BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig2485

Length=618
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008350306.1|  PREDICTED: putative polyol transporter 1           277   9e-90   
ref|XP_009611551.1|  PREDICTED: polyol transporter 5-like               285   1e-89   Nicotiana tomentosiformis
ref|XP_009800568.1|  PREDICTED: polyol transporter 5-like               283   7e-89   Nicotiana sylvestris
ref|XP_009596634.1|  PREDICTED: polyol transporter 5-like               281   2e-88   Nicotiana tomentosiformis
ref|XP_012069681.1|  PREDICTED: putative polyol transporter 1           280   2e-87   Jatropha curcas
ref|XP_012069657.1|  PREDICTED: putative polyol transporter 1           278   7e-87   Jatropha curcas
ref|XP_010096202.1|  Polyol transporter 5                               278   9e-87   Morus notabilis
ref|XP_002519083.1|  sugar transporter, putative                        277   1e-86   Ricinus communis
ref|XP_009766648.1|  PREDICTED: polyol transporter 5-like               276   2e-86   Nicotiana sylvestris
ref|XP_011092774.1|  PREDICTED: polyol transporter 5-like               276   2e-86   Sesamum indicum [beniseed]
ref|XP_006365518.1|  PREDICTED: polyol transporter 5-like               277   3e-86   Solanum tuberosum [potatoes]
emb|CAP58706.1|  putative polyol transporter protein 1                  275   3e-86   Hevea brasiliensis [jebe]
ref|NP_001281033.1|  polyol transporter 5-like                          275   4e-86   Malus domestica [apple tree]
gb|AFI61955.1|  polyol transporter                                      275   7e-86   Camellia sinensis [black tea]
ref|XP_008387369.1|  PREDICTED: putative polyol transporter 1 iso...    275   1e-85   
ref|XP_009344431.1|  PREDICTED: putative polyol transporter 1           274   1e-85   Pyrus x bretschneideri [bai li]
gb|AGG19155.1|  sorbitol transporter                                    274   2e-85   Pyrus pyrifolia [sha li]
ref|XP_007200585.1|  hypothetical protein PRUPE_ppa007633mg             268   2e-85   
gb|ABK29439.1|  sugar transport protein                                 273   4e-85   Coffea canephora [robusta coffee]
ref|XP_009375627.1|  PREDICTED: putative polyol transporter 1           273   4e-85   Pyrus x bretschneideri [bai li]
ref|XP_009375628.1|  PREDICTED: putative polyol transporter 1           273   5e-85   Pyrus x bretschneideri [bai li]
emb|CDO97075.1|  unnamed protein product                                272   6e-85   Coffea canephora [robusta coffee]
gb|ACB56939.1|  mannitol transporter                                    271   1e-84   Artemisia annua [sweet Annie]
ref|NP_001287655.1|  polyol transporter 5-like                          271   2e-84   Solanum lycopersicum
ref|XP_009345075.1|  PREDICTED: putative polyol transporter 1           271   4e-84   Pyrus x bretschneideri [bai li]
gb|AAM44082.1|  putative sorbitol transporter                           270   4e-84   Prunus cerasus [pie cherry]
ref|XP_008387370.1|  PREDICTED: putative polyol transporter 1           270   4e-84   Malus domestica [apple tree]
gb|AGY96955.1|  polyol transporter 1                                    269   1e-83   Vitis vinifera
ref|XP_009344433.1|  PREDICTED: putative polyol transporter 1           269   2e-83   Pyrus x bretschneideri [bai li]
ref|XP_003631630.1|  PREDICTED: polyol transporter 5                    268   2e-83   Vitis vinifera
ref|XP_004299107.1|  PREDICTED: polyol transporter 5-like               268   3e-83   Fragaria vesca subsp. vesca
ref|XP_008236795.1|  PREDICTED: polyol transporter 5-like               268   4e-83   Prunus mume [ume]
emb|CAP58707.1|  putative polyol transported protein 2                  266   2e-82   Hevea brasiliensis [jebe]
ref|XP_008393068.1|  PREDICTED: putative polyol transporter 1           266   3e-82   Malus domestica [apple tree]
ref|XP_007042744.1|  Polyol/monosaccharide transporter 5                265   4e-82   
ref|XP_010065409.1|  PREDICTED: polyol transporter 5-like               265   4e-82   Eucalyptus grandis [rose gum]
gb|EYU42630.1|  hypothetical protein MIMGU_mgv1a0059091mg               254   5e-82   Erythranthe guttata [common monkey flower]
ref|XP_002313809.1|  putative sorbitol transporter family protein       260   3e-80   Populus trichocarpa [western balsam poplar]
ref|XP_010065405.1|  PREDICTED: polyol transporter 5-like               260   5e-80   Eucalyptus grandis [rose gum]
gb|ACC61047.1|  mannitol transporter                                    255   7e-80   Gossypium hirsutum [American cotton]
ref|XP_011048787.1|  PREDICTED: polyol transporter 5-like               259   1e-79   Populus euphratica
gb|AAY86779.1|  putative sugar transporter protein                      249   2e-79   Noccaea caerulescens
gb|KHG20989.1|  Polyol transporter 5 -like protein                      258   2e-79   Gossypium arboreum [tree cotton]
gb|KJB32189.1|  hypothetical protein B456_005G228500                    258   2e-79   Gossypium raimondii
gb|KJB12315.1|  hypothetical protein B456_002G011400                    258   3e-79   Gossypium raimondii
ref|XP_004148857.1|  PREDICTED: polyol transporter 5-like               258   3e-79   Cucumis sativus [cucumbers]
ref|XP_006423215.1|  hypothetical protein CICLE_v10028170mg             258   4e-79   Citrus clementina [clementine]
ref|XP_006487182.1|  PREDICTED: polyol transporter 5-like               257   4e-79   Citrus sinensis [apfelsine]
ref|NP_001289249.1|  polyol transporter 5-like                          257   5e-79   Pyrus x bretschneideri [bai li]
ref|XP_010690917.1|  PREDICTED: polyol transporter 5 isoform X2         257   6e-79   
ref|XP_009344435.1|  PREDICTED: putative polyol transporter 1           257   6e-79   Pyrus x bretschneideri [bai li]
ref|XP_010690916.1|  PREDICTED: polyol transporter 5 isoform X1         257   6e-79   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004300990.1|  PREDICTED: polyol transporter 5-like               257   7e-79   Fragaria vesca subsp. vesca
ref|XP_012069670.1|  PREDICTED: polyol transporter 5-like               256   8e-79   Jatropha curcas
ref|XP_006406559.1|  hypothetical protein EUTSA_v10020495mg             256   9e-79   Eutrema salsugineum [saltwater cress]
gb|EPS69995.1|  sugar transport protein                                 256   1e-78   Genlisea aurea
ref|NP_001280902.1|  putative polyol transporter 1                      256   2e-78   Malus domestica [apple tree]
ref|XP_004507415.1|  PREDICTED: polyol transporter 5-like               255   3e-78   Cicer arietinum [garbanzo]
emb|CDY61985.1|  BnaC03g73840D                                          255   4e-78   Brassica napus [oilseed rape]
ref|XP_008345143.1|  PREDICTED: polyol transporter 5-like               254   6e-78   Malus domestica [apple tree]
ref|XP_009135601.1|  PREDICTED: polyol transporter 5                    254   9e-78   Brassica rapa
gb|ACB86853.1|  mannitol transporter                                    254   9e-78   Citrus sinensis [apfelsine]
ref|XP_006487181.1|  PREDICTED: polyol transporter 5-like               254   1e-77   Citrus sinensis [apfelsine]
ref|XP_011088358.1|  PREDICTED: polyol transporter 5-like               253   1e-77   Sesamum indicum [beniseed]
ref|XP_006423216.1|  hypothetical protein CICLE_v10028174mg             253   2e-77   Citrus clementina [clementine]
ref|XP_011037561.1|  PREDICTED: polyol transporter 5                    253   2e-77   Populus euphratica
ref|XP_009602627.1|  PREDICTED: polyol transporter 5-like               253   2e-77   Nicotiana tomentosiformis
gb|KFK30307.1|  hypothetical protein AALP_AA7G244900                    253   2e-77   Arabis alpina [alpine rockcress]
gb|AIU41385.1|  sorbitol transporter 1                                  251   4e-77   Prunus salicina [Japanese plum]
ref|XP_008387373.1|  PREDICTED: putative polyol transporter 1           252   4e-77   
ref|XP_008236797.1|  PREDICTED: putative polyol transporter 2           252   5e-77   Prunus mume [ume]
ref|XP_009345071.1|  PREDICTED: putative polyol transporter 1           251   6e-77   Pyrus x bretschneideri [bai li]
ref|XP_009336961.1|  PREDICTED: putative polyol transporter 1           251   6e-77   Pyrus x bretschneideri [bai li]
ref|XP_008361285.1|  PREDICTED: putative polyol transporter 1           251   9e-77   
ref|XP_010527590.1|  PREDICTED: polyol transporter 5-like               251   1e-76   Tarenaya hassleriana [spider flower]
gb|KEH30426.1|  polyol/monosaccharide transporter 1                     251   1e-76   Medicago truncatula
ref|XP_002305419.2|  hypothetical protein POPTR_0004s15960g             251   1e-76   Populus trichocarpa [western balsam poplar]
emb|CBI32562.3|  unnamed protein product                                245   2e-76   Vitis vinifera
ref|XP_008387377.1|  PREDICTED: putative polyol transporter 1           250   2e-76   
ref|XP_007199793.1|  hypothetical protein PRUPE_ppa004456mg             249   2e-76   Prunus persica
gb|KHN39768.1|  Polyol transporter 5                                    249   3e-76   Glycine soja [wild soybean]
ref|XP_009345072.1|  PREDICTED: putative polyol transporter 1           249   3e-76   
ref|XP_008236796.1|  PREDICTED: polyol transporter 5-like               249   4e-76   Prunus mume [ume]
ref|XP_008236773.1|  PREDICTED: putative polyol transporter 1           249   4e-76   Prunus mume [ume]
gb|AAO39267.1|AF482011_1  sorbitol transporter                          249   5e-76   Prunus cerasus [pie cherry]
ref|XP_006856084.1|  PREDICTED: polyol transporter 5                    249   5e-76   Amborella trichopoda
emb|CAJ29291.1|  putative polyol transporter protein 4                  249   5e-76   Lotus japonicus
ref|XP_009375822.1|  PREDICTED: putative polyol transporter 1           249   6e-76   Pyrus x bretschneideri [bai li]
ref|XP_006349565.1|  PREDICTED: polyol transporter 5-like               248   8e-76   Solanum tuberosum [potatoes]
ref|XP_009112300.1|  PREDICTED: polyol transporter 5                    249   8e-76   Brassica rapa
ref|XP_007200667.1|  hypothetical protein PRUPE_ppa015294mg             249   8e-76   
ref|XP_007131851.1|  hypothetical protein PHAVU_011G046700g             248   9e-76   Phaseolus vulgaris [French bean]
gb|KHN25361.1|  Polyol transporter 5                                    248   1e-75   Glycine soja [wild soybean]
ref|XP_003541068.1|  PREDICTED: polyol transporter 5-like               248   1e-75   
gb|KJB12316.1|  hypothetical protein B456_002G011500                    248   2e-75   Gossypium raimondii
ref|XP_006349557.1|  PREDICTED: polyol transporter 5-like               247   2e-75   Solanum tuberosum [potatoes]
ref|XP_004148312.2|  PREDICTED: polyol transporter 5-like               247   2e-75   Cucumis sativus [cucumbers]
ref|XP_006384498.1|  hypothetical protein POPTR_0004s15900g             247   3e-75   
ref|XP_008236860.1|  PREDICTED: putative polyol transporter 1           247   4e-75   Prunus mume [ume]
dbj|BAM66296.1|  sorbitol transporter                                   245   4e-75   Pyrus pyrifolia [sha li]
ref|XP_008387376.1|  PREDICTED: putative polyol transporter 1           246   5e-75   
ref|XP_011078883.1|  PREDICTED: polyol transporter 5-like isoform X1    246   6e-75   Sesamum indicum [beniseed]
gb|ACJ85869.1|  unknown                                                 244   6e-75   Medicago truncatula
gb|AAT06053.2|  sorbitol transporter                                    246   6e-75   Malus domestica [apple tree]
ref|XP_008795608.1|  PREDICTED: putative polyol transporter 1           246   6e-75   Phoenix dactylifera
emb|CDX95491.1|  BnaC01g33830D                                          246   9e-75   
gb|AAL85876.2|AF480069_1  mannitol transporter                          246   9e-75   Apium graveolens Dulce Group [celery]
ref|XP_007200254.1|  hypothetical protein PRUPE_ppa015090mg             245   1e-74   Prunus persica
ref|XP_007199207.1|  hypothetical protein PRUPE_ppa021762mg             245   1e-74   Prunus persica
ref|XP_007200033.1|  hypothetical protein PRUPE_ppa024323mg             245   2e-74   
ref|XP_003539021.2|  PREDICTED: polyol transporter 5-like               239   2e-74   
ref|XP_007200117.1|  hypothetical protein PRUPE_ppa018884mg             245   2e-74   Prunus persica
dbj|BAM66295.1|  sorbitol transporter                                   243   2e-74   Pyrus pyrifolia [sha li]
ref|XP_008791366.1|  PREDICTED: polyol transporter 5-like               244   2e-74   
