BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig2514

Length=899
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011070356.1|  PREDICTED: nephrocystin-3                          414   1e-137   Sesamum indicum [beniseed]
emb|CDP12192.1|  unnamed protein product                                406   2e-134   Coffea canephora [robusta coffee]
gb|EYU33495.1|  hypothetical protein MIMGU_mgv1a003155mg                405   3e-134   Erythranthe guttata [common monkey flower]
ref|XP_009802725.1|  PREDICTED: nephrocystin-3                          403   3e-133   Nicotiana sylvestris
ref|XP_009615358.1|  PREDICTED: nephrocystin-3                          403   4e-133   Nicotiana tomentosiformis
ref|XP_006343812.1|  PREDICTED: nephrocystin-3-like                     401   1e-132   Solanum tuberosum [potatoes]
emb|CBI34541.3|  unnamed protein product                                385   1e-128   Vitis vinifera
ref|XP_010324680.1|  PREDICTED: kinesin light chain 4-like              386   3e-128   
ref|XP_006352234.1|  PREDICTED: nephrocystin-3-like                     387   5e-127   Solanum tuberosum [potatoes]
ref|NP_001266207.1|  kinesin light chain I2I isoform                    386   1e-126   Solanum lycopersicum
ref|XP_010053096.1|  PREDICTED: kinesin light chain 4                   386   2e-126   Eucalyptus grandis [rose gum]
ref|XP_002263593.1|  PREDICTED: kinesin light chain 4                   385   3e-126   
ref|XP_006439287.1|  hypothetical protein CICLE_v10019420mg             384   8e-126   Citrus clementina [clementine]
ref|XP_006476340.1|  PREDICTED: nephrocystin-3-like                     384   9e-126   Citrus sinensis [apfelsine]
ref|XP_012086672.1|  PREDICTED: nephrocystin-3                          380   2e-124   Jatropha curcas
ref|XP_010107265.1|  hypothetical protein L484_007826                   380   2e-124   Morus notabilis
gb|KEH21270.1|  kinesin light chain                                     378   8e-124   Medicago truncatula
ref|XP_007040594.1|  Tetratricopeptide repeat (TPR)-like superfam...    377   2e-123   
gb|KHN16719.1|  Nephrocystin-3                                          375   2e-123   Glycine soja [wild soybean]
ref|XP_003525334.1|  PREDICTED: nephrocystin-3-like                     376   4e-123   Glycine max [soybeans]
ref|XP_003530449.1|  PREDICTED: nephrocystin-3-like                     376   5e-123   Glycine max [soybeans]
ref|XP_002518863.1|  kinesin light chain, putative                      376   7e-123   Ricinus communis
ref|XP_007160195.1|  hypothetical protein PHAVU_002G301000g             376   8e-123   Phaseolus vulgaris [French bean]
ref|XP_011026834.1|  PREDICTED: nephrocystin-3-like                     376   9e-123   Populus euphratica
gb|KHG14140.1|  Nephrocystin-3                                          375   1e-122   Gossypium arboreum [tree cotton]
ref|XP_008239183.1|  PREDICTED: nephrocystin-3                          374   1e-122   
ref|XP_004503588.1|  PREDICTED: nephrocystin-3-like                     375   2e-122   Cicer arietinum [garbanzo]
ref|XP_007210269.1|  hypothetical protein PRUPE_ppa003147mg             374   4e-122   Prunus persica
gb|KJB37463.1|  hypothetical protein B456_006G206300                    374   5e-122   Gossypium raimondii
ref|XP_011022457.1|  PREDICTED: uncharacterized protein LOC105124230    374   8e-122   Populus euphratica
ref|XP_004148984.1|  PREDICTED: kinesin light chain                     373   1e-121   Cucumis sativus [cucumbers]
ref|XP_002297964.2|  hypothetical protein POPTR_0001s10980g             373   1e-121   Populus trichocarpa [western balsam poplar]
ref|XP_010676242.1|  PREDICTED: kinesin light chain                     372   3e-121   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002304567.2|  hypothetical protein POPTR_0003s14320g             372   4e-121   Populus trichocarpa [western balsam poplar]
gb|EPS61693.1|  hypothetical protein M569_13098                         372   7e-121   Genlisea aurea
ref|XP_004300493.1|  PREDICTED: nephrocystin-3                          369   6e-120   Fragaria vesca subsp. vesca
ref|XP_008367901.1|  PREDICTED: nephrocystin-3-like                     365   2e-118   
ref|XP_010267540.1|  PREDICTED: uncharacterized protein LOC104604745    360   2e-116   Nelumbo nucifera [Indian lotus]
ref|XP_008451914.1|  PREDICTED: LOW QUALITY PROTEIN: nephrocystin...    358   9e-116   
ref|XP_010266592.1|  PREDICTED: uncharacterized protein LOC104604058    357   2e-115   Nelumbo nucifera [Indian lotus]
emb|CAN83879.1|  hypothetical protein VITISV_021292                     347   4e-115   Vitis vinifera
ref|XP_007051512.1|  Tetratricopeptide repeat (TPR)-like superfam...    352   1e-113   
ref|XP_009358645.1|  PREDICTED: uncharacterized protein LOC103949...    352   2e-113   Pyrus x bretschneideri [bai li]
ref|XP_009358646.1|  PREDICTED: uncharacterized protein LOC103949...    352   2e-113   
ref|XP_009344036.1|  PREDICTED: kinesin light chain-like                349   3e-112   Pyrus x bretschneideri [bai li]
ref|XP_006287252.1|  hypothetical protein CARUB_v10000441mg             350   4e-112   
gb|AAM63491.1|  putative kinesin light chain                            348   1e-111   Arabidopsis thaliana [mouse-ear cress]
ref|NP_192822.1|  protein KINESIN LIGHT CHAIN-RELATED 1                 348   1e-111   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002264247.1|  PREDICTED: uncharacterized protein LOC100267266    346   3e-111   Vitis vinifera
ref|XP_010422007.1|  PREDICTED: uncharacterized protein LOC104707372    347   3e-111   Camelina sativa [gold-of-pleasure]
ref|XP_010436694.1|  PREDICTED: uncharacterized protein LOC104720497    347   4e-111   Camelina sativa [gold-of-pleasure]
ref|XP_002872538.1|  hypothetical protein ARALYDRAFT_489926             346   5e-111   
gb|KFK31862.1|  hypothetical protein AALP_AA6G167900                    346   7e-111   Arabis alpina [alpine rockcress]
emb|CDX90788.1|  BnaA03g24680D                                          345   1e-110   
ref|XP_010915164.1|  PREDICTED: kinesin light chain-like                345   1e-110   Elaeis guineensis
ref|XP_009421472.1|  PREDICTED: uncharacterized protein LOC104001021    345   1e-110   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009134209.1|  PREDICTED: nephrocystin-3                          345   2e-110   Brassica rapa
emb|CDY05122.1|  BnaC03g29200D                                          345   2e-110   
ref|XP_006396997.1|  hypothetical protein EUTSA_v10028519mg             345   2e-110   Eutrema salsugineum [saltwater cress]
ref|XP_008337561.1|  PREDICTED: nephrocystin-3-like                     344   3e-110   
gb|KJB09631.1|  hypothetical protein B456_001G153600                    343   3e-110   Gossypium raimondii
ref|XP_010455474.1|  PREDICTED: kinesin light chain-like isoform X1     344   3e-110   Camelina sativa [gold-of-pleasure]
gb|KHG17048.1|  Nephrocystin-3                                          341   1e-109   Gossypium arboreum [tree cotton]
ref|XP_008795620.1|  PREDICTED: kinesin light chain 4-like isofor...    339   2e-108   Phoenix dactylifera
ref|XP_009375418.1|  PREDICTED: nephrocystin-3-like                     337   6e-108   Pyrus x bretschneideri [bai li]
ref|XP_010100714.1|  hypothetical protein L484_023483                   336   9e-108   Morus notabilis
dbj|BAC78579.1|  hypothetical protein                                   327   1e-107   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001147109.1|  LOC100280717                                       336   3e-107   
ref|XP_012083175.1|  PREDICTED: nephrocystin-3-like isoform X2          334   8e-107   Jatropha curcas
ref|XP_006444813.1|  hypothetical protein CICLE_v10019438mg             334   1e-106   Citrus clementina [clementine]
gb|KDO86517.1|  hypothetical protein CISIN_1g007930mg                   334   1e-106   Citrus sinensis [apfelsine]
ref|XP_008376154.1|  PREDICTED: nephrocystin-3-like                     333   1e-106   Malus domestica [apple tree]
ref|XP_006491305.1|  PREDICTED: nephrocystin-3-like                     334   1e-106   Citrus sinensis [apfelsine]
ref|XP_007220647.1|  hypothetical protein PRUPE_ppa003486mg             333   3e-106   
ref|XP_012083173.1|  PREDICTED: nephrocystin-3-like isoform X1          333   3e-106   
ref|XP_010541795.1|  PREDICTED: kinesin light chain-like                334   3e-106   Tarenaya hassleriana [spider flower]
ref|XP_002453144.1|  hypothetical protein SORBIDRAFT_04g000780          333   5e-106   Sorghum bicolor [broomcorn]
gb|ACN35027.1|  unknown                                                 329   3e-105   Zea mays [maize]
ref|XP_004951217.1|  PREDICTED: nephrocystin-3-like                     330   4e-105   Setaria italica
ref|XP_006648216.1|  PREDICTED: nephrocystin-3-like                     328   9e-105   Oryza brachyantha
ref|XP_003548412.1|  PREDICTED: nephrocystin-3-like                     328   1e-104   Glycine max [soybeans]
ref|XP_010529655.1|  PREDICTED: kinesin light chain-like                329   1e-104   Tarenaya hassleriana [spider flower]
ref|XP_004510654.1|  PREDICTED: nephrocystin-3-like                     328   2e-104   Cicer arietinum [garbanzo]
ref|NP_001130723.1|  uncharacterized protein LOC100191827               329   2e-104   Zea mays [maize]
ref|XP_009334358.1|  PREDICTED: nephrocystin-3-like isoform X1          327   4e-104   Pyrus x bretschneideri [bai li]
ref|NP_001045645.1|  Os02g0109800                                       328   5e-104   
ref|XP_008795853.1|  PREDICTED: kinesin light chain 4-like              326   2e-103   Phoenix dactylifera
ref|XP_007135270.1|  hypothetical protein PHAVU_010G115100g             324   4e-103   Phaseolus vulgaris [French bean]
ref|XP_003571751.1|  PREDICTED: nephrocystin-3                          324   2e-102   Brachypodium distachyon [annual false brome]
gb|EAZ21454.1|  hypothetical protein OsJ_05056                          323   4e-102   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004308296.1|  PREDICTED: nephrocystin-3-like                     321   8e-102   Fragaria vesca subsp. vesca
ref|XP_010924445.1|  PREDICTED: LOW QUALITY PROTEIN: kinesin ligh...    320   4e-101   Elaeis guineensis
dbj|BAK04667.1|  predicted protein                                      313   2e-98    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KEH18621.1|  kinesin light chain                                     311   6e-98    Medicago truncatula
ref|XP_008233119.1|  PREDICTED: nephrocystin-3-like                     309   5e-97    Prunus mume [ume]
ref|XP_002302641.1|  hypothetical protein POPTR_0002s17410g             288   7e-92    
ref|XP_002321593.2|  hypothetical protein POPTR_0015s08660g             298   2e-91    
ref|XP_011028570.1|  PREDICTED: nephrocystin-3-like                     299   2e-91    Populus euphratica
ref|XP_011623614.1|  PREDICTED: nephrocystin-3                          295   2e-91    Amborella trichopoda
ref|XP_002511407.1|  kinesin light chain, putative                      298   5e-91    Ricinus communis
ref|XP_002320874.1|  hypothetical protein POPTR_0014s09590g             293   5e-91    Populus trichocarpa [western balsam poplar]
ref|XP_008360812.1|  PREDICTED: uncharacterized protein LOC103424510    296   1e-90    
ref|XP_011038446.1|  PREDICTED: kinesin light chain 4-like isofor...    291   2e-90    Populus euphratica
ref|XP_008239759.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    295   2e-90    
ref|XP_007211296.1|  hypothetical protein PRUPE_ppa001986mg             295   3e-90    Prunus persica
ref|XP_010251264.1|  PREDICTED: uncharacterized protein LOC104593203    294   9e-90    Nelumbo nucifera [Indian lotus]
ref|XP_010101208.1|  hypothetical protein L484_015012                   294   9e-90    Morus notabilis
ref|XP_004298939.1|  PREDICTED: kinesin light chain 1                   294   1e-89    Fragaria vesca subsp. vesca
emb|CBI15036.3|  unnamed protein product                                291   2e-89    Vitis vinifera
gb|KDO69678.1|  hypothetical protein CISIN_1g004812mg                   292   4e-89    Citrus sinensis [apfelsine]
ref|XP_009363029.1|  PREDICTED: uncharacterized protein LOC103953033    292   4e-89    Pyrus x bretschneideri [bai li]
ref|XP_006476770.1|  PREDICTED: uncharacterized protein LOC102617...    292   5e-89    
gb|KDO69674.1|  hypothetical protein CISIN_1g004812mg                   292   6e-89    Citrus sinensis [apfelsine]
ref|XP_010663184.1|  PREDICTED: uncharacterized protein LOC100255253    292   7e-89    Vitis vinifera
ref|XP_012080075.1|  PREDICTED: kinesin light chain                     291   1e-88    Jatropha curcas
ref|XP_006439809.1|  hypothetical protein CICLE_v10019037mg             290   4e-88    
ref|XP_008374441.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    290   4e-88    
gb|EYU17664.1|  hypothetical protein MIMGU_mgv1a002285mg                288   5e-88    Erythranthe guttata [common monkey flower]
ref|XP_010243016.1|  PREDICTED: uncharacterized protein LOC104587203    290   5e-88    Nelumbo nucifera [Indian lotus]
ref|XP_010678757.1|  PREDICTED: uncharacterized protein LOC104894269    288   9e-88    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011101333.1|  PREDICTED: uncharacterized protein LOC105179...    288   1e-87    Sesamum indicum [beniseed]
ref|XP_009380347.1|  PREDICTED: uncharacterized protein LOC103968764    286   6e-87    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009795408.1|  PREDICTED: uncharacterized protein LOC104242106    286   7e-87    Nicotiana sylvestris
ref|XP_006647776.1|  PREDICTED: uncharacterized protein LOC102714889    286   7e-87    Oryza brachyantha
ref|XP_010936735.1|  PREDICTED: uncharacterized protein LOC105056290    286   7e-87    Elaeis guineensis
ref|XP_004953633.1|  PREDICTED: uncharacterized protein LOC101762...    285   2e-86    Setaria italica
ref|XP_009627990.1|  PREDICTED: uncharacterized protein LOC104118460    285   3e-86    Nicotiana tomentosiformis
ref|NP_001047883.1|  Os02g0708400                                       284   4e-86    
ref|XP_008782452.1|  PREDICTED: uncharacterized protein LOC103701984    283   9e-86    Phoenix dactylifera
gb|ABR16125.1|  unknown                                                 285   1e-85    Picea sitchensis
ref|XP_003570205.1|  PREDICTED: uncharacterized protein LOC100826447    283   1e-85    Brachypodium distachyon [annual false brome]
ref|XP_002452671.1|  hypothetical protein SORBIDRAFT_04g030360          283   1e-85    Sorghum bicolor [broomcorn]
ref|XP_006345055.1|  PREDICTED: kinesin light chain-like                283   2e-85    Solanum tuberosum [potatoes]
ref|XP_010028340.1|  PREDICTED: tetratricopeptide repeat protein 28     283   3e-85    Eucalyptus grandis [rose gum]
gb|AFW73049.1|  kinesin light chain                                     282   3e-85    
ref|NP_001130826.1|  hypothetical protein                               282   3e-85    Zea mays [maize]
ref|NP_001147329.1|  kinesin light chain                                281   3e-85    
ref|XP_010108770.1|  hypothetical protein L484_020503                   282   4e-85    Morus notabilis
emb|CBI34925.3|  unnamed protein product                                280   4e-85    Vitis vinifera
gb|EMT08479.1|  Nephrocystin-3                                          280   5e-85    
gb|EMS45896.1|  Nephrocystin-3                                          280   5e-85    Triticum urartu
gb|AAM13438.1|AF474071_1  similar to A. thaliana protein BAB01483...    281   5e-85    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ98431.1|  predicted protein                                      281   6e-85    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008453093.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    281   1e-84    
ref|XP_010318909.1|  PREDICTED: uncharacterized protein LOC104646605    281   1e-84    Solanum lycopersicum
ref|XP_007036200.1|  Tetratricopeptide repeat-like superfamily pr...    281   1e-84    
ref|XP_004138111.1|  PREDICTED: uncharacterized protein LOC101208453    280   1e-84    Cucumis sativus [cucumbers]
ref|XP_006844980.1|  PREDICTED: uncharacterized protein LOC184348...    281   1e-84    Amborella trichopoda
ref|XP_011623634.1|  PREDICTED: uncharacterized protein LOC184348...    281   2e-84    Amborella trichopoda
ref|XP_011623635.1|  PREDICTED: uncharacterized protein LOC184348...    281   2e-84    Amborella trichopoda
ref|XP_011044307.1|  PREDICTED: tetratricopeptide repeat protein ...    280   2e-84    Populus euphratica
ref|XP_010660916.1|  PREDICTED: uncharacterized protein LOC100254332    280   2e-84    Vitis vinifera
ref|XP_002517328.1|  kinesin light chain, putative                      277   3e-84    
emb|CDP12398.1|  unnamed protein product                                279   3e-84    Coffea canephora [robusta coffee]
gb|EYU44745.1|  hypothetical protein MIMGU_mgv1a002492mg                277   6e-84    Erythranthe guttata [common monkey flower]
ref|XP_002318043.2|  hypothetical protein POPTR_0012s08160g             276   3e-83    
gb|KEH24836.1|  kinesin light chain                                     275   7e-83    Medicago truncatula
gb|KJB07849.1|  hypothetical protein B456_001G047800                    275   1e-82    Gossypium raimondii
gb|ABF70051.1|  kinesin light chain-related                             275   1e-82    Musa acuminata [banana]
ref|XP_009389350.1|  PREDICTED: kinesin light chain 3-like              275   2e-82    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006446488.1|  hypothetical protein CICLE_v10014403mg             274   3e-82    Citrus clementina [clementine]
gb|KDO66204.1|  hypothetical protein CISIN_1g004829mg                   274   3e-82    Citrus sinensis [apfelsine]
ref|XP_006470340.1|  PREDICTED: uncharacterized protein LOC102619851    274   3e-82    Citrus sinensis [apfelsine]
gb|ABF70142.1|  glycoside hydrolase family 17 protein                   274   3e-82    Musa balbisiana [starchy banana]
ref|XP_012081574.1|  PREDICTED: kinesin light chain                     273   6e-82    Jatropha curcas
gb|KDP45346.1|  hypothetical protein JCGZ_09595                         273   6e-82    Jatropha curcas
gb|KJB30306.1|  hypothetical protein B456_005G136800                    273   8e-82    Gossypium raimondii
ref|XP_010555492.1|  PREDICTED: kinesin light chain 1 isoform X4        271   9e-82    Tarenaya hassleriana [spider flower]
ref|XP_010555491.1|  PREDICTED: kinesin light chain 1 isoform X3        271   1e-81    Tarenaya hassleriana [spider flower]
ref|XP_010555490.1|  PREDICTED: kinesin light chain 1 isoform X2        271   1e-81    Tarenaya hassleriana [spider flower]
ref|XP_010555489.1|  PREDICTED: kinesin light chain 1 isoform X1        271   1e-81    Tarenaya hassleriana [spider flower]
ref|XP_004489282.1|  PREDICTED: uncharacterized protein LOC101501435    271   3e-81    Cicer arietinum [garbanzo]
ref|XP_007031462.1|  Tetratricopeptide repeat-like superfamily pr...    271   4e-81    
emb|CDP02116.1|  unnamed protein product                                272   4e-81    Coffea canephora [robusta coffee]
ref|XP_006578627.1|  PREDICTED: nephrocystin-3-like                     271   6e-81    
ref|XP_007217015.1|  hypothetical protein PRUPE_ppa002085mg             270   7e-81    Prunus persica
ref|XP_004304619.1|  PREDICTED: uncharacterized protein LOC101294682    270   8e-81    Fragaria vesca subsp. vesca
ref|XP_008230606.1|  PREDICTED: nephrocystin-3                          270   2e-80    Prunus mume [ume]
gb|KHG27307.1|  Nephrocystin-3                                          269   3e-80    Gossypium arboreum [tree cotton]
ref|XP_010940045.1|  PREDICTED: tetratricopeptide repeat protein ...    269   3e-80    Elaeis guineensis
gb|KHG03919.1|  Kinesin light chain                                     266   6e-80    Gossypium arboreum [tree cotton]
ref|XP_003528151.1|  PREDICTED: nephrocystin-3-like                     268   1e-79    Glycine max [soybeans]
ref|XP_006338558.1|  PREDICTED: uncharacterized protein LOC102590808    267   1e-79    Solanum tuberosum [potatoes]
gb|KHN19310.1|  Nephrocystin-3                                          268   1e-79    Glycine soja [wild soybean]
ref|XP_007138082.1|  hypothetical protein PHAVU_009G179000g             268   1e-79    Phaseolus vulgaris [French bean]
ref|XP_009614635.1|  PREDICTED: tetratricopeptide repeat protein ...    266   2e-79    Nicotiana tomentosiformis
ref|XP_009375110.1|  PREDICTED: uncharacterized protein LOC103963955    266   4e-79    Pyrus x bretschneideri [bai li]
ref|XP_009769549.1|  PREDICTED: tetratricopeptide repeat protein 28     265   4e-79    Nicotiana sylvestris
ref|XP_003601278.1|  Kinesin light chain                                266   5e-79    Medicago truncatula
ref|XP_004501933.1|  PREDICTED: uncharacterized protein LOC101499391    266   5e-79    Cicer arietinum [garbanzo]
gb|KHG25182.1|  Nephrocystin-3                                          265   6e-79    Gossypium arboreum [tree cotton]
ref|XP_004232294.1|  PREDICTED: tetratricopeptide repeat protein ...    265   6e-79    Solanum lycopersicum
ref|XP_003601279.1|  Kinesin light chain                                266   9e-79    Medicago truncatula
gb|ACU23562.1|  unknown                                                 249   1e-78    Glycine max [soybeans]
ref|XP_008379249.1|  PREDICTED: tetratricopeptide repeat protein ...    264   1e-78    
gb|KJB75858.1|  hypothetical protein B456_012G061500                    264   2e-78    Gossypium raimondii
gb|KJB33765.1|  hypothetical protein B456_006G030200                    263   3e-78    Gossypium raimondii
ref|XP_010522908.1|  PREDICTED: nephrocystin-3-like                     259   3e-78    Tarenaya hassleriana [spider flower]
gb|KDO69676.1|  hypothetical protein CISIN_1g004812mg                   263   5e-78    Citrus sinensis [apfelsine]
ref|XP_009334071.1|  PREDICTED: uncharacterized protein LOC103926921    262   1e-77    Pyrus x bretschneideri [bai li]
ref|XP_008341468.1|  PREDICTED: tetratricopeptide repeat protein 28     261   1e-77    
gb|KHG13835.1|  Nephrocystin-3                                          261   3e-77    Gossypium arboreum [tree cotton]
ref|XP_002312280.2|  kinesin light chain-related family protein         259   4e-77    
ref|NP_189435.1|  tetratricopeptide repeat domain-containing protein    259   5e-77    Arabidopsis thaliana [mouse-ear cress]
gb|AAQ22597.1|  At3g27960                                               259   6e-77    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003553842.1|  PREDICTED: uncharacterized protein LOC100786...    259   7e-77    Glycine max [soybeans]
ref|XP_006395386.1|  hypothetical protein EUTSA_v10003775mg             258   9e-77    Eutrema salsugineum [saltwater cress]
ref|XP_006290699.1|  hypothetical protein CARUB_v10016794mg             258   9e-77    Capsella rubella
gb|KHN27426.1|  Nephrocystin-3                                          258   2e-76    Glycine soja [wild soybean]
ref|XP_003524541.1|  PREDICTED: kinesin light chain-like isoform X1     258   2e-76    Glycine max [soybeans]
ref|XP_006579755.1|  PREDICTED: kinesin light chain-like isoform X2     258   2e-76    Glycine max [soybeans]
ref|XP_011018373.1|  PREDICTED: uncharacterized protein LOC105121433    259   3e-76    Populus euphratica
ref|XP_003525501.1|  PREDICTED: tetratricopeptide repeat protein ...    257   9e-76    Glycine max [soybeans]
ref|XP_002877085.1|  hypothetical protein ARALYDRAFT_484584             255   2e-75    
ref|XP_010502803.1|  PREDICTED: nephrocystin-3-like                     255   2e-75    Camelina sativa [gold-of-pleasure]
ref|XP_010925525.1|  PREDICTED: kinesin light chain-like                256   2e-75    Elaeis guineensis
ref|XP_009151903.1|  PREDICTED: nephrocystin-3                          254   4e-75    Brassica rapa
ref|XP_007155421.1|  hypothetical protein PHAVU_003G200000g             255   4e-75    Phaseolus vulgaris [French bean]
ref|XP_008801827.1|  PREDICTED: uncharacterized protein LOC103715840    254   5e-75    Phoenix dactylifera
emb|CDY58518.1|  BnaCnng33310D                                          253   5e-75    Brassica napus [oilseed rape]
gb|KJB37462.1|  hypothetical protein B456_006G206300                    250   5e-75    Gossypium raimondii
ref|XP_007151047.1|  hypothetical protein PHAVU_004G014000g             254   6e-75    Phaseolus vulgaris [French bean]
ref|XP_010528254.1|  PREDICTED: nephrocystin-3                          254   7e-75    Tarenaya hassleriana [spider flower]
ref|XP_010029186.1|  PREDICTED: kinesin light chain                     254   8e-75    Eucalyptus grandis [rose gum]
gb|KCW77343.1|  hypothetical protein EUGRSUZ_D01704                     251   9e-75    Eucalyptus grandis [rose gum]
ref|XP_003608965.1|  Kinesin light chain                                253   1e-74    Medicago truncatula
ref|XP_010514504.1|  PREDICTED: nephrocystin-3-like                     253   1e-74    Camelina sativa [gold-of-pleasure]
ref|XP_010425576.1|  PREDICTED: nephrocystin-3-like                     253   2e-74    Camelina sativa [gold-of-pleasure]
ref|XP_004508864.1|  PREDICTED: uncharacterized protein LOC101493...    249   2e-73    Cicer arietinum [garbanzo]
ref|XP_011098764.1|  PREDICTED: tetratricopeptide repeat protein ...    248   1e-72    
dbj|BAC42575.1|  unknown protein                                        243   5e-71    Arabidopsis thaliana [mouse-ear cress]
ref|NP_174070.1|  tetratricopeptide repeat domain-containing protein    243   5e-71    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006303924.1|  hypothetical protein CARUB_v10008543mg             243   6e-71    Capsella rubella
gb|AAF99740.1|AC004557_19  F17L21.29                                    243   9e-71    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010460507.1|  PREDICTED: uncharacterized protein LOC104741359    241   2e-70    Camelina sativa [gold-of-pleasure]
ref|XP_010499231.1|  PREDICTED: uncharacterized protein LOC104776...    241   2e-70    Camelina sativa [gold-of-pleasure]
ref|XP_010499233.1|  PREDICTED: uncharacterized protein LOC104776...    241   2e-70    
ref|XP_010499229.1|  PREDICTED: uncharacterized protein LOC104776...    241   2e-70    
ref|XP_002893471.1|  hypothetical protein ARALYDRAFT_472955             241   2e-70    
ref|XP_010478089.1|  PREDICTED: uncharacterized protein LOC104757077    241   3e-70    Camelina sativa [gold-of-pleasure]
emb|CDY56191.1|  BnaC05g51100D                                          241   5e-70    Brassica napus [oilseed rape]
ref|XP_010033277.1|  PREDICTED: uncharacterized protein LOC104422608    240   2e-69    Eucalyptus grandis [rose gum]
gb|KGN46524.1|  hypothetical protein Csa_6G106760                       233   9e-69    
gb|EMT27718.1|  Nephrocystin-3                                          231   2e-68    
ref|XP_009113759.1|  PREDICTED: uncharacterized protein LOC103839034    235   4e-68    Brassica rapa
ref|XP_004140507.2|  PREDICTED: kinesin light chain 1-like              232   8e-68    Cucumis sativus [cucumbers]
ref|NP_974530.1|  protein KINESIN LIGHT CHAIN-RELATED 1                 224   6e-65    Arabidopsis thaliana [mouse-ear cress]
ref|XP_012083176.1|  PREDICTED: nephrocystin-3-like isoform X3          223   2e-64    Jatropha curcas
ref|XP_008795621.1|  PREDICTED: kinesin light chain 1-like isofor...    223   3e-64    
gb|EPS70530.1|  hypothetical protein M569_04228                         224   5e-64    Genlisea aurea
ref|XP_006415753.1|  hypothetical protein EUTSA_v10007008mg             222   3e-63    Eutrema salsugineum [saltwater cress]
emb|CDX94243.1|  BnaC02g29030D                                          211   1e-62    
ref|XP_009334359.1|  PREDICTED: nephrocystin-3-like isoform X2          216   4e-62    Pyrus x bretschneideri [bai li]
ref|XP_008459760.1|  PREDICTED: nephrocystin-3-like                     211   4e-60    Cucumis melo [Oriental melon]
ref|XP_011038461.1|  PREDICTED: nephrocystin-3-like isoform X3          210   1e-59    Populus euphratica
ref|XP_011038453.1|  PREDICTED: nephrocystin-3-like isoform X2          210   2e-59    Populus euphratica
ref|XP_010694920.1|  PREDICTED: nephrocystin-3                          207   5e-58    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011101334.1|  PREDICTED: nephrocystin-3 isoform X2               198   2e-54    
gb|AFW73048.1|  hypothetical protein ZEAMMB73_781821                    196   1e-53    
gb|KJB07850.1|  hypothetical protein B456_001G047800                    196   2e-53    Gossypium raimondii
ref|XP_001753175.1|  predicted protein                                  189   3e-52    
ref|XP_002991772.1|  hypothetical protein SELMODRAFT_161893             189   5e-52    
ref|XP_002989709.1|  hypothetical protein SELMODRAFT_42020              187   1e-51    
gb|KJB41577.1|  hypothetical protein B456_007G110100                    186   3e-51    Gossypium raimondii
ref|XP_010555485.1|  PREDICTED: kinesin light chain 1-like isofor...    189   5e-51    Tarenaya hassleriana [spider flower]
ref|XP_010555483.1|  PREDICTED: kinesin light chain 1-like isofor...    189   5e-51    Tarenaya hassleriana [spider flower]
ref|XP_010555482.1|  PREDICTED: kinesin light chain 1-like isofor...    189   5e-51    Tarenaya hassleriana [spider flower]
ref|XP_010555484.1|  PREDICTED: kinesin light chain 1-like isofor...    188   6e-51    Tarenaya hassleriana [spider flower]
ref|XP_001774076.1|  predicted protein                                  184   4e-50    
gb|KEH24837.1|  kinesin light chain                                     185   1e-49    Medicago truncatula
ref|XP_002978558.1|  hypothetical protein SELMODRAFT_31231              178   4e-48    
ref|XP_002970481.1|  hypothetical protein SELMODRAFT_31230              178   4e-48    
ref|XP_002987234.1|  hypothetical protein SELMODRAFT_158571             172   6e-46    
gb|ERN06591.1|  hypothetical protein AMTR_s00058p00150340               173   9e-46    Amborella trichopoda
ref|XP_002976401.1|  hypothetical protein SELMODRAFT_151163             171   2e-45    
gb|AAN64318.1|  kinesin light chain I2I isoform                         154   3e-43    Solanum lycopersicum
ref|XP_001773877.1|  predicted protein                                  153   1e-38    
gb|AFG71077.1|  hypothetical protein UMN_893_01                         142   3e-38    Pinus taeda
ref|XP_001780041.1|  predicted protein                                  148   4e-37    
gb|KEH36846.1|  kinesin light chain, putative                           137   4e-36    
gb|EMS49141.1|  Nephrocystin-3                                          139   2e-34    
gb|KDO76619.1|  hypothetical protein CISIN_1g011858mg                   138   1e-33    
emb|CDX90092.1|  BnaA08g18920D                                          119   4e-29    
ref|XP_002523319.1|  kinesin light chain, putative                      112   8e-25    
gb|KGN46523.1|  hypothetical protein Csa_6G106750                       106   7e-23    
ref|XP_001774134.1|  predicted protein                                92.0    4e-17    
ref|XP_001755747.1|  predicted protein                                89.4    2e-16    
ref|XP_010523391.1|  PREDICTED: uncharacterized protein LOC104801748  87.4    5e-16    
gb|AFR45292.1|  glycoside hydrolase family 17 protein                 81.6    5e-16    
ref|XP_003536936.1|  PREDICTED: nephrocystin-3-like                   83.2    2e-14    
gb|KHN03871.1|  Nephrocystin-3                                        83.2    2e-14    
ref|XP_011025999.1|  PREDICTED: uncharacterized protein LOC105126739  82.0    6e-14    
ref|XP_002306840.2|  hypothetical protein POPTR_0005s24430g           82.0    6e-14    
ref|XP_004148956.2|  PREDICTED: nephrocystin-3                        81.3    1e-13    
ref|XP_003542417.1|  PREDICTED: nephrocystin-3-like                   80.9    1e-13    
gb|KEH42558.1|  kinesin light chain, putative                         80.5    1e-13    
ref|XP_008451256.1|  PREDICTED: nephrocystin-3                        78.6    7e-13    
tpg|DAA48350.1|  TPA: putative protein kinase superfamily protein     78.6    8e-13    
ref|XP_007144915.1|  hypothetical protein PHAVU_007G194200g           78.6    8e-13    
ref|XP_004289925.1|  PREDICTED: uncharacterized protein LOC101306096  78.2    9e-13    
tpg|DAA48349.1|  TPA: putative protein kinase superfamily protein     78.2    1e-12    
ref|XP_007050323.1|  Tetratricopeptide repeat-like superfamily pr...  77.8    1e-12    
ref|XP_010111904.1|  hypothetical protein L484_009788                 77.8    1e-12    
ref|XP_004954416.1|  PREDICTED: nephrocystin-3-like                   77.8    1e-12    
ref|XP_006827498.1|  PREDICTED: nephrocystin-3                        77.8    1e-12    
emb|CDY15411.1|  BnaC04g42120D                                        77.4    2e-12    
emb|CBI37096.3|  unnamed protein product                              77.0    2e-12    
ref|XP_002454793.1|  hypothetical protein SORBIDRAFT_04g037530        77.4    2e-12    
ref|XP_002263867.1|  PREDICTED: uncharacterized protein LOC100247992  77.4    2e-12    
ref|XP_010037985.1|  PREDICTED: nephrocystin-3                        77.0    2e-12    
ref|XP_006443855.1|  hypothetical protein CICLE_v10019294mg           77.0    3e-12    
gb|KJB25994.1|  hypothetical protein B456_004G220300                  76.6    3e-12    
ref|XP_012085333.1|  PREDICTED: uncharacterized protein LOC105644554  77.0    3e-12    
gb|KDO68460.1|  hypothetical protein CISIN_1g006812mg                 77.0    3e-12    
ref|XP_007201731.1|  hypothetical protein PRUPE_ppa002883mg           76.6    3e-12    
emb|CDY19069.1|  BnaA04g18090D                                        76.3    4e-12    
ref|XP_009141143.1|  PREDICTED: uncharacterized protein LOC103865116  76.3    4e-12    
ref|XP_008787385.1|  PREDICTED: nephrocystin-3-like                   76.3    4e-12    
ref|XP_002532368.1|  kinesin light chain, putative                    75.9    6e-12    
ref|XP_011080033.1|  PREDICTED: nephrocystin-3                        75.9    6e-12    
emb|CDP03732.1|  unnamed protein product                              75.9    6e-12    
ref|XP_002881166.1|  tetratricopeptide repeat-containing protein      75.9    6e-12    
gb|AAD20669.1|  putative kinesin light chain                          75.5    8e-12    
ref|XP_009418627.1|  PREDICTED: uncharacterized protein LOC103998773  75.5    8e-12    
ref|NP_850163.1|  tetratricopeptide repeat-containing protein         75.5    8e-12    
ref|XP_004495108.1|  PREDICTED: nephrocystin-3-like                   75.1    1e-11    
ref|XP_006293850.1|  hypothetical protein CARUB_v10022834mg           75.1    1e-11    
ref|XP_006351646.1|  PREDICTED: kinesin light chain 1-like isofor...  74.7    1e-11    
ref|XP_008235697.1|  PREDICTED: nephrocystin-3                        74.7    1e-11    
ref|XP_010274793.1|  PREDICTED: uncharacterized protein LOC104610037  74.7    2e-11    
ref|XP_006410256.1|  hypothetical protein EUTSA_v10016393mg           74.3    2e-11    
gb|KIM31005.1|  hypothetical protein M408DRAFT_327911                 74.3    2e-11    
ref|NP_001048541.1|  Os02g0820300                                     73.9    3e-11    
gb|KJB42256.1|  hypothetical protein B456_007G145300                  73.6    3e-11    
ref|XP_004247232.1|  PREDICTED: uncharacterized protein LOC101250730  73.6    3e-11    
ref|NP_001170071.1|  uncharacterized protein LOC100383987             73.2    3e-11    
gb|EAY88050.1|  hypothetical protein OsI_09478                        73.6    3e-11    
gb|KHG23531.1|  atg9                                                  73.6    4e-11    
gb|AFW63969.1|  hypothetical protein ZEAMMB73_334217                  73.2    5e-11    
ref|XP_010414161.1|  PREDICTED: uncharacterized protein LOC104700347  73.2    5e-11    
ref|XP_010469743.1|  PREDICTED: uncharacterized protein LOC104749751  72.8    6e-11    
gb|EYU46468.1|  hypothetical protein MIMGU_mgv1a018369mg              72.8    7e-11    
ref|XP_003570415.1|  PREDICTED: uncharacterized protein LOC100838393  71.6    1e-10    
ref|XP_010935749.1|  PREDICTED: nephrocystin-3-like                   71.2    2e-10    
gb|EMT07867.1|  Nephrocystin-3                                        71.2    2e-10    
ref|XP_009354932.1|  PREDICTED: uncharacterized protein LOC103946038  71.2    2e-10    
ref|WP_008180050.1|  hypothetical protein                             71.2    2e-10    
ref|XP_010679234.1|  PREDICTED: tetratricopeptide repeat protein ...  70.9    3e-10    
ref|XP_009790958.1|  PREDICTED: uncharacterized protein LOC104238333  70.9    3e-10    
dbj|BAK07885.1|  predicted protein                                    70.5    3e-10    
ref|XP_009621139.1|  PREDICTED: kinesin light chain 4                 70.5    3e-10    
gb|KFK31233.1|  hypothetical protein AALP_AA6G085800                  70.5    3e-10    
gb|EPS61982.1|  hypothetical protein M569_12810                       69.7    5e-10    
gb|EMS49013.1|  Nephrocystin-3                                        69.3    6e-10    
gb|EDY48748.1|  conserved hypothetical protein                        69.7    7e-10    
ref|XP_010522158.1|  PREDICTED: uncharacterized protein LOC104800874  69.3    8e-10    
ref|WP_009998324.1|  hypothetical protein                             69.3    1e-09    
gb|KIM20565.1|  hypothetical protein M408DRAFT_333927                 68.9    1e-09    
gb|KIJ45324.1|  hypothetical protein M422DRAFT_166759                 67.4    2e-09    
dbj|BAK01954.1|  predicted protein                                    68.2    2e-09    
gb|AAQ93540.1|  putative ATP/GTP binding protein                      67.0    3e-09    
ref|WP_045582570.1|  hypothetical protein                             67.4    3e-09    
ref|XP_008382911.1|  PREDICTED: LOW QUALITY PROTEIN: nephrocystin-3   67.0    5e-09    
gb|KIM24466.1|  hypothetical protein M408DRAFT_39596                  63.9    6e-09    
ref|WP_043996167.1|  hypothetical protein                             65.5    7e-09    
ref|WP_017714464.1|  hypothetical protein                             63.5    8e-09    
ref|XP_002118426.1|  hypothetical protein TRIADDRAFT_34167            65.1    8e-09    
gb|AKB25293.1|  hypothetical protein MSMTP_1824                       66.6    9e-09    
ref|XP_002118615.1|  hypothetical protein TRIADDRAFT_34474            63.5    9e-09    
ref|XP_003558803.1|  PREDICTED: nephrocystin-3-like                   66.2    1e-08    
gb|ERH15115.1|  tetratricopeptide repeat protein                      63.5    1e-08    
gb|KIM23936.1|  hypothetical protein M408DRAFT_46291                  61.6    1e-08    
ref|XP_002112980.1|  hypothetical protein TRIADDRAFT_56656            66.2    1e-08    
ref|WP_017714122.1|  hypothetical protein                             65.5    1e-08    
ref|WP_034478142.1|  hypothetical protein                             62.8    1e-08    
ref|WP_043399094.1|  hypothetical protein                             65.5    2e-08    
ref|WP_044076509.1|  hypothetical protein                             65.5    2e-08    
gb|KIM23361.1|  hypothetical protein M408DRAFT_263716                 64.7    2e-08    
ref|XP_002118739.1|  hypothetical protein TRIADDRAFT_62755            65.1    2e-08    
ref|XP_001746345.1|  hypothetical protein                             64.7    3e-08    
ref|WP_041134067.1|  hypothetical protein                             64.7    3e-08    
gb|KIJ39619.1|  hypothetical protein M422DRAFT_174874                 61.6    3e-08    
gb|KIM30741.1|  hypothetical protein M408DRAFT_21593                  64.7    4e-08    
gb|KIM32058.1|  hypothetical protein M408DRAFT_63133                  63.9    4e-08    
gb|AKB34756.1|  hypothetical protein MSSAC_0166                       63.9    5e-08    
gb|KIJ39531.1|  hypothetical protein M422DRAFT_174883                 63.5    6e-08    
ref|WP_034468710.1|  hypothetical protein                             63.9    6e-08    
ref|WP_043997782.1|  hypothetical protein                             61.6    6e-08    
ref|WP_009397242.1|  tetratricopeptide repeat protein                 61.6    7e-08    
ref|WP_036576752.1|  hypothetical protein                             63.5    7e-08    
gb|AKB54406.1|  hypothetical protein MSBRM_1408                       63.5    7e-08    
ref|WP_013720397.1|  hypothetical protein                             63.5    8e-08    
ref|WP_006489620.1|  hypothetical protein                             63.5    8e-08    
ref|XP_010904580.1|  PREDICTED: uncharacterized protein LOC105031972  63.2    9e-08    
ref|XP_008784696.1|  PREDICTED: uncharacterized protein LOC103703567  62.8    1e-07    
ref|WP_008313855.1|  hypothetical protein                             63.2    1e-07    
gb|EMS47108.1|  Nephrocystin-3                                        62.8    1e-07    
gb|AAT07454.1|  kinesin-like protein                                  60.5    1e-07    
gb|KIM24463.1|  hypothetical protein M408DRAFT_75826                  60.5    1e-07    
ref|XP_003036387.1|  hypothetical protein SCHCODRAFT_230323           62.8    2e-07    
gb|AKB53195.1|  hypothetical protein MSBRM_0197                       62.8    2e-07    
ref|WP_040793162.1|  hypothetical protein                             59.3    2e-07    
gb|KIJ43675.1|  hypothetical protein M422DRAFT_169605                 61.6    2e-07    
ref|WP_034468713.1|  hypothetical protein                             62.4    2e-07    
ref|WP_041697847.1|  NB-ARC domain protein                            62.0    2e-07    
emb|CAN64896.1|  hypothetical protein VITISV_044307                   60.1    2e-07    
ref|WP_044076508.1|  hypothetical protein                             62.0    2e-07    
gb|KIM24490.1|  hypothetical protein M408DRAFT_75732                  62.0    2e-07    
ref|WP_035928137.1|  hypothetical protein                             62.0    3e-07    
gb|AKB32820.1|  hypothetical protein MSSIH_2130                       62.0    3e-07    
gb|KIM24512.1|  hypothetical protein M408DRAFT_75862                  62.0    3e-07    
gb|AKB46332.1|  hypothetical protein MSKOL_0555                       62.0    3e-07    
ref|WP_040321424.1|  hypothetical protein                             58.2    3e-07    
ref|WP_043685826.1|  hypothetical protein                             61.6    3e-07    
ref|WP_041526605.1|  hypothetical protein                             61.6    4e-07    
ref|WP_009998315.1|  hypothetical protein                             61.6    4e-07    
ref|XP_006202040.1|  PREDICTED: kinesin light chain 4 isoform X2      61.2    4e-07    
ref|WP_003954235.1|  hypothetical protein                             61.6    4e-07    
gb|ACF42574.1|  Tetratricopeptide TPR_2 repeat protein                61.2    4e-07    
ref|WP_041186503.1|  hypothetical protein                             61.2    5e-07    
emb|CBK41685.1|  conserved exported protein of unknown function, ...  61.2    5e-07    
gb|AKB56857.1|  tetratricopeptide repeat family protein               60.8    5e-07    
ref|XP_008046038.1|  PREDICTED: kinesin light chain 3                 60.5    5e-07    
ref|XP_006190734.1|  PREDICTED: kinesin light chain 4 isoform X2      60.8    5e-07    
gb|AFZ16804.1|  tetratricopeptide repeat protein                      60.8    5e-07    
ref|WP_034477655.1|  hypothetical protein                             58.5    5e-07    
ref|WP_041561618.1|  hypothetical protein                             60.8    6e-07    
ref|XP_007827113.1|  hypothetical protein PFICI_00341                 60.8    6e-07    
dbj|BAD60730.1|  hypothetical protein                                 60.8    6e-07    
gb|KIJ50217.1|  hypothetical protein M422DRAFT_159675                 58.2    6e-07    
ref|WP_012599179.1|  hypothetical protein                             60.8    6e-07    
ref|WP_041780451.1|  hypothetical protein                             60.5    6e-07    
ref|XP_004644366.1|  PREDICTED: kinesin light chain 3                 60.5    6e-07    
gb|EPY76682.1|  kinesin light chain 4 isoform 3                       60.8    7e-07    
gb|EHM87591.1|  hypothetical protein HMPREF0045_01462                 57.4    7e-07    
ref|XP_006202039.1|  PREDICTED: kinesin light chain 4 isoform X1      60.5    7e-07    
ref|XP_006190733.1|  PREDICTED: kinesin light chain 4 isoform X1      60.5    8e-07    
gb|AKB42848.1|  hypothetical protein MSVAZ_0579                       60.5    8e-07    
ref|XP_008992691.1|  PREDICTED: kinesin light chain 4 isoform X1      60.5    8e-07    
gb|EPX64553.1|  hypothetical protein D187_003289                      60.5    8e-07    
ref|XP_010349451.1|  PREDICTED: kinesin light chain 3                 60.1    8e-07    
ref|WP_013322199.1|  hypothetical protein                             60.5    8e-07    
ref|WP_040878522.1|  hypothetical protein                             60.5    9e-07    
ref|WP_027536623.1|  pilus assembly protein PilF                      59.7    9e-07    
gb|ERH16929.1|  tetratricopeptide repeat protein                      58.5    9e-07    
gb|KIM23933.1|  hypothetical protein M408DRAFT_319307                 58.9    9e-07    
ref|WP_040696904.1|  kinesin                                          60.1    9e-07    
ref|WP_015146959.1|  hypothetical protein                             60.5    1e-06    
dbj|BAC86788.1|  unnamed protein product                              59.7    1e-06    
ref|XP_004044091.1|  PREDICTED: kinesin light chain 4 isoform 5       60.1    1e-06    
ref|NP_001275964.1|  kinesin light chain 4 isoform d                  60.1    1e-06    
gb|KIW78089.1|  hypothetical protein Z517_07922                       60.1    1e-06    
ref|WP_041151924.1|  hypothetical protein                             58.9    1e-06    
ref|XP_004992081.1|  mbre TPR repeat protein                          60.1    1e-06    
ref|XP_011927830.1|  PREDICTED: kinesin light chain 4 isoform X3      59.7    1e-06    
ref|WP_040712213.1|  hypothetical protein                             59.7    1e-06    
ref|WP_020534225.1|  hypothetical protein                             59.7    1e-06    
ref|XP_011927820.1|  PREDICTED: kinesin light chain 4 isoform X2      59.7    1e-06    
gb|EPX61893.1|  hypothetical protein D187_010512                      60.1    1e-06    
ref|XP_006539885.2|  PREDICTED: kinesin light chain 3 isoform X1      59.7    1e-06    
ref|WP_043430499.1|  hypothetical protein                             59.7    1e-06    
ref|XP_006539886.2|  PREDICTED: kinesin light chain 3 isoform X2      59.7    1e-06    
gb|EMT27248.1|  Nephrocystin-3                                        59.7    1e-06    
ref|WP_011022234.1|  kinesin                                          59.3    1e-06    
ref|XP_006228441.1|  PREDICTED: kinesin light chain 3 isoform X4      59.7    1e-06    
ref|XP_004044089.1|  PREDICTED: kinesin light chain 4 isoform 3       59.7    1e-06    
gb|EHH53062.1|  hypothetical protein EGM_13622                        59.7    1e-06    
ref|XP_006738579.1|  PREDICTED: kinesin light chain 3                 59.7    1e-06    
ref|XP_006901291.1|  PREDICTED: kinesin light chain 3                 59.3    1e-06    
gb|EHH18350.1|  hypothetical protein EGK_14926                        59.7    1e-06    
dbj|BAG51695.1|  unnamed protein product                              59.7    1e-06    
dbj|BAG52815.1|  unnamed protein product                              59.7    2e-06    
ref|XP_006228439.1|  PREDICTED: kinesin light chain 3 isoform X2      59.3    2e-06    
ref|XP_007970706.1|  PREDICTED: kinesin light chain 4 isoform X1      59.7    2e-06    
ref|WP_039747004.1|  hypothetical protein                             59.7    2e-06    
gb|EGE45980.1|  hypothetical protein SACT1_6683                       59.7    2e-06    
ref|XP_006539890.1|  PREDICTED: kinesin light chain 3 isoform X5      59.3    2e-06    
ref|WP_043392558.1|  hypothetical protein                             59.7    2e-06    
ref|NP_958931.1|  kinesin light chain 4 isoform b                     59.3    2e-06    
ref|XP_003923063.1|  PREDICTED: kinesin light chain 4                 59.3    2e-06    
ref|XP_006539888.2|  PREDICTED: kinesin light chain 3 isoform X4      59.3    2e-06    
ref|XP_005553011.1|  PREDICTED: kinesin light chain 4 isoform X1      59.3    2e-06    
ref|XP_006539889.2|  PREDICTED: kinesin light chain 3 isoform X3      59.3    2e-06    
ref|XP_011752806.1|  PREDICTED: kinesin light chain 4 isoform X1      59.3    2e-06    
ref|NP_958929.1|  kinesin light chain 4 isoform a                     59.3    2e-06    
emb|CAH91707.1|  hypothetical protein                                 59.3    2e-06    
gb|EAX04147.1|  kinesin light chain 4, isoform CRA_b                  59.3    2e-06    
dbj|BAG51496.1|  unnamed protein product                              59.3    2e-06    
ref|XP_004044087.1|  PREDICTED: kinesin light chain 4 isoform 1       59.3    2e-06    
dbj|BAC87179.1|  unnamed protein product                              59.3    2e-06    
ref|WP_039897557.1|  kinesin                                          59.7    2e-06    
ref|XP_004590440.1|  PREDICTED: kinesin light chain 4                 59.3    2e-06    
ref|XP_004993012.1|  tetratricopeptide protein                        59.3    2e-06    
ref|XP_001092463.2|  PREDICTED: kinesin light chain 4-like isoform 7  59.3    2e-06    
gb|AKB58702.1|  hypothetical protein MSBR2_2186                       59.3    2e-06    
ref|XP_007970707.1|  PREDICTED: kinesin light chain 4 isoform X2      59.3    2e-06    
gb|KIM25290.1|  hypothetical protein M408DRAFT_74572                  59.3    2e-06    
ref|XP_004767657.1|  PREDICTED: kinesin light chain 3                 59.3    2e-06    
gb|AKB58701.1|  hypothetical protein MSBR2_2185                       59.3    2e-06    
gb|AGY56838.1|  cellulose synthase subunit BcsC                       59.3    2e-06    



