAEKLCTKVLEIESRNVKALYRRAQSYI  312

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
            + AD +LAE DIKKALEI+PDNREVK EYK+LKEKVKEYNKKDAKFYGNMFAKL+K    
Sbjct  313  NTADLELAESDIKKALEIEPDNREVKSEYKILKEKVKEYNKKDAKFYGNMFAKLNKT---  369

Query  313  SSNKSAPQEAEAIDSKA  263
                +   EA  IDSKA
Sbjct  370  ----TQSGEAMTIDSKA  382



>gb|KJB08784.1| hypothetical protein B456_001G103400 [Gossypium raimondii]
Length=568

 Score =   247 bits (631),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 153/176 (87%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSFVKE+ESWD+NTQEKIEAAGKKKEEGNVLFKAGKY RASKRYEK  K+I+YDT
Sbjct  374  YEVELVSFVKEKESWDLNTQEKIEAAGKKKEEGNVLFKAGKYVRASKRYEKAVKYIDYDT  433

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSEEEKKQSKALK++CNLN+AACKLKLKDYK+AEKLCTKVLELES NVKALYRRAQAYI
Sbjct  434  SFSEEEKKQSKALKVACNLNDAACKLKLKDYKQAEKLCTKVLELESANVKALYRRAQAYI  493

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSK  326
            + AD DLAE DIKKALE+DPDNREVKLEYK LKEK+KEYNKK+AKFYGNMFAK++K
Sbjct  494  NLADLDLAELDIKKALELDPDNREVKLEYKALKEKIKEYNKKEAKFYGNMFAKMNK  549



>ref|XP_009420312.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Musa acuminata 
subsp. malaccensis]
Length=562

 Score =   247 bits (631),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 155/186 (83%), Positives = 168/186 (90%), Gaps = 0/186 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSFVKE+ESWDMNT EKIEAA KKKEEGN LFK GKY RASKRYEKG+KFIE+D+
Sbjct  376  YEVELVSFVKEKESWDMNTAEKIEAAAKKKEEGNALFKMGKYMRASKRYEKGSKFIEHDS  435

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSEEEKKQSKALK  C+LNNAACKLKLKDYKEAEKLCTKVLE ES NVKALYRRAQAYI
Sbjct  436  SFSEEEKKQSKALKAICSLNNAACKLKLKDYKEAEKLCTKVLETESRNVKALYRRAQAYI  495

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
              ADFDLAE DIKKALEIDPDNR+VKLEYK LKEK+KEYNKKDAKFY N+FAK+SK EP 
Sbjct  496  QLADFDLAELDIKKALEIDPDNRDVKLEYKTLKEKMKEYNKKDAKFYSNIFAKMSKLEPT  555

Query  313  SSNKSA  296
             ++K+ 
Sbjct  556  EASKAG  561



>ref|XP_007134161.1| hypothetical protein PHAVU_010G024500g [Phaseolus vulgaris]
 gb|ESW06155.1| hypothetical protein PHAVU_010G024500g [Phaseolus vulgaris]
Length=574

 Score =   247 bits (631),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 157/199 (79%), Positives = 172/199 (86%), Gaps = 2/199 (1%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSF KE+ESWDMNT EKIE AG KKEEGN LFKAGKYA+ASKRYEK  KFIEYDT
Sbjct  376  YEVELVSFEKEKESWDMNTPEKIEGAGNKKEEGNALFKAGKYAKASKRYEKAVKFIEYDT  435

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFS EEKK SK LK++CNLNNAACKLKLKDYK+AEKLCTKVLELESTNVKALYRRAQAYI
Sbjct  436  SFSVEEKKSSKTLKVACNLNNAACKLKLKDYKQAEKLCTKVLELESTNVKALYRRAQAYI  495

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
              AD DLAE DIKKALE+DPDNREVKLEYK LKEK+KEYNKK AKFYGNMF KL K +  
Sbjct  496  QLADLDLAEIDIKKALELDPDNREVKLEYKTLKEKMKEYNKKQAKFYGNMFNKLHKLDSL  555

Query  313  SSNKSAPQEAEA--IDSKA  263
             +NK+  ++A+   +DSKA
Sbjct  556  DNNKAESKDAQPMNVDSKA  574



>gb|KJB42562.1| hypothetical protein B456_007G157600 [Gossypium raimondii]
Length=563

 Score =   246 bits (629),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 155/199 (78%), Positives = 179/199 (90%), Gaps = 11/199 (6%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+E+VSF+K + SWDMNT EKIEAAGKKKEEGNVLFK+GKYARASKRYEK  K+I+YD+
Sbjct  374  YEVEMVSFIKVK-SWDMNTPEKIEAAGKKKEEGNVLFKSGKYARASKRYEKAVKYIDYDS  432

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSEEEKKQ+KALK++CNLNNAACKLKLKD+K+AEKLCTKVLE+ES+NVKALYRRAQAYI
Sbjct  433  SFSEEEKKQAKALKVACNLNNAACKLKLKDFKQAEKLCTKVLEIESSNVKALYRRAQAYI  492

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
            H AD DLAEFD+KKALEIDPDNRE+K+EYK+LKEK+KEYNKK+AKFYGNMFAK+      
Sbjct  493  HLADLDLAEFDVKKALEIDPDNREIKMEYKLLKEKMKEYNKKEAKFYGNMFAKM------  546

Query  313  SSNKSAPQEAE--AIDSKA  263
              NK+AP+E     IDSKA
Sbjct  547  --NKTAPKEPAPMTIDSKA  563



>ref|XP_007034164.1| FKBP-type peptidyl-prolyl cis-trans isomerase family protein 
isoform 3 [Theobroma cacao]
 gb|EOY05090.1| FKBP-type peptidyl-prolyl cis-trans isomerase family protein 
isoform 3 [Theobroma cacao]
Length=574

 Score =   246 bits (629),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 155/197 (79%), Positives = 175/197 (89%), Gaps = 1/197 (1%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+E+VSFVKE+ESWDMNTQEKIEAAGKKKEEGN L+KAGKY RASKRYEK  KFIEYD+
Sbjct  379  YEVEMVSFVKEKESWDMNTQEKIEAAGKKKEEGNALYKAGKYERASKRYEKAVKFIEYDS  438

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFS+EEK+Q+K LKI+CNLNNAACKLKLKDYKEAEKLCTKVLEL++ NVKALYRRAQAYI
Sbjct  439  SFSDEEKQQTKLLKITCNLNNAACKLKLKDYKEAEKLCTKVLELDNKNVKALYRRAQAYI  498

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
               D DLAE DIKKALEIDPDNR+VKLEY+VLKEK++EYNKKDA+FYGN+FAK++K E  
Sbjct  499  QIVDLDLAEVDIKKALEIDPDNRDVKLEYRVLKEKIREYNKKDAQFYGNIFAKMNKLEQA  558

Query  313  SSNKSAPQEAEAIDSKA  263
             + K  P    AIDSKA
Sbjct  559  KAAKRGPTPM-AIDSKA  574



>ref|XP_010926682.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Elaeis guineensis]
Length=548

 Score =   246 bits (627),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 157/201 (78%), Positives = 177/201 (88%), Gaps = 3/201 (1%)
 Frame = -2

Query  856  SYEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYD  677
            +YE+ELVSFVKE+ESWDMN  EKIEAAGKKK+EGN +FK GKY RASKRYEKGAKFIEYD
Sbjct  348  TYEVELVSFVKEKESWDMNNAEKIEAAGKKKQEGNAVFKVGKYIRASKRYEKGAKFIEYD  407

Query  676  TSFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAY  497
            +SFS+EEK+QSK LKI+ NLNNAACKLKLKDYK+AEKLCTKVL+L S+NVKALY RAQAY
Sbjct  408  SSFSDEEKRQSKVLKITFNLNNAACKLKLKDYKQAEKLCTKVLQLNSSNVKALYGRAQAY  467

Query  496  IHFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEP  317
            I  AD DLAE DIKKALEIDPDNR+VKLEYK LKEKV+EYNKK+AKFYGNMFAK+SK E 
Sbjct  468  IQLADLDLAERDIKKALEIDPDNRDVKLEYKTLKEKVREYNKKEAKFYGNMFAKMSKLEH  527

Query  316  FSSNKSAPQ---EAEAIDSKA  263
              +NKSAP+   +  +IDS A
Sbjct  528  TEANKSAPKPEAQPMSIDSAA  548



>ref|XP_006840897.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62 isoform 
X2 [Amborella trichopoda]
 gb|ERN02572.1| hypothetical protein AMTR_s00087p00078190 [Amborella trichopoda]
Length=592

 Score =   246 bits (628),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 155/206 (75%), Positives = 177/206 (86%), Gaps = 4/206 (2%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            Y++EL+SF KE+ESWDMNT EKIEAA KKKEEGN LFK GKY RASK+YEK AK+IEYDT
Sbjct  386  YDLELMSFAKEKESWDMNTAEKIEAASKKKEEGNALFKVGKYLRASKKYEKAAKYIEYDT  445

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSEEEKKQSK LK++CNLNNAACKLKLKDYK+AEKLCTKVL+L+S NVKALYRRAQAYI
Sbjct  446  SFSEEEKKQSKQLKVTCNLNNAACKLKLKDYKQAEKLCTKVLDLQSKNVKALYRRAQAYI  505

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
            H AD DLAE DIKKALEIDPDNR+VKLEY+ LKEK+KEYNKK+AKFYGNMF+++SK E  
Sbjct  506  HTADLDLAELDIKKALEIDPDNRDVKLEYRTLKEKLKEYNKKEAKFYGNMFSRMSKLEQL  565

Query  313  SSNK----SAPQEAEAIDSKA*ACSA  248
             SNK    S+ QE E ++    A +A
Sbjct  566  ESNKANQASSKQEEEPMNIDGEAVAA  591



>ref|XP_009371078.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Pyrus x bretschneideri]
Length=457

 Score =   243 bits (619),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 151/197 (77%), Positives = 172/197 (87%), Gaps = 9/197 (5%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSFVK++ESWDMNTQEKIE AGKKKEEGNVLFKAGKY RASKRYEK  + IEYD+
Sbjct  270  YEVELVSFVKDKESWDMNTQEKIETAGKKKEEGNVLFKAGKYERASKRYEKAVRLIEYDS  329

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            +FS+EEK+Q+KALKI+CNLN+AACKLKLKDYK+AEKLCTKVL+L+S NVKALYRRAQAYI
Sbjct  330  TFSDEEKQQAKALKITCNLNDAACKLKLKDYKQAEKLCTKVLDLDSRNVKALYRRAQAYI  389

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
               D DLAE DIKKALEIDPDNR+VKLEYKVLK+KV+EYNKKDA+FYGN+FAK++K EP 
Sbjct  390  QLVDLDLAELDIKKALEIDPDNRDVKLEYKVLKQKVREYNKKDAQFYGNIFAKMNKQEPV  449

Query  313  SSNKSAPQEAEAIDSKA  263
                        IDSKA
Sbjct  450  PMT---------IDSKA  457



>ref|XP_010532918.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62 [Tarenaya 
hassleriana]
Length=566

 Score =   245 bits (626),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 154/191 (81%), Positives = 172/191 (90%), Gaps = 5/191 (3%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+EL+SF KERESWDMNT EKIEAAGKKKEEGN LFKAGKYARASKRYEK  KFIEYD+
Sbjct  376  YEVELLSFDKERESWDMNTPEKIEAAGKKKEEGNALFKAGKYARASKRYEKAVKFIEYDS  435

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SF+E+EKKQ+KALK +CNLNNAAC+LKLKDYK+AEK+CTKVLELESTNVKALYRRAQAYI
Sbjct  436  SFNEDEKKQAKALKGACNLNNAACQLKLKDYKQAEKICTKVLELESTNVKALYRRAQAYI  495

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSK----  326
              AD DLAEFDIKKAL+IDP+NRE+KLEY+ LKEK+KEYNKK+AKFYGNMFAKL+K    
Sbjct  496  ELADLDLAEFDIKKALDIDPNNREMKLEYRRLKEKMKEYNKKEAKFYGNMFAKLNKEASK  555

Query  325  -PEPFSSNKSA  296
             PEP S +  A
Sbjct  556  DPEPMSVDSKA  566



>ref|XP_008372538.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62 [Malus 
domestica]
Length=572

 Score =   245 bits (625),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 152/200 (76%), Positives = 179/200 (90%), Gaps = 2/200 (1%)
 Frame = -2

Query  856  SYEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYD  677
            +YE+EL SF K++ESWDMNT+EKIEAAGKKKEEGN LFKAGKYARASKRYEK  K+I+YD
Sbjct  373  NYEVELASFEKDKESWDMNTEEKIEAAGKKKEEGNALFKAGKYARASKRYEKAVKYIDYD  432

Query  676  TSFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAY  497
            +SFSEE KKQ+KALK++CNLN+AACKLKLKDYK+AEKLC+KVLELE  NVKALYRRAQAY
Sbjct  433  SSFSEEAKKQAKALKVACNLNDAACKLKLKDYKQAEKLCSKVLELEGRNVKALYRRAQAY  492

Query  496  IHFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEP  317
            I  AD DLAE DIKKALEIDP+NR+VKLE+K LKEK+KEYNKK+AKFYGNMFAKL+K + 
Sbjct  493  IQLADLDLAELDIKKALEIDPNNRDVKLEHKTLKEKMKEYNKKEAKFYGNMFAKLTKSDS  552

Query  316  FSSNKSAPQEAE--AIDSKA  263
              +NK+  ++AE  ++DSKA
Sbjct  553  LDNNKATDKDAEPMSVDSKA  572



>gb|KHN25146.1| Peptidyl-prolyl cis-trans isomerase FKBP62 [Glycine soja]
Length=470

 Score =   242 bits (618),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 155/199 (78%), Positives = 175/199 (88%), Gaps = 2/199 (1%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YEIELVSF KE+ESWDM+T EKIEAAGKKKEEGN LFKAGKYARASKRYEK  KFIEYDT
Sbjct  272  YEIELVSFEKEKESWDMDTPEKIEAAGKKKEEGNALFKAGKYARASKRYEKAVKFIEYDT  331

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            +FSEEEKK SK LK++CNLNNAACKLKLKDYK+AEKLCTKVL+LESTNVKALYRR QAYI
Sbjct  332  AFSEEEKKSSKFLKVACNLNNAACKLKLKDYKQAEKLCTKVLDLESTNVKALYRRTQAYI  391

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
              AD DLAEFDIKKALE++P+NR+VKLEY  LKEK+KEYNKK+AKFYGNMF KL K +  
Sbjct  392  QLADLDLAEFDIKKALELEPNNRDVKLEYVTLKEKMKEYNKKEAKFYGNMFNKLHKLDSL  451

Query  313  SSNKSAPQEAEA--IDSKA  263
             ++K A ++A+   IDSK+
Sbjct  452  DNSKPASKDAQPINIDSKS  470



>gb|KDO40263.1| hypothetical protein CISIN_1g008113mg [Citrus sinensis]
Length=577

 Score =   245 bits (625),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 149/175 (85%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSF KE+ESWDMNT+EKIEAAGKKKE+GN LFKAGKYARASKRYEK  K+IEYDT
Sbjct  374  YEVELVSFEKEKESWDMNTEEKIEAAGKKKEQGNTLFKAGKYARASKRYEKAVKYIEYDT  433

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SF +EEKKQ+KALK++CNLNNAACKLKLKDYK+AEKLCTKVL+L+S NVKALYRRAQAYI
Sbjct  434  SFGDEEKKQAKALKVACNLNNAACKLKLKDYKQAEKLCTKVLDLDSRNVKALYRRAQAYI  493

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLS  329
              AD DLAEFDIKKALEIDPDNR+VKLEYK LKEK+KEYNKK+AKFYGNMFAK+S
Sbjct  494  QMADLDLAEFDIKKALEIDPDNRDVKLEYKTLKEKMKEYNKKEAKFYGNMFAKMS  548



>ref|XP_011622061.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62 isoform 
X1 [Amborella trichopoda]
Length=593

 Score =   245 bits (626),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 150/188 (80%), Positives = 169/188 (90%), Gaps = 0/188 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            Y++EL+SF KE+ESWDMNT EKIEAA KKKEEGN LFK GKY RASK+YEK AK+IEYDT
Sbjct  386  YDLELMSFAKEKESWDMNTAEKIEAASKKKEEGNALFKVGKYLRASKKYEKAAKYIEYDT  445

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSEEEKKQSK LK++CNLNNAACKLKLKDYK+AEKLCTKVL+L+S NVKALYRRAQAYI
Sbjct  446  SFSEEEKKQSKQLKVTCNLNNAACKLKLKDYKQAEKLCTKVLDLQSKNVKALYRRAQAYI  505

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
            H AD DLAE DIKKALEIDPDNR+VKLEY+ LKEK+KEYNKK+AKFYGNMF+++SK E  
Sbjct  506  HTADLDLAELDIKKALEIDPDNRDVKLEYRTLKEKLKEYNKKEAKFYGNMFSRMSKLEQL  565

Query  313  SSNKSAPQ  290
             SN+ A Q
Sbjct  566  ESNQKANQ  573



>ref|XP_006437244.1| hypothetical protein CICLE_v10031088mg [Citrus clementina]
 gb|ESR50484.1| hypothetical protein CICLE_v10031088mg [Citrus clementina]
Length=559

 Score =   243 bits (621),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 149/175 (85%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSF KE+ESWDMNT+EKIEAAGKKKE+GN LFKAGKYARASKRYEK  K+IEYDT
Sbjct  374  YEVELVSFEKEKESWDMNTEEKIEAAGKKKEQGNTLFKAGKYARASKRYEKAVKYIEYDT  433

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SF +EEKKQ+KALK++CNLNNAACKLKLKDYK+AEKLCTKVL+L+S NVKALYRRAQAYI
Sbjct  434  SFGDEEKKQAKALKVACNLNNAACKLKLKDYKQAEKLCTKVLDLDSRNVKALYRRAQAYI  493

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLS  329
              AD DLAEFDIKKALEIDPDNR+VKLEYK LKEK+KEYNKK+AKFYGNMFAK+S
Sbjct  494  QMADLDLAEFDIKKALEIDPDNRDVKLEYKTLKEKMKEYNKKEAKFYGNMFAKMS  548



>ref|XP_009406340.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Musa acuminata 
subsp. malaccensis]
Length=578

 Score =   244 bits (622),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 152/185 (82%), Positives = 171/185 (92%), Gaps = 0/185 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YEIELVSFVKE+ESWD+NT EKIEAAGKKKEEGN LFK GK+ARASKRYEK AK+IEYD+
Sbjct  375  YEIELVSFVKEKESWDLNTAEKIEAAGKKKEEGNALFKLGKHARASKRYEKAAKYIEYDS  434

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFS+EEKKQSK LK++CNLNNAACKLKLKDYK+AEKLCTKVL+++STNVKALYRRAQAY+
Sbjct  435  SFSDEEKKQSKVLKVTCNLNNAACKLKLKDYKQAEKLCTKVLDIDSTNVKALYRRAQAYM  494

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
            H  D DLAE DIKKALEIDPDNR+VK+EYK+LKEKVKEYNKKDAKFY N+FAKLSK E  
Sbjct  495  HLCDLDLAEQDIKKALEIDPDNRDVKMEYKILKEKVKEYNKKDAKFYSNIFAKLSKLEQM  554

Query  313  SSNKS  299
             +NK+
Sbjct  555  EANKA  559



>ref|XP_007034162.1| FKBP-type peptidyl-prolyl cis-trans isomerase family protein 
isoform 1 [Theobroma cacao]
 gb|EOY05088.1| FKBP-type peptidyl-prolyl cis-trans isomerase family protein 
isoform 1 [Theobroma cacao]
Length=609

 Score =   244 bits (623),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 154/197 (78%), Positives = 174/197 (88%), Gaps = 1/197 (1%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+E+VSFVKE+ESWDMNTQEKIEAAGKKKEEGN L+KAGKY RASKRYEK  KFIEYD+
Sbjct  379  YEVEMVSFVKEKESWDMNTQEKIEAAGKKKEEGNALYKAGKYERASKRYEKAVKFIEYDS  438

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFS+EEK+Q+K LKI+CNLNNAACKLKLKDYKEAEKLCTKVLEL++ NVKALYRRAQAYI
Sbjct  439  SFSDEEKQQTKLLKITCNLNNAACKLKLKDYKEAEKLCTKVLELDNKNVKALYRRAQAYI  498

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
               D DLAE DIKKALEIDPDNR+VKLEY+VLKEK++EYNKKDA+FYGN+FAK++K E  
Sbjct  499  QIVDLDLAEVDIKKALEIDPDNRDVKLEYRVLKEKIREYNKKDAQFYGNIFAKMNKLEQA  558

Query  313  SSNKSAPQEAEAIDSKA  263
             + K  P    AIDSK 
Sbjct  559  KAAKRGPTPM-AIDSKV  574



>gb|KDO40262.1| hypothetical protein CISIN_1g008113mg [Citrus sinensis]
Length=567

 Score =   243 bits (619),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 148/174 (85%), Positives = 164/174 (94%), Gaps = 0/174 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSF KE+ESWDMNT+EKIEAAGKKKE+GN LFKAGKYARASKRYEK  K+IEYDT
Sbjct  374  YEVELVSFEKEKESWDMNTEEKIEAAGKKKEQGNTLFKAGKYARASKRYEKAVKYIEYDT  433

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SF +EEKKQ+KALK++CNLNNAACKLKLKDYK+AEKLCTKVL+L+S NVKALYRRAQAYI
Sbjct  434  SFGDEEKKQAKALKVACNLNNAACKLKLKDYKQAEKLCTKVLDLDSRNVKALYRRAQAYI  493

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKL  332
              AD DLAEFDIKKALEIDPDNR+VKLEYK LKEK+KEYNKK+AKFYGNMFAK+
Sbjct  494  QMADLDLAEFDIKKALEIDPDNRDVKLEYKTLKEKMKEYNKKEAKFYGNMFAKM  547



>gb|KDO40266.1| hypothetical protein CISIN_1g008113mg [Citrus sinensis]
Length=557

 Score =   242 bits (618),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 148/175 (85%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSF KE+ESWDMNT+EKIEAAGKKKE+GN LFKAGKYARASKRYEK  K+IEYDT
Sbjct  374  YEVELVSFEKEKESWDMNTEEKIEAAGKKKEQGNTLFKAGKYARASKRYEKAVKYIEYDT  433

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SF +EEKKQ+KALK++CNLNNAACKLKLKDYK+AEKLCTKVL+L+S NVKALYRRAQAYI
Sbjct  434  SFGDEEKKQAKALKVACNLNNAACKLKLKDYKQAEKLCTKVLDLDSRNVKALYRRAQAYI  493

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLS  329
              AD DLAEFDIKKALEIDPDNR+VKLEYK LKEK+KEYNKK+AKFYGNMFAK++
Sbjct  494  QMADLDLAEFDIKKALEIDPDNRDVKLEYKTLKEKMKEYNKKEAKFYGNMFAKMN  548



>ref|XP_008382577.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62 [Malus 
domestica]
Length=567

 Score =   242 bits (618),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 152/198 (77%), Positives = 174/198 (88%), Gaps = 3/198 (2%)
 Frame = -2

Query  856  SYEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYD  677
            +YE+ELVSF K++ESWDMNT+EKIEAAGKKKEEGN LFKAGKYARASKRYEK  K+I+YD
Sbjct  373  NYEVELVSFEKDKESWDMNTEEKIEAAGKKKEEGNALFKAGKYARASKRYEKAVKYIDYD  432

Query  676  TSFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAY  497
            TSF EEEKKQ+K LK++CNLN+AACKLKLKDYK+AEKLCTKVLELE  NVKALYRRAQAY
Sbjct  433  TSFGEEEKKQAKVLKVACNLNDAACKLKLKDYKQAEKLCTKVLELEGRNVKALYRRAQAY  492

Query  496  IHFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEP  317
            I  AD DLAE DIKKALEIDP+NR+VKLEYK LKEK+KEYNKK+AKFYGNMFAKL  P+ 
Sbjct  493  IQLADLDLAELDIKKALEIDPNNRDVKLEYKTLKEKMKEYNKKEAKFYGNMFAKLLAPQK  552

Query  316  FSSNKSAPQEAEAIDSKA  263
             ++  + P    ++DSKA
Sbjct  553  EAAKDAEPM---SVDSKA  567



>ref|XP_009410619.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Musa acuminata 
subsp. malaccensis]
Length=549

 Score =   242 bits (617),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSFVKE+ESWDMNT EKIEAAGKKKEEGN LFK GKYARASKRYEKGAKFIEYD 
Sbjct  374  YEVELVSFVKEKESWDMNTAEKIEAAGKKKEEGNALFKLGKYARASKRYEKGAKFIEYDN  433

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSEEEKKQS+ALK  C+LNNAACKLK KDYKEAEKLC+KVLE++S NVKALYRRAQAYI
Sbjct  434  SFSEEEKKQSRALKAICDLNNAACKLKFKDYKEAEKLCSKVLEVDSRNVKALYRRAQAYI  493

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSK  326
              AD DLAE DIKKALEIDPDNR+VKLEYK LKEK++EYNKKDAKFYGN+FAK+SK
Sbjct  494  QLADLDLAELDIKKALEIDPDNRDVKLEYKSLKEKMREYNKKDAKFYGNIFAKMSK  549



>ref|XP_010466944.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Camelina 
sativa]
Length=562

 Score =   242 bits (617),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE++LV+F KERESWDMNT+EKIEAA KKKEEGN  FKAGKYA ASKRYEK  KFIEYDT
Sbjct  376  YEVDLVTFDKERESWDMNTEEKIEAATKKKEEGNSQFKAGKYALASKRYEKAVKFIEYDT  435

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSEEEKKQ+KALK++CNLN+AACKLKLKDYK+AEKLCTKVLELESTNVKALYRRAQAY+
Sbjct  436  SFSEEEKKQAKALKVACNLNDAACKLKLKDYKQAEKLCTKVLELESTNVKALYRRAQAYM  495

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSK  326
              AD DLAEFD+KKALEIDP+NREVKLE + LKEK+KE+NKK+AKFYGNMFAKL+K
Sbjct  496  ELADLDLAEFDVKKALEIDPNNREVKLEQRRLKEKMKEFNKKEAKFYGNMFAKLTK  551



>ref|XP_009385667.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Musa acuminata 
subsp. malaccensis]
Length=581

 Score =   242 bits (618),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 151/187 (81%), Positives = 166/187 (89%), Gaps = 1/187 (1%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQeki-eaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYD  677
            YEIELVSFVKE+ESWDMN   +  EAA KKKEEGN LFK GKYA+ASKRYEKGAKFI+YD
Sbjct  377  YEIELVSFVKEKESWDMNDNAEKIEAAAKKKEEGNALFKLGKYAKASKRYEKGAKFIDYD  436

Query  676  TSFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAY  497
             +FSEEEKKQSKALK +C+LNNAACKLKLKDYKEA KLCTKVLE+ES+NVKALYRRAQAY
Sbjct  437  NNFSEEEKKQSKALKAACSLNNAACKLKLKDYKEAIKLCTKVLEIESSNVKALYRRAQAY  496

Query  496  IHFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEP  317
            +  AD DLAE DIKKALEIDP+NR+VKLEYK+LKEKV+EYNKKDAKFYGNMFAK+SK EP
Sbjct  497  MQLADLDLAEVDIKKALEIDPNNRDVKLEYKILKEKVREYNKKDAKFYGNMFAKMSKLEP  556

Query  316  FSSNKSA  296
               NK  
Sbjct  557  VEPNKGG  563



>ref|XP_006418643.1| hypothetical protein EUTSA_v10002468mg [Eutrema salsugineum]
 gb|ESQ37079.1| hypothetical protein EUTSA_v10002468mg [Eutrema salsugineum]
Length=550

 Score =   241 bits (615),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YEI+LV+F KE+ESWDMNT+EKIEAAGKKKEEGN  FKAGKYA ASKRYEK  KFIEYDT
Sbjct  375  YEIDLVAFDKEKESWDMNTEEKIEAAGKKKEEGNSKFKAGKYALASKRYEKAVKFIEYDT  434

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSEEEKKQSKALK++CNLN+AACKLKLK+YK+AEKLCTKVLELESTNVKALYRRAQAY+
Sbjct  435  SFSEEEKKQSKALKVACNLNDAACKLKLKEYKQAEKLCTKVLELESTNVKALYRRAQAYM  494

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSK  326
              AD DLAEFD+KKALEIDPDNREVKLE + LKEK+KE+NKK+AKFYGNMFAKL+K
Sbjct  495  ELADLDLAEFDVKKALEIDPDNREVKLEQRRLKEKMKEFNKKEAKFYGNMFAKLTK  550



>ref|XP_010488634.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62 [Camelina 
sativa]
Length=561

 Score =   241 bits (615),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE++LV+F KERESWDMNT+EKIEAA KKKEEGN  FKAGKYA ASKRYEK  KFIEYDT
Sbjct  375  YEVDLVTFDKERESWDMNTEEKIEAATKKKEEGNSKFKAGKYALASKRYEKAVKFIEYDT  434

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSEEEKKQ+KALK++CNLN+AACKLKLKDYK+AEKLCTKVLELESTNVKALYRRAQAY+
Sbjct  435  SFSEEEKKQAKALKVACNLNDAACKLKLKDYKQAEKLCTKVLELESTNVKALYRRAQAYM  494

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSK  326
              AD DLAEFD+KKALEIDP+NREVKLE + LKEK+KE+NKK+AKFYGNMFAKL+K
Sbjct  495  ELADLDLAEFDVKKALEIDPNNREVKLEQRRLKEKMKEFNKKEAKFYGNMFAKLTK  550



>ref|XP_010514063.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Camelina 
sativa]
Length=562

 Score =   241 bits (615),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE++LV+F KERESWDMNT+EKIEAA KKKEEGN  FKAGKYA ASKRYEK  KFIEYDT
Sbjct  376  YEVDLVTFDKERESWDMNTEEKIEAATKKKEEGNSKFKAGKYALASKRYEKAVKFIEYDT  435