emb|CDP10064.1|  unnamed protein product                                244   6e-74   Coffea canephora [robusta coffee]
ref|XP_008775333.1|  PREDICTED: polyol transporter 5-like               243   8e-74   Phoenix dactylifera
ref|XP_010527594.1|  PREDICTED: polyol transporter 5-like isoform X4    243   1e-73   Tarenaya hassleriana [spider flower]
ref|XP_010527593.1|  PREDICTED: polyol transporter 5-like isoform X3    243   2e-73   Tarenaya hassleriana [spider flower]
ref|XP_010527592.1|  PREDICTED: polyol transporter 5-like isoform X2    243   2e-73   Tarenaya hassleriana [spider flower]
ref|XP_010527591.1|  PREDICTED: polyol transporter 5-like isoform X1    242   3e-73   Tarenaya hassleriana [spider flower]
ref|XP_007200584.1|  hypothetical protein PRUPE_ppa007633mg             236   3e-73   
emb|CAD58709.1|  polyol transporter                                     242   4e-73   Plantago major [cart-track plant]
gb|ERN17552.1|  hypothetical protein AMTR_s00059p00123280               241   4e-73   Amborella trichopoda
ref|XP_004500821.1|  PREDICTED: polyol transporter 5-like               241   5e-73   Cicer arietinum [garbanzo]
ref|XP_003603886.1|  Mannitol transporter                               241   5e-73   Medicago truncatula
dbj|BAJ93158.1|  predicted protein                                      241   5e-73   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006299557.1|  hypothetical protein CARUB_v10015731mg             241   5e-73   Capsella rubella
dbj|BAJ86116.1|  predicted protein                                      241   6e-73   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002885281.1|  ATPLT5                                             241   7e-73   Arabidopsis lyrata subsp. lyrata
ref|NP_188513.1|  polyol transporter 5                                  241   7e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009121242.1|  PREDICTED: putative polyol transporter 1           233   7e-73   
ref|NP_179209.1|  polyol/monosaccharide transporter 1                   241   7e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010909852.1|  PREDICTED: putative polyol transporter 1           240   1e-72   Elaeis guineensis
emb|CAD58710.1|  polyol transporter                                     240   1e-72   Plantago major [cart-track plant]
ref|NP_001049269.1|  Os03g0197100                                       239   2e-72   
ref|XP_010516958.1|  PREDICTED: putative polyol transporter 2           239   2e-72   Camelina sativa [gold-of-pleasure]
ref|XP_010468639.1|  PREDICTED: putative polyol transporter 2           239   2e-72   Camelina sativa [gold-of-pleasure]
ref|XP_007135989.1|  hypothetical protein PHAVU_009G008900g             239   2e-72   Phaseolus vulgaris [French bean]
ref|XP_007131850.1|  hypothetical protein PHAVU_011G046600g             239   3e-72   Phaseolus vulgaris [French bean]
ref|XP_011078884.1|  PREDICTED: polyol transporter 5-like isoform X2    239   3e-72   Sesamum indicum [beniseed]
ref|XP_008447049.1|  PREDICTED: polyol transporter 5                    239   4e-72   Cucumis melo [Oriental melon]
gb|KCW55335.1|  hypothetical protein EUGRSUZ_I01255                     237   5e-72   Eucalyptus grandis [rose gum]
ref|XP_010484928.1|  PREDICTED: putative polyol transporter 1           238   5e-72   Camelina sativa [gold-of-pleasure]
ref|XP_002886203.1|  hypothetical protein ARALYDRAFT_343514             238   6e-72   Arabidopsis lyrata subsp. lyrata
ref|NP_001147446.1|  sorbitol transporter                               238   6e-72   Zea mays [maize]
ref|NP_001236592.1|  sorbitol-like transporter                          238   7e-72   
ref|XP_010507195.1|  PREDICTED: polyol transporter 5                    238   8e-72   Camelina sativa [gold-of-pleasure]
gb|EMS50618.1|  Polyol transporter 5                                    232   8e-72   Triticum urartu
ref|XP_010435020.1|  PREDICTED: putative polyol transporter 2           238   9e-72   Camelina sativa [gold-of-pleasure]
ref|XP_007201628.1|  hypothetical protein PRUPE_ppa021469mg             237   1e-71   
emb|CDP17996.1|  unnamed protein product                                238   1e-71   Coffea canephora [robusta coffee]
ref|XP_002884156.1|  predicted protein                                  237   1e-71   Arabidopsis lyrata subsp. lyrata
ref|XP_010254894.1|  PREDICTED: polyol transporter 5-like               237   1e-71   Nelumbo nucifera [Indian lotus]
gb|KFK41272.1|  hypothetical protein AALP_AA2G108500                    235   1e-71   Arabis alpina [alpine rockcress]
ref|XP_010442571.1|  PREDICTED: putative polyol transporter 2           237   2e-71   
ref|XP_003558585.1|  PREDICTED: putative polyol transporter 1           237   2e-71   Brachypodium distachyon [annual false brome]
gb|KFK40045.1|  hypothetical protein AALP_AA3G322700                    236   2e-71   Arabis alpina [alpine rockcress]
ref|XP_010254895.1|  PREDICTED: polyol transporter 5-like               237   2e-71   Nelumbo nucifera [Indian lotus]
ref|XP_006649563.1|  PREDICTED: polyol transporter 5-like               237   3e-71   Oryza brachyantha
ref|XP_010028575.1|  PREDICTED: polyol transporter 5-like               237   3e-71   Eucalyptus grandis [rose gum]
ref|XP_010472942.1|  PREDICTED: putative polyol transporter 2           236   3e-71   Camelina sativa [gold-of-pleasure]
ref|XP_006577924.1|  PREDICTED: polyol transporter 5-like               236   3e-71   Glycine max [soybeans]
ref|XP_010495901.1|  PREDICTED: putative polyol transporter 1           236   3e-71   Camelina sativa [gold-of-pleasure]
ref|XP_010472919.1|  PREDICTED: putative polyol transporter 2           236   3e-71   Camelina sativa [gold-of-pleasure]
ref|XP_010465998.1|  PREDICTED: polyol transporter 5-like               237   4e-71   Camelina sativa [gold-of-pleasure]
ref|XP_009342010.1|  PREDICTED: putative polyol transporter 1           236   5e-71   Pyrus x bretschneideri [bai li]
ref|XP_006409469.1|  hypothetical protein EUTSA_v10023129mg             236   5e-71   Eutrema salsugineum [saltwater cress]
ref|XP_010527595.1|  PREDICTED: polyol transporter 5-like               231   6e-71   Tarenaya hassleriana [spider flower]
ref|XP_010487804.1|  PREDICTED: polyol transporter 5-like               236   6e-71   Camelina sativa [gold-of-pleasure]
ref|XP_008668471.1|  PREDICTED: hypothetical protein isoform X1         236   6e-71   Zea mays [maize]
ref|XP_009350912.1|  PREDICTED: putative polyol transporter 1           236   6e-71   Pyrus x bretschneideri [bai li]
ref|XP_008465477.1|  PREDICTED: polyol transporter 5-like               236   6e-71   Cucumis melo [Oriental melon]
ref|XP_009342008.1|  PREDICTED: putative polyol transporter 1           236   7e-71   Pyrus x bretschneideri [bai li]
ref|XP_010442448.1|  PREDICTED: putative polyol transporter 2           235   9e-71   Camelina sativa [gold-of-pleasure]
ref|XP_009342009.1|  PREDICTED: putative polyol transporter 1           235   1e-70   Pyrus x bretschneideri [bai li]
ref|NP_179210.1|  polyol/monosaccharide transporter 2                   235   1e-70   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ86526.1|  predicted protein                                      235   1e-70   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008795606.1|  PREDICTED: polyol transporter 5-like isoform X1    235   1e-70   Phoenix dactylifera
ref|NP_001150711.1|  LOC100284344                                       235   1e-70   Zea mays [maize]
ref|XP_004985338.1|  PREDICTED: polyol transporter 5-like isoform X2    234   3e-70   
ref|XP_010445995.1|  PREDICTED: putative polyol transporter 2           234   3e-70   Camelina sativa [gold-of-pleasure]
ref|XP_008359575.1|  PREDICTED: LOW QUALITY PROTEIN: polyol trans...    234   4e-70   
ref|XP_008800420.1|  PREDICTED: polyol transporter 5-like               234   4e-70   Phoenix dactylifera
ref|XP_008466921.1|  PREDICTED: putative polyol transporter 1           224   4e-70   Cucumis melo [Oriental melon]
ref|XP_009121227.1|  PREDICTED: putative polyol transporter 1           233   4e-70   Brassica rapa
ref|XP_004985337.1|  PREDICTED: polyol transporter 5-like isoform X1    233   4e-70   Setaria italica
emb|CDP18000.1|  unnamed protein product                                233   5e-70   Coffea canephora [robusta coffee]
ref|XP_008245258.1|  PREDICTED: polyol transporter 5-like               233   5e-70   Prunus mume [ume]
ref|NP_001281038.1|  polyol transporter 5-like                          232   6e-70   Malus domestica [apple tree]
gb|AEX55225.1|  sugar transporter                                       233   6e-70   Allium sativum
ref|XP_009407915.1|  PREDICTED: putative polyol transporter 1           233   8e-70   Musa acuminata subsp. malaccensis [pisang utan]
gb|EAY88906.1|  hypothetical protein OsI_10385                          233   8e-70   Oryza sativa Indica Group [Indian rice]
ref|XP_009350914.1|  PREDICTED: putative polyol transporter 1           233   1e-69   Pyrus x bretschneideri [bai li]
ref|XP_008653287.1|  PREDICTED: polyol transporter 5-like               232   1e-69   Zea mays [maize]
gb|AAY88181.2|  mannitol transporter 1                                  231   1e-69   Olea europaea
gb|EEE58504.1|  hypothetical protein OsJ_09775                          232   1e-69   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007042751.1|  Polyol/monosaccharide transporter 5, putative      232   2e-69   
emb|CDY46217.1|  BnaA07g03530D                                          231   2e-69   Brassica napus [oilseed rape]
ref|XP_009121388.1|  PREDICTED: LOW QUALITY PROTEIN: putative pol...    231   2e-69   Brassica rapa
ref|XP_002463086.1|  hypothetical protein SORBIDRAFT_02g037590          231   2e-69   Sorghum bicolor [broomcorn]
ref|XP_002468337.1|  hypothetical protein SORBIDRAFT_01g044010          231   3e-69   Sorghum bicolor [broomcorn]
ref|XP_009375838.1|  PREDICTED: putative polyol transporter 1           231   3e-69   Pyrus x bretschneideri [bai li]
emb|CDY46218.1|  BnaA07g03520D                                          231   3e-69   Brassica napus [oilseed rape]
ref|XP_009780685.1|  PREDICTED: polyol transporter 5-like               220   4e-69   Nicotiana sylvestris
ref|XP_004148314.2|  PREDICTED: polyol transporter 5-like               231   5e-69   Cucumis sativus [cucumbers]
ref|XP_009378956.1|  PREDICTED: putative polyol transporter 1           231   5e-69   Pyrus x bretschneideri [bai li]
gb|KCW62858.1|  hypothetical protein EUGRSUZ_G00452                     231   6e-69   Eucalyptus grandis [rose gum]
ref|XP_004985339.1|  PREDICTED: polyol transporter 5-like               231   6e-69   Setaria italica
emb|CDP02097.1|  unnamed protein product                                230   8e-69   Coffea canephora [robusta coffee]
gb|ABX71752.1|  mannitol transporter                                    230   9e-69   Apium graveolens
ref|XP_008245305.1|  PREDICTED: polyol transporter 5-like               230   1e-68   Prunus mume [ume]
gb|EYU37769.1|  hypothetical protein MIMGU_mgv1a005015mg                229   1e-68   Erythranthe guttata [common monkey flower]
ref|XP_008447047.1|  PREDICTED: polyol transporter 5-like               229   2e-68   Cucumis melo [Oriental melon]
gb|EMS55536.1|  Polyol transporter 5                                    229   2e-68   Triticum urartu
ref|XP_009395604.1|  PREDICTED: putative polyol transporter 1           230   3e-68   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006657888.1|  PREDICTED: polyol transporter 5-like               228   3e-68   Oryza brachyantha
ref|XP_006297395.1|  hypothetical protein CARUB_v10013420mg             229   3e-68   Capsella rubella
ref|XP_006649564.1|  PREDICTED: polyol transporter 5-like               229   3e-68   Oryza brachyantha
ref|XP_008795604.1|  PREDICTED: putative polyol transporter 1           229   3e-68   Phoenix dactylifera
gb|EAZ04480.1|  hypothetical protein OsI_26629                          228   3e-68   Oryza sativa Indica Group [Indian rice]
dbj|BAC83310.1|  putative sorbitol transporter                          228   4e-68   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009407903.1|  PREDICTED: polyol transporter 5-like               228   4e-68   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAR82416.1|  polyol transporter                                     218   5e-68   Plantago major [cart-track plant]
ref|XP_004958139.1|  PREDICTED: putative polyol transporter 1-like      228   5e-68   Setaria italica
ref|XP_010497306.1|  PREDICTED: putative polyol transporter 1           218   5e-68   