>ref|XP_011070356.1| PREDICTED: nephrocystin-3 [Sesamum indicum]
Length=603

 Score =   414 bits (1065),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 214/227 (94%), Positives = 223/227 (98%), Gaps = 0/227 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTT+EEIASGM EISAIYELFNEPEEALKLL KA+KLLEDKPGQQSTIAGIEARMGVM
Sbjct  377  VPGTTAEEIASGMAEISAIYELFNEPEEALKLLQKAMKLLEDKPGQQSTIAGIEARMGVM  436

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
             YMVGRY+E+RSSFESAV+KLRASGERKSAFFGVVLNQMGL+CVQLFKIDEAAELFEEAR
Sbjct  437  LYMVGRYEESRSSFESAVSKLRASGERKSAFFGVVLNQMGLACVQLFKIDEAAELFEEAR  496

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
            EILE ECGPCHQDTLGVYSNLAATYDAMGR+EDAIEILEYVLKLREEKLGTANPDFDDEK
Sbjct  497  EILEQECGPCHQDTLGVYSNLAATYDAMGRIEDAIEILEYVLKLREEKLGTANPDFDDEK  556

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFRS  217
            KRLAELLKEAG+SRNKKAKSLENLIDPNSKRTKKE+SKKWSAFGFRS
Sbjct  557  KRLAELLKEAGRSRNKKAKSLENLIDPNSKRTKKETSKKWSAFGFRS  603



>emb|CDP12192.1| unnamed protein product [Coffea canephora]
Length=605

 Score =   406 bits (1044),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 209/227 (92%), Positives = 220/227 (97%), Gaps = 0/227 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTT+EEIASGMTE+SAIYELFNEPEEALKLL KA+KLLEDKPGQQSTIAGIEARMGVM
Sbjct  379  VPGTTAEEIASGMTEVSAIYELFNEPEEALKLLQKAMKLLEDKPGQQSTIAGIEARMGVM  438

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
             YM+GRY+EARSSFESAV KLR SGERKSAFFGVVLNQMGL+CVQLF+IDEAAELFEEAR
Sbjct  439  LYMIGRYEEARSSFESAVVKLRGSGERKSAFFGVVLNQMGLACVQLFRIDEAAELFEEAR  498

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
            EILE E GPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK
Sbjct  499  EILEQEVGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  558

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFRS  217
            KRLAELLKEAG+SRNKKAKSLENLIDPN+KRT+KE+SKKWS FGFRS
Sbjct  559  KRLAELLKEAGRSRNKKAKSLENLIDPNAKRTRKETSKKWSPFGFRS  605



>gb|EYU33495.1| hypothetical protein MIMGU_mgv1a003155mg [Erythranthe guttata]
Length=604

 Score =   405 bits (1042),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 211/228 (93%), Positives = 221/228 (97%), Gaps = 1/228 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTT EEIASG+TEISAIYELFNEPEEALKLL KA+KLLEDKPGQQST+AGIEAR GVM
Sbjct  377  VPGTTPEEIASGLTEISAIYELFNEPEEALKLLQKAMKLLEDKPGQQSTVAGIEARTGVM  436

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            FYMVGRY+E+R SFE+AVAKLR SGERKSAFFGVVLNQMGL+CVQLFKIDEAAELFEEAR
Sbjct  437  FYMVGRYEESRGSFETAVAKLRGSGERKSAFFGVVLNQMGLACVQLFKIDEAAELFEEAR  496

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
            EILE ECGPCHQDTLGVYSNLAATYDAMGR+EDAIEILEYVLKLREEKLGTANPDFDDEK
Sbjct  497  EILEQECGPCHQDTLGVYSNLAATYDAMGRIEDAIEILEYVLKLREEKLGTANPDFDDEK  556

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKE-SSKKWSAFGFRS  217
            KRLAELLKEAG+SRNKKAKSLENLIDPNSKRTKKE +SKKWSAFGFRS
Sbjct  557  KRLAELLKEAGRSRNKKAKSLENLIDPNSKRTKKETTSKKWSAFGFRS  604



>ref|XP_009802725.1| PREDICTED: nephrocystin-3 [Nicotiana sylvestris]
Length=605

 Score =   403 bits (1035),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 210/227 (93%), Positives = 220/227 (97%), Gaps = 0/227 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTT+EEIA G+TEISAIYELFNEPEEALKLL+KA+KLLEDKPGQQSTIAGIEARMGVM
Sbjct  379  VPGTTAEEIACGLTEISAIYELFNEPEEALKLLLKAMKLLEDKPGQQSTIAGIEARMGVM  438

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            FYMVGRY+EA SSFE+AVAKLRA GERKSAFFGVVLNQMGLS VQLFKIDEAAELFEEAR
Sbjct  439  FYMVGRYEEAHSSFENAVAKLRAGGERKSAFFGVVLNQMGLSSVQLFKIDEAAELFEEAR  498

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
            +ILE ECGPCHQDTLGVYSNLAATYDA+GRV+DAIEILEYVLKLREEKLGTANPDFDDEK
Sbjct  499  QILEQECGPCHQDTLGVYSNLAATYDALGRVDDAIEILEYVLKLREEKLGTANPDFDDEK  558

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFRS  217
            KRLAELLKEAGKSRNK AKSLENLIDPNSKRTKKE S+KWSAFGFRS
Sbjct  559  KRLAELLKEAGKSRNKNAKSLENLIDPNSKRTKKEPSRKWSAFGFRS  605



>ref|XP_009615358.1| PREDICTED: nephrocystin-3 [Nicotiana tomentosiformis]
Length=605

 Score =   403 bits (1035),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 210/227 (93%), Positives = 220/227 (97%), Gaps = 0/227 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTT+EEIA G+TEISAIYELFNEPEEALKLL+KA+KLLEDKPGQQSTIAGIEARMGVM
Sbjct  379  VPGTTAEEIACGLTEISAIYELFNEPEEALKLLLKAMKLLEDKPGQQSTIAGIEARMGVM  438

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            FYMVGRY+EA SSFE+AVAKLRA GERKSAFFGVVLNQMGLS VQLFKIDEAAELFEEAR
Sbjct  439  FYMVGRYEEAHSSFENAVAKLRAGGERKSAFFGVVLNQMGLSSVQLFKIDEAAELFEEAR  498

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
            +ILE ECGPCHQDTLGVYSNLAATYDA+GRV+DAIEILEYVLKLREEKLGTANPDFDDEK
Sbjct  499  QILEQECGPCHQDTLGVYSNLAATYDALGRVDDAIEILEYVLKLREEKLGTANPDFDDEK  558

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFRS  217
            KRLAELLKEAGKSRNK AKSLENLIDPNSKRTKKE S+KWSAFGFRS
Sbjct  559  KRLAELLKEAGKSRNKNAKSLENLIDPNSKRTKKEPSRKWSAFGFRS  605



>ref|XP_006343812.1| PREDICTED: nephrocystin-3-like [Solanum tuberosum]
Length=601

 Score =   401 bits (1031),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 210/227 (93%), Positives = 220/227 (97%), Gaps = 0/227 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTT+EEIA G+TEISAIYELFNEPEEALKLL+KA+KLLEDKPGQQSTIAGIEARMGVM
Sbjct  375  VPGTTAEEIACGLTEISAIYELFNEPEEALKLLLKAMKLLEDKPGQQSTIAGIEARMGVM  434

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            FYMVGRY+EA SSFE+AVAKLRA GERKSAFFGVVLNQMGLS VQLFKIDEAAELFEEAR
Sbjct  435  FYMVGRYEEAHSSFENAVAKLRAGGERKSAFFGVVLNQMGLSSVQLFKIDEAAELFEEAR  494

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE ECGPCHQDTLGVYSNLAATYDA+GRVEDAIEILEYVLKLREEKLGTANPDFDDEK
Sbjct  495  RILEQECGPCHQDTLGVYSNLAATYDALGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  554

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFRS  217
            KRLAELLKEAGKSRNKKAKSLENLIDP+SK TKKE+S+KWSAFGFRS
Sbjct  555  KRLAELLKEAGKSRNKKAKSLENLIDPSSKTTKKETSRKWSAFGFRS  601



>emb|CBI34541.3| unnamed protein product [Vitis vinifera]
Length=423

 Score =   385 bits (989),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 202/226 (89%), Positives = 214/226 (95%), Gaps = 1/226 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTT+EEIA GMTEISAIYE  NEPEEALKLL KALKLLEDKPGQQSTIAGIEARMGVM
Sbjct  197  VPGTTAEEIAGGMTEISAIYESINEPEEALKLLQKALKLLEDKPGQQSTIAGIEARMGVM  256

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            FY+VGRY EARSSFESAVAKLRASGERKS FFGVVLNQMGL+CVQLFKIDEA ELFEEAR
Sbjct  257  FYLVGRYGEARSSFESAVAKLRASGERKSPFFGVVLNQMGLACVQLFKIDEAVELFEEAR  316

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE ECGPCHQDT+GVY+NLAATYDAMGRVEDAIEILEYVLKLREE+LGTANPDFDDEK
Sbjct  317  GILEKECGPCHQDTIGVYTNLAATYDAMGRVEDAIEILEYVLKLREEQLGTANPDFDDEK  376

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFR  220
            KRL+ELLKEAGK+RN+KAKSL+NLIDPNSKRTKKE +K+WS  GFR
Sbjct  377  KRLSELLKEAGKARNRKAKSLQNLIDPNSKRTKKE-TKRWSGLGFR  421



>ref|XP_010324680.1| PREDICTED: kinesin light chain 4-like [Solanum lycopersicum]
Length=476

 Score =   386 bits (991),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 204/229 (89%), Positives = 217/229 (95%), Gaps = 2/229 (1%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTT E+IA G+TEISA+YELFNEPEEALKLL+KA+KLLEDKPGQQSTIAGIEARMGVM
Sbjct  248  VPGTTPEDIACGLTEISAVYELFNEPEEALKLLLKAMKLLEDKPGQQSTIAGIEARMGVM  307

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            FYMVGRY+EARSS E+AV KLRASGERKSAFFGVVLNQMGLS VQLFKIDEAAELFEEA+
Sbjct  308  FYMVGRYEEARSSLENAVIKLRASGERKSAFFGVVLNQMGLSSVQLFKIDEAAELFEEAK  367

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
            EILE ECG CHQDTLGVYSNLAATYDA+GRV+DAIEILEYVLKLREEKLGTANPDF+DEK
Sbjct  368  EILEQECGHCHQDTLGVYSNLAATYDAIGRVDDAIEILEYVLKLREEKLGTANPDFNDEK  427

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKE--SSKKWSAFGFRS  217
            KRLAELLKEAG+SRNK  KSLENLIDPNSKRT K+  SSKKWSAFGFRS
Sbjct  428  KRLAELLKEAGRSRNKNPKSLENLIDPNSKRTTKKETSSKKWSAFGFRS  476



>ref|XP_006352234.1| PREDICTED: nephrocystin-3-like [Solanum tuberosum]
Length=605

 Score =   387 bits (994),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 206/229 (90%), Positives = 217/229 (95%), Gaps = 2/229 (1%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTT E+IASG+ EISAIYELFNEPEEALKLL+KA+KLLEDKPGQQSTIAGIEARMGVM
Sbjct  377  VPGTTPEDIASGLMEISAIYELFNEPEEALKLLLKAMKLLEDKPGQQSTIAGIEARMGVM  436

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            FYMVGRY+EARSSFE+AV KLRASGERKSAFFGVVLNQMGLS VQLFKIDEAAELFEEAR
Sbjct  437  FYMVGRYEEARSSFENAVTKLRASGERKSAFFGVVLNQMGLSSVQLFKIDEAAELFEEAR  496

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
            EILE ECG CHQDTLGVYSNLAATYDA+GRV+DAIEILEYVLKLREEKLGTANPDF+DEK
Sbjct  497  EILEQECGHCHQDTLGVYSNLAATYDAIGRVDDAIEILEYVLKLREEKLGTANPDFNDEK  556

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKE--SSKKWSAFGFRS  217
            KRLAELLKEAG+SRNK  KSLENLIDP SKRT K+  SSKKWSAFGFRS
Sbjct  557  KRLAELLKEAGRSRNKNPKSLENLIDPTSKRTTKKETSSKKWSAFGFRS  605



>ref|NP_001266207.1| kinesin light chain I2I isoform [Solanum lycopersicum]
 gb|AEW69782.1| Hop-interacting protein THI007 [Solanum lycopersicum]
Length=605

 Score =   386 bits (992),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 205/229 (90%), Positives = 217/229 (95%), Gaps = 2/229 (1%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTT E+IASG+ EISAIYELFNEPEEALKLL+KA+KLLEDKPGQQSTIAGIEARMGVM
Sbjct  377  VPGTTPEDIASGLMEISAIYELFNEPEEALKLLLKAMKLLEDKPGQQSTIAGIEARMGVM  436

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            FYMVGRY+EAR+SFE+AV KLRASGERKSAFFGVVLNQMGLS VQLFKIDEAAELFEEAR
Sbjct  437  FYMVGRYEEARNSFENAVIKLRASGERKSAFFGVVLNQMGLSSVQLFKIDEAAELFEEAR  496

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
            EILE ECG CHQDTLGVYSNLAATYDA+GRV+DAIEILEYVLKLREEKLGTANPDF+DEK
Sbjct  497  EILEQECGHCHQDTLGVYSNLAATYDAIGRVDDAIEILEYVLKLREEKLGTANPDFNDEK  556

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKE--SSKKWSAFGFRS  217
            KRLAELLKEAG+SRNK   SLENLIDPNSKRT K+  SSKKWSAFGFRS
Sbjct  557  KRLAELLKEAGRSRNKNPNSLENLIDPNSKRTTKKETSSKKWSAFGFRS  605



>ref|XP_010053096.1| PREDICTED: kinesin light chain 4 [Eucalyptus grandis]
 gb|KCW77342.1| hypothetical protein EUGRSUZ_D01704 [Eucalyptus grandis]
Length=610

 Score =   386 bits (991),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 199/226 (88%), Positives = 213/226 (94%), Gaps = 0/226 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTT+EEIA G+TEISAIYE  +EPEEALKLL KA+KLLEDKPGQQSTIAGIEARMGVM
Sbjct  384  VPGTTAEEIACGLTEISAIYESVDEPEEALKLLQKAMKLLEDKPGQQSTIAGIEARMGVM  443

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            FYM+GRY+EAR+SFE+AV KLRASGERKSAFFGVVLNQMGL+CVQLFKIDEAAELFEEAR
Sbjct  444  FYMIGRYEEARNSFENAVTKLRASGERKSAFFGVVLNQMGLACVQLFKIDEAAELFEEAR  503

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE ECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLG ANPDF+DEK
Sbjct  504  SILEQECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGIANPDFEDEK  563

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFR  220
             RLAELLKEAG+SRN+KAKSLENLIDPNSKRTKKE +K+W   GFR
Sbjct  564  GRLAELLKEAGRSRNRKAKSLENLIDPNSKRTKKEGTKRWPGLGFR  609



>ref|XP_002263593.1| PREDICTED: kinesin light chain 4 [Vitis vinifera]
Length=591

 Score =   385 bits (988),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 202/226 (89%), Positives = 214/226 (95%), Gaps = 1/226 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTT+EEIA GMTEISAIYE  NEPEEALKLL KALKLLEDKPGQQSTIAGIEARMGVM
Sbjct  365  VPGTTAEEIAGGMTEISAIYESINEPEEALKLLQKALKLLEDKPGQQSTIAGIEARMGVM  424

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            FY+VGRY EARSSFESAVAKLRASGERKS FFGVVLNQMGL+CVQLFKIDEA ELFEEAR
Sbjct  425  FYLVGRYGEARSSFESAVAKLRASGERKSPFFGVVLNQMGLACVQLFKIDEAVELFEEAR  484

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE ECGPCHQDT+GVY+NLAATYDAMGRVEDAIEILEYVLKLREE+LGTANPDFDDEK
Sbjct  485  GILEKECGPCHQDTIGVYTNLAATYDAMGRVEDAIEILEYVLKLREEQLGTANPDFDDEK  544

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFR  220
            KRL+ELLKEAGK+RN+KAKSL+NLIDPNSKRTKKE +K+WS  GFR
Sbjct  545  KRLSELLKEAGKARNRKAKSLQNLIDPNSKRTKKE-TKRWSGLGFR  589



>ref|XP_006439287.1| hypothetical protein CICLE_v10019420mg [Citrus clementina]
 gb|ESR52527.1| hypothetical protein CICLE_v10019420mg [Citrus clementina]
Length=590

 Score =   384 bits (985),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 196/226 (87%), Positives = 214/226 (95%), Gaps = 0/226 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTT+EEIA G+TEISAIYE  +EPEEALKLL +A+KLLEDKPGQQSTIAGIEARMGVM
Sbjct  364  VPGTTAEEIAGGLTEISAIYESVDEPEEALKLLQRAMKLLEDKPGQQSTIAGIEARMGVM  423

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            FYMVGRY+EARSSFESA+AKLRASGERKSAFFGVVLNQMGL+CVQLFKIDEAAELFEEAR
Sbjct  424  FYMVGRYEEARSSFESAIAKLRASGERKSAFFGVVLNQMGLACVQLFKIDEAAELFEEAR  483

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE ECGPCHQDTLGVYSNLAATYDAMGRV DAIEILE+VLKLREE+LG ANPDF+DEK
Sbjct  484  AILEQECGPCHQDTLGVYSNLAATYDAMGRVADAIEILEHVLKLREEQLGIANPDFEDEK  543

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFR  220
             RLAELLKEAG++RN+KAKSLENLIDPNS+RTKKE++K+W   GFR
Sbjct  544  NRLAELLKEAGRARNRKAKSLENLIDPNSRRTKKEATKRWPGLGFR  589



>ref|XP_006476340.1| PREDICTED: nephrocystin-3-like [Citrus sinensis]
Length=590

 Score =   384 bits (985),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 196/226 (87%), Positives = 214/226 (95%), Gaps = 0/226 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTT+EEIA G+TEISAIYE  +EPEEALKLL +A+KLLEDKPGQQSTIAGIEARMGVM
Sbjct  364  VPGTTAEEIAGGLTEISAIYESVDEPEEALKLLQRAMKLLEDKPGQQSTIAGIEARMGVM  423

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            FYMVGRY+EARSSFESA+AKLRASGERKSAFFGVVLNQMGL+CVQLFKIDEAAELFEEAR
Sbjct  424  FYMVGRYEEARSSFESAIAKLRASGERKSAFFGVVLNQMGLACVQLFKIDEAAELFEEAR  483

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE ECGPCHQDTLGVYSNLAATYDAMGRV DAIEILE+VLKLREE+LG ANPDF+DEK
Sbjct  484  AILEQECGPCHQDTLGVYSNLAATYDAMGRVADAIEILEHVLKLREEQLGIANPDFEDEK  543

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFR  220
             RLAELLKEAG++RN+KAKSLENLIDPNS+RTKKE++K+W   GFR
Sbjct  544  NRLAELLKEAGRARNRKAKSLENLIDPNSRRTKKEATKRWPGLGFR  589



>ref|XP_012086672.1| PREDICTED: nephrocystin-3 [Jatropha curcas]
 gb|KDP25259.1| hypothetical protein JCGZ_20415 [Jatropha curcas]
Length=601

 Score =   380 bits (977),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 199/226 (88%), Positives = 213/226 (94%), Gaps = 0/226 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTT+EEIA G+TEISAIYE  +EPEEALKLL KA+KLLEDKPGQQSTIAGIEARMGVM
Sbjct  375  VPGTTAEEIAGGLTEISAIYESVDEPEEALKLLQKAMKLLEDKPGQQSTIAGIEARMGVM  434

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            FYMVGRY+EAR+SFESAVAKLRASGERKSAFFGVVLNQMGL+CVQLFKIDEAAELFEEAR
Sbjct  435  FYMVGRYEEARNSFESAVAKLRASGERKSAFFGVVLNQMGLACVQLFKIDEAAELFEEAR  494

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE ECGPC+QDTLGVYSNLAATYDAMGRV+DAIEILEYVLKLREEKLG ANPDF DEK
Sbjct  495  AILEQECGPCNQDTLGVYSNLAATYDAMGRVDDAIEILEYVLKLREEKLGIANPDFQDEK  554

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFR  220
             RLAELLKEAG++RNKKAKSLE+LID NSKRTKKES+K+W   GFR
Sbjct  555  NRLAELLKEAGRARNKKAKSLEHLIDNNSKRTKKESTKRWPGLGFR  600



>ref|XP_010107265.1| hypothetical protein L484_007826 [Morus notabilis]
 gb|EXC14459.1| hypothetical protein L484_007826 [Morus notabilis]
Length=605

 Score =   380 bits (977),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 196/226 (87%), Positives = 214/226 (95%), Gaps = 0/226 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTT+EEIA G+TEISAIYE  NEPEEALKLL KA+KLLEDKPGQQSTIAGIEARMGVM
Sbjct  379  VPGTTAEEIACGLTEISAIYESVNEPEEALKLLQKAMKLLEDKPGQQSTIAGIEARMGVM  438

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            FYM+GRY+EAR+SFE+AVAKLRASGERKSAFFGVVLNQMGL+CVQLFKIDEAAELFEEAR
Sbjct  439  FYMLGRYEEARNSFENAVAKLRASGERKSAFFGVVLNQMGLACVQLFKIDEAAELFEEAR  498

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE ECG CHQDT+GVYSNLAATYDAMGRV+DAIEILEYVLKLREEKLG ANPDF+DEK
Sbjct  499  GILEQECGSCHQDTIGVYSNLAATYDAMGRVDDAIEILEYVLKLREEKLGIANPDFEDEK  558

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFR  220
            +RLAELLKEAGK+R++KAKSLENLIDPNSK+TKKE +K+W   GFR
Sbjct  559  RRLAELLKEAGKTRDRKAKSLENLIDPNSKKTKKEVTKRWPGLGFR  604



>gb|KEH21270.1| kinesin light chain [Medicago truncatula]
Length=588

 Score =   378 bits (971),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 193/226 (85%), Positives = 213/226 (94%), Gaps = 0/226 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTT+EEIA G+TE+SAI+E  ++PEEALKLL KA+KLLEDKPGQQST+AGIEARMGVM
Sbjct  362  VPGTTAEEIAGGLTEVSAIFESVDDPEEALKLLQKAMKLLEDKPGQQSTVAGIEARMGVM  421

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +YM+G+YDEARS+FESAV KLR SGERKSAFFGVVLNQMGL+CVQLFKIDEAAELFEEAR
Sbjct  422  YYMIGKYDEARSAFESAVLKLRTSGERKSAFFGVVLNQMGLACVQLFKIDEAAELFEEAR  481

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE ECGPCHQDTLGVYSNLAATYDAMGRV DAIEILEYVLKLREEKLG ANPDF+DEK
Sbjct  482  GILEQECGPCHQDTLGVYSNLAATYDAMGRVGDAIEILEYVLKLREEKLGIANPDFEDEK  541

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFR  220
            +RLAELLKEAGK+R++KAKSLENLIDPNSKRTKKES+K+W   GFR
Sbjct  542  RRLAELLKEAGKTRDRKAKSLENLIDPNSKRTKKESNKRWPGLGFR  587



>ref|XP_007040594.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma 
cacao]
 gb|EOY25095.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma 
cacao]
Length=588

 Score =   377 bits (969),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 195/226 (86%), Positives = 213/226 (94%), Gaps = 0/226 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTT+EEIA G+TEISAIYE  +EPEEALKLL KA+KLLEDKPGQQSTIAGIEARMGVM
Sbjct  362  VPGTTAEEIAGGLTEISAIYESVDEPEEALKLLQKAMKLLEDKPGQQSTIAGIEARMGVM  421

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            FY++GRY+EAR+SFESAVAKLRASGERKSAFFGV+LNQMGL+CVQLFKIDEAA+LFEEAR
Sbjct  422  FYILGRYEEARNSFESAVAKLRASGERKSAFFGVMLNQMGLACVQLFKIDEAADLFEEAR  481

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE ECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLG ANPDF+DEK
Sbjct  482  AILEQECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGIANPDFEDEK  541

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFR  220
             RLAELLKEAG+SRN+KAKSLENLI P+S+RTKKE +K+W   GFR
Sbjct  542  SRLAELLKEAGRSRNRKAKSLENLIAPSSRRTKKEGTKRWPGLGFR  587



>gb|KHN16719.1| Nephrocystin-3 [Glycine soja]
Length=523

 Score =   375 bits (964),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 192/226 (85%), Positives = 213/226 (94%), Gaps = 0/226 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTT+EEIA G+TEISA++E  +EPEEALKLL +A+KLLEDKPGQQSTIAGIEARMGVM
Sbjct  297  VPGTTAEEIAGGLTEISAVFESVDEPEEALKLLNRAMKLLEDKPGQQSTIAGIEARMGVM  356

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +YM+GRY+++R+SFESAVAKLRASGERKSAFFGVVLNQMGL+CVQLFKIDEAAELFEEAR
Sbjct  357  YYMIGRYEDSRNSFESAVAKLRASGERKSAFFGVVLNQMGLACVQLFKIDEAAELFEEAR  416

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE ECGPCHQDTLGVYSNLAATYDAMGRV DAIEILEYVLKLREEKLG ANPDF+DEK
Sbjct  417  GILEQECGPCHQDTLGVYSNLAATYDAMGRVGDAIEILEYVLKLREEKLGIANPDFEDEK  476

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFR  220
            +RLAELLKEAGK+R++KAKSLENLIDP SKRTKKE +K+W   GFR
Sbjct  477  RRLAELLKEAGKTRDRKAKSLENLIDPGSKRTKKEGAKRWPGLGFR  522



>ref|XP_003525334.1| PREDICTED: nephrocystin-3-like [Glycine max]
Length=563

 Score =   376 bits (965),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 192/226 (85%), Positives = 213/226 (94%), Gaps = 0/226 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTT+EEIA G+TEISA++E  +EPEEALKLL +A+KLLEDKPGQQSTIAGIEARMGVM
Sbjct  337  VPGTTAEEIAGGLTEISAVFESVDEPEEALKLLNRAMKLLEDKPGQQSTIAGIEARMGVM  396

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +YM+GRY+++R+SFESAVAKLRASGERKSAFFGVVLNQMGL+CVQLFKIDEAAELFEEAR
Sbjct  397  YYMIGRYEDSRNSFESAVAKLRASGERKSAFFGVVLNQMGLACVQLFKIDEAAELFEEAR  456

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE ECGPCHQDTLGVYSNLAATYDAMGRV DAIEILEYVLKLREEKLG ANPDF+DEK
Sbjct  457  GILEQECGPCHQDTLGVYSNLAATYDAMGRVGDAIEILEYVLKLREEKLGIANPDFEDEK  516

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFR  220
            +RLAELLKEAGK+R++KAKSLENLIDP SKRTKKE +K+W   GFR
Sbjct  517  RRLAELLKEAGKTRDRKAKSLENLIDPGSKRTKKEGAKRWPGLGFR  562



>ref|XP_003530449.1| PREDICTED: nephrocystin-3-like [Glycine max]
Length=578

 Score =   376 bits (965),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 192/226 (85%), Positives = 213/226 (94%), Gaps = 0/226 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTT+EEIA G+TEISA++E  +EPEEALKLL +A+KLLEDKPGQQSTIAGIEARMGVM
Sbjct  352  VPGTTAEEIAGGLTEISAVFESVDEPEEALKLLNRAMKLLEDKPGQQSTIAGIEARMGVM  411

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +YM+GRY+++R+SFESAVAKLRASGERKSAFFGVVLNQMGL+CVQLFKIDEAAELFEEAR
Sbjct  412  YYMIGRYEDSRNSFESAVAKLRASGERKSAFFGVVLNQMGLACVQLFKIDEAAELFEEAR  471

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE ECGPCHQDTLGVYSNLAATYDAMGRV DAIEILEYVLKLREEKLG ANPDF+DEK
Sbjct  472  GILEQECGPCHQDTLGVYSNLAATYDAMGRVGDAIEILEYVLKLREEKLGIANPDFEDEK  531

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFR  220
            +RLAELLKEAGK+R++KAKSLENLIDP SKRTKKE +K+W   GFR
Sbjct  532  RRLAELLKEAGKTRDRKAKSLENLIDPGSKRTKKEGAKRWPGLGFR  577



>ref|XP_002518863.1| kinesin light chain, putative [Ricinus communis]
 gb|EEF43396.1| kinesin light chain, putative [Ricinus communis]
Length=605

 Score =   376 bits (966),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 197/226 (87%), Positives = 212/226 (94%), Gaps = 0/226 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTT+EEIA G+TEISAIYE  +EPEEALKLL KA+KLLEDKPGQQSTIAGIEARMGVM
Sbjct  379  VPGTTAEEIAGGLTEISAIYESADEPEEALKLLQKAMKLLEDKPGQQSTIAGIEARMGVM  438

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            FYMVGRY+EAR+SFESAV KLRASGERKSAFFGVVLNQMGL+CVQLFKIDEAAELFEEAR
Sbjct  439  FYMVGRYEEARNSFESAVTKLRASGERKSAFFGVVLNQMGLACVQLFKIDEAAELFEEAR  498

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE ECGPC+QDT+GVYSNLAATYDAMGRV+DAIEILEYVLKLREEKLG ANPDF DEK
Sbjct  499  AILEQECGPCNQDTIGVYSNLAATYDAMGRVDDAIEILEYVLKLREEKLGIANPDFVDEK  558

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFR  220
             RLAELLKEAG++RNKKAKSLE+LID NSKRTKKES+K+W   GFR
Sbjct  559  SRLAELLKEAGRARNKKAKSLESLIDNNSKRTKKESTKRWPGLGFR  604



>ref|XP_007160195.1| hypothetical protein PHAVU_002G301000g [Phaseolus vulgaris]
 gb|ESW32189.1| hypothetical protein PHAVU_002G301000g [Phaseolus vulgaris]
Length=592

 Score =   376 bits (965),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 190/226 (84%), Positives = 213/226 (94%), Gaps = 0/226 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTT+EEIA G+TE+SA++E  +EPEEALKLL +A+KLL+DKPGQQSTIAGIEARMGVM
Sbjct  366  VPGTTAEEIAGGLTEVSAVFESVDEPEEALKLLSRAMKLLDDKPGQQSTIAGIEARMGVM  425

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +YM+GRY+++R+SFESAVAKLRASGERKSAFFGVVLNQMGL+CVQLFKIDEAAELFEEAR
Sbjct  426  YYMIGRYEDSRNSFESAVAKLRASGERKSAFFGVVLNQMGLACVQLFKIDEAAELFEEAR  485

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE ECGPCHQDTLGVYSNLAATYDAMGRV DAIEILEYVLKLREEKLG ANPDF+DEK
Sbjct  486  GILEQECGPCHQDTLGVYSNLAATYDAMGRVGDAIEILEYVLKLREEKLGIANPDFEDEK  545

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFR  220
            +RLAELLKEAGK+R++KAKSLENLIDP SKRTKKE +K+W   GFR
Sbjct  546  RRLAELLKEAGKTRDRKAKSLENLIDPGSKRTKKEGTKRWPGLGFR  591



>ref|XP_011026834.1| PREDICTED: nephrocystin-3-like [Populus euphratica]
Length=596

 Score =   376 bits (965),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 197/226 (87%), Positives = 214/226 (95%), Gaps = 3/226 (1%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTT+EEIA G+TEISAI+E  +EPEEALKLL KA+KLLEDKPGQQSTIAGIEARMGVM
Sbjct  373  VPGTTAEEIAGGLTEISAIFESVDEPEEALKLLQKAMKLLEDKPGQQSTIAGIEARMGVM  432

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            FYMVGRY+EAR+SFESAV KLR+SGERKSAFFGVVLNQMGL+CVQLFKIDEA ELFEEAR
Sbjct  433  FYMVGRYEEARNSFESAVTKLRSSGERKSAFFGVVLNQMGLACVQLFKIDEACELFEEAR  492

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE+ECGPCHQDT+GVYSNLAATYDAMGRVEDAIEILE+VLKLREEKLG ANPDF+DEK
Sbjct  493  GILENECGPCHQDTIGVYSNLAATYDAMGRVEDAIEILEHVLKLREEKLGIANPDFEDEK  552

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFR  220
             RLAELLKEAG++RNKKAKSLENLIDPNS+RTKKES+KKW   GFR
Sbjct  553  SRLAELLKEAGRARNKKAKSLENLIDPNSRRTKKESTKKW---GFR  595



>gb|KHG14140.1| Nephrocystin-3 [Gossypium arboreum]
Length=582

 Score =   375 bits (963),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 199/227 (88%), Positives = 213/227 (94%), Gaps = 4/227 (2%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTT+EEIA G+TEISAIYE  +EPEEALKLL KA+KLLEDKPGQQSTIAGIEAR+GVM
Sbjct  358  VPGTTAEEIAGGLTEISAIYESVDEPEEALKLLQKAMKLLEDKPGQQSTIAGIEARIGVM  417

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            FY++GRYDE+R+SFESAV KLRASGERKSAFFGVVLNQMGL+CVQLFKIDEAAELFEEAR
Sbjct  418  FYILGRYDESRNSFESAVTKLRASGERKSAFFGVVLNQMGLACVQLFKIDEAAELFEEAR  477

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE ECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLG ANPDF+DEK
Sbjct  478  AILEQECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGIANPDFEDEK  537

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRT-KKESSKKWSAFGFR  220
             RLAELLKEAG+SRN+KAKSLENLIDPNSKRT KKE +KKW   GFR
Sbjct  538  NRLAELLKEAGRSRNRKAKSLENLIDPNSKRTAKKEGTKKW---GFR  581



>ref|XP_008239183.1| PREDICTED: nephrocystin-3, partial [Prunus mume]
Length=557

 Score =   374 bits (961),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 192/226 (85%), Positives = 211/226 (93%), Gaps = 0/226 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTT+EEI+ G+TEISAIYE  +EPEEALKLL KA+KLLEDKPGQQSTIAGIEARMGVM
Sbjct  331  VPGTTAEEISGGLTEISAIYESMDEPEEALKLLQKAMKLLEDKPGQQSTIAGIEARMGVM  390

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            F M+GRY+EARSSFESA+ KLRASGE+KS FFGVVLNQMGL+CVQLFKIDEAAELFEEAR
Sbjct  391  FCMLGRYEEARSSFESAIVKLRASGEKKSPFFGVVLNQMGLACVQLFKIDEAAELFEEAR  450

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE ECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLG ANPDF+DEK
Sbjct  451  GILEQECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGIANPDFEDEK  510

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFR  220
            +RL ELLKEAG++R++KAKSLENLIDPNSK+TKKE +K+W   GFR
Sbjct  511  RRLTELLKEAGRTRDRKAKSLENLIDPNSKKTKKEGTKRWGGLGFR  556



>ref|XP_004503588.1| PREDICTED: nephrocystin-3-like [Cicer arietinum]
Length=590

 Score =   375 bits (962),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 193/226 (85%), Positives = 213/226 (94%), Gaps = 0/226 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTT+EEIA G+TE+SAI+E  ++PEEALKLL KA+KLLEDKPGQQSTIAGIEARMGVM
Sbjct  364  VPGTTAEEIAGGLTEVSAIFESVDDPEEALKLLQKAMKLLEDKPGQQSTIAGIEARMGVM  423

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +YMVG+YDEARS+FESAV+KLR+SGERKSAFFGVVLNQMGL+CVQLFKIDEAAELFEEAR
Sbjct  424  YYMVGKYDEARSAFESAVSKLRSSGERKSAFFGVVLNQMGLACVQLFKIDEAAELFEEAR  483

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE ECG CHQDTLGVYSNLAATYDAMGRV DAIEILEYVLKLREEKLG ANPDF+DEK
Sbjct  484  GILEQECGNCHQDTLGVYSNLAATYDAMGRVGDAIEILEYVLKLREEKLGIANPDFEDEK  543

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFR  220
            +RLAELLKEAGK+R++KAKSLENLIDPNSKRTKKE +K+W   GFR
Sbjct  544  RRLAELLKEAGKTRDRKAKSLENLIDPNSKRTKKEGTKRWPGLGFR  589



>ref|XP_007210269.1| hypothetical protein PRUPE_ppa003147mg [Prunus persica]
 gb|EMJ11468.1| hypothetical protein PRUPE_ppa003147mg [Prunus persica]
Length=598

 Score =   374 bits (961),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 192/226 (85%), Positives = 211/226 (93%), Gaps = 0/226 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTT+EEI+ G+TEISAIYE  +EPEEALKLL KA+KLLEDKPGQQSTIAGIEARMGVM
Sbjct  372  VPGTTAEEISGGLTEISAIYESMDEPEEALKLLQKAMKLLEDKPGQQSTIAGIEARMGVM  431

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            F M+GRY+EARSSFESAV KLRASGE+KS FFGVVLNQMGL+CVQLFKIDEAAELFEEAR
Sbjct  432  FCMLGRYEEARSSFESAVVKLRASGEKKSPFFGVVLNQMGLACVQLFKIDEAAELFEEAR  491

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE ECGPCHQDTLG+YSNLAATYDAMGRVEDAIEILEYVLKLREEKLG ANPDF+DEK
Sbjct  492  GILEQECGPCHQDTLGIYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGIANPDFEDEK  551

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFR  220
            +RL ELLKEAG++R++KAKSLENLIDPNSK+TKKE +K+W   GFR
Sbjct  552  RRLTELLKEAGRTRDRKAKSLENLIDPNSKKTKKEGTKRWGGLGFR  597



>gb|KJB37463.1| hypothetical protein B456_006G206300 [Gossypium raimondii]
Length=582

 Score =   374 bits (959),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 198/227 (87%), Positives = 212/227 (93%), Gaps = 4/227 (2%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTT+EEIA G+TEISAIYE  +EPEEALKLL KA+KLLEDKPGQQSTIAGIEAR+GVM
Sbjct  358  VPGTTAEEIAGGLTEISAIYESVDEPEEALKLLQKAMKLLEDKPGQQSTIAGIEARIGVM  417

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            FY++GRYDE+R+SFESAV KLRASGERKSAFFGVVLNQMGL+CVQLFKIDEAAELFEEAR
Sbjct  418  FYILGRYDESRNSFESAVTKLRASGERKSAFFGVVLNQMGLACVQLFKIDEAAELFEEAR  477

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE ECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLG ANPDF+DEK
Sbjct  478  AILEQECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGIANPDFEDEK  537

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRT-KKESSKKWSAFGFR  220
             RLAELLKEAG+ RN+KAKSLENLIDPNSKRT KKE +KKW   GFR
Sbjct  538  NRLAELLKEAGRPRNRKAKSLENLIDPNSKRTAKKEGTKKW---GFR  581



>ref|XP_011022457.1| PREDICTED: uncharacterized protein LOC105124230 [Populus euphratica]
Length=599

 Score =   374 bits (959),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 196/226 (87%), Positives = 212/226 (94%), Gaps = 3/226 (1%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTT+EEIA G+TEISAI+E   EPEEALKLL+KA+KLLEDKPGQQSTIAGIEARMGVM
Sbjct  376  VPGTTTEEIAGGLTEISAIFESVGEPEEALKLLLKAMKLLEDKPGQQSTIAGIEARMGVM  435

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            FY+VGRY+EAR+SFESAV KLR SGERKSAFFGVVLNQMGL+CVQLFKIDEA ELFEEAR
Sbjct  436  FYVVGRYEEARNSFESAVTKLRTSGERKSAFFGVVLNQMGLACVQLFKIDEACELFEEAR  495

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILEHECGPCHQDT+GVYSNLAATYDAMGRVED+IEILEYVLKLREEKLG ANPDF+DEK
Sbjct  496  AILEHECGPCHQDTIGVYSNLAATYDAMGRVEDSIEILEYVLKLREEKLGIANPDFEDEK  555

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFR  220
             RLAELLKEAGK+RNKKAKSLENLIDP+S+R KKES+KKW   GFR
Sbjct  556  SRLAELLKEAGKARNKKAKSLENLIDPSSRRNKKESTKKW---GFR  598



>ref|XP_004148984.1| PREDICTED: kinesin light chain [Cucumis sativus]
 gb|KGN53436.1| hypothetical protein Csa_4G055310 [Cucumis sativus]
Length=593

 Score =   373 bits (958),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 190/226 (84%), Positives = 214/226 (95%), Gaps = 0/226 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGT+ EEIA G+TEISAIYE  +EPEEALKLL KA+K+LEDKPGQQSTIAGIEARMGVM
Sbjct  367  VPGTSPEEIAGGLTEISAIYESVDEPEEALKLLQKAMKMLEDKPGQQSTIAGIEARMGVM  426

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            FYMVGRY++AR++FESA++KLRA+GERKSAFFGVVLNQMGL+CVQLFKIDEAAELFEEAR
Sbjct  427  FYMVGRYEDARNAFESAISKLRATGERKSAFFGVVLNQMGLACVQLFKIDEAAELFEEAR  486

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE ECG CHQDT+GVYSNLAATYDAMGRV+DAIEILE VLKLREEKLG ANPDF+DEK
Sbjct  487  GILEQECGNCHQDTIGVYSNLAATYDAMGRVDDAIEILESVLKLREEKLGIANPDFEDEK  546

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFR  220
            +RLAELLKEAG++RN+KAKSLENLIDPNS++TKKE++KKWS  GFR
Sbjct  547  RRLAELLKEAGRTRNRKAKSLENLIDPNSRKTKKEATKKWSGLGFR  592



>ref|XP_002297964.2| hypothetical protein POPTR_0001s10980g [Populus trichocarpa]
 gb|EEE82769.2| hypothetical protein POPTR_0001s10980g [Populus trichocarpa]
Length=597

 Score =   373 bits (957),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 195/226 (86%), Positives = 213/226 (94%), Gaps = 3/226 (1%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTT+EEIA G+TEISAI+E  +EPEEALKLL KA+KLLEDKPGQQSTIAGIEARMGVM
Sbjct  374  VPGTTAEEIAGGLTEISAIFESVDEPEEALKLLQKAMKLLEDKPGQQSTIAGIEARMGVM  433

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            FYMVGRY+EAR+SFESAV KLR+SGE+KSAFFGVVLNQMGL+CVQLFKIDEA ELFEEAR
Sbjct  434  FYMVGRYEEARNSFESAVTKLRSSGEKKSAFFGVVLNQMGLACVQLFKIDEACELFEEAR  493

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE ECGPCHQDT+GVYSNLAATYDA+GRVEDAIEILE+VLKLREEKLG ANPDF+DEK
Sbjct  494  GILEKECGPCHQDTIGVYSNLAATYDALGRVEDAIEILEHVLKLREEKLGIANPDFEDEK  553

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFR  220
             RLAELLKEAG++RNKKAKSLENLIDPNS+RTKKES+KKW   GFR
Sbjct  554  SRLAELLKEAGRARNKKAKSLENLIDPNSRRTKKESTKKW---GFR  596



>ref|XP_010676242.1| PREDICTED: kinesin light chain [Beta vulgaris subsp. vulgaris]
Length=602

 Score =   372 bits (955),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 186/226 (82%), Positives = 213/226 (94%), Gaps = 0/226 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGT+ EEIASG+++I+A+YE  NEPEEAL+LL +A+KLLEDK GQQ+TIAG+EAR+GVM
Sbjct  376  VPGTSQEEIASGLSDIAAVYESVNEPEEALRLLQRAMKLLEDKAGQQNTIAGLEARVGVM  435

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +YM+GR+ EA SSFESA++KLRASGERKSAFFGV+LNQMGL+CVQLFKID+AAELFEEAR
Sbjct  436  YYMIGRHGEALSSFESAISKLRASGERKSAFFGVLLNQMGLACVQLFKIDQAAELFEEAR  495

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             +LE ECGPCHQDTLGVYSNLAATYDAMGRVED+IEILEYV+KLREEKLGTANPDFDDEK
Sbjct  496  AVLEQECGPCHQDTLGVYSNLAATYDAMGRVEDSIEILEYVVKLREEKLGTANPDFDDEK  555

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFR  220
             RLAELLKEAGKSRN+KAKSLENLIDPNSKRTKKE++K+W   GFR
Sbjct  556  SRLAELLKEAGKSRNRKAKSLENLIDPNSKRTKKETAKRWGGLGFR  601



>ref|XP_002304567.2| hypothetical protein POPTR_0003s14320g [Populus trichocarpa]
 gb|EEE79546.2| hypothetical protein POPTR_0003s14320g [Populus trichocarpa]
Length=599

 Score =   372 bits (954),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 196/226 (87%), Positives = 210/226 (93%), Gaps = 3/226 (1%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTT+EEIA G+TEISAI+E   EPEEALKLL+KA+KLLEDKPGQQSTIAGIEARMGVM
Sbjct  376  VPGTTTEEIAGGLTEISAIFESVGEPEEALKLLLKAMKLLEDKPGQQSTIAGIEARMGVM  435

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            FY+VGRY+EAR+SFE AV KLR SGERKSAFFGVVLNQMGL+CVQLFKIDEA ELFEEAR
Sbjct  436  FYVVGRYEEARNSFEGAVTKLRTSGERKSAFFGVVLNQMGLACVQLFKIDEACELFEEAR  495

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE ECGPCHQDT+GVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLG ANPDF+DEK
Sbjct  496  AILEQECGPCHQDTIGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGIANPDFEDEK  555

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFR  220
             RLAELLKEAGK+RNKKAKSLENLIDPNS+R KKES+KKW   GFR
Sbjct  556  SRLAELLKEAGKARNKKAKSLENLIDPNSRRNKKESTKKW---GFR  598



>gb|EPS61693.1| hypothetical protein M569_13098 [Genlisea aurea]
Length=610

 Score =   372 bits (954),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 191/232 (82%), Positives = 215/232 (93%), Gaps = 5/232 (2%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            +PGT  E++ASGMTEISAIYE+FNEPEEA+KLL KA+KLLEDKPGQQST+AGIEAR+GVM
Sbjct  379  LPGTAPEDVASGMTEISAIYEMFNEPEEAIKLLQKAIKLLEDKPGQQSTVAGIEARLGVM  438

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +Y+VGRY+E+R +FES ++KLR   ERKSAFFGVVLNQMGL+CVQLFKIDEA ELFEEAR
Sbjct  439  YYVVGRYEESRGAFESGISKLRGGNERKSAFFGVVLNQMGLACVQLFKIDEAVELFEEAR  498

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMG-RVEDAIEILEYVLKLREEKLGTANPDFDDE  361
            EILE E GPCHQDTLGVYSNLAATYDAMG R++DAIEILEY+LKLREEKLGTANPDFDDE
Sbjct  499  EILEQENGPCHQDTLGVYSNLAATYDAMGSRIDDAIEILEYILKLREEKLGTANPDFDDE  558

Query  360  KKRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESS----KKWSAFGFRS  217
            KKRL ELLKEAG+SRNKKAKSLENLIDPNSKRTKK+++    +KWSAFGFRS
Sbjct  559  KKRLIELLKEAGRSRNKKAKSLENLIDPNSKRTKKDAAAAAPRKWSAFGFRS  610



>ref|XP_004300493.1| PREDICTED: nephrocystin-3 [Fragaria vesca subsp. vesca]
Length=603

 Score =   369 bits (947),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 190/227 (84%), Positives = 212/227 (93%), Gaps = 1/227 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTT+EEI+SG+TEISAIYE  +EPEEALKLL KA+ LLEDKPGQQSTIAGIEARMGVM
Sbjct  376  VPGTTAEEISSGLTEISAIYESIDEPEEALKLLQKAMSLLEDKPGQQSTIAGIEARMGVM  435

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            + M+GRY+EARSSF SA+AKLRASGE+KS FFGVVLNQMGL+CVQLFKIDEA ELFEEAR
Sbjct  436  YCMLGRYEEARSSFGSAIAKLRASGEKKSPFFGVVLNQMGLACVQLFKIDEAGELFEEAR  495

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE ECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLG ANPDF+DEK
Sbjct  496  SILEKECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGIANPDFEDEK  555

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKR-TKKESSKKWSAFGFR  220
            +RL+ELLKEAG+ R+KKAKSLENLIDPNSK+ TKKE +++W++ GFR
Sbjct  556  RRLSELLKEAGRKRDKKAKSLENLIDPNSKKTTKKEGTRRWASLGFR  602



>ref|XP_008367901.1| PREDICTED: nephrocystin-3-like [Malus domestica]
Length=598

 Score =   365 bits (936),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 190/228 (83%), Positives = 211/228 (93%), Gaps = 2/228 (1%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTT+EEI+ G+TEISAIYE  +EPEEALKLL KA+KLLE KPGQQSTIAGIEARMGVM
Sbjct  370  VPGTTAEEISGGLTEISAIYESMDEPEEALKLLQKAMKLLEGKPGQQSTIAGIEARMGVM  429

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            F M+GRY+EAR+SFESAV KLRASGE+KS FFGVVLNQMGL+CVQLFKIDEAAELFEEAR
Sbjct  430  FCMLGRYEEARNSFESAVTKLRASGEKKSPFFGVVLNQMGLACVQLFKIDEAAELFEEAR  489

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE ECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLG ANPDF+DEK
Sbjct  490  RILEQECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGIANPDFEDEK  549