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSEEEKKQ+KALK++CNLN+AACKLKLKDYK+AEKLCTKVLELESTNVKALYRRAQAY+
Sbjct  436  SFSEEEKKQAKALKVACNLNDAACKLKLKDYKQAEKLCTKVLELESTNVKALYRRAQAYM  495

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSK  326
              AD DLAEFD+KKALEIDP+NREVKLE + LKEK+KE+NKK+AKFYGNMFAKL+K
Sbjct  496  ELADLDLAEFDVKKALEIDPNNREVKLEQRRLKEKMKEFNKKEAKFYGNMFAKLTK  551



>ref|XP_011651108.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Cucumis sativus]
 gb|KGN57238.1| hypothetical protein Csa_3G172920 [Cucumis sativus]
Length=575

 Score =   241 bits (616),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 153/201 (76%), Positives = 177/201 (88%), Gaps = 4/201 (2%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMN-TQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYD  677
            YE+ELVSFVKE+ESWD+N  +EKIEAAGKKKEEGNVLFKAGKY RAS+RYEK  ++IEYD
Sbjct  375  YEVELVSFVKEKESWDLNKAEEKIEAAGKKKEEGNVLFKAGKYERASRRYEKAVRYIEYD  434

Query  676  TSFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAY  497
            TSFS+EEK+QSKALKISCNLNNAACKLK+KDYK+AEKLCTKVLEL+S NVKALYRRAQAY
Sbjct  435  TSFSDEEKQQSKALKISCNLNNAACKLKVKDYKQAEKLCTKVLELDSRNVKALYRRAQAY  494

Query  496  IHFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEP  317
            I   D DLAE DIKKALEIDPDNR+VK+EY+ L++KV+EYNK+DA+FYGN+FAK++K E 
Sbjct  495  IQLVDLDLAERDIKKALEIDPDNRDVKIEYRQLEDKVREYNKRDAQFYGNIFAKMNKLEH  554

Query  316  F-SSNKSAPQEA--EAIDSKA  263
              S+N    QEA    IDSKA
Sbjct  555  AKSANSGGKQEAVPMTIDSKA  575



>ref|XP_009373610.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Pyrus x bretschneideri]
Length=567

 Score =   241 bits (615),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 150/197 (76%), Positives = 171/197 (87%), Gaps = 9/197 (5%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSFVK++ESWDMNTQEKIE AGKKKEEGNVLFKAGKY RASKRYEK  + IEYD+
Sbjct  380  YEVELVSFVKDKESWDMNTQEKIETAGKKKEEGNVLFKAGKYERASKRYEKAVRLIEYDS  439

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            +FS+EEK+Q+KALKI+CNLN+AACKLKLKDYK+AEKLCTKVL+L+  NVKALYRRAQAYI
Sbjct  440  TFSDEEKQQAKALKITCNLNDAACKLKLKDYKQAEKLCTKVLDLDGRNVKALYRRAQAYI  499

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
               D DLAE DIKKALEIDPDNR+VKLEYKVLK+KV+EYNKKDA+FYGN+FAK++K EP 
Sbjct  500  QLVDLDLAELDIKKALEIDPDNRDVKLEYKVLKQKVREYNKKDAQFYGNIFAKMNKQEPV  559

Query  313  SSNKSAPQEAEAIDSKA  263
                        IDSKA
Sbjct  560  PMT---------IDSKA  567



>ref|XP_008352304.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Malus domestica]
Length=567

 Score =   241 bits (615),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 149/197 (76%), Positives = 171/197 (87%), Gaps = 9/197 (5%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSFVK++ESWDMNTQEKIE+AGKKKEEGN LFKAGKY RASKRYEK  +FIEYD+
Sbjct  380  YEVELVSFVKDKESWDMNTQEKIESAGKKKEEGNALFKAGKYERASKRYEKAVRFIEYDS  439

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            +F +EEK+Q+KALKI+CNLN+AACKLKLKDYK+AEKLCTKVL+L+S NVKALYRRAQAYI
Sbjct  440  TFGDEEKQQAKALKITCNLNDAACKLKLKDYKQAEKLCTKVLDLDSRNVKALYRRAQAYI  499

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
               D DLAE DIKKALEIDPDNR+VK EYKVLK+KV+EYNKKDA+FYGN+FAK++K EP 
Sbjct  500  QLVDLDLAELDIKKALEIDPDNRDVKQEYKVLKQKVREYNKKDAQFYGNIFAKMNKQEPV  559

Query  313  SSNKSAPQEAEAIDSKA  263
                        IDSKA
Sbjct  560  PMT---------IDSKA  567



>ref|XP_004149324.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Cucumis 
sativus]
 gb|KGN44652.1| hypothetical protein Csa_7G363060 [Cucumis sativus]
Length=553

 Score =   241 bits (614),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELV+F KE+ESWDMN QEKIEAAGKKKEEGNVLFK+GK+ARASKRYEK  KFIEYD+
Sbjct  374  YEVELVAFDKEKESWDMNNQEKIEAAGKKKEEGNVLFKSGKFARASKRYEKAVKFIEYDS  433

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSEEEKKQ+KALK++CNLNNAACKLKLK Y EAEKLCTKVLELES+NVKALYRRAQAYI
Sbjct  434  SFSEEEKKQAKALKVACNLNNAACKLKLKLYNEAEKLCTKVLELESSNVKALYRRAQAYI  493

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPE  320
              AD DLAEFDIKKAL+IDP+NR+VKLEYK LKEKVKEYNKKDAKFYGNMFAK+ K E
Sbjct  494  QLADLDLAEFDIKKALDIDPNNRDVKLEYKTLKEKVKEYNKKDAKFYGNMFAKMKKVE  551



>ref|XP_009349114.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Pyrus 
x bretschneideri]
Length=572

 Score =   241 bits (614),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 151/200 (76%), Positives = 178/200 (89%), Gaps = 2/200 (1%)
 Frame = -2

Query  856  SYEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYD  677
            +YE+EL SF K++ESWDMNT+EKIEAAGKKKEEGN LFKAGKY RASKRYEK  K+I+YD
Sbjct  373  NYEVELASFEKDKESWDMNTEEKIEAAGKKKEEGNALFKAGKYVRASKRYEKAVKYIDYD  432

Query  676  TSFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAY  497
            +SFSEE KKQ+KALK++CNLN+AACKLKLK+YK+AEKLC+KVLELE  NVKALYRRAQAY
Sbjct  433  SSFSEEAKKQAKALKVACNLNDAACKLKLKEYKQAEKLCSKVLELEGRNVKALYRRAQAY  492

Query  496  IHFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEP  317
            I  AD DLAE DIKKALEIDP+NR+VKLE+K LKEK+KEYNKK+AKFYGNMFAKL+K + 
Sbjct  493  IQLADLDLAELDIKKALEIDPNNRDVKLEHKTLKEKMKEYNKKEAKFYGNMFAKLTKSDS  552

Query  316  FSSNKSAPQEAEA--IDSKA  263
              +NK+A ++AE   +DSKA
Sbjct  553  PDNNKAADKDAEPMIVDSKA  572



>ref|XP_008439052.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Cucumis melo]
Length=575

 Score =   240 bits (612),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 155/201 (77%), Positives = 176/201 (88%), Gaps = 4/201 (2%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMN-TQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYD  677
            YE+ELVSFVKE+ESWD+N  +EKIEAAGKKKEEGNVLFKAGKY RAS+RYEK  ++IEYD
Sbjct  375  YEVELVSFVKEKESWDLNKAEEKIEAAGKKKEEGNVLFKAGKYERASRRYEKAVRYIEYD  434

Query  676  TSFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAY  497
            TSFS+EEK+QSKALKISCNLNNAACKLK+KDYK+AEKLCTKVLEL+S NVKALYRRAQAY
Sbjct  435  TSFSDEEKQQSKALKISCNLNNAACKLKVKDYKQAEKLCTKVLELDSRNVKALYRRAQAY  494

Query  496  IHFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEP  317
            I   D DLAE DIKKALEIDPDNR+VK+EY+ LKEKVKEYNK+DA+FYGN+FAK++K E 
Sbjct  495  IQLVDLDLAEQDIKKALEIDPDNRDVKIEYRQLKEKVKEYNKRDAQFYGNIFAKMNKLEH  554

Query  316  F-SSNKSAPQEA--EAIDSKA  263
              S+N    QE     IDSKA
Sbjct  555  AKSANSGGKQEGVPMTIDSKA  575



>emb|CDP15134.1| unnamed protein product [Coffea canephora]
Length=576

 Score =   240 bits (612),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 154/199 (77%), Positives = 178/199 (89%), Gaps = 2/199 (1%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YEIE+VSFVKE+ESWDMN QEKIEAAGKKKEEGNV FKAGKYARASKRYEKG  FIEYD+
Sbjct  378  YEIEMVSFVKEKESWDMNAQEKIEAAGKKKEEGNVWFKAGKYARASKRYEKGVGFIEYDS  437

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFS+EEK+Q+K LKISCNLNNAACKLKLKDYKEA KLCTKVL+++S NVKALYRRAQAYI
Sbjct  438  SFSDEEKQQAKLLKISCNLNNAACKLKLKDYKEAVKLCTKVLDIDSRNVKALYRRAQAYI  497

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
               + +LAE DIKKALEIDPDNR+VK+EYK+LK+KVKEYN+KDA+FYG++FAK+SK E  
Sbjct  498  QLVELELAEQDIKKALEIDPDNRDVKMEYKILKDKVKEYNRKDAQFYGSIFAKMSKLEQQ  557

Query  313  SSNKSAPQEA--EAIDSKA  263
            +S+ +  +EA   AIDSKA
Sbjct  558  NSSSAEKKEAMPMAIDSKA  576



>ref|XP_010550903.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Tarenaya 
hassleriana]
Length=549

 Score =   239 bits (610),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 149/174 (86%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+EL+SF KERESWDMNT+EKIEAAGKKKEEGN LFKAGKYARAS RYEK  KFIEYD+
Sbjct  375  YEVELLSFDKERESWDMNTEEKIEAAGKKKEEGNALFKAGKYARASTRYEKAVKFIEYDS  434

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSE+EKKQ+KALK++CNLNNAACKLKLKDYK+AEKLCTKVLE ESTNVKALYRR+QAYI
Sbjct  435  SFSEDEKKQAKALKVTCNLNNAACKLKLKDYKQAEKLCTKVLEQESTNVKALYRRSQAYI  494

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKL  332
              AD DLAEFDIKKALEIDP+NREVKLEY+ LKEK+KEYNKK+AK YGNMFAKL
Sbjct  495  ELADLDLAEFDIKKALEIDPNNREVKLEYRRLKEKMKEYNKKEAKLYGNMFAKL  548



>ref|XP_009136108.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62 [Brassica 
rapa]
Length=550

 Score =   239 bits (610),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 145/176 (82%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE++LVSF KERESWDMNT+EKIEAAGKKKEEGN  FKAGKYA ASKRYEK  K+IEYD+
Sbjct  375  YEVDLVSFDKERESWDMNTEEKIEAAGKKKEEGNAKFKAGKYALASKRYEKAVKYIEYDS  434

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSEEEKKQ+KALK++CNLN+AACKLKLK+Y++AEKLCTKVLELESTNVKALYRRAQAY+
Sbjct  435  SFSEEEKKQAKALKVACNLNDAACKLKLKEYRQAEKLCTKVLELESTNVKALYRRAQAYM  494

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSK  326
              AD DLAEFD+KKALE+DPDNREVK+E + LKEK+KE+NKK+AKFYGNMFAKLSK
Sbjct  495  ELADLDLAEFDVKKALEVDPDNREVKVEQRRLKEKMKEFNKKEAKFYGNMFAKLSK  550



>ref|XP_006358774.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP65-like [Solanum 
tuberosum]
Length=580

 Score =   239 bits (611),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 155/199 (78%), Positives = 175/199 (88%), Gaps = 5/199 (3%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSFVKE+ESWDMNTQEKIEAAGKKKEEGNVLFKAGKY RASKRYEK   FIEYD+
Sbjct  385  YEVELVSFVKEKESWDMNTQEKIEAAGKKKEEGNVLFKAGKYVRASKRYEKAVSFIEYDS  444

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFS++EK+Q K LK+SCNLNNAACKLKLK+YKEA KLC++VLE++S NVKALYRRAQAYI
Sbjct  445  SFSDDEKQQVKLLKVSCNLNNAACKLKLKEYKEAAKLCSEVLEIDSKNVKALYRRAQAYI  504

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
               D DLAE DIKKALEIDPDNR+VKLEYKVLKEK+KEYNKKDA+FYGN+FAK++K E  
Sbjct  505  QLVDLDLAELDIKKALEIDPDNRDVKLEYKVLKEKIKEYNKKDAQFYGNIFAKMNKLEQS  564

Query  313  SS--NKSAPQEAEAIDSKA  263
                N++AP    AIDSKA
Sbjct  565  GEAKNEAAPM---AIDSKA  580



>sp|Q43207.1|FKB70_WHEAT RecName: Full=70 kDa peptidyl-prolyl isomerase; AltName: Full=Peptidyl-prolyl 
cis-trans isomerase; Short=PPIase; AltName: 
Full=Rotamase [Triticum aestivum]
 emb|CAA60505.1| peptidylprolyl isomerase [Triticum aestivum]
Length=559

 Score =   239 bits (609),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSFVK++ESWD+N  EKIEAAG KKEEGN LFK+GKYARASKRYEK AKFIEYDT
Sbjct  376  YEVELVSFVKDKESWDLNNSEKIEAAGTKKEEGNALFKSGKYARASKRYEKAAKFIEYDT  435

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSE+EKKQSK LKI+CNLNNAACKLKLKDYK+AEKLCTKVLEL+S NVKALYRRAQAY 
Sbjct  436  SFSEDEKKQSKQLKITCNLNNAACKLKLKDYKQAEKLCTKVLELDSRNVKALYRRAQAYT  495

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKP  323
              AD +LAE DIKKALEIDP+NR+VKL YK LKEK+KE NKKDAKFY NMF+K++KP
Sbjct  496  QLADLELAEVDIKKALEIDPENRDVKLTYKTLKEKIKEINKKDAKFYSNMFSKMTKP  552



>ref|XP_010685108.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62 [Beta vulgaris 
subsp. vulgaris]
Length=547

 Score =   238 bits (608),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 146/175 (83%), Positives = 163/175 (93%), Gaps = 0/175 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YEIELVSF KE+ESWDMNT+EKIEA+GKKKEEGN LFKAGKY RASKRYEK AK+IEYD+
Sbjct  373  YEIELVSFEKEKESWDMNTEEKIEASGKKKEEGNALFKAGKYVRASKRYEKAAKYIEYDS  432

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFS+EEKKQ K LK+SCNLNNAACKLKLK+YKEAEKLCTKVLELES NVKALYRRAQAY+
Sbjct  433  SFSDEEKKQCKVLKVSCNLNNAACKLKLKEYKEAEKLCTKVLELESMNVKALYRRAQAYV  492

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLS  329
            H AD +LAEFDIKKALEIDPDNR+VKLEYK LKEK++EYNKKDA+ YG MF+K++
Sbjct  493  HLADLELAEFDIKKALEIDPDNRDVKLEYKKLKEKIREYNKKDAQLYGKMFSKIA  547



>ref|XP_008458076.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Cucumis 
melo]
Length=553

 Score =   238 bits (608),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 151/178 (85%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELV+F KE+ESW+MN QEKIEAAGKKKEEGNVLFK+GK+ARASKRYEK  KFIEYD+
Sbjct  374  YEVELVAFDKEKESWEMNNQEKIEAAGKKKEEGNVLFKSGKFARASKRYEKAVKFIEYDS  433

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSEEEKKQ+KALK++CNLNNAACKLKLK Y EAEKLCTKVLELES+NVKALYRRAQAYI
Sbjct  434  SFSEEEKKQAKALKVACNLNNAACKLKLKLYNEAEKLCTKVLELESSNVKALYRRAQAYI  493

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPE  320
              AD DLAEFDIKKAL+IDP+NR+VKLEYK LKEKVKEYNKKDAKFYGNMFAK+ K E
Sbjct  494  QLADLDLAEFDIKKALDIDPNNRDVKLEYKTLKEKVKEYNKKDAKFYGNMFAKMKKVE  551



>ref|XP_010100792.1| Peptidyl-prolyl cis-trans isomerase FKBP62 [Morus notabilis]
 gb|EXB84490.1| Peptidyl-prolyl cis-trans isomerase FKBP62 [Morus notabilis]
Length=547

 Score =   238 bits (607),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 153/192 (80%), Positives = 166/192 (86%), Gaps = 6/192 (3%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YEIEL SFVKE+ESWDM  +EK+EAAGKKKEEGN LFKAGKY RASKRYEK  K+IEYDT
Sbjct  356  YEIELESFVKEKESWDMVAEEKVEAAGKKKEEGNALFKAGKYLRASKRYEKAVKYIEYDT  415

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            +F EEEKKQ+KALK++CNLNNAACKLKLKDYKEAEKLCTKVLE ES NVKALYRRAQAYI
Sbjct  416  NFREEEKKQAKALKVACNLNNAACKLKLKDYKEAEKLCTKVLEAESRNVKALYRRAQAYI  475

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSK----  326
              AD DLAEFDIKKALEIDP+N  VKLEYK LKEK++EYNKKDAKFYGNMFAK+SK    
Sbjct  476  QLADLDLAEFDIKKALEIDPNNMNVKLEYKTLKEKMREYNKKDAKFYGNMFAKMSKNAAA  535

Query  325  --PEPFSSNKSA  296
               EP S + SA
Sbjct  536  KEAEPTSVDSSA  547



>gb|KJB42559.1| hypothetical protein B456_007G157600 [Gossypium raimondii]
Length=589

 Score =   239 bits (610),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 156/224 (70%), Positives = 181/224 (81%), Gaps = 35/224 (16%)
 Frame = -2

Query  853  YEIELVSFVK-------------------------ERESWDMNTQekieaagkkkeeGNV  749
            YE+E+VSF+K                         ++ESWDMNT EKIEAAGKKKEEGNV
Sbjct  374  YEVEMVSFIKVSGSVCLCKFFGCCINSGFGNLLLQDKESWDMNTPEKIEAAGKKKEEGNV  433

Query  748  LFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAE  569
            LFK+GKYARASKRYEK  K+I+YD+SFSEEEKKQ+KALK++CNLNNAACKLKLKD+K+AE
Sbjct  434  LFKSGKYARASKRYEKAVKYIDYDSSFSEEEKKQAKALKVACNLNNAACKLKLKDFKQAE  493

Query  568  KLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvlkek  389
            KLCTKVLE+ES+NVKALYRRAQAYIH AD DLAEFD+KKALEIDPDNRE+K+EYK+LKEK
Sbjct  494  KLCTKVLEIESSNVKALYRRAQAYIHLADLDLAEFDVKKALEIDPDNREIKMEYKLLKEK  553

Query  388  vkeynkKDAKFYGNMFAKLSKPEPFSSNKSAPQEAE--AIDSKA  263
            +KEYNKK+AKFYGNMFAK+        NK+AP+E     IDSKA
Sbjct  554  MKEYNKKEAKFYGNMFAKM--------NKTAPKEPAPMTIDSKA  589



>ref|NP_189160.3| rotamase FKBP 1 [Arabidopsis thaliana]
 sp|Q38931.2|FKB62_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase FKBP62; Short=PPIase 
FKBP62; AltName: Full=70 kDa peptidyl-prolyl isomerase; 
AltName: Full=FK506-binding protein 62; Short=AtFKBP62; 
AltName: Full=Immunophilin FKBP62; AltName: Full=Peptidylprolyl 
isomerase ROF1; AltName: Full=Protein ROTAMASE FKBP 1; 
AltName: Full=Rotamase [Arabidopsis thaliana]
 gb|AAB82062.1| rof1 [Arabidopsis thaliana]
 gb|AEE76996.1| rotamase FKBP 1 [Arabidopsis thaliana]
Length=551

 Score =   238 bits (606),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  856  SYEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYD  677
            +YE++L++F KERESWDMNT+EKIEAA KKKEEGN  FK GKY+ ASKRYEK  KFIEYD
Sbjct  374  TYEVDLLTFDKERESWDMNTEEKIEAASKKKEEGNSKFKGGKYSLASKRYEKAVKFIEYD  433

Query  676  TSFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAY  497
            TSFSEEEKKQ+KALK++CNLN+AACKLKLKDYK+AEKLCTKVLELESTNVKALYRRAQAY
Sbjct  434  TSFSEEEKKQAKALKVACNLNDAACKLKLKDYKQAEKLCTKVLELESTNVKALYRRAQAY  493

Query  496  IHFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSK  326
            +  +D DLAEFD+KKALEIDP+NREVKLE K LKEK+KE+NKK+AKFYGNMFAKLSK
Sbjct  494  MELSDLDLAEFDVKKALEIDPNNREVKLEQKRLKEKMKEFNKKEAKFYGNMFAKLSK  550



>ref|XP_004504386.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X2 [Cicer 
arietinum]
Length=570

 Score =   238 bits (607),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 151/201 (75%), Positives = 177/201 (88%), Gaps = 7/201 (3%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+EL+SFVKE+ESWD+NTQEKIEAAGKKKEEGN LFKA K+ RAS RYEK  K+IEYD+
Sbjct  373  YEVELISFVKEKESWDLNTQEKIEAAGKKKEEGNALFKASKHERASNRYEKAIKYIEYDS  432

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFS++EK+Q+KALKI+CNLNNAACKLKLKDYK+AEKLCTKVLEL+S NVKALYRRAQA+I
Sbjct  433  SFSDKEKQQAKALKITCNLNNAACKLKLKDYKQAEKLCTKVLELDSRNVKALYRRAQAHI  492

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
            H  D DLAE DIKKALEIDPDNR+VK+EYK+LK+KV+EYNKKDA+FYGN+FAKL+K E  
Sbjct  493  HLVDLDLAEMDIKKALEIDPDNRDVKIEYKILKDKVREYNKKDAQFYGNIFAKLNKVEQA  552

Query  313  SS----NKSAPQEAEAIDSKA  263
             +     +SAP    A+DSKA
Sbjct  553  RTAAAKQESAPM---AVDSKA  570



>ref|XP_006492988.1| PREDICTED: LOW QUALITY PROTEIN: peptidyl-prolyl cis-trans isomerase 
FKBP65-like [Citrus sinensis]
Length=567

 Score =   238 bits (606),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 150/200 (75%), Positives = 173/200 (87%), Gaps = 3/200 (2%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSF+KE+ESWDMNTQEKIEAAGKKKEEGNVLFKAGKY RASKRYEK   +I YD+
Sbjct  368  YEVELVSFIKEKESWDMNTQEKIEAAGKKKEEGNVLFKAGKYERASKRYEKAVNYIGYDS  427

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFS+EEK+Q+K LKI+CNLNNAACKLKLK+YK+AEKLC+KVLEL+S NVKALYRR QAYI
Sbjct  428  SFSDEEKQQAKVLKITCNLNNAACKLKLKEYKQAEKLCSKVLELDSKNVKALYRRVQAYI  487

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
               D DLAE DIKKALEIDPDNR V++EYK+LKEKV+EYNKKDA+FYGN+FAK++K E  
Sbjct  488  QLVDLDLAELDIKKALEIDPDNRAVRMEYKLLKEKVREYNKKDAQFYGNIFAKMNKLEQA  547

Query  313  SSNKSAPQEAEA---IDSKA  263
             S  S  ++  A   IDSKA
Sbjct  548  KSASSMAKQEPAPMVIDSKA  567



>ref|XP_008222791.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Prunus mume]
Length=578

 Score =   238 bits (607),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 155/203 (76%), Positives = 175/203 (86%), Gaps = 9/203 (4%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+EL+SFVKE+ESWD+NTQEKIEAAGKKKEEGNVLFKAGKY RASKRYEK  KFIEYD+
Sbjct  379  YEVELLSFVKEKESWDLNTQEKIEAAGKKKEEGNVLFKAGKYERASKRYEKAVKFIEYDS  438

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            +FS+EEK+QSK LKI+CNLN+AACKLKLK+YK+AEKLCTKVLEL+S NVKALYRRAQAYI
Sbjct  439  AFSDEEKQQSKMLKITCNLNDAACKLKLKEYKQAEKLCTKVLELDSRNVKALYRRAQAYI  498

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
               D DLAE DIKKALEIDPDNR+VK EYKVLKEKV+EYNKKDA+FYG +FAK++K   F
Sbjct  499  QLVDLDLAELDIKKALEIDPDNRDVKQEYKVLKEKVREYNKKDAQFYGAIFAKMNK---F  555

Query  313  SSNKSAPQEAE------AIDSKA  263
               KSA   A+       IDSKA
Sbjct  556  EQVKSASGGAKQDPVPMTIDSKA  578



>gb|AAB82061.1| rof1 [Arabidopsis thaliana]
Length=551

 Score =   237 bits (605),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  856  SYEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYD  677
            +YE++L++F KERESWDMNT+EKIEAA KKKEEGN  FK GKY+ ASKRYEK  KF+EYD
Sbjct  374  TYEVDLLTFDKERESWDMNTEEKIEAASKKKEEGNSKFKGGKYSLASKRYEKAVKFVEYD  433

Query  676  TSFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAY  497
            TSFSEEEKKQ+KALK++CNLN+AACKLKLKDYK+AEKLCTKVLELESTNVKALYRRAQAY
Sbjct  434  TSFSEEEKKQAKALKVACNLNDAACKLKLKDYKQAEKLCTKVLELESTNVKALYRRAQAY  493

Query  496  IHFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSK  326
            +  +D DLAEFD+KKALEIDP+NREVKLE K LKEK+KE+NKK+AKFYGNMFAKLSK
Sbjct  494  MELSDLDLAEFDVKKALEIDPNNREVKLEQKRLKEKMKEFNKKEAKFYGNMFAKLSK  550



>emb|CDY52281.1| BnaA03g57740D [Brassica napus]
Length=558

 Score =   237 bits (605),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 144/175 (82%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE++LVSF KERESWDMNT+EKIEAAGKKKEEGN  FKAGKYA ASKRYEK  K+IEYD+
Sbjct  375  YEVDLVSFDKERESWDMNTEEKIEAAGKKKEEGNAKFKAGKYALASKRYEKAVKYIEYDS  434

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSEEEKKQ+KALK++CNLN+AACKLKLK+Y++AEKLCTKVLELESTNVKALYRRAQAY+
Sbjct  435  SFSEEEKKQAKALKVACNLNDAACKLKLKEYRQAEKLCTKVLELESTNVKALYRRAQAYM  494

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLS  329
              AD DLAEFD+KKALE+DPDNREVK+E + LKEK+KE+NKK+AKFYGNMFAKLS
Sbjct  495  ELADLDLAEFDVKKALEVDPDNREVKVEQRRLKEKMKEFNKKEAKFYGNMFAKLS  549



>ref|XP_002321107.2| hypothetical protein POPTR_0014s14690g [Populus trichocarpa]
 gb|EEE99422.2| hypothetical protein POPTR_0014s14690g [Populus trichocarpa]
Length=577

 Score =   238 bits (606),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 149/199 (75%), Positives = 173/199 (87%), Gaps = 2/199 (1%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+E++SF KE+ESWDMNTQEKIEAAGKKKEEGN  FKAGKY RAS+RYEK AKFIEYD+
Sbjct  379  YEVEMISFTKEKESWDMNTQEKIEAAGKKKEEGNAWFKAGKYERASRRYEKAAKFIEYDS  438

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SF++EEK+QSK LKISC LNNAACKLKLKDYKEAEKLC+KVLEL+  NVKALYRRAQAYI
Sbjct  439  SFTDEEKQQSKVLKISCKLNNAACKLKLKDYKEAEKLCSKVLELDGKNVKALYRRAQAYI  498

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
               D DLAE DIK+ALEIDPDNR+VKLE K+LK+KV+EYNKK+A+FY N+FAK++K E  
Sbjct  499  QLVDLDLAEIDIKRALEIDPDNRDVKLENKILKDKVREYNKKEAQFYSNIFAKMNKLEQT  558

Query  313  SSNKSAPQEA--EAIDSKA  263
            +S  +A Q+A    IDSKA
Sbjct  559  NSTMAAKQDAMPMTIDSKA  577



>ref|XP_004290160.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62 [Fragaria 
vesca subsp. vesca]
Length=565

 Score =   237 bits (604),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 153/197 (78%), Positives = 174/197 (88%), Gaps = 6/197 (3%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YEIELVSFVK++ESWDMNT EKIEAAGKKKEEGN  FKAGKYA+ASKRYEK  K+IEYDT
Sbjct  375  YEIELVSFVKDKESWDMNTPEKIEAAGKKKEEGNAFFKAGKYAKASKRYEKAVKYIEYDT  434

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            +F+EEEKKQ+KALK++CNLN+AA KLKLK+YK+AEKLCTKVLELE  NVKALYRRAQAYI
Sbjct  435  AFAEEEKKQAKALKVACNLNDAASKLKLKEYKQAEKLCTKVLELEGRNVKALYRRAQAYI  494

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
              AD DLAE DIKKALEIDP+NR+VKLEYK LKEK+KE+NKK+AKFYGNMFAKL+K    
Sbjct  495  QLADLDLAELDIKKALEIDPNNRDVKLEYKTLKEKMKEFNKKEAKFYGNMFAKLTK----  550

Query  313  SSNKSAPQEAEAIDSKA  263
             S+K A  E  ++DSKA
Sbjct  551  DSDKDA--EPMSVDSKA  565



>ref|XP_002883594.1| peptidylprolyl isomerase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59853.1| peptidylprolyl isomerase [Arabidopsis lyrata subsp. lyrata]
Length=551