ref|XP_006856085.2|  PREDICTED: polyol transporter 5                    227   7e-68   
ref|XP_003562817.1|  PREDICTED: polyol transporter 5-like               227   1e-67   Brachypodium distachyon [annual false brome]
ref|XP_002440825.1|  hypothetical protein SORBIDRAFT_09g007450          227   1e-67   Sorghum bicolor [broomcorn]
ref|XP_007208924.1|  hypothetical protein PRUPE_ppb008257mg             219   2e-67   
ref|NP_001060108.1|  Os07g0582400                                       228   2e-67   
ref|XP_010229631.1|  PREDICTED: putative polyol transporter 1           226   2e-67   Brachypodium distachyon [annual false brome]
ref|XP_003558586.1|  PREDICTED: polyol transporter 5-like               226   2e-67   Brachypodium distachyon [annual false brome]
ref|XP_011088360.1|  PREDICTED: polyol transporter 5-like               226   2e-67   Sesamum indicum [beniseed]
dbj|BAJ85302.1|  predicted protein                                      226   5e-67   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB12318.1|  hypothetical protein B456_002G011700                    225   6e-67   Gossypium raimondii
gb|AAG43998.1|AF215837_1  mannitol transporter                          225   6e-67   Apium graveolens Dulce Group [celery]
ref|XP_002460923.1|  hypothetical protein SORBIDRAFT_02g037570          225   8e-67   Sorghum bicolor [broomcorn]
ref|XP_009396401.1|  PREDICTED: polyol transporter 5-like               225   8e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010527168.1|  PREDICTED: putative polyol transporter 1           221   8e-67   Tarenaya hassleriana [spider flower]
ref|XP_008800418.1|  PREDICTED: polyol transporter 5-like               225   1e-66   Phoenix dactylifera
ref|XP_002467638.1|  hypothetical protein SORBIDRAFT_01g031360          224   1e-66   Sorghum bicolor [broomcorn]
ref|XP_008368694.1|  PREDICTED: polyol transporter 5-like               223   2e-66   
tpg|DAA45950.1|  TPA: hypothetical protein ZEAMMB73_850316              223   3e-66   
gb|EMT15229.1|  Putative polyol transporter 1                           218   4e-66   
emb|CDP17999.1|  unnamed protein product                                223   5e-66   Coffea canephora [robusta coffee]
ref|XP_010905472.1|  PREDICTED: polyol transporter 5-like               223   6e-66   
gb|AAN07021.1|  putative mannitol transporter                           223   7e-66   Phelipanche ramosa
ref|XP_011659070.1|  PREDICTED: polyol transporter 5-like               222   8e-66   Cucumis sativus [cucumbers]
ref|XP_004983902.1|  PREDICTED: polyol transporter 5-like isoform X2    222   1e-65   
ref|XP_003562818.1|  PREDICTED: polyol transporter 5-like               222   1e-65   Brachypodium distachyon [annual false brome]
gb|KJB12317.1|  hypothetical protein B456_002G011600                    221   1e-65   Gossypium raimondii
ref|XP_004983901.1|  PREDICTED: polyol transporter 5-like isoform X1    222   1e-65   Setaria italica
ref|XP_008795607.1|  PREDICTED: polyol transporter 5-like isoform X2    221   1e-65   Phoenix dactylifera
ref|XP_004958138.1|  PREDICTED: polyol transporter 5-like               221   1e-65   Setaria italica
ref|XP_006827103.2|  PREDICTED: polyol transporter 5                    220   2e-65   
gb|KHN25431.1|  Polyol transporter 5                                    221   2e-65   Glycine soja [wild soybean]
dbj|BAK00091.1|  predicted protein                                      221   2e-65   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010905473.1|  PREDICTED: putative polyol transporter 1           221   3e-65   
ref|XP_003540961.2|  PREDICTED: polyol transporter 5-like               221   3e-65   Glycine max [soybeans]
gb|EMT15230.1|  Polyol transporter 5                                    221   3e-65   
ref|XP_010068107.1|  PREDICTED: polyol transporter 5-like               219   5e-65   Eucalyptus grandis [rose gum]
ref|XP_006361759.1|  PREDICTED: polyol transporter 5-like               218   1e-64   Solanum tuberosum [potatoes]
gb|EYU20732.1|  hypothetical protein MIMGU_mgv1a026176mg                219   1e-64   Erythranthe guttata [common monkey flower]
gb|EMS55537.1|  Putative polyol transporter 1                           216   1e-64   Triticum urartu
ref|XP_004148303.1|  PREDICTED: polyol transporter 5-like               219   1e-64   Cucumis sativus [cucumbers]
gb|EAZ04481.1|  hypothetical protein OsI_26630                          219   1e-64   Oryza sativa Indica Group [Indian rice]
ref|XP_003607077.1|  Sorbitol-like transporter                          218   3e-64   Medicago truncatula
tpg|DAA43975.1|  TPA: polyol transporter protein 4                      216   1e-63   
ref|XP_006827104.1|  PREDICTED: polyol transporter 5                    216   1e-63   
ref|XP_008387375.1|  PREDICTED: polyol transporter 5-like               216   1e-63   
gb|AAO88964.1|  sorbitol transporter                                    216   1e-63   Malus domestica [apple tree]
gb|ACG47895.1|  polyol transporter protein 4                            216   2e-63   Zea mays [maize]
emb|CDP03333.1|  unnamed protein product                                216   2e-63   Coffea canephora [robusta coffee]
ref|XP_007131852.1|  hypothetical protein PHAVU_011G046800g             216   2e-63   Phaseolus vulgaris [French bean]
dbj|BAC83311.1|  putative sorbitol transporter                          216   2e-63   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001060109.2|  Os07g0582500                                       215   2e-63   
ref|XP_009607069.1|  PREDICTED: polyol transporter 5-like               215   3e-63   Nicotiana tomentosiformis
gb|KCW55336.1|  hypothetical protein EUGRSUZ_I01255                     213   3e-63   Eucalyptus grandis [rose gum]
ref|XP_006658740.1|  PREDICTED: polyol transporter 5-like               215   3e-63   Oryza brachyantha
ref|XP_008447044.1|  PREDICTED: polyol transporter 5-like               216   3e-63   
gb|ABF94465.1|  Sugar transporter family protein, expressed             216   4e-63   
ref|XP_009344434.1|  PREDICTED: polyol transporter 5-like               214   4e-63   
ref|XP_009375629.1|  PREDICTED: polyol transporter 5-like               214   4e-63   
ref|NP_001281036.1|  polyol transporter 5-like                          214   4e-63   
gb|AGG19156.1|  sorbitol transporter                                    214   5e-63   
ref|XP_009774532.1|  PREDICTED: polyol transporter 5-like               214   9e-63   
ref|XP_011088761.1|  PREDICTED: putative polyol transporter 1           209   2e-62   
ref|XP_004958137.1|  PREDICTED: polyol transporter 5-like               213   2e-62   
ref|XP_006360474.1|  PREDICTED: polyol transporter 5-like               214   2e-62   
ref|XP_010530848.1|  PREDICTED: LOW QUALITY PROTEIN: putative pol...    213   2e-62   
ref|XP_009345073.1|  PREDICTED: polyol transporter 5-like               213   2e-62   
ref|XP_008386449.1|  PREDICTED: polyol transporter 5-like               212   6e-62   
dbj|BAJ93015.1|  predicted protein                                      212   7e-62   
ref|XP_012076686.1|  PREDICTED: polyol transporter 5-like               212   9e-62   
ref|XP_009371465.1|  PREDICTED: polyol transporter 5-like               211   9e-62   
ref|XP_008447045.1|  PREDICTED: polyol transporter 5-like               211   2e-61   
gb|KEH30425.1|  polyol/monosaccharide transporter 1                     209   2e-61   
ref|XP_007013362.1|  Polyol/monosaccharide transporter 5, putative      210   3e-61   
ref|XP_010548048.1|  PREDICTED: putative polyol transporter 1           210   4e-61   
ref|XP_011458734.1|  PREDICTED: probable polyol transporter 6           210   5e-61   
ref|XP_008242649.1|  PREDICTED: probable polyol transporter 6           209   7e-61   
ref|XP_007203539.1|  hypothetical protein PRUPE_ppa1027213mg            210   8e-61   
gb|ABR16466.1|  unknown                                                 209   9e-61   
gb|ERM94340.1|  hypothetical protein AMTR_s00010p00243630               208   1e-60   
ref|XP_004148302.1|  PREDICTED: putative polyol transporter 2           209   1e-60   
ref|NP_001142160.1|  hypothetical protein                               208   2e-60   
ref|XP_003529995.1|  PREDICTED: polyol transporter 5-like               208   2e-60   
ref|XP_004243120.1|  PREDICTED: polyol transporter 5-like               207   3e-60   
ref|XP_010688202.1|  PREDICTED: polyol transporter 5-like               207   4e-60   
ref|XP_011458741.1|  PREDICTED: polyol transporter 5-like               206   7e-60   
gb|EYU23018.1|  hypothetical protein MIMGU_mgv1a005494mg                206   8e-60   
ref|XP_008667512.1|  PREDICTED: hypothetical protein isoform X1         206   8e-60   
ref|XP_002514302.1|  sugar transporter, putative                        207   9e-60   
ref|XP_008670519.1|  PREDICTED: putative polyol transporter 1           206   2e-59   
ref|XP_007203309.1|  hypothetical protein PRUPE_ppa025908mg             205   2e-59   
ref|XP_012076685.1|  PREDICTED: polyol transporter 5-like               205   2e-59   
gb|EMT00465.1|  Putative polyol transporter 1                           206   2e-59   
ref|XP_007152832.1|  hypothetical protein PHAVU_004G163600g             206   2e-59   
ref|XP_007013174.1|  Polyol/monosaccharide transporter 5 isoform 1      206   2e-59   
ref|XP_008651795.1|  PREDICTED: uncharacterized protein LOC100501...    204   4e-59   
ref|XP_010049692.1|  PREDICTED: polyol transporter 5-like               204   4e-59   
gb|KCW81997.1|  hypothetical protein EUGRSUZ_C03362                     204   7e-59   
gb|KHG12832.1|  Polyol transporter 5 -like protein                      194   7e-59   
gb|EMS52712.1|  Putative polyol transporter 2                           204   9e-59   
ref|XP_006833286.2|  PREDICTED: polyol transporter 5                    204   2e-58   
ref|XP_002280978.1|  PREDICTED: polyol transporter 5                    202   2e-58   
ref|NP_001132062.1|  proton myo-inositol cotransporter                  202   3e-58   
gb|ACG35144.1|  proton myo-inositol cotransporter                       202   4e-58   
gb|KJB64902.1|  hypothetical protein B456_010G071500                    199   4e-58   
ref|XP_008463391.1|  PREDICTED: probable polyol transporter 6           201   5e-58   
ref|XP_003533389.1|  PREDICTED: polyol transporter 5-like               202   6e-58   
ref|XP_011650543.1|  PREDICTED: putative polyol transporter 2           202   6e-58   
gb|KJB64901.1|  hypothetical protein B456_010G071400                    201   6e-58   
ref|XP_002460924.1|  hypothetical protein SORBIDRAFT_02g037580          201   8e-58   
ref|NP_001168177.1|  uncharacterized protein LOC100381931               201   9e-58   
ref|XP_008452333.1|  PREDICTED: polyol transporter 5-like isoform X2    201   1e-57   
ref|XP_010099586.1|  Polyol transporter 5                               201   1e-57   
gb|KHG11695.1|  Polyol transporter 5 -like protein                      200   2e-57   
ref|XP_007013177.1|  Polyol/monosaccharide transporter 5 isoform 1      200   2e-57   
ref|XP_008447046.1|  PREDICTED: polyol transporter 5-like               200   2e-57   
ref|XP_006451145.1|  hypothetical protein CICLE_v10008031mg             200   2e-57   
ref|XP_002514303.1|  sugar transporter, putative                        200   2e-57   
ref|XP_009374073.1|  PREDICTED: probable polyol transporter 6           200   3e-57   
gb|KJB54071.1|  hypothetical protein B456_009G019700                    199   5e-57   
emb|CBI28072.3|  unnamed protein product                                202   8e-57   
ref|XP_004148315.2|  PREDICTED: polyol transporter 5-like               197   2e-56   
ref|XP_008337386.1|  PREDICTED: polyol transporter 5-like               197   2e-56   
gb|KJB40206.1|  hypothetical protein B456_007G051000                    197   2e-56   
gb|KGN56185.1|  hypothetical protein Csa_3G095020                       196   3e-56   
ref|XP_003539908.1|  PREDICTED: probable polyol transporter 4-like      197   3e-56   
ref|XP_011045507.1|  PREDICTED: probable polyol transporter 4           197   3e-56   
ref|XP_002517946.1|  sugar transporter, putative                        197   3e-56   
ref|XP_011015401.1|  PREDICTED: probable polyol transporter 4           197   3e-56   
ref|XP_008229167.1|  PREDICTED: probable polyol transporter 4           197   4e-56   
ref|XP_007160334.1|  hypothetical protein PHAVU_002G312900g             196   4e-56   
ref|XP_002319907.2|  mannitol transporter family protein                197   4e-56   