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPN--SKRTKKESSKKWSAFGFR  220
            +RL+ELLKEAG++R++KAKSLENLIDPN  SK+T+KE +KKW A  F+
Sbjct  550  RRLSELLKEAGRTRDRKAKSLENLIDPNSTSKKTRKEGTKKWGALSFK  597



>ref|XP_010267540.1| PREDICTED: uncharacterized protein LOC104604745 [Nelumbo nucifera]
Length=601

 Score =   360 bits (923),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 185/227 (81%), Positives = 207/227 (91%), Gaps = 0/227 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTT+EEI+SG+TEISAIYE  NEP+EALKLL KA+KLLED PGQ+STIAGIEA+MGVM
Sbjct  375  VPGTTAEEISSGLTEISAIYEAVNEPDEALKLLQKAMKLLEDTPGQRSTIAGIEAQMGVM  434

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            FYMV RY EAR SFESA+AKLRASGERKSA  G+VLNQMGL+CVQL+KIDEAAELF+EAR
Sbjct  435  FYMVRRYGEARHSFESAIAKLRASGERKSAVLGIVLNQMGLACVQLYKIDEAAELFQEAR  494

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE ECGP H DTLGVYSNLAATYDAMGRVEDAIEILEY+LK REEKLGTANPD DDEK
Sbjct  495  RILEQECGPYHPDTLGVYSNLAATYDAMGRVEDAIEILEYILKAREEKLGTANPDVDDEK  554

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFRS  217
            KRLAELLKEAG++RN+KAKSLENL+D NS+R KKE +K+W + GFR+
Sbjct  555  KRLAELLKEAGRARNRKAKSLENLLDSNSQRMKKEVTKRWPSLGFRT  601



>ref|XP_008451914.1| PREDICTED: LOW QUALITY PROTEIN: nephrocystin-3-like [Cucumis 
melo]
Length=593

 Score =   358 bits (918),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 190/226 (84%), Positives = 214/226 (95%), Gaps = 0/226 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGT+ EEIA G+TEISAIYE  +EPEEALKLL KA+K+LEDKPGQQSTIAGIEARMGVM
Sbjct  367  VPGTSPEEIAGGLTEISAIYESVDEPEEALKLLQKAMKMLEDKPGQQSTIAGIEARMGVM  426

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            FYMVGRY++AR++FESA++KLRA+GERKSAFFGVVLNQMGL+CVQLFKIDEAAELFEEAR
Sbjct  427  FYMVGRYEDARNAFESAISKLRATGERKSAFFGVVLNQMGLACVQLFKIDEAAELFEEAR  486

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE ECG CHQDT+GVYSNLAATYDAMGRV+DAIEILE VLKLREEKLG ANPDF+DEK
Sbjct  487  GILEQECGNCHQDTIGVYSNLAATYDAMGRVDDAIEILESVLKLREEKLGIANPDFEDEK  546

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFR  220
            +RLAELLKEAG++RN+KAKSLENLIDPNS++TKKE++KKWS  GFR
Sbjct  547  RRLAELLKEAGRTRNRKAKSLENLIDPNSRKTKKETTKKWSGLGFR  592



>ref|XP_010266592.1| PREDICTED: uncharacterized protein LOC104604058 [Nelumbo nucifera]
Length=604

 Score =   357 bits (917),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 182/227 (80%), Positives = 207/227 (91%), Gaps = 0/227 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTT+EEI+SG+TE+SAIYE  NEP+EALKLL KA+ LLED PGQ+STIAGIEA+MGVM
Sbjct  378  VPGTTAEEISSGLTEVSAIYEAVNEPDEALKLLQKAMNLLEDTPGQRSTIAGIEAQMGVM  437

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            FYMVGR++EARSSFESAV KLRASGERKS+FFG+VLNQMGL+CVQL+KIDEAAELFEEAR
Sbjct  438  FYMVGRHEEARSSFESAVTKLRASGERKSSFFGIVLNQMGLACVQLYKIDEAAELFEEAR  497

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE ECGP H DTLGVYSNLAATYDAMGRVEDAIE+LEY+LK REEKLGTANPD +DEK
Sbjct  498  GILEQECGPYHPDTLGVYSNLAATYDAMGRVEDAIEVLEYILKAREEKLGTANPDVEDEK  557

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFRS  217
            KRLAELLKEAG+SRN+KAKSL NL D  S+R +KE +++WS  GF+S
Sbjct  558  KRLAELLKEAGRSRNRKAKSLVNLFDTTSQRMRKEVTRRWSGLGFKS  604



>emb|CAN83879.1| hypothetical protein VITISV_021292 [Vitis vinifera]
Length=315

 Score =   347 bits (889),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 178/227 (78%), Positives = 202/227 (89%), Gaps = 0/227 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTT EEIA+G+TEISAIYE  NEPEEAL+LL KA+KLLED P  +STI GIEA+MGVM
Sbjct  89   VPGTTPEEIANGLTEISAIYEAVNEPEEALRLLQKAMKLLEDTPAHRSTITGIEAQMGVM  148

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            FYMVGRY EAR+SFES +AKL+ASGERKS+FFG+VLNQMGL+CVQL+KIDEAAELFEEAR
Sbjct  149  FYMVGRYGEARASFESVIAKLQASGERKSSFFGIVLNQMGLACVQLYKIDEAAELFEEAR  208

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE ECGP H DTLGVYSNLAATYDAMGRVEDAIEILEY+LK+REEKLGTANPD DDEK
Sbjct  209  GILEQECGPYHLDTLGVYSNLAATYDAMGRVEDAIEILEYILKVREEKLGTANPDVDDEK  268

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFRS  217
            KRL ELLK+AG+ RN+K KSLENL+  N +  KKE +K+WS FGF++
Sbjct  269  KRLTELLKQAGRVRNRKGKSLENLLVSNPQGMKKEGTKRWSGFGFKT  315



>ref|XP_007051512.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma 
cacao]
 gb|EOX95669.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma 
cacao]
Length=576

 Score =   352 bits (903),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 182/227 (80%), Positives = 206/227 (91%), Gaps = 0/227 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTTSEEIASG+TE+SAIYE  +EPEEALKLL KA++LLED PG +STIAGIEA+MGVM
Sbjct  350  VPGTTSEEIASGLTELSAIYEALDEPEEALKLLQKAMRLLEDTPGNRSTIAGIEAQMGVM  409

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            FYMVGRY EARSSFESAVAKLRASGE KSA FG+VLNQMGL+ VQL++IDEA ELF EAR
Sbjct  410  FYMVGRYGEARSSFESAVAKLRASGESKSALFGIVLNQMGLASVQLYRIDEAVELFGEAR  469

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
            +ILE ECGPCH +TLGVYSNLAATYDAMGRVEDAIEILEY+LK+REEKLGTANP+ DDEK
Sbjct  470  KILEQECGPCHLETLGVYSNLAATYDAMGRVEDAIEILEYILKMREEKLGTANPEVDDEK  529

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFRS  217
            KRLA LLKEAG++RN+K KSLENL+  NS +TKK S+K+W+ FGFRS
Sbjct  530  KRLAALLKEAGRTRNRKGKSLENLLGTNSYKTKKGSAKRWATFGFRS  576



>ref|XP_009358645.1| PREDICTED: uncharacterized protein LOC103949268 isoform X1 [Pyrus 
x bretschneideri]
Length=598

 Score =   352 bits (903),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 189/228 (83%), Positives = 210/228 (92%), Gaps = 2/228 (1%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTT+EE++ G+TEISAIYE  +EP EALKLL KA+KLLEDKPGQQSTIAGIEARMGVM
Sbjct  370  VPGTTAEEVSGGLTEISAIYESMDEPGEALKLLQKAMKLLEDKPGQQSTIAGIEARMGVM  429

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            F M+GRY+EARSSFESAV KLRASGE+KS FFGVVLNQMGL+CVQLFKIDEAAELFEEAR
Sbjct  430  FCMLGRYEEARSSFESAVTKLRASGEKKSPFFGVVLNQMGLACVQLFKIDEAAELFEEAR  489

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE ECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLG ANPDF+DEK
Sbjct  490  RILEQECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGIANPDFEDEK  549

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNS--KRTKKESSKKWSAFGFR  220
            +RL+ELLKEAG++R++KAKSLENLIDPNS  K+TKKE +K+W    F+
Sbjct  550  RRLSELLKEAGRTRDRKAKSLENLIDPNSTTKKTKKEGTKRWGGLSFK  597



>ref|XP_009358646.1| PREDICTED: uncharacterized protein LOC103949268 isoform X2 [Pyrus 
x bretschneideri]
Length=598

 Score =   352 bits (903),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 189/228 (83%), Positives = 210/228 (92%), Gaps = 2/228 (1%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTT+EE++ G+TEISAIYE  +EP EALKLL KA+KLLEDKPGQQSTIAGIEARMGVM
Sbjct  370  VPGTTAEEVSGGLTEISAIYESMDEPGEALKLLQKAMKLLEDKPGQQSTIAGIEARMGVM  429

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            F M+GRY+EARSSFESAV KLRASGE+KS FFGVVLNQMGL+CVQLFKIDEAAELFEEAR
Sbjct  430  FCMLGRYEEARSSFESAVTKLRASGEKKSPFFGVVLNQMGLACVQLFKIDEAAELFEEAR  489

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE ECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLG ANPDF+DEK
Sbjct  490  RILEQECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGIANPDFEDEK  549

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNS--KRTKKESSKKWSAFGFR  220
            +RL+ELLKEAG++R++KAKSLENLIDPNS  K+TKKE +K+W    F+
Sbjct  550  RRLSELLKEAGRTRDRKAKSLENLIDPNSTTKKTKKEGTKRWGGLSFK  597



>ref|XP_009344036.1| PREDICTED: kinesin light chain-like [Pyrus x bretschneideri]
 ref|XP_009347911.1| PREDICTED: kinesin light chain-like [Pyrus x bretschneideri]
Length=597

 Score =   349 bits (895),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 186/228 (82%), Positives = 207/228 (91%), Gaps = 3/228 (1%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTT+EEI+ G+TEISAIYE  +EPEEALKLL KA+KLLE KPGQQSTIAGIEARMGVM
Sbjct  370  VPGTTAEEISGGLTEISAIYESMDEPEEALKLLQKAMKLLEGKPGQQSTIAGIEARMGVM  429

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            F M+GRY+EAR+SFESAV KLRASGE KS FFGVVLNQMGL+CVQLFKIDEAAELFEEAR
Sbjct  430  FCMLGRYEEARNSFESAVTKLRASGE-KSPFFGVVLNQMGLACVQLFKIDEAAELFEEAR  488

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE ECGPCHQD+LGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLG ANPDF DEK
Sbjct  489  RILEQECGPCHQDSLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGIANPDFADEK  548

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPN--SKRTKKESSKKWSAFGFR  220
             RL+ELLKEAG++R++KAKSLENLI+ N  SK+T+KE +K+W A  F+
Sbjct  549  GRLSELLKEAGRTRDRKAKSLENLIESNSTSKKTRKEGTKRWGALSFK  596



>ref|XP_006287252.1| hypothetical protein CARUB_v10000441mg, partial [Capsella rubella]
 gb|EOA20150.1| hypothetical protein CARUB_v10000441mg, partial [Capsella rubella]
Length=640

 Score =   350 bits (898),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 187/227 (82%), Positives = 207/227 (91%), Gaps = 2/227 (1%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTT EEIA G+TEISAIYE  +EPEEALKLL K++KLLEDKPGQQS IAG+EARMGVM
Sbjct  414  VPGTTVEEIAGGLTEISAIYESVDEPEEALKLLQKSMKLLEDKPGQQSAIAGLEARMGVM  473

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +Y +GRY++AR+SFESAV KLRA+GE KSAFFGVVLNQMGL+CVQLFKIDEA ELFEEAR
Sbjct  474  YYTLGRYEDARNSFESAVTKLRAAGE-KSAFFGVVLNQMGLACVQLFKIDEAGELFEEAR  532

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE E GPC QDTLGVYSNLAATYDAMGR+EDAIEILE VLKLREEKLGTANPDF+DEK
Sbjct  533  GILEQERGPCDQDTLGVYSNLAATYDAMGRIEDAIEILEQVLKLREEKLGTANPDFEDEK  592

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESS-KKWSAFGFR  220
            KRLAELLKEAG+SRN KAKSL+NLIDPN++ TKKESS KKW + GF+
Sbjct  593  KRLAELLKEAGRSRNYKAKSLQNLIDPNARPTKKESSAKKWPSLGFK  639



>gb|AAM63491.1| putative kinesin light chain [Arabidopsis thaliana]
Length=606

 Score =   348 bits (892),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 186/227 (82%), Positives = 206/227 (91%), Gaps = 2/227 (1%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTT EEIA G+TEISAIYE  +EPEEALKLL K++KLLEDKPGQQS IAG+EARMGVM
Sbjct  380  VPGTTVEEIAGGLTEISAIYESVDEPEEALKLLQKSMKLLEDKPGQQSAIAGLEARMGVM  439

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +Y VGRY++AR++FESAV KLRA+GE KSAFFGVVLNQMGL+CVQLFKIDEA ELFEEAR
Sbjct  440  YYTVGRYEDARNAFESAVTKLRAAGE-KSAFFGVVLNQMGLACVQLFKIDEAGELFEEAR  498

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE E GPC QDTLGVYSNLAATYDAMGR+EDAIEILE VLKLREEKLGTANPDF+DEK
Sbjct  499  GILEQERGPCDQDTLGVYSNLAATYDAMGRIEDAIEILEQVLKLREEKLGTANPDFEDEK  558

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESS-KKWSAFGFR  220
            KRLAELLKEAG+SRN KAKSL+NLIDPN++  KKESS KKW + GF+
Sbjct  559  KRLAELLKEAGRSRNYKAKSLQNLIDPNARPPKKESSAKKWPSLGFK  605



>ref|NP_192822.1| protein KINESIN LIGHT CHAIN-RELATED 1 [Arabidopsis thaliana]
 gb|AAC33943.1| contains similarity to TPR domains (Pfam: TPR.hmm: score: 11.15) 
and kinesin motor domains (Pfam: kinesin2.hmm, score: 17.49, 
20.52 and 10.94) [Arabidopsis thaliana]
 emb|CAB40052.1| putative protein [Arabidopsis thaliana]
 emb|CAB81185.1| putative protein [Arabidopsis thaliana]
 gb|AAL59992.1| unknown protein [Arabidopsis thaliana]
 gb|AAL91265.1| AT4g10840/F25I24_50 [Arabidopsis thaliana]
 gb|AAN41387.1| unknown protein [Arabidopsis thaliana]
 gb|AEE82933.1| tetratricopeptide repeat domain-containing protein [Arabidopsis 
thaliana]
Length=609

 Score =   348 bits (892),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 186/227 (82%), Positives = 206/227 (91%), Gaps = 2/227 (1%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTT EEIA G+TEISAIYE  +EPEEALKLL K++KLLEDKPGQQS IAG+EARMGVM
Sbjct  383  VPGTTVEEIAGGLTEISAIYESVDEPEEALKLLQKSMKLLEDKPGQQSAIAGLEARMGVM  442

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +Y VGRY++AR++FESAV KLRA+GE KSAFFGVVLNQMGL+CVQLFKIDEA ELFEEAR
Sbjct  443  YYTVGRYEDARNAFESAVTKLRAAGE-KSAFFGVVLNQMGLACVQLFKIDEAGELFEEAR  501

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE E GPC QDTLGVYSNLAATYDAMGR+EDAIEILE VLKLREEKLGTANPDF+DEK
Sbjct  502  GILEQERGPCDQDTLGVYSNLAATYDAMGRIEDAIEILEQVLKLREEKLGTANPDFEDEK  561

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESS-KKWSAFGFR  220
            KRLAELLKEAG+SRN KAKSL+NLIDPN++  KKESS KKW + GF+
Sbjct  562  KRLAELLKEAGRSRNYKAKSLQNLIDPNARPPKKESSAKKWPSLGFK  608



>ref|XP_002264247.1| PREDICTED: uncharacterized protein LOC100267266 [Vitis vinifera]
 emb|CBI40572.3| unnamed protein product [Vitis vinifera]
Length=596

 Score =   346 bits (888),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 178/227 (78%), Positives = 202/227 (89%), Gaps = 0/227 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTT EEIA+G+TEISAIYE  NEPEEAL+LL KA+KLLED P  +STI GIEA+MGVM
Sbjct  370  VPGTTPEEIANGLTEISAIYEAVNEPEEALRLLQKAMKLLEDTPAHRSTITGIEAQMGVM  429

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            FYMVGRY EAR+SFES +AKL+ASGERKS+FFG+VLNQMGL+CVQL+KIDEAAELFEEAR
Sbjct  430  FYMVGRYGEARASFESVIAKLQASGERKSSFFGIVLNQMGLACVQLYKIDEAAELFEEAR  489

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE ECGP H DTLGVYSNLAATYDAMGRVEDAIEILEY+LK+REEKLGTANPD DDEK
Sbjct  490  GILEQECGPYHLDTLGVYSNLAATYDAMGRVEDAIEILEYILKVREEKLGTANPDVDDEK  549

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFRS  217
            KRL ELLK+AG+ RN+K KSLENL+  N +  KKE +K+WS FGF++
Sbjct  550  KRLTELLKQAGRVRNRKGKSLENLLVSNPQGMKKEGTKRWSGFGFKT  596



>ref|XP_010422007.1| PREDICTED: uncharacterized protein LOC104707372 [Camelina sativa]
Length=610

 Score =   347 bits (889),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 185/227 (81%), Positives = 206/227 (91%), Gaps = 2/227 (1%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTT EEIA G+TEISAIYE  +EPEEALKLL K++KLLEDKPGQQS IAG+EARMGVM
Sbjct  384  VPGTTVEEIAGGLTEISAIYESVDEPEEALKLLQKSMKLLEDKPGQQSAIAGLEARMGVM  443

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +Y +GRY++AR++FESAV KLRA+GE KSAFFGVVLNQMGL+CVQLFKIDEA ELFEEAR
Sbjct  444  YYTLGRYEDARNAFESAVTKLRAAGE-KSAFFGVVLNQMGLACVQLFKIDEAGELFEEAR  502

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE E GPC QDTLGVYSNLAATYDAMGR+EDAIEILE VLKLREEKLGTANPDF+DEK
Sbjct  503  GILEQERGPCDQDTLGVYSNLAATYDAMGRIEDAIEILEQVLKLREEKLGTANPDFEDEK  562

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESS-KKWSAFGFR  220
            KRLAELLKEAG+SRN KAKSL+NLIDPN++  KKESS KKW + GF+
Sbjct  563  KRLAELLKEAGRSRNYKAKSLQNLIDPNARPAKKESSAKKWPSLGFK  609



>ref|XP_010436694.1| PREDICTED: uncharacterized protein LOC104720497 [Camelina sativa]
Length=610

 Score =   347 bits (889),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 185/227 (81%), Positives = 206/227 (91%), Gaps = 2/227 (1%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTT EEIA G+TEISAIYE  +EPEEALKLL K++KLLEDKPGQQS IAG+EARMGVM
Sbjct  384  VPGTTVEEIAGGLTEISAIYESVDEPEEALKLLQKSMKLLEDKPGQQSAIAGLEARMGVM  443

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +Y +GRY++AR++FESAV KLRA+GE KSAFFGVVLNQMGL+CVQLFKIDEA ELFEEAR
Sbjct  444  YYTLGRYEDARNAFESAVTKLRAAGE-KSAFFGVVLNQMGLACVQLFKIDEAGELFEEAR  502

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE E GPC QDTLGVYSNLAATYDAMGR+EDAIEILE VLKLREEKLGTANPDF+DEK
Sbjct  503  GILEQERGPCDQDTLGVYSNLAATYDAMGRIEDAIEILEQVLKLREEKLGTANPDFEDEK  562

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESS-KKWSAFGFR  220
            KRLAELLKEAG+SRN KAKSL+NLIDPN++  KKESS KKW + GF+
Sbjct  563  KRLAELLKEAGRSRNYKAKSLQNLIDPNARPAKKESSAKKWPSLGFK  609



>ref|XP_002872538.1| hypothetical protein ARALYDRAFT_489926 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48797.1| hypothetical protein ARALYDRAFT_489926 [Arabidopsis lyrata subsp. 
lyrata]
Length=608

 Score =   346 bits (887),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 185/227 (81%), Positives = 206/227 (91%), Gaps = 2/227 (1%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTT EEIA G+TEISAIYE  +EPEEALKLL K++KLLEDKPGQQS IAG+EARMGVM
Sbjct  382  VPGTTVEEIAGGLTEISAIYESVDEPEEALKLLQKSMKLLEDKPGQQSAIAGLEARMGVM  441

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +Y +GRY++AR++FESAV KLRA+GE KSAFFGVVLNQMGL+CVQLFKIDEA ELFEEAR
Sbjct  442  YYTLGRYEDARNAFESAVTKLRAAGE-KSAFFGVVLNQMGLACVQLFKIDEAGELFEEAR  500

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE E GPC QDTLGVYSNLAATYDAMGR+EDAIEILE VLKLREEKLGTANPDF+DEK
Sbjct  501  GILEQERGPCDQDTLGVYSNLAATYDAMGRIEDAIEILEQVLKLREEKLGTANPDFEDEK  560

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESS-KKWSAFGFR  220
            KRLAELLKEAG+SRN KAKSL+NLIDPN++  KKESS KKW + GF+
Sbjct  561  KRLAELLKEAGRSRNYKAKSLQNLIDPNARPPKKESSAKKWPSLGFK  607



>gb|KFK31862.1| hypothetical protein AALP_AA6G167900 [Arabis alpina]
Length=610

 Score =   346 bits (887),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 185/227 (81%), Positives = 206/227 (91%), Gaps = 2/227 (1%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTT EEIA G+TEISAIYE  +EPEEALKLL K++KLLEDKPGQQS IAG+EARMGVM
Sbjct  384  VPGTTVEEIAGGLTEISAIYESVDEPEEALKLLQKSMKLLEDKPGQQSAIAGLEARMGVM  443

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +Y +GRY++AR++FESAV KLRA+GE KSAFFGVVLNQMGL+CVQLFKIDEA ELFEEAR
Sbjct  444  YYTLGRYEDARNAFESAVIKLRAAGE-KSAFFGVVLNQMGLACVQLFKIDEAGELFEEAR  502

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE E GPC QDTLGVYSNLAATYDAMGR+EDAIEILE VLKLREEKLGTANPDF+DEK
Sbjct  503  VILEQERGPCDQDTLGVYSNLAATYDAMGRIEDAIEILEQVLKLREEKLGTANPDFEDEK  562

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESS-KKWSAFGFR  220
            KRLAELLKEAG+SRN KAKSL+NLIDPN++  KKESS KKW + GF+
Sbjct  563  KRLAELLKEAGRSRNYKAKSLQNLIDPNARPAKKESSAKKWPSLGFK  609



>emb|CDX90788.1| BnaA03g24680D [Brassica napus]
Length=606

 Score =   345 bits (885),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 184/227 (81%), Positives = 205/227 (90%), Gaps = 2/227 (1%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTT EEIA G+TEISAIYE  +EPEEALKLL K++KLLEDKPGQQS IAG+EARMGVM
Sbjct  380  VPGTTVEEIAGGLTEISAIYESVDEPEEALKLLQKSMKLLEDKPGQQSAIAGLEARMGVM  439

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +Y +GRY++AR++FESAV KLRA+GE KSAFFGVVLNQMGL+CVQLFKIDEA ELFEEAR
Sbjct  440  YYTLGRYEDARNAFESAVTKLRAAGE-KSAFFGVVLNQMGLACVQLFKIDEAGELFEEAR  498

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE E GPC QDTLGVYSNLAATYDAMGR+EDAIEILE VLKLREEKLGTANPDF+DEK
Sbjct  499  VILEQERGPCDQDTLGVYSNLAATYDAMGRIEDAIEILEQVLKLREEKLGTANPDFEDEK  558

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESS-KKWSAFGFR  220
            KRLAELLKEAG+SRN KAKSL+NLIDPN++  KKE+S KKW   GF+
Sbjct  559  KRLAELLKEAGRSRNYKAKSLQNLIDPNARPPKKEASGKKWPGLGFK  605



>ref|XP_010915164.1| PREDICTED: kinesin light chain-like [Elaeis guineensis]
Length=601

 Score =   345 bits (884),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 179/227 (79%), Positives = 201/227 (89%), Gaps = 0/227 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VP T+ E+IA G+ EISAIYE  NEPEEALKLL KALK LED PGQ ST+AGIEA+MGVM
Sbjct  375  VPATSPEDIAGGLMEISAIYEAMNEPEEALKLLQKALKQLEDSPGQWSTVAGIEAQMGVM  434

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +YMVGRY E+RSSFESAVAKLRA+GE+KSAFFGVVLNQMGL+CVQLFKIDEAAELFEEAR
Sbjct  435  YYMVGRYGESRSSFESAVAKLRATGEKKSAFFGVVLNQMGLACVQLFKIDEAAELFEEAR  494

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE ECG  H DTLGVYSNLAATYDAMGRVEDAIEILEYVLK+REEKLGTANPD +DE+
Sbjct  495  AILEQECGSAHPDTLGVYSNLAATYDAMGRVEDAIEILEYVLKVREEKLGTANPDVEDER  554

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFRS  217
            KRLAELLKEAG+ RN+K  SLENL+  NS+R KKE +++WS  GF++
Sbjct  555  KRLAELLKEAGRVRNRKLASLENLMVTNSQRVKKEGARRWSGLGFKT  601



>ref|XP_009421472.1| PREDICTED: uncharacterized protein LOC104001021 [Musa acuminata 
subsp. malaccensis]
Length=620

 Score =   345 bits (885),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 179/227 (79%), Positives = 204/227 (90%), Gaps = 0/227 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPG+++E+IA GM EI+AIYE  NEP+EALKLL KALKL+ED PGQ ST+AGIEA+MGVM
Sbjct  394  VPGSSNEDIAGGMMEIAAIYEAMNEPDEALKLLQKALKLMEDAPGQWSTVAGIEAQMGVM  453

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +YMVG+Y EARSSFESAVAKLRASGERKSAFFGV+LNQMGL+CVQLFKIDEAA LFEEAR
Sbjct  454  YYMVGKYGEARSSFESAVAKLRASGERKSAFFGVLLNQMGLACVQLFKIDEAAALFEEAR  513

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             +LE ECG  H DTLGVYSNLAATYDAMGRV +AIEILE+VLKLREEKLGTANPD DDEK
Sbjct  514  AVLEQECGTSHPDTLGVYSNLAATYDAMGRVGEAIEILEHVLKLREEKLGTANPDVDDEK  573

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFRS  217
            KRLAELLKEAG+SRN+K KSLENL+  NS+R +KE +++WS  GF+S
Sbjct  574  KRLAELLKEAGRSRNRKPKSLENLLVTNSQRIRKEVTRRWSGLGFKS  620



>ref|XP_009134209.1| PREDICTED: nephrocystin-3 [Brassica rapa]
Length=608

 Score =   345 bits (884),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 184/227 (81%), Positives = 205/227 (90%), Gaps = 2/227 (1%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTT EEIA G+TEISAIYE  +EPEEALKLL K++KLLEDKPGQQS IAG+EARMGVM
Sbjct  382  VPGTTVEEIAGGLTEISAIYESVDEPEEALKLLQKSMKLLEDKPGQQSAIAGLEARMGVM  441

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +Y +GRY++AR++FESAV KLRA+GE KSAFFGVVLNQMGL+CVQLFKIDEA ELFEEAR
Sbjct  442  YYTLGRYEDARNAFESAVTKLRAAGE-KSAFFGVVLNQMGLACVQLFKIDEAGELFEEAR  500

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE E GPC QDTLGVYSNLAATYDAMGR+EDAIEILE VLKLREEKLGTANPDF+DEK
Sbjct  501  VILEQERGPCDQDTLGVYSNLAATYDAMGRIEDAIEILEQVLKLREEKLGTANPDFEDEK  560

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESS-KKWSAFGFR  220
            KRLAELLKEAG+SRN KAKSL+NLIDPN++  KKE+S KKW   GF+
Sbjct  561  KRLAELLKEAGRSRNYKAKSLQNLIDPNARPPKKEASGKKWPGLGFK  607



>emb|CDY05122.1| BnaC03g29200D [Brassica napus]
Length=607

 Score =   345 bits (884),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 184/227 (81%), Positives = 205/227 (90%), Gaps = 2/227 (1%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTT EEIA G+TEISAIYE  +EPEEALKLL K++KLLEDKPGQQS IAG+EARMGVM
Sbjct  381  VPGTTVEEIAGGLTEISAIYESVDEPEEALKLLQKSMKLLEDKPGQQSAIAGLEARMGVM  440

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +Y +GRY++AR++FESAV KLRA+GE KSAFFGVVLNQMGL+CVQLFKIDEA ELFEEAR
Sbjct  441  YYTLGRYEDARNAFESAVTKLRAAGE-KSAFFGVVLNQMGLACVQLFKIDEAGELFEEAR  499

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE E GPC QDTLGVYSNLAATYDAMGR+EDAIEILE VLKLREEKLGTANPDF+DEK
Sbjct  500  GILEQERGPCDQDTLGVYSNLAATYDAMGRIEDAIEILEQVLKLREEKLGTANPDFEDEK  559

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESS-KKWSAFGFR  220
            KRLAELLKEAG+SRN KAKSL+NLIDPN++  KKE+S KKW   GF+
Sbjct  560  KRLAELLKEAGRSRNYKAKSLQNLIDPNARPPKKEASGKKWPGLGFK  606



>ref|XP_006396997.1| hypothetical protein EUTSA_v10028519mg [Eutrema salsugineum]
 gb|ESQ38450.1| hypothetical protein EUTSA_v10028519mg [Eutrema salsugineum]
Length=610

 Score =   345 bits (884),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 184/227 (81%), Positives = 206/227 (91%), Gaps = 2/227 (1%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTT EEIA G+TEISAIYE  +EPEEALKLL K++KLLEDKPGQQS IAG+EARMGVM
Sbjct  384  VPGTTVEEIAGGLTEISAIYESVDEPEEALKLLQKSMKLLEDKPGQQSAIAGLEARMGVM  443

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +Y +GRY++AR++FE+AV KLRA+GE KSAFFGVVLNQMGL+CVQLFKIDEA ELFEEAR
Sbjct  444  YYTLGRYEDARNAFENAVTKLRAAGE-KSAFFGVVLNQMGLACVQLFKIDEAGELFEEAR  502

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE E GPC QDTLGVYSNLAATYDAMGR+EDAIEILE VLKLREEKLGTANPDF+DEK
Sbjct  503  GILEQERGPCDQDTLGVYSNLAATYDAMGRIEDAIEILEQVLKLREEKLGTANPDFEDEK  562

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESS-KKWSAFGFR  220
            KRLAELLKEAG+SRN KAKSL+NLIDPN++  KKESS KKW + GF+
Sbjct  563  KRLAELLKEAGRSRNYKAKSLQNLIDPNARPAKKESSAKKWHSLGFK  609



>ref|XP_008337561.1| PREDICTED: nephrocystin-3-like [Malus domestica]
Length=598

 Score =   344 bits (882),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 187/228 (82%), Positives = 208/228 (91%), Gaps = 2/228 (1%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTTSEEI+ G+TEISAIYE  +EP EALKLL KA+KLLEDKPGQQSTIAGIEARMGVM
Sbjct  370  VPGTTSEEISGGLTEISAIYESMDEPGEALKLLQKAMKLLEDKPGQQSTIAGIEARMGVM  429

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            F M+GRY+EAR+SFESAV KLRASGE+KS FFGVVLNQMGL+CVQLFKIDEAAELFEEAR
Sbjct  430  FCMLGRYEEARNSFESAVTKLRASGEKKSPFFGVVLNQMGLACVQLFKIDEAAELFEEAR  489

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE ECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLG ANPDF+DEK
Sbjct  490  RILEQECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGIANPDFEDEK  549

Query  357  KRLAELLKEAGKSRNKKAKSLENLID--PNSKRTKKESSKKWSAFGFR  220
            +RL+ELLKEAG++R++KAKSLENLID    +K+TKKE +K+W    F+
Sbjct  550  RRLSELLKEAGRTRDRKAKSLENLIDTNSTTKKTKKEGTKRWGGLSFK  597



>gb|KJB09631.1| hypothetical protein B456_001G153600 [Gossypium raimondii]
Length=569

 Score =   343 bits (879),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 180/227 (79%), Positives = 205/227 (90%), Gaps = 2/227 (1%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTTSEEIASG+TE+SAIYE  +E EEAL+LL KA+KLLED PG +STIAGIEA+MGVM
Sbjct  345  VPGTTSEEIASGLTEVSAIYESLDEIEEALRLLEKAVKLLEDTPGNRSTIAGIEAQMGVM  404

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            FYMVGRY +AR SFE+AVAKLRASGE KSAFFG+VLNQMGL+ VQL++IDEA ELFEEAR
Sbjct  405  FYMVGRYGDARISFENAVAKLRASGESKSAFFGIVLNQMGLASVQLYRIDEAIELFEEAR  464

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
            +ILE ECGPCH +TLGVYSNLAATYDA+GRVEDAIEILEY+LK+REEKLGTANPD DDEK
Sbjct  465  KILEQECGPCHLETLGVYSNLAATYDAIGRVEDAIEILEYILKMREEKLGTANPDVDDEK  524

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFRS  217
            KRLAELLKEAG++RN+K KSLE L+D  S   KKES+K+WS FGFR+
Sbjct  525  KRLAELLKEAGRTRNRKGKSLEKLLDARS--AKKESAKRWSTFGFRT  569



>ref|XP_010455474.1| PREDICTED: kinesin light chain-like isoform X1 [Camelina sativa]
 ref|XP_010455475.1| PREDICTED: kinesin light chain-like isoform X2 [Camelina sativa]
Length=610

 Score =   344 bits (883),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 185/227 (81%), Positives = 206/227 (91%), Gaps = 2/227 (1%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTT EEIA G+TEISAIYE  +EPEEALKLL K++KLLEDKPGQQS IAG+EARMGVM
Sbjct  384  VPGTTVEEIAGGLTEISAIYESVDEPEEALKLLQKSMKLLEDKPGQQSAIAGLEARMGVM  443

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +Y +GRY++AR++FESAV KLRA+GE KSAFFGVVLNQMGL+CVQLFKIDEA ELFEEAR
Sbjct  444  YYTLGRYEDARNAFESAVTKLRAAGE-KSAFFGVVLNQMGLACVQLFKIDEAGELFEEAR  502

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE E GPC QDTLGVYSNLAATYDAMGR+EDAIEILE VLKLREEKLGTANPDF+DEK
Sbjct  503  GILELERGPCDQDTLGVYSNLAATYDAMGRIEDAIEILEQVLKLREEKLGTANPDFEDEK  562

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESS-KKWSAFGFR  220
            KRLAELLKEAG+SRN KAKSL+NLIDPN++  KKESS KKW + GF+
Sbjct  563  KRLAELLKEAGRSRNYKAKSLQNLIDPNARPAKKESSAKKWPSLGFK  609



>gb|KHG17048.1| Nephrocystin-3 [Gossypium arboreum]
Length=569

 Score =   341 bits (875),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 178/227 (78%), Positives = 206/227 (91%), Gaps = 2/227 (1%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTTSEEIASG+TE+SAIYE  +E EEAL+LL KA+KLLED PG +STIAGIEA+MGVM
Sbjct  345  VPGTTSEEIASGLTEVSAIYESLDEIEEALRLLEKAVKLLEDTPGNRSTIAGIEAQMGVM  404

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            FYMVGRY +AR+SF++AVAKLRASGE KSAFFG+VLNQMGL+ VQL++IDEA ELFEEAR
Sbjct  405  FYMVGRYGDARNSFQNAVAKLRASGESKSAFFGIVLNQMGLASVQLYRIDEAIELFEEAR  464

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
            +ILE ECGPCH +TLGVYSNLAATYDA+GRVEDAIEILEY+LK+REEKLGTANP+ DDEK
Sbjct  465  KILEQECGPCHLETLGVYSNLAATYDAIGRVEDAIEILEYILKMREEKLGTANPEVDDEK  524

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFRS  217
            KRLAELLKEAG++RN+K KSLE L+D  S   KKES+K+WS FGFR+
Sbjct  525  KRLAELLKEAGRTRNRKGKSLEKLLDARS--AKKESAKRWSTFGFRT  569



>ref|XP_008795620.1| PREDICTED: kinesin light chain 4-like isoform X1 [Phoenix dactylifera]
Length=601

 Score =   339 bits (870),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 178/227 (78%), Positives = 202/227 (89%), Gaps = 0/227 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGT+ E+IA G+ EISAIYE  NEPEEALKLL KALKLLED PGQ ST+AGIEA+MGVM
Sbjct  375  VPGTSPEDIAGGLMEISAIYEAMNEPEEALKLLQKALKLLEDSPGQWSTVAGIEAQMGVM  434

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +YMVGRY E+RSSFESAVAKLRA+GE+KSAFFGVVLNQMGL+CVQLFKIDEAAELF EAR
Sbjct  435  YYMVGRYGESRSSFESAVAKLRATGEKKSAFFGVVLNQMGLACVQLFKIDEAAELFVEAR  494

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE E G  H DTLGVYSNLAATYDAMGRVE+AIEILEYVLK+REEKLGTANPD +DE+
Sbjct  495  AILEQEYGSTHPDTLGVYSNLAATYDAMGRVENAIEILEYVLKVREEKLGTANPDVEDER  554

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFRS  217
            KRLAELLKEAG+ RN+K  SLENL+D NS++ KKE +++WS  GF++
Sbjct  555  KRLAELLKEAGRVRNRKLTSLENLMDTNSQKAKKEGTRRWSGLGFKT  601



>ref|XP_009375418.1| PREDICTED: nephrocystin-3-like [Pyrus x bretschneideri]
Length=579

 Score =   337 bits (865),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 171/227 (75%), Positives = 206/227 (91%), Gaps = 0/227 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            +PG   EE+ASG+TEI+AIYE  NEPEEAL LL KA+KLL+D P Q+S+IAGIEA+MGVM
Sbjct  353  LPGIVPEELASGLTEIAAIYEAVNEPEEALNLLQKAMKLLDDTPAQRSSIAGIEAQMGVM  412

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            FYMVGRY +A +SFESA++KLRA GERKSA+FGVVLNQMGL+ VQL+K+DEAA+LFEEA+
Sbjct  413  FYMVGRYRDAWTSFESAISKLRAGGERKSAYFGVVLNQMGLAGVQLYKLDEAAQLFEEAK  472

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
            EILE ECG CH DTLGVY+NLAATYDAMGRVE AIE+LE+VLK+REE+LGTANPDFDDEK
Sbjct  473  EILEQECGLCHADTLGVYTNLAATYDAMGRVEAAIEMLEHVLKVREEQLGTANPDFDDEK  532

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFRS  217
            KRLA+LLKEAG++RN+K KSLENL+DPNS++TKKE SK+ S FG+++
Sbjct  533  KRLADLLKEAGRARNRKGKSLENLLDPNSQKTKKEGSKRRSGFGYKT  579



>ref|XP_010100714.1| hypothetical protein L484_023483 [Morus notabilis]
 gb|EXB83876.1| hypothetical protein L484_023483 [Morus notabilis]
Length=557

 Score =   336 bits (862),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 199/225 (88%), Gaps = 1/225 (0%)
 Frame = -3

Query  891  GTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMFY  712
            G TSEEIASG+TEISAIYE  +EPEEALKLL KA+KLLED P  Q TIAG+EA+MGVMFY
Sbjct  334  GVTSEEIASGLTEISAIYEAVSEPEEALKLLKKAIKLLEDNPAHQGTIAGLEAQMGVMFY  393

Query  711  MVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAREI  532
            MVGR+ EAR+SFESA+AKLRASGE KSAFFG+VLNQMGL+CVQL+KI+EA  LFEEAREI
Sbjct  394  MVGRFAEARNSFESAIAKLRASGEWKSAFFGIVLNQMGLACVQLYKINEATGLFEEAREI  453

Query  531  LEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKKR  352
            LE ECGPCH DTLGVYSNLAATYDAMGRVEDAIEILEY+LK+REEKLGTANPD DDEKKR
Sbjct  454  LEQECGPCHLDTLGVYSNLAATYDAMGRVEDAIEILEYILKVREEKLGTANPDVDDEKKR  513

Query  351  LAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFRS  217
            L +LL+E G+SRNKK KSLENL+  N +R KK  +K+WS F F++
Sbjct  514  LTQLLREVGRSRNKKGKSLENLLGSNLRR-KKVGTKRWSGFSFKT  557



>dbj|BAC78579.1| hypothetical protein [Oryza sativa Japonica Group]
Length=309

 Score =   327 bits (839),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 169/226 (75%), Positives = 198/226 (88%), Gaps = 0/226 (0%)
 Frame = -3

Query  894  PGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMF  715
            PG   +E+A G+ EI+AIYE   + +EALKLL +ALKLLED PGQ ST+AGIEA+MGV++
Sbjct  84   PGAAPDEVAGGLMEIAAIYEALGDLDEALKLLQRALKLLEDSPGQWSTVAGIEAQMGVLY  143

Query  714  YMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEARE  535
            YMVGRY ++R+SFE+AVAKLRASGERKSAFFGV+LNQMGL+CVQLFKIDEAA+LFEEAR 
Sbjct  144  YMVGRYADSRNSFENAVAKLRASGERKSAFFGVLLNQMGLACVQLFKIDEAAQLFEEARA  203

Query  534  ILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKK  355
            +LE ECG  H DTLGVYSNLAA YDAMGRVEDAIEILE+VLK+REEKLGTANPD +DEK 
Sbjct  204  VLEQECGASHPDTLGVYSNLAAIYDAMGRVEDAIEILEHVLKVREEKLGTANPDVEDEKL  263

Query  354  RLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFRS  217
            RLAELLKEAG+SRN+K KSLENL   NS+R KK++ ++WS FGFRS
Sbjct  264  RLAELLKEAGRSRNRKQKSLENLFVTNSQRVKKDAGRRWSNFGFRS  309



>ref|NP_001147109.1| LOC100280717 [Zea mays]
 gb|ACG25477.1| kinesin light chain [Zea mays]
Length=587

 Score =   336 bits (861),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 174/226 (77%), Positives = 199/226 (88%), Gaps = 0/226 (0%)
 Frame = -3

Query  894  PGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMF  715
            PG   +EI  G+ EI+AIYE  ++ +EALKLL +ALKLLED PGQ ST+AGIEA+MGV++
Sbjct  362  PGAAPDEIGGGLMEIAAIYEALDDLDEALKLLQRALKLLEDAPGQWSTVAGIEAQMGVLY  421

Query  714  YMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEARE  535
            YMVGRY E+RSSFESAVAKLRASGERKSAFFGV+LNQMGL+CVQLFKIDEAA+LFEEAR 
Sbjct  422  YMVGRYAESRSSFESAVAKLRASGERKSAFFGVLLNQMGLACVQLFKIDEAAQLFEEARA  481

Query  534  ILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKK  355
            +LE ECG  H DTLGVYSNLAA YDAMGRVEDAIEILE+VLK+REEKLGTANPD +DEKK
Sbjct  482  VLEQECGASHPDTLGVYSNLAAIYDAMGRVEDAIEILEHVLKVREEKLGTANPDVEDEKK  541

Query  354  RLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFRS  217
            RLAELLKEAG+SRN+K KSLENL   NS+R KKE+ ++WS FGFRS
Sbjct  542  RLAELLKEAGRSRNRKQKSLENLFGTNSQRAKKEAGRRWSNFGFRS  587



>ref|XP_012083175.1| PREDICTED: nephrocystin-3-like isoform X2 [Jatropha curcas]
 ref|XP_012083178.1| PREDICTED: nephrocystin-3-like isoform X4 [Jatropha curcas]
 gb|KDP28468.1| hypothetical protein JCGZ_14239 [Jatropha curcas]
Length=578

 Score =   334 bits (857),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 202/225 (90%), Gaps = 0/225 (0%)
 Frame = -3

Query  891  GTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMFY  712
            GT +EEIAS +TEI+AIYE  NEP+EALKLL KA+KLLED+PGQ+STIAGIEA+MGVMFY
Sbjct  354  GTATEEIASSLTEIAAIYEALNEPDEALKLLNKAMKLLEDRPGQRSTIAGIEAQMGVMFY  413

Query  711  MVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAREI  532
            M+GRY EAR+SFESAVAKLRASGE KSAFFG+VLNQ+GL  VQL+KID+AAELFEEAREI
Sbjct  414  MIGRYGEARTSFESAVAKLRASGESKSAFFGIVLNQLGLVNVQLYKIDKAAELFEEAREI  473

Query  531  LEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKKR  352
            LE ECG CH +TLGVYSNLAATYDA+GRV DAIEILEY+LK+REEKLGTANPDFDDEKKR
Sbjct  474  LEQECGSCHLETLGVYSNLAATYDAVGRVGDAIEILEYILKVREEKLGTANPDFDDEKKR  533

Query  351  LAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFRS  217
            LAELLKEAG++R +K KSLENL+D NS+R KK  +K+ S F  R+
Sbjct  534  LAELLKEAGRARIRKGKSLENLLDSNSERRKKGVTKRRSGFSIRN  578



>ref|XP_006444813.1| hypothetical protein CICLE_v10019438mg [Citrus clementina]
 gb|ESR58053.1| hypothetical protein CICLE_v10019438mg [Citrus clementina]
Length=584

 Score =   334 bits (857),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 174/226 (77%), Positives = 198/226 (88%), Gaps = 0/226 (0%)
 Frame = -3

Query  894  PGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMF  715
            P T  EEIA+G+TEISAIYE  NE EEALKLL KA+KLLED PG  STIAGIEA+MGVM 
Sbjct  359  PATAPEEIANGLTEISAIYEALNEHEEALKLLQKAMKLLEDTPGYHSTIAGIEAQMGVML  418

Query  714  YMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEARE  535
            Y+VGRY EARSSFESAV KLRASGE KSAFFG+VLNQMGL+C+QL++I+EA ELFEEAR 
Sbjct  419  YVVGRYGEARSSFESAVVKLRASGESKSAFFGIVLNQMGLACLQLYRINEATELFEEARG  478

Query  534  ILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKK  355
            +LE ECG CH DTLGVYSNLAATYDA+GRVEDAIEILEY+LK+REEKLGTANPD DDEK+
Sbjct  479  VLEQECGSCHLDTLGVYSNLAATYDALGRVEDAIEILEYILKVREEKLGTANPDIDDEKE  538

Query  354  RLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFRS  217
            RLAELLKE G++RN+K KSLENL+D N+ R KKE +K+ S FGFR+
Sbjct  539  RLAELLKETGRARNRKGKSLENLLDSNAYRVKKEVTKRRSGFGFRT  584



>gb|KDO86517.1| hypothetical protein CISIN_1g007930mg [Citrus sinensis]
Length=584

 Score =   334 bits (857),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 174/226 (77%), Positives = 198/226 (88%), Gaps = 0/226 (0%)
 Frame = -3

Query  894  PGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMF  715
            P T  EEIA+G+TEISAIYE  NE EEALKLL KA+KLLED PG  STIAGIEA+MGVM 
Sbjct  359  PATAPEEIANGLTEISAIYEALNEHEEALKLLQKAMKLLEDTPGYHSTIAGIEAQMGVML  418

Query  714  YMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEARE  535
            Y+VGRY EARSSFESAV KLRASGE KSAFFG+VLNQMGL+C+QL++I+EA ELFEEAR 
Sbjct  419  YVVGRYGEARSSFESAVVKLRASGESKSAFFGIVLNQMGLACLQLYRINEATELFEEARG  478

Query  534  ILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKK  355
            +LE ECG CH DTLGVYSNLAATYDA+GRVEDAIEILEY+LK+REEKLGTANPD DDEK+
Sbjct  479  VLEQECGSCHLDTLGVYSNLAATYDALGRVEDAIEILEYILKVREEKLGTANPDIDDEKE  538

Query  354  RLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFRS  217
            RLAELLKE G++RN+K KSLENL+D N+ R KKE +K+ S FGFR+
Sbjct  539  RLAELLKETGRARNRKGKSLENLLDSNAYRVKKEVTKRRSGFGFRT  584



>ref|XP_008376154.1| PREDICTED: nephrocystin-3-like [Malus domestica]
Length=579

 Score =   333 bits (855),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 173/226 (77%), Positives = 200/226 (88%), Gaps = 0/226 (0%)
 Frame = -3

Query  894  PGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMF  715
            PG TSEE+ASG+TEI+AIYE  NEPEEAL LL KA+K L+D P Q+STIAGIEA+MGVMF
Sbjct  354  PGITSEELASGLTEIAAIYEAVNEPEEALTLLQKAMKSLDDTPAQRSTIAGIEAQMGVMF  413

Query  714  YMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEARE  535
            YMVGRY EA  SFESA++KLRASGERKSA+FGVVLNQMGL+ VQL+K+DEAA+LFEEA+E
Sbjct  414  YMVGRYVEAWRSFESALSKLRASGERKSAYFGVVLNQMGLASVQLYKLDEAAQLFEEAKE  473

Query  534  ILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKK  355
            ILE E G CH DTLGVYSNLAATYDAMGRVE AIEILE+VL+++EEKLGTANPDFDDEKK
Sbjct  474  ILEQESGLCHPDTLGVYSNLAATYDAMGRVEAAIEILEHVLRVKEEKLGTANPDFDDEKK  533

Query  354  RLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFRS  217
            RLA LLKEAG++RN+K KSLENL+  NS+RTK E SK+ S FG+ +
Sbjct  534  RLAHLLKEAGRARNRKGKSLENLLHSNSQRTKDEGSKRQSGFGYET  579



>ref|XP_006491305.1| PREDICTED: nephrocystin-3-like [Citrus sinensis]
Length=584

 Score =   334 bits (856),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 174/226 (77%), Positives = 198/226 (88%), Gaps = 0/226 (0%)
 Frame = -3

Query  894  PGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMF  715
            P T  EEIA+G+TEISAIYE  NE EEALKLL KA+KLLED PG  STIAGIEA+MGVM 
Sbjct  359  PATAPEEIANGLTEISAIYEALNEHEEALKLLQKAMKLLEDTPGYHSTIAGIEAQMGVML  418

Query  714  YMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEARE  535
            Y+VGRY EARSSFESAV KLRASGE KSAFFG+VLNQMGL+C+QL++I+EA ELFEEAR 
Sbjct  419  YVVGRYGEARSSFESAVVKLRASGESKSAFFGIVLNQMGLACLQLYRINEATELFEEARG  478

Query  534  ILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKK  355
            +LE ECG CH DTLGVYSNLAATYDA+GRVEDAIEILEY+LK+REEKLGTANPD DDEK+
Sbjct  479  VLEQECGSCHLDTLGVYSNLAATYDALGRVEDAIEILEYILKVREEKLGTANPDIDDEKE  538