 Score =   236 bits (603),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -2

Query  856  SYEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYD  677
            +YE++L++F KERESWDM+T+EKIEAA KKKEEGN  FKAGKYA ASKRYEK  KFIEYD
Sbjct  371  TYEVDLLTFDKERESWDMSTEEKIEAASKKKEEGNSKFKAGKYALASKRYEKAVKFIEYD  430

Query  676  TSFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAY  497
            TSFSEEEKKQ+KALK++CNLN+AACKLKLKDYK+AEKLCTKVLELESTNVKALYRRAQAY
Sbjct  431  TSFSEEEKKQAKALKVACNLNDAACKLKLKDYKQAEKLCTKVLELESTNVKALYRRAQAY  490

Query  496  IHFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLS  329
            +  AD DLAEFD+KKALEIDP+NREVKLE + LKEK+KE+NKK+AKFYGNMFAKL+
Sbjct  491  MEMADLDLAEFDVKKALEIDPNNREVKLEQRRLKEKMKEFNKKEAKFYGNMFAKLT  546



>ref|XP_007222365.1| hypothetical protein PRUPE_ppa003399mg [Prunus persica]
 gb|EMJ23564.1| hypothetical protein PRUPE_ppa003399mg [Prunus persica]
Length=578

 Score =   237 bits (605),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 154/203 (76%), Positives = 175/203 (86%), Gaps = 9/203 (4%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+EL+SFVKE+ESWD+NTQEKIEAAGKKKEEGNVLFKAGKY RASKRYEK  KFIEYD+
Sbjct  379  YEVELLSFVKEKESWDLNTQEKIEAAGKKKEEGNVLFKAGKYERASKRYEKAVKFIEYDS  438

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            +FS+EEK+QSK LK++CNLN+AACKLKLK+YK+AEKLCTKVLEL+S NVKALYRRAQAYI
Sbjct  439  AFSDEEKQQSKMLKVTCNLNDAACKLKLKEYKQAEKLCTKVLELDSRNVKALYRRAQAYI  498

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
               D DLAE DIKKALEIDPDNR+VK EYKVLKEKV+EYNKKDA+FYG +FAK++K   F
Sbjct  499  QLVDLDLAELDIKKALEIDPDNRDVKQEYKVLKEKVREYNKKDAQFYGAIFAKMNK---F  555

Query  313  SSNKSAPQEAE------AIDSKA  263
               KSA   A+       IDSKA
Sbjct  556  EQVKSASGGAKQDPVPMTIDSKA  578



>dbj|BAB02082.1| peptidylprolyl isomerase; FK506-binding protein [Arabidopsis 
thaliana]
Length=555

 Score =   236 bits (603),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -2

Query  856  SYEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYD  677
            +YE++L++F KERESWDMNT+EKIEAA KKKEEGN  FK GKY+ ASKRYEK  KFIEYD
Sbjct  374  TYEVDLLTFDKERESWDMNTEEKIEAASKKKEEGNSKFKGGKYSLASKRYEKAVKFIEYD  433

Query  676  TSFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAY  497
            TSFSEEEKKQ+KALK++CNLN+AACKLKLKDYK+AEKLCTKVLELESTNVKALYRRAQAY
Sbjct  434  TSFSEEEKKQAKALKVACNLNDAACKLKLKDYKQAEKLCTKVLELESTNVKALYRRAQAY  493

Query  496  IHFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLS  329
            +  +D DLAEFD+KKALEIDP+NREVKLE K LKEK+KE+NKK+AKFYGNMFAKLS
Sbjct  494  MELSDLDLAEFDVKKALEIDPNNREVKLEQKRLKEKMKEFNKKEAKFYGNMFAKLS  549



>ref|XP_007034163.1| FKBP-type peptidyl-prolyl cis-trans isomerase family protein 
isoform 2 [Theobroma cacao]
 gb|EOY05089.1| FKBP-type peptidyl-prolyl cis-trans isomerase family protein 
isoform 2 [Theobroma cacao]
Length=609

 Score =   238 bits (606),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 147/178 (83%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+E+VSFVKE+ESWDMNTQEKIEAAGKKKEEGN L+KAGKY RASKRYEK  KFIEYD+
Sbjct  379  YEVEMVSFVKEKESWDMNTQEKIEAAGKKKEEGNALYKAGKYERASKRYEKAVKFIEYDS  438

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFS+EEK+Q+K LKI+CNLNNAACKLKLKDYKEAEKLCTKVLEL++ NVKALYRRAQAYI
Sbjct  439  SFSDEEKQQTKLLKITCNLNNAACKLKLKDYKEAEKLCTKVLELDNKNVKALYRRAQAYI  498

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPE  320
               D DLAE DIKKALEIDPDNR+VKLEY+VLKEK++EYNKKDA+FYGN+FAK++K E
Sbjct  499  QIVDLDLAEVDIKKALEIDPDNRDVKLEYRVLKEKIREYNKKDAQFYGNIFAKMNKLE  556



>gb|KEH20636.1| peptidyl-prolyl cis-trans isomerase FKBP62-like protein [Medicago 
truncatula]
Length=570

 Score =   237 bits (604),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 150/199 (75%), Positives = 178/199 (89%), Gaps = 3/199 (2%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+EL+SFV E+ESWD+NTQEKIEAAGKKKEEGN LFKAGK+ RASKRYEK  ++ EYD+
Sbjct  373  YEVELLSFVNEKESWDLNTQEKIEAAGKKKEEGNALFKAGKHERASKRYEKAIRYFEYDS  432

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFS+EEK+Q+KALKISCNLN+AACKLKLKDYK+AEKLCTKVLEL+S NVKALYRRAQAYI
Sbjct  433  SFSDEEKQQAKALKISCNLNDAACKLKLKDYKQAEKLCTKVLELDSRNVKALYRRAQAYI  492

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
            H  D DLAE DIKKALEIDPDNR+VK+EYK+LK+KV+EYNKKDA+FYGN+FAK++K E  
Sbjct  493  HLIDLDLAEMDIKKALEIDPDNRDVKIEYKILKDKVREYNKKDAQFYGNIFAKMNKVEQ-  551

Query  313  SSNKSAPQEA--EAIDSKA  263
            +   +A QE+   A+DS+A
Sbjct  552  ARTAAAKQESVPMAVDSQA  570



>ref|NP_001149790.1| LOC100283417 [Zea mays]
 gb|ACG36811.1| peptidyl-prolyl isomerase [Zea mays]
 tpg|DAA48150.1| TPA: peptidyl-prolyl isomerase [Zea mays]
 tpg|DAA48151.1| TPA: peptidyl-prolyl isomerase [Zea mays]
Length=553

 Score =   236 bits (601),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+EL+SFVK++ESWD+N +EKIEAAGKKKEEGN LFK+GKYARASKRYEK AK+IEYDT
Sbjct  378  YEVELISFVKDKESWDLNNEEKIEAAGKKKEEGNALFKSGKYARASKRYEKAAKYIEYDT  437

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSE+EKKQSK LKISCNLNNAACKLKLKDYKEA KLCTKVLEL+S NVKALYRR QAYI
Sbjct  438  SFSEDEKKQSKQLKISCNLNNAACKLKLKDYKEAAKLCTKVLELDSQNVKALYRRVQAYI  497

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSK  326
              AD +LAE DIKKALEIDPDNR+VKLEYK+LKEK+KEYNKKDAKFY NMFAK++K
Sbjct  498  QLADLELAEADIKKALEIDPDNRDVKLEYKILKEKIKEYNKKDAKFYSNMFAKMTK  553



>gb|AIU40165.1| peptidyl-prolyl cis-trans isomerase, partial [Triticum aestivum]
Length=438

 Score =   233 bits (594),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 159/175 (91%), Gaps = 0/175 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSFVK++ESWD+N  EKIEAAG KKEEGN LFK+GKYARASKRYEK AKFI+YDT
Sbjct  264  YEVELVSFVKDKESWDLNNSEKIEAAGTKKEEGNALFKSGKYARASKRYEKAAKFIDYDT  323

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSE+EKKQSK LKI+CNLNNAACKLKLKDYK+AEKLCTKVLEL+S NVKALYRRAQAY 
Sbjct  324  SFSEDEKKQSKQLKITCNLNNAACKLKLKDYKQAEKLCTKVLELDSQNVKALYRRAQAYT  383

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLS  329
              AD +LAE DIKKALEIDP+NR+VKL YK LKEK+KE NKKDAKFY NMF+K++
Sbjct  384  QLADLELAEVDIKKALEIDPENRDVKLTYKTLKEKIKEINKKDAKFYSNMFSKMT  438



>emb|CDY15103.1| BnaC03g44640D [Brassica napus]
Length=558

 Score =   236 bits (601),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 143/175 (82%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE++LVSF KERESWDMNT+EKIEAAGKKKEEGN  FKAGKYA ASKRYEK  K+IEYD+
Sbjct  375  YEVDLVSFDKERESWDMNTEEKIEAAGKKKEEGNAKFKAGKYALASKRYEKAVKYIEYDS  434

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSE+EKKQ+KALK++CNLN+AACKLKLK+Y++AEKLCTKVLELESTNVKALYRRAQAY+
Sbjct  435  SFSEDEKKQAKALKVACNLNDAACKLKLKEYRQAEKLCTKVLELESTNVKALYRRAQAYM  494

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLS  329
              AD DLAEFD+KKALE+DPDNREVK+E + LKEK+KE+NKK+AKFYGNMFAKLS
Sbjct  495  ELADLDLAEFDVKKALEVDPDNREVKVEQRRLKEKMKEFNKKEAKFYGNMFAKLS  549



>tpg|DAA48152.1| TPA: hypothetical protein ZEAMMB73_593378 [Zea mays]
Length=559

 Score =   236 bits (601),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+EL+SFVK++ESWD+N +EKIEAAGKKKEEGN LFK+GKYARASKRYEK AK+IEYDT
Sbjct  384  YEVELISFVKDKESWDLNNEEKIEAAGKKKEEGNALFKSGKYARASKRYEKAAKYIEYDT  443

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSE+EKKQSK LKISCNLNNAACKLKLKDYKEA KLCTKVLEL+S NVKALYRR QAYI
Sbjct  444  SFSEDEKKQSKQLKISCNLNNAACKLKLKDYKEAAKLCTKVLELDSQNVKALYRRVQAYI  503

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSK  326
              AD +LAE DIKKALEIDPDNR+VKLEYK+LKEK+KEYNKKDAKFY NMFAK++K
Sbjct  504  QLADLELAEADIKKALEIDPDNRDVKLEYKILKEKIKEYNKKDAKFYSNMFAKMTK  559



>ref|NP_001062292.1| Os08g0525600 [Oryza sativa Japonica Group]
 dbj|BAD11570.1| putative 70 kDa peptidylprolyl isomerase [Oryza sativa Japonica 
Group]
 dbj|BAF24206.1| Os08g0525600 [Oryza sativa Japonica Group]
 dbj|BAG95934.1| unnamed protein product [Oryza sativa Japonica Group]
Length=580

 Score =   236 bits (602),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 163/186 (88%), Gaps = 1/186 (1%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSFVK++ESWD+N  EKIE AG KKEEGN LFK GKY RASKRYEK AKFIEYD+
Sbjct  381  YEVELVSFVKDKESWDLNNTEKIETAGAKKEEGNALFKLGKYVRASKRYEKAAKFIEYDS  440

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSE+EKKQSK LK++CNLNNAACKLKLKDYK+AEKLCTKVLEL+S NVKALYRRAQAY+
Sbjct  441  SFSEDEKKQSKQLKVTCNLNNAACKLKLKDYKQAEKLCTKVLELDSQNVKALYRRAQAYM  500

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
              AD +LAE DIKKALEIDPDNR+VKL YK LKEKVKEYNKKDAKFY NMFAK++K +P 
Sbjct  501  QLADLELAEVDIKKALEIDPDNRDVKLTYKNLKEKVKEYNKKDAKFYSNMFAKMTK-QPA  559

Query  313  SSNKSA  296
               K+ 
Sbjct  560  EDGKAG  565



>ref|XP_007153782.1| hypothetical protein PHAVU_003G064500g [Phaseolus vulgaris]
 gb|ESW25776.1| hypothetical protein PHAVU_003G064500g [Phaseolus vulgaris]
Length=569

 Score =   236 bits (601),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 150/199 (75%), Positives = 173/199 (87%), Gaps = 3/199 (2%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+EL+SFVKE+ESWD+NT EKIE AGKKKEEGN LFK GKY RASKRYEK  KFIEYD+
Sbjct  372  YEVELLSFVKEKESWDLNTPEKIEGAGKKKEEGNALFKVGKYERASKRYEKAMKFIEYDS  431

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SF +EEK+QSKALKI+CNLNNAACKLKLKDYK+AEKLCTKVLEL+S NVKALYRRAQAY+
Sbjct  432  SFGDEEKQQSKALKITCNLNNAACKLKLKDYKQAEKLCTKVLELDSRNVKALYRRAQAYL  491

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
            H  D DLAE DIKKALEI+P+NR+VK+EYK+LK+KV+EYNKKDA+FYG MFAK++K E  
Sbjct  492  HLVDLDLAEMDIKKALEIEPENRDVKMEYKLLKQKVREYNKKDAQFYGIMFAKMNKLEE-  550

Query  313  SSNKSAPQE--AEAIDSKA  263
            +   +A QE     IDSKA
Sbjct  551  ARTATAKQEPVPMTIDSKA  569



>ref|XP_011000006.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X2 [Populus euphratica]
Length=577

 Score =   236 bits (601),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 148/199 (74%), Positives = 172/199 (86%), Gaps = 2/199 (1%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+E++SF KE+ESWDMNTQEKIEAAGKKKEEGN  FKAGKY RAS+RYEK AKFIEYD+
Sbjct  379  YEVEMISFTKEKESWDMNTQEKIEAAGKKKEEGNAWFKAGKYERASRRYEKAAKFIEYDS  438

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SF++EEK+QSK LKISC LNNAACKLKLKDYKEAEKLC+KVLEL+  NVKALYRRAQAYI
Sbjct  439  SFTDEEKQQSKVLKISCKLNNAACKLKLKDYKEAEKLCSKVLELDGQNVKALYRRAQAYI  498

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
               D DLAE DIK+ALEIDPDNR+VKLEYK+LK+KV+EY KK+A+FY N+FAK++K E  
Sbjct  499  QLVDLDLAEIDIKRALEIDPDNRDVKLEYKILKDKVREYKKKEAQFYSNIFAKMNKLEQT  558

Query  313  SSNKSAPQE--AEAIDSKA  263
            +S  +A Q+     IDSKA
Sbjct  559  NSTMAAKQDPMPMTIDSKA  577



>gb|EYU40640.1| hypothetical protein MIMGU_mgv1a003616mg [Erythranthe guttata]
 gb|EYU40641.1| hypothetical protein MIMGU_mgv1a003616mg [Erythranthe guttata]
Length=574

 Score =   235 bits (600),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 147/174 (84%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            Y++ELVSFVKE+ESWDMNT+EKIEAAGKKKEEGN LFKAGKYA+ASKRYEK AK+IE++T
Sbjct  400  YDVELVSFVKEKESWDMNTEEKIEAAGKKKEEGNSLFKAGKYAKASKRYEKAAKYIEHET  459

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFS+EEKK  K LK+SCNLNNAACKLKLKDYK+AEKLC+KVLELESTNVKALYRRAQAY+
Sbjct  460  SFSDEEKKLCKVLKVSCNLNNAACKLKLKDYKQAEKLCSKVLELESTNVKALYRRAQAYM  519

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKL  332
            + AD D+AEFDIKKALE+DP+NREVKL YK LKEK+KEYNKKDAKFYGNMFAKL
Sbjct  520  NMADLDVAEFDIKKALELDPENREVKLGYKALKEKMKEYNKKDAKFYGNMFAKL  573



>ref|XP_003524915.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoformX1 [Glycine 
max]
Length=570

 Score =   235 bits (600),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 176/199 (88%), Gaps = 3/199 (2%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+EL+SFVKE+ESWD+NTQEKIEAAGKKKEEGN  FK GKY RASKRYEK  KF+EYD+
Sbjct  373  YEVELLSFVKEKESWDLNTQEKIEAAGKKKEEGNAFFKVGKYERASKRYEKAIKFVEYDS  432

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFS+EEK+Q+KALKI+CNLNNAACKLKLKDYK+AEK+CTKVLEL+S NVKALYRRAQAY+
Sbjct  433  SFSDEEKQQTKALKITCNLNNAACKLKLKDYKQAEKMCTKVLELDSRNVKALYRRAQAYL  492

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
            H  D DLAE DIKKALEI+P+NR+VK+EYK+LK+KV+E+NKKDA+FYG++FAK++K E  
Sbjct  493  HLVDLDLAEMDIKKALEIEPNNRDVKMEYKILKQKVREHNKKDAQFYGSIFAKMNKLEQ-  551

Query  313  SSNKSAPQE--AEAIDSKA  263
            +   +A QE     IDSKA
Sbjct  552  ARTATAKQEPVPMTIDSKA  570



>ref|NP_001118695.1| rotamase FKBP 1 [Arabidopsis thaliana]
 gb|AEE76997.1| rotamase FKBP 1 [Arabidopsis thaliana]
Length=562

 Score =   234 bits (598),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 143/175 (82%), Positives = 162/175 (93%), Gaps = 0/175 (0%)
 Frame = -2

Query  856  SYEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYD  677
            +YE++L++F KERESWDMNT+EKIEAA KKKEEGN  FK GKY+ ASKRYEK  KFIEYD
Sbjct  374  TYEVDLLTFDKERESWDMNTEEKIEAASKKKEEGNSKFKGGKYSLASKRYEKAVKFIEYD  433

Query  676  TSFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAY  497
            TSFSEEEKKQ+KALK++CNLN+AACKLKLKDYK+AEKLCTKVLELESTNVKALYRRAQAY
Sbjct  434  TSFSEEEKKQAKALKVACNLNDAACKLKLKDYKQAEKLCTKVLELESTNVKALYRRAQAY  493

Query  496  IHFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKL  332
            +  +D DLAEFD+KKALEIDP+NREVKLE K LKEK+KE+NKK+AKFYGNMFAKL
Sbjct  494  MELSDLDLAEFDVKKALEIDPNNREVKLEQKRLKEKMKEFNKKEAKFYGNMFAKL  548



>dbj|BAK02378.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=560

 Score =   234 bits (597),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 144/185 (78%), Positives = 162/185 (88%), Gaps = 0/185 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSFVK++ESWDM+  EKIEAAG KKEEGN LFK GKYARASKRYEK AK IEYDT
Sbjct  376  YEVELVSFVKDKESWDMDNSEKIEAAGTKKEEGNALFKLGKYARASKRYEKAAKIIEYDT  435

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSE+EKKQSK LKI+CNLNNAACKLKLKDYK+AEKLCTKVLEL+S NVKALYRR+QAY 
Sbjct  436  SFSEDEKKQSKQLKITCNLNNAACKLKLKDYKQAEKLCTKVLELDSRNVKALYRRSQAYT  495

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
              AD +LAE DIKKALEIDP+NR+VKL YK LKEK+KE NKKDAKFY NMF+K+++P   
Sbjct  496  QLADLELAEVDIKKALEIDPENRDVKLTYKTLKEKIKEINKKDAKFYSNMFSKMTRPSAE  555

Query  313  SSNKS  299
             S K+
Sbjct  556  ESQKA  560



>ref|XP_004504385.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X1 [Cicer 
arietinum]
Length=571

 Score =   234 bits (598),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 178/202 (88%), Gaps = 8/202 (4%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGA-KFIEYD  677
            YE+EL+SFVKE+ESWD+NTQEKIEAAGKKKEEGN LFKA K+ RAS RYEK A K+IEYD
Sbjct  373  YEVELISFVKEKESWDLNTQEKIEAAGKKKEEGNALFKASKHERASNRYEKVAIKYIEYD  432

Query  676  TSFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAY  497
            +SFS++EK+Q+KALKI+CNLNNAACKLKLKDYK+AEKLCTKVLEL+S NVKALYRRAQA+
Sbjct  433  SSFSDKEKQQAKALKITCNLNNAACKLKLKDYKQAEKLCTKVLELDSRNVKALYRRAQAH  492

Query  496  IHFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEP  317
            IH  D DLAE DIKKALEIDPDNR+VK+EYK+LK+KV+EYNKKDA+FYGN+FAKL+K E 
Sbjct  493  IHLVDLDLAEMDIKKALEIDPDNRDVKIEYKILKDKVREYNKKDAQFYGNIFAKLNKVEQ  552

Query  316  FSS----NKSAPQEAEAIDSKA  263
              +     +SAP    A+DSKA
Sbjct  553  ARTAAAKQESAPM---AVDSKA  571



>ref|XP_004973965.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X1 [Setaria 
italica]
 ref|XP_004973966.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X2 [Setaria 
italica]
Length=553

 Score =   234 bits (596),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 146/176 (83%), Positives = 161/176 (91%), Gaps = 0/176 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSFVK++ESWD+N +EKIEAAGKKKEEGN LFK GKYARASKRYEK AK+IEYD+
Sbjct  378  YEVELVSFVKDKESWDLNNEEKIEAAGKKKEEGNTLFKLGKYARASKRYEKAAKYIEYDS  437

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSE+EKKQSK LKISCNLNNAACKLKLKDYK+AEKLCTKVLEL+S NVKALYRR QAYI
Sbjct  438  SFSEDEKKQSKQLKISCNLNNAACKLKLKDYKQAEKLCTKVLELDSQNVKALYRRVQAYI  497

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSK  326
              AD +LAE DIKK LEIDPDNR+ KLEYK LKEK+KEYNKKDAKFY NMFAK++K
Sbjct  498  QLADLELAEADIKKGLEIDPDNRDFKLEYKTLKEKIKEYNKKDAKFYSNMFAKMTK  553



>ref|XP_006659596.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Oryza brachyantha]
Length=579

 Score =   234 bits (597),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 164/186 (88%), Gaps = 1/186 (1%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSFVK++ESWD+N  EKIEAA  KKEEGN LFK GKY +ASKRYEK AKFIEYD+
Sbjct  381  YEVELVSFVKDKESWDLNNVEKIEAALAKKEEGNALFKLGKYVKASKRYEKAAKFIEYDS  440

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSE+EKKQSK LK++CNLNNAACKLKLKDYK+AEKLCTKVLEL+S NVKALYRRAQAYI
Sbjct  441  SFSEDEKKQSKQLKVTCNLNNAACKLKLKDYKQAEKLCTKVLELDSQNVKALYRRAQAYI  500

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
              AD +LAE DIKKALEIDPDNR+VKL YK LKEKVKEYNKKDAKFY NMFAK++K +P 
Sbjct  501  QLADLELAEVDIKKALEIDPDNRDVKLTYKNLKEKVKEYNKKDAKFYSNMFAKMTK-QPA  559

Query  313  SSNKSA  296
              +K+ 
Sbjct  560  DDSKAG  565



>gb|KJB42564.1| hypothetical protein B456_007G157600 [Gossypium raimondii]
Length=516

 Score =   233 bits (593),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 138/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+E+VSF+K++ESWDMNT EKIEAAGKKKEEGNVLFK+GKYARASKRYEK  K+I+YD+
Sbjct  374  YEVEMVSFIKDKESWDMNTPEKIEAAGKKKEEGNVLFKSGKYARASKRYEKAVKYIDYDS  433

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSEEEKKQ+KALK++CNLNNAACKLKLKD+K+AEKLCTKVLE+ES+NVKALYRRAQAYI
Sbjct  434  SFSEEEKKQAKALKVACNLNNAACKLKLKDFKQAEKLCTKVLEIESSNVKALYRRAQAYI  493

Query  493  HFADFDLAEFDIKKALEIDPDNR  425
            H AD DLAEFD+KKALEIDPDNR
Sbjct  494  HLADLDLAEFDVKKALEIDPDNR  516



>gb|KHN10949.1| Peptidyl-prolyl cis-trans isomerase FKBP62 [Glycine soja]
Length=544

 Score =   233 bits (594),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 161/176 (91%), Gaps = 0/176 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            +E+ELVSF KE+ESWD+NT+EK+EAAGKKKEEGNVLFKAGK+ARASKRYEK  K+IEYD+
Sbjct  366  FEVELVSFEKEKESWDLNTEEKLEAAGKKKEEGNVLFKAGKHARASKRYEKAVKYIEYDS  425

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SF EEEKKQ+K LK++CNLNNAACKLKLKDYKEAEKLCTKVL+LESTNVKALYRRAQAY+
Sbjct  426  SFGEEEKKQAKTLKVACNLNNAACKLKLKDYKEAEKLCTKVLDLESTNVKALYRRAQAYM  485

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSK  326
               D DLAE DIKKALEIDP+NR+VKLEY+ LKEKVK  N+K+A+FYGNM  K++K
Sbjct  486  QLTDLDLAELDIKKALEIDPNNRDVKLEYRTLKEKVKANNRKEAQFYGNMINKMTK  541



>ref|XP_003574798.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase [Brachypodium distachyon]
Length=567

 Score =   233 bits (595),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSFVK++ESWD+N  EKIEAAG KKEEGN LFK  KYARASKRYEK AK IEYDT
Sbjct  381  YEVELVSFVKDKESWDLNNAEKIEAAGTKKEEGNALFKLSKYARASKRYEKAAKLIEYDT  440

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSE+EKKQSK LKI+CNLNNAACKLKLKDYK+AEKLCTKVLEL+S NVKALYRRAQAY 
Sbjct  441  SFSEDEKKQSKQLKITCNLNNAACKLKLKDYKQAEKLCTKVLELDSQNVKALYRRAQAYT  500

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKP  323
              AD +LAE DIKKALEI+PDNR+VKL YK LKEK+KE NKKDAKFY NMFAK++KP
Sbjct  501  QLADLELAETDIKKALEIEPDNRDVKLTYKNLKEKIKEINKKDAKFYSNMFAKMTKP  557



>ref|NP_199668.1| peptidyl-prolyl cis-trans isomerase FKBP65 [Arabidopsis thaliana]
 sp|Q9FJL3.1|FKB65_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase FKBP65; Short=PPIase 
FKBP65; AltName: Full=70 kDa peptidyl-prolyl isomerase; 
AltName: Full=FK506-binding protein 65; Short=AtFKBP65; 
AltName: Full=Immunophilin FKBP65; AltName: Full=Peptidyl-prolyl 
isomerase ROF2; AltName: Full=Protein ROTAMASE FKBP 2; 
AltName: Full=Rotamase [Arabidopsis thaliana]
 dbj|BAB10690.1| peptidylprolyl isomerase [Arabidopsis thaliana]
 gb|AED95689.1| peptidyl-prolyl cis-trans isomerase FKBP65 [Arabidopsis thaliana]
Length=578

 Score =   233 bits (594),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 150/199 (75%), Positives = 174/199 (87%), Gaps = 7/199 (4%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSF+KE+ESWDMNTQE+IEAAGKKKEEGNVLFKAGKYARASKRYE+G K+IEYD+
Sbjct  385  YEVELVSFIKEKESWDMNTQERIEAAGKKKEEGNVLFKAGKYARASKRYERGVKYIEYDS  444

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            +F EEEKK+SK LKI+CNLN+AACKLKLKDYKEA KL TKVLE++S NVKA+YRRA AY+
Sbjct  445  TFDEEEKKKSKDLKIACNLNDAACKLKLKDYKEAAKLSTKVLEMDSRNVKAMYRRAHAYL  504

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
              AD DLAE DIKKALEIDPDN+EVK+EYK LKEKVKEYNKKDAKFY NM +K+ +P   
Sbjct  505  ETADLDLAELDIKKALEIDPDNKEVKIEYKKLKEKVKEYNKKDAKFYSNMLSKMLEP---  561

Query  313  SSNKSAPQEAEA--IDSKA  263
              +K   +EA+A  ID+KA
Sbjct  562  --HKGTQKEAQAMSIDTKA  578



>dbj|BAE99990.1| peptidylprolyl isomerase [Arabidopsis thaliana]
Length=578

 Score =   233 bits (594),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 150/199 (75%), Positives = 174/199 (87%), Gaps = 7/199 (4%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSF+KE+ESWDMNTQE+IEAAGKKKEEGNVLFKAGKYARASKRYE+G K+IEYD+
Sbjct  385  YEVELVSFIKEKESWDMNTQERIEAAGKKKEEGNVLFKAGKYARASKRYERGVKYIEYDS  444

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            +F EEEKK+SK LKI+CNLN+AACKLKLKDYKEA KL TKVLE++S NVKA+YRRA AY+
Sbjct  445  TFDEEEKKKSKDLKIACNLNDAACKLKLKDYKEAAKLSTKVLEMDSRNVKAMYRRAHAYL  504

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
              AD DLAE DIKKALEIDPDN+EVK+EYK LKEKVKEYNKKDAKFY NM +K+ +P   
Sbjct  505  ETADLDLAELDIKKALEIDPDNKEVKIEYKKLKEKVKEYNKKDAKFYSNMLSKMLEP---  561

Query  313  SSNKSAPQEAEA--IDSKA  263
              +K   +EA+A  ID+KA
Sbjct  562  --HKGTQKEAQAMSIDTKA  578



>gb|KJB08782.1| hypothetical protein B456_001G103400 [Gossypium raimondii]
Length=516

 Score =   231 bits (590),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 125/143 (87%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSFVKE+ESWD+NTQEKIEAAGKKKEEGNVLFKAGKY RASKRYEK  K+I+YDT
Sbjct  374  YEVELVSFVKEKESWDLNTQEKIEAAGKKKEEGNVLFKAGKYVRASKRYEKAVKYIDYDT  433

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSEEEKKQSKALK++CNLN+AACKLKLKDYK+AEKLCTKVLELES NVKALYRRAQAYI
Sbjct  434  SFSEEEKKQSKALKVACNLNDAACKLKLKDYKQAEKLCTKVLELESANVKALYRRAQAYI  493

Query  493  HFADFDLAEFDIKKALEIDPDNR  425
            + AD DLAE DIKKALE+DPDNR
Sbjct  494  NLADLDLAELDIKKALELDPDNR  516



>gb|AGT17361.1| peptidylprolyl isomerase [Saccharum hybrid cultivar R570]
Length=590