ref|XP_006475613.1|  PREDICTED: polyol transporter 5-like               197   5e-56   
gb|ERM98564.1|  hypothetical protein AMTR_s00109p00027810               195   5e-56   
gb|KDO50887.1|  hypothetical protein CISIN_1g009185mg                   197   5e-56   
ref|XP_010095276.1|  putative polyol transporter 6                      196   5e-56   
ref|XP_007215837.1|  hypothetical protein PRUPE_ppa004119mg             197   6e-56   
ref|XP_006451144.1|  hypothetical protein CICLE_v10007938mg             197   6e-56   
tpg|DAA41237.1|  TPA: hypothetical protein ZEAMMB73_503211              188   6e-56   
ref|XP_003620669.1|  Myo-inositol transporter                           196   7e-56   
gb|EPS63014.1|  hypothetical protein M569_11773                         194   1e-55   
ref|XP_006827815.2|  PREDICTED: LOW QUALITY PROTEIN: probable pol...    196   1e-55   
ref|XP_003593550.1|  hypothetical protein MTR_2g013310                  195   2e-55   
ref|XP_004150056.1|  PREDICTED: probable polyol transporter 6           194   2e-55   
gb|AJU57226.1|  polyol transporter 4                                    195   2e-55   
ref|XP_003527443.1|  PREDICTED: probable polyol transporter 4-like      195   2e-55   
ref|XP_011096257.1|  PREDICTED: probable polyol transporter 4           195   3e-55   
ref|XP_004512978.1|  PREDICTED: polyol transporter 5-like               194   3e-55   
gb|ERM95231.1|  hypothetical protein AMTR_s00009p00268230               194   4e-55   
ref|XP_010070046.1|  PREDICTED: probable polyol transporter 6           194   5e-55   
ref|XP_010035720.1|  PREDICTED: probable polyol transporter 4           194   5e-55   
ref|XP_006449296.1|  hypothetical protein CICLE_v10014943mg             194   5e-55   
emb|CBI28773.3|  unnamed protein product                                193   6e-55   
ref|XP_009342652.1|  PREDICTED: probable polyol transporter 4           194   7e-55   
ref|XP_008338123.1|  PREDICTED: probable polyol transporter 6           193   8e-55   
gb|KDO75863.1|  hypothetical protein CISIN_1g010273mg                   193   9e-55   
ref|XP_006467839.1|  PREDICTED: probable polyol transporter 4-like      193   1e-54   
ref|XP_007211557.1|  hypothetical protein PRUPE_ppa004144mg             193   1e-54   
ref|XP_008225034.1|  PREDICTED: probable polyol transporter 4           193   1e-54   
ref|XP_010026167.1|  PREDICTED: probable polyol transporter 6           192   1e-54   
ref|XP_007132713.1|  hypothetical protein PHAVU_011G118500g             193   1e-54   
ref|XP_004134957.1|  PREDICTED: probable polyol transporter 4           192   1e-54   
emb|CAN66670.1|  hypothetical protein VITISV_017987                     193   1e-54   
ref|XP_002263849.1|  PREDICTED: probable polyol transporter 4           193   1e-54   
ref|XP_008342925.1|  PREDICTED: probable polyol transporter 4           193   1e-54   
ref|XP_004301584.2|  PREDICTED: probable polyol transporter 4           193   1e-54   
ref|XP_009624322.1|  PREDICTED: probable polyol transporter 4 iso...    192   1e-54   
ref|XP_007046983.1|  Major facilitator superfamily protein              192   2e-54   
gb|KFK40451.1|  hypothetical protein AALP_AA3G374800                    192   2e-54   
ref|XP_010530847.1|  PREDICTED: putative polyol transporter 1           192   2e-54   
ref|XP_006347075.1|  PREDICTED: probable polyol transporter 4-lik...    192   2e-54   
ref|XP_009371568.1|  PREDICTED: probable polyol transporter 6           192   2e-54   
gb|ACN26310.1|  unknown                                                 191   2e-54   
ref|XP_002519026.1|  sugar transporter, putative                        192   2e-54   
ref|XP_007148196.1|  hypothetical protein PHAVU_006G188100g             192   3e-54   
gb|AFK48916.1|  unknown                                                 182   3e-54   
ref|XP_009773455.1|  PREDICTED: probable polyol transporter 4 iso...    192   3e-54   
ref|XP_009773456.1|  PREDICTED: probable polyol transporter 4 iso...    191   3e-54   
ref|XP_004232838.1|  PREDICTED: probable polyol transporter 4 iso...    191   4e-54   
ref|XP_006425707.1|  hypothetical protein CICLE_v10027247mg             191   4e-54   
ref|XP_010414363.1|  PREDICTED: probable polyol transporter 3           191   4e-54   
ref|XP_010686555.1|  PREDICTED: probable polyol transporter 4           191   5e-54   
gb|EYU26153.1|  hypothetical protein MIMGU_mgv1a018346mg                191   5e-54   
ref|XP_008381259.1|  PREDICTED: probable polyol transporter 4           191   7e-54   
ref|XP_010099574.1|  putative polyol transporter 4                      191   7e-54   
ref|XP_008241649.1|  PREDICTED: probable polyol transporter 6           191   7e-54   
ref|XP_006297425.1|  hypothetical protein CARUB_v10013450mg             191   8e-54   
ref|XP_003545891.1|  PREDICTED: probable polyol transporter 4-lik...    191   1e-53   
gb|KJB77296.1|  hypothetical protein B456_012G130400                    191   1e-53   
ref|XP_010467666.1|  PREDICTED: probable polyol transporter 3           190   1e-53   
ref|XP_010497436.1|  PREDICTED: putative polyol transporter 1           182   1e-53   
ref|XP_011460253.1|  PREDICTED: probable polyol transporter 4           190   1e-53   
ref|XP_012084471.1|  PREDICTED: probable polyol transporter 6           189   1e-53   
ref|XP_006475614.1|  PREDICTED: polyol transporter 5-like isoform X1    190   2e-53   
ref|XP_008795662.1|  PREDICTED: probable polyol transporter 6           189   2e-53   
gb|KJB31705.1|  hypothetical protein B456_005G202400                    190   2e-53   
ref|XP_008439885.1|  PREDICTED: LOW QUALITY PROTEIN: probable pol...    189   2e-53   
gb|ADP37150.1|  putative polyol/monosaccharide transporter              190   2e-53   
ref|XP_006395993.1|  hypothetical protein EUTSA_v10003989mg             190   2e-53   
gb|KHN08546.1|  Putative polyol transporter 4                           189   2e-53   
emb|CDY66291.1|  BnaCnng50240D                                          188   2e-53   
ref|XP_006409145.1|  hypothetical protein EUTSA_v10022657mg             189   3e-53   
tpg|DAA63328.1|  TPA: hypothetical protein ZEAMMB73_585953              188   3e-53   
ref|NP_179438.1|  putative polyol transporter 3                         189   4e-53   
gb|KHN00554.1|  Putative polyol transporter 3                           188   4e-53   
ref|XP_006346943.1|  PREDICTED: probable polyol transporter 6-like      188   4e-53   
emb|CDY72252.1|  BnaCnng76720D                                          188   4e-53   
ref|XP_002886303.1|  hypothetical protein ARALYDRAFT_480914             189   4e-53   
ref|XP_003543064.1|  PREDICTED: probable polyol transporter 4-lik...    189   4e-53   
emb|CDY66868.1|  BnaUnng01720D                                          188   4e-53   
ref|XP_011011702.1|  PREDICTED: LOW QUALITY PROTEIN: probable pol...    192   4e-53   
ref|NP_179671.2|  putative polyol transporter 4                         189   4e-53   
ref|XP_011085354.1|  PREDICTED: LOW QUALITY PROTEIN: probable pol...    189   5e-53   
ref|XP_009627595.1|  PREDICTED: probable polyol transporter 6           188   5e-53   
ref|XP_010489553.1|  PREDICTED: probable polyol transporter 3           188   5e-53   
ref|XP_010649162.1|  PREDICTED: probable polyol transporter 6 iso...    185   5e-53   
ref|XP_008452332.1|  PREDICTED: putative polyol transporter 2 iso...    189   6e-53   
ref|XP_010488992.1|  PREDICTED: probable polyol transporter 4           188   8e-53   
ref|XP_010467767.1|  PREDICTED: probable polyol transporter 4 iso...    188   8e-53   
ref|XP_007149864.1|  hypothetical protein PHAVU_005G105000g             188   8e-53   
ref|XP_009112494.1|  PREDICTED: probable polyol transporter 3           187   9e-53   
ref|XP_007025694.1|  Major facilitator superfamily protein              188   1e-52   
ref|XP_010680814.1|  PREDICTED: probable polyol transporter 3           187   1e-52   
ref|XP_009787559.1|  PREDICTED: probable polyol transporter 4           188   1e-52   
ref|XP_009613014.1|  PREDICTED: probable polyol transporter 4           188   1e-52   
ref|XP_009121193.1|  PREDICTED: probable polyol transporter 4           187   1e-52   
ref|XP_011658491.1|  PREDICTED: probable polyol transporter 6           187   1e-52   
ref|XP_010531021.1|  PREDICTED: probable polyol transporter 3           187   1e-52   
ref|XP_011027893.1|  PREDICTED: probable polyol transporter 4           187   1e-52   
ref|XP_007203922.1|  hypothetical protein PRUPE_ppa017052mg             187   1e-52   
ref|XP_012088309.1|  PREDICTED: probable polyol transporter 4 iso...    187   1e-52   
ref|XP_007043554.1|  Major facilitator superfamily protein              187   1e-52   
gb|EAY77363.1|  hypothetical protein OsI_05348                          186   1e-52   
ref|XP_003618299.1|  Mannitol transporter                               187   2e-52   
ref|NP_001141158.1|  hypothetical protein                               186   2e-52   
ref|XP_003538847.1|  PREDICTED: probable polyol transporter 3-like      187   2e-52   
ref|XP_004509296.1|  PREDICTED: probable polyol transporter 3-like      186   2e-52   
ref|XP_006297471.1|  hypothetical protein CARUB_v10013492mg             187   2e-52   
ref|NP_001045505.2|  Os01g0966900                                       186   2e-52   
ref|XP_009799010.1|  PREDICTED: probable polyol transporter 6           186   2e-52   
emb|CBI17542.3|  unnamed protein product                                185   2e-52   
ref|XP_008371338.1|  PREDICTED: probable polyol transporter 4           187   3e-52   
ref|XP_009357822.1|  PREDICTED: probable polyol transporter 4           187   3e-52   
ref|XP_010049436.1|  PREDICTED: polyol transporter 5-like               185   3e-52   
ref|XP_002531429.1|  sugar transporter, putative                        186   3e-52   
ref|XP_004233513.1|  PREDICTED: probable polyol transporter 6 iso...    186   3e-52   
ref|XP_010242001.1|  PREDICTED: probable polyol transporter 4           187   3e-52   
ref|XP_009335311.1|  PREDICTED: probable polyol transporter 4           187   3e-52   
ref|XP_009624323.1|  PREDICTED: probable polyol transporter 4 iso...    186   3e-52   
ref|XP_008338588.1|  PREDICTED: probable polyol transporter 6           186   4e-52   
ref|XP_003575479.1|  PREDICTED: polyol transporter 5-like               185   5e-52   
ref|XP_011016252.1|  PREDICTED: probable polyol transporter 4           186   5e-52   
ref|XP_006597419.1|  PREDICTED: probable polyol transporter 4-lik...    185   6e-52   
ref|XP_006411974.1|  hypothetical protein EUTSA_v10024974mg             185   7e-52   
ref|XP_010052344.1|  PREDICTED: probable polyol transporter 4 iso...    184   7e-52   
ref|XP_004514460.1|  PREDICTED: probable polyol transporter 4-like      186   8e-52   
ref|XP_002267872.1|  PREDICTED: probable polyol transporter 6 iso...    185   8e-52   
ref|XP_009773457.1|  PREDICTED: probable polyol transporter 4 iso...    185   8e-52   
gb|KFK40217.1|  hypothetical protein AALP_AA3G345800                    185   8e-52   
gb|AFK37582.1|  unknown                                                 185   8e-52   
gb|EPS74022.1|  hypothetical protein M569_00722                         184   9e-52   
ref|XP_010035723.1|  PREDICTED: probable polyol transporter 4           185   1e-51   
ref|XP_006350047.1|  PREDICTED: probable polyol transporter 4-like      185   1e-51   
dbj|BAO96228.1|  polyol/monosaccharide transporter 3                    185   1e-51   
ref|XP_006347076.1|  PREDICTED: probable polyol transporter 4-lik...    184   1e-51   
ref|XP_003629474.1|  hypothetical protein MTR_8g077890                  184   1e-51   
ref|XP_010047731.1|  PREDICTED: probable polyol transporter 6           185   1e-51   
ref|XP_004251791.1|  PREDICTED: probable polyol transporter 4           185   1e-51   
gb|ACN35873.1|  unknown                                                 183   1e-51   
ref|XP_006346993.1|  PREDICTED: probable polyol transporter 6-like      184   1e-51   
ref|XP_010316729.1|  PREDICTED: probable polyol transporter 4 iso...    184   1e-51   
gb|ACJ85829.1|  unknown                                                 184   1e-51   
ref|XP_003630795.1|  Polyol transporter                                 184   1e-51   
ref|NP_001239704.1|  uncharacterized protein LOC100778511               185   2e-51   
emb|CCC58382.1|  polyol/monosaccharide transporter 4                    184   2e-51   
ref|XP_008440694.1|  PREDICTED: probable polyol transporter 6           184   2e-51   