Query  354  RLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFRS  217
            RLAELLKE G++RN+K KSLENL+D N+ R KKE +K+ S FGFR+
Sbjct  539  RLAELLKETGRARNRKGKSLENLLDSNAYRVKKEVTKRRSGFGFRT  584



>ref|XP_007220647.1| hypothetical protein PRUPE_ppa003486mg [Prunus persica]
 gb|EMJ21846.1| hypothetical protein PRUPE_ppa003486mg [Prunus persica]
Length=571

 Score =   333 bits (853),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 175/228 (77%), Positives = 202/228 (89%), Gaps = 1/228 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            +PG  SEEIASG+TEISAIYE  NEPEEAL LL KA+KLLED P Q+STIAGIEA+MGVM
Sbjct  344  LPGIISEEIASGLTEISAIYEAVNEPEEALNLLQKAMKLLEDTPAQRSTIAGIEAQMGVM  403

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            FYMVGRY EA  SF+SA++KLRASGERKSA FG+VLNQMGL+ VQL+K+DEAA LFEEAR
Sbjct  404  FYMVGRYGEAWRSFKSAISKLRASGERKSAHFGIVLNQMGLASVQLYKLDEAARLFEEAR  463

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
            EILE ECG CH DTLGVYSNLAATYDAMGRVE AIE+LE++LK+REEKLGTA+PDFDDEK
Sbjct  464  EILEQECGLCHVDTLGVYSNLAATYDAMGRVEAAIEMLEHILKVREEKLGTAHPDFDDEK  523

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNS-KRTKKESSKKWSAFGFRS  217
            KRLA+LLKEAG++RN+K KSLENL+  NS +RTKKE  K+W+ FG ++
Sbjct  524  KRLADLLKEAGRARNRKGKSLENLLGSNSHQRTKKEGVKRWAGFGHKT  571



>ref|XP_012083173.1| PREDICTED: nephrocystin-3-like isoform X1 [Jatropha curcas]
 ref|XP_012083174.1| PREDICTED: nephrocystin-3-like isoform X1 [Jatropha curcas]
Length=599

 Score =   333 bits (855),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 202/225 (90%), Gaps = 0/225 (0%)
 Frame = -3

Query  891  GTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMFY  712
            GT +EEIAS +TEI+AIYE  NEP+EALKLL KA+KLLED+PGQ+STIAGIEA+MGVMFY
Sbjct  375  GTATEEIASSLTEIAAIYEALNEPDEALKLLNKAMKLLEDRPGQRSTIAGIEAQMGVMFY  434

Query  711  MVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAREI  532
            M+GRY EAR+SFESAVAKLRASGE KSAFFG+VLNQ+GL  VQL+KID+AAELFEEAREI
Sbjct  435  MIGRYGEARTSFESAVAKLRASGESKSAFFGIVLNQLGLVNVQLYKIDKAAELFEEAREI  494

Query  531  LEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKKR  352
            LE ECG CH +TLGVYSNLAATYDA+GRV DAIEILEY+LK+REEKLGTANPDFDDEKKR
Sbjct  495  LEQECGSCHLETLGVYSNLAATYDAVGRVGDAIEILEYILKVREEKLGTANPDFDDEKKR  554

Query  351  LAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFRS  217
            LAELLKEAG++R +K KSLENL+D NS+R KK  +K+ S F  R+
Sbjct  555  LAELLKEAGRARIRKGKSLENLLDSNSERRKKGVTKRRSGFSIRN  599



>ref|XP_010541795.1| PREDICTED: kinesin light chain-like [Tarenaya hassleriana]
Length=613

 Score =   334 bits (856),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 178/227 (78%), Positives = 201/227 (89%), Gaps = 1/227 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTT EEIA G+ EIS IYE  +EPEEALKLL KA+KLLEDKPGQQS IAG+EARMGVM
Sbjct  386  VPGTTVEEIADGLMEISTIYESVDEPEEALKLLQKAMKLLEDKPGQQSAIAGLEARMGVM  445

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +YM+GRY+++R+ FES+V KLRA+GERKSAFFGVVLNQMGL+CVQLFKIDEAAELFEEAR
Sbjct  446  YYMLGRYEDSRNVFESSVTKLRAAGERKSAFFGVVLNQMGLACVQLFKIDEAAELFEEAR  505

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE E G C QDTL VYSNLAATYDAMGR+EDAIEILE VLKLREEKLG ANPDF+ EK
Sbjct  506  GILESERGSCDQDTLSVYSNLAATYDAMGRIEDAIEILEQVLKLREEKLGIANPDFEVEK  565

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKE-SSKKWSAFGFR  220
            +RL ELLKEAG+SRN KAKSL+NLIDPN++  KKE S+KKW + GF+
Sbjct  566  RRLTELLKEAGRSRNHKAKSLQNLIDPNARPPKKEPSAKKWPSLGFK  612



>ref|XP_002453144.1| hypothetical protein SORBIDRAFT_04g000780 [Sorghum bicolor]
 gb|EES06120.1| hypothetical protein SORBIDRAFT_04g000780 [Sorghum bicolor]
Length=612

 Score =   333 bits (854),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 173/226 (77%), Positives = 199/226 (88%), Gaps = 0/226 (0%)
 Frame = -3

Query  894  PGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMF  715
            PG   +EIA G+ EI+AIYE   + +EALKLL +ALKLLED PGQ ST+AGIEA+MGV++
Sbjct  387  PGAAPDEIAGGLMEIAAIYEALGDLDEALKLLQRALKLLEDSPGQWSTVAGIEAQMGVLY  446

Query  714  YMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEARE  535
            YMVGRY ++R+SFESAVAKLRASGERKSAFFGV+LNQMGL+CVQLFKIDEAA+LFEEAR 
Sbjct  447  YMVGRYADSRNSFESAVAKLRASGERKSAFFGVLLNQMGLACVQLFKIDEAAQLFEEARA  506

Query  534  ILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKK  355
            +LE ECG  H DTLGVYSNLAA YDAMGRVEDAIEILE+VLK+REEKLGTANPD +DEKK
Sbjct  507  VLEQECGASHPDTLGVYSNLAAIYDAMGRVEDAIEILEHVLKVREEKLGTANPDVEDEKK  566

Query  354  RLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFRS  217
            RLAELLKEAG+SRN+K KSLENL   NS+R KKE+ ++WS FGFRS
Sbjct  567  RLAELLKEAGRSRNRKQKSLENLFVTNSQRAKKEAGRRWSNFGFRS  612



>gb|ACN35027.1| unknown [Zea mays]
Length=546

 Score =   329 bits (844),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 170/226 (75%), Positives = 197/226 (87%), Gaps = 0/226 (0%)
 Frame = -3

Query  894  PGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMF  715
            PG   +EIA G+ EI+AIYE   + +EALKLL +AL+LLE  PGQ ST+AGIEA+MGV++
Sbjct  321  PGAAPDEIAGGLMEIAAIYEALGDLDEALKLLQRALRLLEGSPGQWSTVAGIEAQMGVLY  380

Query  714  YMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEARE  535
            YMVGRY ++R+SFESAVAKLRA GERKSAFFGV+LNQMGL+CVQLFKIDEAA+LFEEAR 
Sbjct  381  YMVGRYADSRNSFESAVAKLRAIGERKSAFFGVLLNQMGLACVQLFKIDEAAQLFEEARA  440

Query  534  ILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKK  355
            +LE ECG  H DTLGVYSNLAA YDAMGRVEDAIEILE+VLK+REEKLGTANPD DDEKK
Sbjct  441  VLEQECGASHPDTLGVYSNLAAIYDAMGRVEDAIEILEHVLKVREEKLGTANPDVDDEKK  500

Query  354  RLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFRS  217
            RLAELLKEAG+SRN+K KSL+NL   NS+R KKE+ ++WS FGFRS
Sbjct  501  RLAELLKEAGRSRNRKQKSLQNLFGTNSQRAKKEAGRRWSNFGFRS  546



>ref|XP_004951217.1| PREDICTED: nephrocystin-3-like [Setaria italica]
Length=599

 Score =   330 bits (847),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 171/226 (76%), Positives = 198/226 (88%), Gaps = 0/226 (0%)
 Frame = -3

Query  894  PGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMF  715
            PG   +EIA G+ EI+AIYE   + +EALKLL +ALKLLED PGQ ST+AGIEA+MGV++
Sbjct  374  PGAAPDEIAGGLMEIAAIYEALGDLDEALKLLQRALKLLEDSPGQWSTVAGIEAQMGVLY  433

Query  714  YMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEARE  535
            YM+GRY ++R+SFESAVAKLRASGERKSAFFGV+LNQMGL+CVQLFKIDEAA+LFEEAR 
Sbjct  434  YMIGRYADSRNSFESAVAKLRASGERKSAFFGVLLNQMGLACVQLFKIDEAAQLFEEARA  493

Query  534  ILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKK  355
            +LE ECG  H DTLGVYSNLAA YDAMGRVEDAIEILE+VLK+REEKLGTANPD +DEKK
Sbjct  494  VLEQECGASHPDTLGVYSNLAAIYDAMGRVEDAIEILEHVLKVREEKLGTANPDVEDEKK  553

Query  354  RLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFRS  217
            RLAELLKEAG+SRN+K KSLENL   N+ R KKE+ ++WS FGFRS
Sbjct  554  RLAELLKEAGRSRNRKQKSLENLFGSNAARAKKEAGRRWSNFGFRS  599



>ref|XP_006648216.1| PREDICTED: nephrocystin-3-like [Oryza brachyantha]
Length=536

 Score =   328 bits (840),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 169/226 (75%), Positives = 198/226 (88%), Gaps = 0/226 (0%)
 Frame = -3

Query  894  PGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMF  715
            PG   +E+A G+ EI+AIYE   + +EALKLL +ALKLLED PGQ ST+AGIEA+MGV++
Sbjct  311  PGAAPDEVAGGLMEIAAIYEALGDLDEALKLLQRALKLLEDSPGQWSTVAGIEAQMGVLY  370

Query  714  YMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEARE  535
            YMVGRY ++R+SF+SAVAKLRASGERKSAFFGV+LNQMGL+CVQLFKIDEAA+LFEEAR 
Sbjct  371  YMVGRYADSRNSFDSAVAKLRASGERKSAFFGVLLNQMGLACVQLFKIDEAAQLFEEARA  430

Query  534  ILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKK  355
            +LE ECG  H DTLGVYSNLAA YDAMGRVEDAIEILE+VLK+REEKLGTANPD +DEK 
Sbjct  431  VLEQECGASHPDTLGVYSNLAAIYDAMGRVEDAIEILEHVLKVREEKLGTANPDVEDEKL  490

Query  354  RLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFRS  217
            RLAELLKEAG+SRN+K KSLENL   NS+R KK++ ++WS FGFRS
Sbjct  491  RLAELLKEAGRSRNRKQKSLENLFVTNSQRVKKDAGRRWSNFGFRS  536



>ref|XP_003548412.1| PREDICTED: nephrocystin-3-like [Glycine max]
Length=554

 Score =   328 bits (841),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 175/228 (77%), Positives = 199/228 (87%), Gaps = 1/228 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            V GTT+ EIASG+TEISAIYE  NEPEEALKLL KA+KLLED PGQ  T+AGIEA+MGVM
Sbjct  327  VAGTTAGEIASGLTEISAIYEALNEPEEALKLLQKAVKLLEDIPGQYRTVAGIEAQMGVM  386

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            FYMVG+Y +A  SFE+A+ KLRASGE+KSAFFGVVLNQMGL+CVQL+KI +AA+ FEEA+
Sbjct  387  FYMVGKYMDAWKSFENAITKLRASGEKKSAFFGVVLNQMGLACVQLYKIGDAAKHFEEAK  446

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
            EILE ECG  H DTLGVYSNLAATYDA+GRVEDAIEILEY+LK+REEKLGTANPD DDEK
Sbjct  447  EILERECGTYHSDTLGVYSNLAATYDALGRVEDAIEILEYILKMREEKLGTANPDVDDEK  506

Query  357  KRLAELLKEAGKSRNKKA-KSLENLIDPNSKRTKKESSKKWSAFGFRS  217
            KRL ELLKEAG+ RN+K  KSLENLID NS + KKE  K+W+AFG R+
Sbjct  507  KRLFELLKEAGRVRNRKGKKSLENLIDSNSLKMKKEGKKRWAAFGLRT  554



>ref|XP_010529655.1| PREDICTED: kinesin light chain-like [Tarenaya hassleriana]
Length=613

 Score =   329 bits (844),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 173/229 (76%), Positives = 206/229 (90%), Gaps = 3/229 (1%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTT EEI+ G+TEISAIYE  +EPEEALKLL KA+KLLEDKPGQQSTIAG+EARMGVM
Sbjct  384  VPGTTVEEISGGLTEISAIYESVDEPEEALKLLQKAMKLLEDKPGQQSTIAGLEARMGVM  443

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +YM+GRY+++R++FESAV KLRA+GER+SAFFGVVLNQMGL+ VQLFKIDEAAELFEE++
Sbjct  444  YYMLGRYEDSRNAFESAVMKLRAAGERRSAFFGVVLNQMGLASVQLFKIDEAAELFEESK  503

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE E G C QDTLGVYSNLAATYDAMGR+E AIE+LE V+K+REEKLG ANPDF++EK
Sbjct  504  SILESERGSCDQDTLGVYSNLAATYDAMGRIEKAIEMLEQVVKVREEKLGIANPDFEEEK  563

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKE---SSKKWSAFGFR  220
            +RLAELLKEAG+SRN+KAKSL+NLIDPN+ R  K+   S+K+W + GF+
Sbjct  564  RRLAELLKEAGRSRNRKAKSLQNLIDPNAPRPAKKDSSSAKRWPSLGFK  612



>ref|XP_004510654.1| PREDICTED: nephrocystin-3-like [Cicer arietinum]
Length=573

 Score =   328 bits (840),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 174/227 (77%), Positives = 195/227 (86%), Gaps = 0/227 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTT+ EIASG+TEISAIYE  NEPEEALKLL KA+KLLE  PGQ  T+AGIEA+MGVM
Sbjct  347  VPGTTAGEIASGLTEISAIYEALNEPEEALKLLQKAVKLLEGIPGQYRTVAGIEAQMGVM  406

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            FYMVGR+ +A  SF+S+V KLRA GERKSAFFG VLNQMGL+CVQL+KI+EAA  FEEAR
Sbjct  407  FYMVGRHVDAWKSFDSSVTKLRAGGERKSAFFGFVLNQMGLACVQLYKIEEAATHFEEAR  466

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
            EILE ECG  H DTLGVYSNLAATYDA+GRVEDAI ILEY+LK+REEKLGTANPD DDEK
Sbjct  467  EILERECGTYHLDTLGVYSNLAATYDALGRVEDAIRILEYILKMREEKLGTANPDVDDEK  526

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFRS  217
            KRL ELLKEAG+ RN+K KSLENLID NS + KKE  ++W AF FR+
Sbjct  527  KRLFELLKEAGRVRNRKGKSLENLIDSNSLKMKKEGRRRWGAFSFRT  573



>ref|NP_001130723.1| uncharacterized protein LOC100191827 [Zea mays]
 gb|ACF79059.1| unknown [Zea mays]
 gb|ACN28972.1| unknown [Zea mays]
 gb|AFW69752.1| hypothetical protein ZEAMMB73_983154 [Zea mays]
Length=612

 Score =   329 bits (843),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 170/226 (75%), Positives = 197/226 (87%), Gaps = 0/226 (0%)
 Frame = -3

Query  894  PGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMF  715
            PG   +EIA G+ EI+AIYE   + +EALKLL +AL+LLE  PGQ ST+AGIEA+MGV++
Sbjct  387  PGAAPDEIAGGLMEIAAIYEALGDLDEALKLLQRALRLLEGSPGQWSTVAGIEAQMGVLY  446

Query  714  YMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEARE  535
            YMVGRY ++R+SFESAVAKLRA GERKSAFFGV+LNQMGL+CVQLFKIDEAA+LFEEAR 
Sbjct  447  YMVGRYADSRNSFESAVAKLRAIGERKSAFFGVLLNQMGLACVQLFKIDEAAQLFEEARA  506

Query  534  ILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKK  355
            +LE ECG  H DTLGVYSNLAA YDAMGRVEDAIEILE+VLK+REEKLGTANPD DDEKK
Sbjct  507  VLEQECGASHPDTLGVYSNLAAIYDAMGRVEDAIEILEHVLKVREEKLGTANPDVDDEKK  566

Query  354  RLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFRS  217
            RLAELLKEAG+SRN+K KSL+NL   NS+R KKE+ ++WS FGFRS
Sbjct  567  RLAELLKEAGRSRNRKQKSLQNLFGTNSQRAKKEAGRRWSNFGFRS  612



>ref|XP_009334358.1| PREDICTED: nephrocystin-3-like isoform X1 [Pyrus x bretschneideri]
Length=579

 Score =   327 bits (839),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 170/226 (75%), Positives = 200/226 (88%), Gaps = 0/226 (0%)
 Frame = -3

Query  894  PGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMF  715
            PG TSEE+ASG+TEI+AIYE  NEPEEAL LL KA+K L+D P Q+STIAGIEA+MGV+F
Sbjct  354  PGITSEELASGLTEIAAIYEDVNEPEEALNLLQKAMKSLDDTPAQRSTIAGIEAQMGVIF  413

Query  714  YMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEARE  535
            YMVGRY EA  SF+SA++KLRAS ERKSA+FGVVLNQMGL+ VQL+K+DEAA+LFEEA+E
Sbjct  414  YMVGRYGEAWRSFDSALSKLRASRERKSAYFGVVLNQMGLASVQLYKLDEAAQLFEEAKE  473

Query  534  ILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKK  355
            IL+ ECG CH DTLGVYSNLAATYDAMGRVE AIEILE+VLK++EEKLGTANPDFDDEKK
Sbjct  474  ILKQECGLCHPDTLGVYSNLAATYDAMGRVEAAIEILEHVLKVKEEKLGTANPDFDDEKK  533

Query  354  RLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFRS  217
            RLA LLKEAG++RN+K KSLE L+  NS+RTK+E SK+ S FG+ +
Sbjct  534  RLAHLLKEAGRARNRKGKSLEKLLHSNSQRTKEEGSKRQSGFGYET  579



>ref|NP_001045645.1| Os02g0109800 [Oryza sativa Japonica Group]
 dbj|BAD07830.1| kinesin light chain-like protein [Oryza sativa Japonica Group]
 dbj|BAD27945.1| kinesin light chain-like protein [Oryza sativa Japonica Group]
 dbj|BAF07559.1| Os02g0109800 [Oryza sativa Japonica Group]
 dbj|BAG91212.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC72331.1| hypothetical protein OsI_05534 [Oryza sativa Indica Group]
Length=599

 Score =   328 bits (840),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 169/226 (75%), Positives = 198/226 (88%), Gaps = 0/226 (0%)
 Frame = -3

Query  894  PGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMF  715
            PG   +E+A G+ EI+AIYE   + +EALKLL +ALKLLED PGQ ST+AGIEA+MGV++
Sbjct  374  PGAAPDEVAGGLMEIAAIYEALGDLDEALKLLQRALKLLEDSPGQWSTVAGIEAQMGVLY  433

Query  714  YMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEARE  535
            YMVGRY ++R+SFE+AVAKLRASGERKSAFFGV+LNQMGL+CVQLFKIDEAA+LFEEAR 
Sbjct  434  YMVGRYADSRNSFENAVAKLRASGERKSAFFGVLLNQMGLACVQLFKIDEAAQLFEEARA  493

Query  534  ILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKK  355
            +LE ECG  H DTLGVYSNLAA YDAMGRVEDAIEILE+VLK+REEKLGTANPD +DEK 
Sbjct  494  VLEQECGASHPDTLGVYSNLAAIYDAMGRVEDAIEILEHVLKVREEKLGTANPDVEDEKL  553

Query  354  RLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFRS  217
            RLAELLKEAG+SRN+K KSLENL   NS+R KK++ ++WS FGFRS
Sbjct  554  RLAELLKEAGRSRNRKQKSLENLFVTNSQRVKKDAGRRWSNFGFRS  599



>ref|XP_008795853.1| PREDICTED: kinesin light chain 4-like [Phoenix dactylifera]
Length=598

 Score =   326 bits (836),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 173/227 (76%), Positives = 201/227 (89%), Gaps = 1/227 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGT+ E+IA G+ EISAI+E  NEPEEALKLL KAL+LLED PGQ ST+AGIEA+MGVM
Sbjct  373  VPGTSPEDIAGGLMEISAIFEAVNEPEEALKLLQKALRLLEDSPGQWSTVAGIEAQMGVM  432

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +YMVGRY E+ SSF+SAVAKLRASGE+KSAFFG+VLNQMGL+CVQLFKI+EAA+LFEEAR
Sbjct  433  YYMVGRYGESWSSFDSAVAKLRASGEKKSAFFGIVLNQMGLACVQLFKINEAADLFEEAR  492

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE E G  H DTLGVYSNLAATYDA+GRVEDAIEILEYVLK+REEKLGTANPD +DE+
Sbjct  493  AILEQEYGSSHPDTLGVYSNLAATYDAIGRVEDAIEILEYVLKVREEKLGTANPDVEDER  552

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFRS  217
            KRLAELLKEAG+ RN++ KSLENL+  NS R  KE +++WSA GF++
Sbjct  553  KRLAELLKEAGRVRNREPKSLENLMVTNSHRV-KEGTRRWSALGFKT  598



>ref|XP_007135270.1| hypothetical protein PHAVU_010G115100g [Phaseolus vulgaris]
 gb|ESW07264.1| hypothetical protein PHAVU_010G115100g [Phaseolus vulgaris]
Length=561

 Score =   324 bits (831),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 174/228 (76%), Positives = 197/228 (86%), Gaps = 1/228 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            V GTT+ EIASG+TEISAIYE  NEPEEALKLL KA+KLL+D PGQ  T+AGIEA+MGVM
Sbjct  334  VVGTTAGEIASGLTEISAIYEALNEPEEALKLLQKAVKLLQDIPGQYRTVAGIEAQMGVM  393

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            FY+VGRY EA  SFE+A+ KLRASGE+KS FFGVVLNQMGL+CVQL+KI +AA+ FEEA+
Sbjct  394  FYVVGRYMEAWKSFENAITKLRASGEKKSTFFGVVLNQMGLACVQLYKIGDAAKHFEEAK  453

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE ECG  H DTLGVYSNLAATYDAMGRVEDAIEILEY+LK+REEKLGTANPD DDEK
Sbjct  454  VILERECGTYHSDTLGVYSNLAATYDAMGRVEDAIEILEYILKMREEKLGTANPDVDDEK  513

Query  357  KRLAELLKEAGKSRNKKA-KSLENLIDPNSKRTKKESSKKWSAFGFRS  217
            KRL ELLKEAG+ RN+K  KSLENLID +S + KKE  K+WSAFG R+
Sbjct  514  KRLFELLKEAGRVRNRKGKKSLENLIDSSSLKMKKEGKKRWSAFGLRT  561



>ref|XP_003571751.1| PREDICTED: nephrocystin-3 [Brachypodium distachyon]
Length=618

 Score =   324 bits (831),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 168/227 (74%), Positives = 199/227 (88%), Gaps = 1/227 (0%)
 Frame = -3

Query  894  PGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMF  715
            PG   +E+A G+ EI+AIYE   + +EALKLL +ALKLLED PGQ ST+AGIEA+MGV++
Sbjct  392  PGAAPDEVAGGLMEIAAIYEALGDLDEALKLLQRALKLLEDSPGQWSTVAGIEAQMGVLY  451

Query  714  YMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEARE  535
            YM+GRY ++R+SFESAVAKLRASGERKSAFFGV+LNQMGL+CVQLFKIDEAA+LFEEAR 
Sbjct  452  YMIGRYADSRNSFESAVAKLRASGERKSAFFGVLLNQMGLACVQLFKIDEAAQLFEEARA  511

Query  534  ILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKK  355
            +LE ECG  H DTLGVYSNLAA YDAMGRVEDAIEILE+VLK+REEKLGTANPD +DEKK
Sbjct  512  VLEQECGASHPDTLGVYSNLAAIYDAMGRVEDAIEILEHVLKVREEKLGTANPDVEDEKK  571

Query  354  RLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKES-SKKWSAFGFRS  217
            RLAELLKEAG+SRN+K KSLENL   N++R KK++  ++W+ FGFRS
Sbjct  572  RLAELLKEAGRSRNRKQKSLENLFGSNAQRAKKDAGGRRWTNFGFRS  618



>gb|EAZ21454.1| hypothetical protein OsJ_05056 [Oryza sativa Japonica Group]
Length=615

 Score =   323 bits (828),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 167/225 (74%), Positives = 197/225 (88%), Gaps = 0/225 (0%)
 Frame = -3

Query  894  PGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMF  715
            PG   +E+A G+ EI+AIYE   + +EALKLL +ALKLLED PGQ ST+AGIEA+MGV++
Sbjct  374  PGAAPDEVAGGLMEIAAIYEALGDLDEALKLLQRALKLLEDSPGQWSTVAGIEAQMGVLY  433

Query  714  YMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEARE  535
            YMVGRY ++R+SFE+AVAKLRASGERKSAFFGV+LNQMGL+CVQLFKIDEAA+LFEEAR 
Sbjct  434  YMVGRYADSRNSFENAVAKLRASGERKSAFFGVLLNQMGLACVQLFKIDEAAQLFEEARA  493

Query  534  ILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKK  355
            +LE ECG  H DTLGVYSNLAA YDAMGRVEDAIEILE+VLK+REEKLGTANPD +DEK 
Sbjct  494  VLEQECGASHPDTLGVYSNLAAIYDAMGRVEDAIEILEHVLKVREEKLGTANPDVEDEKL  553

Query  354  RLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFR  220
            RLAELLKEAG+SRN+K KSLENL   NS+R KK++ ++WS FGF+
Sbjct  554  RLAELLKEAGRSRNRKQKSLENLFVTNSQRVKKDAGRRWSNFGFQ  598



>ref|XP_004308296.1| PREDICTED: nephrocystin-3-like [Fragaria vesca subsp. vesca]
Length=566

 Score =   321 bits (823),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 168/228 (74%), Positives = 197/228 (86%), Gaps = 1/228 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            +PG  SEEIA+G+TEI+AIYE  NEPEEALKLL KA+KLLED P  +STIAGIEA+MGVM
Sbjct  339  LPGIVSEEIATGLTEIAAIYEAVNEPEEALKLLQKAMKLLEDTPAHRSTIAGIEAQMGVM  398

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            FYM+GR+ EA SS +SA+ KLRASGE+KSA+FG+VLNQ+GLSCVQL+K++EA  LFEEAR
Sbjct  399  FYMIGRFGEAWSSLDSAIEKLRASGEKKSAYFGIVLNQLGLSCVQLYKLNEAVRLFEEAR  458

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
            +ILE ECG CH DTLGVYSNLAATYDA GRVE AIEILEY+LK+REEKLGTANPD DDEK
Sbjct  459  DILEQECGICHLDTLGVYSNLAATYDATGRVESAIEILEYILKVREEKLGTANPDVDDEK  518

Query  357  KRLAELLKEAGKSRNKKAKSLENLI-DPNSKRTKKESSKKWSAFGFRS  217
            KRLA+LLKEAG+ RN+K KSLENLI   NS+R KKE  K+WS   +++
Sbjct  519  KRLADLLKEAGRVRNRKGKSLENLIGGSNSQRMKKEGMKRWSGTSYKN  566



>ref|XP_010924445.1| PREDICTED: LOW QUALITY PROTEIN: kinesin light chain 4-like [Elaeis 
guineensis]
Length=598

 Score =   320 bits (820),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 170/227 (75%), Positives = 197/227 (87%), Gaps = 1/227 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGT+ E+IA G+ EISAIYE  NEP+EALKLL KAL LLED  GQ ST+AGIEA+MGVM
Sbjct  373  VPGTSPEDIAGGLMEISAIYEAMNEPDEALKLLQKALMLLEDSXGQWSTVAGIEAQMGVM  432

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +YM GRY E+ SSFESAVAKLRASGE+KSAFFG+V+NQMGL+CVQLFKI+EAAELFEEAR
Sbjct  433  YYMAGRYGESWSSFESAVAKLRASGEKKSAFFGIVVNQMGLACVQLFKINEAAELFEEAR  492

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE E G  H DTLGVYSNLAATYDA+GR E+AIEILEYVLK+REEKLGTANPD +DE+
Sbjct  493  AILEQESGSSHPDTLGVYSNLAATYDALGRAENAIEILEYVLKVREEKLGTANPDVEDER  552

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFRS  217
            KRLAELLKEAG+ RN++ KSLENL+  NS+R  KE +K+WS  GF++
Sbjct  553  KRLAELLKEAGRVRNREPKSLENLMVTNSQRV-KEGTKRWSGLGFKT  598



>dbj|BAK04667.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=609

 Score =   313 bits (803),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 166/230 (72%), Positives = 197/230 (86%), Gaps = 4/230 (2%)
 Frame = -3

Query  894  PGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMF  715
            PG   +E+A G+ EI+AIYE   + +EALKLL +ALKLLED PGQ ST+AGIEA+MGV++
Sbjct  380  PGAAPDEVAGGLMEIAAIYEALGDLDEALKLLQRALKLLEDSPGQWSTVAGIEAQMGVLY  439

Query  714  YMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEARE  535
            YM+GRY ++R+SFESAV+KLRASGERKSAFFGV+LNQMGL+CVQLFKIDEAA+LFEEAR 
Sbjct  440  YMIGRYADSRNSFESAVSKLRASGERKSAFFGVLLNQMGLACVQLFKIDEAAQLFEEARA  499

Query  534  ILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKK  355
            +LE ECG  H DTLGVYSNLAA YDAMGRVEDAIEILE+VLK+REEKLGTANPD +DEKK
Sbjct  500  VLEQECGASHPDTLGVYSNLAAIYDAMGRVEDAIEILEHVLKVREEKLGTANPDVEDEKK  559

Query  354  RLAELLKEAGKSRNKKAKSLENLIDPN--SKRTKKESS--KKWSAFGFRS  217
            RLAELLKEAG+SRN+K KSLENL      ++  KK+ S  ++W+ FGFRS
Sbjct  560  RLAELLKEAGRSRNRKQKSLENLFGSGGAARGAKKDGSGGRRWTNFGFRS  609



>gb|KEH18621.1| kinesin light chain [Medicago truncatula]
Length=572

 Score =   311 bits (797),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 168/227 (74%), Positives = 194/227 (85%), Gaps = 0/227 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            +PG T+ EIASG+TEISAIYE  NEPEEALKLL KA+KLLE  PGQ  T+AGIEA+MGV+
Sbjct  346  MPGITAGEIASGLTEISAIYEALNEPEEALKLLQKAVKLLEGIPGQYRTMAGIEAQMGVL  405

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            FYMVGR+ +A  SF++AV KLRA GERKSAFFG VLNQMGL+CVQL+KI+EAA  FEEAR
Sbjct  406  FYMVGRHVDAWKSFDNAVTKLRAGGERKSAFFGFVLNQMGLACVQLYKIEEAATHFEEAR  465

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
            +ILE E G  H DTLGVYSNLAATYDA+GRVEDAI+ILEY+LK+REEKLGTANPD DDEK
Sbjct  466  DILEREYGTYHLDTLGVYSNLAATYDALGRVEDAIQILEYILKMREEKLGTANPDVDDEK  525

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFRS  217
            KRL ELLKEAG+ R++K  SLENLID NS + KKE+ +K  AFGFR+
Sbjct  526  KRLFELLKEAGRVRSRKGTSLENLIDSNSLKMKKEARRKRGAFGFRT  572



>ref|XP_008233119.1| PREDICTED: nephrocystin-3-like [Prunus mume]
Length=571

 Score =   309 bits (791),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 174/228 (76%), Positives = 200/228 (88%), Gaps = 1/228 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            +PG  SEEIASG+TEISAIYE  NEPEEAL LL KA+KLLED P Q+STIAGIEA+MGVM
Sbjct  344  LPGIISEEIASGLTEISAIYEAVNEPEEALNLLQKAMKLLEDTPAQRSTIAGIEAQMGVM  403

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            FYMV RY EA  SF SA++KLRASGERKSA FG+VLNQMGL+ VQL+K+DEAA LFEEAR
Sbjct  404  FYMVRRYGEAWRSFNSAISKLRASGERKSAHFGIVLNQMGLASVQLYKLDEAARLFEEAR  463

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
            EILE ECG CH DTLGVYSNLAATYDAMGRVE AIE+LE++LK+REEKLGTA+PDFDDEK
Sbjct  464  EILEEECGLCHVDTLGVYSNLAATYDAMGRVEAAIEMLEHILKVREEKLGTAHPDFDDEK  523

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNS-KRTKKESSKKWSAFGFRS  217
            KRLA+LLKEAG++RN+K KSLENL+  NS +RTKKE  K+W+ FG ++
Sbjct  524  KRLADLLKEAGRARNRKGKSLENLLGSNSHQRTKKEGVKRWAGFGHKT  571



>ref|XP_002302641.1| hypothetical protein POPTR_0002s17410g [Populus trichocarpa]
 gb|EEE81914.1| hypothetical protein POPTR_0002s17410g [Populus trichocarpa]
Length=353

 Score =   288 bits (738),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 153/209 (73%), Positives = 177/209 (85%), Gaps = 0/209 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            V G  +EEIASG+ EISAIYE  NE  EALKLL  A+KLL+D PGQ+S IAGIEA+MG+M
Sbjct  145  VTGIATEEIASGLAEISAIYEALNEHGEALKLLYMAMKLLKDTPGQRSMIAGIEAQMGLM  204

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            FY VG+Y EARSSFE+AVAKLRASG+ KS FFG++LNQ+GL+ VQL++I EA ELFEEAR
Sbjct  205  FYKVGKYGEARSSFENAVAKLRASGDAKSVFFGILLNQLGLASVQLYRIHEAVELFEEAR  264

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
            EILE ECG CH DTLGVYSNLAATYDA+GRVEDA  ILEY+LKLREEKLGTANP+  DEK
Sbjct  265  EILEQECGSCHSDTLGVYSNLAATYDALGRVEDAAVILEYILKLREEKLGTANPEVADEK  324

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNS  271
            KRLA LLKEAG++R +K  SL NL+D +S
Sbjct  325  KRLAVLLKEAGRARIRKGNSLVNLLDSSS  353



>ref|XP_002321593.2| hypothetical protein POPTR_0015s08660g [Populus trichocarpa]
 gb|EEF05720.2| hypothetical protein POPTR_0015s08660g [Populus trichocarpa]
Length=699

 Score =   298 bits (763),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 153/215 (71%), Positives = 186/215 (87%), Gaps = 0/215 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPG   EEIASG++++SAIYE  NE ++A+KLL KALK+  D PGQQSTIAGIEA+MGVM
Sbjct  480  VPGIPPEEIASGLSDVSAIYESMNELDQAIKLLGKALKIYNDAPGQQSTIAGIEAQMGVM  539

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +YM+G Y E+ +SF++A++KLRASGE+KSAFFG+ LNQMGLSCVQ + I+EAAELFEEA+
Sbjct  540  YYMMGNYSESYNSFKNAISKLRASGEKKSAFFGIALNQMGLSCVQRYAINEAAELFEEAK  599

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE ECGP H DTLGVYSNLA TYDAMGR++DAIEILEYV+++REEKLGTANPD  DEK
Sbjct  600  IILEQECGPYHPDTLGVYSNLAGTYDAMGRLDDAIEILEYVVEMREEKLGTANPDVVDEK  659

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKE  253
            KRLAELLKEAG+ R++KA+SLENL+D NS    K+
Sbjct  660  KRLAELLKEAGRVRSRKARSLENLLDGNSHDINKD  694



>ref|XP_011028570.1| PREDICTED: nephrocystin-3-like [Populus euphratica]
 ref|XP_011028571.1| PREDICTED: nephrocystin-3-like [Populus euphratica]
Length=746

 Score =   299 bits (765),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 153/216 (71%), Positives = 187/216 (87%), Gaps = 0/216 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPG   EEIASG++++SAIYE  NE ++A+KLL KALK+  D PGQQSTI+GIEA+MGVM
Sbjct  527  VPGIPPEEIASGLSDVSAIYESMNELDQAIKLLGKALKIYNDAPGQQSTISGIEAQMGVM  586

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +YM+G Y E+ +SF++A++KLRASGE+KSAFFG+ LNQMGLSCVQ + I+EAAELFEEA+
Sbjct  587  YYMMGNYSESYNSFKNAISKLRASGEKKSAFFGIALNQMGLSCVQRYAINEAAELFEEAK  646

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE ECGP H DTLGVYSNLA TYDAMGR++DAIEILEYV+++REEKLGTANPD  DEK
Sbjct  647  IILEQECGPYHPDTLGVYSNLAGTYDAMGRLDDAIEILEYVVEMREEKLGTANPDVVDEK  706

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKES  250
            KRLAELLKEAG+ R++KA+SLENL+D NS    K+S
Sbjct  707  KRLAELLKEAGRVRSRKARSLENLLDGNSHDINKDS  742



>ref|XP_011623614.1| PREDICTED: nephrocystin-3 [Amborella trichopoda]
Length=583

 Score =   295 bits (754),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 148/229 (65%), Positives = 189/229 (83%), Gaps = 2/229 (1%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDK--PGQQSTIAGIEARMG  724
            VPGT +E++A+G+ E++A+YE   + +E++KLL KA+++++    PG+Q  +AGIEA+MG
Sbjct  355  VPGTATEDVAAGLAEVAAVYEAMGDLDESVKLLQKAVRMMDGSVAPGRQGQVAGIEAQMG  414

Query  723  VMFYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEE  544
            V++YMVGRY +A  +F+  VAK+RA GE  SAFFGVVLNQMGL+CVQ F+I EA ELF E
Sbjct  415  VVYYMVGRYGDAYDTFKVVVAKMRAGGEAGSAFFGVVLNQMGLTCVQRFEIKEAVELFAE  474

Query  543  AREILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDD  364
            A+ ILE ECG  H DTLGVYSNLAA YDAMGRV+DAIE+LEYVL +REEKLGTANPD DD
Sbjct  475  AKVILEKECGAFHPDTLGVYSNLAAAYDAMGRVDDAIEMLEYVLGVREEKLGTANPDVDD  534

Query  363  EKKRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWSAFGFRS  217
            EKKRLAELLK AG++RN+KAKSLE L+D  S+R KK+ +++WSA GFRS
Sbjct  535  EKKRLAELLKTAGRARNRKAKSLETLLDTGSQRMKKDVTRRWSALGFRS  583



>ref|XP_002511407.1| kinesin light chain, putative [Ricinus communis]
 gb|EEF52009.1| kinesin light chain, putative [Ricinus communis]
Length=767

 Score =   298 bits (763),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 153/213 (72%), Positives = 182/213 (85%), Gaps = 0/213 (0%)
 Frame = -3

Query  894  PGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMF  715
            PG   EEIASG+T++SAIYE  NE E+A+KLL KALK+  D PGQQSTIAGIEA+MGVM+
Sbjct  549  PGIPPEEIASGLTDVSAIYESMNELEQAIKLLQKALKIYNDAPGQQSTIAGIEAQMGVMY  608

Query  714  YMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEARE  535
            YM+G Y E+ ++F++AV+KLRASGERKSAFFG+ LNQMGL+CVQ + I+EAAELFEEA+ 
Sbjct  609  YMLGNYSESYNTFKNAVSKLRASGERKSAFFGIALNQMGLACVQRYSINEAAELFEEAKS  668

Query  534  ILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKK  355
            ILE ECGP H DTLGVYSNLA TYDAMGR++DAIEILE V+ +REEKLGTANPD DDEKK
Sbjct  669  ILEQECGPYHPDTLGVYSNLAGTYDAMGRLDDAIEILELVVGMREEKLGTANPDVDDEKK  728

Query  354  RLAELLKEAGKSRNKKAKSLENLIDPNSKRTKK  256
            RLAELLKEAG+ R++K +SLENL+D NS    K
Sbjct  729  RLAELLKEAGRVRSRKGRSLENLLDSNSHSIDK  761



>ref|XP_002320874.1| hypothetical protein POPTR_0014s09590g [Populus trichocarpa]
 gb|EEE99189.1| hypothetical protein POPTR_0014s09590g [Populus trichocarpa]
Length=568

 Score =   293 bits (750),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 155/209 (74%), Positives = 179/209 (86%), Gaps = 0/209 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPG  +EEIASG+TEISAIY+  NE EEALKLL  A+KLL+D PGQ S IAGIEA MGVM
Sbjct  360  VPGIATEEIASGLTEISAIYQALNEHEEALKLLDMAMKLLKDTPGQHSMIAGIEAHMGVM  419

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            FY VGRY EARSSF++AVAKLRASG+ +S FFG+VLNQMGL+  QL++IDEAA+LF+EAR
Sbjct  420  FYKVGRYGEARSSFKNAVAKLRASGKTRSVFFGIVLNQMGLASAQLYRIDEAAQLFQEAR  479

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
            EILE ECG CH DT+GVYSNLAATYDAMGRVEDA  ILEY+LKLREEKLGTANP+  DEK
Sbjct  480  EILEQECGSCHLDTIGVYSNLAATYDAMGRVEDATVILEYILKLREEKLGTANPEVADEK  539

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNS  271
            +RLA LLKEAG++R +K  SL NL+D +S
Sbjct  540  ERLAMLLKEAGRARIRKGNSLVNLLDSSS  568



>ref|XP_008360812.1| PREDICTED: uncharacterized protein LOC103424510 [Malus domestica]
Length=730

 Score =   296 bits (758),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 147/209 (70%), Positives = 181/209 (87%), Gaps = 0/209 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            +PG   EE+ASG+T++SAIYE  N+ E+A+KLL KAL +  D PGQQSTIAGIEA+MGVM
Sbjct  511  MPGVPPEEMASGLTDVSAIYESMNDLEQAVKLLQKALXIYNDAPGQQSTIAGIEAQMGVM  570

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +YM+G Y E+  SF+SA++KLRA+GE+K+AFFG+VLNQ+GL+CVQ + I+EA E FEEAR
Sbjct  571  YYMLGSYSESYDSFKSAISKLRATGEKKTAFFGIVLNQIGLACVQRYSINEAQEFFEEAR  630

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILEHECGP H DTLGVYSNLA TYDA GR+EDAIEILEYV+++REEKLGTANPD DDEK
Sbjct  631  TILEHECGPYHPDTLGVYSNLAGTYDATGRLEDAIEILEYVVEMREEKLGTANPDVDDEK  690

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNS  271
            +RLAELLKEAG+ R++K +SLENL+D NS
Sbjct  691  RRLAELLKEAGRDRSRKTRSLENLLDSNS  719



>ref|XP_011038446.1| PREDICTED: kinesin light chain 4-like isoform X1 [Populus euphratica]
Length=568

 Score =   291 bits (746),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 154/209 (74%), Positives = 178/209 (85%), Gaps = 0/209 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            V G+ +EEIASG+TEISAIY+  NE  EALKLL  A+KLL+D PGQ S IAGIEA MGVM
Sbjct  360  VRGSATEEIASGLTEISAIYQALNEHVEALKLLDMAMKLLKDTPGQHSMIAGIEAHMGVM  419

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            FY VGRY EARSSF++AVAKLRASGE +S FFG+VLNQMGL+  QL++IDEAA+LF+EAR
Sbjct  420  FYKVGRYGEARSSFKNAVAKLRASGETRSVFFGIVLNQMGLASAQLYRIDEAAQLFQEAR  479

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
            EILE ECG CH DT+GVYSNLAATYDAMGRVEDA  ILEY+LKLREEKLGTANP+  DEK
Sbjct  480  EILEQECGSCHLDTIGVYSNLAATYDAMGRVEDATVILEYILKLREEKLGTANPEVADEK  539

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNS  271
            +RLA LLKEAG++R +K  SL NL+D +S
Sbjct  540  ERLAMLLKEAGRARIRKGNSLVNLLDSSS  568



>ref|XP_008239759.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103338340 
[Prunus mume]
Length=718

 Score =   295 bits (756),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 149/218 (68%), Positives = 184/218 (84%), Gaps = 0/218 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            +PG   EE+ASG+T++SAIYE  N+ E+A+KLL KALK+  D PGQQSTIAGIEA+MGVM
Sbjct  500  MPGVPPEEMASGLTDVSAIYESMNDLEQAVKLLQKALKIYNDAPGQQSTIAGIEAQMGVM  559

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +YM+G Y E+  SF+SA++KLRA+GE+K+AFFG+VLNQMGL+CVQ + I+EA E FEEAR
Sbjct  560  YYMLGNYSESYDSFKSAISKLRATGEKKTAFFGIVLNQMGLACVQRYSINEAQEFFEEAR  619

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             +LEHECG  H DTLGVYSNLA TYDA GR+EDAIEILEYV+++REEKLGTANPD DDEK
Sbjct  620  TVLEHECGRYHPDTLGVYSNLAGTYDATGRLEDAIEILEYVVEMREEKLGTANPDVDDEK  679

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSK  244
            +RLAELLKEAG+ R++KA+SLENL+D NS     +  K
Sbjct  680  RRLAELLKEAGRVRSRKARSLENLLDANSHSISNDGVK  717



>ref|XP_007211296.1| hypothetical protein PRUPE_ppa001986mg [Prunus persica]
 gb|EMJ12495.1| hypothetical protein PRUPE_ppa001986mg [Prunus persica]
Length=732

 Score =   295 bits (756),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 149/218 (68%), Positives = 184/218 (84%), Gaps = 0/218 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            +PG   EE+ASG+T++SAIYE  N+ E+A+KLL KALK+  D PGQQSTIAGIEA+MGVM
Sbjct  514  MPGVPPEEMASGLTDVSAIYESMNDLEQAVKLLQKALKIYNDAPGQQSTIAGIEAQMGVM  573

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +YM+G Y E+  SF+SA++KLRA+GE+K+AFFG+VLNQMGL+CVQ + I+EA E FEEAR
Sbjct  574  YYMLGNYSESYDSFKSAISKLRATGEKKTAFFGIVLNQMGLACVQRYSINEAQEFFEEAR  633

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             +LEHECG  H DTLGVYSNLA TYDA GR+EDAIEILEYV+++REEKLGTANPD DDEK
Sbjct  634  TVLEHECGRYHPDTLGVYSNLAGTYDATGRLEDAIEILEYVVEMREEKLGTANPDVDDEK  693

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSK  244
            +RLAELLKEAG+ R++KA+SLENL+D NS     +  K
Sbjct  694  RRLAELLKEAGRVRSRKARSLENLLDANSHSISNDGVK  731



>ref|XP_010251264.1| PREDICTED: uncharacterized protein LOC104593203 [Nelumbo nucifera]
Length=740

 Score =   294 bits (753),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 148/218 (68%), Positives = 187/218 (86%), Gaps = 0/218 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            +PG   EEIASG+T++SAIYE  NEPE+AL+LL KAL++ ++ PGQQ+TIAGIEA+MGVM
Sbjct  522  IPGVPPEEIASGLTDVSAIYESMNEPEQALRLLQKALRIYDNSPGQQNTIAGIEAQMGVM  581

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +YM+G Y+++  S ++A+ KLRASGE+KSAFFG+ LNQMGL+CVQ + I+EAA+LFEEAR
Sbjct  582  YYMMGNYNDSYISLKNAITKLRASGEKKSAFFGIALNQMGLACVQRYAINEAADLFEEAR  641

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE E GP H DTLGVYSNLA TYDAMGR++DAIEILEYV+ +REEKLGTANPD DDEK
Sbjct  642  NILEQEYGPYHPDTLGVYSNLAGTYDAMGRLDDAIEILEYVVGMREEKLGTANPDVDDEK  701

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSK  244
            +RL+ELLKEAG+ R++KA+SLE L+D NS  T+K+  K
Sbjct  702  RRLSELLKEAGRVRSRKARSLEALLDTNSHSTEKDVIK  739



>ref|XP_010101208.1| hypothetical protein L484_015012 [Morus notabilis]
 gb|EXB87882.1| hypothetical protein L484_015012 [Morus notabilis]
Length=743

 Score =   294 bits (753),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 152/209 (73%), Positives = 183/209 (88%), Gaps = 0/209 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPG  +EEIASG+T++SAIYE  NE E+ALKLL KALK+  D PGQQSTIAGIEA+MGVM
Sbjct  525  VPGFPAEEIASGLTDVSAIYESMNEIEQALKLLEKALKIYNDAPGQQSTIAGIEAQMGVM  584

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
             YM+G Y E+ +SF++AV+KLRASGE+KSAFFG+ LNQMGL+CVQ + I+EAAELFEEAR
Sbjct  585  HYMLGNYSESYNSFKNAVSKLRASGEKKSAFFGIALNQMGLACVQRYAINEAAELFEEAR  644

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE ECGP H DTLGVYSNLA TYDA+GR++DAIE+LEYV+ +REEKLGTANPD DDEK
Sbjct  645  SILEQECGPYHPDTLGVYSNLAGTYDAVGRLDDAIELLEYVVGMREEKLGTANPDVDDEK  704

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNS  271
            +RLAELLKEAG+ R++KA+SLE L+D N+
Sbjct  705  RRLAELLKEAGRVRSRKARSLETLLDANT  733



>ref|XP_004298939.1| PREDICTED: kinesin light chain 1 [Fragaria vesca subsp. vesca]
Length=732

 Score =   294 bits (752),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 147/218 (67%), Positives = 182/218 (83%), Gaps = 0/218 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            +PG  +EE+ASG+T+I+AIYE  NE E+A+KLL KALK+  D PGQQST+AGIEA+MGVM
Sbjct  514  MPGVPAEEMASGLTDIAAIYESMNELEQAVKLLQKALKIYNDAPGQQSTVAGIEAQMGVM  573

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +YM+G Y E+  SF++A+ KLRA+GE+KSAFFG+VLNQMGL+CVQ + I+EA E FEEAR
Sbjct  574  YYMLGNYSESYESFKNAITKLRATGEKKSAFFGIVLNQMGLACVQRYDINEAQEFFEEAR  633

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             +LE ECGP H DTLGVYSNLA TYDA GR++DAIE+LEYV+ +REEKLGTANPD DDEK
Sbjct  634  TVLEQECGPYHPDTLGVYSNLAGTYDAAGRLDDAIELLEYVVGMREEKLGTANPDVDDEK  693

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSK  244
            +RL ELLKE G+ RN+KA+SLENL+D NS    K+  K
Sbjct  694  RRLTELLKETGRVRNRKARSLENLLDANSHGVNKDGIK  731



>emb|CBI15036.3| unnamed protein product [Vitis vinifera]
Length=651

 Score =   291 bits (746),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 149/218 (68%), Positives = 184/218 (84%), Gaps = 0/218 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            +PG   EEIASG+T++SAIYE  +E E+AL LL KALK+  D PGQQST AGIEA+MGVM
Sbjct  433  IPGIPPEEIASGLTDVSAIYESMDELEQALSLLQKALKIYNDAPGQQSTTAGIEAQMGVM  492