 Score =   233 bits (595),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 143/200 (72%), Positives = 163/200 (82%), Gaps = 4/200 (2%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkke-eGNVLFKAGKYARASKRYEKGAKFIEYD  677
            YE+ELVSF KE+ESWD+ T  +   A  KK+ EGNV FK GKYA+ASKRYEK AK+IEYD
Sbjct  392  YEVELVSFEKEKESWDLKTNTEKIEAAAKKKDEGNVWFKMGKYAKASKRYEKAAKYIEYD  451

Query  676  TSFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAY  497
            +SFSE+EKKQSKALK+SC LNNAACKLKLK+Y+EAEKLCTKVLELESTNVKALYRRAQAY
Sbjct  452  SSFSEDEKKQSKALKVSCKLNNAACKLKLKEYREAEKLCTKVLELESTNVKALYRRAQAY  511

Query  496  IHFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEP  317
            I   D +LAE D+KKALEIDPDNR+VKL YK LKE+++EYN++DAKFYGNMFAK  K E 
Sbjct  512  IELVDLELAELDVKKALEIDPDNRDVKLVYKTLKERMREYNRRDAKFYGNMFAKWRKLEQ  571

Query  316  FS--SNKSAPQEAEAIDSKA  263
                  K  PQ   AIDS A
Sbjct  572  LQKVPGKQEPQPM-AIDSAA  590



>ref|XP_012078436.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Jatropha curcas]
 gb|KDP32575.1| hypothetical protein JCGZ_13125 [Jatropha curcas]
Length=579

 Score =   233 bits (594),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 151/200 (76%), Positives = 173/200 (87%), Gaps = 3/200 (2%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+E++SF KE+ESW+MNTQEKIEAAGKKKEEGN LFKAGKY RAS+RYEK   FIEYD+
Sbjct  380  YEVEMISFTKEKESWEMNTQEKIEAAGKKKEEGNALFKAGKYERASRRYEKAVSFIEYDS  439

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFS+EEKKQ+KALKI+C LNNAACKLKLKDYKEA KLCTKVLEL+  NVKALYRRAQAYI
Sbjct  440  SFSDEEKKQTKALKITCKLNNAACKLKLKDYKEAVKLCTKVLELDIRNVKALYRRAQAYI  499

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
               D DLAE DIKKALEIDPDNR+VKLEYK+LKEKV+EYNKKDA+FY N+F+K+SK E  
Sbjct  500  QLVDLDLAEMDIKKALEIDPDNRDVKLEYKILKEKVREYNKKDAQFYSNIFSKISKLEQT  559

Query  313  -SSNKSAPQE--AEAIDSKA  263
             S+N +  Q+    A+DSKA
Sbjct  560  KSANGTGKQDPMPMAVDSKA  579



>ref|XP_004247908.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Solanum lycopersicum]
Length=581

 Score =   232 bits (591),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 151/199 (76%), Positives = 174/199 (87%), Gaps = 5/199 (3%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSFVKE+ESWDM+TQEKIEAAGKKKEEGNVLFKAGKY RASKRYEK   FIEY++
Sbjct  386  YEVELVSFVKEKESWDMSTQEKIEAAGKKKEEGNVLFKAGKYVRASKRYEKAVSFIEYES  445

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFS++EK+Q+K LK++ NLNNAACKLKLK+YKEA KLC+KVLE++S NVKALYRRAQAYI
Sbjct  446  SFSDDEKQQAKLLKVTSNLNNAACKLKLKEYKEAAKLCSKVLEIDSKNVKALYRRAQAYI  505

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
               D DLAE DIKKALEIDPDNR+VKLEYKVLKEK+KEYNKKDA+FYGN+FAK++K E  
Sbjct  506  QLVDLDLAELDIKKALEIDPDNRDVKLEYKVLKEKIKEYNKKDAQFYGNIFAKMNKLEQS  565

Query  313  SS--NKSAPQEAEAIDSKA  263
                N++AP     IDSKA
Sbjct  566  GGAKNEAAPM---TIDSKA  581



>ref|XP_010547132.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP65-like [Tarenaya 
hassleriana]
Length=573

 Score =   231 bits (589),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 148/199 (74%), Positives = 171/199 (86%), Gaps = 7/199 (4%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            +E+ELVSFVKE+ESWDMNTQEKIEAAG+KKEEGN LFKAGKY RASKRYEKG ++IEY++
Sbjct  380  FEVELVSFVKEKESWDMNTQEKIEAAGRKKEEGNALFKAGKYDRASKRYEKGVRYIEYES  439

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            S  EEEKKQ+KALKISCNLNNAACKLK KDYK+  KLCTKVLE+E  NVKALYRRA+AYI
Sbjct  440  SLGEEEKKQAKALKISCNLNNAACKLKQKDYKQVVKLCTKVLEMEGRNVKALYRRAEAYI  499

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
              AD +LAE DIKKALEIDPDN+EVK EYK LKEK KEYNKKDA+FY NM AK+ +P   
Sbjct  500  ETADLELAEIDIKKALEIDPDNKEVKREYKKLKEKEKEYNKKDARFYSNMLAKMLEP---  556

Query  313  SSNKSAPQEAE--AIDSKA  263
              +K+A +EA+  +ID+KA
Sbjct  557  --HKTAKKEAQPMSIDAKA  573



>gb|EEC83911.1| hypothetical protein OsI_29964 [Oryza sativa Indica Group]
 gb|EEE69029.1| hypothetical protein OsJ_28006 [Oryza sativa Japonica Group]
Length=583

 Score =   231 bits (589),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 142/189 (75%), Positives = 159/189 (84%), Gaps = 4/189 (2%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSFVK++ESWD+N  EKIE AG KKEEGN LFK GKY RASKRYEK AKFIEYD+
Sbjct  381  YEVELVSFVKDKESWDLNNTEKIETAGAKKEEGNALFKLGKYVRASKRYEKAAKFIEYDS  440

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSE+EKKQSK LK++CNLNNAACKLKLKDYK+AEKLCTKVLEL+S NVKALYRRAQAY+
Sbjct  441  SFSEDEKKQSKQLKVTCNLNNAACKLKLKDYKQAEKLCTKVLELDSQNVKALYRRAQAYM  500

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykv---lkekvkeynkKDAKFYGNMFAKLSKP  323
              AD +LAE DIKKALEIDPDNR+V         LKEKVKEYNKKDAKFY NMFAK++K 
Sbjct  501  QLADLELAEVDIKKALEIDPDNRQVLDVKLTYKNLKEKVKEYNKKDAKFYSNMFAKMTK-  559

Query  322  EPFSSNKSA  296
            +P    K+ 
Sbjct  560  QPAEDGKAG  568



>ref|NP_001052535.1| Os04g0352400 [Oryza sativa Japonica Group]
 gb|AAD29708.2|AF140495_1 FK506-binding protein [Oryza sativa Japonica Group]
 emb|CAE05842.2| OSJNBa0091C07.4 [Oryza sativa Japonica Group]
 dbj|BAF14449.1| Os04g0352400 [Oryza sativa Japonica Group]
 gb|EAZ30344.1| hypothetical protein OsJ_14391 [Oryza sativa Japonica Group]
 dbj|BAG94794.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC77072.1| hypothetical protein OsI_15470 [Oryza sativa Indica Group]
Length=585

 Score =   231 bits (589),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 151/202 (75%), Positives = 172/202 (85%), Gaps = 6/202 (3%)
 Frame = -2

Query  853  YEIELVSFVKERESWDM-NTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYD  677
            YE+ELVSF KE+ESWD+ +  EKIEAA KKK+EGNV FK GKYA+ASKRYEK AK+IEYD
Sbjct  385  YEVELVSFEKEKESWDLKDNAEKIEAAAKKKDEGNVWFKMGKYAKASKRYEKAAKYIEYD  444

Query  676  TSFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAY  497
            +SF+++EKKQSKALK+SC LNNAACKLKLK+Y+EAEKLCTKVLELESTNVKALYRR QAY
Sbjct  445  SSFTDDEKKQSKALKVSCKLNNAACKLKLKEYREAEKLCTKVLELESTNVKALYRRTQAY  504

Query  496  IHFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEP  317
            I  AD +LAE D+KKALEIDPDNR+VK+ YK LKEK+KEYNK+DAKFYGNMFAK  K E 
Sbjct  505  IELADLELAELDVKKALEIDPDNRDVKMVYKTLKEKIKEYNKRDAKFYGNMFAKWRKLE-  563

Query  316  FSSNKSAP--QEAE--AIDSKA  263
               NK  P  QEA+  AIDS A
Sbjct  564  HMENKKVPGKQEAQPMAIDSAA  585



>ref|XP_003532733.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Glycine max]
Length=570

 Score =   230 bits (587),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 145/199 (73%), Positives = 175/199 (88%), Gaps = 3/199 (2%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+EL+SF+KE+ESWD+NTQEKIEAAGKKKEEGN LFK GKY RASKRYEK  KF+EYD+
Sbjct  373  YEVELLSFIKEKESWDLNTQEKIEAAGKKKEEGNALFKVGKYERASKRYEKAIKFVEYDS  432

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFS+EEK+++KALKI+CNLNNAACKLKLKDYK+AEK+CTKVLEL+S NVKALYRRAQ Y+
Sbjct  433  SFSDEEKQKTKALKITCNLNNAACKLKLKDYKQAEKMCTKVLELDSRNVKALYRRAQGYL  492

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
            H  D DLAE DIKKALEI+PDNR+VK+EYK+LK+KV+EYNKKDA+FY ++FAK++K E  
Sbjct  493  HLVDLDLAEMDIKKALEIEPDNRDVKMEYKILKQKVREYNKKDAQFYSSIFAKMNKLEQ-  551

Query  313  SSNKSAPQE--AEAIDSKA  263
            +   +A QE     IDS+A
Sbjct  552  ARTATAKQEPVPMTIDSEA  570



>gb|EMT24309.1| 70 kDa peptidyl-prolyl isomerase [Aegilops tauschii]
Length=611

 Score =   231 bits (588),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 153/188 (81%), Gaps = 11/188 (6%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSFVK++ESWD+N  EKIEAAG KKEEGN LFK+GKYARASKRYEK AKFI+YDT
Sbjct  376  YEVELVSFVKDKESWDLNNSEKIEAAGTKKEEGNALFKSGKYARASKRYEKAAKFIDYDT  435

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSE+EKKQSK LKI+CNLNNAACKLKLKDYK+AEKLCTKVLEL+S NVKALYRRAQAY 
Sbjct  436  SFSEDEKKQSKQLKITCNLNNAACKLKLKDYKQAEKLCTKVLELDSQNVKALYRRAQAYT  495

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkey-----------nkKDAKFYGN  347
              AD +LAE DIKKALEIDP+NR+V  +       VK             NKKDAKFY N
Sbjct  496  QLADLELAEVDIKKALEIDPENRQVPQKVAASDRDVKLTYKTLKEKIKEINKKDAKFYSN  555

Query  346  MFAKLSKP  323
            MF+K++KP
Sbjct  556  MFSKMTKP  563



>gb|KHN12365.1| Peptidyl-prolyl cis-trans isomerase FKBP65 [Glycine soja]
Length=570

 Score =   230 bits (586),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 144/199 (72%), Positives = 175/199 (88%), Gaps = 3/199 (2%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+EL+SF+KE+E WD+NTQEKIEAAGKKKEEGN LFK GKY RASKRYEK  KF+EYD+
Sbjct  373  YEVELLSFIKEKELWDLNTQEKIEAAGKKKEEGNALFKVGKYERASKRYEKAIKFVEYDS  432

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFS+EE++++KALKI+CNLNNAACKLKLKDYK+AEK+CTKVLEL+S NVKALYRRAQ Y+
Sbjct  433  SFSDEERQKTKALKITCNLNNAACKLKLKDYKQAEKMCTKVLELDSRNVKALYRRAQGYL  492

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
            H  D DLAE DIKKALEI+PDNR+VK+EYK+LK+KV+EYNKKDA+FYG++FAK++K E  
Sbjct  493  HLVDLDLAEMDIKKALEIEPDNRDVKMEYKILKQKVREYNKKDAQFYGSIFAKMNKLEQ-  551

Query  313  SSNKSAPQE--AEAIDSKA  263
            +   +A QE     IDS+A
Sbjct  552  ARTATAKQEPVPMTIDSEA  570



>tpg|DAA48154.1| TPA: hypothetical protein ZEAMMB73_593378 [Zea mays]
Length=239

 Score =   220 bits (560),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 135/203 (67%), Positives = 148/203 (73%), Gaps = 27/203 (13%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+EL+SFVK++ESWD+N +EKIEAAGKKKEEGN LFK+GKYARASKRYEK AK+IEYDT
Sbjct  37   YEVELISFVKDKESWDLNNEEKIEAAGKKKEEGNALFKSGKYARASKRYEKAAKYIEYDT  96

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSE+EKKQSK LKISCNLNNAACKLKLKDYKEA KLCTKVLEL+S NVKALYRR QAYI
Sbjct  97   SFSEDEKKQSKQLKISCNLNNAACKLKLKDYKEAAKLCTKVLELDSQNVKALYRRVQAYI  156

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkey---------------------  377
              AD +LAE DIKKALEIDPDNR                                     
Sbjct  157  QLADLELAEADIKKALEIDPDNRYSLGNGFCKAGSTLITYHADNFGNNPRDVKLEYKILK  216

Query  376  ------nkKDAKFYGNMFAKLSK  326
                  NKKDAKFY NMFAK++K
Sbjct  217  EKIKEYNKKDAKFYSNMFAKMTK  239



>gb|ABK24451.1| unknown [Picea sitchensis]
Length=578

 Score =   229 bits (585),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 151/194 (78%), Positives = 171/194 (88%), Gaps = 0/194 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            Y++ELVSFVKE+ESWDM+T EKIEAAGKKKEEGN LFK GKY RASK+Y+K AK+IEYDT
Sbjct  370  YDVELVSFVKEKESWDMSTAEKIEAAGKKKEEGNALFKVGKYFRASKKYKKAAKYIEYDT  429

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSEEEKKQSK LKI+CNLNNAACKLKLKDY +AEKLCTKVLE+ES NVKALYRRAQ+YI
Sbjct  430  SFSEEEKKQSKPLKITCNLNNAACKLKLKDYTQAEKLCTKVLEIESQNVKALYRRAQSYI  489

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
              AD +LAE DIKKALEIDP+NR+VKLEY+ LKEK KEYNKK+AKFYGNMFA++SK E  
Sbjct  490  QTADLELAEIDIKKALEIDPNNRDVKLEYRALKEKQKEYNKKEAKFYGNMFARMSKLEEL  549

Query  313  SSNKSAPQEAEAID  272
             S KS  Q+ E +D
Sbjct  550  ESRKSGSQKVETVD  563



>ref|XP_002865651.1| hypothetical protein ARALYDRAFT_494919 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41910.1| hypothetical protein ARALYDRAFT_494919 [Arabidopsis lyrata subsp. 
lyrata]
Length=570

 Score =   228 bits (582),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 145/197 (74%), Positives = 171/197 (87%), Gaps = 9/197 (5%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+E+VSF+KE+ESWDMNTQEKIEAAGKKKEEGN+LFKAGKYARASKRYE+G K+IEYD+
Sbjct  383  YEVEMVSFIKEKESWDMNTQEKIEAAGKKKEEGNMLFKAGKYARASKRYERGVKYIEYDS  442

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            +F EEEKK+++ LKI+CNLN+AACKLKLKDYKEA KL TKVLE++S NVKA+YRRA AY+
Sbjct  443  TFDEEEKKKARDLKIACNLNDAACKLKLKDYKEAAKLSTKVLEMDSRNVKAMYRRAHAYM  502

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
              AD DLAE DIKKALEIDPDN+EVK+EYK LKEKVKEYNKKDAKFYGNM +K+ +P   
Sbjct  503  ETADLDLAELDIKKALEIDPDNKEVKIEYKKLKEKVKEYNKKDAKFYGNMLSKMLEPH--  560

Query  313  SSNKSAPQEAEAIDSKA  263
                   + A +ID+KA
Sbjct  561  -------KGAMSIDTKA  570



>gb|ABK95085.1| unknown [Populus trichocarpa]
Length=608

 Score =   229 bits (584),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 166/189 (88%), Gaps = 2/189 (1%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+E++SF KE+ESWDMNTQEKIEAAGKKKEEGN  FKAGKY RAS+RYEK AKFIEYD+
Sbjct  379  YEVEMISFTKEKESWDMNTQEKIEAAGKKKEEGNAWFKAGKYERASRRYEKAAKFIEYDS  438

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SF++EEK+QSK LKISC LNNAACKLKLKDYKEAEKLC+KVLEL+  NVKALYRRAQAYI
Sbjct  439  SFTDEEKQQSKVLKISCKLNNAACKLKLKDYKEAEKLCSKVLELDGQNVKALYRRAQAYI  498

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
               D DLAE DIK+ALEIDPDNR+VKLE K+LK+KV+EYNKK+A+FY N+FAK++K E  
Sbjct  499  QLVDLDLAEIDIKRALEIDPDNRDVKLENKILKDKVREYNKKEAQFYSNIFAKMNKLEQT  558

Query  313  SS--NKSAP  293
            +S  N+  P
Sbjct  559  NSTVNRQNP  567



>ref|XP_003547780.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Glycine 
max]
Length=574

 Score =   228 bits (582),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 155/199 (78%), Positives = 176/199 (88%), Gaps = 2/199 (1%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YEIELVSF KE+ESWDM+T EKIEAAGKKKEEGN LFKAGKYARASKRYEK  KFIEYDT
Sbjct  376  YEIELVSFEKEKESWDMDTPEKIEAAGKKKEEGNALFKAGKYARASKRYEKAVKFIEYDT  435

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            +FSEEEKK SK+LK++CNLNNAACKLKLKDYK+AEKLCTKVL+LESTNVKALYRR QAYI
Sbjct  436  AFSEEEKKSSKSLKVACNLNNAACKLKLKDYKQAEKLCTKVLDLESTNVKALYRRTQAYI  495

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
              AD DLAEFDIKKALE++P+NR+VKLEY  LKEK+KEYNKK+AKFYGNMF KL K +  
Sbjct  496  QLADLDLAEFDIKKALELEPNNRDVKLEYVTLKEKMKEYNKKEAKFYGNMFNKLHKLDSL  555

Query  313  SSNKSAPQEAEA--IDSKA  263
             ++K A ++A+   IDSK+
Sbjct  556  DNSKPASKDAQPINIDSKS  574



>ref|XP_006375512.1| hypothetical protein POPTR_0014s14690g [Populus trichocarpa]
 gb|ERP53309.1| hypothetical protein POPTR_0014s14690g [Populus trichocarpa]
Length=608

 Score =   229 bits (583),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 166/189 (88%), Gaps = 2/189 (1%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+E++SF KE+ESWDMNTQEKIEAAGKKKEEGN  FKAGKY RAS+RYEK AKFIEYD+
Sbjct  379  YEVEMISFTKEKESWDMNTQEKIEAAGKKKEEGNAWFKAGKYERASRRYEKAAKFIEYDS  438

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SF++EEK+QSK LKISC LNNAACKLKLKDYKEAEKLC+KVLEL+  NVKALYRRAQAYI
Sbjct  439  SFTDEEKQQSKVLKISCKLNNAACKLKLKDYKEAEKLCSKVLELDGKNVKALYRRAQAYI  498

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
               D DLAE DIK+ALEIDPDNR+VKLE K+LK+KV+EYNKK+A+FY N+FAK++K E  
Sbjct  499  QLVDLDLAEIDIKRALEIDPDNRDVKLENKILKDKVREYNKKEAQFYSNIFAKMNKLEQT  558

Query  313  SS--NKSAP  293
            +S  N+  P
Sbjct  559  NSTVNRQNP  567



>gb|AFK48238.1| unknown [Lotus japonicus]
Length=547

 Score =   228 bits (580),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 141/176 (80%), Positives = 159/176 (90%), Gaps = 0/176 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSF KE+ESWD+NTQEKIEAAGKKKEEGNVLFKAGKYARASKRY+K  K++EYDT
Sbjct  369  YEVELVSFEKEKESWDLNTQEKIEAAGKKKEEGNVLFKAGKYARASKRYDKAVKYVEYDT  428

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSEEEKKQSK LK++CNLNNAACKLKL D+ EAEKLCT+VL LESTNVKALYRRA+A +
Sbjct  429  SFSEEEKKQSKTLKVACNLNNAACKLKLNDFIEAEKLCTRVLNLESTNVKALYRRAEALM  488

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSK  326
              AD DLAE DIKKA E+DPDNREVKL+YK LKEKVKE+NKK+A+FYGNM  K +K
Sbjct  489  QLADLDLAELDIKKAFEVDPDNREVKLQYKTLKEKVKEFNKKEARFYGNMLNKFTK  544



>ref|XP_004296967.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Fragaria 
vesca subsp. vesca]
Length=566

 Score =   228 bits (581),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 147/197 (75%), Positives = 170/197 (86%), Gaps = 9/197 (5%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSFVKE+ESWDMNTQEKIEAAGKKKEEGN LFKA KY RASKRYEK  ++IEYD+
Sbjct  379  YEVELVSFVKEKESWDMNTQEKIEAAGKKKEEGNALFKAAKYERASKRYEKAVRYIEYDS  438

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFS++EK+Q++ LKI+CNLN+AACKLKLK YKEAEKLCTKVLEL+S NVKALYRRAQAYI
Sbjct  439  SFSDDEKQQARVLKITCNLNDAACKLKLKKYKEAEKLCTKVLELDSRNVKALYRRAQAYI  498

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
               D DLAE DIKKALEI+P+N++VKLEYK+LKEKV+EYNKKDA+FYGN+FAK+SK +P 
Sbjct  499  QLVDLDLAEQDIKKALEIEPNNKDVKLEYKLLKEKVREYNKKDAQFYGNIFAKMSKHDPV  558

Query  313  SSNKSAPQEAEAIDSKA  263
                        IDSKA
Sbjct  559  PMT---------IDSKA  566



>ref|XP_006395163.1| hypothetical protein EUTSA_v10003906mg [Eutrema salsugineum]
 gb|ESQ32449.1| hypothetical protein EUTSA_v10003906mg [Eutrema salsugineum]
Length=573

 Score =   228 bits (581),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 148/199 (74%), Positives = 172/199 (86%), Gaps = 7/199 (4%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            +E+ELVSF+KE+ESWDMNTQEKIEAAGKKKEEGN LFKAGKY RASKRY++G ++IEYD+
Sbjct  380  FEVELVSFIKEKESWDMNTQEKIEAAGKKKEEGNALFKAGKYTRASKRYKRGVEYIEYDS  439

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            +F EEEKK+++ALKISCNLNNAACKLKLKDYKEA K  TKVLE++  NVKALYRRA AY+
Sbjct  440  TFDEEEKKKAQALKISCNLNNAACKLKLKDYKEAAKFSTKVLEMDGGNVKALYRRAHAYM  499

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
              AD DLAE DIKKALEIDPDN+EVK+EYK LKEKVKEYNKKDAKFY NM AK+ +P   
Sbjct  500  EMADLDLAELDIKKALEIDPDNKEVKMEYKKLKEKVKEYNKKDAKFYSNMLAKMLEP---  556

Query  313  SSNKSAPQEAEA--IDSKA  263
              +K A +EA+A  ID+KA
Sbjct  557  --HKEARKEAQAMSIDTKA  573



>dbj|BAK01956.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=589

 Score =   228 bits (581),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 141/198 (71%), Positives = 162/198 (82%), Gaps = 2/198 (1%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkke-eGNVLFKAGKYARASKRYEKGAKFIEYD  677
            YE+ELVSF KE+ESWD+ +  +   A  KK+ EGNV FK GKYA+ASKRYEK AK+IEYD
Sbjct  393  YEVELVSFEKEKESWDLKSNAEKIEAASKKKDEGNVWFKMGKYAKASKRYEKAAKYIEYD  452

Query  676  TSFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAY  497
            +SFSE+EKKQ+KA+KIS  LNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAY
Sbjct  453  SSFSEDEKKQTKAVKISIKLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAY  512

Query  496  IHFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEP  317
                D +LAE DIKKALEIDPDNREVK+ YK LK+K++EYNK+DAKFYGNMFAK  K E 
Sbjct  513  TQLVDLELAELDIKKALEIDPDNREVKVAYKALKDKLREYNKRDAKFYGNMFAKWRKTE-  571

Query  316  FSSNKSAPQEAEAIDSKA  263
             ++ K    +  AIDS A
Sbjct  572  NAAGKQQDAQPMAIDSTA  589



>ref|XP_011000005.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X1 [Populus euphratica]
Length=608

 Score =   228 bits (582),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 166/189 (88%), Gaps = 2/189 (1%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+E++SF KE+ESWDMNTQEKIEAAGKKKEEGN  FKAGKY RAS+RYEK AKFIEYD+
Sbjct  379  YEVEMISFTKEKESWDMNTQEKIEAAGKKKEEGNAWFKAGKYERASRRYEKAAKFIEYDS  438

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SF++EEK+QSK LKISC LNNAACKLKLKDYKEAEKLC+KVLEL+  NVKALYRRAQAYI
Sbjct  439  SFTDEEKQQSKVLKISCKLNNAACKLKLKDYKEAEKLCSKVLELDGQNVKALYRRAQAYI  498

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
               D DLAE DIK+ALEIDPDNR+VKLEYK+LK+KV+EY KK+A+FY N+FAK++K E  
Sbjct  499  QLVDLDLAEIDIKRALEIDPDNRDVKLEYKILKDKVREYKKKEAQFYSNIFAKMNKLEQT  558

Query  313  SS--NKSAP  293
            +S  N+  P
Sbjct  559  NSTVNRRNP  567



>gb|EMS57053.1| 70 kDa peptidyl-prolyl isomerase [Triticum urartu]
Length=582

 Score =   228 bits (580),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 143/200 (72%), Positives = 163/200 (82%), Gaps = 7/200 (4%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkke-eGNVLFKAGKYARASKRYEKGAKFIEYD  677
            YE+ELVSF KE+ESWD+ +  +   A  KK+ EGN  FK GKYA+ASKRYEK AK+IEYD
Sbjct  387  YEVELVSFDKEKESWDLKSNAEKIEAAAKKKDEGNAWFKMGKYAKASKRYEKAAKYIEYD  446

Query  676  TSFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAY  497
            +SFSE+EKKQSKA+KIS  LNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAY
Sbjct  447  SSFSEDEKKQSKAVKISIKLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAY  506

Query  496  IHFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEP  317
                D +LAE DIKKALEIDPDNREVK+ YK LK+K++EYNK+DAKFYGNMFAK  K E 
Sbjct  507  TELVDLELAELDIKKALEIDPDNREVKVAYKALKDKLREYNKRDAKFYGNMFAKWRKTE-  565

Query  316  FSSNKSAPQEAE--AIDSKA  263
               N +  Q+A+  AIDS A
Sbjct  566  ---NAAGKQDAQPMAIDSTA  582



>ref|XP_003552100.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Glycine 
max]
Length=544

 Score =   226 bits (577),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 137/176 (78%), Positives = 161/176 (91%), Gaps = 0/176 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            +E+ELVSF KE+ESWD+NT+EK+EAAGKKKEEGNVLFKA KYARASKRYEK  K+IEYD+
Sbjct  366  FEVELVSFEKEKESWDLNTEEKLEAAGKKKEEGNVLFKASKYARASKRYEKAVKYIEYDS  425

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SF EEEKKQ+K LK++CNLNNAACKLKLKDYKEAEKLCTKVL+LESTNVKALYRRAQA++
Sbjct  426  SFGEEEKKQAKTLKVACNLNNAACKLKLKDYKEAEKLCTKVLDLESTNVKALYRRAQAHM  485

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSK  326
               + DLAE DIKKAL+IDP+NR+VKLEY+ LKEKVKE N+K+A+FYGNM  K++K
Sbjct  486  QLTNLDLAELDIKKALDIDPNNRDVKLEYRTLKEKVKENNRKEAQFYGNMINKMTK  541



>ref|XP_006652190.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Oryza brachyantha]
Length=570

 Score =   227 bits (578),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 151/202 (75%), Positives = 170/202 (84%), Gaps = 6/202 (3%)
 Frame = -2

Query  853  YEIELVSFVKERESWDM-NTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYD  677
            YE+EL SF KE+ESWD+ +  EKIEAA KKK+EGNV FK GKYA+ASKRYEK AKF+EYD
Sbjct  370  YEVELGSFEKEKESWDLKDNAEKIEAAAKKKDEGNVWFKMGKYAKASKRYEKAAKFVEYD  429

Query  676  TSFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAY  497
            +SFS++EKKQSKALK+S  LNNAACKLKLK+YKEAEKLCTKVLELE TNVKALYRRAQAY
Sbjct  430  SSFSDDEKKQSKALKVSTKLNNAACKLKLKEYKEAEKLCTKVLELECTNVKALYRRAQAY  489

Query  496  IHFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEP  317
            I  AD +LAE D+KKALEIDPDNR+VK+ YK LKEK+KEYNK+DAKFYGNMFAK  K E 
Sbjct  490  IQLADLELAELDVKKALEIDPDNRDVKMVYKTLKEKIKEYNKRDAKFYGNMFAKWRKLEH  549

Query  316  FSSNKSAP--QEAE--AIDSKA  263
               NK  P  QEA+  AIDS A
Sbjct  550  M-ENKKVPGKQEAQPMAIDSAA  570



>ref|XP_007140683.1| hypothetical protein PHAVU_008G133100g [Phaseolus vulgaris]
 ref|XP_007140684.1| hypothetical protein PHAVU_008G133100g [Phaseolus vulgaris]
 gb|ESW12677.1| hypothetical protein PHAVU_008G133100g [Phaseolus vulgaris]
 gb|ESW12678.1| hypothetical protein PHAVU_008G133100g [Phaseolus vulgaris]
Length=544