>ref|XP_008350306.1| PREDICTED: putative polyol transporter 1, partial [Malus domestica]
Length=282

 Score =   277 bits (708),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 148/190 (78%), Positives = 166/190 (87%), Gaps = 4/190 (2%)
 Frame = +3

Query  60   MTDGKLENNGVSGH----IPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAII  227
            M D   ++N VS      I  FDPP+KP RNKYA AC++LAS+ SILLGYDIGVMSGA I
Sbjct  1    MADRTTDDNTVSSQPQKTIEDFDPPQKPKRNKYAFACAILASMTSILLGYDIGVMSGAAI  60

Query  228  YIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGF  407
            YIKDDLKISDV+VE+L+G L ++SL GSAAAGRTSDW+GRRYT+V+A  IFF GALLMGF
Sbjct  61   YIKDDLKISDVEVEILLGILNLYSLIGSAAAGRTSDWVGRRYTIVLAGAIFFVGALLMGF  120

Query  408  ATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSN  587
            AT+YAFLM GRFVAGVGVGYALM+APVYTAEVSPASSRGFLTSFPEVFIN+GILLGYVSN
Sbjct  121  ATNYAFLMFGRFVAGVGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINSGILLGYVSN  180

Query  588  FAFSKLPTHL  617
            +AFSKLPTHL
Sbjct  181  YAFSKLPTHL  190



>ref|XP_009611551.1| PREDICTED: polyol transporter 5-like [Nicotiana tomentosiformis]
Length=539

 Score =   285 bits (728),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 159/192 (83%), Positives = 168/192 (88%), Gaps = 6/192 (3%)
 Frame = +3

Query  60   MTDGKL-ENNGVSGH-----IPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGA  221
            M + KL  NNGV        I  FDPPKKP  NKYA+ACS LASLASILLGYDIGVMSGA
Sbjct  1    MAEEKLASNNGVHSQPQIASIRDFDPPKKPKTNKYAIACSFLASLASILLGYDIGVMSGA  60

Query  222  IIYIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLM  401
            IIYI+ DL I+D+QVE+LVG L V+SLFGSAAAGRTSDWIGRRYTMVVA+ IFFAGALLM
Sbjct  61   IIYIQKDLHITDIQVEILVGILNVYSLFGSAAAGRTSDWIGRRYTMVVAAAIFFAGALLM  120

Query  402  GFATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYV  581
            GFAT YAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFIN GILLGYV
Sbjct  121  GFATTYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYV  180

Query  582  SNFAFSKLPTHL  617
            SNFAFS+LPTHL
Sbjct  181  SNFAFSRLPTHL  192



>ref|XP_009800568.1| PREDICTED: polyol transporter 5-like [Nicotiana sylvestris]
Length=534

 Score =   283 bits (723),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 168/190 (88%), Gaps = 4/190 (2%)
 Frame = +3

Query  60   MTDGKL-ENNG---VSGHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAII  227
            M + KL  NNG   +   I  FDPPKKP RNKYA+ACS LASLASILLGYDIGVMSGAII
Sbjct  1    MAEEKLASNNGQPQIVTSIQDFDPPKKPKRNKYAIACSFLASLASILLGYDIGVMSGAII  60

Query  228  YIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGF  407
            YIK DL I+D QVE+LVG L ++SLFGSAAAGRTSDWIGRRYTMVVA+ IFFAGALLMGF
Sbjct  61   YIKKDLHITDTQVEILVGILNIYSLFGSAAAGRTSDWIGRRYTMVVAAAIFFAGALLMGF  120

Query  408  ATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSN  587
            AT YAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFIN GILLGYVSN
Sbjct  121  ATTYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYVSN  180

Query  588  FAFSKLPTHL  617
            FAFS+LPT+L
Sbjct  181  FAFSRLPTNL  190



>ref|XP_009596634.1| PREDICTED: polyol transporter 5-like [Nicotiana tomentosiformis]
Length=526

 Score =   281 bits (720),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 154/187 (82%), Positives = 164/187 (88%), Gaps = 1/187 (1%)
 Frame = +3

Query  60   MTDGKLENNGVSGHIP-AFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIK  236
            M D K   N V G +  AFDPPKKP RNKYA+ACS LASLASILLGYDIGVMSGAIIYIK
Sbjct  1    MADKKQGRNAVCGQLQIAFDPPKKPKRNKYAVACSFLASLASILLGYDIGVMSGAIIYIK  60

Query  237  DDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATD  416
             DL I+DVQVE+L G L ++SL GSAAAGRTSDWIGRR TMVVA+VIFF GALLMGFAT+
Sbjct  61   KDLNINDVQVEILAGILNLYSLIGSAAAGRTSDWIGRRNTMVVAAVIFFVGALLMGFATN  120

Query  417  YAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAF  596
            YAFLM GRFVAG+GVGYALM+APVYTAEVSPASSRGFLTSFPEVFIN GILLGYVSNFAF
Sbjct  121  YAFLMFGRFVAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYVSNFAF  180

Query  597  SKLPTHL  617
            SKLP HL
Sbjct  181  SKLPAHL  187



>ref|XP_012069681.1| PREDICTED: putative polyol transporter 1 [Jatropha curcas]
 gb|KDP46230.1| hypothetical protein JCGZ_10070 [Jatropha curcas]
Length=542

 Score =   280 bits (715),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 146/179 (82%), Positives = 160/179 (89%), Gaps = 0/179 (0%)
 Frame = +3

Query  81   NNGVSGHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDV  260
             N     +  FDPPKKP  NK+A+AC++LAS+ SILLGYDIGVMSGA IYIKDDLKISD+
Sbjct  18   QNQTEKRLADFDPPKKPKSNKFALACAVLASMTSILLGYDIGVMSGAAIYIKDDLKISDL  77

Query  261  QVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGR  440
            QVE+LVG+L ++SL GSAAAGRTSDWIGRRYT+VVA  IFF GALLMGFAT YAFLMVGR
Sbjct  78   QVEVLVGTLNIYSLVGSAAAGRTSDWIGRRYTIVVAGAIFFVGALLMGFATTYAFLMVGR  137

Query  441  FVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            FVAG+GVGYALM+APVYTAEVSPASSRGFLTSFPEVFIN GILLGYVSNFAFSKLPTHL
Sbjct  138  FVAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYVSNFAFSKLPTHL  196



>ref|XP_012069657.1| PREDICTED: putative polyol transporter 1 [Jatropha curcas]
Length=542

 Score =   278 bits (710),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 145/179 (81%), Positives = 159/179 (89%), Gaps = 0/179 (0%)
 Frame = +3

Query  81   NNGVSGHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDV  260
             N     +  FDPPKKP  NK+A+AC++LAS+ SILLGYDIGVMSGA IYIKDDL+ISD 
Sbjct  18   QNQTEKRLADFDPPKKPKSNKFALACAVLASMTSILLGYDIGVMSGAAIYIKDDLQISDF  77

Query  261  QVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGR  440
            QVE+LVG+L ++SL GSAAAGRTSDWIGRRYT+VVA  IFF GALLMGFAT YAFLMVGR
Sbjct  78   QVEVLVGTLNIYSLVGSAAAGRTSDWIGRRYTIVVAGAIFFVGALLMGFATTYAFLMVGR  137

Query  441  FVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            FVAG+GVGYALM+APVYTAEVSPASSRGFLTSFPEVFIN GILLGYVSNFAFSKLPTHL
Sbjct  138  FVAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYVSNFAFSKLPTHL  196



>ref|XP_010096202.1| Polyol transporter 5 [Morus notabilis]
 gb|EXB63597.1| Polyol transporter 5 [Morus notabilis]
Length=541

 Score =   278 bits (710),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 147/190 (77%), Positives = 169/190 (89%), Gaps = 4/190 (2%)
 Frame = +3

Query  60   MTDGKLENNGVSGH----IPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAII  227
            M D K E NG+SG     I  FDPPK+P +N +A+AC++LAS+ SILLGYDIGVMSGA+I
Sbjct  1    MADRKAEVNGISGQTQKTIADFDPPKRPRKNIFAIACAVLASMTSILLGYDIGVMSGAVI  60

Query  228  YIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGF  407
            +IK+DLKISDV+VE+L G L ++SL GSAAAGRTSDWIGRRYT+V+A  IFFAGALLMGF
Sbjct  61   FIKEDLKISDVKVEILTGILNLYSLLGSAAAGRTSDWIGRRYTIVLAGAIFFAGALLMGF  120

Query  408  ATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSN  587
            AT+YAFLM GRFVAG+GVGYALM+APVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSN
Sbjct  121  ATNYAFLMFGRFVAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSN  180

Query  588  FAFSKLPTHL  617
            +AFSKLPT+L
Sbjct  181  YAFSKLPTYL  190



>ref|XP_002519083.1| sugar transporter, putative [Ricinus communis]
 gb|EEF43294.1| sugar transporter, putative [Ricinus communis]
Length=539

 Score =   277 bits (708),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 144/172 (84%), Positives = 160/172 (93%), Gaps = 0/172 (0%)
 Frame = +3

Query  102  IPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVG  281
            I  FDPPKKP RNK+A+AC++LAS+ SILLGYDIGVMSGA IYIKD+ ++SD+QVE+LVG
Sbjct  20   IADFDPPKKPKRNKFALACAILASMTSILLGYDIGVMSGAAIYIKDEFRLSDLQVEILVG  79

Query  282  SLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGV  461
            +L ++SL GSAAAGRTSDWIGRRYT+VVA  IFF GALLMGFAT YAFLMVGRFVAG+GV
Sbjct  80   TLNLYSLVGSAAAGRTSDWIGRRYTIVVAGAIFFVGALLMGFATSYAFLMVGRFVAGIGV  139

Query  462  GYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            GYALM+APVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL
Sbjct  140  GYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  191



>ref|XP_009766648.1| PREDICTED: polyol transporter 5-like [Nicotiana sylvestris]
Length=526

 Score =   276 bits (707),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 152/187 (81%), Positives = 163/187 (87%), Gaps = 1/187 (1%)
 Frame = +3

Query  60   MTDGKLENNGVSGHIP-AFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIK  236
            M D K   N V G +  AFDPPKKP RNKYA ACS LASLASILLGYDIGVMSGAIIYIK
Sbjct  1    MADKKHGRNAVCGQLQIAFDPPKKPKRNKYATACSFLASLASILLGYDIGVMSGAIIYIK  60

Query  237  DDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATD  416
             DL I+DVQVE+L G L ++SL GSAAAGRTSDWIGRR TMVVA+VIFF GA+LMGFAT+
Sbjct  61   KDLNINDVQVEILAGILNLYSLIGSAAAGRTSDWIGRRNTMVVAAVIFFVGAILMGFATN  120

Query  417  YAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAF  596
            YAFLM GRFVAG+GVGYALM+APVYTAEVSPASSRGFLTSFPEVFIN GILLGYVSNFAF
Sbjct  121  YAFLMFGRFVAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYVSNFAF  180

Query  597  SKLPTHL  617
            SKLP +L
Sbjct  181  SKLPANL  187



>ref|XP_011092774.1| PREDICTED: polyol transporter 5-like [Sesamum indicum]
Length=519

 Score =   276 bits (706),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 147/172 (85%), Positives = 160/172 (93%), Gaps = 0/172 (0%)
 Frame = +3

Query  102  IPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVG  281
            IPAFDPP+KP RNKYAMACS LAS+ SILLGYDIGVMSGAIIYI+ DL+ISDVQ E+++G
Sbjct  9    IPAFDPPQKPKRNKYAMACSFLASMTSILLGYDIGVMSGAIIYIQKDLQISDVQKEVIMG  68

Query  282  SLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGV  461
             L V+SL GSAAAGRTSDWIGRRYT+V A VIFFAGALLMGFAT+YAFLMVGRFVAG+GV
Sbjct  69   ILNVYSLLGSAAAGRTSDWIGRRYTIVFAGVIFFAGALLMGFATNYAFLMVGRFVAGIGV  128

Query  462  GYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            GYALM+APVYTAEV+PASSRGFLTSFPEVFIN GILLGYVSNFAFSKLPT L
Sbjct  129  GYALMIAPVYTAEVAPASSRGFLTSFPEVFINFGILLGYVSNFAFSKLPTSL  180



>ref|XP_006365518.1| PREDICTED: polyol transporter 5-like [Solanum tuberosum]
Length=566