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +YM+G Y ++ +SF++A++KLRASGE+KSAFFG+ LNQMGL+CVQ + I+EAAELFEEAR
Sbjct  493  YYMLGNYSDSYNSFKNAISKLRASGEKKSAFFGIALNQMGLACVQRYAINEAAELFEEAR  552

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
            +ILE E GP H DTLGVYSNLA TYDA+GR++DAIEILE+V+ +REEKLGTANPD DDEK
Sbjct  553  DILEQEYGPYHPDTLGVYSNLAGTYDAVGRLDDAIEILEHVVGMREEKLGTANPDVDDEK  612

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSK  244
            +RLAELLKEAGK RN+KA+SLE L+D NS+    +  K
Sbjct  613  RRLAELLKEAGKVRNRKARSLETLLDVNSQTVNNDDIK  650



>gb|KDO69678.1| hypothetical protein CISIN_1g004812mg [Citrus sinensis]
 gb|KDO69679.1| hypothetical protein CISIN_1g004812mg [Citrus sinensis]
 gb|KDO69680.1| hypothetical protein CISIN_1g004812mg [Citrus sinensis]
Length=727

 Score =   292 bits (748),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 148/210 (70%), Positives = 181/210 (86%), Gaps = 0/210 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPG   EEIASG+T++S+IYE  NE E+A+KLL KALK+  D PGQQST+AGIEA+MGVM
Sbjct  508  VPGVPPEEIASGLTDVSSIYESMNELEQAIKLLQKALKIYNDAPGQQSTVAGIEAQMGVM  567

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +YM+G Y ++  SF++A++KLRA GERKSAFFGV LNQMGL+CVQ + I+EA ELFEEAR
Sbjct  568  YYMLGNYSDSYDSFKNAISKLRAIGERKSAFFGVALNQMGLACVQRYSINEAVELFEEAR  627

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE ECGP H DTLGVYSNLA TYDA+GR++DAIEILE+V+ +REEKLGTANPD DDEK
Sbjct  628  SILEQECGPYHPDTLGVYSNLAGTYDAIGRLDDAIEILEFVVGIREEKLGTANPDVDDEK  687

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSK  268
            +RLAELLKEAG+ R++KA+SLE L+D NS+
Sbjct  688  RRLAELLKEAGRVRSRKAQSLETLLDANSR  717



>ref|XP_009363029.1| PREDICTED: uncharacterized protein LOC103953033 [Pyrus x bretschneideri]
Length=730

 Score =   292 bits (748),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 147/207 (71%), Positives = 180/207 (87%), Gaps = 0/207 (0%)
 Frame = -3

Query  891  GTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMFY  712
            G   EE+ASG+T++SAIYE  N+ E+A+KLL KALK+  D PGQQSTIAGIEA+MGVM+Y
Sbjct  513  GVPPEEMASGLTDVSAIYESMNDLEQAVKLLQKALKIYNDAPGQQSTIAGIEAQMGVMYY  572

Query  711  MVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAREI  532
            M+G Y E+  SF+SA++KLRA+GE+K+AFFG+VLNQ+GL+CVQ + I+EA E FEEAR I
Sbjct  573  MLGSYSESYDSFKSAISKLRATGEKKTAFFGIVLNQIGLACVQRYSINEAQECFEEARTI  632

Query  531  LEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKKR  352
            LEHECGP H DTLGVYSNLA TYDA GR+EDAIEILEYV+++REEKLGTANPD DDEK+R
Sbjct  633  LEHECGPYHPDTLGVYSNLAGTYDATGRLEDAIEILEYVVEMREEKLGTANPDVDDEKRR  692

Query  351  LAELLKEAGKSRNKKAKSLENLIDPNS  271
            LAELLKEAG+ R++K +SLENL+D NS
Sbjct  693  LAELLKEAGRDRSRKTRSLENLLDSNS  719



>ref|XP_006476770.1| PREDICTED: uncharacterized protein LOC102617381 isoform X1 [Citrus 
sinensis]
 ref|XP_006476771.1| PREDICTED: uncharacterized protein LOC102617381 isoform X2 [Citrus 
sinensis]
Length=729

 Score =   292 bits (747),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 148/210 (70%), Positives = 181/210 (86%), Gaps = 0/210 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPG   EEIASG+T++S+IYE  NE E+A+KLL KALK+  D PGQQST+AGIEA+MGVM
Sbjct  508  VPGVPPEEIASGLTDVSSIYESMNELEQAIKLLQKALKIYNDAPGQQSTVAGIEAQMGVM  567

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +YM+G Y ++  SF++A++KLRA GERKSAFFGV LNQMGL+CVQ + I+EA ELFEEAR
Sbjct  568  YYMLGNYSDSYDSFKNAISKLRAIGERKSAFFGVALNQMGLACVQRYSINEAVELFEEAR  627

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE ECGP H DTLGVYSNLA TYDA+GR++DAIEILE+V+ +REEKLGTANPD DDEK
Sbjct  628  SILEQECGPYHPDTLGVYSNLAGTYDAIGRLDDAIEILEFVVGMREEKLGTANPDVDDEK  687

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSK  268
            +RLAELLKEAG+ R++KA+SLE L+D NS+
Sbjct  688  RRLAELLKEAGRVRSRKAQSLETLLDANSR  717



>gb|KDO69674.1| hypothetical protein CISIN_1g004812mg [Citrus sinensis]
 gb|KDO69675.1| hypothetical protein CISIN_1g004812mg [Citrus sinensis]
Length=729

 Score =   292 bits (747),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 148/210 (70%), Positives = 181/210 (86%), Gaps = 0/210 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPG   EEIASG+T++S+IYE  NE E+A+KLL KALK+  D PGQQST+AGIEA+MGVM
Sbjct  508  VPGVPPEEIASGLTDVSSIYESMNELEQAIKLLQKALKIYNDAPGQQSTVAGIEAQMGVM  567

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +YM+G Y ++  SF++A++KLRA GERKSAFFGV LNQMGL+CVQ + I+EA ELFEEAR
Sbjct  568  YYMLGNYSDSYDSFKNAISKLRAIGERKSAFFGVALNQMGLACVQRYSINEAVELFEEAR  627

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE ECGP H DTLGVYSNLA TYDA+GR++DAIEILE+V+ +REEKLGTANPD DDEK
Sbjct  628  SILEQECGPYHPDTLGVYSNLAGTYDAIGRLDDAIEILEFVVGIREEKLGTANPDVDDEK  687

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSK  268
            +RLAELLKEAG+ R++KA+SLE L+D NS+
Sbjct  688  RRLAELLKEAGRVRSRKAQSLETLLDANSR  717



>ref|XP_010663184.1| PREDICTED: uncharacterized protein LOC100255253 [Vitis vinifera]
 ref|XP_010663185.1| PREDICTED: uncharacterized protein LOC100255253 [Vitis vinifera]
Length=738

 Score =   292 bits (747),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 149/218 (68%), Positives = 184/218 (84%), Gaps = 0/218 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            +PG   EEIASG+T++SAIYE  +E E+AL LL KALK+  D PGQQST AGIEA+MGVM
Sbjct  520  IPGIPPEEIASGLTDVSAIYESMDELEQALSLLQKALKIYNDAPGQQSTTAGIEAQMGVM  579

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +YM+G Y ++ +SF++A++KLRASGE+KSAFFG+ LNQMGL+CVQ + I+EAAELFEEAR
Sbjct  580  YYMLGNYSDSYNSFKNAISKLRASGEKKSAFFGIALNQMGLACVQRYAINEAAELFEEAR  639

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
            +ILE E GP H DTLGVYSNLA TYDA+GR++DAIEILE+V+ +REEKLGTANPD DDEK
Sbjct  640  DILEQEYGPYHPDTLGVYSNLAGTYDAVGRLDDAIEILEHVVGMREEKLGTANPDVDDEK  699

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSK  244
            +RLAELLKEAGK RN+KA+SLE L+D NS+    +  K
Sbjct  700  RRLAELLKEAGKVRNRKARSLETLLDVNSQTVNNDDIK  737



>ref|XP_012080075.1| PREDICTED: kinesin light chain [Jatropha curcas]
 ref|XP_012080076.1| PREDICTED: kinesin light chain [Jatropha curcas]
 gb|KDP31106.1| hypothetical protein JCGZ_11482 [Jatropha curcas]
Length=755

 Score =   291 bits (746),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 149/208 (72%), Positives = 181/208 (87%), Gaps = 0/208 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            +PG   EEIASG+T++SAIYE   E E+A+KLL KALK+ ++ PGQQSTIAGIEA+MGVM
Sbjct  536  IPGIPPEEIASGLTDVSAIYESMGELEQAIKLLQKALKIYDNAPGQQSTIAGIEAQMGVM  595

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +YM+G Y E+ +SF++A++KLRASGERKS FFG+ LNQMGL+CVQ F I+EAAELFEEA+
Sbjct  596  YYMLGNYSESYNSFKNAISKLRASGERKSTFFGIALNQMGLACVQRFSINEAAELFEEAK  655

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE ECGP H DTLGVYSNLA TYDAMGR++DAIEILE+V+ +REEKLGTANPD DDEK
Sbjct  656  IILEQECGPYHPDTLGVYSNLAGTYDAMGRLDDAIEILEHVVGMREEKLGTANPDVDDEK  715

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPN  274
            KRLAELLKEAG+ R++KA+SLE L+D N
Sbjct  716  KRLAELLKEAGRVRSRKARSLEKLLDSN  743



>ref|XP_006439809.1| hypothetical protein CICLE_v10019037mg [Citrus clementina]
 gb|ESR53049.1| hypothetical protein CICLE_v10019037mg [Citrus clementina]
Length=727

 Score =   290 bits (741),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 147/210 (70%), Positives = 180/210 (86%), Gaps = 0/210 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPG   EEIASG+T++S+IYE  NE E+A+KLL KALK+  D PGQQST+AGIEA+MGVM
Sbjct  508  VPGVPPEEIASGLTDVSSIYESMNELEQAIKLLQKALKIYNDAPGQQSTVAGIEAQMGVM  567

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +YM+G Y ++  S ++A++KLRA GERKSAFFGV LNQMGL+CVQ + I+EA ELFEEAR
Sbjct  568  YYMLGNYSDSYDSLKNAISKLRAIGERKSAFFGVALNQMGLACVQRYSINEAVELFEEAR  627

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE ECGP H DTLGVYSNLA TYDA+GR++DAIEILE+V+ +REEKLGTANPD DDEK
Sbjct  628  SILEQECGPYHPDTLGVYSNLAGTYDAIGRLDDAIEILEFVVGIREEKLGTANPDVDDEK  687

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSK  268
            +RLAELLKEAG+ R++KA+SLE L+D NS+
Sbjct  688  RRLAELLKEAGRVRSRKAQSLETLLDANSR  717



>ref|XP_008374441.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103437723 
[Malus domestica]
Length=730

 Score =   290 bits (741),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 145/209 (69%), Positives = 178/209 (85%), Gaps = 0/209 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPG   EE+ASG+T++SAIYE  N+ E+A+ LL KALK+  D PGQQSTIAGIEA+MGVM
Sbjct  511  VPGVPPEEMASGLTDVSAIYESMNDLEQAVMLLQKALKIYNDAPGQQSTIAGIEAQMGVM  570

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +YM+G Y E+  SF+SA++KLRA+GE+K+AFFG+VLNQ+GL+CVQ + I EA E FEEAR
Sbjct  571  YYMLGSYSESYDSFKSAISKLRATGEKKTAFFGIVLNQIGLTCVQRYSIYEAQEFFEEAR  630

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILEHECGP H DTLGVY NLA TYDA GR+EDAIEILEYV+++REEKLGTANPD DDEK
Sbjct  631  TILEHECGPYHPDTLGVYGNLAGTYDAAGRLEDAIEILEYVVEMREEKLGTANPDVDDEK  690

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNS  271
            +RL ELLKEAG++R++K +SLENL+  NS
Sbjct  691  RRLGELLKEAGRTRSRKNRSLENLLGSNS  719



>gb|EYU17664.1| hypothetical protein MIMGU_mgv1a002285mg [Erythranthe guttata]
Length=691

 Score =   288 bits (738),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 177/208 (85%), Gaps = 0/208 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            +PG   EEIASG+T+ISAIYE  +E ++ALKLL KALK+  D PGQQ+TIAGIEA+MGVM
Sbjct  469  IPGIAPEEIASGLTDISAIYESMDEVDQALKLLQKALKIYSDVPGQQNTIAGIEAQMGVM  528

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +YM+G Y E+ SSF SA  KLRASGE+KSAFFG+ LNQMGL+CVQ + I+EA  LFEEAR
Sbjct  529  YYMLGNYSESYSSFRSATTKLRASGEKKSAFFGIALNQMGLACVQRYAINEAVGLFEEAR  588

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE ECGP H DTLGVYSNLA TYDA+GR++DAIEILE+++ +REEKLGTANPD DDEK
Sbjct  589  VILEQECGPYHPDTLGVYSNLAGTYDAVGRLDDAIEILEFIVGMREEKLGTANPDVDDEK  648

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPN  274
            KRLAELLKEAG+ R++K +SLENL+D N
Sbjct  649  KRLAELLKEAGRVRSRKNRSLENLLDSN  676



>ref|XP_010243016.1| PREDICTED: uncharacterized protein LOC104587203 [Nelumbo nucifera]
Length=736

 Score =   290 bits (741),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 146/216 (68%), Positives = 183/216 (85%), Gaps = 0/216 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            +PG   EEIASG+T++SAIYE  NE E+ALKLL KAL + ++ PGQQ+TIAGIEA++GVM
Sbjct  518  IPGIPPEEIASGLTDVSAIYESMNELEQALKLLQKALTIYDNAPGQQNTIAGIEAQVGVM  577

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +YM+G Y+++  SF +A+ KLRASGE+KSAFFG+ LNQMGL+CVQ + I+EAA+LFEEAR
Sbjct  578  YYMMGNYNDSYISFSNAITKLRASGEKKSAFFGIALNQMGLACVQRYAINEAADLFEEAR  637

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE E GP H DTLGVYSNLA TYDAMGR++DAIEILEYV+ +REEKLGTANPD DDEK
Sbjct  638  NILEQEYGPYHPDTLGVYSNLAGTYDAMGRLDDAIEILEYVVGMREEKLGTANPDVDDEK  697

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKES  250
            +RLAELLKEAG+ RN+K +SLE L+D N+   K+++
Sbjct  698  RRLAELLKEAGRVRNRKVRSLETLLDTNTHSVKEDA  733



>ref|XP_010678757.1| PREDICTED: uncharacterized protein LOC104894269 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010678758.1| PREDICTED: uncharacterized protein LOC104894269 [Beta vulgaris 
subsp. vulgaris]
Length=716

 Score =   288 bits (738),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 179/208 (86%), Gaps = 0/208 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            +PG   EEIASG T++SAIYE  NE ++A+KLL KALK+  D PGQQST+AGIEA+MGVM
Sbjct  498  IPGIPQEEIASGFTDVSAIYESMNELDQAIKLLQKALKIYGDTPGQQSTVAGIEAQMGVM  557

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +YM+ +Y E+ +SF+SAV KLRASGE+KSAFFG+ LNQMGL+CVQ + I+EAAELFEEAR
Sbjct  558  YYMLEKYTESYNSFKSAVTKLRASGEKKSAFFGIALNQMGLTCVQRYAINEAAELFEEAR  617

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE E GP H DTLGVYSNLA TYDA+GR+++AI +LEYV+ +REEKLGTANPD DDEK
Sbjct  618  SILEQEYGPYHPDTLGVYSNLAGTYDAIGRLDEAIALLEYVVGMREEKLGTANPDVDDEK  677

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPN  274
            +RLAELLKEAGK RN+KA+SLENL+D N
Sbjct  678  RRLAELLKEAGKVRNRKARSLENLLDSN  705



>ref|XP_011101333.1| PREDICTED: uncharacterized protein LOC105179412 isoform X1 [Sesamum 
indicum]
Length=731

 Score =   288 bits (738),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 150/212 (71%), Positives = 177/212 (83%), Gaps = 0/212 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            +PG   EEIASG+T+ISAIYE  +E E+ALKLL KALK+  D PGQQ+TIAGIEA+MGVM
Sbjct  510  IPGIAPEEIASGLTDISAIYESMDELEQALKLLQKALKIYNDAPGQQNTIAGIEAQMGVM  569

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +YM+G Y E+ SSF SA  KLRASGE+KSAFFG+ LNQMGL+CVQ + I+EA +LFEEAR
Sbjct  570  YYMMGNYSESYSSFRSATTKLRASGEKKSAFFGIALNQMGLACVQRYAINEAVDLFEEAR  629

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE E GP H DTLGVYSNLA TYDA+GR++DAIEILE+V+ +REEKLGTANPD DDEK
Sbjct  630  AILEQEYGPYHPDTLGVYSNLAGTYDAVGRLDDAIEILEFVVGMREEKLGTANPDVDDEK  689

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRT  262
            KRLAELLKEAG+ RN+K +SLE L+D N  R 
Sbjct  690  KRLAELLKEAGRVRNRKNRSLETLLDSNQNRN  721



>ref|XP_009380347.1| PREDICTED: uncharacterized protein LOC103968764 [Musa acuminata 
subsp. malaccensis]
Length=728

 Score =   286 bits (733),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 144/217 (66%), Positives = 185/217 (85%), Gaps = 0/217 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            +PGT+SEEIA+G+T++SAIYE  NE E+ALKLL KALK+     GQQSTIAGIEA++GV+
Sbjct  508  IPGTSSEEIAAGLTDVSAIYESMNEHEQALKLLQKALKMYNSSSGQQSTIAGIEAQIGVL  567

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +Y++G Y E+ +SF+SA+AK RA GE+KSAFFG+ LNQMGL+CVQ + ++EA+ELFEEA+
Sbjct  568  YYILGNYGESYASFKSAIAKFRACGEKKSAFFGIALNQMGLACVQRYALNEASELFEEAK  627

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE  CGP H +TLGVY NLA TYDAMGR+++AIEILEY++ LREEKLGTANPD DDEK
Sbjct  628  SILEQVCGPYHSETLGVYGNLAGTYDAMGRLDEAIEILEYIVGLREEKLGTANPDVDDEK  687

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESS  247
            +RLAELLKEAG+ RN+KA+SLE L+D N +  KK+++
Sbjct  688  RRLAELLKEAGRVRNRKARSLETLLDTNPRVVKKDAT  724



>ref|XP_009795408.1| PREDICTED: uncharacterized protein LOC104242106 [Nicotiana sylvestris]
Length=738

 Score =   286 bits (733),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 144/210 (69%), Positives = 183/210 (87%), Gaps = 0/210 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            +PG   EEIA G+T++SAIYE  NE ++ALKLL +ALK+  + PGQQ+TIAGIEA+MGV+
Sbjct  518  IPGIAPEEIACGLTDVSAIYESMNELDQALKLLQRALKIYNNAPGQQNTIAGIEAQMGVI  577

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +YM+G+Y E+ +SF++A++KLRASGE+KSAFFG+ LNQMGL+CVQ + I+EA ELFEEAR
Sbjct  578  YYMLGKYSESYNSFKNAISKLRASGEKKSAFFGIALNQMGLACVQRYAINEAVELFEEAR  637

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE E GP H +TLGVYSNLA TYDA+GR+++AIEILEY++ +REEKLGTANPD DDEK
Sbjct  638  GILEQEYGPYHPETLGVYSNLAGTYDAVGRLDEAIEILEYIVGVREEKLGTANPDVDDEK  697

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSK  268
            KRLAELLKEAG+SRN+KA+SLENL+D N +
Sbjct  698  KRLAELLKEAGRSRNRKARSLENLLDANHR  727



>ref|XP_006647776.1| PREDICTED: uncharacterized protein LOC102714889 [Oryza brachyantha]
Length=710

 Score =   286 bits (732),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 148/217 (68%), Positives = 182/217 (84%), Gaps = 0/217 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            +PGT+ EEIA+G+T++SAIYE  NE E+ALKLL KALK+  +  GQQSTIAGIEA+MGV+
Sbjct  491  IPGTSLEEIATGLTDVSAIYETMNEHEQALKLLQKALKMYNNSAGQQSTIAGIEAQMGVL  550

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
             Y++G Y EA  SF+SA+AKLR  GE+K+AFFGV LNQMGL+CVQ + I+EAAELFEEAR
Sbjct  551  HYILGNYGEAYDSFKSAIAKLRTCGEKKTAFFGVALNQMGLACVQRYSINEAAELFEEAR  610

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             +LE E GP H DTLGVYSNLA TYDAMGR+++AIEILE+V+ +REEKLGTANPD DDEK
Sbjct  611  AVLEQEYGPYHPDTLGVYSNLAGTYDAMGRLDEAIEILEHVVGMREEKLGTANPDVDDEK  670

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESS  247
            +RLAELLKEAG+ R++KAKSLENL++ N     K S+
Sbjct  671  RRLAELLKEAGRGRSRKAKSLENLLETNPYTVTKRST  707



>ref|XP_010936735.1| PREDICTED: uncharacterized protein LOC105056290 [Elaeis guineensis]
Length=729

 Score =   286 bits (733),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 150/217 (69%), Positives = 186/217 (86%), Gaps = 1/217 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            +PGT++EEIASG+T++SAIYE  NE E+ALKLL KALK+ ++  GQQSTIAGIEA+MGV+
Sbjct  511  IPGTSAEEIASGLTDVSAIYESMNEHEQALKLLQKALKMYDNSVGQQSTIAGIEAQMGVL  570

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +Y++G Y E+ +SF++A+ KLRA GE+KSAFFG+ LNQMGL+CVQ + I+EAAELFEEAR
Sbjct  571  YYIIGNYGESYASFKNAITKLRACGEKKSAFFGIALNQMGLACVQRYAINEAAELFEEAR  630

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE E GP HQDTLGV SNLA TYDAMGR+ +AIEILEYV+ +REEKLGTANPD DDEK
Sbjct  631  SILEQEYGPYHQDTLGVCSNLAGTYDAMGRLGEAIEILEYVVGIREEKLGTANPDVDDEK  690

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESS  247
            +RLAELLKEAG+ RN+KA+SLE L+D N +  KKE +
Sbjct  691  RRLAELLKEAGRVRNRKARSLETLLDTN-QNIKKEDA  726



>ref|XP_004953633.1| PREDICTED: uncharacterized protein LOC101762075 isoform X1 [Setaria 
italica]
 ref|XP_004953634.1| PREDICTED: uncharacterized protein LOC101762075 isoform X2 [Setaria 
italica]
Length=711

 Score =   285 bits (728),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 147/217 (68%), Positives = 181/217 (83%), Gaps = 0/217 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            +PGT+ EEIA+G+T++SAIYE  NE E+ALKLL KALK+  +  GQQSTIAGIEA+MGV+
Sbjct  492  IPGTSLEEIATGLTDVSAIYETMNEHEQALKLLQKALKMYNNSAGQQSTIAGIEAQMGVL  551

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
             Y++G Y EA  SF+SA+AKLR  GE+KSAFFG+ LNQMGL+CVQ + I+EAAELFEEAR
Sbjct  552  HYILGNYGEAYDSFKSAIAKLRTCGEKKSAFFGIALNQMGLACVQRYSINEAAELFEEAR  611

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             +LE E GP H DTLGVYSNLA TYDAMGR+++AIEILEYV+ +REEKLGTANPD DDEK
Sbjct  612  TVLEQEYGPYHPDTLGVYSNLAGTYDAMGRLDEAIEILEYVVGMREEKLGTANPDVDDEK  671

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESS  247
            +RL ELLKEAG+ R++KAKSLENL++ N     K ++
Sbjct  672  RRLGELLKEAGRVRSRKAKSLENLLETNPYTVTKRNT  708



>ref|XP_009627990.1| PREDICTED: uncharacterized protein LOC104118460 [Nicotiana tomentosiformis]
Length=738

 Score =   285 bits (729),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 144/208 (69%), Positives = 182/208 (88%), Gaps = 0/208 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            +PG   EEIA G+T++SAIYE  +E ++ALKLL +ALK+  + PGQQ+TIAGIEA+MGV+
Sbjct  518  IPGIAPEEIACGLTDVSAIYESMSELDQALKLLQRALKIYNNAPGQQNTIAGIEAQMGVI  577

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            FYM+G+Y E+ +SF+SA++KLRASGE+KSAFFG+ LNQMGL+CVQ + I+EA ELFEEAR
Sbjct  578  FYMLGKYSESYNSFKSAISKLRASGEKKSAFFGIALNQMGLACVQRYAINEAVELFEEAR  637

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             I+E E GP H +TLGVYSNLA TYDA+GR+++AIEILEY++ +REEKLGTANPD DDEK
Sbjct  638  GIMEQEYGPYHPETLGVYSNLAGTYDAVGRLDEAIEILEYIVGVREEKLGTANPDVDDEK  697

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPN  274
            KRLAELLKEAG+SRN+KA+SLENL+D N
Sbjct  698  KRLAELLKEAGRSRNRKARSLENLLDAN  725



>ref|NP_001047883.1| Os02g0708400 [Oryza sativa Japonica Group]
 gb|AAL87157.1|AF480496_11 putative kinesin light chain gene [Oryza sativa Japonica Group]
 dbj|BAD08110.1| putative kinesin light chain [Oryza sativa Japonica Group]
 dbj|BAF09797.1| Os02g0708400 [Oryza sativa Japonica Group]
 dbj|BAG90897.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC73865.1| hypothetical protein OsI_08639 [Oryza sativa Indica Group]
 gb|EEE57657.1| hypothetical protein OsJ_08096 [Oryza sativa Japonica Group]
Length=711

 Score =   284 bits (726),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 147/217 (68%), Positives = 181/217 (83%), Gaps = 0/217 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            +PGT+ EEIA+G+T++SAIYE  NE E+ALKLL KALK+  +  GQQSTIAGIEA+MGV+
Sbjct  492  IPGTSLEEIATGLTDVSAIYETMNEHEQALKLLQKALKMYNNSAGQQSTIAGIEAQMGVL  551

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
             Y++G Y EA  SF+SA+AKLR  GE+K+AFFGV LNQMGL+CVQ + I+EAAELFEEAR
Sbjct  552  HYILGNYGEAYDSFKSAIAKLRTCGEKKTAFFGVALNQMGLACVQRYSINEAAELFEEAR  611

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             +LE E GP H DTLGVYSNLA TYDAMGR+++AIEILE+V+ +REEKLGTANPD DDEK
Sbjct  612  AVLEQEYGPYHPDTLGVYSNLAGTYDAMGRLDEAIEILEHVVGMREEKLGTANPDVDDEK  671

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESS  247
            +RLAELLKEAG+ R++KAKSLENL++ N     K  +
Sbjct  672  RRLAELLKEAGRGRSRKAKSLENLLETNPYTVTKRGT  708



>ref|XP_008782452.1| PREDICTED: uncharacterized protein LOC103701984 [Phoenix dactylifera]
Length=729

 Score =   283 bits (725),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 146/216 (68%), Positives = 183/216 (85%), Gaps = 0/216 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            +PGT++EEIASG+T++SAIYE  NE E+ALKLL KALK+  +  GQQSTIAGIEA+MGV+
Sbjct  511  IPGTSAEEIASGLTDVSAIYESMNEHEQALKLLQKALKMYNNSAGQQSTIAGIEAQMGVL  570

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +Y++G Y E+ +SF++A+ KLRA GE+KSAFFG+ LNQMGL+CVQ + I+EAA LFEEAR
Sbjct  571  YYIIGNYGESYASFKNAITKLRACGEKKSAFFGIALNQMGLACVQRYAINEAAGLFEEAR  630

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE E GP H DTLGV SNLA TYDAMGR+++AIEILEYV+ +REEKLGTANPD DDEK
Sbjct  631  SILEQEYGPYHHDTLGVCSNLAGTYDAMGRLDEAIEILEYVVGIREEKLGTANPDVDDEK  690

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKES  250
            +RLAELLKEAG+ RN+KA+SLE L+D N    K+++
Sbjct  691  RRLAELLKEAGRVRNRKARSLETLLDANQNIKKEDA  726



>gb|ABR16125.1| unknown [Picea sitchensis]
Length=824

 Score =   285 bits (730),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 150/207 (72%), Positives = 179/207 (86%), Gaps = 0/207 (0%)
 Frame = -3

Query  891  GTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMFY  712
            G   E+IA G+TE+SAIYE  +EPE+AL+LL KALK+L+D PGQQS IAGIEA+MGV++Y
Sbjct  609  GHPPEDIAGGLTELSAIYEAMSEPEQALRLLQKALKILDDAPGQQSAIAGIEAQMGVIYY  668

Query  711  MVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAREI  532
            ++G+Y E+ SSF+SAVAKLRASGERKS+FFGVVLNQMGL+CVQ + I+EAA+LFEEAR I
Sbjct  669  ILGKYGESYSSFKSAVAKLRASGERKSSFFGVVLNQMGLACVQRYAINEAADLFEEARSI  728

Query  531  LEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKKR  352
            LE   G  H DTL VYSNLA TYDAMGR+EDAI +LEYV+ +REEKLGTANPD DDEKKR
Sbjct  729  LEEVSGQYHPDTLAVYSNLAGTYDAMGRLEDAIGVLEYVVGMREEKLGTANPDVDDEKKR  788

Query  351  LAELLKEAGKSRNKKAKSLENLIDPNS  271
            LAELLKEAG++RN+KAKSLE L+  NS
Sbjct  789  LAELLKEAGRARNRKAKSLETLLQSNS  815



>ref|XP_003570205.1| PREDICTED: uncharacterized protein LOC100826447 [Brachypodium 
distachyon]
 gb|ACF22694.1| kinesin light chain [Brachypodium distachyon]
Length=711

 Score =   283 bits (724),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 146/217 (67%), Positives = 181/217 (83%), Gaps = 0/217 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            +PGT+ EEIA+G+T++SAIYE  NE ++ALKLL KALK+  +  GQQSTIAGIEA++GV+
Sbjct  492  IPGTSLEEIATGLTDVSAIYETMNEHDQALKLLQKALKMYNNSAGQQSTIAGIEAQIGVL  551

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
             Y+ G Y EA +SF+SA+ KLR  GE+KSAFFG+ LNQMGL+CVQ + I+EAAELFEEAR
Sbjct  552  QYISGNYGEAYNSFKSAITKLRTCGEKKSAFFGIALNQMGLACVQRYSINEAAELFEEAR  611

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             +LE E GP H DTLGVYSNLA TYDAMGR+++AIEILEYV+ +REEKLGTANPD DDEK
Sbjct  612  TVLEQEYGPYHPDTLGVYSNLAGTYDAMGRLDEAIEILEYVVGMREEKLGTANPDVDDEK  671

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESS  247
            +RLAELLKEAG+ R++KAKSLENL++ N     K S+
Sbjct  672  RRLAELLKEAGRGRSRKAKSLENLLETNPYTVTKRST  708



>ref|XP_002452671.1| hypothetical protein SORBIDRAFT_04g030360 [Sorghum bicolor]
 gb|EES05647.1| hypothetical protein SORBIDRAFT_04g030360 [Sorghum bicolor]
Length=713

 Score =   283 bits (723),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 146/217 (67%), Positives = 181/217 (83%), Gaps = 0/217 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            +PGT+ EEIA+G+T++SAIYE  NE E+ALKLL KALK+  +  GQQSTIAGIEA+MGV+
Sbjct  494  IPGTSLEEIATGLTDVSAIYETMNEHEQALKLLQKALKMYNNSAGQQSTIAGIEAQMGVL  553

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
             Y++G Y E+  SF+SA+AKLR  GE+KSAFFG+ LNQMGL+CVQ + I+EAAELFEEAR
Sbjct  554  HYILGNYGESYDSFKSAIAKLRTCGEKKSAFFGIALNQMGLACVQRYSINEAAELFEEAR  613

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             +LE E GP H DTLGVYSNLA TYDAMGR+++AIEILEYV+ +REEKLGTANPD DDEK
Sbjct  614  TVLEQEYGPYHPDTLGVYSNLAGTYDAMGRLDEAIEILEYVVGMREEKLGTANPDVDDEK  673

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESS  247
            +RL ELLKEAG+ R++KAKSLENL++ N     K ++
Sbjct  674  RRLGELLKEAGRVRSRKAKSLENLLETNPYTATKRNA  710



>ref|XP_006345055.1| PREDICTED: kinesin light chain-like [Solanum tuberosum]
Length=730

 Score =   283 bits (723),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 144/210 (69%), Positives = 182/210 (87%), Gaps = 0/210 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            +PG   EEIA+G+T++SAIYE  NE ++ALKLL KALK+  + PGQQSTIAGIEA+MGV+
Sbjct  510  IPGIAPEEIANGLTDVSAIYESMNELDQALKLLQKALKIYNNAPGQQSTIAGIEAQMGVI  569

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +YM+G+Y E+ +SF+SA++KLRASGE+KSAFFGV LNQMGL+CVQ + I+EA ELFEE++
Sbjct  570  YYMLGKYSESYNSFKSAISKLRASGEKKSAFFGVALNQMGLACVQRYAINEAVELFEESK  629

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE E GP H +TLGVYSNLA TYDA+GR+++AIEILEY++ +REEKLGTANPD  DEK
Sbjct  630  GILEQEYGPYHPETLGVYSNLAGTYDAVGRLDEAIEILEYIVGVREEKLGTANPDVADEK  689

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSK  268
            KRLAELLKEAG+ RN+KA+SLENL+D N +
Sbjct  690  KRLAELLKEAGRVRNRKARSLENLLDANHR  719



>ref|XP_010028340.1| PREDICTED: tetratricopeptide repeat protein 28 [Eucalyptus grandis]
 ref|XP_010028348.1| PREDICTED: tetratricopeptide repeat protein 28 [Eucalyptus grandis]
 ref|XP_010028356.1| PREDICTED: tetratricopeptide repeat protein 28 [Eucalyptus grandis]
 gb|KCW83451.1| hypothetical protein EUGRSUZ_B00370 [Eucalyptus grandis]
Length=751

 Score =   283 bits (723),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 145/206 (70%), Positives = 177/206 (86%), Gaps = 0/206 (0%)
 Frame = -3

Query  891  GTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMFY  712
            G   EE A+G+T++SAIYE  NE EEA+KLL KALK+  D PGQQST+AGIEA+MGVM+Y
Sbjct  535  GIPPEEFATGLTDVSAIYESMNELEEAIKLLEKALKIYNDAPGQQSTVAGIEAQMGVMYY  594

Query  711  MVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAREI  532
            M+G Y ++ +SF +A+ KLRASGERKSAFFG+ LNQMGL+CVQ + I+EAAELFEEA+ I
Sbjct  595  MLGNYSDSYASFNNAITKLRASGERKSAFFGIALNQMGLACVQRYAINEAAELFEEAKNI  654

Query  531  LEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKKR  352
            LE E GP H DTLGVYSNLA TYDA+GR++DAI+ILEYV+++REEKLGTANPD DDEK+R
Sbjct  655  LEEEYGPYHPDTLGVYSNLAGTYDAIGRLDDAIKILEYVVEMREEKLGTANPDVDDEKRR  714

Query  351  LAELLKEAGKSRNKKAKSLENLIDPN  274
            LAELLKEAGK R++K +SLENL+D N
Sbjct  715  LAELLKEAGKVRSRKGRSLENLLDAN  740



>gb|AFW73049.1| kinesin light chain [Zea mays]
Length=713

 Score =   282 bits (721),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 145/208 (70%), Positives = 178/208 (86%), Gaps = 0/208 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            +PGT+ EEIA+G+T++SAIYE  NE E+ALKLL KALK+  +  GQQSTIAGIEA+MGV+
Sbjct  494  IPGTSLEEIATGLTDVSAIYETMNEHEQALKLLQKALKMYNNSAGQQSTIAGIEAQMGVL  553

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
             Y++G Y E+  SF+SA+AKLR  GE+KSAFFG+ LNQMGL+CVQ + I+EAAELFEEAR
Sbjct  554  HYILGNYGESYDSFKSAIAKLRTCGEKKSAFFGIALNQMGLACVQRYSINEAAELFEEAR  613

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             +LE E GP H DTLGVYSNLA TYDAMGR+++AIEILEYV+ +REEKLGTANPD DDEK
Sbjct  614  TVLEQEYGPYHPDTLGVYSNLAGTYDAMGRLDEAIEILEYVVGMREEKLGTANPDVDDEK  673

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPN  274
            +RL ELLKEAG+ R++KAKSLENL++ N
Sbjct  674  RRLGELLKEAGRVRSRKAKSLENLLETN  701



>ref|NP_001130826.1| hypothetical protein [Zea mays]
 gb|ACF79192.1| unknown [Zea mays]
 gb|AFW63564.1| hypothetical protein ZEAMMB73_255866 [Zea mays]
Length=713

 Score =   282 bits (721),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 145/208 (70%), Positives = 178/208 (86%), Gaps = 0/208 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            +PGT+ EEIA+G+T++SAIYE  NE E+ALKLL KALK+  +  GQQSTIAGIEA+MGV+
Sbjct  494  IPGTSLEEIATGLTDVSAIYETMNEHEQALKLLQKALKMYNNSAGQQSTIAGIEAQMGVL  553

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
             Y++G Y E+  SF+SA+AKLR  GE+KSAFFG+ LNQMGL+CVQ + I+EAAELFEEAR
Sbjct  554  HYILGNYGESYDSFKSAIAKLRTCGEKKSAFFGIALNQMGLACVQRYSINEAAELFEEAR  613

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             +LE E GP H DTLGVYSNLA TYDAMGR+++AIEILEYV+ +REEKLGTANPD DDEK
Sbjct  614  TVLEQEYGPYHPDTLGVYSNLAGTYDAMGRLDEAIEILEYVVGMREEKLGTANPDVDDEK  673

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPN  274
            +RL ELLKEAG+ R++KAKSLENL++ N
Sbjct  674  RRLGELLKEAGRVRSRKAKSLENLLETN  701



>ref|NP_001147329.1| kinesin light chain [Zea mays]
 gb|ACG26820.1| kinesin light chain [Zea mays]
Length=713

 Score =   281 bits (720),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 145/208 (70%), Positives = 178/208 (86%), Gaps = 0/208 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            +PGT+ EEIA+G+T++SAIYE  NE E+ALKLL KALK+  +  GQQSTIAGIEA+MGV+
Sbjct  494  IPGTSLEEIATGLTDVSAIYETMNEHEQALKLLQKALKMYNNSAGQQSTIAGIEAQMGVL  553

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
             Y++G Y E+  SF+SA+AKLR  GE+KSAFFG+ LNQMGL+CVQ + I+EAAELFEEAR
Sbjct  554  HYILGNYGESYDSFKSAIAKLRTCGEKKSAFFGIALNQMGLACVQRYSINEAAELFEEAR  613

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             +LE E GP H DTLGVYSNLA TYDAMGR+++AIEILEYV+ +REEKLGTANPD DDEK
Sbjct  614  TVLEQEYGPYHPDTLGVYSNLAGTYDAMGRLDEAIEILEYVVGMREEKLGTANPDVDDEK  673

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPN  274
            +RL ELLKEAG+ R++KAKSLENL++ N
Sbjct  674  RRLGELLKEAGRVRSRKAKSLENLLETN  701



>ref|XP_010108770.1| hypothetical protein L484_020503 [Morus notabilis]
 gb|EXC20285.1| hypothetical protein L484_020503 [Morus notabilis]
Length=733

 Score =   282 bits (721),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 145/214 (68%), Positives = 181/214 (85%), Gaps = 0/214 (0%)
 Frame = -3

Query  894  PGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMF  715
            PG  SEEI+SG  ++SAIY+  NE E+ALKLL KALK+  D PGQQ+TIAGIEA+MGVM+
Sbjct  515  PGIPSEEISSGFIDVSAIYQSMNELEQALKLLKKALKIFGDAPGQQNTIAGIEAQMGVMY  574

Query  714  YMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEARE  535
            YM+G Y ++ ++F+SAV K RAS E+KSA FG+ LNQMGL+CVQ + I+EAAELFEEAR 
Sbjct  575  YMMGNYSDSYNTFKSAVTKFRASAEKKSALFGIALNQMGLACVQRYSINEAAELFEEARS  634

Query  534  ILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKK  355
            ILE E GP H DTLGVYSNLA TYDAMGR++DAIE+LEYV+ +RE+KLGTANPD DDEK+
Sbjct  635  ILEKEYGPYHPDTLGVYSNLAGTYDAMGRLDDAIELLEYVVGMREDKLGTANPDVDDEKR  694

Query  354  RLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKE  253
            RLAELLKEAG++RN+KA+SLE L+D N++  K++
Sbjct  695  RLAELLKEAGRARNRKARSLETLLDTNAQVVKED  728



>emb|CBI34925.3| unnamed protein product [Vitis vinifera]
Length=670

 Score =   280 bits (717),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 145/217 (67%), Positives = 177/217 (82%), Gaps = 0/217 (0%)
 Frame = -3

Query  894  PGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMF  715
            PG  SEEIASG+ +ISAI+E  NE E+ALKLL KALK+  + PGQQSTIAGIEA+MGV++
Sbjct  452  PGIPSEEIASGLIDISAIFESMNELEQALKLLQKALKIYGNAPGQQSTIAGIEAQMGVIY  511

Query  714  YMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEARE  535
            YM+G Y  + +SF  A++KLRASGE+KSAF G+ LNQMGL+CVQ + I EAAELFEEAR 
Sbjct  512  YMMGNYSASYNSFSCAISKLRASGEKKSAFLGIALNQMGLACVQRYAIGEAAELFEEARS  571

Query  534  ILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKK  355
            ILE E GPCH DTLG+YSNLA TYDAMGR+EDAIEILEYV+ +REEKLGTANPD DDEK+
Sbjct  572  ILEKEYGPCHPDTLGIYSNLAGTYDAMGRLEDAIEILEYVVGVREEKLGTANPDVDDEKR  631

Query  354  RLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSK  244
            RL ELL EAG+ R++K +SL+  +D N + T  ++ K
Sbjct  632  RLTELLTEAGRVRSRKTRSLQTFLDTNPQTTINDAIK  668



>gb|EMT08479.1| Nephrocystin-3 [Aegilops tauschii]
Length=679

 Score =   280 bits (717),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 146/216 (68%), Positives = 181/216 (84%), Gaps = 4/216 (2%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            +PGT+ EEIA+G+T++SAIYE  NE ++ALKLL KALK+  +  GQQSTIAGIEA++GV+
Sbjct  460  IPGTSLEEIATGLTDVSAIYETMNEHDQALKLLQKALKMYNNSAGQQSTIAGIEAQIGVL  519

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
             Y+ G Y +A  SF+SA+ KLR  GE+KSAFFG+ LNQMGL+CVQ + I+EAAELFEEAR
Sbjct  520  HYISGNYGDAYDSFKSAITKLRTCGEKKSAFFGIALNQMGLACVQRYSINEAAELFEEAR  579

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             +LE E GP H DTLGVYSNLA TYDAMGR+++AIEILEYV+++REEKLGTANPD DDEK
Sbjct  580  TVLEQEYGPYHADTLGVYSNLAGTYDAMGRLDEAIEILEYVVEMREEKLGTANPDVDDEK  639

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPN----SKRT  262
            +RLAELLKEAG+ R++KAKSLENL++ N     KRT
Sbjct  640  RRLAELLKEAGRGRSRKAKSLENLLETNPYTIGKRT  675



>gb|EMS45896.1| Nephrocystin-3 [Triticum urartu]
Length=678

 Score =   280 bits (717),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 146/216 (68%), Positives = 181/216 (84%), Gaps = 4/216 (2%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            +PGT+ EEIA+G+T++SAIYE  NE ++ALKLL KALK+  +  GQQSTIAGIEA++GV+
Sbjct  459  IPGTSLEEIATGLTDVSAIYETMNEHDQALKLLQKALKMYNNSAGQQSTIAGIEAQIGVL  518

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
             Y+ G Y +A  SF+SA+ KLR  GE+KSAFFG+ LNQMGL+CVQ + I+EAAELFEEAR
Sbjct  519  HYISGNYGDAYDSFKSAITKLRTCGEKKSAFFGIALNQMGLACVQRYSINEAAELFEEAR  578

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             +LE E GP H DTLGVYSNLA TYDAMGR+++AIEILEYV+++REEKLGTANPD DDEK
Sbjct  579  TVLEQEYGPYHADTLGVYSNLAGTYDAMGRLDEAIEILEYVVEMREEKLGTANPDVDDEK  638

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPN----SKRT  262
            +RLAELLKEAG+ R++KAKSLENL++ N     KRT
Sbjct  639  RRLAELLKEAGRGRSRKAKSLENLLETNPYTIGKRT  674



>gb|AAM13438.1|AF474071_1 similar to A. thaliana protein BAB01483 similar to kinesin light 
chain [Hordeum vulgare subsp. vulgare]
Length=708

 Score =   281 bits (719),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 144/217 (66%), Positives = 180/217 (83%), Gaps = 0/217 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            +PGT+ EEIA+G+T++SAIYE  NE ++ALKLL KALK+  +  GQQSTIAGIEA++GV+
Sbjct  489  IPGTSLEEIATGLTDVSAIYETMNEHDQALKLLQKALKMYNNSAGQQSTIAGIEAQIGVL  548

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
             Y+ G Y +A  SF+SA+ KLR  GE+KSAFFG+ LNQMGL+CVQ + I+EAAELFEEAR
Sbjct  549  HYISGNYGDAYDSFKSAITKLRTCGEKKSAFFGIALNQMGLACVQRYSINEAAELFEEAR  608

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             +LE E GP H DTLGVYSNLA TYDAMGR+++AIEILEYV+++REEKLGTANPD DDEK
Sbjct  609  TVLEQEYGPYHADTLGVYSNLAGTYDAMGRLDEAIEILEYVVEMREEKLGTANPDVDDEK  668

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESS  247
            +RLAELLKEAG+ R++KAKSLENL+  N     K ++
Sbjct  669  RRLAELLKEAGRGRSRKAKSLENLLGTNPYTVGKRTT  705



>dbj|BAJ98431.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=708

 Score =   281 bits (718),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 144/217 (66%), Positives = 179/217 (82%), Gaps = 0/217 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            +PGT+ EEIA+G+T++SAIYE  NE ++ALKLL KALK+  +  GQQSTIAGIEA++GV+
Sbjct  489  IPGTSLEEIATGLTDVSAIYETMNEHDQALKLLQKALKMYNNSAGQQSTIAGIEAQIGVL  548

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
             Y+ G Y +A  SF SA+ KLR  GE+KSAFFG+ LNQMGL+CVQ + I+EAAELFEEAR
Sbjct  549  HYISGNYGDAYDSFNSAITKLRTCGEKKSAFFGIALNQMGLACVQRYSINEAAELFEEAR  608

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             +LE E GP H DTLGVYSNLA TYDAMGR+++AIEILEYV+++REEKLGTANPD DDEK
Sbjct  609  TVLEQEYGPYHADTLGVYSNLAGTYDAMGRLDEAIEILEYVVEMREEKLGTANPDVDDEK  668

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESS  247
            +RLAELLKEAG+ R++KAKSLENL+  N     K ++
Sbjct  669  RRLAELLKEAGRGRSRKAKSLENLLGTNPYTVGKRTT  705



>ref|XP_008453093.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103493911 
[Cucumis melo]
Length=737

 Score =   281 bits (718),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 144/209 (69%), Positives = 177/209 (85%), Gaps = 0/209 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPG   EEIASG+T+I+AIYE  NE E+A+KLL KALK+  D PGQQ+TIAGIEA+MGV+
Sbjct  519  VPGIPPEEIASGLTDIAAIYESMNEVEQAVKLLHKALKIYNDAPGQQNTIAGIEAQMGVL  578

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +YM+G Y E+ +SF +A+ KLR SGE+KSAFFG+ LNQMGL CVQ + I+EA ELFEEA+
Sbjct  579  YYMLGNYSESYNSFNNAIPKLRNSGEKKSAFFGIALNQMGLVCVQKYAINEAVELFEEAK  638

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE E GP H DTLGVYSNLA TYDA+GR++DAIEILEYV+ +REEKLGTANPD DDEK
Sbjct  639  SILEQEYGPYHPDTLGVYSNLAGTYDAIGRLDDAIEILEYVVGMREEKLGTANPDVDDEK  698

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNS  271
            +RL+ELLKEAG+ R++KA+SLE L+D N+
Sbjct  699  RRLSELLKEAGRVRSRKARSLETLLDANA  727



>ref|XP_010318909.1| PREDICTED: uncharacterized protein LOC104646605 [Solanum lycopersicum]
 ref|XP_010318910.1| PREDICTED: uncharacterized protein LOC104646605 [Solanum lycopersicum]
Length=730

 Score =   281 bits (718),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 142/210 (68%), Positives = 182/210 (87%), Gaps = 0/210 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            +PG   EEIA+G+T++SAIYE  NE ++ALKLL +ALK+  + PGQQ+TIAGIEA+MGV+
Sbjct  510  IPGIAPEEIANGLTDVSAIYESMNELDQALKLLQRALKIYNNAPGQQNTIAGIEAQMGVI  569

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +YM+G+Y E+ +SF+SA++KLRASGE+KSAFFGV LNQMGL+CVQ + I+EA ELFEE++
Sbjct  570  YYMLGKYSESYNSFKSAISKLRASGEKKSAFFGVALNQMGLACVQRYAINEAVELFEESK  629

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE E GP H +TLGVYSNLA TYDA+GR+++AIEILEY++ +REEKLGTANPD  DEK
Sbjct  630  VILEQEYGPYHPETLGVYSNLAGTYDAVGRLDEAIEILEYIVGVREEKLGTANPDVADEK  689

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSK  268
            KRLAELLKEAG+ RN+KA+SLENL+D N +
Sbjct  690  KRLAELLKEAGRVRNRKARSLENLLDANHR  719



>ref|XP_007036200.1| Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
 ref|XP_007036201.1| Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY20701.1| Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY20702.1| Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
Length=733

 Score =   281 bits (718),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 143/218 (66%), Positives = 179/218 (82%), Gaps = 0/218 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            +PG   EEIASG+T++SAIYE  N+ ++A+KLL +ALK+ +D PGQQ+T AGIEA+MGVM
Sbjct  515  MPGIPPEEIASGLTDVSAIYESMNDLDQAIKLLQRALKIYDDAPGQQTTTAGIEAQMGVM  574

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +YM+G Y E+ +SF+SA++KLR  GERKSAFFG+ LNQMGL+CVQ + I+EA ELFEEA+
Sbjct  575  YYMLGNYSESYNSFKSAISKLRGCGERKSAFFGIALNQMGLACVQRYSINEAVELFEEAK  634