 Score =   226 bits (576),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 159/176 (90%), Gaps = 0/176 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            +E+ELVSF KE+ESWD+NT+EK+EAAGKKKEEGNVLFKAGKY RASKRYEK  K IEYD+
Sbjct  366  FEVELVSFEKEKESWDLNTEEKLEAAGKKKEEGNVLFKAGKYVRASKRYEKAVKHIEYDS  425

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SF EEEKK +K LK++CNLNNAACKLKLKDYKEAEKL TKVL+LESTNVKALYRRAQAY+
Sbjct  426  SFGEEEKKLAKTLKVACNLNNAACKLKLKDYKEAEKLSTKVLDLESTNVKALYRRAQAYM  485

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSK  326
               DFDLAE D+KKALEIDP+NR++KLEYK L+EKVKE N+K+A+FYGNM  KL+K
Sbjct  486  QLTDFDLAELDLKKALEIDPNNRDLKLEYKTLREKVKENNRKEAQFYGNMINKLTK  541



>ref|XP_004975324.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X2 [Setaria 
italica]
Length=594

 Score =   226 bits (576),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 144/202 (71%), Positives = 165/202 (82%), Gaps = 6/202 (3%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQeki-eaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYD  677
            YE+ELVSF K++ESWD+ +  +  EAA KKK+EGN  FK GKYA+ASKRYEK AK+IEYD
Sbjct  394  YEVELVSFEKDKESWDLKSNAEKIEAAAKKKDEGNAWFKMGKYAKASKRYEKAAKYIEYD  453

Query  676  TSFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAY  497
            +SFSE+EKKQSKALKISC LNNAACKLKLK+Y+EAEKLCTKVLELESTNVKALYRRAQAY
Sbjct  454  SSFSEDEKKQSKALKISCKLNNAACKLKLKEYREAEKLCTKVLELESTNVKALYRRAQAY  513

Query  496  IHFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEP  317
            I   D +LAE D+KKALE DPDNR+VKL YK LKEK++EYN++DAKFYGNMFAK  K E 
Sbjct  514  IELVDLELAELDVKKALEFDPDNRDVKLVYKTLKEKMREYNRRDAKFYGNMFAKWRKLEH  573

Query  316  FSS----NKSAPQEAEAIDSKA  263
              +     K  PQ   AIDS A
Sbjct  574  MDTKKVPGKQEPQPM-AIDSAA  594



>emb|CAA68913.1| peptidylprolyl isomerase [Triticum aestivum]
Length=568

 Score =   225 bits (573),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 137/196 (70%), Positives = 160/196 (82%), Gaps = 5/196 (3%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkke-eGNVLFKAGKYARASKRYEKGAKFIEYD  677
            YE+ELVSF KE+ESWD+ +  +   A  +K+ EGN  FK GKYA+ASKRYEK AK+IEYD
Sbjct  373  YEVELVSFEKEKESWDLKSNSEKIEAASEKKDEGNAWFKMGKYAKASKRYEKAAKYIEYD  432

Query  676  TSFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAY  497
            +SFSE+EKKQSKA+KIS  LNNAACKLKLKDYKEAEK+C+KVLELESTNVKALYRRAQAY
Sbjct  433  SSFSEDEKKQSKAVKISIKLNNAACKLKLKDYKEAEKICSKVLELESTNVKALYRRAQAY  492

Query  496  IHFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEP  317
                D +LAE DIKKALEIDPDNREVK+ YK LK+K++EYNK+DAKFYGNMFAK  K E 
Sbjct  493  TELVDLELAELDIKKALEIDPDNREVKVAYKALKDKLREYNKRDAKFYGNMFAKWRKTE-  551

Query  316  FSSNKSAPQEAEAIDS  269
               N +  QEA+ + S
Sbjct  552  ---NAAGKQEAQPMAS  564



>ref|XP_010023594.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X2 [Eucalyptus grandis]
 gb|KCW59903.1| hypothetical protein EUGRSUZ_H02629 [Eucalyptus grandis]
Length=587

 Score =   225 bits (573),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 146/200 (73%), Positives = 170/200 (85%), Gaps = 3/200 (2%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+EL+SFVKE+ESW+MN QEKIEAA +KKEEGN  FKAGKY RASKRYEK  +FIEYD+
Sbjct  388  YEVELLSFVKEKESWEMNNQEKIEAAARKKEEGNAAFKAGKYVRASKRYEKAVRFIEYDS  447

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFS+EEK+Q+K LK +CNLN+AACKLKLKD+KEAEKLCTKVLE +  NVKALYRRAQAYI
Sbjct  448  SFSDEEKQQAKTLKNTCNLNDAACKLKLKDFKEAEKLCTKVLEGDGKNVKALYRRAQAYI  507

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPE-P  317
               D DLAE DIKKALEIDP+NR+VKLEYK+LKEKV+EYNK+DA+FYGNMFAK++K E  
Sbjct  508  QLVDLDLAEQDIKKALEIDPNNRDVKLEYKILKEKVREYNKRDAQFYGNMFAKMNKLEHS  567

Query  316  FSSNKSAPQEAE--AIDSKA  263
             ++   A  EA    IDSKA
Sbjct  568  RTAGMGAKHEAAPMTIDSKA  587



>ref|XP_008669632.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Zea mays]
 tpg|DAA38461.1| TPA: hypothetical protein ZEAMMB73_460939 [Zea mays]
Length=588

 Score =   224 bits (572),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 139/200 (70%), Positives = 161/200 (81%), Gaps = 4/200 (2%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkke-eGNVLFKAGKYARASKRYEKGAKFIEYD  677
            YE+ELVSF KE+ESWD+ T  +   A  KK+ EGNV FK GKYA+ASKRYEK AK+IEYD
Sbjct  390  YEVELVSFEKEKESWDLKTNIEKIEAAAKKKDEGNVWFKMGKYAKASKRYEKAAKYIEYD  449

Query  676  TSFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAY  497
            +SF+E+EKKQSKALK+S  LNNAACKLK+K+Y+EAEKLCTKVLELESTNVKALYRRAQAY
Sbjct  450  SSFNEDEKKQSKALKVSSKLNNAACKLKMKEYREAEKLCTKVLELESTNVKALYRRAQAY  509

Query  496  IHFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEP  317
            I   D +LAE D+KKALEIDPDNR+VKL YK LKE+++EYN++DA FYGNMFAK  K E 
Sbjct  510  IELVDLELAELDVKKALEIDPDNRDVKLVYKTLKERMREYNRRDAMFYGNMFAKWRKLEQ  569

Query  316  FS--SNKSAPQEAEAIDSKA  263
                  K  PQ   AIDS A
Sbjct  570  LQKVPGKQEPQPM-AIDSAA  588



>ref|XP_007034165.1| FKBP-type peptidyl-prolyl cis-trans isomerase family protein 
isoform 4 [Theobroma cacao]
 gb|EOY05091.1| FKBP-type peptidyl-prolyl cis-trans isomerase family protein 
isoform 4 [Theobroma cacao]
Length=533

 Score =   223 bits (567),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+E+VSFVKE+ESWDMNTQEKIEAAGKKKEEGN L+KAGKY RASKRYEK  KFIEYD+
Sbjct  379  YEVEMVSFVKEKESWDMNTQEKIEAAGKKKEEGNALYKAGKYERASKRYEKAVKFIEYDS  438

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFS+EEK+Q+K LKI+CNLNNAACKLKLKDYKEAEKLCTKVLEL++ NVKALYRRAQAYI
Sbjct  439  SFSDEEKQQTKLLKITCNLNNAACKLKLKDYKEAEKLCTKVLELDNKNVKALYRRAQAYI  498

Query  493  HFADFDLAEFDIKKALEIDPDNR  425
               D DLAE DIKKALEIDPDNR
Sbjct  499  QIVDLDLAEVDIKKALEIDPDNR  521



>gb|EMT25795.1| 70 kDa peptidyl-prolyl isomerase [Aegilops tauschii]
Length=587

 Score =   223 bits (569),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 139/198 (70%), Positives = 161/198 (81%), Gaps = 3/198 (2%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkke-eGNVLFKAGKYARASKRYEKGAKFIEYD  677
            YE++LVSF KE+ESWD+ +  +   A  KK+ EGN  FK GKYA+ASKRYEK AK+IEYD
Sbjct  392  YEVDLVSFEKEKESWDLKSNAENIEAAAKKKDEGNAWFKMGKYAKASKRYEKAAKYIEYD  451

Query  676  TSFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAY  497
            +SFSE+EKKQSKA+KIS  LNNAACKLKLKDYKEAEKLC KVLELESTNVKALYRRAQAY
Sbjct  452  SSFSEDEKKQSKAVKISIKLNNAACKLKLKDYKEAEKLCAKVLELESTNVKALYRRAQAY  511

Query  496  IHFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEP  317
                D +LAE DIKKALEIDPDNREVK+ YK LK+K++EYNK+DAKFYGNMFAK  K E 
Sbjct  512  TELVDLELAELDIKKALEIDPDNREVKVAYKALKDKLREYNKRDAKFYGNMFAKWRKTEN  571

Query  316  FSSNKSAPQEAEAIDSKA  263
             +  ++A  +  AIDS A
Sbjct  572  AAGKQNA--QPMAIDSTA  587



>gb|KHF97531.1| Peptidyl-prolyl cis-trans isomerase FKBP65 -like protein [Gossypium 
arboreum]
Length=567

 Score =   223 bits (567),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 145/197 (74%), Positives = 170/197 (86%), Gaps = 5/197 (3%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+E+VSFVKE+ESW+M+T +KIEAAGKKKEEGN LFKAGK+ RASKRYEK   FIEYD+
Sbjct  376  YEVEMVSFVKEKESWEMDTPQKIEAAGKKKEEGNALFKAGKFERASKRYEKAVSFIEYDS  435

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SF++EEKKQ+K LK++CNLNNAA KLKLKDYK+A KLCTKVLEL+S NVKALYRRAQAYI
Sbjct  436  SFNDEEKKQAKLLKVNCNLNNAASKLKLKDYKQAAKLCTKVLELDSGNVKALYRRAQAYI  495

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
               D DLAE DIKKALEIDPDNR+VKLEY+VLKEK+KEYNK+DA+FY N+FAK++K    
Sbjct  496  QLVDLDLAEADIKKALEIDPDNRDVKLEYRVLKEKIKEYNKRDAQFYSNIFAKMNKSA--  553

Query  313  SSNKSAPQEAEAIDSKA  263
               ++AP    AIDSKA
Sbjct  554  GKREAAPM---AIDSKA  567



>emb|CDX86295.1| BnaA06g30120D [Brassica napus]
Length=573

 Score =   222 bits (565),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 151/199 (76%), Positives = 176/199 (88%), Gaps = 7/199 (4%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSF+KE+ESWDMNTQEKIEAAGKKKEEGN LFKAGKYARASKRYE+G KFIEYD+
Sbjct  380  YEVELVSFIKEKESWDMNTQEKIEAAGKKKEEGNTLFKAGKYARASKRYERGVKFIEYDS  439

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SF EE+KK++KALK++CNLNNAACKLKLKDYKEA KL TKVLE++ +NVKA+YRRAQAY+
Sbjct  440  SFDEEDKKKAKALKVACNLNNAACKLKLKDYKEAAKLATKVLEMDGSNVKAMYRRAQAYM  499

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
              AD DLAE DIKKALEIDPDN+EVK+EYK LKEKV+EYNKKDAKFY NM AK+ +P   
Sbjct  500  ETADLDLAELDIKKALEIDPDNKEVKIEYKKLKEKVREYNKKDAKFYSNMLAKMLEP---  556

Query  313  SSNKSAPQEAEA--IDSKA  263
              +K A ++A+A  ID+KA
Sbjct  557  --HKEARKDAQAMSIDAKA  573



>gb|KJB37901.1| hypothetical protein B456_006G225400 [Gossypium raimondii]
Length=567

 Score =   222 bits (565),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 145/197 (74%), Positives = 170/197 (86%), Gaps = 5/197 (3%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+E+VSFVKE+ESW+M+T +KIEAAGKKKEEGN LFKAGK+ RASKRYEK   FIEYD+
Sbjct  376  YEVEMVSFVKEKESWEMDTPQKIEAAGKKKEEGNALFKAGKFERASKRYEKAVSFIEYDS  435

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SF++EEKKQ+K LK++CNLNNAA KLKLKDYK+A KLCTKVLEL+S NVKALYRRAQAYI
Sbjct  436  SFNDEEKKQAKLLKVNCNLNNAASKLKLKDYKQAAKLCTKVLELDSGNVKALYRRAQAYI  495

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
               D DLAE DIKKALEIDPDNR+VKLEY+VLKEK+KEYNK+DA+FY N+FAK++K    
Sbjct  496  QLVDLDLAEADIKKALEIDPDNRDVKLEYRVLKEKIKEYNKRDAQFYSNIFAKMNKLA--  553

Query  313  SSNKSAPQEAEAIDSKA  263
               ++AP    AIDSKA
Sbjct  554  GKQEAAPM---AIDSKA  567



>ref|XP_004492269.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X1 [Cicer arietinum]
 ref|XP_004492270.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X2 [Cicer arietinum]
Length=545

 Score =   221 bits (563),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 158/176 (90%), Gaps = 1/176 (1%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSF KE+ESWDMNTQEKIEAAGKKKEEGNVLFKAGKYARASKRYEK  K+IEYD+
Sbjct  370  YEVELVSFDKEKESWDMNTQEKIEAAGKKKEEGNVLFKAGKYARASKRYEKAVKYIEYDS  429

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSEEEKK SK LK++  LNNAAC LKLK+YK+AEKLCTKVL++ESTNVKALYRRAQA +
Sbjct  430  SFSEEEKKVSKTLKLASYLNNAACNLKLKEYKDAEKLCTKVLDIESTNVKALYRRAQASM  489

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSK  326
               D DLAE DIKKALE+DPDNREVKLEY+ LKE VKEYNKK AKFYGNMF KL+K
Sbjct  490  QLGDLDLAEIDIKKALEVDPDNREVKLEYRTLKEMVKEYNKKQAKFYGNMF-KLTK  544



>ref|XP_010023593.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X1 [Eucalyptus grandis]
 gb|KCW59904.1| hypothetical protein EUGRSUZ_H02629 [Eucalyptus grandis]
Length=617

 Score =   222 bits (566),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 138/178 (78%), Positives = 160/178 (90%), Gaps = 0/178 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+EL+SFVKE+ESW+MN QEKIEAA +KKEEGN  FKAGKY RASKRYEK  +FIEYD+
Sbjct  388  YEVELLSFVKEKESWEMNNQEKIEAAARKKEEGNAAFKAGKYVRASKRYEKAVRFIEYDS  447

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFS+EEK+Q+K LK +CNLN+AACKLKLKD+KEAEKLCTKVLE +  NVKALYRRAQAYI
Sbjct  448  SFSDEEKQQAKTLKNTCNLNDAACKLKLKDFKEAEKLCTKVLEGDGKNVKALYRRAQAYI  507

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPE  320
               D DLAE DIKKALEIDP+NR+VKLEYK+LKEKV+EYNK+DA+FYGNMFAK++K E
Sbjct  508  QLVDLDLAEQDIKKALEIDPNNRDVKLEYKILKEKVREYNKRDAQFYGNMFAKMNKLE  565



>ref|XP_002436973.1| hypothetical protein SORBIDRAFT_10g012970 [Sorghum bicolor]
 gb|EER88340.1| hypothetical protein SORBIDRAFT_10g012970 [Sorghum bicolor]
Length=592

 Score =   221 bits (564),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 139/202 (69%), Positives = 162/202 (80%), Gaps = 8/202 (4%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkke-eGNVLFKAGKYARASKRYEKGAKFIEYD  677
            YE+ELVSF KE+ESWD+ T  +   A  KK+ EGNV FK GKYA+ASKRYEK AK+IEYD
Sbjct  394  YEVELVSFEKEKESWDLKTNTEKIEAAAKKKDEGNVWFKMGKYAKASKRYEKAAKYIEYD  453

Query  676  TSFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAY  497
             SFSE+EKKQSK+LKIS  LNNAACKLKLK+Y+EAEKLCTKVL+LEST+VKALYRRAQAY
Sbjct  454  NSFSEDEKKQSKSLKISSKLNNAACKLKLKEYREAEKLCTKVLDLESTSVKALYRRAQAY  513

Query  496  IHFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEP  317
            I   D +LAE D+KKALEIDPDNR+VKL YK LKE+++EYN++DAKFYGNMFAK  K E 
Sbjct  514  IELVDLELAELDVKKALEIDPDNRDVKLVYKTLKERMREYNRRDAKFYGNMFAKWRKLEQ  573

Query  316  FSSNKSAPQEAE----AIDSKA  263
                +  P + E    AIDS A
Sbjct  574  L---QKVPGKQELQPMAIDSAA  592



>gb|KEH22557.1| FKBP-type peptidyl-prolyl cis-trans isomerase [Medicago truncatula]
Length=544

 Score =   220 bits (561),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 140/172 (81%), Positives = 154/172 (90%), Gaps = 0/172 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVS+ KE+ESWDMNTQEKIEAAGKKKEEGNVLFKAGKY RASKRY+K AK+IEYD+
Sbjct  369  YEVELVSYEKEKESWDMNTQEKIEAAGKKKEEGNVLFKAGKYERASKRYDKAAKYIEYDS  428

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSEEEKK SK LKI+  LNNAACKLKLK+YK+AEKLCTKVL++ESTNVKALYRRAQA +
Sbjct  429  SFSEEEKKLSKTLKIASYLNNAACKLKLKEYKDAEKLCTKVLDIESTNVKALYRRAQASM  488

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFA  338
               D DLAE DIKKALE+DPDNREVKLEYK LK+ VKEYN K AKFYGNMF 
Sbjct  489  QLTDLDLAEIDIKKALEVDPDNREVKLEYKNLKQMVKEYNNKQAKFYGNMFG  540



>ref|XP_003579568.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Brachypodium 
distachyon]
Length=596

 Score =   221 bits (562),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 144/203 (71%), Positives = 165/203 (81%), Gaps = 10/203 (5%)
 Frame = -2

Query  853  YEIELVSFVKERESWDM--NTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEY  680
            YE+ELVSF KE+ESWD+  NT++   AA KK E  NV FK GKYA+ASKRY+K AK+IEY
Sbjct  398  YEVELVSFEKEKESWDLKSNTEKIEAAAKKKDEG-NVWFKMGKYAKASKRYDKAAKYIEY  456

Query  679  DTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQA  500
            D+SF+E+EKKQSKALKI+  LNNAACKL+LK+YKEAEKLCTKVLELESTNVKALYRRAQA
Sbjct  457  DSSFTEDEKKQSKALKINIKLNNAACKLRLKEYKEAEKLCTKVLELESTNVKALYRRAQA  516

Query  499  YIHFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPE  320
            Y    D +LAE DIKKALEIDPDNR+VK+ YK LK+KVKEYNK+DAK YGNMFAK  K E
Sbjct  517  YTELVDLELAEMDIKKALEIDPDNRDVKMAYKALKDKVKEYNKRDAKLYGNMFAKWRKVE  576

Query  319  PFSSNKSAP--QEAE--AIDSKA  263
               S +  P  QEA+  AIDS A
Sbjct  577  ---SAEKVPGKQEAQPMAIDSAA  596



>ref|XP_009151655.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP65 [Brassica 
rapa]
Length=573

 Score =   220 bits (560),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 151/199 (76%), Positives = 175/199 (88%), Gaps = 7/199 (4%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSF+KE+ESWDMNTQEKIEAAGKKKEEGN LFKAGKYARASKRYE+G KFIEYD+
Sbjct  380  YEVELVSFIKEKESWDMNTQEKIEAAGKKKEEGNTLFKAGKYARASKRYERGVKFIEYDS  439

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SF EE+KK++KALKI+CNLNNAACKLKLKDYKEA KL TKVLE++ +NVKA+YRRAQAY+
Sbjct  440  SFDEEDKKKAKALKIACNLNNAACKLKLKDYKEAAKLSTKVLEMDGSNVKAMYRRAQAYM  499

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
              AD DLAE DIKK LEIDPDN+EVK+EYK LKEKV+EYNKKDAKFY NM AK+ +P   
Sbjct  500  ETADLDLAELDIKKVLEIDPDNKEVKMEYKKLKEKVREYNKKDAKFYSNMLAKMLEP---  556

Query  313  SSNKSAPQEAEA--IDSKA  263
              +K A ++A+A  ID+KA
Sbjct  557  --HKEARKDAQAMSIDAKA  573



>ref|XP_011084142.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Sesamum 
indicum]
Length=650

 Score =   221 bits (562),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 137/178 (77%), Positives = 165/178 (93%), Gaps = 0/178 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+E++SF+KE+ESWDMNT+EKI AAGKKKEEGNV FKAGKY RASKRYEK  +FIE+D+
Sbjct  383  YELEMISFLKEKESWDMNTEEKIAAAGKKKEEGNVWFKAGKYKRASKRYEKAVRFIEFDS  442

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            +F+EEEK+++K LK+SCNLNNAACKLKLKDYKEAEKLCTKVLE++  NVKALYRRAQAY+
Sbjct  443  NFNEEEKEKAKVLKVSCNLNNAACKLKLKDYKEAEKLCTKVLEIDGKNVKALYRRAQAYL  502

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPE  320
            +  + +LAE DIKKALEIDPDNR+VKLEYK+LKEKVKEYNKKDA+FYG++FAK++K E
Sbjct  503  NLVELELAEKDIKKALEIDPDNRDVKLEYKILKEKVKEYNKKDAQFYGSIFAKMNKLE  560



>ref|XP_004975323.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X1 [Setaria 
italica]
Length=709

 Score =   220 bits (561),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 155/187 (83%), Gaps = 1/187 (1%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkke-eGNVLFKAGKYARASKRYEKGAKFIEYD  677
            YE+ELVSF K++ESWD+ +  +   A  KK+ EGN  FK GKYA+ASKRYEK AK+IEYD
Sbjct  394  YEVELVSFEKDKESWDLKSNAEKIEAAAKKKDEGNAWFKMGKYAKASKRYEKAAKYIEYD  453

Query  676  TSFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAY  497
            +SFSE+EKKQSKALKISC LNNAACKLKLK+Y+EAEKLCTKVLELESTNVKALYRRAQAY
Sbjct  454  SSFSEDEKKQSKALKISCKLNNAACKLKLKEYREAEKLCTKVLELESTNVKALYRRAQAY  513

Query  496  IHFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEP  317
            I   D +LAE D+KKALE DPDNR+VKL YK LKEK++EYN++DAKFYGNMFAK  K E 
Sbjct  514  IELVDLELAELDVKKALEFDPDNRDVKLVYKTLKEKMREYNRRDAKFYGNMFAKWRKLEH  573

Query  316  FSSNKSA  296
              +  S 
Sbjct  574  MDTKVST  580



>gb|KJB28026.1| hypothetical protein B456_005G022600, partial [Gossypium raimondii]
Length=493

 Score =   216 bits (549),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 138/200 (69%), Positives = 164/200 (82%), Gaps = 7/200 (4%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSFVKE+ESW+MN  EKIEA+GKKKEEGNVLF AG   RASKRYEK  ++IE+D 
Sbjct  298  YEVELVSFVKEKESWEMNAPEKIEASGKKKEEGNVLFTAGNIERASKRYEKAVRYIEHDY  357

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SF+ EE++QSK LK++CNLNNAAC+LKLKDYK+AE+LCTKVLELES NVKALYRRAQAYI
Sbjct  358  SFNHEEQQQSKLLKVTCNLNNAACQLKLKDYKQAEELCTKVLELESRNVKALYRRAQAYI  417

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
               D DLAE  IKKALEIDP NRE+K+ Y+VLK+K++EYNKKDA+FYGN+FAK++     
Sbjct  418  QLVDLDLAEAGIKKALEIDPGNRELKVGYRVLKQKMREYNKKDAQFYGNIFAKMN----L  473

Query  313  SSNKSAPQEAEA---IDSKA  263
                +A QE      IDSKA
Sbjct  474  QQANAAKQEQRTPMIIDSKA  493



>gb|KJB37905.1| hypothetical protein B456_006G225400 [Gossypium raimondii]
Length=568

 Score =   217 bits (553),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 145/198 (73%), Positives = 170/198 (86%), Gaps = 6/198 (3%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+E+VSFVKE+ESW+M+T +KIEAAGKKKEEGN LFKAGK+ RASKRYEK   FIEYD+
Sbjct  376  YEVEMVSFVKEKESWEMDTPQKIEAAGKKKEEGNALFKAGKFERASKRYEKAVSFIEYDS  435

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTK-VLELESTNVKALYRRAQAY  497
            SF++EEKKQ+K LK++CNLNNAA KLKLKDYK+A KLCTK VLEL+S NVKALYRRAQAY
Sbjct  436  SFNDEEKKQAKLLKVNCNLNNAASKLKLKDYKQAAKLCTKVVLELDSGNVKALYRRAQAY  495

Query  496  IHFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEP  317
            I   D DLAE DIKKALEIDPDNR+VKLEY+VLKEK+KEYNK+DA+FY N+FAK++K   
Sbjct  496  IQLVDLDLAEADIKKALEIDPDNRDVKLEYRVLKEKIKEYNKRDAQFYSNIFAKMNKLA-  554

Query  316  FSSNKSAPQEAEAIDSKA  263
                ++AP    AIDSKA
Sbjct  555  -GKQEAAPM---AIDSKA  568



>ref|XP_006280236.1| hypothetical protein CARUB_v10026151mg [Capsella rubella]
 gb|EOA13134.1| hypothetical protein CARUB_v10026151mg [Capsella rubella]
Length=575

 Score =   216 bits (550),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 154/200 (77%), Positives = 175/200 (88%), Gaps = 7/200 (4%)
 Frame = -2

Query  856  SYEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYD  677
            SYE+ELVSF+KE+ESWDMNTQEKIEAAGKKKEEGN LFKAGKYARASKRYE+G K+IEYD
Sbjct  381  SYEVELVSFIKEKESWDMNTQEKIEAAGKKKEEGNALFKAGKYARASKRYERGVKYIEYD  440

Query  676  TSFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAY  497
            +SF EEEKK++KALKI+CNLNNAACKLKLKDYKEA KL TKVLE++  NVKA+YRRA AY
Sbjct  441  SSFDEEEKKKAKALKIACNLNNAACKLKLKDYKEAAKLSTKVLEMDGGNVKAMYRRAHAY  500

Query  496  IHFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEP  317
            +  AD DLAE DIKKALEIDPDN+EVK+EYK LKEKVKEYNKKDAKFY NM +KL +P  
Sbjct  501  METADLDLAELDIKKALEIDPDNKEVKIEYKKLKEKVKEYNKKDAKFYSNMLSKLLEP--  558

Query  316  FSSNKSAPQEAEA--IDSKA  263
               +K A +EA+A  ID+KA
Sbjct  559  ---HKGAQKEAQAMSIDTKA  575



>ref|XP_010442282.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP65-like [Camelina 
sativa]
Length=576

 Score =   214 bits (545),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 147/200 (74%), Positives = 173/200 (87%), Gaps = 7/200 (4%)
 Frame = -2

Query  856  SYEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYD  677
            SYE+ELVSF+KE+ESWDM+T+EKIEAAGKKK EGN LFKAGKYARASKRYE+G K+IEYD
Sbjct  382  SYEVELVSFIKEKESWDMDTKEKIEAAGKKKGEGNALFKAGKYARASKRYERGVKYIEYD  441

Query  676  TSFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAY  497
            ++F EE+KK++KALKI+CNLNNAACKLKL+DYKEA KL TKVLE++  NVKA+YRRA AY
Sbjct  442  SAFDEEDKKKAKALKIACNLNNAACKLKLRDYKEAAKLSTKVLEMDGRNVKAMYRRAHAY  501

Query  496  IHFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEP  317
            +  AD DLAE DIKKALEIDPDN+EVK+EY  LKEKVKEYNKKDAKFY NM +KL +P  
Sbjct  502  METADLDLAELDIKKALEIDPDNKEVKIEYMKLKEKVKEYNKKDAKFYSNMLSKLLEP--  559

Query  316  FSSNKSAPQEAEA--IDSKA  263
               +K A +EA+A  ID+KA
Sbjct  560  ---HKGAQKEAQAMSIDAKA  576



>ref|XP_010482107.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP65-like [Camelina 
sativa]
Length=578

 Score =   214 bits (544),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 149/200 (75%), Positives = 175/200 (88%), Gaps = 7/200 (4%)
 Frame = -2

Query  856  SYEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYD  677
            SYE+ELVSF+KE+ESWDM+T+EKIEAAGKKKEEGNVLFK GKYARASKRYE+G ++IEYD
Sbjct  384  SYEVELVSFIKEKESWDMDTKEKIEAAGKKKEEGNVLFKNGKYARASKRYERGVRYIEYD  443

Query  676  TSFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAY  497
            ++F EE+KK++KALKI+CNLNNAACKLKLKDYKEA KL TKVLE++  NVKA+YRRA AY
Sbjct  444  SAFDEEDKKKAKALKIACNLNNAACKLKLKDYKEAAKLSTKVLEMDGRNVKAMYRRAHAY  503

Query  496  IHFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEP  317
            +  AD DLAE DIKKALEIDPDN+EVK+EYK LKEKVKEYNKKDAKFY NM +KL +P  
Sbjct  504  METADLDLAELDIKKALEIDPDNKEVKIEYKKLKEKVKEYNKKDAKFYSNMLSKLLEP--  561

Query  316  FSSNKSAPQEAEA--IDSKA  263
               +K A +EA+A  ID+KA
Sbjct  562  ---HKGAQKEAQAMSIDTKA  578



>ref|XP_004952509.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Setaria italica]
Length=676

 Score =   215 bits (548),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 134/184 (73%), Positives = 154/184 (84%), Gaps = 1/184 (1%)
 Frame = -2