 Score =   277 bits (708),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 155/201 (77%), Positives = 167/201 (83%), Gaps = 2/201 (1%)
 Frame = +3

Query  15   PLFLFIFHTH*FSVVMTDGKLENNGVSGHIPAFDPPKKPPRNKYAMacsllaslasillG  194
            P + F      FS+   +   +N      I  FDPPKKP  NKYA+AC+ LASL+SILLG
Sbjct  11   PNYTFSLRLANFSLPTMEEDKQNQ--VARIQDFDPPKKPKTNKYAIACTFLASLSSILLG  68

Query  195  YDIGVMSGAIIYIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASV  374
            YDIGVMSGAIIYIK DL I+DVQVE+LVG L V+SLFGSAAAGRTSDWIGRRYTMVVA+ 
Sbjct  69   YDIGVMSGAIIYIKKDLHITDVQVEILVGILNVYSLFGSAAAGRTSDWIGRRYTMVVAAG  128

Query  375  IFFAGALLMGFATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFI  554
            IFFAGALLMGFAT YAFLM GRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFI
Sbjct  129  IFFAGALLMGFATTYAFLMFGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFI  188

Query  555  NAGILLGYVSNFAFSKLPTHL  617
            N GIL+GYVSN AFSKLPTHL
Sbjct  189  NFGILMGYVSNVAFSKLPTHL  209



>emb|CAP58706.1| putative polyol transporter protein 1 [Hevea brasiliensis]
 emb|CAN88842.1| polyols transporter 1 [Hevea brasiliensis]
Length=525

 Score =   275 bits (704),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 159/169 (94%), Gaps = 0/169 (0%)
 Frame = +3

Query  111  FDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSLA  290
            FDPPKKP RNK+A+AC+ LAS+ SILLGYDIGVMSGA IYIKDDLKISD QVE+LVG+L 
Sbjct  24   FDPPKKPKRNKFALACAALASMTSILLGYDIGVMSGAAIYIKDDLKISDTQVEILVGTLN  83

Query  291  VFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGYA  470
            ++SL GSAAAGRTSDWIGRRYT+VVA  IFF GALLMGFAT+YAFLMVGRF+AG+GVGYA
Sbjct  84   IYSLVGSAAAGRTSDWIGRRYTIVVAGGIFFVGALLMGFATNYAFLMVGRFIAGIGVGYA  143

Query  471  LMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            +++APVYTAEVSPASSRGFLTSFPEVFIN+GIL+GYVSNFAFSKLPTHL
Sbjct  144  VVIAPVYTAEVSPASSRGFLTSFPEVFINSGILIGYVSNFAFSKLPTHL  192



>ref|NP_001281033.1| polyol transporter 5-like [Malus domestica]
 dbj|BAD42345.1| sorbitol transporter [Malus domestica]
Length=535

 Score =   275 bits (704),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 166/190 (87%), Gaps = 4/190 (2%)
 Frame = +3

Query  60   MTDGKLENNGVSGH----IPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAII  227
            M D   ++N VS      I  FDPP+KP RNKYA AC++LAS+ SILLGYDIGVMSGA I
Sbjct  1    MADRTTDDNTVSSQPQKTIADFDPPQKPKRNKYAFACAILASMTSILLGYDIGVMSGAAI  60

Query  228  YIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGF  407
            YIKDDLKISDV+VE+L+G L ++SL GSAAAGRTSDW+GRRYT+V+A  IFF GALLMGF
Sbjct  61   YIKDDLKISDVEVEVLLGILNLYSLIGSAAAGRTSDWVGRRYTIVLAGAIFFVGALLMGF  120

Query  408  ATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSN  587
            AT+Y+FLM GRFVAG+GVGYALM+APVYTAEVSPASSRGFLTSFPEVFIN+GILLGYVSN
Sbjct  121  ATNYSFLMFGRFVAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINSGILLGYVSN  180

Query  588  FAFSKLPTHL  617
            +AFSKLPTHL
Sbjct  181  YAFSKLPTHL  190



>gb|AFI61955.1| polyol transporter [Camellia sinensis]
Length=532

 Score =   275 bits (703),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 169/190 (89%), Gaps = 4/190 (2%)
 Frame = +3

Query  60   MTDGKLENNGVSG----HIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAII  227
            M D K +NNG SG    HIPA DPP+KP RNKYA AC++LAS+ SILLGYD GVMSGA +
Sbjct  1    MADRKPQNNGFSGQTQTHIPALDPPQKPKRNKYAFACAILASMTSILLGYDGGVMSGAAL  60

Query  228  YIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGF  407
            +IKDDLKISDVQ+E+L+G ++++SL G  AAGRTSDW+GRRYT+V+A+ IFF GA+LMGF
Sbjct  61   FIKDDLKISDVQLEVLMGIMSLYSLLGCYAAGRTSDWVGRRYTIVIAAAIFFVGAILMGF  120

Query  408  ATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSN  587
            AT+YAFLMVGRFVAG+GVGYAL++APVYTAEVSPA+SRGFLTSFPEVFINAG+LLGYVSN
Sbjct  121  ATNYAFLMVGRFVAGIGVGYALLIAPVYTAEVSPAASRGFLTSFPEVFINAGVLLGYVSN  180

Query  588  FAFSKLPTHL  617
            +AFSKLP +L
Sbjct  181  YAFSKLPLYL  190



>ref|XP_008387369.1| PREDICTED: putative polyol transporter 1 isoform X2 [Malus domestica]
Length=535

 Score =   275 bits (702),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 147/190 (77%), Positives = 165/190 (87%), Gaps = 4/190 (2%)
 Frame = +3

Query  60   MTDGKLENNGVSGH----IPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAII  227
            M D   ++N VS      I  FDPP+KP RNKYA AC++LAS+ SILLG DIGVMSGA I
Sbjct  1    MADRTTDDNTVSSQPQKTIEDFDPPQKPKRNKYAFACAILASMTSILLGLDIGVMSGAAI  60

Query  228  YIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGF  407
            YIKDDLKISDV+VE+L+G L ++SL GSAAAGRTSDW+GRRYT+V+A  IFF GALLMGF
Sbjct  61   YIKDDLKISDVEVEILLGILNLYSLIGSAAAGRTSDWVGRRYTIVLAGAIFFVGALLMGF  120

Query  408  ATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSN  587
            AT+YAFLM GRFVAGVGVGYALM+APVYTAEVSPASSRGFLTSFPEVFIN+GILLGYVSN
Sbjct  121  ATNYAFLMFGRFVAGVGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINSGILLGYVSN  180

Query  588  FAFSKLPTHL  617
            +AFSKLPTHL
Sbjct  181  YAFSKLPTHL  190



>ref|XP_009344431.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
 ref|XP_009344432.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=535

 Score =   274 bits (701),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 164/190 (86%), Gaps = 4/190 (2%)
 Frame = +3

Query  60   MTDGKLENNGVSGH----IPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAII  227
            M D    +N VS      I  FDPP+KP RNKYA AC++LAS+ SILLGYDIGVMSGA I
Sbjct  1    MADRTTNDNTVSSQPQKTIEDFDPPQKPKRNKYAFACAILASMTSILLGYDIGVMSGAAI  60

Query  228  YIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGF  407
            YIKDDLKISDV+VE+L+G L ++SL GSAAAGRTSDW+GRRYT+V+A  IFF GALLMGF
Sbjct  61   YIKDDLKISDVEVEVLLGILNLYSLIGSAAAGRTSDWVGRRYTIVLAGAIFFVGALLMGF  120

Query  408  ATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSN  587
            AT+YAFLM GRFVAG+GVGYALM+APVYTAEVSPASSRGFLTSFPEVFIN+GILLGYVSN
Sbjct  121  ATNYAFLMFGRFVAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINSGILLGYVSN  180

Query  588  FAFSKLPTHL  617
            +AFSKLP HL
Sbjct  181  YAFSKLPKHL  190



>gb|AGG19155.1| sorbitol transporter [Pyrus pyrifolia]
Length=535

 Score =   274 bits (701),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 164/190 (86%), Gaps = 4/190 (2%)
 Frame = +3

Query  60   MTDGKLENNGVSGH----IPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAII  227
            M D    +N VS      I  FDPP+KP RNKYA AC++LAS+ SILLGYDIGVMSGA I
Sbjct  1    MADRTTNDNTVSSQPQKTIEDFDPPQKPKRNKYAFACAILASMTSILLGYDIGVMSGAAI  60

Query  228  YIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGF  407
            YIKDDLKISDV+VE+L+G L ++SL GSAAAGRTSDW+GRRYT+V+A  IFF GALLMGF
Sbjct  61   YIKDDLKISDVEVEVLLGILNLYSLIGSAAAGRTSDWVGRRYTIVLAGAIFFVGALLMGF  120

Query  408  ATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSN  587
            AT+YAFLM GRFVAG+GVGYALM+APVYTAEVSPASSRGFLTSFPEVFIN+GILLGYVSN
Sbjct  121  ATNYAFLMFGRFVAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINSGILLGYVSN  180

Query  588  FAFSKLPTHL  617
            +AFSKLP HL
Sbjct  181  YAFSKLPKHL  190



>ref|XP_007200585.1| hypothetical protein PRUPE_ppa007633mg [Prunus persica]
 gb|EMJ01784.1| hypothetical protein PRUPE_ppa007633mg [Prunus persica]
Length=361

 Score =   268 bits (686),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 164/191 (86%), Gaps = 5/191 (3%)
 Frame = +3

Query  60   MTDGKLENNGV-SGH----IPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAI  224
            M D + E+N V SG     I  FDPP KP RNKYA AC++LAS+ SILLGYDIGVMSGA 
Sbjct  1    MADERAEDNAVVSGQPQKTIADFDPPGKPKRNKYAFACAILASMTSILLGYDIGVMSGAA  60

Query  225  IYIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMG  404
            IYIK DLK+SDV++E+L+G L ++SL GSAAAGRTSDWIGRRYT+V+A  IFFAGALLMG
Sbjct  61   IYIKKDLKVSDVEIEVLIGILNLYSLIGSAAAGRTSDWIGRRYTIVLAGAIFFAGALLMG  120

Query  405  FATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVS  584
            FA +YAFLM GRF+AG+GVGYALM+APVYTAEVSPASSRGFLTSFPEVFINAGIL GYVS
Sbjct  121  FAPNYAFLMFGRFIAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGILFGYVS  180

Query  585  NFAFSKLPTHL  617
            N+ FSKLPTHL
Sbjct  181  NYGFSKLPTHL  191



>gb|ABK29439.1| sugar transport protein [Coffea canephora]
Length=529

 Score =   273 bits (697),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 147/184 (80%), Positives = 161/184 (88%), Gaps = 4/184 (2%)
 Frame = +3

Query  78   ENNGVSGHIPA----FDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDL  245
            EN+  SG  P     FDPPKKP RNKYA+ACS LAS+ S+LLGYDIGVMSGA IYIK D 
Sbjct  8    ENDVFSGQTPKVIADFDPPKKPKRNKYALACSFLASMTSVLLGYDIGVMSGAAIYIKRDF  67

Query  246  KISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAF  425
            K+SDV+VE+LVG L ++SL GSAAAGRTSDWIGRR T+V AS IFFAGALLMGF+T+YAF
Sbjct  68   KLSDVKVEILVGILNLYSLLGSAAAGRTSDWIGRRLTIVFASAIFFAGALLMGFSTNYAF  127

Query  426  LMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKL  605
            LMVGRFVAGVGVGYALM+APVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSN+ FSKL
Sbjct  128  LMVGRFVAGVGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNYGFSKL  187

Query  606  PTHL  617
            P HL
Sbjct  188  PPHL  191



>ref|XP_009375627.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=535

 Score =   273 bits (698),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 164/190 (86%), Gaps = 4/190 (2%)
 Frame = +3

Query  60   MTDGKLENNGVSGH----IPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAII  227
            M D    +N VS      I  FDPP+KP RNKYA AC++LAS+ SILLGYDIGVMSGA I
Sbjct  1    MADRTTNDNTVSSQPQKTIEDFDPPQKPKRNKYAFACAILASMTSILLGYDIGVMSGAAI  60

Query  228  YIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGF  407
            YIKDDLKI+DV+VE+L+G L ++SL GSAAAGRTSDW+GRRYT+V+A  IFF GALLMGF
Sbjct  61   YIKDDLKITDVEVEVLLGILNLYSLIGSAAAGRTSDWVGRRYTIVLAGAIFFVGALLMGF  120

Query  408  ATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSN  587
            AT+YAFLM GRFVAG+GVGYALM+APVYTAEVSPASSRGFLTSFPEVFIN+GILLGYVSN
Sbjct  121  ATNYAFLMFGRFVAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINSGILLGYVSN  180

Query  588  FAFSKLPTHL  617
            +AFSKLP HL
Sbjct  181  YAFSKLPKHL  190



>ref|XP_009375628.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=537

 Score =   273 bits (698),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 164/191 (86%), Gaps = 5/191 (3%)
 Frame = +3