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE  CGP H DTLGV SNLA TYDA+GR++DAIEILEYV+++REEKLGTANP+  DEK
Sbjct  635  SILEQACGPYHPDTLGVCSNLAGTYDAIGRLDDAIEILEYVVEMREEKLGTANPEVYDEK  694

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSK  244
            KRLAELLKEAGK R++KA+SLE L+D N      E  K
Sbjct  695  KRLAELLKEAGKVRSRKARSLETLLDDNPPNVNGEGIK  732



>ref|XP_004138111.1| PREDICTED: uncharacterized protein LOC101208453 [Cucumis sativus]
 ref|XP_011657335.1| PREDICTED: uncharacterized protein LOC101208453 [Cucumis sativus]
 gb|KGN63584.1| hypothetical protein Csa_1G004960 [Cucumis sativus]
Length=736

 Score =   280 bits (717),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 144/209 (69%), Positives = 177/209 (85%), Gaps = 0/209 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPG   EEIASG+T+I+AIYE  NE E+A+KLL KALK+  D PGQQ+TIAGIEA+MGV+
Sbjct  518  VPGIPPEEIASGLTDIAAIYESMNEVEQAVKLLHKALKIYNDAPGQQNTIAGIEAQMGVL  577

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +YM+G Y E+ +SF +A+ KLR SGE+KSAFFG+ LNQMGL CVQ + I+EA ELFEEA+
Sbjct  578  YYMLGNYSESYNSFNNAIPKLRNSGEKKSAFFGIALNQMGLVCVQKYAINEAVELFEEAK  637

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE E GP H DTLGVYSNLA TYDA+GR++DAIEILEYV+ +REEKLGTANPD DDEK
Sbjct  638  SILEQEYGPYHPDTLGVYSNLAGTYDAIGRLDDAIEILEYVVGMREEKLGTANPDVDDEK  697

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNS  271
            +RL+ELLKEAG+ R++KA+SLE L+D N+
Sbjct  698  RRLSELLKEAGRVRSRKARSLETLLDANA  726



>ref|XP_006844980.1| PREDICTED: uncharacterized protein LOC18434854 isoform X1 [Amborella 
trichopoda]
 gb|ERN06655.1| hypothetical protein AMTR_s00058p00186720 [Amborella trichopoda]
Length=785

 Score =   281 bits (720),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 151/213 (71%), Positives = 180/213 (85%), Gaps = 0/213 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            + G   EEIASG+TE+SAIYE  NEPEEALKLL +ALKLLED PGQQS +AGIEA+MGVM
Sbjct  565  IAGNPMEEIASGLTEVSAIYEAMNEPEEALKLLQRALKLLEDSPGQQSAVAGIEAQMGVM  624

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +YM+G Y E+  SF++AV KLRASGE++SAF G+VLNQMGL+CVQ + I+EA  LFEEAR
Sbjct  625  YYMMGNYGESYISFKNAVEKLRASGEKRSAFLGIVLNQMGLACVQRYAINEAMVLFEEAR  684

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             +LE E GP H DTLGVYSNLA TYDAMGR+EDAIEILEYVL +REEKLGTA+PD D+EK
Sbjct  685  AVLEQEYGPYHPDTLGVYSNLAGTYDAMGRLEDAIEILEYVLGIREEKLGTAHPDVDEEK  744

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTK  259
            +RLAELL+EAG+ R++KAKSLE L+  NS+  K
Sbjct  745  RRLAELLREAGRVRSRKAKSLETLLVSNSQAIK  777



>ref|XP_011623634.1| PREDICTED: uncharacterized protein LOC18434854 isoform X2 [Amborella 
trichopoda]
Length=780

 Score =   281 bits (719),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 151/213 (71%), Positives = 180/213 (85%), Gaps = 0/213 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            + G   EEIASG+TE+SAIYE  NEPEEALKLL +ALKLLED PGQQS +AGIEA+MGVM
Sbjct  560  IAGNPMEEIASGLTEVSAIYEAMNEPEEALKLLQRALKLLEDSPGQQSAVAGIEAQMGVM  619

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +YM+G Y E+  SF++AV KLRASGE++SAF G+VLNQMGL+CVQ + I+EA  LFEEAR
Sbjct  620  YYMMGNYGESYISFKNAVEKLRASGEKRSAFLGIVLNQMGLACVQRYAINEAMVLFEEAR  679

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             +LE E GP H DTLGVYSNLA TYDAMGR+EDAIEILEYVL +REEKLGTA+PD D+EK
Sbjct  680  AVLEQEYGPYHPDTLGVYSNLAGTYDAMGRLEDAIEILEYVLGIREEKLGTAHPDVDEEK  739

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTK  259
            +RLAELL+EAG+ R++KAKSLE L+  NS+  K
Sbjct  740  RRLAELLREAGRVRSRKAKSLETLLVSNSQAIK  772



>ref|XP_011623635.1| PREDICTED: uncharacterized protein LOC18434854 isoform X3 [Amborella 
trichopoda]
Length=777

 Score =   281 bits (719),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 151/213 (71%), Positives = 180/213 (85%), Gaps = 0/213 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            + G   EEIASG+TE+SAIYE  NEPEEALKLL +ALKLLED PGQQS +AGIEA+MGVM
Sbjct  557  IAGNPMEEIASGLTEVSAIYEAMNEPEEALKLLQRALKLLEDSPGQQSAVAGIEAQMGVM  616

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +YM+G Y E+  SF++AV KLRASGE++SAF G+VLNQMGL+CVQ + I+EA  LFEEAR
Sbjct  617  YYMMGNYGESYISFKNAVEKLRASGEKRSAFLGIVLNQMGLACVQRYAINEAMVLFEEAR  676

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             +LE E GP H DTLGVYSNLA TYDAMGR+EDAIEILEYVL +REEKLGTA+PD D+EK
Sbjct  677  AVLEQEYGPYHPDTLGVYSNLAGTYDAMGRLEDAIEILEYVLGIREEKLGTAHPDVDEEK  736

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTK  259
            +RLAELL+EAG+ R++KAKSLE L+  NS+  K
Sbjct  737  RRLAELLREAGRVRSRKAKSLETLLVSNSQAIK  769



>ref|XP_011044307.1| PREDICTED: tetratricopeptide repeat protein 28-like [Populus 
euphratica]
 ref|XP_011044308.1| PREDICTED: tetratricopeptide repeat protein 28-like [Populus 
euphratica]
Length=742

 Score =   280 bits (717),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 144/207 (70%), Positives = 180/207 (87%), Gaps = 0/207 (0%)
 Frame = -3

Query  891  GTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMFY  712
            G   EEIASG+T++SA+YE  NE ++A+KLL KALK+ +D PGQQSTIAGIEA+MGVM+Y
Sbjct  533  GIPPEEIASGLTDVSAVYESMNELDQAIKLLKKALKIYKDAPGQQSTIAGIEAQMGVMYY  592

Query  711  MVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAREI  532
            ++G Y E+ +SF++A++KLR+SGE+KSAFFG+ LNQMGL+CV+   I+EAAELFEEA+ +
Sbjct  593  LLGDYSESYNSFKNAISKLRSSGEKKSAFFGIALNQMGLACVRRNAINEAAELFEEAKIV  652

Query  531  LEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKKR  352
            LE ECGP H DTLGVYSNLA  YDAMGR++DAIEILEYV+ +REEKLGTANPD  DEKKR
Sbjct  653  LEQECGPYHPDTLGVYSNLAGIYDAMGRLDDAIEILEYVVGMREEKLGTANPDVVDEKKR  712

Query  351  LAELLKEAGKSRNKKAKSLENLIDPNS  271
            LAELLKEAG+ R++KA+SLENL+D NS
Sbjct  713  LAELLKEAGRVRSRKARSLENLLDDNS  739



>ref|XP_010660916.1| PREDICTED: uncharacterized protein LOC100254332 [Vitis vinifera]
 ref|XP_010660917.1| PREDICTED: uncharacterized protein LOC100254332 [Vitis vinifera]
 ref|XP_010660918.1| PREDICTED: uncharacterized protein LOC100254332 [Vitis vinifera]
Length=728

 Score =   280 bits (715),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 145/217 (67%), Positives = 177/217 (82%), Gaps = 0/217 (0%)
 Frame = -3

Query  894  PGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMF  715
            PG  SEEIASG+ +ISAI+E  NE E+ALKLL KALK+  + PGQQSTIAGIEA+MGV++
Sbjct  510  PGIPSEEIASGLIDISAIFESMNELEQALKLLQKALKIYGNAPGQQSTIAGIEAQMGVIY  569

Query  714  YMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEARE  535
            YM+G Y  + +SF  A++KLRASGE+KSAF G+ LNQMGL+CVQ + I EAAELFEEAR 
Sbjct  570  YMMGNYSASYNSFSCAISKLRASGEKKSAFLGIALNQMGLACVQRYAIGEAAELFEEARS  629

Query  534  ILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKK  355
            ILE E GPCH DTLG+YSNLA TYDAMGR+EDAIEILEYV+ +REEKLGTANPD DDEK+
Sbjct  630  ILEKEYGPCHPDTLGIYSNLAGTYDAMGRLEDAIEILEYVVGVREEKLGTANPDVDDEKR  689

Query  354  RLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSK  244
            RL ELL EAG+ R++K +SL+  +D N + T  ++ K
Sbjct  690  RLTELLTEAGRVRSRKTRSLQTFLDTNPQTTINDAIK  726



>ref|XP_002517328.1| kinesin light chain, putative [Ricinus communis]
 gb|EEF44870.1| kinesin light chain, putative [Ricinus communis]
Length=621

 Score =   277 bits (708),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 141/205 (69%), Positives = 174/205 (85%), Gaps = 0/205 (0%)
 Frame = -3

Query  894  PGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMF  715
            PG  +EEIASG+ ++SAIY+  NE  +ALKLL KALK+    PGQQSTIAGIEA+MGVM+
Sbjct  403  PGIPAEEIASGLIDVSAIYQSMNEFNQALKLLKKALKIYGKTPGQQSTIAGIEAQMGVMY  462

Query  714  YMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEARE  535
            YM+G Y ++ ++F+SAV+K RASGE+KSA FG+ LNQMGL+CVQ + I+EAA+LFEEAR 
Sbjct  463  YMMGNYADSYNTFKSAVSKFRASGEKKSALFGIALNQMGLACVQRYAINEAADLFEEARS  522

Query  534  ILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKK  355
            ILE E GPCH DTLGVYSNLA TYDAMGR++DAIEIL+YV+ +REEKLGTANPD DDEK+
Sbjct  523  ILEKEYGPCHPDTLGVYSNLAGTYDAMGRLDDAIEILDYVVGMREEKLGTANPDVDDEKR  582

Query  354  RLAELLKEAGKSRNKKAKSLENLID  280
            RL ELLK+AGK RN+K++SL  L+D
Sbjct  583  RLGELLKDAGKVRNRKSRSLVTLLD  607



>emb|CDP12398.1| unnamed protein product [Coffea canephora]
Length=704

 Score =   279 bits (713),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 145/205 (71%), Positives = 178/205 (87%), Gaps = 0/205 (0%)
 Frame = -3

Query  894  PGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMF  715
            PG   EEIASG+T+ISAIYE  NE E+ALKLL KALK+ ++ PGQQ+TIAGIEA+MGV++
Sbjct  485  PGFAPEEIASGLTDISAIYESMNELEQALKLLQKALKMYDNAPGQQNTIAGIEAQMGVLY  544

Query  714  YMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEARE  535
            YM+G Y ++ +SF+SAV KLRA G++KSAFFG+ LNQMGL+CVQ + I+EA +LFEE+R 
Sbjct  545  YMLGNYSDSYNSFKSAVLKLRACGDKKSAFFGIALNQMGLACVQRYAINEALDLFEESRS  604

Query  534  ILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKK  355
            ILE E GP H DTLGVYSNLA TYDA+GR+EDAI++LE+V+ +REEKLGTANPD DDEKK
Sbjct  605  ILEQEYGPYHPDTLGVYSNLAGTYDAVGRLEDAIKMLEFVVGMREEKLGTANPDVDDEKK  664

Query  354  RLAELLKEAGKSRNKKAKSLENLID  280
            RLAELLKEAGK RN+KA+SLENL+D
Sbjct  665  RLAELLKEAGKVRNRKARSLENLLD  689



>gb|EYU44745.1| hypothetical protein MIMGU_mgv1a002492mg [Erythranthe guttata]
Length=667

 Score =   277 bits (709),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 144/209 (69%), Positives = 174/209 (83%), Gaps = 0/209 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPG+  EEIASG+ +ISAI+E  NEPE AL+LL KALK+    PGQQS IAGIEA+MGV+
Sbjct  448  VPGSPKEEIASGLVDISAIFESMNEPERALQLLKKALKVYGTAPGQQSIIAGIEAQMGVL  507

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +Y++G Y EA SS ++AV K R++GE+KSA FG+ LNQMGL+CVQL  I+EAA+LFEEAR
Sbjct  508  YYILGSYPEAYSSLKNAVMKFRSTGEKKSALFGIALNQMGLACVQLLLINEAADLFEEAR  567

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
            +ILE ECGP H DTLGVYSNLA TYDAMGR  DAIEILEYV+++REEKLGTANPD +DEK
Sbjct  568  DILEAECGPYHADTLGVYSNLAGTYDAMGRTCDAIEILEYVVEMREEKLGTANPDVEDEK  627

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNS  271
            +RLAELLKE GK R +K++SLE L+  NS
Sbjct  628  RRLAELLKEVGKVRTRKSRSLETLLVKNS  656



>ref|XP_002318043.2| hypothetical protein POPTR_0012s08160g [Populus trichocarpa]
 gb|EEE96263.2| hypothetical protein POPTR_0012s08160g [Populus trichocarpa]
Length=702

 Score =   276 bits (706),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 143/207 (69%), Positives = 178/207 (86%), Gaps = 0/207 (0%)
 Frame = -3

Query  891  GTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMFY  712
            G   EE+ASG+T++SA+YE  NE ++A+KLL KALK+ +D PGQQSTIAGIEA+MGVM+Y
Sbjct  488  GIPPEEVASGLTDVSAVYESMNELDQAIKLLKKALKIYKDAPGQQSTIAGIEAQMGVMYY  547

Query  711  MVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAREI  532
            M+G Y E+ +SF++A++KLR+SGE+KSAFFG+ LNQMGL+C Q   I+EAAELFEEA+ +
Sbjct  548  MLGDYSESYNSFKNAISKLRSSGEKKSAFFGIALNQMGLACAQRNAINEAAELFEEAKIV  607

Query  531  LEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKKR  352
            LE ECG  H DTLGVYSNLA TYDA GR++DAIEILEYV+ +REEKLGTANPD  DEKKR
Sbjct  608  LEQECGLYHPDTLGVYSNLAGTYDATGRLDDAIEILEYVVGMREEKLGTANPDVVDEKKR  667

Query  351  LAELLKEAGKSRNKKAKSLENLIDPNS  271
            LAELLKEAG+ R++KA+SLENL+D NS
Sbjct  668  LAELLKEAGRVRSRKARSLENLLDDNS  694



>gb|KEH24836.1| kinesin light chain [Medicago truncatula]
Length=700

 Score =   275 bits (704),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 144/218 (66%), Positives = 179/218 (82%), Gaps = 1/218 (0%)
 Frame = -3

Query  894  PGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMF  715
            PG + EEIA+G+ +++AIY+  N+ E+ LKLL KALK+  + PGQ STIAGIEA+MGVM+
Sbjct  481  PGISLEEIANGLIDVAAIYQSMNDLEKGLKLLKKALKIYNNVPGQHSTIAGIEAQMGVMY  540

Query  714  YMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEARE  535
            YM+G Y ++ + F+SAV K RASGE+KSA FG+ LNQMGL+CVQ + I+EAA+LFEEAR 
Sbjct  541  YMLGNYSDSYNIFKSAVTKFRASGEKKSALFGIALNQMGLACVQRYAINEAADLFEEART  600

Query  534  ILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKK  355
            ILE E GP H DTLGVYSNLA TYDAMGRV+DAIE+LEYV+ +REEKLGTANPD DDEK+
Sbjct  601  ILEKEYGPYHPDTLGVYSNLAGTYDAMGRVDDAIEMLEYVVGMREEKLGTANPDVDDEKR  660

Query  354  RLAELLKEAGKSRNKKAK-SLENLIDPNSKRTKKESSK  244
            RLAELLKEAG++RN+K+K SLE L+D NS+  K    K
Sbjct  661  RLAELLKEAGRARNRKSKRSLETLLDSNSQIIKDNGIK  698



>gb|KJB07849.1| hypothetical protein B456_001G047800 [Gossypium raimondii]
Length=737

 Score =   275 bits (704),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 142/216 (66%), Positives = 176/216 (81%), Gaps = 0/216 (0%)
 Frame = -3

Query  891  GTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMFY  712
            G   EEIASG+T++SAIYE  N+ ++A+KLL KALK+  D PGQQSTIAGIEA++GVM+Y
Sbjct  521  GIPPEEIASGLTDVSAIYESMNDLDQAIKLLQKALKIYNDCPGQQSTIAGIEAQIGVMYY  580

Query  711  MVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAREI  532
            M+G Y E+ +SFE A++KLRA G+RKSAFFGV LNQMGL+CVQ + I EA +LFEEA+ I
Sbjct  581  MLGNYSESYNSFEGAISKLRACGQRKSAFFGVALNQMGLACVQCYAIHEAVQLFEEAKSI  640

Query  531  LEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKKR  352
            LE ECGP H DTLGVYSNLA TYDA GR++DAIEILE+V+++REEKLGTA P+  DEKKR
Sbjct  641  LEQECGPYHLDTLGVYSNLAGTYDASGRLDDAIEILEHVVQMREEKLGTATPEVYDEKKR  700

Query  351  LAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSK  244
            L+ELLKEAG+ R++KA+SLE L+D N      E  K
Sbjct  701  LSELLKEAGRVRSRKARSLETLLDANPHSLNGEGIK  736



>gb|ABF70051.1| kinesin light chain-related [Musa acuminata]
Length=715

 Score =   275 bits (702),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 142/216 (66%), Positives = 174/216 (81%), Gaps = 0/216 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            +PG +SEE+A+G+T +S+I+E  NE E+ALKLL KA K+  + PG Q+TIAGIEA+MGV+
Sbjct  495  IPGVSSEEVAAGLTNVSSIFESMNEHEQALKLLQKASKMYSNSPGHQNTIAGIEAQMGVL  554

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
             Y+ G YDE+  SF++A+ KLRA GE+KSAFFGV LNQMGL CVQ F I EAAELFEEAR
Sbjct  555  HYIRGDYDESYISFKNAITKLRACGEKKSAFFGVALNQMGLVCVQRFAIIEAAELFEEAR  614

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE E GP H DTLGVYSNLA TYDAMGR+++AIEILEYV+ +REE LGTANP+ DDEK
Sbjct  615  SILEQEYGPFHPDTLGVYSNLAGTYDAMGRLDEAIEILEYVVGIREENLGTANPEVDDEK  674

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKES  250
            +RLAELLKEAG+ RN+K +SLE L+D N     K +
Sbjct  675  RRLAELLKEAGRVRNRKPRSLETLLDKNPHAINKNT  710



>ref|XP_009389350.1| PREDICTED: kinesin light chain 3-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009389351.1| PREDICTED: kinesin light chain 3-like [Musa acuminata subsp. 
malaccensis]
Length=715

 Score =   275 bits (702),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 142/216 (66%), Positives = 174/216 (81%), Gaps = 0/216 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            +PG +SEE+A+G+T +S+I+E  NE E+ALKLL KA K+  + PG Q+TIAGIEA+MGV+
Sbjct  495  IPGVSSEEVAAGLTNVSSIFESMNEHEQALKLLQKASKMYSNSPGHQNTIAGIEAQMGVL  554

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
             Y+ G YDE+  SF++A+ KLRA GE+KSAFFGV LNQMGL CVQ F I EAAELFEEAR
Sbjct  555  HYIRGDYDESYISFKNAITKLRACGEKKSAFFGVALNQMGLVCVQRFAIIEAAELFEEAR  614

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE E GP H DTLGVYSNLA TYDAMGR+++AIEILEYV+ +REE LGTANP+ DDEK
Sbjct  615  SILEQEYGPFHPDTLGVYSNLAGTYDAMGRLDEAIEILEYVVGIREENLGTANPEVDDEK  674

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKES  250
            +RLAELLKEAG+ RN+K +SLE L+D N     K +
Sbjct  675  RRLAELLKEAGRVRNRKPRSLETLLDKNPHAMNKNT  710



>ref|XP_006446488.1| hypothetical protein CICLE_v10014403mg [Citrus clementina]
 gb|ESR59728.1| hypothetical protein CICLE_v10014403mg [Citrus clementina]
Length=728

 Score =   274 bits (701),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 140/214 (65%), Positives = 177/214 (83%), Gaps = 0/214 (0%)
 Frame = -3

Query  891  GTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMFY  712
            G  SEEIASG+ +I+AIY+  NE E+A+KLL KALK+    PGQQSTIAGIEA+MGVM+Y
Sbjct  511  GIPSEEIASGLIDIAAIYQSMNELEQAVKLLNKALKIYGKTPGQQSTIAGIEAQMGVMYY  570

Query  711  MVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAREI  532
            M G Y ++ ++ +SA++K R SGE+KSA FG+ LNQMGL+CVQ + I+EAA+LFEEAR I
Sbjct  571  MTGNYSDSYNTLKSAISKFRTSGEKKSALFGIALNQMGLACVQRYTINEAADLFEEARTI  630

Query  531  LEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKKR  352
            LE E GP H DTLGVYSNLA TYDAMGR++DAIEILEYV+ +REEKLGTANPD +DEK+R
Sbjct  631  LEKEYGPYHHDTLGVYSNLAGTYDAMGRIDDAIEILEYVVGMREEKLGTANPDVEDEKRR  690

Query  351  LAELLKEAGKSRNKKAKSLENLIDPNSKRTKKES  250
            LAELLKEAG+ RN+K++SL   +D NS+  K+++
Sbjct  691  LAELLKEAGRVRNRKSRSLVTFLDSNSQNLKEDA  724



>gb|KDO66204.1| hypothetical protein CISIN_1g004829mg [Citrus sinensis]
 gb|KDO66205.1| hypothetical protein CISIN_1g004829mg [Citrus sinensis]
 gb|KDO66206.1| hypothetical protein CISIN_1g004829mg [Citrus sinensis]
Length=728

 Score =   274 bits (701),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 140/214 (65%), Positives = 177/214 (83%), Gaps = 0/214 (0%)
 Frame = -3

Query  891  GTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMFY  712
            G  SEEIASG+ +I+AIY+  NE E+A+KLL KALK+    PGQQSTIAGIEA+MGVM+Y
Sbjct  511  GIPSEEIASGLIDIAAIYQSMNELEQAVKLLNKALKIYGKTPGQQSTIAGIEAQMGVMYY  570

Query  711  MVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAREI  532
            M G Y ++ ++ +SA++K R SGE+KSA FG+ LNQMGL+CVQ + I+EAA+LFEEAR I
Sbjct  571  MTGNYSDSYNTLKSAISKFRTSGEKKSALFGIALNQMGLACVQRYTINEAADLFEEARTI  630

Query  531  LEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKKR  352
            LE E GP H DTLGVYSNLA TYDAMGR++DAIEILEYV+ +REEKLGTANPD +DEK+R
Sbjct  631  LEKEYGPYHHDTLGVYSNLAGTYDAMGRIDDAIEILEYVVGMREEKLGTANPDVEDEKRR  690

Query  351  LAELLKEAGKSRNKKAKSLENLIDPNSKRTKKES  250
            LAELLKEAG+ RN+K++SL   +D NS+  K+++
Sbjct  691  LAELLKEAGRVRNRKSRSLVTFLDSNSQNLKEDA  724



>ref|XP_006470340.1| PREDICTED: uncharacterized protein LOC102619851 [Citrus sinensis]
Length=728

 Score =   274 bits (701),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 140/214 (65%), Positives = 177/214 (83%), Gaps = 0/214 (0%)
 Frame = -3

Query  891  GTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMFY  712
            G  SEEIASG+ +I+AIY+  NE E+A+KLL KALK+    PGQQSTIAGIEA+MGVM+Y
Sbjct  511  GIPSEEIASGLIDIAAIYQSMNELEQAVKLLNKALKIYGKTPGQQSTIAGIEAQMGVMYY  570

Query  711  MVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAREI  532
            M G Y ++ ++ +SA++K R SGE+KSA FG+ LNQMGL+CVQ + I+EAA+LFEEAR I
Sbjct  571  MTGNYSDSYNTLKSAISKFRTSGEKKSALFGIALNQMGLACVQRYTINEAADLFEEARTI  630

Query  531  LEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKKR  352
            LE E GP H DTLGVYSNLA TYDAMGR++DAIEILEYV+ +REEKLGTANPD +DEK+R
Sbjct  631  LEKEYGPYHHDTLGVYSNLAGTYDAMGRIDDAIEILEYVVGMREEKLGTANPDVEDEKRR  690

Query  351  LAELLKEAGKSRNKKAKSLENLIDPNSKRTKKES  250
            LAELLKEAG+ RN+K++SL   +D NS+  K+++
Sbjct  691  LAELLKEAGRVRNRKSRSLVTFLDSNSQNLKEDA  724



>gb|ABF70142.1| glycoside hydrolase family 17 protein [Musa balbisiana]
Length=715

 Score =   274 bits (700),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 142/216 (66%), Positives = 174/216 (81%), Gaps = 0/216 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            +PG +SEE+A+G+T +S+I+E  NE E+ALKLL KA K+  + PG Q+TIAGIEA++GV+
Sbjct  495  IPGVSSEEVAAGLTNVSSIFESMNEHEQALKLLQKASKMYNNSPGHQNTIAGIEAQIGVL  554

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
             Y+ G YDE+  SF+SA+ KLRA GE+KSAFFGV LNQMGL CVQ F I EAAELFEEAR
Sbjct  555  HYIRGDYDESYISFKSAITKLRACGEKKSAFFGVALNQMGLVCVQRFAIIEAAELFEEAR  614

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE E GP H DTLGVYSNLA TYDAMGR+++AIEILEYV+ +REE LGTANP+ DDEK
Sbjct  615  SILEQEYGPFHPDTLGVYSNLAGTYDAMGRLDEAIEILEYVVGIREENLGTANPEVDDEK  674

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKES  250
            +RLAELLKEAG+ RN+K +SLE L+D N     K +
Sbjct  675  RRLAELLKEAGRVRNRKPRSLETLLDKNPHAMNKNT  710



>ref|XP_012081574.1| PREDICTED: kinesin light chain [Jatropha curcas]
Length=734

 Score =   273 bits (699),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 140/205 (68%), Positives = 173/205 (84%), Gaps = 0/205 (0%)
 Frame = -3

Query  894  PGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMF  715
            PG  +EEIASG  +ISAIY+  N+ E AL+LL KALK+  + PGQQSTIAGI+A+MGVM+
Sbjct  516  PGIPAEEIASGFLDISAIYQCMNQFEPALRLLKKALKIYGNAPGQQSTIAGIQAQMGVMY  575

Query  714  YMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEARE  535
            YM+G Y E+  + +S+V+K RASGE+KSA FG+ LNQMGL+CVQ + I+EAA+LFEEAR 
Sbjct  576  YMMGNYAESYKTLKSSVSKFRASGEKKSALFGIALNQMGLACVQRYAINEAADLFEEARS  635

Query  534  ILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKK  355
            ILE E GPCH DTLGVYSNLA TYDAMGR++DAIEIL+YV+ +REEKLGTANPD DDEK+
Sbjct  636  ILEKEYGPCHPDTLGVYSNLAGTYDAMGRLDDAIEILDYVVGMREEKLGTANPDVDDEKR  695

Query  354  RLAELLKEAGKSRNKKAKSLENLID  280
            RLAELLK+AGK RN+K++SL  L+D
Sbjct  696  RLAELLKDAGKVRNRKSRSLVKLLD  720



>gb|KDP45346.1| hypothetical protein JCGZ_09595 [Jatropha curcas]
Length=729

 Score =   273 bits (699),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 140/205 (68%), Positives = 173/205 (84%), Gaps = 0/205 (0%)
 Frame = -3

Query  894  PGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMF  715
            PG  +EEIASG  +ISAIY+  N+ E AL+LL KALK+  + PGQQSTIAGI+A+MGVM+
Sbjct  511  PGIPAEEIASGFLDISAIYQCMNQFEPALRLLKKALKIYGNAPGQQSTIAGIQAQMGVMY  570

Query  714  YMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEARE  535
            YM+G Y E+  + +S+V+K RASGE+KSA FG+ LNQMGL+CVQ + I+EAA+LFEEAR 
Sbjct  571  YMMGNYAESYKTLKSSVSKFRASGEKKSALFGIALNQMGLACVQRYAINEAADLFEEARS  630

Query  534  ILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKK  355
            ILE E GPCH DTLGVYSNLA TYDAMGR++DAIEIL+YV+ +REEKLGTANPD DDEK+
Sbjct  631  ILEKEYGPCHPDTLGVYSNLAGTYDAMGRLDDAIEILDYVVGMREEKLGTANPDVDDEKR  690

Query  354  RLAELLKEAGKSRNKKAKSLENLID  280
            RLAELLK+AGK RN+K++SL  L+D
Sbjct  691  RLAELLKDAGKVRNRKSRSLVKLLD  715



>gb|KJB30306.1| hypothetical protein B456_005G136800 [Gossypium raimondii]
 gb|KJB30307.1| hypothetical protein B456_005G136800 [Gossypium raimondii]
Length=730

 Score =   273 bits (698),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 139/214 (65%), Positives = 174/214 (81%), Gaps = 0/214 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            +PG   EEIA+G+T++SAIYE  N+ ++A+KLL KALK+  D PGQQST+AGIEA+MGVM
Sbjct  511  MPGIPPEEIATGLTDVSAIYESMNDLDQAIKLLQKALKIYNDVPGQQSTVAGIEAQMGVM  570

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +YM+G Y E+ +SF SA++KLR   ++KSAFFG+ LNQMGL+CVQ + I EA ELFEEA+
Sbjct  571  YYMLGNYSESYNSFSSAISKLRICRDKKSAFFGIALNQMGLACVQRYAIKEAVELFEEAK  630

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE ECGP H DTL VYSNLA TYDA+GR++DAIEILEYV++ REEKLGTAN + DDEK
Sbjct  631  SILEQECGPYHPDTLSVYSNLAGTYDAIGRLDDAIEILEYVVQTREEKLGTANSEVDDEK  690

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKK  256
            KRLAELLKEAG+  ++KA+SLE L+D N     K
Sbjct  691  KRLAELLKEAGRVESRKARSLETLLDANPHHNSK  724



>ref|XP_010555492.1| PREDICTED: kinesin light chain 1 isoform X4 [Tarenaya hassleriana]
 ref|XP_010555493.1| PREDICTED: kinesin light chain 1 isoform X4 [Tarenaya hassleriana]
 ref|XP_010555494.1| PREDICTED: kinesin light chain 1 isoform X4 [Tarenaya hassleriana]
 ref|XP_010555495.1| PREDICTED: kinesin light chain 1 isoform X4 [Tarenaya hassleriana]
 ref|XP_010555496.1| PREDICTED: kinesin light chain 1 isoform X4 [Tarenaya hassleriana]
Length=670

 Score =   271 bits (694),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 139/207 (67%), Positives = 172/207 (83%), Gaps = 0/207 (0%)
 Frame = -3

Query  891  GTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMFY  712
            G   EE+ASG+T+ISAIYE  NE E+A+ LL KALK+  + PGQ S IAGIEA+ GV++Y
Sbjct  456  GIPPEEVASGLTDISAIYESMNELEQAINLLQKALKVYNNSPGQHSMIAGIEAQAGVLYY  515

Query  711  MVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAREI  532
            M G+Y E+  SF+SA++KLRA G++KS FFG+ LNQMGL+CVQ + IDEA ELFEEA++I
Sbjct  516  MSGKYSESYDSFKSAISKLRAMGKKKSTFFGIALNQMGLACVQRYAIDEAVELFEEAKDI  575

Query  531  LEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKKR  352
            LE ECGP H DTLGVYSNLA TYDA+GR EDAIE+LE+V+ +REEKLGTANPD +DEKKR
Sbjct  576  LEQECGPYHPDTLGVYSNLAGTYDAIGRSEDAIEMLEHVVGIREEKLGTANPDVEDEKKR  635

Query  351  LAELLKEAGKSRNKKAKSLENLIDPNS  271
            LA LLKEAG++R +KAKSLE L+D N+
Sbjct  636  LAVLLKEAGRNRGRKAKSLETLLDSNA  662



>ref|XP_010555491.1| PREDICTED: kinesin light chain 1 isoform X3 [Tarenaya hassleriana]
Length=678

 Score =   271 bits (694),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 139/207 (67%), Positives = 172/207 (83%), Gaps = 0/207 (0%)
 Frame = -3

Query  891  GTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMFY  712
            G   EE+ASG+T+ISAIYE  NE E+A+ LL KALK+  + PGQ S IAGIEA+ GV++Y
Sbjct  464  GIPPEEVASGLTDISAIYESMNELEQAINLLQKALKVYNNSPGQHSMIAGIEAQAGVLYY  523

Query  711  MVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAREI  532
            M G+Y E+  SF+SA++KLRA G++KS FFG+ LNQMGL+CVQ + IDEA ELFEEA++I
Sbjct  524  MSGKYSESYDSFKSAISKLRAMGKKKSTFFGIALNQMGLACVQRYAIDEAVELFEEAKDI  583

Query  531  LEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKKR  352
            LE ECGP H DTLGVYSNLA TYDA+GR EDAIE+LE+V+ +REEKLGTANPD +DEKKR
Sbjct  584  LEQECGPYHPDTLGVYSNLAGTYDAIGRSEDAIEMLEHVVGIREEKLGTANPDVEDEKKR  643

Query  351  LAELLKEAGKSRNKKAKSLENLIDPNS  271
            LA LLKEAG++R +KAKSLE L+D N+
Sbjct  644  LAVLLKEAGRNRGRKAKSLETLLDSNA  670



>ref|XP_010555490.1| PREDICTED: kinesin light chain 1 isoform X2 [Tarenaya hassleriana]
Length=680

 Score =   271 bits (694),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 139/207 (67%), Positives = 172/207 (83%), Gaps = 0/207 (0%)
 Frame = -3

Query  891  GTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMFY  712
            G   EE+ASG+T+ISAIYE  NE E+A+ LL KALK+  + PGQ S IAGIEA+ GV++Y
Sbjct  466  GIPPEEVASGLTDISAIYESMNELEQAINLLQKALKVYNNSPGQHSMIAGIEAQAGVLYY  525

Query  711  MVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAREI  532
            M G+Y E+  SF+SA++KLRA G++KS FFG+ LNQMGL+CVQ + IDEA ELFEEA++I
Sbjct  526  MSGKYSESYDSFKSAISKLRAMGKKKSTFFGIALNQMGLACVQRYAIDEAVELFEEAKDI  585

Query  531  LEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKKR  352
            LE ECGP H DTLGVYSNLA TYDA+GR EDAIE+LE+V+ +REEKLGTANPD +DEKKR
Sbjct  586  LEQECGPYHPDTLGVYSNLAGTYDAIGRSEDAIEMLEHVVGIREEKLGTANPDVEDEKKR  645

Query  351  LAELLKEAGKSRNKKAKSLENLIDPNS  271
            LA LLKEAG++R +KAKSLE L+D N+
Sbjct  646  LAVLLKEAGRNRGRKAKSLETLLDSNA  672



>ref|XP_010555489.1| PREDICTED: kinesin light chain 1 isoform X1 [Tarenaya hassleriana]
Length=683

 Score =   271 bits (694),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 139/207 (67%), Positives = 172/207 (83%), Gaps = 0/207 (0%)
 Frame = -3

Query  891  GTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMFY  712
            G   EE+ASG+T+ISAIYE  NE E+A+ LL KALK+  + PGQ S IAGIEA+ GV++Y
Sbjct  469  GIPPEEVASGLTDISAIYESMNELEQAINLLQKALKVYNNSPGQHSMIAGIEAQAGVLYY  528

Query  711  MVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAREI  532
            M G+Y E+  SF+SA++KLRA G++KS FFG+ LNQMGL+CVQ + IDEA ELFEEA++I
Sbjct  529  MSGKYSESYDSFKSAISKLRAMGKKKSTFFGIALNQMGLACVQRYAIDEAVELFEEAKDI  588

Query  531  LEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKKR  352
            LE ECGP H DTLGVYSNLA TYDA+GR EDAIE+LE+V+ +REEKLGTANPD +DEKKR
Sbjct  589  LEQECGPYHPDTLGVYSNLAGTYDAIGRSEDAIEMLEHVVGIREEKLGTANPDVEDEKKR  648

Query  351  LAELLKEAGKSRNKKAKSLENLIDPNS  271
            LA LLKEAG++R +KAKSLE L+D N+
Sbjct  649  LAVLLKEAGRNRGRKAKSLETLLDSNA  675



>ref|XP_004489282.1| PREDICTED: uncharacterized protein LOC101501435 [Cicer arietinum]
Length=700

 Score =   271 bits (692),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 141/213 (66%), Positives = 178/213 (84%), Gaps = 1/213 (0%)
 Frame = -3

Query  894  PGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMF  715
            PG   EEIA+G+ +++AIY+  N+ E+ LKLL KALK+ E+ PGQ+STIAGIEA+MGVM+
Sbjct  481  PGIPLEEIANGLIDVAAIYQSMNDLEKGLKLLKKALKIYENVPGQKSTIAGIEAQMGVMY  540

Query  714  YMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEARE  535
            YM+G Y ++ + F+S+V K RA GE+KSA FG+ LNQMGL+CVQ + I+EAA+LFEEA+ 
Sbjct  541  YMLGNYSDSYNIFQSSVMKFRAGGEKKSALFGIALNQMGLACVQRYSINEAADLFEEAKT  600

Query  534  ILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKK  355
            ILE E GP H DTLGVYSNLA TYDAMGRV+DAIE+LEYV+ +REEKLGTANPD DDEK+
Sbjct  601  ILEKEYGPYHHDTLGVYSNLAGTYDAMGRVDDAIEMLEYVVGMREEKLGTANPDVDDEKR  660

Query  354  RLAELLKEAGKSRNKKAK-SLENLIDPNSKRTK  259
            RLAELLKEAG++RN+K+K SLE L+D NS+  K
Sbjct  661  RLAELLKEAGRARNRKSKRSLETLLDANSQLMK  693



>ref|XP_007031462.1| Tetratricopeptide repeat-like superfamily protein [Theobroma 
cacao]
 gb|EOY02388.1| Tetratricopeptide repeat-like superfamily protein [Theobroma 
cacao]
Length=734

 Score =   271 bits (694),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 138/217 (64%), Positives = 180/217 (83%), Gaps = 0/217 (0%)
 Frame = -3

Query  894  PGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMF  715
            PG  SEEIASG+ +I+A+Y+  NE ++ALKLL KAL +  + PGQQSTIAGIEA+MGVM+
Sbjct  516  PGIPSEEIASGLIDIAAMYQSMNELDQALKLLKKALSIFGEAPGQQSTIAGIEAQMGVMY  575

Query  714  YMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEARE  535
            YM+G Y ++ ++F+SA++K RASGE+KSA FG+ LNQMGL+CVQL+ I+EAA+LFEEAR 
Sbjct  576  YMMGSYADSYNTFKSAISKFRASGEKKSALFGITLNQMGLACVQLYAINEAADLFEEARS  635

Query  534  ILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKK  355
            ILE E GP H DTLGVYSNLA TYDAMGR++DAIE+L+YV+ +REEKLGTANPD  DEK+
Sbjct  636  ILEKEYGPYHPDTLGVYSNLAGTYDAMGRLDDAIELLDYVVDMREEKLGTANPDVIDEKR  695

Query  354  RLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSK  244
            RL ELLKEAG+ R++K++SL  L+D +++  K +  K
Sbjct  696  RLGELLKEAGRVRSRKSRSLVTLLDTSNQIMKDDGIK  732



>emb|CDP02116.1| unnamed protein product [Coffea canephora]
Length=761

 Score =   272 bits (695),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 136/206 (66%), Positives = 174/206 (84%), Gaps = 0/206 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            +PG++ EEIASG+ ++SAIYE  +E ++AL+LL  A+K+  + PGQQSTIAGIEA++GV+
Sbjct  542  IPGSSPEEIASGLVDVSAIYESMSETDQALELLQTAIKVYGNAPGQQSTIAGIEAQIGVL  601

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +Y++G Y ++ +S ++A+ K RA GE+K+A FGV LNQMGL+CVQL+ I+EAAELFEEAR
Sbjct  602  YYILGSYSDSYNSLKNAITKFRAVGEKKNALFGVALNQMGLACVQLYAINEAAELFEEAR  661

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE ECGP H DTLGVYSNLA TYDAMGR  DAIEILEYV+ LREE+LGTANPD  DEK
Sbjct  662  SILEAECGPYHADTLGVYSNLAGTYDAMGRTVDAIEILEYVVGLREERLGTANPDVIDEK  721

Query  357  KRLAELLKEAGKSRNKKAKSLENLID  280
            +RLAELL+EAGK RNK+++SLE L+D
Sbjct  722  RRLAELLREAGKVRNKESRSLETLLD  747



>ref|XP_006578627.1| PREDICTED: nephrocystin-3-like [Glycine max]
 gb|KHN30909.1| Nephrocystin-3 [Glycine soja]
Length=755

 Score =   271 bits (694),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 139/209 (67%), Positives = 174/209 (83%), Gaps = 0/209 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            +PG   EEIASG+T IS IYE  NE E+ALKLL KAL++  D PGQQSTIAGIEA+MGVM
Sbjct  537  MPGVPLEEIASGLTNISTIYESMNELEQALKLLQKALEIYSDTPGQQSTIAGIEAQMGVM  596

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +YM+G Y E+ ++ + A++KLRA GE+KS+FFG+ LNQMGL+CVQ + + EA ELFEEA+
Sbjct  597  YYMLGNYSESYNTLKDAISKLRAIGEKKSSFFGIALNQMGLACVQRYALSEATELFEEAK  656

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE E GP H +TLGVYSNLA TYDA+GR++DAI+ILEYV+  REEKLGTANP+ DDEK
Sbjct  657  SILEQEYGPYHPETLGVYSNLAGTYDAIGRLDDAIQILEYVVNTREEKLGTANPEVDDEK  716

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNS  271
            +RL ELLKEAG+ R++KA+SLENL+D N+
Sbjct  717  RRLGELLKEAGRVRSRKARSLENLLDGNA  745



>ref|XP_007217015.1| hypothetical protein PRUPE_ppa002085mg [Prunus persica]
 gb|EMJ18214.1| hypothetical protein PRUPE_ppa002085mg [Prunus persica]
Length=719

 Score =   270 bits (691),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 140/210 (67%), Positives = 174/210 (83%), Gaps = 0/210 (0%)
 Frame = -3

Query  894  PGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMF  715
            PGT SEEIASG+ ++SAIY+  N+ E+ALKLL KALK+  D PG QST AGIEA+MGVM+
Sbjct  500  PGTPSEEIASGLIDVSAIYQSMNDLEQALKLLKKALKIFGDGPGHQSTTAGIEAQMGVMY  559

Query  714  YMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEARE  535
            YM+G Y ++  +F+S+++K RA+GE+KSA FG+ LNQMGL CVQ + I+EAA+LFEEAR 
Sbjct  560  YMMGNYSDSYDTFKSSISKFRATGEKKSALFGIALNQMGLVCVQRYSINEAADLFEEARN  619

Query  534  ILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKK  355
            ILE E GP H DTLGVYSNLA TYDAMGR++DAIEILEYV+ +REEKLGTANPD  DEK+
Sbjct  620  ILEKEYGPYHPDTLGVYSNLAGTYDAMGRLDDAIEILEYVVGMREEKLGTANPDVADEKR  679

Query  354  RLAELLKEAGKSRNKKAKSLENLIDPNSKR  265
            RLAELLKEAG+ R++K +SLE L+D  + R
Sbjct  680  RLAELLKEAGRVRSRKPRSLETLLDTANSR  709



>ref|XP_004304619.1| PREDICTED: uncharacterized protein LOC101294682 [Fragaria vesca 
subsp. vesca]
 ref|XP_011468264.1| PREDICTED: uncharacterized protein LOC101294682 [Fragaria vesca 
subsp. vesca]
Length=708

 Score =   270 bits (690),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 140/215 (65%), Positives = 176/215 (82%), Gaps = 0/215 (0%)
 Frame = -3

Query  894  PGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMF  715
            PG  +EEIASG+ ++SAIY+  ++ E+ALKLL KALK+  D PGQQSTIAGIEA+MGVM+
Sbjct  488  PGIPAEEIASGLIDVSAIYQSMSDLEQALKLLKKALKMFGDSPGQQSTIAGIEAQMGVMY  547

Query  714  YMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEARE  535
            YM+G Y ++ ++F+S+  K RASGE+KSA FG+ LNQMGL+CVQ + I+EAA+LFEEAR 
Sbjct  548  YMMGNYSDSYNTFKSSTTKFRASGEKKSALFGIALNQMGLACVQRYSINEAADLFEEARN  607

Query  534  ILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKK  355
            ILE E GP H DTLGVYSNLA TYDAMGRV+DAIEILEYV+ +REEKLGTANPD  DEK+
Sbjct  608  ILEKEYGPYHPDTLGVYSNLAGTYDAMGRVDDAIEILEYVVGMREEKLGTANPDVTDEKQ  667

Query  354  RLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKES  250
            RLA LLKEAG+ R++K +SLE L+D  + +  + S
Sbjct  668  RLAVLLKEAGRVRSRKTRSLETLLDTANPQITRSS  702



>ref|XP_008230606.1| PREDICTED: nephrocystin-3 [Prunus mume]
Length=722

 Score =   270 bits (689),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 139/210 (66%), Positives = 174/210 (83%), Gaps = 0/210 (0%)
 Frame = -3

Query  894  PGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMF  715
            PGT SEEIASG+ ++SAIY+  N+ E+ALKLL KALK+  D PG QST AGIEA+MGVM+
Sbjct  503  PGTPSEEIASGLIDVSAIYQSMNDLEQALKLLKKALKIFGDAPGHQSTTAGIEAQMGVMY  562

Query  714  YMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEARE  535
            YM+G Y ++  +F+++++K RA+GE+KSA FG+ LNQMGL CVQ + I+EAA+LFEEAR 
Sbjct  563  YMMGNYSDSYDTFKNSISKFRATGEKKSALFGIALNQMGLVCVQRYSINEAADLFEEARN  622

Query  534  ILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKK  355
            ILE E GP H DTLGVYSNLA TYDAMGR++DAIEILEYV+ +REEKLGTANPD  DEK+
Sbjct  623  ILEKEYGPYHPDTLGVYSNLAGTYDAMGRLDDAIEILEYVVGMREEKLGTANPDVADEKR  682

Query  354  RLAELLKEAGKSRNKKAKSLENLIDPNSKR  265
            RLAELLKEAG+ R++K +SLE L+D  + R
Sbjct  683  RLAELLKEAGRVRSRKPRSLETLLDTANSR  712



>gb|KHG27307.1| Nephrocystin-3 [Gossypium arboreum]
Length=730

 Score =   269 bits (687),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 137/208 (66%), Positives = 173/208 (83%), Gaps = 0/208 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            +PG   EEIA+G+T++SAIYE  N+ ++A+KLL KALK+  D PGQQST+AGIEA+MGVM
Sbjct  511  MPGIPPEEIAAGLTDVSAIYESMNDLDQAIKLLQKALKIYNDVPGQQSTVAGIEAQMGVM  570

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +YM+G Y E+ +SF SA++KLR   ++KSAFFG+ LNQMGL+CVQ + I EA ELFEEA+
Sbjct  571  YYMLGNYSESYNSFGSAISKLRICRDKKSAFFGIALNQMGLACVQRYAIKEAVELFEEAK  630

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE ECGP H DTL VYSNLA TYDA+GR++DA+EILEYV++ REEKLGTAN + DDEK
Sbjct  631  SILEQECGPYHPDTLSVYSNLAGTYDAIGRLDDAVEILEYVVQTREEKLGTANSEVDDEK  690

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPN  274
            KRLAELLKEAG+  ++KA+SLE L+D N
Sbjct  691  KRLAELLKEAGRVESRKARSLETLLDAN  718



>ref|XP_010940045.1| PREDICTED: tetratricopeptide repeat protein 28-like [Elaeis guineensis]
Length=729

 Score =   269 bits (687),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 139/215 (65%), Positives = 174/215 (81%), Gaps = 0/215 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            +PGT+ E+IASG+T++SAIY L NE E+ALKLL KA++      GQQS IAGIEA MGV+
Sbjct  511  IPGTSVEDIASGLTDVSAIYGLMNEHEQALKLLQKAIQTYNKSAGQQSIIAGIEAHMGVL  570

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +Y+VG Y E+ +S ++A+ KLRA GE+KSAFFG+ LNQMGL+CVQ + I+EAAELFEEAR
Sbjct  571  YYIVGNYGESYASLKNAITKLRACGEKKSAFFGIALNQMGLACVQRYAINEAAELFEEAR  630

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE E G  HQ+TLGVYSNLA TYDAMGR+++A+EILEYV+ +REEK G ANPD DDEK
Sbjct  631  SILELEYGLYHQETLGVYSNLAGTYDAMGRLDEAVEILEYVIAIREEKPGIANPDVDDEK  690

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKE  253
            +RLAELLKE G+ RN+KA+SLE L D N    K++
Sbjct  691  RRLAELLKEGGRVRNRKARSLETLPDTNQNAKKED  725



>gb|KHG03919.1| Kinesin light chain [Gossypium arboreum]
Length=632

 Score =   266 bits (680),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 139/216 (64%), Positives = 174/216 (81%), Gaps = 0/216 (0%)
 Frame = -3

Query  891  GTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMFY  712
            G   EEIASG+T++SAIYE  N+ ++A+KLL KALK+  D PGQQSTIAGIEA++GVM+Y
Sbjct  416  GIPPEEIASGLTDVSAIYESMNDLDQAIKLLQKALKIYNDCPGQQSTIAGIEAQIGVMYY  475

Query  711  MVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAREI  532
            M+G Y E+ +SF+ A++KLRA G+RKSAFFGV LNQMGL+CVQ + I EA +LFEEA+ I
Sbjct  476  MLGNYSESYNSFKGAISKLRACGQRKSAFFGVALNQMGLACVQCYAIHEAVQLFEEAKSI  535

Query  531  LEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKKR  352
            LE E GP H DTL VYSNLA TYDA GR++DAIEILE+V+++REEKLGTA P+  DEKKR
Sbjct  536  LEQELGPYHLDTLVVYSNLAGTYDASGRLDDAIEILEHVVQMREEKLGTATPEVYDEKKR  595