Query  853  YEIELVSFVKERESWDM-NTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYD  677
            YE+ELVSF KE++SWD+ N  EKIEAA KKK+EGNV FK GKYARASKRY+K   F+EYD
Sbjct  425  YEVELVSFDKEKDSWDLKNNSEKIEAAAKKKDEGNVWFKVGKYARASKRYKKALSFVEYD  484

Query  676  TSFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAY  497
            +SFSEEEK+ SK LKISC LNNAACKLKLKDYKEA++LCT+VLEL+ TNVKALYRRAQA+
Sbjct  485  SSFSEEEKQLSKPLKISCKLNNAACKLKLKDYKEAKELCTEVLELDCTNVKALYRRAQAH  544

Query  496  IHFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEP  317
             H  D DLAE DIKKALEIDPDNR+VK+ Y+ LKE VKEY ++DAK YGNM +KLSK E 
Sbjct  545  THLVDLDLAEADIKKALEIDPDNRDVKMGYRRLKETVKEYKRRDAKLYGNMISKLSKVED  604

Query  316  FSSN  305
               N
Sbjct  605  TEGN  608



>ref|XP_002453845.1| hypothetical protein SORBIDRAFT_04g019590 [Sorghum bicolor]
 gb|EES06821.1| hypothetical protein SORBIDRAFT_04g019590 [Sorghum bicolor]
Length=685

 Score =   214 bits (546),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 156/189 (83%), Gaps = 1/189 (1%)
 Frame = -2

Query  853  YEIELVSFVKERESWDM-NTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYD  677
            YE+ELVSF KE++SWD+ N  EKIEAA KKKEEGNV FK GKYARASKRYEK   FIEYD
Sbjct  433  YEMELVSFDKEKDSWDLKNIAEKIEAAAKKKEEGNVWFKVGKYARASKRYEKALSFIEYD  492

Query  676  TSFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAY  497
            +SFSEEEK+ SK LKISC LNNAACKL+L DYKEA++LCT+VLE +STNVKALYRRAQA+
Sbjct  493  SSFSEEEKQLSKPLKISCKLNNAACKLRLNDYKEAKELCTEVLESDSTNVKALYRRAQAH  552

Query  496  IHFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEP  317
            +H  D DLAE DIKKALEIDPDNR+VK+ Y+ LKEKVKEY ++DAK YGNM +KLSK E 
Sbjct  553  MHLVDLDLAEADIKKALEIDPDNRDVKMGYRRLKEKVKEYKRRDAKLYGNMISKLSKLED  612

Query  316  FSSNKSAPQ  290
               N    Q
Sbjct  613  TEDNDQMSQ  621



>ref|XP_010493687.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP65 [Camelina 
sativa]
Length=575

 Score =   212 bits (539),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 152/200 (76%), Positives = 174/200 (87%), Gaps = 7/200 (4%)
 Frame = -2

Query  856  SYEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYD  677
            SYE+ELV F+KE+ESWDMNTQEKIEAAGKKKEEGN LFKAGKYARASKRYE+G K+IEYD
Sbjct  381  SYEVELVFFIKEKESWDMNTQEKIEAAGKKKEEGNALFKAGKYARASKRYERGVKYIEYD  440

Query  676  TSFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAY  497
            ++F EEEKK++KALKI+CNLNNAACKLKLKDYKEA KL TKVLE++  NVKA+YRRA AY
Sbjct  441  STFDEEEKKKAKALKIACNLNNAACKLKLKDYKEAAKLSTKVLEMDGRNVKAMYRRAHAY  500

Query  496  IHFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEP  317
            +  AD DLAE DIKKALEIDPDN+EVK+EYK LKEKVKEYNKKDAKFY NM +KL +P  
Sbjct  501  METADLDLAELDIKKALEIDPDNKEVKIEYKKLKEKVKEYNKKDAKFYSNMLSKLLEP--  558

Query  316  FSSNKSAPQEAEA--IDSKA  263
               +K A +EA+A  ID+KA
Sbjct  559  ---HKGAQKEAQAMSIDTKA  575



>ref|XP_002977259.1| hypothetical protein SELMODRAFT_443450 [Selaginella moellendorffii]
 gb|EFJ21868.1| hypothetical protein SELMODRAFT_443450 [Selaginella moellendorffii]
Length=567

 Score =   210 bits (534),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 159/190 (84%), Gaps = 1/190 (1%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMN-TQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYD  677
            YE+E++SFVK ++SWD++  +EK++ A  +K+EGNVL+KAGK+ARASK+YE+  KFI+YD
Sbjct  361  YEVEMISFVKAKDSWDLHKAEEKLQEATVRKDEGNVLYKAGKFARASKKYEQALKFIDYD  420

Query  676  TSFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAY  497
            ++FS++EKKQ+KALK+SCNLNNAA KLKL ++K+A K C+KVLELES NVKALYRRAQAY
Sbjct  421  SNFSDDEKKQAKALKVSCNLNNAASKLKLNEFKDAIKCCSKVLELESQNVKALYRRAQAY  480

Query  496  IHFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEP  317
               AD DLAEFDIKKALEIDP NR++++EYK LK+K  EYNKK+AK YGNMFA+LSK E 
Sbjct  481  TRTADLDLAEFDIKKALEIDPQNRDLRMEYKSLKQKQVEYNKKEAKLYGNMFARLSKLEA  540

Query  316  FSSNKSAPQE  287
                  AP +
Sbjct  541  LEQKSEAPMD  550



>gb|AFW71473.2| peptidyl-prolyl isomerase [Zea mays]
Length=619

 Score =   211 bits (536),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 134/189 (71%), Positives = 156/189 (83%), Gaps = 1/189 (1%)
 Frame = -2

Query  853  YEIELVSFVKERESWDM-NTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYD  677
            YE+ELVSF KE++SWD+ N  EKIEAA KKKEEGNV FK GKYARASKRYEK   F+EYD
Sbjct  367  YEMELVSFDKEKDSWDLKNVAEKIEAAAKKKEEGNVWFKIGKYARASKRYEKALSFVEYD  426

Query  676  TSFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAY  497
            +SF+EEEK+ SK L+ISC LNNAACKL+L DYKEA++LCT+VLE ++TNVKALYRRAQA+
Sbjct  427  SSFTEEEKQLSKPLQISCKLNNAACKLRLNDYKEAKELCTEVLESDNTNVKALYRRAQAH  486

Query  496  IHFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEP  317
            +H  D DLAE DIKKALEIDPDNR+VK+ YK LKEKVKEY ++DAK YGNM +KLSK E 
Sbjct  487  MHLVDLDLAEADIKKALEIDPDNRDVKMGYKRLKEKVKEYKRRDAKLYGNMISKLSKLED  546

Query  316  FSSNKSAPQ  290
               N    Q
Sbjct  547  TEDNGQMSQ  555



>gb|ACN30883.1| unknown [Zea mays]
Length=677

 Score =   211 bits (536),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 134/189 (71%), Positives = 156/189 (83%), Gaps = 1/189 (1%)
 Frame = -2

Query  853  YEIELVSFVKERESWDM-NTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYD  677
            YE+ELVSF KE++SWD+ N  EKIEAA KKKEEGNV FK GKYARASKRYEK   F+EYD
Sbjct  425  YEMELVSFDKEKDSWDLKNVAEKIEAAAKKKEEGNVWFKIGKYARASKRYEKALSFVEYD  484

Query  676  TSFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAY  497
            +SF+EEEK+ SK L+ISC LNNAACKL+L DYKEA++LCT+VLE ++TNVKALYRRAQA+
Sbjct  485  SSFTEEEKQLSKPLQISCKLNNAACKLRLNDYKEAKELCTEVLESDNTNVKALYRRAQAH  544

Query  496  IHFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEP  317
            +H  D DLAE DIKKALEIDPDNR+VK+ YK LKEKVKEY ++DAK YGNM +KLSK E 
Sbjct  545  MHLVDLDLAEADIKKALEIDPDNRDVKMGYKRLKEKVKEYKRRDAKLYGNMISKLSKLED  604

Query  316  FSSNKSAPQ  290
               N    Q
Sbjct  605  TEDNGQMSQ  613



>ref|NP_001151484.1| LOC100285117 [Zea mays]
 gb|ACG43033.1| peptidyl-prolyl isomerase [Zea mays]
Length=677

 Score =   211 bits (536),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 134/189 (71%), Positives = 156/189 (83%), Gaps = 1/189 (1%)
 Frame = -2

Query  853  YEIELVSFVKERESWDM-NTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYD  677
            YE+ELVSF KE++SWD+ N  EKIEAA KKKEEGNV FK GKYARASKRYEK   F+EYD
Sbjct  425  YEMELVSFDKEKDSWDLKNVAEKIEAAAKKKEEGNVWFKIGKYARASKRYEKALSFVEYD  484

Query  676  TSFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAY  497
            +SF+EEEK+ SK L+ISC LNNAACKL+L DYKEA++LCT+VLE ++TNVKALYRRAQA+
Sbjct  485  SSFTEEEKQLSKPLQISCKLNNAACKLRLNDYKEAKELCTEVLESDNTNVKALYRRAQAH  544

Query  496  IHFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEP  317
            +H  D DLAE DIKKALEIDPDNR+VK+ YK LKEKVKEY ++DAK YGNM +KLSK E 
Sbjct  545  MHLVDLDLAEADIKKALEIDPDNRDVKMGYKRLKEKVKEYKRRDAKLYGNMISKLSKLED  604

Query  316  FSSNKSAPQ  290
               N    Q
Sbjct  605  TEDNGQMSQ  613



>emb|CDX85348.1| BnaC07g26590D [Brassica napus]
Length=570

 Score =   207 bits (528),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 172/199 (86%), Gaps = 7/199 (4%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE ELVSF+KE+ESWDM TQEKIEAAGKKKEEGN LFKAG YARASKRYE+G K+IEYD+
Sbjct  377  YEAELVSFIKEKESWDMITQEKIEAAGKKKEEGNTLFKAGNYARASKRYERGVKYIEYDS  436

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SF EE+KK++KALKI+C LNNAACKLKLKDYKEA KL TKVLE++ +NVKA+YRRA+AY+
Sbjct  437  SFDEEDKKKAKALKIACYLNNAACKLKLKDYKEAAKLSTKVLEMDGSNVKAMYRRAEAYM  496

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
              AD DLAE DIKKALEIDPDN+E+K+EYK LKEKVKEYNKKDAKFY NM AK+ +P   
Sbjct  497  ETADLDLAELDIKKALEIDPDNKELKMEYKKLKEKVKEYNKKDAKFYSNMLAKMLEP---  553

Query  313  SSNKSAPQEAEA--IDSKA  263
              +K A ++A+A  ID+KA
Sbjct  554  --HKEARKDAQAMSIDAKA  570



>ref|XP_001769063.1| predicted protein [Physcomitrella patens]
 gb|EDQ66141.1| predicted protein [Physcomitrella patens]
Length=562

 Score =   207 bits (526),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 129/178 (72%), Positives = 147/178 (83%), Gaps = 0/178 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YEIELV F+KE+ESW++   EK+E A KKKE+GN LFKAG YARASKRYEK  K IEYD+
Sbjct  377  YEIELVEFIKEKESWELEVPEKLELAAKKKEDGNALFKAGNYARASKRYEKAVKLIEYDS  436

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SF + +KKQ+K LK+SCNLN AACKLKLKDY+E  KL TKVLELES+NVKALYRR QAYI
Sbjct  437  SFDDAQKKQAKTLKVSCNLNMAACKLKLKDYREVVKLTTKVLELESSNVKALYRRVQAYI  496

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPE  320
               D D AE DIKKAL+IDP NREVKLEYK LK+K+ E NKK+AK YGNMFA+LSK E
Sbjct  497  ELLDLDYAETDIKKALDIDPQNREVKLEYKRLKQKLAEQNKKEAKLYGNMFARLSKME  554



>gb|KJB71963.1| hypothetical protein B456_011G150600 [Gossypium raimondii]
Length=607

 Score =   206 bits (524),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 153/237 (65%), Positives = 178/237 (75%), Gaps = 23/237 (10%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+E+VSFVKE+ESWDMN QEKIEAAGKKKEEGN LFKAGKY RA KRYEK  +FIEYD+
Sbjct  376  YEVEMVSFVKEKESWDMNAQEKIEAAGKKKEEGNALFKAGKYERALKRYEKAFRFIEYDS  435

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFS+EEK+Q+K LK++CNLNNAACKLKLKDYK+A+KLCT+VLEL+  NVKALYRRAQAY+
Sbjct  436  SFSDEEKQQAKMLKVTCNLNNAACKLKLKDYKKAKKLCTEVLELDDRNVKALYRRAQAYM  495

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
               DFDLAE DIKKALEIDPDNR+VKLEY+VLKEK+++YNKKDA+FYGN+ AK+SK E  
Sbjct  496  ELVDFDLAEADIKKALEIDPDNRDVKLEYRVLKEKIRQYNKKDAQFYGNIIAKMSKSEQE  555

Query  313  SSNKSAPQEAEAIDSKA*ACSAEKQVCYLLKFL--------------WVAWSVKLGD  185
             + K  P+               KQVC L   L              W  WS  L D
Sbjct  556  KATKKEPRH---------MTIGRKQVCRLPVLLVCIFLILPVIAAVIWQKWSDPLVD  603



>gb|KHG01160.1| Peptidyl-prolyl cis-trans isomerase FKBP65 -like protein [Gossypium 
arboreum]
Length=606

 Score =   206 bits (523),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 154/230 (67%), Positives = 181/230 (79%), Gaps = 10/230 (4%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+E+VSFVKE+ESWDMN QEKIEAAGKKKEEGN LFKAGKY RASKRYEK  +FIEYD+
Sbjct  376  YELEMVSFVKEKESWDMNAQEKIEAAGKKKEEGNALFKAGKYERASKRYEKAFRFIEYDS  435

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFS+EEK+Q+K LK++CNLNNAACKLKLKDYK+A+KLCT+VLEL+  NVKALYRRAQAY+
Sbjct  436  SFSDEEKQQAKLLKVTCNLNNAACKLKLKDYKKAKKLCTEVLELDDRNVKALYRRAQAYM  495

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
               DFDLAE DIKKALEIDPDNR+VKLEY+VLKEK+++YNKKDA+FYGN+ AK+SK E  
Sbjct  496  ELVDFDLAEADIKKALEIDPDNRDVKLEYRVLKEKIRQYNKKDAQFYGNIIAKMSKLE--  553

Query  313  SSNKSAPQEAEAIDSKA*ACSAEK-QVCYLLKF------LWVAWSVKLGD  185
               K+  +E+  I      C      VC  L F      +W  WS  L D
Sbjct  554  -QAKATKKESRHITIGRKVCRLPVLLVCIFLIFPVIAAVIWQKWSDPLVD  602



>gb|KJB37904.1| hypothetical protein B456_006G225400 [Gossypium raimondii]
Length=559

 Score =   204 bits (520),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 162/190 (85%), Gaps = 5/190 (3%)
 Frame = -2

Query  832  FVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEK  653
            + +E+ESW+M+T +KIEAAGKKKEEGN LFKAGK+ RASKRYEK   FIEYD+SF++EEK
Sbjct  375  YYEEKESWEMDTPQKIEAAGKKKEEGNALFKAGKFERASKRYEKAVSFIEYDSSFNDEEK  434

Query  652  KQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDL  473
            KQ+K LK++CNLNNAA KLKLKDYK+A KLCTKVLEL+S NVKALYRRAQAYI   D DL
Sbjct  435  KQAKLLKVNCNLNNAASKLKLKDYKQAAKLCTKVLELDSGNVKALYRRAQAYIQLVDLDL  494

Query  472  AEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPFSSNKSAP  293
            AE DIKKALEIDPDNR+VKLEY+VLKEK+KEYNK+DA+FY N+FAK++K       ++AP
Sbjct  495  AEADIKKALEIDPDNRDVKLEYRVLKEKIKEYNKRDAQFYSNIFAKMNKLA--GKQEAAP  552

Query  292  QEAEAIDSKA  263
                AIDSKA
Sbjct  553  M---AIDSKA  559



>ref|XP_002992143.1| hypothetical protein SELMODRAFT_134839 [Selaginella moellendorffii]
 gb|EFJ06798.1| hypothetical protein SELMODRAFT_134839 [Selaginella moellendorffii]
Length=593

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 156/179 (87%), Gaps = 1/179 (1%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMN-TQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYD  677
            YE+E++SFVK ++SWD++  +EK++ A  +K+EGNVL+KAGK+ARASK+YE+  KFI+YD
Sbjct  374  YEVEMISFVKAKDSWDLHKAEEKLQEATVRKDEGNVLYKAGKFARASKKYEQALKFIDYD  433

Query  676  TSFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAY  497
            ++FS++EKKQ+KALK+SCNLNNAA KLKL ++K+A K C+KVLELES NVKALYRRAQAY
Sbjct  434  SNFSDDEKKQAKALKVSCNLNNAASKLKLNEFKDAIKCCSKVLELESQNVKALYRRAQAY  493

Query  496  IHFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPE  320
               AD DLAEFDIKKALEIDP NR++++EYK LK+K  EYNKK+AK YGNMFA+LSK E
Sbjct  494  TRTADLDLAEFDIKKALEIDPQNRDLRMEYKSLKQKQVEYNKKEAKLYGNMFARLSKLE  552



>gb|EEC73201.1| hypothetical protein OsI_07270 [Oryza sativa Indica Group]
Length=600

 Score =   204 bits (520),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 146/180 (81%), Gaps = 3/180 (2%)
 Frame = -2

Query  853  YEIELVSFVKERESWDM--NTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEY  680
            YE+ELVSF KE+ESWDM  NT++   AA KK E  N  FK  KYARASKRY K   FIEY
Sbjct  348  YEVELVSFDKEKESWDMKENTEKIEAAAKKKDEG-NAWFKMEKYARASKRYGKALNFIEY  406

Query  679  DTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQA  500
            D+SFSEEEK+ SK LK+SC LNNAACKLKLKDYKEA++LCT+VLEL+S NVKA YRRAQA
Sbjct  407  DSSFSEEEKQLSKPLKVSCKLNNAACKLKLKDYKEAKELCTEVLELDSMNVKAFYRRAQA  466

Query  499  YIHFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPE  320
            +++  DFDLAE DIKKALEIDPDNR+VK+ Y+ LKEKVKE  +K+ K YGNM +KLSK E
Sbjct  467  HMYLVDFDLAELDIKKALEIDPDNRDVKMGYRRLKEKVKEQKRKETKLYGNMISKLSKLE  526



>gb|KJB71964.1| hypothetical protein B456_011G150600 [Gossypium raimondii]
Length=606

 Score =   204 bits (519),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 153/230 (67%), Positives = 179/230 (78%), Gaps = 10/230 (4%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+E+VSFVKE+ESWDMN QEKIEAAGKKKEEGN LFKAGKY RA KRYEK  +FIEYD+
Sbjct  376  YEVEMVSFVKEKESWDMNAQEKIEAAGKKKEEGNALFKAGKYERALKRYEKAFRFIEYDS  435

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFS+EEK+Q+K LK++CNLNNAACKLKLKDYK+A+KLCT+VLEL+  NVKALYRRAQAY+
Sbjct  436  SFSDEEKQQAKMLKVTCNLNNAACKLKLKDYKKAKKLCTEVLELDDRNVKALYRRAQAYM  495

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
               DFDLAE DIKKALEIDPDNR+VKLEY+VLKEK+++YNKKDA+FYGN+ AK+SK E  
Sbjct  496  ELVDFDLAEADIKKALEIDPDNRDVKLEYRVLKEKIRQYNKKDAQFYGNIIAKMSKSEQE  555

Query  313  SSNKSAPQEAEAIDSKA*ACSAEK-QVCYLL------KFLWVAWSVKLGD  185
             + K  P+    I  K   C      VC  L        +W  WS  L D
Sbjct  556  KATKKEPRHM-TIGRK--VCRLPVLLVCIFLILPVIAAVIWQKWSDPLVD  602



>gb|EEE57017.1| hypothetical protein OsJ_06790 [Oryza sativa Japonica Group]
Length=600

 Score =   203 bits (517),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 146/180 (81%), Gaps = 3/180 (2%)
 Frame = -2

Query  853  YEIELVSFVKERESWDM--NTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEY  680
            YE+ELVSF KE+ESWDM  NT++   AA KK E  N  FK  KYARASKRY K   FI+Y
Sbjct  348  YEVELVSFDKEKESWDMKENTEKIEAAAKKKDEG-NAWFKMEKYARASKRYGKALNFIQY  406

Query  679  DTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQA  500
            D+SFSEEEK+ SK LK+SC LNNAACKLKLKDYKEA++LCT+VLEL+S NVKA YRRAQA
Sbjct  407  DSSFSEEEKQLSKPLKVSCKLNNAACKLKLKDYKEAKELCTEVLELDSMNVKAFYRRAQA  466

Query  499  YIHFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPE  320
            +++  DFDLAE DIKKALEIDPDNR+VK+ Y+ LKEKVKE  +K+ K YGNM +KLSK E
Sbjct  467  HMYLVDFDLAELDIKKALEIDPDNRDVKMGYRRLKEKVKEQKRKETKLYGNMISKLSKLE  526



>gb|EMT19050.1| 70 kDa peptidyl-prolyl isomerase [Aegilops tauschii]
Length=676

 Score =   204 bits (520),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 154/179 (86%), Gaps = 1/179 (1%)
 Frame = -2

Query  853  YEIELVSFVKERESWDM-NTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYD  677
            Y++ELVSF KE+ESW++ +  EKIEAA KKK+EGNV FK GKYARASKRY K   FIEY+
Sbjct  432  YDVELVSFDKEKESWELKDNAEKIEAAAKKKDEGNVWFKMGKYARASKRYGKALDFIEYE  491

Query  676  TSFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAY  497
            +SF+EEEK+ SK LK+SC LN AACKLKLKDYKEA+ LCT+VLE++STNVKALYRRAQA+
Sbjct  492  SSFNEEEKQLSKPLKVSCKLNKAACKLKLKDYKEAKNLCTEVLEIDSTNVKALYRRAQAH  551

Query  496  IHFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPE  320
            +H  DFDLAE DIK+ALEIDP+NR+VK+ Y+ LKEKVKEY ++DAKFYGNM  KLSK E
Sbjct  552  MHLVDFDLAEVDIKRALEIDPENRDVKMGYRRLKEKVKEYERRDAKFYGNMINKLSKLE  610



>ref|NP_001046873.1| Os02g0491400 [Oryza sativa Japonica Group]
 dbj|BAD21897.1| putative peptidylprolyl isomerase [Oryza sativa Japonica Group]
 dbj|BAD22074.1| putative peptidylprolyl isomerase [Oryza sativa Japonica Group]
 dbj|BAF08787.1| Os02g0491400 [Oryza sativa Japonica Group]
Length=682

 Score =   203 bits (517),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 146/180 (81%), Gaps = 3/180 (2%)
 Frame = -2

Query  853  YEIELVSFVKERESWDM--NTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEY  680
            YE+ELVSF KE+ESWDM  NT++   AA KK E  N  FK  KYARASKRY K   FI+Y
Sbjct  430  YEVELVSFDKEKESWDMKENTEKIEAAAKKKDEG-NAWFKMEKYARASKRYGKALNFIQY  488

Query  679  DTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQA  500
            D+SFSEEEK+ SK LK+SC LNNAACKLKLKDYKEA++LCT+VLEL+S NVKA YRRAQA
Sbjct  489  DSSFSEEEKQLSKPLKVSCKLNNAACKLKLKDYKEAKELCTEVLELDSMNVKAFYRRAQA  548

Query  499  YIHFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPE  320
            +++  DFDLAE DIKKALEIDPDNR+VK+ Y+ LKEKVKE  +K+ K YGNM +KLSK E
Sbjct  549  HMYLVDFDLAELDIKKALEIDPDNRDVKMGYRRLKEKVKEQKRKETKLYGNMISKLSKLE  608



>ref|XP_002988507.1| hypothetical protein SELMODRAFT_183937 [Selaginella moellendorffii]
 gb|EFJ10303.1| hypothetical protein SELMODRAFT_183937 [Selaginella moellendorffii]
Length=569

 Score =   199 bits (507),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 149/177 (84%), Gaps = 0/177 (0%)
 Frame = -2

Query  856  SYEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYD  677
            +YE+EL SFVKE++ WDM+T EK++AAG+KKE+GN LFKAGKY RAS +YEK  K+I++D
Sbjct  360  TYELELDSFVKEKDPWDMDTGEKLKAAGQKKEDGNALFKAGKYQRASSKYEKAIKYIQHD  419

Query  676  TSFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAY  497
             SFSEEEKK  K L+ S NLNNAACKLKLK+Y+EA KLCT VL++ES NVKALYRRAQAY
Sbjct  420  NSFSEEEKKVVKKLRASSNLNNAACKLKLKEYQEAAKLCTTVLQVESQNVKALYRRAQAY  479

Query  496  IHFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSK  326
            +   D DLAE+D++KALE+DP+NREVK+E   LK+KV EYNK  AK YGNMFA+LSK
Sbjct  480  VETLDLDLAEWDLRKALELDPNNREVKVELTRLKQKVCEYNKIQAKMYGNMFARLSK  536



>ref|XP_002979133.1| hypothetical protein SELMODRAFT_110584 [Selaginella moellendorffii]
 gb|EFJ19541.1| hypothetical protein SELMODRAFT_110584 [Selaginella moellendorffii]
Length=569

 Score =   199 bits (507),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 149/177 (84%), Gaps = 0/177 (0%)
 Frame = -2

Query  856  SYEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYD  677
            +YE+EL SFVKE++ WDM+T EK++AAG+KKE+GN LFKAGKY RAS +YEK  K+I++D
Sbjct  360  TYELELDSFVKEKDPWDMDTGEKLKAAGQKKEDGNALFKAGKYQRASSKYEKAIKYIQHD  419

Query  676  TSFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAY  497
             SFSEEEKK  K L+ S NLNNAACKLKLK+Y+EA KLCT VL++ES NVKALYRRAQAY
Sbjct  420  NSFSEEEKKVVKKLRASSNLNNAACKLKLKEYQEAAKLCTTVLQVESQNVKALYRRAQAY  479

Query  496  IHFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSK  326
            +   D DLAE+D++KALE+DP+NREVK+E   LK+KV EYNK  AK YGNMFA+LSK
Sbjct  480  VETLDLDLAEWDLRKALELDPNNREVKVELTRLKQKVCEYNKIQAKMYGNMFARLSK  536



>ref|XP_006647293.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Oryza 
brachyantha]
Length=558

 Score =   199 bits (506),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 121/179 (68%), Positives = 144/179 (80%), Gaps = 1/179 (1%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkke-eGNVLFKAGKYARASKRYEKGAKFIEYD  677
            YE+ELVSF KE+ESWDM    +   A  KK+ EGN  FK  KYARASKRY K   F+EYD
Sbjct  306  YEVELVSFDKEKESWDMKENIEKIDAAAKKKDEGNAWFKMEKYARASKRYGKALNFVEYD  365

Query  676  TSFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAY  497
            +SFSEEEK+ SK LK+SC LNNAACKLKLKDYKEA++LCT+VLEL++ NVKA YRRAQA+
Sbjct  366  SSFSEEEKQLSKPLKVSCKLNNAACKLKLKDYKEAKELCTEVLELDNMNVKAFYRRAQAH  425

Query  496  IHFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPE  320
            ++  DFDLAE DIKKALEIDPDNR+VK+ Y+ LKEK+KE  +K+ K YGNM +KLSK E
Sbjct  426  MYLVDFDLAEQDIKKALEIDPDNRDVKMGYRRLKEKIKEQKRKETKLYGNMISKLSKLE  484



>ref|XP_003574982.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Brachypodium 
distachyon]
Length=648

 Score =   198 bits (504),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 120/179 (67%), Positives = 146/179 (82%), Gaps = 1/179 (1%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkke-eGNVLFKAGKYARASKRYEKGAKFIEYD  677
            Y++ELVSF KE+ESW++ +  +   A  KK+ EGNV FK  KY RASKRY K   FI+YD
Sbjct  399  YDLELVSFDKEKESWELKSNAEKIEAAAKKKDEGNVWFKMCKYTRASKRYGKALSFIDYD  458

Query  676  TSFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAY  497
            +SFSEEEK+ S+ALK+SC LNNAACKLKLKDYK+A++LCT+VLEL++TNVKALYRRAQA 
Sbjct  459  SSFSEEEKQPSRALKVSCKLNNAACKLKLKDYKKAKELCTEVLELDNTNVKALYRRAQAQ  518

Query  496  IHFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPE  320
             H  D DLAE DIKKALEIDPDNR+VK+ Y+ LKE VK+YN+K+AKFYGN+  KL K E
Sbjct  519  THLVDLDLAELDIKKALEIDPDNRDVKMGYRRLKETVKQYNRKEAKFYGNIIDKLGKLE  577



>gb|KHN03897.1| Peptidyl-prolyl cis-trans isomerase FKBP62, partial [Glycine 
soja]
Length=136

 Score =   182 bits (462),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 100/127 (79%), Positives = 114/127 (90%), Gaps = 0/127 (0%)
 Frame = -2

Query  805  MNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDTSFSEEEKKQSKALKIS  626
            +NT+EK++AAGKKKEEGNVLFKAGK+ARASKRYEK  K+IEYD+ F EEEKKQ+K LK+S
Sbjct  1    LNTEEKLKAAGKKKEEGNVLFKAGKHARASKRYEKVVKYIEYDSLFGEEEKKQAKTLKVS  60

Query  625  CNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYIHFADFDLAEFDIKKAL  446
            CNLNNAACKLKLKDYKEAEKLCTKVL++EST+VKALYRRAQAY+   D DL E DI K L
Sbjct  61   CNLNNAACKLKLKDYKEAEKLCTKVLDIESTSVKALYRRAQAYMQLTDLDLTELDINKTL  120