Query  60   MTDGKLENNGV-----SGHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAI  224
            M   + E+N V        +  FDPPKKP RNKYA  C++LAS+ SILLGYDIGVMSGA 
Sbjct  1    MAGRRAEDNAVFSQQTGSSLSDFDPPKKPKRNKYAFGCAILASMTSILLGYDIGVMSGAA  60

Query  225  IYIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMG  404
            IYI+ DLKISDVQ+E+L+G L V+SLFGSAAAGRTSDWIGRRYT+V+A  IFFAGALLMG
Sbjct  61   IYIQKDLKISDVQIEILLGILNVYSLFGSAAAGRTSDWIGRRYTIVLAGAIFFAGALLMG  120

Query  405  FATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVS  584
            FAT+Y FLMVGRFVAG+GVGYALM+APVYTAEVSPASSRGFLTSFPEVF+N GILLGYVS
Sbjct  121  FATNYVFLMVGRFVAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFVNVGILLGYVS  180

Query  585  NFAFSKLPTHL  617
            N+AFSKLPT+L
Sbjct  181  NYAFSKLPTNL  191



>emb|CDO97075.1| unnamed protein product [Coffea canephora]
Length=529

 Score =   272 bits (696),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 147/184 (80%), Positives = 161/184 (88%), Gaps = 4/184 (2%)
 Frame = +3

Query  78   ENNGVSGHIPA----FDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDL  245
            EN+  SG  P     FDPPKKP RNKYA+ACS LAS+ S+LLGYDIGVMSGA IYIK D 
Sbjct  8    ENDVFSGQTPKVIADFDPPKKPKRNKYALACSFLASMTSVLLGYDIGVMSGAAIYIKRDF  67

Query  246  KISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAF  425
            K+SDV+VE+LVG L ++SL GSAAAGRTSDWIGRR T+V AS IFFAGALLMGF+T+YAF
Sbjct  68   KLSDVKVEILVGILNLYSLLGSAAAGRTSDWIGRRLTIVFASAIFFAGALLMGFSTNYAF  127

Query  426  LMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKL  605
            LMVGRFVAGVGVGYALM+APVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSN+ FSKL
Sbjct  128  LMVGRFVAGVGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNYGFSKL  187

Query  606  PTHL  617
            P HL
Sbjct  188  PPHL  191



>gb|ACB56939.1| mannitol transporter [Artemisia annua]
Length=522

 Score =   271 bits (694),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 162/189 (86%), Gaps = 3/189 (2%)
 Frame = +3

Query  60   MTDGKLENNGVSG---HIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIY  230
            M D K E NGVS     +  FDPPK P RNKYA AC++LAS+ S+LLGYDIGVMSGA IY
Sbjct  1    MADQKPEENGVSSKTKELADFDPPKAPKRNKYAFACAMLASMTSVLLGYDIGVMSGAQIY  60

Query  231  IKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFA  410
            IK DL  SD Q+++LVG L ++SL GSAAAGRTSDWIGRRYT+V+A VIFF GA+LMGFA
Sbjct  61   IKRDLHCSDNQIQILVGILNLYSLVGSAAAGRTSDWIGRRYTIVLAGVIFFTGAILMGFA  120

Query  411  TDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNF  590
            T+YAFLM GRFVAG+GVGYALM+APVYTAEVSPAS+RGFLTSFPEVFINAGILLGYVSNF
Sbjct  121  TNYAFLMFGRFVAGIGVGYALMIAPVYTAEVSPASARGFLTSFPEVFINAGILLGYVSNF  180

Query  591  AFSKLPTHL  617
            AFSKLP HL
Sbjct  181  AFSKLPLHL  189



>ref|NP_001287655.1| polyol transporter 5-like [Solanum lycopersicum]
 dbj|BAO96229.1| polyol/monosaccharide transporter 4 [Solanum lycopersicum]
Length=541

 Score =   271 bits (694),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 149/180 (83%), Positives = 160/180 (89%), Gaps = 1/180 (1%)
 Frame = +3

Query  78   ENNGVSGHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISD  257
            + N V+  I  FDPPKKP  NKYA+AC+ LASL+SILLGYDIGVMSGAI+YIK DL I+D
Sbjct  5    KQNQVA-RIQDFDPPKKPKTNKYAIACTFLASLSSILLGYDIGVMSGAILYIKKDLHITD  63

Query  258  VQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVG  437
            VQVE+LVG L V+SLFGSAAAGRTSDWIGRRYTMVVA+ IFFAGALLMGFAT YAFLM G
Sbjct  64   VQVEILVGILNVYSLFGSAAAGRTSDWIGRRYTMVVAAGIFFAGALLMGFATTYAFLMFG  123

Query  438  RFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            RFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFIN GIL+GYVSN  FSKL THL
Sbjct  124  RFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINFGILMGYVSNVVFSKLSTHL  183



>ref|XP_009345075.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=538

 Score =   271 bits (692),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 165/191 (86%), Gaps = 5/191 (3%)
 Frame = +3

Query  60   MTDGKLENNGVS-----GHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAI  224
            M   + E+N VS     G +  FDPPKKP RNKYA AC++LAS+ SILLGYDIGVMSGA 
Sbjct  1    MAGRRAEDNAVSQQPGSGGLSEFDPPKKPKRNKYAFACAILASMTSILLGYDIGVMSGAA  60

Query  225  IYIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMG  404
            IYIK+DLKISDV++E+L+G + V+SL GSAAAGRTSDWIGRRYT+V+A  IFF GA+LMG
Sbjct  61   IYIKEDLKISDVEIEILLGIINVYSLIGSAAAGRTSDWIGRRYTIVLAGAIFFTGAILMG  120

Query  405  FATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVS  584
            FAT+Y FLMVGRFVAG+G+GYALM+APVYTAEVSPASSRGFLTSFPEVF+N GILLGYVS
Sbjct  121  FATNYVFLMVGRFVAGIGIGYALMIAPVYTAEVSPASSRGFLTSFPEVFVNIGILLGYVS  180

Query  585  NFAFSKLPTHL  617
            N+AFSKLPT L
Sbjct  181  NYAFSKLPTDL  191



>gb|AAM44082.1| putative sorbitol transporter [Prunus cerasus]
Length=538

 Score =   270 bits (691),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 163/191 (85%), Gaps = 5/191 (3%)
 Frame = +3

Query  60   MTDGKLENNGV-----SGHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAI  224
            M D + E N V       +I  FDPP KP RNKYA AC++LAS+ SILLGYDIGVMSGA+
Sbjct  1    MADRRAEYNAVVSGQPQKNIADFDPPGKPKRNKYAFACAILASMTSILLGYDIGVMSGAV  60

Query  225  IYIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMG  404
            IYIK DLK+SDV++E+LVG L ++SL GSAAAGRTSDWIGRRYT+V+A  IFFAGALLMG
Sbjct  61   IYIKKDLKVSDVEIEVLVGILNLYSLIGSAAAGRTSDWIGRRYTIVLAGAIFFAGALLMG  120

Query  405  FATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVS  584
            FA +YAFLM GRFVAG+GVGYALM+APVYTAEVSPASSRGFLTSFPEVFINAGIL GYVS
Sbjct  121  FAPNYAFLMFGRFVAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGILFGYVS  180

Query  585  NFAFSKLPTHL  617
            N+ FSKLPTHL
Sbjct  181  NYGFSKLPTHL  191



>ref|XP_008387370.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=538

 Score =   270 bits (691),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 143/192 (74%), Positives = 166/192 (86%), Gaps = 6/192 (3%)
 Frame = +3

Query  60   MTDGKLENNGV------SGHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGA  221
            M   + E+N V      S  +  FDPPKKP RNKYA  C++LAS+ SILLGYDIGVMSGA
Sbjct  1    MAGRRAEDNAVFSQQTGSRGLSDFDPPKKPKRNKYAFGCAILASMTSILLGYDIGVMSGA  60

Query  222  IIYIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLM  401
             IYI+ DLKISDV++E+L+G + V+SLFGSAAAGRTSDWIGRRYT+V+A  IFFAGALLM
Sbjct  61   AIYIQKDLKISDVEIEILLGIINVYSLFGSAAAGRTSDWIGRRYTIVLAGAIFFAGALLM  120

Query  402  GFATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYV  581
            GF+T+YAFLMVGRFVAG+G+GYALM+APVYTAEVSPASSRGFLTSFPEVF+N GILLGYV
Sbjct  121  GFSTNYAFLMVGRFVAGIGIGYALMIAPVYTAEVSPASSRGFLTSFPEVFVNVGILLGYV  180

Query  582  SNFAFSKLPTHL  617
            SN+AFSKLPT+L
Sbjct  181  SNYAFSKLPTNL  192



>gb|AGY96955.1| polyol transporter 1 [Vitis vinifera]
Length=528

 Score =   269 bits (687),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 165/190 (87%), Gaps = 4/190 (2%)
 Frame = +3

Query  60   MTDGKLENNGVSGH----IPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAII  227
            M  GK +++ V G     +  FD PKK  RNKYA+AC++LAS+ SILLGYDIGVMSGA I
Sbjct  1    MATGKEKSSVVHGEAQKVVTEFDAPKKKGRNKYAIACTILASMTSILLGYDIGVMSGAAI  60

Query  228  YIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGF  407
            YIK DLKISDV+VE+LVG L V+ LFGSAAAGRTSDWIGRRYT+V+ASVIFF GALLMGF
Sbjct  61   YIKKDLKISDVEVEILVGILNVYCLFGSAAAGRTSDWIGRRYTIVLASVIFFLGALLMGF  120

Query  408  ATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSN  587
            AT+Y FLMVGRFVAG+GVGYALM+APVY AEVSPASSRGF+TSFPEVFINAGIL GY+SN
Sbjct  121  ATNYVFLMVGRFVAGIGVGYALMIAPVYAAEVSPASSRGFITSFPEVFINAGILFGYISN  180

Query  588  FAFSKLPTHL  617
            +AFSKLPT+L
Sbjct  181  YAFSKLPTNL  190



>ref|XP_009344433.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=537

 Score =   269 bits (687),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 163/191 (85%), Gaps = 5/191 (3%)
 Frame = +3

Query  60   MTDGKLENNGV-----SGHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAI  224
            M   + E+N V        +  FDPPKK  RNKYA  C++LAS+ SILLGYDIGVMSGA 
Sbjct  1    MAGRRAEDNAVFSQQTGSSLSDFDPPKKLKRNKYAFGCAILASMTSILLGYDIGVMSGAA  60

Query  225  IYIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMG  404
            IYI+ DLKISDVQ+E+L+G L V+SLFGSAAAGRTSDWIGRRYT+V+A  IFFAGALLMG
Sbjct  61   IYIQKDLKISDVQIEILLGILNVYSLFGSAAAGRTSDWIGRRYTIVLAGAIFFAGALLMG  120

Query  405  FATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVS  584
            FAT+Y FLMVGRFVAG+GVGYALM+APVYTAEVSPASSRGFLTSFPEVF+N GILLGYVS
Sbjct  121  FATNYVFLMVGRFVAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFVNVGILLGYVS  180

Query  585  NFAFSKLPTHL  617
            N+AFSKLPT+L
Sbjct  181  NYAFSKLPTNL  191



>ref|XP_003631630.1| PREDICTED: polyol transporter 5 [Vitis vinifera]
 gb|ADP37154.1| putative polyol/monosaccharide transporter [Vitis vinifera]
Length=528

 Score =   268 bits (686),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 165/190 (87%), Gaps = 4/190 (2%)
 Frame = +3

Query  60   MTDGKLENNGVSGH----IPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAII  227
            M  GK +++ V G     +  FD PKK  RNKYA+AC++LAS+ SILLGYDIGVMSGA I
Sbjct  1    MATGKEKSSVVHGEAQKVVTEFDAPKKNGRNKYAIACTILASMTSILLGYDIGVMSGAAI  60

Query  228  YIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGF  407
            YIK DLKISDV+VE+LVG L V+ LFGSAAAGRTSDWIGRRYT+V+ASVIFF GALLMGF
Sbjct  61   YIKKDLKISDVEVEILVGILNVYCLFGSAAAGRTSDWIGRRYTIVLASVIFFLGALLMGF  120

Query  408  ATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSN  587
            AT+Y FLMVGRFVAG+GVGYALM+APVY AEVSPASSRGF+TSFPEVFINAGIL GY+SN
Sbjct  121  ATNYVFLMVGRFVAGIGVGYALMIAPVYAAEVSPASSRGFITSFPEVFINAGILFGYISN  180

Query  588  FAFSKLPTHL  617
            +AFSKLPT+L
Sbjct  181  YAFSKLPTNL  190



>ref|XP_004299107.1| PREDICTED: polyol transporter 5-like [Fragaria vesca subsp. vesca]
Length=535

 Score =   268 bits (685),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 164/191 (86%), Gaps = 5/191 (3%)
 Frame = +3

Query  60   MTDGKLENNGVSGH-----IPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAI  224
            M D + E N VSG      I  FDP  KP RNKYA AC++LAS+ SILLGYDIGVMSGA 
Sbjct  1    MADRRAEENAVSGQPTQKAIADFDPAPKPKRNKYAFACAMLASMTSILLGYDIGVMSGAA  60