Query  351  LAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSK  244
            L+ELLKEAG+ R++KA+SLE L+D N      E  K
Sbjct  596  LSELLKEAGRVRSRKARSLETLLDANPHSLNGEGIK  631



>ref|XP_003528151.1| PREDICTED: nephrocystin-3-like [Glycine max]
Length=753

 Score =   268 bits (685),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 137/209 (66%), Positives = 173/209 (83%), Gaps = 0/209 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            +PG   EEIASG+T IS IYE  NE E ALKLL KAL++  D PGQQSTIAGIEA+MGVM
Sbjct  535  MPGIPPEEIASGLTNISTIYESMNELEHALKLLQKALEIYNDTPGQQSTIAGIEAQMGVM  594

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +YM+G Y ++ ++ ++A++KLRA GE+KS+FFG+ LNQMGL+CVQ + + EA ELFEEA+
Sbjct  595  YYMLGNYSKSYNTLKNAISKLRAIGEKKSSFFGIALNQMGLACVQCYALSEATELFEEAK  654

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE E GP H +TLGV SNLAATYDA+GR++DAI+ILEYV+  REEKLGTANP+ DDEK
Sbjct  655  SILEQEYGPYHPETLGVSSNLAATYDAIGRLDDAIQILEYVVNTREEKLGTANPEVDDEK  714

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNS  271
            +RL ELLKEAG+ R++K +SLENL+D N+
Sbjct  715  RRLGELLKEAGRVRSRKTRSLENLLDGNA  743



>ref|XP_006338558.1| PREDICTED: uncharacterized protein LOC102590808 [Solanum tuberosum]
Length=716

 Score =   267 bits (682),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 133/205 (65%), Positives = 172/205 (84%), Gaps = 0/205 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPG+  EEIASG+ ++S IYE  NEP++ALKLL KA+K   + PGQQSTIAGIEA++GV+
Sbjct  494  VPGSHPEEIASGLVDVSVIYESMNEPDQALKLLQKAIKAYGNAPGQQSTIAGIEAQIGVL  553

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +Y++G Y ++  S ++AV+K R  GE+KSA FG+ LNQMGL+CVQL+ I+EAA+LFEEAR
Sbjct  554  YYILGEYMDSYDSLKTAVSKFREIGEKKSAIFGITLNQMGLACVQLYAINEAADLFEEAR  613

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE ECGP H DTLG+YSNLA TYDAMGR +DAIEILE+V+ +REEKLGTANPD DDEK
Sbjct  614  IILETECGPYHADTLGIYSNLAGTYDAMGRTDDAIEILEFVVGMREEKLGTANPDVDDEK  673

Query  357  KRLAELLKEAGKSRNKKAKSLENLI  283
            +RL ELL+E+G+ R++K++SLE L+
Sbjct  674  RRLTELLRESGRVRSRKSRSLETLL  698



>gb|KHN19310.1| Nephrocystin-3 [Glycine soja]
Length=753

 Score =   268 bits (684),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 137/209 (66%), Positives = 173/209 (83%), Gaps = 0/209 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            +PG   EEIASG+T IS IYE  NE E ALKLL KAL++  D PGQQSTIAGIEA+MGVM
Sbjct  535  MPGIPPEEIASGLTNISTIYESMNELEHALKLLQKALEIYNDTPGQQSTIAGIEAQMGVM  594

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +YM+G Y ++ ++ ++A++KLRA GE+KS+FFG+ LNQMGL+CVQ + + EA ELFEEA+
Sbjct  595  YYMLGNYSKSYNTLKNAISKLRAIGEKKSSFFGIALNQMGLACVQRYALSEATELFEEAK  654

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE E GP H +TLGV SNLAATYDA+GR++DAI+ILEYV+  REEKLGTANP+ DDEK
Sbjct  655  SILEQEYGPYHPETLGVSSNLAATYDAIGRLDDAIQILEYVVNTREEKLGTANPEVDDEK  714

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNS  271
            +RL ELLKEAG+ R++K +SLENL+D N+
Sbjct  715  RRLGELLKEAGRVRSRKTRSLENLLDGNA  743



>ref|XP_007138082.1| hypothetical protein PHAVU_009G179000g [Phaseolus vulgaris]
 ref|XP_007138083.1| hypothetical protein PHAVU_009G179000g [Phaseolus vulgaris]
 ref|XP_007138084.1| hypothetical protein PHAVU_009G179000g [Phaseolus vulgaris]
 gb|ESW10076.1| hypothetical protein PHAVU_009G179000g [Phaseolus vulgaris]
 gb|ESW10077.1| hypothetical protein PHAVU_009G179000g [Phaseolus vulgaris]
 gb|ESW10078.1| hypothetical protein PHAVU_009G179000g [Phaseolus vulgaris]
Length=749

 Score =   268 bits (684),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 138/209 (66%), Positives = 173/209 (83%), Gaps = 0/209 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            +PG   EEIASG+T IS IYE  NE E+ALKLL KAL++  D PGQQSTIAGIEA+MGVM
Sbjct  531  IPGVPLEEIASGLTNISTIYESMNELEQALKLLQKALEIYNDVPGQQSTIAGIEAQMGVM  590

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +YM+G+Y E+  + ++A++KLRA GE+KS+FFG+ LNQMGL+CVQ + + EA ELFEEA+
Sbjct  591  YYMLGKYSESYETLKTAISKLRAIGEKKSSFFGIALNQMGLACVQRYALSEATELFEEAK  650

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE E GP H +TLGV SNLA TYDA+GR++DAI+ILEYV+  REEKLGTANP+ DDEK
Sbjct  651  SILEKEYGPYHPETLGVCSNLAGTYDAIGRLDDAIQILEYVVSTREEKLGTANPEVDDEK  710

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNS  271
            KRL ELLKEAG+ R++K +SLENL+D N+
Sbjct  711  KRLGELLKEAGRVRSRKTRSLENLLDGNA  739



>ref|XP_009614635.1| PREDICTED: tetratricopeptide repeat protein 28-like [Nicotiana 
tomentosiformis]
Length=716

 Score =   266 bits (681),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 134/205 (65%), Positives = 173/205 (84%), Gaps = 0/205 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPG++ EEIASG+ ++S IYE  NEP++ALKLL KA+K+  + P QQS IAGIEA++GV+
Sbjct  494  VPGSSPEEIASGLVDVSVIYESMNEPDQALKLLQKAIKVYGNAPRQQSIIAGIEAQIGVL  553

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +Y++G+Y ++  S ++AV+K R  GE+KSA FG+ LNQMGL+CVQL+ I+EAA+LFEEAR
Sbjct  554  YYILGKYMDSYDSLKNAVSKFRDIGEKKSAIFGIALNQMGLACVQLYAINEAADLFEEAR  613

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE ECGP H DTLG+YSNLA TYDAMGR +DAIEILE+V+ +REEKLGTANPD DDEK
Sbjct  614  IILETECGPYHADTLGIYSNLAGTYDAMGRTDDAIEILEFVVGMREEKLGTANPDVDDEK  673

Query  357  KRLAELLKEAGKSRNKKAKSLENLI  283
            +RL ELLKE+GK R++K+KSLE L+
Sbjct  674  RRLTELLKESGKVRSRKSKSLETLL  698



>ref|XP_009375110.1| PREDICTED: uncharacterized protein LOC103963955 [Pyrus x bretschneideri]
Length=710

 Score =   266 bits (679),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 137/205 (67%), Positives = 172/205 (84%), Gaps = 0/205 (0%)
 Frame = -3

Query  894  PGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMF  715
            PG  SEEIASG+ +++AIY+  N+ E+ALKLL KALK+  + PG QST AGIEA+MGVM+
Sbjct  490  PGIPSEEIASGLIDVAAIYQSMNDLEQALKLLKKALKIFGNAPGHQSTTAGIEAQMGVMY  549

Query  714  YMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEARE  535
            YM+G Y ++ ++F+S++ K RA+GE+KSA FG+ LNQMGL+CVQ F I+EAA+LFEEAR 
Sbjct  550  YMMGNYTDSYNTFKSSITKFRATGEKKSALFGIALNQMGLACVQRFSINEAADLFEEARN  609

Query  534  ILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKK  355
            ILE E GP H DTLGVYSNLA TYDAMGR++ AIEILEYV+ +REEKLGTANPD  DEK+
Sbjct  610  ILEKEYGPYHPDTLGVYSNLAGTYDAMGRLDAAIEILEYVVGMREEKLGTANPDVADEKR  669

Query  354  RLAELLKEAGKSRNKKAKSLENLID  280
            RLAELLKEAG++RN+K +SLE L+D
Sbjct  670  RLAELLKEAGRARNRKPRSLEALLD  694



>ref|XP_009769549.1| PREDICTED: tetratricopeptide repeat protein 28 [Nicotiana sylvestris]
Length=716

 Score =   265 bits (678),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 172/204 (84%), Gaps = 0/204 (0%)
 Frame = -3

Query  894  PGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMF  715
            PG++ EEIASG+ ++S IYE  NEP++ALKLL KA+K+  + PGQQS IAGIEA++GV++
Sbjct  495  PGSSPEEIASGLVDVSVIYESMNEPDQALKLLQKAIKVYGNSPGQQSIIAGIEAQIGVLY  554

Query  714  YMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEARE  535
            Y++G+Y ++  S ++AV+K R  GE+KSA FG+ LNQMGL+CVQ + I+EAA+LFEEAR 
Sbjct  555  YILGKYMDSYDSLKNAVSKFRDIGEKKSAIFGIALNQMGLACVQRYAINEAADLFEEARI  614

Query  534  ILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKK  355
            ILE ECGP H DTLG+YSNLA TYDAMGR +DAIEILE+V+ +REEKLGTANPD DDEK+
Sbjct  615  ILETECGPYHADTLGIYSNLAGTYDAMGRTDDAIEILEFVVGMREEKLGTANPDVDDEKR  674

Query  354  RLAELLKEAGKSRNKKAKSLENLI  283
            RL ELLKE+GK R++K+KSLE L+
Sbjct  675  RLTELLKESGKVRSRKSKSLETLL  698



>ref|XP_003601278.1| Kinesin light chain [Medicago truncatula]
 gb|AES71529.1| kinesin light chain [Medicago truncatula]
Length=767

 Score =   266 bits (681),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 134/206 (65%), Positives = 172/206 (83%), Gaps = 0/206 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            +PG T EEIASG+T +S+IYE  NE ++ALKLL KAL++  D PGQQ TIAGIEA++GVM
Sbjct  549  MPGVTPEEIASGLTNLSSIYESMNEVDQALKLLQKALEIYNDAPGQQGTIAGIEAQVGVM  608

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +YM+G Y E+ ++ + A+AKLRA GE+KS+FFG+ LNQ+GL+CVQ + + EA ELFEEA+
Sbjct  609  YYMLGNYTESYNTLKKAIAKLRAIGEKKSSFFGIALNQLGLACVQRYALREAIELFEEAK  668

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             +LEHE GP H +TLGVYSNLA TYDA+GR++DAI  LE+V+ +REEKLGTANPD DDEK
Sbjct  669  SVLEHELGPYHPETLGVYSNLAGTYDAIGRLDDAILTLEHVVSMREEKLGTANPDVDDEK  728

Query  357  KRLAELLKEAGKSRNKKAKSLENLID  280
            +RL+ELLKEAGK R++K +SLENL D
Sbjct  729  RRLSELLKEAGKVRSRKVRSLENLFD  754



>ref|XP_004501933.1| PREDICTED: uncharacterized protein LOC101499391 [Cicer arietinum]
Length=743

 Score =   266 bits (679),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 134/207 (65%), Positives = 175/207 (85%), Gaps = 0/207 (0%)
 Frame = -3

Query  891  GTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMFY  712
            G T E+IASG+T +S IYE  NE E+ALKLL KAL++  D PGQQ TIAGIEA+MGV++Y
Sbjct  527  GVTPEDIASGLTNLSTIYESMNELEQALKLLQKALEIYNDAPGQQGTIAGIEAQMGVIYY  586

Query  711  MVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAREI  532
            M+G Y ++ ++ ++A++KLRA GE+KS+FFG+ LNQMGL+CVQ + ++EA ELFEE++ I
Sbjct  587  MLGNYAQSYNTLKNAISKLRAIGEKKSSFFGIALNQMGLACVQRYALNEATELFEESKSI  646

Query  531  LEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKKR  352
            LE E GP H +TLGVYSNLA TYDA+GR++DAI+IL++V+ +REEKLGTANPD DDEKKR
Sbjct  647  LEQELGPYHPETLGVYSNLAGTYDAIGRLDDAIQILDHVVSVREEKLGTANPDVDDEKKR  706

Query  351  LAELLKEAGKSRNKKAKSLENLIDPNS  271
            L ELLKEAGK R++KA+SLENL+D N+
Sbjct  707  LNELLKEAGKVRSRKARSLENLLDGNA  733



>gb|KHG25182.1| Nephrocystin-3 [Gossypium arboreum]
Length=719

 Score =   265 bits (678),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 134/217 (62%), Positives = 176/217 (81%), Gaps = 0/217 (0%)
 Frame = -3

Query  894  PGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMF  715
            PG  SEEIASG+ +I+AIY+  N+ ++ALKLL KAL +  + PGQQSTIAGIEA+MGVM+
Sbjct  501  PGIPSEEIASGLIDIAAIYQSMNDLDQALKLLKKALTIFHEAPGQQSTIAGIEAQMGVMY  560

Query  714  YMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEARE  535
            YM+G Y ++ ++F+S+++K RASGE+KSA FG+ LNQMGL+C+Q + I+EA +LFEEAR 
Sbjct  561  YMMGSYTDSYNTFKSSISKFRASGEKKSALFGIALNQMGLACIQRYSINEATDLFEEARN  620

Query  534  ILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKK  355
            IL+ E GP H DTLGVYSNLA TYDAMGR+ DAIEIL+YV+ +REEKLGTANPD  DEK+
Sbjct  621  ILDKEYGPYHPDTLGVYSNLAGTYDAMGRLNDAIEILDYVVDIREEKLGTANPDVIDEKQ  680

Query  354  RLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSK  244
            RL ELLKEAG+ R++K +SL  L+D +++  K +  K
Sbjct  681  RLGELLKEAGRVRSRKPRSLVTLLDTSTQIIKDDGIK  717



>ref|XP_004232294.1| PREDICTED: tetratricopeptide repeat protein 28-like [Solanum 
lycopersicum]
 ref|XP_010316284.1| PREDICTED: tetratricopeptide repeat protein 28-like [Solanum 
lycopersicum]
Length=716

 Score =   265 bits (677),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 132/205 (64%), Positives = 172/205 (84%), Gaps = 0/205 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPG+  EEIASG+ ++S IYE  NEP++ALKLL KA+K+  + PGQQSTIAGIEA++GV+
Sbjct  494  VPGSHPEEIASGLVDVSVIYESMNEPDQALKLLQKAIKVYGNAPGQQSTIAGIEAQIGVL  553

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +Y++G Y ++  S ++AV+K R  GE+KSA FG+ LNQMGL+CVQL+ I+EA +LFEEAR
Sbjct  554  YYILGDYMDSYDSLKTAVSKFREIGEKKSAIFGITLNQMGLACVQLYAINEAGDLFEEAR  613

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE ECGP H DTLG+YSNLA TYDAMGR +DAIEILE+V+ +REEKLGTANPD DDEK
Sbjct  614  IILETECGPYHADTLGIYSNLAGTYDAMGRTDDAIEILEFVVGMREEKLGTANPDVDDEK  673

Query  357  KRLAELLKEAGKSRNKKAKSLENLI  283
            +RL ELL+E+G+ R++K++SLE L+
Sbjct  674  RRLTELLRESGRVRSRKSRSLETLL  698



>ref|XP_003601279.1| Kinesin light chain [Medicago truncatula]
 gb|AES71530.1| kinesin light chain [Medicago truncatula]
Length=795

 Score =   266 bits (680),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 134/206 (65%), Positives = 172/206 (83%), Gaps = 0/206 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            +PG T EEIASG+T +S+IYE  NE ++ALKLL KAL++  D PGQQ TIAGIEA++GVM
Sbjct  577  MPGVTPEEIASGLTNLSSIYESMNEVDQALKLLQKALEIYNDAPGQQGTIAGIEAQVGVM  636

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +YM+G Y E+ ++ + A+AKLRA GE+KS+FFG+ LNQ+GL+CVQ + + EA ELFEEA+
Sbjct  637  YYMLGNYTESYNTLKKAIAKLRAIGEKKSSFFGIALNQLGLACVQRYALREAIELFEEAK  696

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             +LEHE GP H +TLGVYSNLA TYDA+GR++DAI  LE+V+ +REEKLGTANPD DDEK
Sbjct  697  SVLEHELGPYHPETLGVYSNLAGTYDAIGRLDDAILTLEHVVSMREEKLGTANPDVDDEK  756

Query  357  KRLAELLKEAGKSRNKKAKSLENLID  280
            +RL+ELLKEAGK R++K +SLENL D
Sbjct  757  RRLSELLKEAGKVRSRKVRSLENLFD  782



>gb|ACU23562.1| unknown [Glycine max]
Length=197

 Score =   249 bits (636),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 144/168 (86%), Gaps = 0/168 (0%)
 Frame = -3

Query  774  DKPGQQSTIAGIEARMGVMFYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGL  595
            D PGQQSTIAGIEA+MGVM+YM+G Y E+ ++ + A++KLRA GE+KS+FFG+ LNQMGL
Sbjct  20   DTPGQQSTIAGIEAQMGVMYYMLGNYSESYNTLKDAISKLRAIGEKKSSFFGIALNQMGL  79

Query  594  SCVQLFKIDEAAELFEEAREILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYV  415
            +CVQ + + EA ELFEEA+ ILE E GP H +TLGVYSNLA TYDA+GR++DAI+ILEYV
Sbjct  80   ACVQRYALSEATELFEEAKSILEQEYGPYHPETLGVYSNLAGTYDAIGRLDDAIQILEYV  139

Query  414  LKLREEKLGTANPDFDDEKKRLAELLKEAGKSRNKKAKSLENLIDPNS  271
            +  REEKLGTANP+ DDEK+RL ELLKEAG+ R++KA+SLENL+D N+
Sbjct  140  VNTREEKLGTANPEVDDEKRRLGELLKEAGRVRSRKARSLENLLDGNA  187



>ref|XP_008379249.1| PREDICTED: tetratricopeptide repeat protein 28-like [Malus domestica]
Length=716

 Score =   264 bits (675),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 136/208 (65%), Positives = 172/208 (83%), Gaps = 0/208 (0%)
 Frame = -3

Query  894  PGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMF  715
            PG  SEEIA G+ ++SAIY+  N+ E+ALKLL KALK+  D PG QST AGIEA+MGVM+
Sbjct  496  PGIPSEEIAGGLIDVSAIYQSMNDLEQALKLLKKALKIFGDAPGHQSTSAGIEAQMGVMY  555

Query  714  YMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEARE  535
            YM+G + ++  +F+S++ K RA+GE+KSA FG+ LNQMGL+CVQ + I+EAA+LFEEAR+
Sbjct  556  YMMGNFTDSYXTFKSSITKFRATGEKKSALFGIALNQMGLACVQRYSINEAADLFEEARK  615

Query  534  ILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKK  355
            ILE E GP H DTLGVYSNLA TYDAMGR++ AIE LEYV+ +REEKLGTANPD  DEK+
Sbjct  616  ILEKEYGPYHPDTLGVYSNLAGTYDAMGRLDAAIETLEYVVGMREEKLGTANPDVADEKR  675

Query  354  RLAELLKEAGKSRNKKAKSLENLIDPNS  271
            RL+ELLKEAG++RNKK +SLE L+D N+
Sbjct  676  RLSELLKEAGRARNKKTRSLETLLDANN  703



>gb|KJB75858.1| hypothetical protein B456_012G061500 [Gossypium raimondii]
Length=720

 Score =   264 bits (675),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 135/209 (65%), Positives = 175/209 (84%), Gaps = 0/209 (0%)
 Frame = -3

Query  894  PGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMF  715
            PG  SEEIASG+ +I+AI +  NE ++ALKLL KAL +  + PG+QSTIAGIEA+MGVM+
Sbjct  503  PGIPSEEIASGLIDIAAICQSMNELDQALKLLKKALSIFSEAPGKQSTIAGIEAQMGVMY  562

Query  714  YMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEARE  535
            YM+G Y ++ S+F+SA++K RASG++KSA FG+ LNQMGL+CVQ + I+EAA+LFEEAR 
Sbjct  563  YMMGSYADSYSTFKSAISKFRASGDKKSALFGIALNQMGLACVQRYSINEAADLFEEARS  622

Query  534  ILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKK  355
            ILE E GP H DTLGVYSNLA TYDAMGR++DAIEIL+YV+ +REEKLGTANPD  DEK+
Sbjct  623  ILEKEYGPYHPDTLGVYSNLAGTYDAMGRLDDAIEILDYVVDMREEKLGTANPDVIDEKR  682

Query  354  RLAELLKEAGKSRNKKAKSLENLIDPNSK  268
            RL+ELLKEAGK R++K+++L  L+D  ++
Sbjct  683  RLSELLKEAGKVRSRKSRALVTLLDTTTQ  711



>gb|KJB33765.1| hypothetical protein B456_006G030200 [Gossypium raimondii]
Length=707

 Score =   263 bits (673),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 133/206 (65%), Positives = 170/206 (83%), Gaps = 0/206 (0%)
 Frame = -3

Query  894  PGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMF  715
            PG  SEEIASG+ +I+AIY+  N+ ++ALKLL KAL +  + PGQQSTIAGIEA+MGVM+
Sbjct  499  PGIPSEEIASGLIDIAAIYQSMNDLDQALKLLKKALTIFGEAPGQQSTIAGIEAQMGVMY  558

Query  714  YMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEARE  535
            YM+G Y ++ ++F+S+++K RASGE+KSA FG+ LNQMGL+C+Q + I+EA +LFEEAR 
Sbjct  559  YMMGSYTDSYNTFKSSISKFRASGEKKSALFGIALNQMGLACIQRYSINEATDLFEEARN  618

Query  534  ILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKK  355
            ILE E GP H DTLGVYSNLA TYDAMGR+ DAIEIL+YV+ +REEKLGTANPD  DEK+
Sbjct  619  ILEKEYGPYHPDTLGVYSNLAGTYDAMGRLNDAIEILDYVVDIREEKLGTANPDVIDEKR  678

Query  354  RLAELLKEAGKSRNKKAKSLENLIDP  277
            RL ELLKEAG+ R++K +SL  L+ P
Sbjct  679  RLGELLKEAGRVRSRKPRSLVTLLTP  704



>ref|XP_010522908.1| PREDICTED: nephrocystin-3-like [Tarenaya hassleriana]
Length=539

 Score =   259 bits (662),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 135/203 (67%), Positives = 168/203 (83%), Gaps = 2/203 (1%)
 Frame = -3

Query  891  GTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMFY  712
            GT  EEIA G+TE+S+IYE  NE E AL+LL +A+ LL DKP   +T+AGIEA+MGV+FY
Sbjct  333  GTLPEEIAKGLTEVSSIYESLNEHERALELLSQAINLLHDKPANSTTVAGIEAQMGVIFY  392

Query  711  MVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAREI  532
            ++GRY E+RSS +SAV KL ++GE ++AFFG+V+NQMGL+C+Q+++I EAAELFE AR I
Sbjct  393  IMGRYRESRSSLKSAVEKLSSNGESRTAFFGIVVNQMGLACLQMYRIGEAAELFELARTI  452

Query  531  LEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKKR  352
            LE ECGP H DTLGVYSNLAATYDAMGR+EDAIEILE++LK REEK G   PDF++EKKR
Sbjct  453  LEEECGPIHSDTLGVYSNLAATYDAMGRIEDAIEILEHILKAREEKAGI--PDFNEEKKR  510

Query  351  LAELLKEAGKSRNKKAKSLENLI  283
            L ELLKE+GK R KK + L+ LI
Sbjct  511  LIELLKESGKPRIKKKRPLKKLI  533



>gb|KDO69676.1| hypothetical protein CISIN_1g004812mg [Citrus sinensis]
 gb|KDO69677.1| hypothetical protein CISIN_1g004812mg [Citrus sinensis]
Length=712

 Score =   263 bits (671),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 139/210 (66%), Positives = 167/210 (80%), Gaps = 15/210 (7%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPG   EEIASG+T++S+IYE  NE E+A+KLL KALK+  D PGQQST+AGIEA+MGVM
Sbjct  508  VPGVPPEEIASGLTDVSSIYESMNELEQAIKLLQKALKIYNDAPGQQSTVAGIEAQMGVM  567

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +YM+G Y ++  SF++A++KLRA GERKSAFFGV LNQMGL+CVQ + I+EA ELFEEAR
Sbjct  568  YYMLGNYSDSYDSFKNAISKLRAIGERKSAFFGVALNQMGLACVQRYSINEAVELFEEAR  627

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE ECGP H DTLGVYSNLA TYDA+G               REEKLGTANPD DDEK
Sbjct  628  SILEQECGPYHPDTLGVYSNLAGTYDAIG---------------REEKLGTANPDVDDEK  672

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSK  268
            +RLAELLKEAG+ R++KA+SLE L+D NS+
Sbjct  673  RRLAELLKEAGRVRSRKAQSLETLLDANSR  702



>ref|XP_009334071.1| PREDICTED: uncharacterized protein LOC103926921 [Pyrus x bretschneideri]
Length=719

 Score =   262 bits (669),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 134/208 (64%), Positives = 172/208 (83%), Gaps = 0/208 (0%)
 Frame = -3

Query  894  PGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMF  715
            PG  SEEIA G+  +SAIY+  N+ E+ALKLL KALK+  D PG QST AGIEA+MGVM+
Sbjct  499  PGIPSEEIAGGLIHVSAIYQSMNDLEQALKLLKKALKIFGDAPGHQSTSAGIEAQMGVMY  558

Query  714  YMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEARE  535
            YM+G + ++ ++F+S++ K RA+GE+KSA FG+ LNQMGL+C+Q + I+EAA+LFEEAR 
Sbjct  559  YMMGNFTDSYNTFKSSITKFRATGEKKSALFGIALNQMGLACIQRYLINEAADLFEEARN  618

Query  534  ILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKK  355
            IL+ E GP H DTLGVYSNLA TYDAMGR++ AIEILEYV+ +REEKLGTANPD  DEK+
Sbjct  619  ILDKEYGPYHPDTLGVYSNLAGTYDAMGRLDAAIEILEYVVGMREEKLGTANPDVVDEKR  678

Query  354  RLAELLKEAGKSRNKKAKSLENLIDPNS  271
            RL+ELLKEAG++RN+K +SLE L+D N+
Sbjct  679  RLSELLKEAGRARNRKTRSLETLLDTNN  706



>ref|XP_008341468.1| PREDICTED: tetratricopeptide repeat protein 28 [Malus domestica]
Length=710

 Score =   261 bits (668),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 134/205 (65%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = -3

Query  894  PGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMF  715
            PG  SEEIA G+ +++AIY+  N+ E+ALKLL KALK+  + PG Q T AGIEA+MGVM+
Sbjct  490  PGIPSEEIAGGLIDVAAIYQSMNDLEQALKLLKKALKIFGNAPGHQXTTAGIEAQMGVMY  549

Query  714  YMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEARE  535
            YM+G Y ++ ++F+S++ K RA+GE+KSA FG+ LNQMGL+CVQ F I+EAA+LFEEAR 
Sbjct  550  YMMGNYTDSYNTFKSSITKFRATGEKKSALFGIALNQMGLACVQRFSINEAADLFEEARN  609

Query  534  ILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKK  355
            ILE E GP H DTLGVYSNLA TYDAMGR++ AIEILEYV+ +RE+KLGTANPD  DEK+
Sbjct  610  ILEKEYGPYHPDTLGVYSNLAGTYDAMGRLDAAIEILEYVVGMREDKLGTANPDVADEKR  669

Query  354  RLAELLKEAGKSRNKKAKSLENLID  280
            RLAELLKEAG++RN+K +SLE L+D
Sbjct  670  RLAELLKEAGRARNRKPRSLETLLD  694



>gb|KHG13835.1| Nephrocystin-3 [Gossypium arboreum]
Length=720

 Score =   261 bits (666),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 173/209 (83%), Gaps = 0/209 (0%)
 Frame = -3

Query  894  PGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMF  715
            PG  SEEIASG+ +++AI +  N  ++ALKLL KAL +  + PG+QSTIAGIEA+MGVM+
Sbjct  503  PGIPSEEIASGLIDVAAICQSMNALDQALKLLKKALSIFSEAPGKQSTIAGIEAQMGVMY  562

Query  714  YMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEARE  535
            YM+G Y ++ S+F+SA++K RASG++KSA FG+ LNQMGL+CVQ + I+EAA+LFEEAR 
Sbjct  563  YMMGSYADSYSTFKSAISKFRASGDKKSALFGITLNQMGLACVQRYSINEAADLFEEARS  622

Query  534  ILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKK  355
            ILE E GP H DTLGVYSNLA TYDAMGR+ DAIEIL+YV+ +REEKLGTANPD  DEK+
Sbjct  623  ILEKEYGPYHPDTLGVYSNLAGTYDAMGRLSDAIEILDYVVDMREEKLGTANPDVIDEKR  682

Query  354  RLAELLKEAGKSRNKKAKSLENLIDPNSK  268
            RL+ELLKEAGK R++K+++L  L+D  ++
Sbjct  683  RLSELLKEAGKVRSRKSRALVTLLDTTTQ  711



>ref|XP_002312280.2| kinesin light chain-related family protein [Populus trichocarpa]
 gb|EEE89647.2| kinesin light chain-related family protein [Populus trichocarpa]
Length=684

 Score =   259 bits (663),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 160/205 (78%), Gaps = 1/205 (0%)
 Frame = -3

Query  885  TSEEIASGMTEISAIYELFNE-PeealkllvkalkllEDKPGQQSTIAGIEARMGVMFYM  709
            + E IASG  ++SA+Y+  NE       L         D PGQQ+T+AGIEA+MGV++YM
Sbjct  468  SEEIIASGFIDVSALYQSMNEYDRALKLLKKALKIYGTDAPGQQNTVAGIEAQMGVIYYM  527

Query  708  VGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAREIL  529
            +G Y ++  +F+SA+AK RASGERKSA FG+ LNQMGL+CVQ + I+EAA+LF+EAR IL
Sbjct  528  MGNYADSYRTFKSAIAKFRASGERKSALFGIALNQMGLACVQCYAINEAADLFKEARSIL  587

Query  528  EHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKKRL  349
            E E GP H DTLGVYSNLA TYDAMGR++DAIEIL+YV+ +REEKLGTANPD DDEK+RL
Sbjct  588  EKEYGPHHPDTLGVYSNLAGTYDAMGRLDDAIEILDYVVGMREEKLGTANPDVDDEKQRL  647

Query  348  AELLKEAGKSRNKKAKSLENLIDPN  274
             ELLKEAG+ RN+K+KSL  L+D N
Sbjct  648  VELLKEAGRVRNRKSKSLVTLLDAN  672



>ref|NP_189435.1| tetratricopeptide repeat domain-containing protein [Arabidopsis 
thaliana]
 dbj|BAB01483.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAS44558.1| kinesin light chain-like protein [Arabidopsis thaliana]
 gb|AEE77386.1| tetratricopeptide repeat domain-containing protein [Arabidopsis 
thaliana]
Length=663

 Score =   259 bits (661),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 133/208 (64%), Positives = 169/208 (81%), Gaps = 0/208 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
             PGT  EE+A+G  EISAIY+  NE ++ALKLL +ALK+  + PGQQ+TIAGIEA+MGV+
Sbjct  445  TPGTPMEEVATGFIEISAIYQSMNELDQALKLLRRALKIYANAPGQQNTIAGIEAQMGVV  504

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
             YM+G Y E+   F+SA++K R SGE+K+A FG+ LNQMGL+CVQ + I+EAA+LFEEA+
Sbjct  505  TYMMGNYSESYDIFKSAISKFRNSGEKKTALFGIALNQMGLACVQRYAINEAADLFEEAK  564

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE ECGP H DTL VYSNLA TYDAMGR++DAIEILEYV+  REEKLGTANP+ +DEK
Sbjct  565  TILEKECGPYHPDTLAVYSNLAGTYDAMGRLDDAIEILEYVVGTREEKLGTANPEVEDEK  624

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPN  274
            +RLA LLKEAG+ R+K+ ++L  L+D N
Sbjct  625  QRLAALLKEAGRGRSKRNRALLTLLDNN  652



>gb|AAQ22597.1| At3g27960 [Arabidopsis thaliana]
 dbj|BAE99464.1| hypothetical protein [Arabidopsis thaliana]
Length=663

 Score =   259 bits (661),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 133/208 (64%), Positives = 169/208 (81%), Gaps = 0/208 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
             PGT  EE+A+G  EISAIY+  NE ++ALKLL +ALK+  + PGQQ+TIAGIEA+MGV+
Sbjct  445  TPGTPMEEVATGFIEISAIYQSMNELDQALKLLRRALKIYANAPGQQNTIAGIEAQMGVV  504

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
             YM+G Y E+   F+SA++K R SGE+K+A FG+ LNQMGL+CVQ + I+EAA+LFEEA+
Sbjct  505  TYMMGNYSESYDIFKSAISKFRNSGEKKTALFGIALNQMGLACVQRYAINEAADLFEEAK  564

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE ECGP H DTL VYSNLA TYDAMGR++DAIEILEYV+  REEKLGTANP+ +DEK
Sbjct  565  TILEKECGPYHPDTLAVYSNLAGTYDAMGRLDDAIEILEYVVGTREEKLGTANPEVEDEK  624

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPN  274
            +RLA LLKEAG+ R+K+ ++L  L+D N
Sbjct  625  QRLAALLKEAGRGRSKRNRALLTLLDNN  652



>ref|XP_003553842.1| PREDICTED: uncharacterized protein LOC100786477 isoform X1 [Glycine 
max]
 ref|XP_006603813.1| PREDICTED: uncharacterized protein LOC100786477 isoform X2 [Glycine 
max]
 gb|KHN23537.1| Nephrocystin-3 [Glycine soja]
Length=700

 Score =   259 bits (662),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 138/218 (63%), Positives = 172/218 (79%), Gaps = 1/218 (0%)
 Frame = -3

Query  894  PGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMF  715
            PG  SEEIASG+ +++AIY+  N+ E+ LKLL KALK+  + PGQQST+AGIEA+MGVM+
Sbjct  481  PGVPSEEIASGLIDVAAIYQSMNDLEKGLKLLKKALKIYGNAPGQQSTVAGIEAQMGVMY  540

Query  714  YMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEARE  535
            YM+G Y ++ + F+SA+AK RASGE+K+A FG+ LNQMGL+CVQ + I+EAA+LFEEAR 
Sbjct  541  YMLGNYSDSYNIFKSAIAKFRASGEKKTALFGIALNQMGLACVQCYAINEAADLFEEART  600

Query  534  ILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKK  355
            ILE E GP H DTLGVYSNLA TYDAMGRV+DAIEILEYV+ +REEKLGTANPD DDEK+
Sbjct  601  ILEKEYGPYHPDTLGVYSNLAGTYDAMGRVDDAIEILEYVVGMREEKLGTANPDVDDEKR  660

Query  354  RLAELLKE-AGKSRNKKAKSLENLIDPNSKRTKKESSK  244
            RL ELLKE       +  +SLE L+D +S+  K    K
Sbjct  661  RLEELLKESGRARNRRSRRSLETLLDTHSQLVKNNGIK  698



>ref|XP_006395386.1| hypothetical protein EUTSA_v10003775mg [Eutrema salsugineum]
 ref|XP_006395387.1| hypothetical protein EUTSA_v10003775mg [Eutrema salsugineum]
 gb|ESQ32672.1| hypothetical protein EUTSA_v10003775mg [Eutrema salsugineum]
 gb|ESQ32673.1| hypothetical protein EUTSA_v10003775mg [Eutrema salsugineum]
Length=664

 Score =   258 bits (660),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 135/211 (64%), Positives = 172/211 (82%), Gaps = 0/211 (0%)
 Frame = -3

Query  894  PGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMF  715
            PGT  EE+A+G  EISAIY+  NE E++LKLL +ALK+  + PGQQ+TIAGIEA+MGV+ 
Sbjct  445  PGTPVEEVATGFIEISAIYQSMNELEQSLKLLRRALKIYSNAPGQQNTIAGIEAQMGVIS  504

Query  714  YMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEARE  535
            YM+G Y E+ + F+SA+ K R SGE+K+A FG+ LNQMGL+CVQ + I+EAA+LFEEA+ 
Sbjct  505  YMMGNYPESYNIFKSAILKFRNSGEKKTALFGIALNQMGLACVQRYAINEAADLFEEAKT  564

Query  534  ILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKK  355
            ILE+E GP H DTL VYSNLA TYDAMGR+EDAIEILEYV+  REEKLGTANP+ +DEK+
Sbjct  565  ILENEYGPYHPDTLAVYSNLAGTYDAMGRLEDAIEILEYVVGTREEKLGTANPEVEDEKQ  624

Query  354  RLAELLKEAGKSRNKKAKSLENLIDPNSKRT  262
            RLA LLKEAG+ R+K+ ++L  L+D NS+ T
Sbjct  625  RLAALLKEAGRGRSKRNRALFTLLDKNSEMT  655



>ref|XP_006290699.1| hypothetical protein CARUB_v10016794mg [Capsella rubella]
 gb|EOA23597.1| hypothetical protein CARUB_v10016794mg [Capsella rubella]
Length=664

 Score =   258 bits (660),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 134/217 (62%), Positives = 173/217 (80%), Gaps = 0/217 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
             PGT  EE+A+G  EISAIY+  NE +++LKLL +ALK+  + PGQQ+TIAGIEA+MGV+
Sbjct  446  TPGTPMEEVATGFIEISAIYQSMNELDQSLKLLRRALKIYANAPGQQNTIAGIEAQMGVI  505

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
             YM+G Y EA + F+SA++K R SGE+K+A FG+ LNQMGL+CVQ + I+EAA+LFEEA+
Sbjct  506  SYMMGNYPEAYNIFKSAISKFRNSGEKKTALFGIALNQMGLACVQRYAINEAADLFEEAK  565

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE E GP H DTL VYSNLA TYDAMGR++DAIEILEYV+  REEKLGTANP+ +DEK
Sbjct  566  TILEKEYGPYHPDTLAVYSNLAGTYDAMGRLDDAIEILEYVVGTREEKLGTANPEVEDEK  625

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESS  247
            +RLA LLKEAG+ R+K+ ++L  L+D N + T  + S
Sbjct  626  QRLAALLKEAGRGRSKRNRALLTLLDNNPEITNGQRS  662



>gb|KHN27426.1| Nephrocystin-3 [Glycine soja]
Length=702

 Score =   258 bits (659),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 136/214 (64%), Positives = 172/214 (80%), Gaps = 1/214 (0%)
 Frame = -3

Query  894  PGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMF  715
            PG  SEEIASG+ +++AIY+  N+ E+ LKLL KALK+  + PGQQST+AGIEA+MGVM+
Sbjct  483  PGIPSEEIASGLIDVAAIYQSMNDLEKGLKLLKKALKIYGNAPGQQSTVAGIEAQMGVMY  542

Query  714  YMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEARE  535
            Y++G Y ++ + F+SA+AK RASGE+K+A FG+ LNQMGL+CVQ + I+EAA+LFEEA+ 
Sbjct  543  YLLGNYSDSYNIFKSAIAKFRASGEKKTALFGIALNQMGLACVQCYAINEAADLFEEAKT  602

Query  534  ILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKK  355
            ILE E  P H DTLGVYSNLA TYDAMGRV+DAIEILEYV+ +REEKLGTANPD DDE++
Sbjct  603  ILEKEYAPYHPDTLGVYSNLAGTYDAMGRVDDAIEILEYVVGMREEKLGTANPDVDDERR  662

Query  354  RLAELLKEAG-KSRNKKAKSLENLIDPNSKRTKK  256
            RL ELLKEAG     +  +SLE L+D NS+  K 
Sbjct  663  RLEELLKEAGRARNRRSRRSLETLLDTNSQLIKN  696



>ref|XP_003524541.1| PREDICTED: kinesin light chain-like isoform X1 [Glycine max]
Length=702

 Score =   258 bits (659),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 136/214 (64%), Positives = 172/214 (80%), Gaps = 1/214 (0%)
 Frame = -3

Query  894  PGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMF  715
            PG  SEEIASG+ +++AIY+  N+ E+ LKLL KALK+  + PGQQST+AGIEA+MGVM+
Sbjct  483  PGIPSEEIASGLIDVAAIYQSMNDLEKGLKLLKKALKIYGNAPGQQSTVAGIEAQMGVMY  542

Query  714  YMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEARE  535
            Y++G Y ++ + F+SA+AK RASGE+K+A FG+ LNQMGL+CVQ + I+EAA+LFEEA+ 
Sbjct  543  YLLGNYSDSYNIFKSAIAKFRASGEKKTALFGIALNQMGLACVQCYAINEAADLFEEAKT  602

Query  534  ILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKK  355
            ILE E  P H DTLGVYSNLA TYDAMGRV+DAIEILEYV+ +REEKLGTANPD DDE++
Sbjct  603  ILEKEYAPYHPDTLGVYSNLAGTYDAMGRVDDAIEILEYVVGMREEKLGTANPDVDDERR  662

Query  354  RLAELLKEAG-KSRNKKAKSLENLIDPNSKRTKK  256
            RL ELLKEAG     +  +SLE L+D NS+  K 
Sbjct  663  RLEELLKEAGRARNRRSRRSLETLLDTNSQLIKN  696



>ref|XP_006579755.1| PREDICTED: kinesin light chain-like isoform X2 [Glycine max]
Length=697

 Score =   258 bits (659),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 136/214 (64%), Positives = 172/214 (80%), Gaps = 1/214 (0%)
 Frame = -3

Query  894  PGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMF  715
            PG  SEEIASG+ +++AIY+  N+ E+ LKLL KALK+  + PGQQST+AGIEA+MGVM+
Sbjct  478  PGIPSEEIASGLIDVAAIYQSMNDLEKGLKLLKKALKIYGNAPGQQSTVAGIEAQMGVMY  537

Query  714  YMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEARE  535
            Y++G Y ++ + F+SA+AK RASGE+K+A FG+ LNQMGL+CVQ + I+EAA+LFEEA+ 
Sbjct  538  YLLGNYSDSYNIFKSAIAKFRASGEKKTALFGIALNQMGLACVQCYAINEAADLFEEAKT  597

Query  534  ILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKK  355
            ILE E  P H DTLGVYSNLA TYDAMGRV+DAIEILEYV+ +REEKLGTANPD DDE++
Sbjct  598  ILEKEYAPYHPDTLGVYSNLAGTYDAMGRVDDAIEILEYVVGMREEKLGTANPDVDDERR  657

Query  354  RLAELLKEAG-KSRNKKAKSLENLIDPNSKRTKK  256
            RL ELLKEAG     +  +SLE L+D NS+  K 
Sbjct  658  RLEELLKEAGRARNRRSRRSLETLLDTNSQLIKN  691



>ref|XP_011018373.1| PREDICTED: uncharacterized protein LOC105121433 [Populus euphratica]
 ref|XP_011018382.1| PREDICTED: uncharacterized protein LOC105121433 [Populus euphratica]
 ref|XP_011018390.1| PREDICTED: uncharacterized protein LOC105121433 [Populus euphratica]
Length=747

 Score =   259 bits (661),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 160/205 (78%), Gaps = 1/205 (0%)
 Frame = -3

Query  885  TSEEIASGMTEISAIYELFNE-PeealkllvkalkllEDKPGQQSTIAGIEARMGVMFYM  709
            + E IASG  ++SA+Y+  NE       L         D PGQQ+T+AGIEA+MGV++YM
Sbjct  531  SEEIIASGFIDVSALYQSMNEYDRALKLLKKALKIYGTDAPGQQNTVAGIEAQMGVIYYM  590

Query  708  VGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAREIL  529
            +G Y ++  +F+SA+AK RASGE+KSA FG+ LNQMGL+CVQ + I+EAA+LF+EAR IL
Sbjct  591  MGNYADSYRTFKSAIAKFRASGEKKSALFGIALNQMGLACVQCYAINEAADLFKEARSIL  650

Query  528  EHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKKRL  349
            E E GP H DTLGVYSNLA TYDAMGR++DAIEIL+YV+ +REEKLGTANPD DDEK+RL
Sbjct  651  EKEYGPHHPDTLGVYSNLAGTYDAMGRLDDAIEILDYVVGMREEKLGTANPDVDDEKQRL  710

Query  348  AELLKEAGKSRNKKAKSLENLIDPN  274
             ELLKEAG+ RN+K+KSL  L+D N
Sbjct  711  VELLKEAGRVRNRKSKSLVTLLDTN  735



>ref|XP_003525501.1| PREDICTED: tetratricopeptide repeat protein 28-like [Glycine 
max]
 gb|KHN34310.1| Nephrocystin-3 [Glycine soja]
Length=730

 Score =   257 bits (656),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 137/213 (64%), Positives = 171/213 (80%), Gaps = 0/213 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            +PG   EE+ASG   +SAIYE  NE E+ALKLL KAL++L +  GQQ+TIAGIEA+MGVM
Sbjct  512  MPGVPPEEVASGFMNVSAIYESMNELEQALKLLHKALEILNEASGQQNTIAGIEAQMGVM  571

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +Y++  Y E+ ++F++AV+KLRA+GE+KSAFFG VLNQMGL+CVQL  +DEA ELFEEAR
Sbjct  572  YYVLENYTESYNTFKNAVSKLRATGEKKSAFFGTVLNQMGLACVQLHALDEAVELFEEAR  631

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE E GP H +TLGVY NLA TYDA+GR+++AIEILE ++ +REEKLGTANPD  DEK
Sbjct  632  VILEQENGPYHPETLGVYGNLAGTYDAIGRLDEAIEILENIVVMREEKLGTANPDVVDEK  691

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTK  259
            +RL ELLKE G+ RN+K KSLE L D N +  K
Sbjct  692  RRLDELLKETGRVRNRKTKSLEILFDANPRTIK  724


 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 66/131 (50%), Gaps = 3/131 (2%)
 Frame = -3

Query  765  GQQSTIAGIEARMGVMFYMVGRYDEARSSFESAVAKLRAS-GERKSAFFGVVLNQMGLSC  589
            GQ   +A ++  +G  +  + RYDEA  +++ A+A  R   GE   +   V +    L C
Sbjct  430  GQHVEVASVDCNIGDTYLSLARYDEAIFAYQRALAVYRTHKGENHPSVGSVFVRLADLYC  489

Query  588  VQLFKIDEAAELFEEAREILEHEC-GPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVL  412
             + +KI E+    E A +I E+   G   ++    + N++A Y++M  +E A+++L   L
Sbjct  490  -RTWKIRESKSYCESALKIYENPMPGVPPEEVASGFMNVSAIYESMNELEQALKLLHKAL  548

Query  411  KLREEKLGTAN  379
            ++  E  G  N
Sbjct  549  EILNEASGQQN  559



>ref|XP_002877085.1| hypothetical protein ARALYDRAFT_484584 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53344.1| hypothetical protein ARALYDRAFT_484584 [Arabidopsis lyrata subsp. 
lyrata]
Length=661

 Score =   255 bits (651),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 131/208 (63%), Positives = 169/208 (81%), Gaps = 0/208 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
             PGT  EE+A+G  EISAIY+  NE +++LKLL +ALK+  + PGQQ+TIAGIEA+MGV+
Sbjct  443  TPGTPMEEVATGFIEISAIYQSLNELDQSLKLLKRALKIYANAPGQQNTIAGIEAQMGVI  502

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
             YM+G Y E+ + F+SA++K R SGE+K+A FG+ LNQMGL+CVQ + I+EAA+LFEEA+
Sbjct  503  SYMMGNYPESYNIFKSAISKFRNSGEKKTALFGIALNQMGLACVQRYAINEAADLFEEAK  562

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE E GP H DTL VYSNLA TYDAMGR++DAIEILEYV+  REEKLGTANP+ +DEK
Sbjct  563  TILEKEYGPYHPDTLAVYSNLAGTYDAMGRLDDAIEILEYVVGTREEKLGTANPEVEDEK  622

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPN  274
            +RLA LLKEAG+ R+K+ ++L  L+D N
Sbjct  623  QRLAALLKEAGRGRSKRNRALLTLLDKN  650



>ref|XP_010502803.1| PREDICTED: nephrocystin-3-like [Camelina sativa]
 ref|XP_010502804.1| PREDICTED: nephrocystin-3-like [Camelina sativa]
Length=669

 Score =   255 bits (651),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 132/217 (61%), Positives = 172/217 (79%), Gaps = 0/217 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
             PGT  EE+A+G  EISAIY+   E +++LKLL +ALK+  + PGQQ+T+AGIEA+MGV+
Sbjct  451  TPGTPMEEVATGFIEISAIYQSMTELDQSLKLLRRALKIYGNAPGQQNTVAGIEAQMGVI  510

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
             YM+G Y EA + F+SA++K R SGE+K+A FG+ LNQMGL+CVQ + I+EAA+LFEEA+
Sbjct  511  SYMMGNYSEAYNIFKSAISKFRNSGEKKTALFGIALNQMGLACVQRYAINEAADLFEEAK  570

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE E GP H DTL VYSNLA TYDAMGR++DAIEILEYV+  REEKLGTANP+ +DEK
Sbjct  571  TILEKEYGPYHPDTLAVYSNLAGTYDAMGRLDDAIEILEYVVGTREEKLGTANPEVEDEK  630

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESS  247
            +RLA LLKEAG+ R+K+ ++L  L+D N + T  + S
Sbjct  631  QRLAALLKEAGRGRSKRNRALLTLLDNNPEITNGQRS  667



>ref|XP_010925525.1| PREDICTED: kinesin light chain-like [Elaeis guineensis]
Length=703

 Score =   256 bits (653),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 134/217 (62%), Positives = 174/217 (80%), Gaps = 1/217 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            +PGT+ EE+A G+T+ISAI+   NE E ALKLL  AL    D PGQQS  AG+EA+MGV+
Sbjct  484  LPGTSPEEVACGLTDISAIFASMNEHEMALKLLQSALDFYNDLPGQQSKAAGVEAQMGVL  543

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +Y+VG Y E+ +SF+++VAK RA G++KSAFFG+ LNQMGL+CVQL +I+EAA+LFEEA+
Sbjct  544  YYIVGDYSESYASFQNSVAKFRACGKKKSAFFGIALNQMGLACVQLDEINEAAKLFEEAK  603

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE E GP H DTLG YSNLA TYDA+GR+ DAI ILEY++++REEKLGTANP  DDEK
Sbjct  604  SILEQEYGPYHPDTLGAYSNLAGTYDALGRLNDAIGILEYLVEIREEKLGTANPTVDDEK  663