Query  445  EIDPDNR  425
            EIDP+NR
Sbjct  121  EIDPNNR  127



>gb|EMS49100.1| 70 kDa peptidyl-prolyl isomerase [Triticum urartu]
Length=651

 Score =   187 bits (474),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 128/179 (72%), Positives = 154/179 (86%), Gaps = 1/179 (1%)
 Frame = -2

Query  853  YEIELVSFVKERESWDM-NTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYD  677
            Y++ELVSF KE+ESW++ +  EKIE A KKK+EGNV FK GKYARASKRY K   FIEY+
Sbjct  407  YDVELVSFDKEKESWELKDNAEKIEVAAKKKDEGNVWFKMGKYARASKRYGKALDFIEYE  466

Query  676  TSFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAY  497
            +SFSEEEK+ SK LK+SC LN AACKLKLKDYKEA++LCT+VLE++STNVKALYRRAQA+
Sbjct  467  SSFSEEEKQLSKPLKVSCKLNKAACKLKLKDYKEAKELCTEVLEIDSTNVKALYRRAQAH  526

Query  496  IHFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPE  320
            +H  DFDLAE DIK+ALEIDP+NR++K+ Y+ LKEKVKEY ++DAKFYGNM  KLSK E
Sbjct  527  MHLVDFDLAEVDIKRALEIDPENRDIKMGYRRLKEKVKEYERRDAKFYGNMINKLSKLE  585



>dbj|BAJ95453.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=650

 Score =   186 bits (471),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 130/179 (73%), Positives = 154/179 (86%), Gaps = 1/179 (1%)
 Frame = -2

Query  853  YEIELVSFVKERESWDM-NTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYD  677
            Y+IELVSF KE+ESW++ +  EKIEAA KKK+EGNV FK GKY+RASKRY K   FIEY+
Sbjct  406  YDIELVSFDKEKESWEIKDNAEKIEAAAKKKDEGNVWFKMGKYSRASKRYGKALDFIEYE  465

Query  676  TSFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAY  497
            +SFSEEEK+ SK LK+SC LN AACKLKLKDYKEA++LCTKVLE++STNVKALYRRAQA+
Sbjct  466  SSFSEEEKQLSKPLKLSCKLNKAACKLKLKDYKEAKELCTKVLEMDSTNVKALYRRAQAH  525

Query  496  IHFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPE  320
            +H  D DLAE DIK+ALEIDP+NR+VK+ Y+ LKEKVKEY ++DAKFYGNM  KLSK E
Sbjct  526  MHLVDLDLAELDIKRALEIDPENRDVKMGYRRLKEKVKEYERRDAKFYGNMIDKLSKLE  584



>ref|XP_010552023.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP65-like [Tarenaya 
hassleriana]
Length=548

 Score =   181 bits (459),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 144/186 (77%), Gaps = 0/186 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+EL+SFVKE+ESW+M TQEKIEAA  KKEEGN LFKAGKYA+A KRY+K   +IEY +
Sbjct  363  YEVELLSFVKEKESWEMYTQEKIEAAESKKEEGNALFKAGKYAKALKRYDKAVGYIEYGS  422

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            +F EEE+K++K L+ +C+LN AACKLK ++Y+EA +LCTKVL  E  NVKALYRRA+AY+
Sbjct  423  AFGEEERKKTKELRAACDLNKAACKLKQREYREAVELCTKVLSGEEENVKALYRRAEAYM  482

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
               + +LAEFDIKKAL IDP NREVK EY+ LKEKVK YNK++AKFY  M  K     P 
Sbjct  483  ETDELELAEFDIKKALHIDPSNREVKSEYRKLKEKVKGYNKREAKFYSKMLGKTKDERPI  542

Query  313  SSNKSA  296
              +  A
Sbjct  543  GVDAEA  548



>ref|XP_006857116.2| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62 [Amborella 
trichopoda]
Length=600

 Score =   181 bits (459),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 108/184 (59%), Positives = 137/184 (74%), Gaps = 0/184 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+E+V F KE ESW+M+T E+I+AA  KKEEGNVL+K GKY RA+K+Y+K   ++  D 
Sbjct  378  YELEMVDFTKEEESWEMDTHERIKAAETKKEEGNVLYKIGKYTRAAKKYDKAMDYVREDD  437

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SF + + K  KALK+SC LNN AC LKL +YK A  LC+KVL +ES NVKALYRRAQAY+
Sbjct  438  SFEDNQMKLVKALKVSCWLNNGACSLKLDEYKGAINLCSKVLNVESQNVKALYRRAQAYM  497

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
              +D DLAE D+KKALE+DP NREVK  +K LK+   E NK+DAK +GNMF+++ K E  
Sbjct  498  GTSDLDLAELDLKKALEVDPQNREVKALHKTLKQMQIESNKRDAKLFGNMFSRMRKDECM  557

Query  313  SSNK  302
             S K
Sbjct  558  GSKK  561



>gb|ERN18583.1| hypothetical protein AMTR_s00065p00132670 [Amborella trichopoda]
Length=599

 Score =   181 bits (459),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 108/184 (59%), Positives = 137/184 (74%), Gaps = 0/184 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+E+V F KE ESW+M+T E+I+AA  KKEEGNVL+K GKY RA+K+Y+K   ++  D 
Sbjct  377  YELEMVDFTKEEESWEMDTHERIKAAETKKEEGNVLYKIGKYTRAAKKYDKAMDYVREDD  436

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SF + + K  KALK+SC LNN AC LKL +YK A  LC+KVL +ES NVKALYRRAQAY+
Sbjct  437  SFEDNQMKLVKALKVSCWLNNGACSLKLDEYKGAINLCSKVLNVESQNVKALYRRAQAYM  496

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
              +D DLAE D+KKALE+DP NREVK  +K LK+   E NK+DAK +GNMF+++ K E  
Sbjct  497  GTSDLDLAELDLKKALEVDPQNREVKALHKTLKQMQIESNKRDAKLFGNMFSRMRKDECM  556

Query  313  SSNK  302
             S K
Sbjct  557  GSKK  560



>gb|KDO57438.1| hypothetical protein CISIN_1g028428mg [Citrus sinensis]
 gb|KDO57439.1| hypothetical protein CISIN_1g028428mg [Citrus sinensis]
Length=209

 Score =   167 bits (424),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 132/175 (75%), Gaps = 0/175 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ L+ F KE+  W M+T EKIEA  +KK +GN+LF+AGKY RASK+YEK AK IE+  
Sbjct  35   YEVTLIDFTKEKPFWKMDTHEKIEACERKKHDGNLLFRAGKYWRASKKYEKAAKIIEFHH  94

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SF+++EK Q+  L++SC LNNAACKLKL+DY E   LCTKVLELE  NVKALYRR+QA++
Sbjct  95   SFTDDEKHQANGLRLSCYLNNAACKLKLEDYSETSSLCTKVLELEPLNVKALYRRSQAHL  154

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLS  329
              ++ + AE DIK+AL IDP+NR VKL Y  LK+K +EY K  A+ +G M +K+ 
Sbjct  155  KTSELEKAEADIKRALTIDPNNRVVKLVYMELKDKQREYAKYQAEIFGTMLSKMG  209



>gb|KDO52833.1| hypothetical protein CISIN_1g036950mg [Citrus sinensis]
Length=469

 Score =   172 bits (437),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 112/197 (57%), Positives = 137/197 (70%), Gaps = 28/197 (14%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELVSF+KE+ESWDMNTQEKIEAAGKKKEEGNVLFKAGKY RASKRYE+   +I YD+
Sbjct  265  YEVELVSFIKEKESWDMNTQEKIEAAGKKKEEGNVLFKAGKYERASKRYEQAVNYIGYDS  324

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFS+EEK+Q+K LKI+CNLNNAACKLKLK+YK+AEKLC+KVLEL+               
Sbjct  325  SFSDEEKQQAKVLKITCNLNNAACKLKLKEYKQAEKLCSKVLELD---------------  369

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynk-----KDAKFYGNMFAKLS  329
                    + DIKKALEIDPDN         ++ K+ +        KD +FYGN+FAK++
Sbjct  370  --------KLDIKKALEIDPDNSLEAGWGVRMEYKLLKEKVREYNKKDVQFYGNIFAKIN  421

Query  328  KPEPFSSNKSAPQEAEA  278
            K E   S  S  ++  A
Sbjct  422  KLEQAKSASSMAKQEPA  438



>ref|XP_003544491.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Glycine 
max]
 gb|KHN17168.1| Peptidyl-prolyl cis-trans isomerase FKBP62 [Glycine soja]
Length=582

 Score =   173 bits (439),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 101/181 (56%), Positives = 136/181 (75%), Gaps = 0/181 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            Y++E++ F+KE+  W++N++EKIE AG+ KEEGNVLFK G Y RA K+YEK A F+E D 
Sbjct  371  YDVEMMDFIKEKAPWELNSKEKIEVAGRMKEEGNVLFKGGNYQRAGKKYEKAADFVEEDG  430

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SF ++E+KQ++ L++SC LN AAC LKL D+  A KLC++VL++E  NVKA YRRAQAYI
Sbjct  431  SFGDDEQKQAQTLRVSCWLNGAACSLKLNDFPGAIKLCSQVLDVEFCNVKAFYRRAQAYI  490

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
               D+ LA+ DIKKAL +DP NREVK+  K LK+   + +KKDAK Y NMFA+ +K  P 
Sbjct  491  ETGDYLLADVDIKKALVVDPQNREVKVIQKKLKQLQADSDKKDAKLYENMFARKTKDSPM  550

Query  313  S  311
            +
Sbjct  551  A  551



>ref|XP_007018460.1| FKBP-type peptidyl-prolyl cis-trans isomerase family protein 
[Theobroma cacao]
 gb|EOY15685.1| FKBP-type peptidyl-prolyl cis-trans isomerase family protein 
[Theobroma cacao]
Length=603

 Score =   172 bits (436),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 135/176 (77%), Gaps = 0/176 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+E++ FVKE+  W++N+QEKIEAAGKKKEEGN+LFK+GKY RA K+Y+K   ++  D 
Sbjct  382  YEVEMLDFVKEKAPWELNSQEKIEAAGKKKEEGNMLFKSGKYQRAGKKYDKAVDYVSEDG  441

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
             F ++E+K  KAL+ISC LN AAC LKL D++ A KLC+KVL+ E  NVKALYRRAQAY+
Sbjct  442  PFGDDEQKLVKALRISCWLNGAACSLKLSDFQGAIKLCSKVLDFEFHNVKALYRRAQAYM  501

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSK  326
              +D  LAE DIKKALE DP NREVKL  K L++   E N +DAK + NMFA++SK
Sbjct  502  ETSDLVLAELDIKKALEADPQNREVKLLQKTLRQLQVESNMRDAKLFTNMFARMSK  557



>ref|XP_006433656.1| hypothetical protein CICLE_v10003372mg [Citrus clementina]
 gb|ESR46896.1| hypothetical protein CICLE_v10003372mg [Citrus clementina]
Length=606

 Score =   171 bits (432),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 108/184 (59%), Positives = 138/184 (75%), Gaps = 0/184 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+E++ F+KE+  W+MN QEKIEAAG+KKEEGN+LFK GKY RA K+Y K A  +  D 
Sbjct  384  YEVEMMDFIKEKVPWEMNNQEKIEAAGRKKEEGNLLFKNGKYERAGKKYNKAADCVSEDG  443

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SF ++E+K  K+L++SC LN+AAC LKLKDY+ A +LC+KVL+ +  NVKALYRRAQAY+
Sbjct  444  SFVDDEQKLVKSLRVSCWLNSAACCLKLKDYQGAIELCSKVLDCDCHNVKALYRRAQAYM  503

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
              AD  LAE DIKKA+E DP NREV L  K LK+   E NK+DAKFY NMFA ++K    
Sbjct  504  EIADLILAELDIKKAIEADPQNREVTLLQKSLKQLQAESNKRDAKFYANMFAHVTKDSSV  563

Query  313  SSNK  302
            ++ K
Sbjct  564  ATKK  567



>gb|KEH40013.1| FKBP-type peptidyl-prolyl cis-trans isomerase [Medicago truncatula]
Length=340

 Score =   166 bits (420),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 134/176 (76%), Gaps = 0/176 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            Y+IE+V F+KE+  W++N+ EKI+ A +KKEEGN+LFK+GKY RA+K+Y+K A F+  D 
Sbjct  161  YDIEMVDFIKEKAPWELNSNEKIKVAERKKEEGNLLFKSGKYQRAAKKYDKAADFVSRDG  220

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            S  ++E+K +K+L++SC LN AAC LKL D+  A KLCT+VL++E  NVKALYRRAQAYI
Sbjct  221  SLGDDEEKLAKSLRVSCWLNGAACCLKLNDFPGAIKLCTQVLDVEFHNVKALYRRAQAYI  280

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSK  326
               DF LA+ DIKKALE+DP NREVK+    LK+   + +KKDAK Y +MFA  +K
Sbjct  281  ETEDFLLADVDIKKALEVDPQNREVKVLKMKLKQLQADSDKKDAKLYESMFAPKTK  336



>ref|XP_009613899.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X3 [Nicotiana tomentosiformis]
Length=362

 Score =   166 bits (421),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 138/192 (72%), Gaps = 0/192 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            +E+E++ F KE++ W+MN  E+I+ + +KKEEGN+LFK GKY RA K+YEK   +I  D 
Sbjct  159  FEVEMLEFTKEKDPWEMNKHERIQVSQRKKEEGNLLFKNGKYQRAMKKYEKAVDYINEDG  218

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            +F +++++  K+L++SC LN AAC LK  D++EA KLC+KVLE+ES NVKALYRRAQA++
Sbjct  219  TFEDDDQRLVKSLRVSCWLNGAACCLKQNDFQEAFKLCSKVLEIESCNVKALYRRAQAFM  278

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
              AD  LAE D KKALEIDP NREVKL  K LK+   E NKKDAK Y  MF +LS     
Sbjct  279  ETADLHLAELDFKKALEIDPQNREVKLIQKTLKQLQVESNKKDAKLYTTMFTRLSNENSS  338

Query  313  SSNKSAPQEAEA  278
            ++ +   +E E+
Sbjct  339  AAKRLKVEETES  350



>ref|XP_006472323.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Citrus sinensis]
Length=606

 Score =   170 bits (431),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 108/184 (59%), Positives = 139/184 (76%), Gaps = 0/184 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+E++ F+KE+  W+MN Q KIEAAG+KKEEGN+LFK GKY RA K+Y K A  +  D 
Sbjct  384  YEVEMMDFIKEKVPWEMNNQGKIEAAGRKKEEGNLLFKNGKYERAGKKYYKAADCVSEDG  443

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SF ++E+K  K+L++SC LN+AAC LKLKDY+ A +LC+KVL+ +  NVKALYRRAQAY+
Sbjct  444  SFVDDEQKLVKSLRVSCWLNSAACCLKLKDYQGAIELCSKVLDCDCHNVKALYRRAQAYM  503

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
              AD  LAE DIKKA+E DP NREVKL  K LK+   E NK+DAKFY NMFA+++K    
Sbjct  504  EIADLILAELDIKKAIEADPQNREVKLLQKSLKQLQAESNKRDAKFYANMFARVTKDSSV  563

Query  313  SSNK  302
            ++ K
Sbjct  564  ATKK  567



>ref|XP_006430496.1| hypothetical protein CICLE_v10011447mg [Citrus clementina]
 gb|ESR43736.1| hypothetical protein CICLE_v10011447mg [Citrus clementina]
Length=535

 Score =   169 bits (428),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 133/175 (76%), Gaps = 0/175 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ L+ F KE+  W M+T EKIEA  +KK +GN+LF+AGKY RASK+YEK AK IE+  
Sbjct  361  YEVTLIDFTKEKPFWKMDTHEKIEACERKKHDGNLLFRAGKYWRASKKYEKAAKIIEFHH  420

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SF+++EK Q+  L++SC LNNAACKLKL+DY E   LCTKVLELE  NVKALYRR+QAY+
Sbjct  421  SFTDDEKHQANGLRLSCYLNNAACKLKLEDYSETSSLCTKVLELEPLNVKALYRRSQAYL  480

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLS  329
              ++ + AE DIK+AL IDP+NR+VKL Y  LK+K +EY K  A+ +G M +K+ 
Sbjct  481  KTSELEKAEADIKRALTIDPNNRDVKLVYMELKDKQREYAKYQAEIFGTMLSKMG  535



>ref|XP_010553661.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase isoform X3 [Tarenaya 
hassleriana]
Length=376

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 107/187 (57%), Positives = 138/187 (74%), Gaps = 3/187 (2%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+E++ FVKE+  W+MN QEKIEAA +KK+EGN L+K  KY RA+K+Y+K A  +E   
Sbjct  161  YEVEMLDFVKEKRPWEMNNQEKIEAACRKKDEGNQLYKNQKYQRAAKKYDKAADCVEA-C  219

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SF ++E+KQ KAL++SC LN AAC LKLKD+ EA +LC+KVLE+E  NVKALYRRAQAYI
Sbjct  220  SFGDDEEKQVKALRVSCWLNGAACSLKLKDFPEAIRLCSKVLEIEFLNVKALYRRAQAYI  279

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
               D   AE DI+KALE DP+NREVK   + LK+   E +K+DAK Y NMF +L+  +  
Sbjct  280  EIGDLFQAEMDIRKALEADPENREVKSLERTLKQSKAETDKRDAKLYSNMFKRLATKD--  337

Query  313  SSNKSAP  293
            S + SAP
Sbjct  338  SLDLSAP  344



>gb|KEH40012.1| FKBP-type peptidyl-prolyl cis-trans isomerase [Medicago truncatula]
Length=370

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 134/176 (76%), Gaps = 0/176 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            Y+IE+V F+KE+  W++N+ EKI+ A +KKEEGN+LFK+GKY RA+K+Y+K A F+  D 
Sbjct  161  YDIEMVDFIKEKAPWELNSNEKIKVAERKKEEGNLLFKSGKYQRAAKKYDKAADFVSRDG  220

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            S  ++E+K +K+L++SC LN AAC LKL D+  A KLCT+VL++E  NVKALYRRAQAYI
Sbjct  221  SLGDDEEKLAKSLRVSCWLNGAACCLKLNDFPGAIKLCTQVLDVEFHNVKALYRRAQAYI  280

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSK  326
               DF LA+ DIKKALE+DP NREVK+    LK+   + +KKDAK Y +MFA  +K
Sbjct  281  ETEDFLLADVDIKKALEVDPQNREVKVLKMKLKQLQADSDKKDAKLYESMFAPKTK  336



>ref|XP_009764363.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X3 [Nicotiana sylvestris]
Length=361

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 139/192 (72%), Gaps = 1/192 (1%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            +E+E++ F KE++ W+MN  E+I+ A +KKEEGN+LFK GKY RA  +YEK   +I  D 
Sbjct  159  FEVEMLEFTKEKDPWEMNKHERIQVAQRKKEEGNLLFKNGKYQRAMTKYEKAVDYINEDG  218

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            +F +++++  K+L++SC LN AAC LK  D++EA K C+KVLE+ES NVKALYRRAQA++
Sbjct  219  TFEDDDQRLVKSLRVSCWLNGAACCLKQNDFQEAIKQCSKVLEIESCNVKALYRRAQAFM  278

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
              AD  LAE DIKKALEIDP NREVKL  + LK+   E NKKDAK Y  MFA+LS  E  
Sbjct  279  ETADLHLAELDIKKALEIDPQNREVKLIQRTLKQLQAESNKKDAKVYTTMFARLSN-ENS  337

Query  313  SSNKSAPQEAEA  278
            S+ K    EAE+
Sbjct  338  SAAKRLKVEAES  349



>ref|XP_010273186.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X2 [Nelumbo nucifera]
Length=437

 Score =   166 bits (421),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 104/192 (54%), Positives = 135/192 (70%), Gaps = 0/192 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+E+V F +E+  W+M+  EKIE AG KKEEGN LFK GK+ RA+KRYEK   ++  D 
Sbjct  194  YEVEMVDFTREKAPWEMSNHEKIETAGMKKEEGNALFKNGKFQRAAKRYEKATDYVSEDG  253

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            +  + E+K  KAL++SC LN AAC LKL D++ A KLC+KVL++E  NVKALYRRAQAYI
Sbjct  254  TSEDGEQKLVKALRVSCWLNIAACNLKLNDFQGAIKLCSKVLDIEFYNVKALYRRAQAYI  313

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
              AD D AE D+KKALE+DP NRE K   K LK+   E NK+DAK Y +MFA + K  P 
Sbjct  314  ETADLDFAELDVKKALEVDPQNREFKSMQKKLKQLQVESNKRDAKLYTSMFAWMKKDTPV  373

Query  313  SSNKSAPQEAEA  278
            ++ +   ++AE 
Sbjct  374  ATKRLKVEKAEG  385



>gb|KEH40011.1| FKBP-type peptidyl-prolyl cis-trans isomerase [Medicago truncatula]
Length=424

 Score =   166 bits (420),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 134/176 (76%), Gaps = 0/176 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            Y+IE+V F+KE+  W++N+ EKI+ A +KKEEGN+LFK+GKY RA+K+Y+K A F+  D 
Sbjct  245  YDIEMVDFIKEKAPWELNSNEKIKVAERKKEEGNLLFKSGKYQRAAKKYDKAADFVSRDG  304

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            S  ++E+K +K+L++SC LN AAC LKL D+  A KLCT+VL++E  NVKALYRRAQAYI
Sbjct  305  SLGDDEEKLAKSLRVSCWLNGAACCLKLNDFPGAIKLCTQVLDVEFHNVKALYRRAQAYI  364

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSK  326
               DF LA+ DIKKALE+DP NREVK+    LK+   + +KKDAK Y +MFA  +K
Sbjct  365  ETEDFLLADVDIKKALEVDPQNREVKVLKMKLKQLQADSDKKDAKLYESMFAPKTK  420



>ref|XP_002510075.1| peptidylprolyl isomerase, putative [Ricinus communis]
 gb|EEF52262.1| peptidylprolyl isomerase, putative [Ricinus communis]
Length=598

 Score =   169 bits (427),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 102/176 (58%), Positives = 135/176 (77%), Gaps = 0/176 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YEIE++ F+KE+  W+MN +EKIEAAG+KKEEGN+LFK+GK+ RA K+Y+K A +I  + 
Sbjct  376  YEIEMLDFIKEKTPWEMNNKEKIEAAGRKKEEGNLLFKSGKFQRAGKKYDKAADYIVEEV  435

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SF ++E+K  K+L++SC LN AAC LKL D++    LC+KVL++E  NVKALYRRAQAY+
Sbjct  436  SFDDDEQKLIKSLRVSCWLNGAACSLKLGDFQGTINLCSKVLDVEFDNVKALYRRAQAYM  495

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSK  326
              AD   AE DIKKALEIDP NREVK   K L++   E +K+DAK Y NMFA+++K
Sbjct  496  QTADLVSAELDIKKALEIDPHNREVKSLQKTLRQLQVERDKRDAKLYSNMFARMTK  551



>ref|XP_010244430.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Nelumbo nucifera]
Length=541

 Score =   168 bits (426),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 141/186 (76%), Gaps = 8/186 (4%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEK--------G  698
            YE+EL+SF KE+  W M T EKIE   +KKE+GN+LFK GK+  ASK+YEK         
Sbjct  355  YEVELISFTKEKPFWKMETAEKIETCERKKEDGNMLFKNGKFLFASKKYEKEIIFYYLQA  414

Query  697  AKFIEYDTSFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKAL  518
             K+IE+D SF++EEK Q+ AL+ISCNLNNAACKLKL +Y EA  LCTKVLEL+  NVKAL
Sbjct  415  VKYIEFDHSFTDEEKSQANALRISCNLNNAACKLKLGEYVEAAGLCTKVLELDPFNVKAL  474

Query  517  YRRAQAYIHFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFA  338
            YRR+Q+YI  +D + AE DIKKAL +DP+NR+VKLEYK LK+K KEY K  A+ +G MF+
Sbjct  475  YRRSQSYIRTSDLEKAEIDIKKALTVDPNNRDVKLEYKKLKDKAKEYAKYQAEIFGTMFS  534

Query  337  KLSKPE  320
            ++++ E
Sbjct  535  RMAQLE  540



>ref|XP_006482027.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X1 [Citrus 
sinensis]
Length=535

 Score =   168 bits (425),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 132/175 (75%), Gaps = 0/175 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ L+ F KE+  W M+T EKIEA  +KK +GN+LF+AGKY RASK+YEK AK IE+  
Sbjct  361  YEVTLIDFTKEKPFWKMDTHEKIEACERKKHDGNLLFRAGKYWRASKKYEKAAKIIEFHH  420

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SF+++EK Q+  L++SC LNNAACKLKL+DY E   LCTKVLELE  NVKALYRR+QA++
Sbjct  421  SFTDDEKHQANGLRLSCYLNNAACKLKLEDYSETSSLCTKVLELEPLNVKALYRRSQAHL  480

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLS  329
              ++ + AE DIK+AL IDP+NR VKL Y  LK+K +EY K  A+ +G M +K+ 
Sbjct  481  KTSELEKAEADIKRALTIDPNNRVVKLVYMELKDKQREYAKYQAEIFGTMLSKMG  535



>ref|XP_010653645.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Vitis vinifera]
Length=517

 Score =   167 bits (424),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 113/143 (79%), Gaps = 0/143 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+EL+ F KER  W M   EK+EA  +KK +GN+LFKAGK+  ASK+YEK  K+IE+D 
Sbjct  343  YEVELIDFTKERPFWKMENHEKLEACERKKHDGNMLFKAGKFWHASKKYEKAEKYIEFDH  402

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SF++EEK Q+ AL+ISCNLNNAACKLKL +Y EA K CTKVLEL+ +N+KALYRR+Q+Y+
Sbjct  403  SFTDEEKVQANALRISCNLNNAACKLKLGEYLEASKQCTKVLELDPSNIKALYRRSQSYL  462

Query  493  HFADFDLAEFDIKKALEIDPDNR  425
              ++ + AE DI++AL IDP NR
Sbjct  463  RISELEKAEADIRRALTIDPSNR  485



>gb|KEH40010.1| FKBP-type peptidyl-prolyl cis-trans isomerase [Medicago truncatula]
Length=454

 Score =   166 bits (421),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 134/176 (76%), Gaps = 0/176 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            Y+IE+V F+KE+  W++N+ EKI+ A +KKEEGN+LFK+GKY RA+K+Y+K A F+  D 
Sbjct  245  YDIEMVDFIKEKAPWELNSNEKIKVAERKKEEGNLLFKSGKYQRAAKKYDKAADFVSRDG  304

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            S  ++E+K +K+L++SC LN AAC LKL D+  A KLCT+VL++E  NVKALYRRAQAYI
Sbjct  305  SLGDDEEKLAKSLRVSCWLNGAACCLKLNDFPGAIKLCTQVLDVEFHNVKALYRRAQAYI  364

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSK  326
               DF LA+ DIKKALE+DP NREVK+    LK+   + +KKDAK Y +MFA  +K
Sbjct  365  ETEDFLLADVDIKKALEVDPQNREVKVLKMKLKQLQADSDKKDAKLYESMFAPKTK  420



>ref|XP_007162035.1| hypothetical protein PHAVU_001G118200g [Phaseolus vulgaris]
 gb|ESW34029.1| hypothetical protein PHAVU_001G118200g [Phaseolus vulgaris]
Length=610

 Score =   168 bits (425),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 114/143 (80%), Gaps = 0/143 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELV FVKE+  W M+TQEKIEA  +KK +GN+LFKA  +  ASK+YEK  K+IE+D 
Sbjct  436  YEVELVDFVKEKPFWKMDTQEKIEACERKKYDGNLLFKAENFMHASKKYEKAVKYIEFDH  495

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSE+EK +S  L++SCNLNNAACKLKL +Y EA +LCTKVLE +  N+KALYRR+QAY+
Sbjct  496  SFSEDEKHRSNTLRLSCNLNNAACKLKLGEYIEASRLCTKVLEQDPLNIKALYRRSQAYV  555

Query  493  HFADFDLAEFDIKKALEIDPDNR  425
              +D + AE DIK+AL IDP+NR
Sbjct  556  KTSDLEKAEADIKRALTIDPNNR  578



>gb|KEH40009.1| FKBP-type peptidyl-prolyl cis-trans isomerase [Medicago truncatula]
Length=550

 Score =   167 bits (423),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 134/176 (76%), Gaps = 0/176 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            Y+IE+V F+KE+  W++N+ EKI+ A +KKEEGN+LFK+GKY RA+K+Y+K A F+  D 
Sbjct  371  YDIEMVDFIKEKAPWELNSNEKIKVAERKKEEGNLLFKSGKYQRAAKKYDKAADFVSRDG  430

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            S  ++E+K +K+L++SC LN AAC LKL D+  A KLCT+VL++E  NVKALYRRAQAYI
Sbjct  431  SLGDDEEKLAKSLRVSCWLNGAACCLKLNDFPGAIKLCTQVLDVEFHNVKALYRRAQAYI  490

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSK  326
               DF LA+ DIKKALE+DP NREVK+    LK+   + +KKDAK Y +MFA  +K
Sbjct  491  ETEDFLLADVDIKKALEVDPQNREVKVLKMKLKQLQADSDKKDAKLYESMFAPKTK  546



>gb|KEH40014.1| FKBP-type peptidyl-prolyl cis-trans isomerase [Medicago truncatula]
Length=556

 Score =   167 bits (422),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 134/176 (76%), Gaps = 0/176 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            Y+IE+V F+KE+  W++N+ EKI+ A +KKEEGN+LFK+GKY RA+K+Y+K A F+  D 
Sbjct  347  YDIEMVDFIKEKAPWELNSNEKIKVAERKKEEGNLLFKSGKYQRAAKKYDKAADFVSRDG  406

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            S  ++E+K +K+L++SC LN AAC LKL D+  A KLCT+VL++E  NVKALYRRAQAYI
Sbjct  407  SLGDDEEKLAKSLRVSCWLNGAACCLKLNDFPGAIKLCTQVLDVEFHNVKALYRRAQAYI  466