Query  357  KRLAELLKEAGKSRNKKAKSLENLID-PNSKRTKKES  250
            KRL+ LLK+AG+ R++K +SLE L++  NS   KK++
Sbjct  664  KRLSVLLKDAGRVRHQKTRSLEILLEGGNSSGIKKKA  700



>ref|XP_009151903.1| PREDICTED: nephrocystin-3 [Brassica rapa]
 ref|XP_009151904.1| PREDICTED: nephrocystin-3 [Brassica rapa]
 ref|XP_009151905.1| PREDICTED: nephrocystin-3 [Brassica rapa]
 ref|XP_009151906.1| PREDICTED: nephrocystin-3 [Brassica rapa]
 emb|CDX86457.1| BnaA06g31740D [Brassica napus]
Length=664

 Score =   254 bits (648),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 133/207 (64%), Positives = 169/207 (82%), Gaps = 0/207 (0%)
 Frame = -3

Query  894  PGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMF  715
            PGT  EE+A+G  EISAIY+  NE ++ALKLL +ALK+  + PGQQ+T+AGIEA+MGV+ 
Sbjct  445  PGTPMEEVATGFVEISAIYQSMNELDQALKLLRRALKIYVNAPGQQNTVAGIEAQMGVIS  504

Query  714  YMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEARE  535
            YM+G Y E+ + F+SAV+K R SGE+K+A FG+ LNQMGL+CVQ + I+EAA+LFEEA+ 
Sbjct  505  YMMGNYPESYNIFKSAVSKFRNSGEKKTAMFGIALNQMGLACVQRYAINEAADLFEEAKG  564

Query  534  ILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKK  355
            ILE+E GP H DTL VYSNLA TYDAMGR+EDAIEILEYV+  REEKLGTANP+ +DEK+
Sbjct  565  ILENEYGPYHPDTLAVYSNLAGTYDAMGRLEDAIEILEYVVGTREEKLGTANPEVEDEKQ  624

Query  354  RLAELLKEAGKSRNKKAKSLENLIDPN  274
            RLA LLKEAG+ R K+ ++L  L+D N
Sbjct  625  RLAALLKEAGRGRIKRNRALLTLLDKN  651



>ref|XP_007155421.1| hypothetical protein PHAVU_003G200000g [Phaseolus vulgaris]
 gb|ESW27415.1| hypothetical protein PHAVU_003G200000g [Phaseolus vulgaris]
Length=744

 Score =   255 bits (652),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 137/206 (67%), Positives = 167/206 (81%), Gaps = 0/206 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            +PG   EE ASG+  +SAIYE  NE EEALKLL +AL +L D PGQ +TIAGIEA+MGVM
Sbjct  535  MPGVPPEETASGLMNVSAIYESMNELEEALKLLQEALTILNDVPGQMNTIAGIEAQMGVM  594

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +Y++  Y E+ ++ ++AV+KLRA+GE+KSAFFG VLNQMGL+CVQL  +DEAAELFEEAR
Sbjct  595  YYVLKNYTESYNTLKNAVSKLRATGEKKSAFFGTVLNQMGLACVQLHSLDEAAELFEEAR  654

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE E GP H +TLGV  NLA TYDA+GR+++AIEILE ++ +REEKLGTANPD  DEK
Sbjct  655  VILEQENGPYHTETLGVSGNLAGTYDAIGRLDEAIEILENIVVMREEKLGTANPDVADEK  714

Query  357  KRLAELLKEAGKSRNKKAKSLENLID  280
            +RL ELLKE GK RN+K KSLENL D
Sbjct  715  RRLEELLKETGKVRNRKTKSLENLFD  740



>ref|XP_008801827.1| PREDICTED: uncharacterized protein LOC103715840 [Phoenix dactylifera]
Length=680

 Score =   254 bits (649),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 133/216 (62%), Positives = 174/216 (81%), Gaps = 0/216 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            +PGT+ EE+ASG+T++SAI    +E E ALKLL  AL +  D PG+QS  AG+EA+MGV+
Sbjct  462  LPGTSPEEVASGLTDVSAICASMHENEMALKLLQSALNIYNDLPGRQSKAAGVEAQMGVL  521

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +Y+VG Y E+ +S +++V KL+A G++KSAFFG+ LNQMGL+CVQL +I+EAA+LFEEA+
Sbjct  522  YYIVGDYSESYASSQNSVTKLQACGKKKSAFFGIALNQMGLACVQLDEINEAAKLFEEAK  581

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE E GP H DTLGVYSNLA TYDA+GR+ DAI ILEY++++REEKLGTANP  DDEK
Sbjct  582  SILEQEYGPYHPDTLGVYSNLAGTYDALGRLNDAIRILEYLVEIREEKLGTANPAVDDEK  641

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKES  250
             RLA LLKEAG+ R+KK +SLE L++ NS   KK++
Sbjct  642  NRLAVLLKEAGRVRHKKTRSLEILLEGNSHGIKKKA  677



>emb|CDY58518.1| BnaCnng33310D [Brassica napus]
Length=657

 Score =   253 bits (647),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 132/207 (64%), Positives = 170/207 (82%), Gaps = 0/207 (0%)
 Frame = -3

Query  894  PGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMF  715
            PGT  EE+A+G  EISAIY+  NE ++ALKLL +ALK+  + PGQQ+T+AGIEA+MGV+ 
Sbjct  438  PGTPMEEVATGFIEISAIYQSMNELDQALKLLRRALKIYVNAPGQQNTVAGIEAQMGVIS  497

Query  714  YMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEARE  535
            YM+G Y E+ + F+SAV+K R SGE+K+A FG+ LNQ+GL+CVQ + I+EAA+LFEEA+ 
Sbjct  498  YMMGNYPESYNIFKSAVSKFRNSGEKKTAMFGIALNQLGLACVQRYAINEAADLFEEAKG  557

Query  534  ILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKK  355
            ILE+E GP H DTL VYSNLA TYDAMGR+EDAIEILEYV+  REEKLGTANP+ +DEK+
Sbjct  558  ILENEYGPYHPDTLAVYSNLAGTYDAMGRLEDAIEILEYVVGTREEKLGTANPEVEDEKQ  617

Query  354  RLAELLKEAGKSRNKKAKSLENLIDPN  274
            RLA LLKEAG+ R+K+ ++L  L+D N
Sbjct  618  RLAALLKEAGRGRSKRNRALLTLLDKN  644



>gb|KJB37462.1| hypothetical protein B456_006G206300 [Gossypium raimondii]
Length=507

 Score =   250 bits (638),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 133/150 (89%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTT+EEIA G+TEISAIYE  +EPEEALKLL KA+KLLEDKPGQQSTIAGIEAR+GVM
Sbjct  358  VPGTTAEEIAGGLTEISAIYESVDEPEEALKLLQKAMKLLEDKPGQQSTIAGIEARIGVM  417

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            FY++GRYDE+R+SFESAV KLRASGERKSAFFGVVLNQMGL+CVQLFKIDEAAELFEEAR
Sbjct  418  FYILGRYDESRNSFESAVTKLRASGERKSAFFGVVLNQMGLACVQLFKIDEAAELFEEAR  477

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGR  448
             ILE ECGPCHQDTLGVYSNLAATYDAMGR
Sbjct  478  AILEQECGPCHQDTLGVYSNLAATYDAMGR  507



>ref|XP_007151047.1| hypothetical protein PHAVU_004G014000g [Phaseolus vulgaris]
 gb|ACZ74702.1| kinesin light chain-like protein [Phaseolus vulgaris]
 gb|ESW23041.1| hypothetical protein PHAVU_004G014000g [Phaseolus vulgaris]
Length=711

 Score =   254 bits (650),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 135/218 (62%), Positives = 173/218 (79%), Gaps = 1/218 (0%)
 Frame = -3

Query  894  PGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMF  715
            PG + EEIASG+ +++AIY+  N+ ++ LKLL KALK+  + PGQQST+AGIEA+MGVM+
Sbjct  492  PGISLEEIASGLIDVAAIYQSMNDLQKGLKLLKKALKIYVNAPGQQSTVAGIEAQMGVMY  551

Query  714  YMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEARE  535
            YM+G + ++ + F+SA+AK RASGE+K+A FG+ LNQMGL+CVQ + I+EAA+LFEEA+ 
Sbjct  552  YMLGNFSDSYNIFKSAIAKFRASGEKKNALFGIALNQMGLACVQCYAINEAADLFEEAKT  611

Query  534  ILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKK  355
            ILE E GP H DTLGV SNLA TYDAMGRV+DAIEILEYV+ +REEKLGTANPD DDEK+
Sbjct  612  ILEKEYGPYHPDTLGVCSNLAGTYDAMGRVDDAIEILEYVVGMREEKLGTANPDVDDEKR  671

Query  354  RLAELLKEAG-KSRNKKAKSLENLIDPNSKRTKKESSK  244
            RL ELLKEAG     +  +SLE L++ NS+  K    K
Sbjct  672  RLEELLKEAGRARNRRSRRSLETLLETNSQIIKNSGIK  709



>ref|XP_010528254.1| PREDICTED: nephrocystin-3 [Tarenaya hassleriana]
Length=680

 Score =   254 bits (648),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 131/207 (63%), Positives = 171/207 (83%), Gaps = 0/207 (0%)
 Frame = -3

Query  894  PGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMF  715
            PGT  EEIA+G  EISAIY+  NE E+ LKLL +ALK+ E+ PGQQ+TIAGIEA+MGV+ 
Sbjct  461  PGTPLEEIATGFIEISAIYQSMNELEKGLKLLRRALKIYENSPGQQNTIAGIEAQMGVIC  520

Query  714  YMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEARE  535
            YM+G Y E+ + F+SA++K R SGE+K++ FG+ LNQMGL+CVQ + I+EAA+LFEEA+ 
Sbjct  521  YMMGNYPESYTIFKSAISKFRNSGEKKTSLFGIALNQMGLACVQRYAINEAADLFEEAKS  580

Query  534  ILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKK  355
            +LE E GP H DTL VYSNLA TYDAMGR++DAIEILEYV+ +REEKLGTANP+ +DEK+
Sbjct  581  VLEKEYGPYHPDTLAVYSNLAGTYDAMGRLDDAIEILEYVVGMREEKLGTANPEVEDEKR  640

Query  354  RLAELLKEAGKSRNKKAKSLENLIDPN  274
            RLA LLKEAG++R+++ ++L  L+D N
Sbjct  641  RLAALLKEAGRARSRRNRALLTLLDKN  667



>ref|XP_010029186.1| PREDICTED: kinesin light chain [Eucalyptus grandis]
 gb|KCW56033.1| hypothetical protein EUGRSUZ_I01797 [Eucalyptus grandis]
Length=725

 Score =   254 bits (649),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 129/202 (64%), Positives = 170/202 (84%), Gaps = 0/202 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
             PG   +EIA+G+ ++SAIY+  NE E+ALKLL KAL++  + PG+QST+AGIEA+MGVM
Sbjct  504  TPGIPLDEIANGLIDVSAIYQSMNELEQALKLLKKALRIYGNAPGKQSTVAGIEAQMGVM  563

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +YM+G+Y ++ ++ ++AV+K RASGE+KS  FG+ +NQ+GL+CVQ F I+EAAELFEEAR
Sbjct  564  YYMMGKYSDSYNTLKTAVSKFRASGEKKSPLFGISVNQLGLACVQCFAINEAAELFEEAR  623

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
            +I+E E GP H DTLGVYSNLA TYDAMGR +DAI+ILEYV+ +REEKLGTANPD +DE+
Sbjct  624  DIMEKEYGPYHPDTLGVYSNLAGTYDAMGRSDDAIQILEYVVGMREEKLGTANPDVEDER  683

Query  357  KRLAELLKEAGKSRNKKAKSLE  292
            +RL ELLKEAGK RN+K++ LE
Sbjct  684  QRLFELLKEAGKVRNRKSRRLE  705



>gb|KCW77343.1| hypothetical protein EUGRSUZ_D01704 [Eucalyptus grandis]
Length=571

 Score =   251 bits (640),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 134/150 (89%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTT+EEIA G+TEISAIYE  +EPEEALKLL KA+KLLEDKPGQQSTIAGIEARMGVM
Sbjct  384  VPGTTAEEIACGLTEISAIYESVDEPEEALKLLQKAMKLLEDKPGQQSTIAGIEARMGVM  443

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            FYM+GRY+EAR+SFE+AV KLRASGERKSAFFGVVLNQMGL+CVQLFKIDEAAELFEEAR
Sbjct  444  FYMIGRYEEARNSFENAVTKLRASGERKSAFFGVVLNQMGLACVQLFKIDEAAELFEEAR  503

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGR  448
             ILE ECGPCHQDTLGVYSNLAATYDAMGR
Sbjct  504  SILEQECGPCHQDTLGVYSNLAATYDAMGR  533



>ref|XP_003608965.1| Kinesin light chain [Medicago truncatula]
 gb|AES91162.1| kinesin light chain [Medicago truncatula]
Length=672

 Score =   253 bits (646),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 132/208 (63%), Positives = 170/208 (82%), Gaps = 0/208 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            +PG  SEEIASG   ++AIYE  NE E+AL+LL KAL++  D PGQQ+TIAGIEA+MGV+
Sbjct  463  MPGVPSEEIASGFVNVAAIYESMNELEQALELLHKALEIHNDAPGQQNTIAGIEAQMGVI  522

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +Y++G   E+ ++F++AV+KLRA+GE+KSAFFG VLNQMGL CVQL  + EA +LFEEA+
Sbjct  523  YYVLGNQTESYNAFKNAVSKLRATGEKKSAFFGFVLNQMGLCCVQLNALSEAVKLFEEAK  582

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             +LE E GPCH +TLGVYSNLA TYDA+GRV+DAI+I+EY++ +REEKLGTA+ D  DEK
Sbjct  583  IVLEQEYGPCHPETLGVYSNLAGTYDAIGRVDDAIDIIEYIVVVREEKLGTAHFDVVDEK  642

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPN  274
            +RL ELLKE G+ R +K KSLE L+D N
Sbjct  643  RRLDELLKETGRVRKRKTKSLEILLDVN  670


 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 65/130 (50%), Gaps = 1/130 (1%)
 Frame = -3

Query  765  GQQSTIAGIEARMGVMFYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCV  586
            GQ+  +A ++  +G  F  + RYDEA  +++ A+A  +          G VL ++     
Sbjct  381  GQEVEVASVDCSIGDTFLSLARYDEAILAYKKALAVFKTHKGGNHPSVGSVLVRLAELYN  440

Query  585  QLFKIDEAAELFEEAREILEHEC-GPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLK  409
            + +K+ E+    E A +I E+   G   ++    + N+AA Y++M  +E A+E+L   L+
Sbjct  441  RTWKVRESKSYCENALKIYENPMPGVPSEEIASGFVNVAAIYESMNELEQALELLHKALE  500

Query  408  LREEKLGTAN  379
            +  +  G  N
Sbjct  501  IHNDAPGQQN  510



>ref|XP_010514504.1| PREDICTED: nephrocystin-3-like [Camelina sativa]
 ref|XP_010514505.1| PREDICTED: nephrocystin-3-like [Camelina sativa]
Length=669

 Score =   253 bits (645),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 130/208 (63%), Positives = 168/208 (81%), Gaps = 0/208 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
             PGT  EE+A+G  EISAIY+   E +++LKLL +ALK+  + PGQQ+T+AGIEA+MGV+
Sbjct  451  TPGTPMEEVATGFIEISAIYQSMTELDQSLKLLRRALKIYGNAPGQQNTVAGIEAQMGVI  510

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
             YM+G Y EA + F+SA++K R SGE+K+A FG+ LNQMGL+CVQ + I+EAA+LFEEA+
Sbjct  511  SYMMGNYSEAYNIFKSAISKFRNSGEKKTALFGIALNQMGLACVQRYAINEAADLFEEAK  570

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE E GP H DTL VYSNLA TYDAMGR++DAIEILEYV+  REEKLGTANP+ +DEK
Sbjct  571  TILEKEYGPYHPDTLAVYSNLAGTYDAMGRLDDAIEILEYVVGTREEKLGTANPEVEDEK  630

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPN  274
            +RLA LLKEAG+ R+K+ ++L  L+D N
Sbjct  631  QRLAALLKEAGRGRSKRNRALLTLLDNN  658



>ref|XP_010425576.1| PREDICTED: nephrocystin-3-like [Camelina sativa]
Length=669

 Score =   253 bits (645),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 130/208 (63%), Positives = 168/208 (81%), Gaps = 0/208 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
             PGT  EE+A+G  EISAIY+   E +++LKLL +ALK+  + PGQQ+T+AGIEA+MGV+
Sbjct  451  TPGTPMEEVATGFIEISAIYQSMTELDQSLKLLRRALKIYGNAPGQQNTVAGIEAQMGVI  510

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
             YM+G Y EA + F+SA++K R SGE+K+A FG+ LNQMGL+CVQ + I+EAA+LFEEA+
Sbjct  511  SYMMGNYSEAYNIFKSAISKFRNSGEKKTALFGIALNQMGLACVQRYAINEAADLFEEAK  570

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE E GP H DTL VYSNLA TYDAMGR++DAIEILEYV+  REEKLGTANP+ +DEK
Sbjct  571  TILEKEYGPYHPDTLAVYSNLAGTYDAMGRLDDAIEILEYVVGTREEKLGTANPEVEDEK  630

Query  357  KRLAELLKEAGKSRNKKAKSLENLIDPN  274
            +RLA LLKEAG+ R+K+ ++L  L+D N
Sbjct  631  QRLAALLKEAGRGRSKRNRALLTLLDNN  658



>ref|XP_004508864.1| PREDICTED: uncharacterized protein LOC101493785 isoform X1 [Cicer 
arietinum]
 ref|XP_004508865.1| PREDICTED: uncharacterized protein LOC101493785 isoform X2 [Cicer 
arietinum]
Length=677

 Score =   249 bits (637),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 131/206 (64%), Positives = 168/206 (82%), Gaps = 0/206 (0%)
 Frame = -3

Query  891  GTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMFY  712
            G   +EIASG   ++AIYE  NE E+ALKLL KAL++  D PGQQ+TIAGIEA+MGV++Y
Sbjct  466  GVPPDEIASGFVNVAAIYESMNELEQALKLLHKALEIHNDAPGQQNTIAGIEAQMGVIYY  525

Query  711  MVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAREI  532
            ++G  +E+ ++F++AV+KLRA+GERKSAFFG+VLNQMGL CVQL  ++EAA LFEE + +
Sbjct  526  VLGNQNESYNAFKNAVSKLRATGERKSAFFGIVLNQMGLCCVQLCALNEAANLFEEGKVV  585

Query  531  LEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKKR  352
            LE E GP H +TLGVYSNLA TYDA+GRVEDAI+I+EY++ +REEKLGTAN +  DEK+R
Sbjct  586  LEQEYGPYHPETLGVYSNLAGTYDALGRVEDAIDIMEYIVAVREEKLGTANFEVVDEKRR  645

Query  351  LAELLKEAGKSRNKKAKSLENLIDPN  274
            L ELLKE G+ RN+K  SLE L+D N
Sbjct  646  LDELLKETGRVRNRKTTSLELLLDVN  671


 Score = 51.6 bits (122),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 63/130 (48%), Gaps = 1/130 (1%)
 Frame = -3

Query  765  GQQSTIAGIEARMGVMFYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCV  586
            GQ+  +A ++  +G  F  + RYDEA  +++ A+A  +          G V  ++     
Sbjct  382  GQEVEVASVDCSIGDTFLSLARYDEAILAYKKALAVFKTHKGENHPVVGSVYVRLAELYS  441

Query  585  QLFKIDEAAELFEEAREILEHECGPCHQDTLGV-YSNLAATYDAMGRVEDAIEILEYVLK  409
            + +KI E+    E A +I E+       D +   + N+AA Y++M  +E A+++L   L+
Sbjct  442  RTWKIRESKSYCESALKIYENPMTGVPPDEIASGFVNVAAIYESMNELEQALKLLHKALE  501

Query  408  LREEKLGTAN  379
            +  +  G  N
Sbjct  502  IHNDAPGQQN  511



>ref|XP_011098764.1| PREDICTED: tetratricopeptide repeat protein 28-like [Sesamum 
indicum]
Length=710

 Score =   248 bits (633),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 156/189 (83%), Gaps = 0/189 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
             PG+ SEEIASG+ +ISAIYE  NE + AL+LL KA+K+    PG QS IAGIEA+MGV+
Sbjct  498  TPGSPSEEIASGLVDISAIYESMNEHDRALQLLQKAIKVYASMPGHQSIIAGIEAQMGVL  557

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +YM+G Y E+ +S ++A  K R++GE+KSA FG+ LNQMGL+CVQL  I+EAA+LFEEAR
Sbjct  558  YYMLGSYSESYNSLKNATQKFRSAGEKKSALFGIALNQMGLACVQLLLINEAADLFEEAR  617

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEK  358
             ILE +CGP H DTLGVYSNLA TYDAMGR  DAIEIL+YV+++REE+LGTANPD +DEK
Sbjct  618  TILEAQCGPYHADTLGVYSNLAGTYDAMGRTADAIEILDYVVEMREERLGTANPDGEDEK  677

Query  357  KRLAELLKE  331
            +RLAELLKE
Sbjct  678  RRLAELLKE  686



>dbj|BAC42575.1| unknown protein [Arabidopsis thaliana]
 gb|AAO64874.1| At1g27500 [Arabidopsis thaliana]
Length=650

 Score =   243 bits (620),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 125/204 (61%), Positives = 168/204 (82%), Gaps = 0/204 (0%)
 Frame = -3

Query  885  TSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMFYMV  706
            + EEIASG+T+IS I E  NE E+A+ LL KALK+  D PGQ+  IAGIEA+MGV++YM+
Sbjct  439  SPEEIASGLTDISVICESMNEVEQAITLLQKALKIYADSPGQKIMIAGIEAQMGVLYYMM  498

Query  705  GRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAREILE  526
            G+Y E+ ++F+SA++KLRA+G+++S FFG+ LNQMGL+C+QL  I+EA ELFEEA+ ILE
Sbjct  499  GKYMESYNTFKSAISKLRATGKKQSTFFGIALNQMGLACIQLDAIEEAVELFEEAKCILE  558

Query  525  HECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKKRLA  346
             ECGP H +TLG+YSNLA  YDA+GR++DAI++L +V+ +REEKLGTANP  +DEK+RLA
Sbjct  559  QECGPYHPETLGLYSNLAGAYDAIGRLDDAIKLLGHVVGVREEKLGTANPVTEDEKRRLA  618

Query  345  ELLKEAGKSRNKKAKSLENLIDPN  274
            +LLKEAG    +KAKSL+ LID +
Sbjct  619  QLLKEAGNVTGRKAKSLKTLIDSD  642



>ref|NP_174070.1| tetratricopeptide repeat domain-containing protein [Arabidopsis 
thaliana]
 gb|AEE30839.1| tetratricopeptide repeat domain-containing protein [Arabidopsis 
thaliana]
Length=650

 Score =   243 bits (619),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 125/204 (61%), Positives = 168/204 (82%), Gaps = 0/204 (0%)
 Frame = -3

Query  885  TSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMFYMV  706
            + EEIASG+T+IS I E  NE E+A+ LL KALK+  D PGQ+  IAGIEA+MGV++YM+
Sbjct  439  SPEEIASGLTDISVICESMNEVEQAITLLQKALKIYADSPGQKIMIAGIEAQMGVLYYMM  498

Query  705  GRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAREILE  526
            G+Y E+ ++F+SA++KLRA+G+++S FFG+ LNQMGL+C+QL  I+EA ELFEEA+ ILE
Sbjct  499  GKYMESYNTFKSAISKLRATGKKQSTFFGIALNQMGLACIQLDAIEEAVELFEEAKCILE  558

Query  525  HECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKKRLA  346
             ECGP H +TLG+YSNLA  YDA+GR++DAI++L +V+ +REEKLGTANP  +DEK+RLA
Sbjct  559  QECGPYHPETLGLYSNLAGAYDAIGRLDDAIKLLGHVVGVREEKLGTANPVTEDEKRRLA  618

Query  345  ELLKEAGKSRNKKAKSLENLIDPN  274
            +LLKEAG    +KAKSL+ LID +
Sbjct  619  QLLKEAGNVTGRKAKSLKTLIDSD  642



>ref|XP_006303924.1| hypothetical protein CARUB_v10008543mg [Capsella rubella]
 gb|EOA36822.1| hypothetical protein CARUB_v10008543mg [Capsella rubella]
Length=650

 Score =   243 bits (619),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 126/204 (62%), Positives = 166/204 (81%), Gaps = 0/204 (0%)
 Frame = -3

Query  885  TSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMFYMV  706
            + EEIASG+T+IS I E  NE E+A+ LL KALK+  D PGQ+  IAGIEA+MGV++YM+
Sbjct  440  SPEEIASGLTDISVICESMNELEQAISLLQKALKIYADSPGQKIMIAGIEAQMGVLYYMM  499

Query  705  GRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAREILE  526
            G+Y E+ ++F+SAV+KLRA+G+++S FFG+ LNQMGL+C+QL  I+EA ELFEEA+ ILE
Sbjct  500  GKYMESYNTFKSAVSKLRATGKKQSTFFGIALNQMGLACIQLDAIEEAVELFEEAKCILE  559

Query  525  HECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKKRLA  346
             ECGP H +TLG+YSNLA  YDA+GR++DAI +L +V+ +REEKLGTANP  +DEKKRL 
Sbjct  560  QECGPYHPETLGLYSNLAGAYDAIGRLDDAIALLAHVVGVREEKLGTANPVTEDEKKRLV  619

Query  345  ELLKEAGKSRNKKAKSLENLIDPN  274
            +LLKEAG    +KAKSL+ LID +
Sbjct  620  QLLKEAGNVTGRKAKSLKTLIDAD  643



>gb|AAF99740.1|AC004557_19 F17L21.29 [Arabidopsis thaliana]
Length=684

 Score =   243 bits (619),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 125/204 (61%), Positives = 168/204 (82%), Gaps = 0/204 (0%)
 Frame = -3

Query  885  TSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMFYMV  706
            + EEIASG+T+IS I E  NE E+A+ LL KALK+  D PGQ+  IAGIEA+MGV++YM+
Sbjct  473  SPEEIASGLTDISVICESMNEVEQAITLLQKALKIYADSPGQKIMIAGIEAQMGVLYYMM  532

Query  705  GRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAREILE  526
            G+Y E+ ++F+SA++KLRA+G+++S FFG+ LNQMGL+C+QL  I+EA ELFEEA+ ILE
Sbjct  533  GKYMESYNTFKSAISKLRATGKKQSTFFGIALNQMGLACIQLDAIEEAVELFEEAKCILE  592

Query  525  HECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKKRLA  346
             ECGP H +TLG+YSNLA  YDA+GR++DAI++L +V+ +REEKLGTANP  +DEK+RLA
Sbjct  593  QECGPYHPETLGLYSNLAGAYDAIGRLDDAIKLLGHVVGVREEKLGTANPVTEDEKRRLA  652

Query  345  ELLKEAGKSRNKKAKSLENLIDPN  274
            +LLKEAG    +KAKSL+ LID +
Sbjct  653  QLLKEAGNVTGRKAKSLKTLIDSD  676



>ref|XP_010460507.1| PREDICTED: uncharacterized protein LOC104741359 [Camelina sativa]
 ref|XP_010460508.1| PREDICTED: uncharacterized protein LOC104741359 [Camelina sativa]
Length=656

 Score =   241 bits (616),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 125/204 (61%), Positives = 166/204 (81%), Gaps = 0/204 (0%)
 Frame = -3

Query  885  TSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMFYMV  706
            + EEIASG+T+IS I E  NE E+A+ LL KALK+  D PGQ+  IAGIEA+MGV++YM+
Sbjct  446  SPEEIASGLTDISVICESMNEVEQAISLLQKALKIYSDSPGQKIMIAGIEAQMGVLYYMM  505

Query  705  GRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAREILE  526
            G+Y E+ ++F+SAV+KLRA+G+++S FFG+ LNQMGL+C+QL  I+EA ELFEEA+ +LE
Sbjct  506  GKYMESYNTFKSAVSKLRATGKKQSTFFGIALNQMGLACIQLDAIEEAVELFEEAKCVLE  565

Query  525  HECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKKRLA  346
             ECGP H +TLG+YSNLA  YDA+GR++DAI +L +V+ +REEKLGTANP  +DEKKRL 
Sbjct  566  QECGPYHPETLGLYSNLAGAYDAIGRLDDAIALLGHVVGVREEKLGTANPVTEDEKKRLV  625

Query  345  ELLKEAGKSRNKKAKSLENLIDPN  274
            +LLKEAG    +KAKSL+ LID +
Sbjct  626  QLLKEAGNVTGRKAKSLKTLIDSD  649



>ref|XP_010499231.1| PREDICTED: uncharacterized protein LOC104776804 isoform X2 [Camelina 
sativa]
 ref|XP_010499234.1| PREDICTED: uncharacterized protein LOC104776804 isoform X4 [Camelina 
sativa]
Length=656

 Score =   241 bits (616),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 125/204 (61%), Positives = 166/204 (81%), Gaps = 0/204 (0%)
 Frame = -3

Query  885  TSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMFYMV  706
            + EEIASG+T+IS I E  NE E+A+ LL KALK+  D PGQ+  IAGIEA+MGV++YM+
Sbjct  446  SPEEIASGLTDISVICESMNEVEQAISLLQKALKIYSDSPGQKIMIAGIEAQMGVLYYMM  505

Query  705  GRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAREILE  526
            G+Y E+ ++F+SAV+KLRA+G+++S FFG+ LNQMGL+C+QL  ++EA ELFEEA+ ILE
Sbjct  506  GKYMESYNTFKSAVSKLRATGKKQSTFFGIALNQMGLACIQLDAVEEAVELFEEAKCILE  565

Query  525  HECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKKRLA  346
             ECGP H +TLG+YSNLA  YDA+GR++DAI +L +V+ +REEKLGTANP  +DEKKRL 
Sbjct  566  QECGPYHPETLGLYSNLAGAYDAIGRLDDAIALLGHVVGVREEKLGTANPVTEDEKKRLV  625

Query  345  ELLKEAGKSRNKKAKSLENLIDPN  274
            +LLKEAG    +KAKSL+ LID +
Sbjct  626  QLLKEAGNVTGRKAKSLKTLIDSD  649



>ref|XP_010499233.1| PREDICTED: uncharacterized protein LOC104776804 isoform X3 [Camelina 
sativa]
Length=655

 Score =   241 bits (616),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 125/204 (61%), Positives = 166/204 (81%), Gaps = 0/204 (0%)
 Frame = -3

Query  885  TSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMFYMV  706
            + EEIASG+T+IS I E  NE E+A+ LL KALK+  D PGQ+  IAGIEA+MGV++YM+
Sbjct  445  SPEEIASGLTDISVICESMNEVEQAISLLQKALKIYSDSPGQKIMIAGIEAQMGVLYYMM  504

Query  705  GRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAREILE  526
            G+Y E+ ++F+SAV+KLRA+G+++S FFG+ LNQMGL+C+QL  ++EA ELFEEA+ ILE
Sbjct  505  GKYMESYNTFKSAVSKLRATGKKQSTFFGIALNQMGLACIQLDAVEEAVELFEEAKCILE  564

Query  525  HECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKKRLA  346
             ECGP H +TLG+YSNLA  YDA+GR++DAI +L +V+ +REEKLGTANP  +DEKKRL 
Sbjct  565  QECGPYHPETLGLYSNLAGAYDAIGRLDDAIALLGHVVGVREEKLGTANPVTEDEKKRLV  624

Query  345  ELLKEAGKSRNKKAKSLENLIDPN  274
            +LLKEAG    +KAKSL+ LID +
Sbjct  625  QLLKEAGNVTGRKAKSLKTLIDSD  648



>ref|XP_010499229.1| PREDICTED: uncharacterized protein LOC104776804 isoform X1 [Camelina 
sativa]
 ref|XP_010499232.1| PREDICTED: uncharacterized protein LOC104776804 isoform X1 [Camelina 
sativa]
Length=656

 Score =   241 bits (616),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 125/204 (61%), Positives = 166/204 (81%), Gaps = 0/204 (0%)
 Frame = -3

Query  885  TSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMFYMV  706
            + EEIASG+T+IS I E  NE E+A+ LL KALK+  D PGQ+  IAGIEA+MGV++YM+
Sbjct  446  SPEEIASGLTDISVICESMNEVEQAISLLQKALKIYSDSPGQKIMIAGIEAQMGVLYYMM  505

Query  705  GRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAREILE  526
            G+Y E+ ++F+SAV+KLRA+G+++S FFG+ LNQMGL+C+QL  ++EA ELFEEA+ ILE
Sbjct  506  GKYMESYNTFKSAVSKLRATGKKQSTFFGIALNQMGLACIQLDAVEEAVELFEEAKCILE  565

Query  525  HECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKKRLA  346
             ECGP H +TLG+YSNLA  YDA+GR++DAI +L +V+ +REEKLGTANP  +DEKKRL 
Sbjct  566  QECGPYHPETLGLYSNLAGAYDAIGRLDDAIALLGHVVGVREEKLGTANPVTEDEKKRLV  625

Query  345  ELLKEAGKSRNKKAKSLENLIDPN  274
            +LLKEAG    +KAKSL+ LID +
Sbjct  626  QLLKEAGNVTGRKAKSLKTLIDSD  649



>ref|XP_002893471.1| hypothetical protein ARALYDRAFT_472955 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69730.1| hypothetical protein ARALYDRAFT_472955 [Arabidopsis lyrata subsp. 
lyrata]
Length=645

 Score =   241 bits (615),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 125/204 (61%), Positives = 166/204 (81%), Gaps = 0/204 (0%)
 Frame = -3

Query  885  TSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMFYMV  706
            + EEIASG+T+IS I E  NE E+A+ LL KALK+  D PGQ+  IAGIEA+MGV++YM+
Sbjct  434  SPEEIASGLTDISVICESMNEVEQAISLLQKALKIYADSPGQKIMIAGIEAQMGVLYYMM  493

Query  705  GRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAREILE  526
            G+Y E+ ++F+SAV+KLRA+G+++S FFG+ LNQMGL+C+QL  I+EA ELFEEA+ ILE
Sbjct  494  GKYMESYNTFKSAVSKLRATGKKQSTFFGIALNQMGLACIQLDAIEEAVELFEEAKCILE  553

Query  525  HECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKKRLA  346
             ECGP H +TLG+YSNLA  YDA+GR++DAI +L +V+ +REEKLGTANP  +DEK+RL 
Sbjct  554  QECGPYHPETLGLYSNLAGAYDAIGRLDDAIALLGHVVGVREEKLGTANPVTEDEKRRLV  613

Query  345  ELLKEAGKSRNKKAKSLENLIDPN  274
            +LLKEAG    +KAKSL+ LID +
Sbjct  614  QLLKEAGNVTGRKAKSLKTLIDSD  637



>ref|XP_010478089.1| PREDICTED: uncharacterized protein LOC104757077 [Camelina sativa]
 ref|XP_010478090.1| PREDICTED: uncharacterized protein LOC104757077 [Camelina sativa]
Length=655

 Score =   241 bits (614),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 126/204 (62%), Positives = 166/204 (81%), Gaps = 0/204 (0%)
 Frame = -3

Query  885  TSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMFYMV  706
            + EEIASG+T+IS I E  NE E+A+ LL KALK+  D PGQ+  IAGIEA+MGV++YM+
Sbjct  445  SPEEIASGLTDISVICESMNEVEQAISLLQKALKIYSDSPGQKIMIAGIEAQMGVLYYMM  504

Query  705  GRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAREILE  526
            G+Y E+ ++F+SAV+KLRA+G+++S FFG+ LNQMGL+C+QL  I+EA ELFEEA+ ILE
Sbjct  505  GKYMESYNTFKSAVSKLRATGKKQSTFFGIALNQMGLACIQLDAIEEAVELFEEAKCILE  564

Query  525  HECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKKRLA  346
             ECGP H +TLG+YSNLA  YDA+GR++DAI +L +V+ +REEKLGTANP  +DEKKRL 
Sbjct  565  QECGPYHPETLGLYSNLAGAYDAVGRLDDAIALLGHVVGVREEKLGTANPVTEDEKKRLV  624

Query  345  ELLKEAGKSRNKKAKSLENLIDPN  274
            +LLKEAG    +KAKSL+ LID +
Sbjct  625  QLLKEAGNVTGRKAKSLKILIDSD  648



>emb|CDY56191.1| BnaC05g51100D, partial [Brassica napus]
Length=712

 Score =   241 bits (615),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 125/202 (62%), Positives = 166/202 (82%), Gaps = 0/202 (0%)
 Frame = -3

Query  885  TSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMFYMV  706
            + EEIASG+T+IS I E  NE E+A+ LL KALK+  D PGQ+  IAGIEA+MGV++YM+
Sbjct  501  SPEEIASGLTDISVICESMNEVEQAVTLLQKALKIYTDSPGQKMMIAGIEAQMGVLYYMM  560

Query  705  GRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAREILE  526
            G+Y E+ ++F+ AV+KLRA+G+++S FFG+ LNQMGL+CVQL  I+EA ELFEEA+ ILE
Sbjct  561  GKYLESYNTFKRAVSKLRATGKKQSTFFGIALNQMGLACVQLDAIEEAVELFEEAKCILE  620

Query  525  HECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKKRLA  346
             ECGP H +TLG+Y+NLA  YDA+GR++DAIE+L +V+ +REEKLGTANP  ++EK+RL 
Sbjct  621  QECGPYHPETLGLYNNLAGAYDAIGRLDDAIELLGHVVGVREEKLGTANPGTEEEKRRLV  680

Query  345  ELLKEAGKSRNKKAKSLENLID  280
            +LLKEAGK   +KAKSL+ LID
Sbjct  681  QLLKEAGKVTGRKAKSLQTLID  702



>ref|XP_010033277.1| PREDICTED: uncharacterized protein LOC104422608 [Eucalyptus grandis]
 ref|XP_010033278.1| PREDICTED: uncharacterized protein LOC104422608 [Eucalyptus grandis]
 gb|KCW52886.1| hypothetical protein EUGRSUZ_J02210 [Eucalyptus grandis]
Length=722

 Score =   240 bits (612),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 128/208 (62%), Positives = 163/208 (78%), Gaps = 0/208 (0%)
 Frame = -3

Query  894  PGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMF  715
            P   +EEIA G  E+SAIYE  NE E+AL LL KALK+  D PGQQ+ +AG+EA++GV++
Sbjct  504  PMMPTEEIAGGFIELSAIYESMNELEQALTLLKKALKIHADAPGQQNMVAGVEAQIGVIY  563

Query  714  YMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEARE  535
            YM+G+Y +A +S +SAV+K RAS E+ S  FG+ LNQMGLSCVQ   I+EAAELFEEAR 
Sbjct  564  YMMGKYSDAYTSLKSAVSKFRASAEQNSPLFGIALNQMGLSCVQCHAINEAAELFEEARS  623

Query  534  ILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKK  355
            ILE E GP H DTLGV SNLA TYDAMGR++DAIEILE V+ +R+EKLGTAN D + EK+
Sbjct  624  ILEKEYGPYHPDTLGVCSNLAGTYDAMGRLDDAIEILENVVAIRQEKLGTANSDVNAEKQ  683

Query  354  RLAELLKEAGKSRNKKAKSLENLIDPNS  271
            RLAELLKEAG+  ++K++ L  L++ +S
Sbjct  684  RLAELLKEAGRDSSRKSRPLGTLLNADS  711



>gb|KGN46524.1| hypothetical protein Csa_6G106760 [Cucumis sativus]
Length=476

 Score =   233 bits (593),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 140/234 (60%), Positives = 173/234 (74%), Gaps = 13/234 (6%)
 Frame = -3

Query  891  GTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQS---------TIAGI  739
            G + EEI+SG+ EISA+YE  NEPEEA K+L +A  +LE                 +AGI
Sbjct  245  GASYEEISSGLVEISAVYEATNEPEEAFKVLQRATTILEQGGRGGGGRRSGSGSGAMAGI  304

Query  738  EARMGVMFYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAA  559
            EA+MGVMFYMVG+Y EAR +FE A+ KLR +   KSA FGV+LNQMGL+C+QL+KI EA 
Sbjct  305  EAQMGVMFYMVGKYGEARKAFEGAIGKLRGT---KSAMFGVLLNQMGLTCIQLYKIGEAV  361

Query  558  ELFEEAREILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTAN  379
             LF+EA+ +LE   G  H DTL V SNLAA YDAMGRVE+AIEILE +LK+REE LGTAN
Sbjct  362  RLFQEAKVVLEEHYGVYHSDTLAVSSNLAAAYDAMGRVEEAIEILEEILKVREEMLGTAN  421

Query  378  PDFDDEKKRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWS-AFGFR  220
            P+ D+EK+RL ELLKEAG++RNKKAKSL+ L+  NS R KKE +K+W+  F FR
Sbjct  422  PEVDEEKRRLEELLKEAGRARNKKAKSLQILLGSNSLRMKKEVAKRWTGGFSFR  475



>gb|EMT27718.1| Nephrocystin-3 [Aegilops tauschii]
Length=441

 Score =   231 bits (589),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 140/252 (56%), Positives = 169/252 (67%), Gaps = 54/252 (21%)
 Frame = -3

Query  894  PGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMF  715
            PG   +E+A G+ EI+AIYE   + +EALKLL +ALKLLED PGQ ST+AGIEA+MGV++
Sbjct  218  PGAAPDEVAGGLMEIAAIYEALGDLDEALKLLQRALKLLEDSPGQWSTVAGIEAQMGVLY  277

Query  714  YMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEARE  535
            YM+GRY ++R+SFESA                            LFKIDEAA+LFEEAR 
Sbjct  278  YMIGRYADSRNSFESA----------------------------LFKIDEAAQLFEEARA  309

Query  534  ILEHECGPCHQDTLGVYSNLAATYDAMGR----------------------VEDAIEILE  421
            +LE ECG  H DTLGVYSNLAA YDAMGR                      VEDAIEILE
Sbjct  310  VLEQECGASHPDTLGVYSNLAAIYDAMGRSNGADFVLLSEEMNMWGSTCVLVEDAIEILE  369

Query  420  YVLKLREEKLGTANPDFDDEKKRLAELLKEAGKSRNKKAKSLENLIDPN--SKRTKKESS  247
            +VLK+REEKLGTANPD +DEKKRLAELLKEAG+SRN+K KSLENL      ++  KK+ +
Sbjct  370  HVLKVREEKLGTANPDVEDEKKRLAELLKEAGRSRNRKQKSLENLFGSGGAARGAKKDGA  429

Query  246  --KKWSAFGFRS  217
              ++W+ FGFRS
Sbjct  430  GGRRWTNFGFRS  441



>ref|XP_009113759.1| PREDICTED: uncharacterized protein LOC103839034 [Brassica rapa]
 emb|CDY27619.1| BnaA09g27880D [Brassica napus]
Length=659

 Score =   235 bits (600),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 120/204 (59%), Positives = 162/204 (79%), Gaps = 0/204 (0%)
 Frame = -3

Query  885  TSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMFYMV  706
            + EEIASG+T+IS IYE  NE E+A+ LL K LK+  D PG +  I GIEA+MGV++YM+
Sbjct  448  SPEEIASGLTDISVIYESMNEVEQAVTLLQKVLKIYTDSPGHKMMIVGIEAQMGVLYYMM  507

Query  705  GRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAREILE  526
            G+Y ++ ++F+ AV+KLRA+G+++S FFG+ LNQMGL+CVQL  I+EA ELFEEA+ ILE
Sbjct  508  GKYLDSYNTFKKAVSKLRATGKKQSTFFGIALNQMGLACVQLDAIEEAVELFEEAKCILE  567

Query  525  HECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDEKKRLA  346
             ECGP H +TLG+Y+NLA  YDA+GR++DAIE+L +V+  REE LGTANP  ++ K+RL 
Sbjct  568  QECGPYHPETLGLYNNLAGAYDAIGRLDDAIELLGHVVGAREENLGTANPGTEEGKRRLV  627

Query  345  ELLKEAGKSRNKKAKSLENLIDPN  274
            +LLKEAGK   +KAKSL+ LID +
Sbjct  628  QLLKEAGKVTGRKAKSLQTLIDSD  651



>ref|XP_004140507.2| PREDICTED: kinesin light chain 1-like, partial [Cucumis sativus]
Length=541

 Score =   232 bits (591),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 140/234 (60%), Positives = 173/234 (74%), Gaps = 13/234 (6%)
 Frame = -3

Query  891  GTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQS---------TIAGI  739
            G + EEI+SG+ EISA+YE  NEPEEA K+L +A  +LE                 +AGI
Sbjct  310  GASYEEISSGLVEISAVYEATNEPEEAFKVLQRATTILEQGGRGGGGRRSGSGSGAMAGI  369

Query  738  EARMGVMFYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAA  559
            EA+MGVMFYMVG+Y EAR +FE A+ KLR +   KSA FGV+LNQMGL+C+QL+KI EA 
Sbjct  370  EAQMGVMFYMVGKYGEARKAFEGAIGKLRGT---KSAMFGVLLNQMGLTCIQLYKIGEAV  426

Query  558  ELFEEAREILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTAN  379
             LF+EA+ +LE   G  H DTL V SNLAA YDAMGRVE+AIEILE +LK+REE LGTAN
Sbjct  427  RLFQEAKVVLEEHYGVYHSDTLAVSSNLAAAYDAMGRVEEAIEILEEILKVREEMLGTAN  486

Query  378  PDFDDEKKRLAELLKEAGKSRNKKAKSLENLIDPNSKRTKKESSKKWS-AFGFR  220
            P+ D+EK+RL ELLKEAG++RNKKAKSL+ L+  NS R KKE +K+W+  F FR
Sbjct  487  PEVDEEKRRLEELLKEAGRARNKKAKSLQILLGSNSLRMKKEVAKRWTGGFSFR  540



>ref|NP_974530.1| protein KINESIN LIGHT CHAIN-RELATED 1 [Arabidopsis thaliana]
 gb|AEE82934.1| tetratricopeptide repeat domain-containing protein [Arabidopsis 
thaliana]
Length=531

 Score =   224 bits (571),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 124/150 (83%), Positives = 136/150 (91%), Gaps = 1/150 (1%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGTT EEIA G+TEISAIYE  +EPEEALKLL K++KLLEDKPGQQS IAG+EARMGVM
Sbjct  383  VPGTTVEEIAGGLTEISAIYESVDEPEEALKLLQKSMKLLEDKPGQQSAIAGLEARMGVM  442

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +Y VGRY++AR++FESAV KLRA+GE KSAFFGVVLNQMGL+CVQLFKIDEA ELFEEAR
Sbjct  443  YYTVGRYEDARNAFESAVTKLRAAGE-KSAFFGVVLNQMGLACVQLFKIDEAGELFEEAR  501

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGR  448
             ILE E GPC QDTLGVYSNLAATYDAMGR
Sbjct  502  GILEQERGPCDQDTLGVYSNLAATYDAMGR  531



>ref|XP_012083176.1| PREDICTED: nephrocystin-3-like isoform X3 [Jatropha curcas]
Length=523

 Score =   223 bits (568),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = -3

Query  891  GTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVMFY  712
            GT +EEIAS +TEI+AIYE  NEP+EALKLL KA+KLLED+PGQ+STIAGIEA+MGVMFY
Sbjct  375  GTATEEIASSLTEIAAIYEALNEPDEALKLLNKAMKLLEDRPGQRSTIAGIEAQMGVMFY  434

Query  711  MVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAREI  532
            M+GRY EAR+SFESAVAKLRASGE KSAFFG+VLNQ+GL  VQL+KID+AAELFEEAREI
Sbjct  435  MIGRYGEARTSFESAVAKLRASGESKSAFFGIVLNQLGLVNVQLYKIDKAAELFEEAREI  494

Query  531  LEHECGPCHQDTLGVYSNLAATYDAMGR  448
            LE ECG CH +TLGVYSNLAATYDA+GR
Sbjct  495  LEQECGSCHLETLGVYSNLAATYDAVGR  522



>ref|XP_008795621.1| PREDICTED: kinesin light chain 1-like isoform X2 [Phoenix dactylifera]
Length=559

 Score =   223 bits (567),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 124/150 (83%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPGQQSTIAGIEARMGVM  718
            VPGT+ E+IA G+ EISAIYE  NEPEEALKLL KALKLLED PGQ ST+AGIEA+MGVM
Sbjct  375  VPGTSPEDIAGGLMEISAIYEAMNEPEEALKLLQKALKLLEDSPGQWSTVAGIEAQMGVM  434

Query  717  FYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEAR  538
            +YMVGRY E+RSSFESAVAKLRA+GE+KSAFFGVVLNQMGL+CVQLFKIDEAAELF EAR
Sbjct  435  YYMVGRYGESRSSFESAVAKLRATGEKKSAFFGVVLNQMGLACVQLFKIDEAAELFVEAR  494

Query  537  EILEHECGPCHQDTLGVYSNLAATYDAMGR  448
             ILE E G  H DTLGVYSNLAATYDAMGR
Sbjct  495  AILEQEYGSTHPDTLGVYSNLAATYDAMGR  524



>gb|EPS70530.1| hypothetical protein M569_04228, partial [Genlisea aurea]
Length=659

 Score =   224 bits (571),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 151/190 (79%), Gaps = 1/190 (1%)
 Frame = -3

Query  897  VPGTTSEEIASGMTEISAIYELFNEPeealkllvkalkllEDKPG-QQSTIAGIEARMGV  721
            +PGT  EEIASG+ +ISAIYE  NEPE AL+LL KA++   D  G QQ  IAGIEA++GV
Sbjct  446  IPGTPPEEIASGLVDISAIYESANEPEMALELLRKAMEKYGDPTGGQQGIIAGIEAQIGV  505

Query  720  MFYMVGRYDEARSSFESAVAKLRASGERKSAFFGVVLNQMGLSCVQLFKIDEAAELFEEA  541
            +++++G++ EA    +S+ A  R+ G++KSA FG+ LNQMGL C+QL  I+EAA+LFEE+
Sbjct  506  LYFVLGKFSEAYGYLKSSTANFRSIGDKKSAVFGIALNQMGLVCLQLMAINEAADLFEES  565

Query  540  REILEHECGPCHQDTLGVYSNLAATYDAMGRVEDAIEILEYVLKLREEKLGTANPDFDDE  361
            R ILE ECGP H DTL V SNLA+TYDAMGR  DAIE+LEYV++LREEKLGTANP+ +DE
Sbjct  566  RSILEAECGPYHADTLRVCSNLASTYDAMGRTGDAIELLEYVVELREEKLGTANPEVEDE  625

Query  360  KKRLAELLKE  331
            ++RL ELLKE
Sbjct  626  RRRLDELLKE  635



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2049935769300