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSK  326
               DF LA+ DIKKALE+DP NREVK+    LK+   + +KKDAK Y +MFA  +K
Sbjct  467  ETEDFLLADVDIKKALEVDPQNREVKVLKMKLKQLQADSDKKDAKLYESMFAPKTK  522



>gb|AES59301.2| FKBP-type peptidyl-prolyl cis-trans isomerase [Medicago truncatula]
Length=580

 Score =   167 bits (423),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 134/176 (76%), Gaps = 0/176 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            Y+IE+V F+KE+  W++N+ EKI+ A +KKEEGN+LFK+GKY RA+K+Y+K A F+  D 
Sbjct  371  YDIEMVDFIKEKAPWELNSNEKIKVAERKKEEGNLLFKSGKYQRAAKKYDKAADFVSRDG  430

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            S  ++E+K +K+L++SC LN AAC LKL D+  A KLCT+VL++E  NVKALYRRAQAYI
Sbjct  431  SLGDDEEKLAKSLRVSCWLNGAACCLKLNDFPGAIKLCTQVLDVEFHNVKALYRRAQAYI  490

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSK  326
               DF LA+ DIKKALE+DP NREVK+    LK+   + +KKDAK Y +MFA  +K
Sbjct  491  ETEDFLLADVDIKKALEVDPQNREVKVLKMKLKQLQADSDKKDAKLYESMFAPKTK  546



>ref|XP_003589050.1| 70 kDa peptidyl-prolyl isomerase [Medicago truncatula]
Length=609

 Score =   167 bits (422),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 134/176 (76%), Gaps = 0/176 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            Y+IE+V F+KE+  W++N+ EKI+ A +KKEEGN+LFK+GKY RA+K+Y+K A F+  D 
Sbjct  371  YDIEMVDFIKEKAPWELNSNEKIKVAERKKEEGNLLFKSGKYQRAAKKYDKAADFVSRDG  430

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            S  ++E+K +K+L++SC LN AAC LKL D+  A KLCT+VL++E  NVKALYRRAQAYI
Sbjct  431  SLGDDEEKLAKSLRVSCWLNGAACCLKLNDFPGAIKLCTQVLDVEFHNVKALYRRAQAYI  490

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSK  326
               DF LA+ DIKKALE+DP NREVK+    LK+   + +KKDAK Y +MFA  +K
Sbjct  491  ETEDFLLADVDIKKALEVDPQNREVKVLKMKLKQLQADSDKKDAKLYESMFAPKTK  546



>ref|XP_010553659.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase isoform X1 [Tarenaya 
hassleriana]
Length=598

 Score =   166 bits (420),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 107/187 (57%), Positives = 138/187 (74%), Gaps = 3/187 (2%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+E++ FVKE+  W+MN QEKIEAA +KK+EGN L+K  KY RA+K+Y+K A  +E   
Sbjct  383  YEVEMLDFVKEKRPWEMNNQEKIEAACRKKDEGNQLYKNQKYQRAAKKYDKAADCVEA-C  441

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SF ++E+KQ KAL++SC LN AAC LKLKD+ EA +LC+KVLE+E  NVKALYRRAQAYI
Sbjct  442  SFGDDEEKQVKALRVSCWLNGAACSLKLKDFPEAIRLCSKVLEIEFLNVKALYRRAQAYI  501

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
               D   AE DI+KALE DP+NREVK   + LK+   E +K+DAK Y NMF +L+  +  
Sbjct  502  EIGDLFQAEMDIRKALEADPENREVKSLERTLKQSKAETDKRDAKLYSNMFKRLATKD--  559

Query  313  SSNKSAP  293
            S + SAP
Sbjct  560  SLDLSAP  566



>ref|XP_009613898.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X2 [Nicotiana tomentosiformis]
Length=571

 Score =   166 bits (419),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 138/192 (72%), Gaps = 0/192 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            +E+E++ F KE++ W+MN  E+I+ + +KKEEGN+LFK GKY RA K+YEK   +I  D 
Sbjct  368  FEVEMLEFTKEKDPWEMNKHERIQVSQRKKEEGNLLFKNGKYQRAMKKYEKAVDYINEDG  427

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            +F +++++  K+L++SC LN AAC LK  D++EA KLC+KVLE+ES NVKALYRRAQA++
Sbjct  428  TFEDDDQRLVKSLRVSCWLNGAACCLKQNDFQEAFKLCSKVLEIESCNVKALYRRAQAFM  487

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
              AD  LAE D KKALEIDP NREVKL  K LK+   E NKKDAK Y  MF +LS     
Sbjct  488  ETADLHLAELDFKKALEIDPQNREVKLIQKTLKQLQVESNKKDAKLYTTMFTRLSNENSS  547

Query  313  SSNKSAPQEAEA  278
            ++ +   +E E+
Sbjct  548  AAKRLKVEETES  559



>gb|KHG02788.1| Peptidyl-prolyl cis-trans isomerase FKBP65 -like protein [Gossypium 
arboreum]
Length=603

 Score =   166 bits (420),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 133/176 (76%), Gaps = 0/176 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+E++ FVKE+  W++N QEKIEAAGKKKEEGN+LFK G Y RA K+Y+K   ++  D 
Sbjct  382  YEVEMLDFVKEKAPWELNNQEKIEAAGKKKEEGNILFKDGNYQRAGKKYDKAVDYVSEDG  441

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
             F ++E+KQ KAL+ISC LN AAC LKL D+  A +LC+KVL+ ES NVKALYRRAQAY+
Sbjct  442  LFQDDEQKQIKALRISCWLNGAACSLKLSDFWGAIQLCSKVLDFESYNVKALYRRAQAYM  501

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSK  326
              +D   AE DIKKALE DP NREVKL  K L++   E NK+DAK + NMFA++SK
Sbjct  502  KTSDLISAEMDIKKALEADPQNREVKLLQKTLRQLQVESNKRDAKLFTNMFAQMSK  557



>ref|XP_010273182.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X1 [Nelumbo 
nucifera]
Length=623

 Score =   166 bits (420),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 104/192 (54%), Positives = 135/192 (70%), Gaps = 0/192 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+E+V F +E+  W+M+  EKIE AG KKEEGN LFK GK+ RA+KRYEK   ++  D 
Sbjct  380  YEVEMVDFTREKAPWEMSNHEKIETAGMKKEEGNALFKNGKFQRAAKRYEKATDYVSEDG  439

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            +  + E+K  KAL++SC LN AAC LKL D++ A KLC+KVL++E  NVKALYRRAQAYI
Sbjct  440  TSEDGEQKLVKALRVSCWLNIAACNLKLNDFQGAIKLCSKVLDIEFYNVKALYRRAQAYI  499

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
              AD D AE D+KKALE+DP NRE K   K LK+   E NK+DAK Y +MFA + K  P 
Sbjct  500  ETADLDFAELDVKKALEVDPQNREFKSMQKKLKQLQVESNKRDAKLYTSMFAWMKKDTPV  559

Query  313  SSNKSAPQEAEA  278
            ++ +   ++AE 
Sbjct  560  ATKRLKVEKAEG  571



>ref|XP_009613897.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X1 [Nicotiana tomentosiformis]
Length=581

 Score =   166 bits (419),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 100/175 (57%), Positives = 131/175 (75%), Gaps = 0/175 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            +E+E++ F KE++ W+MN  E+I+ + +KKEEGN+LFK GKY RA K+YEK   +I  D 
Sbjct  378  FEVEMLEFTKEKDPWEMNKHERIQVSQRKKEEGNLLFKNGKYQRAMKKYEKAVDYINEDG  437

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            +F +++++  K+L++SC LN AAC LK  D++EA KLC+KVLE+ES NVKALYRRAQA++
Sbjct  438  TFEDDDQRLVKSLRVSCWLNGAACCLKQNDFQEAFKLCSKVLEIESCNVKALYRRAQAFM  497

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLS  329
              AD  LAE D KKALEIDP NREVKL  K LK+   E NKKDAK Y  MF +LS
Sbjct  498  ETADLHLAELDFKKALEIDPQNREVKLIQKTLKQLQVESNKKDAKLYTTMFTRLS  552



>ref|XP_009764360.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X1 [Nicotiana sylvestris]
Length=580

 Score =   166 bits (419),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 139/192 (72%), Gaps = 1/192 (1%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            +E+E++ F KE++ W+MN  E+I+ A +KKEEGN+LFK GKY RA  +YEK   +I  D 
Sbjct  378  FEVEMLEFTKEKDPWEMNKHERIQVAQRKKEEGNLLFKNGKYQRAMTKYEKAVDYINEDG  437

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            +F +++++  K+L++SC LN AAC LK  D++EA K C+KVLE+ES NVKALYRRAQA++
Sbjct  438  TFEDDDQRLVKSLRVSCWLNGAACCLKQNDFQEAIKQCSKVLEIESCNVKALYRRAQAFM  497

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
              AD  LAE DIKKALEIDP NREVKL  + LK+   E NKKDAK Y  MFA+LS  E  
Sbjct  498  ETADLHLAELDIKKALEIDPQNREVKLIQRTLKQLQAESNKKDAKVYTTMFARLSN-ENS  556

Query  313  SSNKSAPQEAEA  278
            S+ K    EAE+
Sbjct  557  SAAKRLKVEAES  568



>ref|XP_002863790.1| hypothetical protein ARALYDRAFT_917529 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40049.1| hypothetical protein ARALYDRAFT_917529 [Arabidopsis lyrata subsp. 
lyrata]
Length=349

 Score =   161 bits (408),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 94/119 (79%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = -2

Query  856  SYEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYD  677
            +YE++LV+F KERE WDMNT+EKIEAAGKKKEEGN  FKAGKYA ASKRY+K  KFIEYD
Sbjct  146  NYEVDLVTFEKERELWDMNTEEKIEAAGKKKEEGNAKFKAGKYALASKRYDKAVKFIEYD  205

Query  676  TSFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQA  500
            TSFSEEEKKQ+KALK++CNL + ACKLKLKDYK+AEKLCTKVLELESTNVKAL+   +A
Sbjct  206  TSFSEEEKKQAKALKVACNLQDVACKLKLKDYKQAEKLCTKVLELESTNVKALFVLVKA  264



>ref|XP_003550301.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Glycine 
max]
Length=583

 Score =   166 bits (419),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 133/176 (76%), Gaps = 0/176 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            Y+IE++ F+KE+  W++N++EKIE AG+ KEEGNVLFK G Y RA K+YEK A F++ D 
Sbjct  372  YDIEMMDFIKEKAPWELNSKEKIEVAGRMKEEGNVLFKVGNYQRAGKKYEKAADFVDEDG  431

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SF  +E+KQ++ LK+SC LN+AAC LKL D+  A KLC++VL++E  NVKA YRRAQAYI
Sbjct  432  SFGFDEQKQAQTLKVSCWLNSAACSLKLNDFPGAIKLCSQVLDVEFCNVKAFYRRAQAYI  491

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSK  326
               D+ LA+ DIKKAL +DP NR+VK+  K LK+   + +KKDAK Y NM A+ +K
Sbjct  492  ETGDYLLADVDIKKALVVDPQNRDVKVIQKKLKQLQADSDKKDAKLYENMLARKTK  547



>ref|XP_009764362.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X2 [Nicotiana sylvestris]
Length=570

 Score =   165 bits (418),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 139/192 (72%), Gaps = 1/192 (1%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            +E+E++ F KE++ W+MN  E+I+ A +KKEEGN+LFK GKY RA  +YEK   +I  D 
Sbjct  368  FEVEMLEFTKEKDPWEMNKHERIQVAQRKKEEGNLLFKNGKYQRAMTKYEKAVDYINEDG  427

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            +F +++++  K+L++SC LN AAC LK  D++EA K C+KVLE+ES NVKALYRRAQA++
Sbjct  428  TFEDDDQRLVKSLRVSCWLNGAACCLKQNDFQEAIKQCSKVLEIESCNVKALYRRAQAFM  487

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSKPEPF  314
              AD  LAE DIKKALEIDP NREVKL  + LK+   E NKKDAK Y  MFA+LS  E  
Sbjct  488  ETADLHLAELDIKKALEIDPQNREVKLIQRTLKQLQAESNKKDAKVYTTMFARLSN-ENS  546

Query  313  SSNKSAPQEAEA  278
            S+ K    EAE+
Sbjct  547  SAAKRLKVEAES  558



>gb|KHN36977.1| Peptidyl-prolyl cis-trans isomerase FKBP62 [Glycine soja]
Length=583

 Score =   166 bits (419),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 133/176 (76%), Gaps = 0/176 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            Y+IE++ F+KE+  W++N++EKIE AG+ KEEGNVLFK G Y RA K+YEK A F++ D 
Sbjct  372  YDIEMMDFIKEKAPWELNSKEKIEVAGRMKEEGNVLFKVGNYQRAGKKYEKAADFVDEDG  431

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SF  +E+KQ++ LK+SC LN+AAC LKL D+  A KLC++VL++E  NVKA YRRAQAYI
Sbjct  432  SFGFDEQKQAQTLKVSCWLNSAACSLKLDDFPGAIKLCSQVLDVEFCNVKAFYRRAQAYI  491

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSK  326
               D+ LA+ DIKKAL +DP NR+VK+  K LK+   + +KKDAK Y NM A+ +K
Sbjct  492  ETGDYLLADVDIKKALVVDPQNRDVKVIQKKLKQLQADSDKKDAKLYENMLARKTK  547



>ref|XP_010061642.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Eucalyptus 
grandis]
 gb|KCW68629.1| hypothetical protein EUGRSUZ_F02235 [Eucalyptus grandis]
Length=608

 Score =   165 bits (417),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 134/176 (76%), Gaps = 0/176 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+E++ F+KER  W+MN  E+IE AG+KKEEGN+LFKAGK  RA K+Y+K A ++  D 
Sbjct  380  YEVEMLDFIKERAPWEMNNSERIEEAGRKKEEGNLLFKAGKLRRAGKKYDKAADYVGEDG  439

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SF ++E+K  KAL+++C LN AAC LKL +++EA +LC+KVL+ E  NVKALYRRAQAY+
Sbjct  440  SFGDDEQKLVKALRVACWLNAAACSLKLNNFQEAIRLCSKVLDYEFYNVKALYRRAQAYM  499

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSK  326
              AD   AE DI+KAL+IDP NREVK+  + LK+   E N++DAK Y NMFA ++K
Sbjct  500  ETADLVSAELDIRKALDIDPVNREVKMLERSLKQLQAESNRRDAKVYSNMFAWMTK  555



>ref|XP_006380967.1| hypothetical protein POPTR_0006s03190g [Populus trichocarpa]
 gb|ERP58764.1| hypothetical protein POPTR_0006s03190g [Populus trichocarpa]
Length=535

 Score =   164 bits (414),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 117/143 (82%), Gaps = 0/143 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+EL+ F+KE+  W M+T EK+EA+ +KK +GNVLFKAGK+ RASK+YEK AK+IE+D 
Sbjct  361  YEVELLDFIKEKPFWKMDTHEKLEASERKKLDGNVLFKAGKFWRASKKYEKAAKYIEFDH  420

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SF++EE   +K+L++SC LNNAACKLK  ++ EA +LCTKVLEL+  NVKAL+RR+QAY+
Sbjct  421  SFTDEEMCLAKSLRLSCYLNNAACKLKSGEFLEASRLCTKVLELDPLNVKALFRRSQAYL  480

Query  493  HFADFDLAEFDIKKALEIDPDNR  425
              ++ + AE DIKKAL IDP+NR
Sbjct  481  KTSELEKAEADIKKALAIDPNNR  503



>ref|XP_010936157.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X1 [Elaeis guineensis]
Length=635

 Score =   163 bits (413),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 129/176 (73%), Gaps = 0/176 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELV F+KE+E W+M+  EKIEAA K K+ GN L+K GK+ RA+K+Y+K   +I  D 
Sbjct  385  YEVELVDFIKEKEPWEMSGLEKIEAAEKLKKAGNDLYKMGKFQRAAKKYDKAVNYINEDG  444

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
             F   E+K  K L++SC LN+AAC LKLKD++ A +LC+KVL++E  NVKALYRRAQAY+
Sbjct  445  PFKGGEEKLVKTLRVSCWLNHAACCLKLKDFQGAIELCSKVLDIEYCNVKALYRRAQAYM  504

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSK  326
              AD DLA+ DI+KALE+DP NREV+     LK+   E N++DAK Y NMF ++ K
Sbjct  505  EAADLDLAKLDIQKALEVDPQNREVRSLQVTLKQLQAESNRRDAKLYANMFERMRK  560



>ref|XP_009360953.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Pyrus x bretschneideri]
Length=553

 Score =   162 bits (411),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 135/176 (77%), Gaps = 0/176 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            +E+E++ F++E+  W+M+ QE++EAAGKKKEEGN+LFK GK+ +A K+Y+K A ++  D 
Sbjct  369  FEVEMLDFIREKAPWEMSNQERLEAAGKKKEEGNLLFKKGKHQQAGKKYDKAADYVSEDG  428

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            +F ++E K ++AL++ C LN AAC LKL D++EA KLC+KVL++E  NVKALYRRAQAY+
Sbjct  429  NFGDDESKLARALRMLCWLNGAACSLKLNDFQEAIKLCSKVLDIEFHNVKALYRRAQAYM  488

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSK  326
              AD  LAE DIKKALE+DP NREVKL  K LK    E +K+DAK Y N+F + +K
Sbjct  489  EIADLVLAELDIKKALEVDPHNREVKLIEKNLKRLQVESDKRDAKLYTNIFGRATK  544



>ref|XP_012068192.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X3 [Jatropha 
curcas]
Length=513

 Score =   161 bits (408),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 101/176 (57%), Positives = 130/176 (74%), Gaps = 0/176 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+E++ F+KE+  W+MN QEKIEAA  KKEEGN+LFK+GKY +A K+Y+K   ++  + 
Sbjct  292  YEVEMLDFLKEKAPWEMNNQEKIEAACIKKEEGNLLFKSGKYQKAGKKYDKAVDYVVEEE  351

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SF + E+K  K+L +SC LN AAC LKL D + A KLC+KVL++E  NVKALYRRAQAYI
Sbjct  352  SFGDNEQKLVKSLIVSCWLNGAACSLKLDDLQGAIKLCSKVLDIEYNNVKALYRRAQAYI  411

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSK  326
               D   AE DIKKALE+DP +REVK   K+LK+   E NK+DAK Y NMFA ++K
Sbjct  412  RILDLFSAEVDIKKALEVDPQSREVKSLQKMLKQLQAESNKRDAKLYSNMFAHMTK  467



>ref|XP_012068191.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X2 [Jatropha 
curcas]
Length=536

 Score =   162 bits (409),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 101/176 (57%), Positives = 130/176 (74%), Gaps = 0/176 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+E++ F+KE+  W+MN QEKIEAA  KKEEGN+LFK+GKY +A K+Y+K   ++  + 
Sbjct  315  YEVEMLDFLKEKAPWEMNNQEKIEAACIKKEEGNLLFKSGKYQKAGKKYDKAVDYVVEEE  374

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SF + E+K  K+L +SC LN AAC LKL D + A KLC+KVL++E  NVKALYRRAQAYI
Sbjct  375  SFGDNEQKLVKSLIVSCWLNGAACSLKLDDLQGAIKLCSKVLDIEYNNVKALYRRAQAYI  434

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSK  326
               D   AE DIKKALE+DP +REVK   K+LK+   E NK+DAK Y NMFA ++K
Sbjct  435  RILDLFSAEVDIKKALEVDPQSREVKSLQKMLKQLQAESNKRDAKLYSNMFAHMTK  490



>ref|XP_011017099.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Populus euphratica]
Length=608

 Score =   162 bits (409),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 132/176 (75%), Gaps = 0/176 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+E++ F+KE+  W+MN QEKI+AA +KKEEGN+LFK+GKY RA K+Y+K A ++  + 
Sbjct  380  YEVEMLDFIKEKTPWEMNNQEKIKAAERKKEEGNLLFKSGKYLRAGKKYDKAASYVGEEE  439

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
             F ++E+K   A++++C LN AAC LKL D++ A KLC+KVL++E  N+KALYRRAQA I
Sbjct  440  VFGDDEQKLVTAMRVTCWLNKAACSLKLNDFQGAIKLCSKVLDIEFYNIKALYRRAQALI  499

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSK  326
               D   A+ DIKKALE+DP NRE+KL  K LK+   E NK+DAK Y NMFA +++
Sbjct  500  QTTDLVSADMDIKKALEVDPQNREMKLIQKTLKQLQAESNKRDAKLYSNMFADMTR  555



>gb|KDO81465.1| hypothetical protein CISIN_1g0137551mg, partial [Citrus sinensis]
Length=221

 Score =   154 bits (390),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 111/143 (78%), Gaps = 0/143 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+E++ F+KE+  W+MN Q KIEAAG+KKEEGN+LFK GKY RA K+Y K A  +  D 
Sbjct  79   YEVEMMDFIKEKVPWEMNNQGKIEAAGRKKEEGNLLFKNGKYERAGKKYNKAADCVSEDG  138

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SF ++E+K  K+L++SC LN+AAC LKLKDY+ A +LC+KVL+ +  NVKALYRRAQAY+
Sbjct  139  SFVDDEQKLVKSLRVSCWLNSAACCLKLKDYQGAIELCSKVLDCDCHNVKALYRRAQAYM  198

Query  493  HFADFDLAEFDIKKALEIDPDNR  425
              AD  LAE DIKKA+E DP NR
Sbjct  199  EIADLILAELDIKKAIEADPQNR  221



>gb|KDO81464.1| hypothetical protein CISIN_1g0137551mg, partial [Citrus sinensis]
Length=223

 Score =   154 bits (390),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 111/143 (78%), Gaps = 0/143 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+E++ F+KE+  W+MN Q KIEAAG+KKEEGN+LFK GKY RA K+Y K A  +  D 
Sbjct  79   YEVEMMDFIKEKVPWEMNNQGKIEAAGRKKEEGNLLFKNGKYERAGKKYNKAADCVSEDG  138

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SF ++E+K  K+L++SC LN+AAC LKLKDY+ A +LC+KVL+ +  NVKALYRRAQAY+
Sbjct  139  SFVDDEQKLVKSLRVSCWLNSAACCLKLKDYQGAIELCSKVLDCDCHNVKALYRRAQAYM  198

Query  493  HFADFDLAEFDIKKALEIDPDNR  425
              AD  LAE DIKKA+E DP NR
Sbjct  199  EIADLILAELDIKKAIEADPQNR  221



>ref|XP_011013750.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X1 [Populus 
euphratica]
Length=608

 Score =   162 bits (409),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 132/176 (75%), Gaps = 0/176 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+E++ F+KE+  W+MN QEKI+AA +KKEEGN+LFK+GKY RA K+Y+K A ++  + 
Sbjct  380  YEVEMLDFIKEKTPWEMNNQEKIKAAERKKEEGNLLFKSGKYLRAGKKYDKAASYVGEEE  439

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
             F ++E+K   A++++C LN AAC LKL D++ A KLC+KVL++E  N+KALYRRAQA I
Sbjct  440  VFGDDEQKLVTAMRVTCWLNKAACSLKLNDFQGAIKLCSKVLDIEFYNIKALYRRAQALI  499

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSK  326
               D   A+ DIKKALE+DP NRE+KL  K LK+   E NK+DAK Y NMFA +++
Sbjct  500  QTTDLVSADMDIKKALEVDPQNREMKLIQKTLKQLQAESNKRDAKLYSNMFADMTR  555



>ref|XP_012068190.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X1 [Jatropha 
curcas]
 gb|KDP41599.1| hypothetical protein JCGZ_16006 [Jatropha curcas]
Length=601

 Score =   162 bits (409),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 101/176 (57%), Positives = 130/176 (74%), Gaps = 0/176 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+E++ F+KE+  W+MN QEKIEAA  KKEEGN+LFK+GKY +A K+Y+K   ++  + 
Sbjct  380  YEVEMLDFLKEKAPWEMNNQEKIEAACIKKEEGNLLFKSGKYQKAGKKYDKAVDYVVEEE  439

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SF + E+K  K+L +SC LN AAC LKL D + A KLC+KVL++E  NVKALYRRAQAYI
Sbjct  440  SFGDNEQKLVKSLIVSCWLNGAACSLKLDDLQGAIKLCSKVLDIEYNNVKALYRRAQAYI  499

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSK  326
               D   AE DIKKALE+DP +REVK   K+LK+   E NK+DAK Y NMFA ++K
Sbjct  500  RILDLFSAEVDIKKALEVDPQSREVKSLQKMLKQLQAESNKRDAKLYSNMFAHMTK  555



>ref|XP_011040722.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X2 [Populus 
euphratica]
Length=489

 Score =   160 bits (406),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 117/143 (82%), Gaps = 0/143 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+EL+ F+KE+  W M+T EK+EA+ +KK +GNVLFKAGK+ RASK+YEK AK+IE+D 
Sbjct  315  YEVELLDFIKEKPFWKMDTHEKLEASERKKLDGNVLFKAGKFWRASKKYEKAAKYIEFDH  374

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SF++EE   +K+L++SC LNN+ACKLK  ++ EA +LCTKVLEL+  NVKAL+RR+QA++
Sbjct  375  SFTDEEMCLAKSLRLSCYLNNSACKLKSGEFLEASRLCTKVLELDPLNVKALFRRSQAFL  434

Query  493  HFADFDLAEFDIKKALEIDPDNR  425
              ++ + AE DIKKAL IDP+NR
Sbjct  435  KTSELEKAEADIKKALAIDPNNR  457



>ref|XP_006576767.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP65-like isoform 
X2 [Glycine max]
Length=511

 Score =   160 bits (406),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 111/143 (78%), Gaps = 0/143 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELV FVKE+  W M+TQEKIEA  +KK +GN+LFK   +  ASK+YEK  K+IE+D 
Sbjct  337  YEVELVDFVKEKPFWKMDTQEKIEACERKKHDGNLLFKVENFRHASKKYEKAVKYIEFDH  396

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSE+EK ++  L +SCNLNNAACKLKL +Y EA +LCTKVLE +  N+KALYRR QAY+
Sbjct  397  SFSEDEKCRANTLHLSCNLNNAACKLKLGEYIEASRLCTKVLEQDPLNIKALYRRCQAYL  456

Query  493  HFADFDLAEFDIKKALEIDPDNR  425
              +D + AE DIK+AL IDP+NR
Sbjct  457  KTSDLEKAEADIKRALIIDPNNR  479



>ref|XP_004981889.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X1 [Setaria italica]
 ref|XP_004981890.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X2 [Setaria italica]
Length=368

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 126/176 (72%), Gaps = 0/176 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELV F KE+ESW+M+  EK+EAA K K   N LF  GK+ RA+K+Y KG  +I  D 
Sbjct  158  YEVELVDFTKEKESWEMSGHEKLEAAEKSKVANNDLFNIGKFQRAAKKYSKGLNYINEDG  217

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            +F +E +K  K L++SC LN+AAC LKLKD  +A  LC+KVLE+ES NVKALY+RAQAY+
Sbjct  218  NFEDEVEKLMKTLRVSCWLNHAACCLKLKDNAQAISLCSKVLEIESCNVKALYQRAQAYV  277

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSK  326
               D +LA+ D+ K LE+DPDN+EVKL    LK+   E NK+DAK Y NMF + +K
Sbjct  278  ESYDLELAKRDVLKVLELDPDNKEVKLLQAHLKKLQVESNKRDAKLYANMFDRTAK  333



>ref|XP_003520475.2| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP65-like isoform 
X1 [Glycine max]
 gb|KHN12184.1| Peptidyl-prolyl cis-trans isomerase FKBP65 [Glycine soja]
Length=540

 Score =   160 bits (406),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 111/143 (78%), Gaps = 0/143 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+ELV FVKE+  W M+TQEKIEA  +KK +GN+LFK   +  ASK+YEK  K+IE+D 
Sbjct  366  YEVELVDFVKEKPFWKMDTQEKIEACERKKHDGNLLFKVENFRHASKKYEKAVKYIEFDH  425

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
            SFSE+EK ++  L +SCNLNNAACKLKL +Y EA +LCTKVLE +  N+KALYRR QAY+
Sbjct  426  SFSEDEKCRANTLHLSCNLNNAACKLKLGEYIEASRLCTKVLEQDPLNIKALYRRCQAYL  485

Query  493  HFADFDLAEFDIKKALEIDPDNR  425
              +D + AE DIK+AL IDP+NR
Sbjct  486  KTSDLEKAEADIKRALIIDPNNR  508



>emb|CDP01264.1| unnamed protein product [Coffea canephora]
Length=604

 Score =   161 bits (407),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 130/176 (74%), Gaps = 0/176 (0%)
 Frame = -2

Query  853  YEIELVSFVKERESWDMNTQekieaagkkkeeGNVLFKAGKYARASKRYEKGAKFIEYDT  674
            YE+E++ F+KE+  W+MN QEKIEA  +KK+EGN+LFK GKY RA K+Y+K   F+  D 
Sbjct  381  YEVEILDFIKEKAPWEMNDQEKIEACKRKKDEGNLLFKNGKYRRAGKKYDKALDFVSGDI  440

Query  673  SFSEEEKKQSKALKISCNLNNAACKLKLKDYKEAEKLCTKVLELESTNVKALYRRAQAYI  494
             F +++ K  ++L++SC LN AAC LKL D+  A  LC+KVL++ES+NVKALYRRAQAY+
Sbjct  441  PFGDDDLKLVESLRVSCWLNTAACCLKLLDFHRAVNLCSKVLDVESSNVKALYRRAQAYM  500

Query  493  HFADFDLAEFDIKKALEIDPDNRevkleykvlkekvkeynkKDAKFYGNMFAKLSK  326
              AD  LAE DIKKALE +P NREVKL  K LK+   E NK DA+ Y  MF++++K
Sbjct  501  ETADLHLAELDIKKALETEPQNREVKLLQKSLKQLRAESNKSDAQIYTTMFSRMTK  556



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1881220847521