Query  225  IYIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMG  404
            I+IKDDLKISDVQVE+L+G L ++SL GSAAAGRTSDWIGRRYT+V+A  IFFAGALLMG
Sbjct  61   IFIKDDLKISDVQVEVLMGILNLYSLIGSAAAGRTSDWIGRRYTIVLAGAIFFAGALLMG  120

Query  405  FATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVS  584
            FAT+Y+FLM GRFVAG+GVGYALM+APVYTAEVSPASSRGFLTSFPEVFINAGILLGY+S
Sbjct  121  FATNYSFLMFGRFVAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYIS  180

Query  585  NFAFSKLPTHL  617
            N+AFS+L  +L
Sbjct  181  NWAFSELALNL  191



>ref|XP_008236795.1| PREDICTED: polyol transporter 5-like [Prunus mume]
Length=538

 Score =   268 bits (685),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 164/191 (86%), Gaps = 5/191 (3%)
 Frame = +3

Query  60   MTDGKLENNGV-SGH----IPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAI  224
            M D + E+N V SG     I  FDPP KP RNKYA AC++LAS+ SILLGYDIGVMSGA 
Sbjct  1    MADRRAEDNAVVSGQPQKTIADFDPPGKPKRNKYAFACAILASMTSILLGYDIGVMSGAA  60

Query  225  IYIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMG  404
            IYIK DLK+SDV++E+L+G L ++SL GSAAAGRTSDWIGRRYT+V+A  IFFAGALLMG
Sbjct  61   IYIKKDLKVSDVEIEVLIGILNLYSLIGSAAAGRTSDWIGRRYTIVLAGGIFFAGALLMG  120

Query  405  FATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVS  584
            FA +YAFLM GRF+AG+GVGYALM+APVYTAEVSPASSRGFLTSFPEVFINAGIL GYVS
Sbjct  121  FAPNYAFLMFGRFIAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGILFGYVS  180

Query  585  NFAFSKLPTHL  617
            N+ FSKLPTHL
Sbjct  181  NYGFSKLPTHL  191



>emb|CAP58707.1| putative polyol transported protein 2 [Hevea brasiliensis]
Length=547

 Score =   266 bits (680),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 155/169 (92%), Gaps = 0/169 (0%)
 Frame = +3

Query  111  FDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSLA  290
            FDP KKP RNK+A AC++LAS+ SILLGYDIGVMSGA IYIK +LKISD QVE+L G+L 
Sbjct  25   FDPQKKPKRNKFAFACAILASMTSILLGYDIGVMSGAAIYIKKNLKISDTQVEILAGTLN  84

Query  291  VFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGYA  470
            ++SL GSAAAGRTSDWIGRRYT+V+A  IFF GALLMGFAT+YAFLMVGRFVAGVGVGYA
Sbjct  85   IYSLVGSAAAGRTSDWIGRRYTIVMAGGIFFVGALLMGFATNYAFLMVGRFVAGVGVGYA  144

Query  471  LMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            LM+APVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLP +L
Sbjct  145  LMIAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPANL  193



>ref|XP_008393068.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=538

 Score =   266 bits (679),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 163/191 (85%), Gaps = 5/191 (3%)
 Frame = +3

Query  60   MTDGKLENNGVSGH-----IPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAI  224
            M   + E+N VS       +  FD PKKP RNKYA AC++LAS+ SILLGYDIGVMSGA 
Sbjct  1    MAGRRAEDNAVSQQPGSRGLSEFDSPKKPKRNKYAFACAILASMTSILLGYDIGVMSGAA  60

Query  225  IYIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMG  404
            IYIK+DLKISDV++E+L+G + V+SL GSAAAGRTSD IGRRYT+V+A  IFF GALLMG
Sbjct  61   IYIKEDLKISDVEIEILLGIINVYSLIGSAAAGRTSDRIGRRYTIVLAGAIFFTGALLMG  120

Query  405  FATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVS  584
            FAT+Y FLMVGRFVAG+G+GYALM+APVYTAEVSPASSRGFLTSFPEVF+N GILLGYVS
Sbjct  121  FATNYVFLMVGRFVAGIGIGYALMIAPVYTAEVSPASSRGFLTSFPEVFVNIGILLGYVS  180

Query  585  NFAFSKLPTHL  617
            N+AFSKLPTHL
Sbjct  181  NYAFSKLPTHL  191



>ref|XP_007042744.1| Polyol/monosaccharide transporter 5 [Theobroma cacao]
 gb|EOX98575.1| Polyol/monosaccharide transporter 5 [Theobroma cacao]
Length=538

 Score =   265 bits (678),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 155/169 (92%), Gaps = 0/169 (0%)
 Frame = +3

Query  111  FDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSLA  290
            F+P KKP RNK+A AC++LASL SILLGYDIGVMSGA+IYIKDDLKI+DVQVE+LVG L 
Sbjct  25   FEPAKKPKRNKFAFACAILASLTSILLGYDIGVMSGAVIYIKDDLKINDVQVEILVGILN  84

Query  291  VFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGYA  470
            ++ L GS AAGRTSDWIGRRYT+V A  IFF GALLMGFAT+YAFLMVGRFVAG+GVGYA
Sbjct  85   LYCLVGSCAAGRTSDWIGRRYTIVFACAIFFVGALLMGFATNYAFLMVGRFVAGIGVGYA  144

Query  471  LMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            LM+APVYTAEVSPASSRGFLTSFPEVFIN GILLGYVSN+AFSKLPT++
Sbjct  145  LMIAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYVSNYAFSKLPTNI  193



>ref|XP_010065409.1| PREDICTED: polyol transporter 5-like [Eucalyptus grandis]
 gb|KCW62859.1| hypothetical protein EUGRSUZ_G00453 [Eucalyptus grandis]
Length=535

 Score =   265 bits (678),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 142/182 (78%), Positives = 158/182 (87%), Gaps = 1/182 (1%)
 Frame = +3

Query  75   LENNGVS-GHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKI  251
            + NNG+    I  FDPP +P RNKYAMAC+ LAS  SILLGYDIGVMSGAIIYIK DLKI
Sbjct  14   VSNNGLRPKSIEDFDPPARPRRNKYAMACATLASTTSILLGYDIGVMSGAIIYIKKDLKI  73

Query  252  SDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLM  431
            SDV+VE+L G LAV+SL GSA AGRTSDWIGRRYT+V+A  IFFAGALLMGFA +YAFLM
Sbjct  74   SDVEVEILTGILAVYSLLGSAMAGRTSDWIGRRYTIVLAGAIFFAGALLMGFAPNYAFLM  133

Query  432  VGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPT  611
             GRFVAG+GVGYALM+APVYTAEVSPAS+RGFLTSFPEVFIN GILLGY+SN+AFSKL  
Sbjct  134  FGRFVAGIGVGYALMIAPVYTAEVSPASTRGFLTSFPEVFINIGILLGYISNYAFSKLRL  193

Query  612  HL  617
            +L
Sbjct  194  NL  195



>gb|EYU42630.1| hypothetical protein MIMGU_mgv1a0059091mg, partial [Erythranthe 
guttata]
Length=189

 Score =   254 bits (648),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 138/186 (74%), Positives = 157/186 (84%), Gaps = 2/186 (1%)
 Frame = +3

Query  66   DGKLENNGVSGH--IPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKD  239
             GK E NG      IP FDPPKKP RN YA+ACS LAS+ SILLGYDIGVMSGAIIYI++
Sbjct  4    SGKPETNGAQTRLPIPGFDPPKKPKRNMYALACSFLASMTSILLGYDIGVMSGAIIYIQE  63

Query  240  DLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDY  419
            +  I+ VQ E+++G L V+SL GSAAAGRTSDWIGRRYT+V+A  IFF GALLMGFAT+Y
Sbjct  64   EFGITSVQKEVVMGILNVYSLLGSAAAGRTSDWIGRRYTIVLAGAIFFVGALLMGFATNY  123

Query  420  AFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFS  599
            AFLMVGRFVAG+GVGYALM+APVYTAEV+PASSRGFL+SFPEVFIN G  LGYVSNFAFS
Sbjct  124  AFLMVGRFVAGIGVGYALMIAPVYTAEVAPASSRGFLSSFPEVFINFGTQLGYVSNFAFS  183

Query  600  KLPTHL  617
            K P ++
Sbjct  184  KPPENI  189



>ref|XP_002313809.1| putative sorbitol transporter family protein [Populus trichocarpa]
 gb|EEE87764.1| putative sorbitol transporter family protein [Populus trichocarpa]
Length=533

 Score =   260 bits (665),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = +3

Query  111  FDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSLA  290
            FDP KKP RNK+A AC++LAS+ S+LLGYDIGVMSGA IYI+DDLKISD+QV LLVG+L 
Sbjct  25   FDPVKKPKRNKFAFACAILASMTSVLLGYDIGVMSGANIYIQDDLKISDLQVALLVGTLN  84

Query  291  VFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGYA  470
            ++SL GSAAAGRTSD IGRRYT+V+A  IFF G++LMGFAT+YAFLMVGRFVAGVGVGYA
Sbjct  85   LYSLVGSAAAGRTSDRIGRRYTIVMAGAIFFLGSILMGFATNYAFLMVGRFVAGVGVGYA  144

Query  471  LMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            LM+APVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSN+AFSKLPT+L
Sbjct  145  LMIAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNYAFSKLPTNL  193



>ref|XP_010065405.1| PREDICTED: polyol transporter 5-like [Eucalyptus grandis]
 gb|KCW62856.1| hypothetical protein EUGRSUZ_G00450 [Eucalyptus grandis]
Length=535

 Score =   260 bits (664),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 139/182 (76%), Positives = 156/182 (86%), Gaps = 1/182 (1%)
 Frame = +3

Query  75   LENNGVS-GHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKI  251
            + +NG+    I  FDPP +P RNKYAMAC+ LAS  SILLGYDIGVMSGAIIYIK+DLKI
Sbjct  14   VSDNGLRPKSIEDFDPPARPRRNKYAMACATLASTTSILLGYDIGVMSGAIIYIKEDLKI  73

Query  252  SDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLM  431
            SDV+VE+L G LAV+SL GS  AGRTSDWIGRRYT+V+A  IFFAGALLMGFA +YAFLM
Sbjct  74   SDVEVEILTGILAVYSLLGSPMAGRTSDWIGRRYTIVLAGAIFFAGALLMGFAPNYAFLM  133

Query  432  VGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPT  611
             GRFVAG+GVGYALM+APVYTAEVSPAS+RGFL SFPEVFIN GILLGY+SN+AFSKL  
Sbjct  134  FGRFVAGIGVGYALMIAPVYTAEVSPASTRGFLNSFPEVFINIGILLGYISNYAFSKLRL  193

Query  612  HL  617
             L
Sbjct  194  SL  195



>gb|ACC61047.1| mannitol transporter [Gossypium hirsutum]
Length=392

 Score =   255 bits (652),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 159/190 (84%), Gaps = 10/190 (5%)
 Frame = +3

Query  78   ENNGVSGHIPA---------FDPP-KKPPRNKYAMacsllaslasillGYDIGVMSGAII  227
            E NGV    P          F+P  KKP RNK+A AC++LASL SILLGYDIGV+SGAII
Sbjct  6    EQNGVVSTRPVMADNRNFADFEPAVKKPKRNKFASACAILASLTSILLGYDIGVISGAII  65

Query  228  YIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGF  407
            YI++DLKI+DVQ E+L+G L V+SL GS AAGRTSDW+GRRYT+V+A  IFF GALLMGF
Sbjct  66   YIQEDLKINDVQKEILMGILNVYSLVGSCAAGRTSDWVGRRYTIVLAGAIFFLGALLMGF  125

Query  408  ATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSN  587
            AT YAFLMVGRFVAG+GVGYALM+APVYTAEVSPASSRGFLTSFPEVFIN GILLGYVSN
Sbjct  126  ATSYAFLMVGRFVAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYVSN  185

Query  588  FAFSKLPTHL  617
            +AFSKLPT L
Sbjct  186  YAFSKLPTDL  195



>ref|XP_011048787.1| PREDICTED: polyol transporter 5-like [Populus euphratica]
Length=532

 Score =   259 bits (661),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 156/169 (92%), Gaps = 0/169 (0%)
 Frame = +3

Query  111  FDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSLA  290
            FDP KKP RNK+A AC+ +AS+ S+LLGYDIGVMSGA IYI+DDLKI+D+QV LLVG+L 
Sbjct  25   FDPAKKPKRNKFAFACASIASMTSVLLGYDIGVMSGANIYIQDDLKINDLQVALLVGTLN  84

Query  291  VFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGYA  470
            ++SL GSAAAGRTSD IGRRYT+V+A  IFF G++LMGFAT+YAFLMVGRFVAGVGVGYA
Sbjct  85   IYSLVGSAAAGRTSDRIGRRYTIVMAGAIFFLGSVLMGFATNYAFLMVGRFVAGVGVGYA  144

Query  471  LMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            LM+APVYTAEVSPASSRGFLTSFPEVFIN+GILLGYVSN+AFSKLPT+L
Sbjct  145  LMIAPVYTAEVSPASSRGFLTSFPEVFINSGILLGYVSNYAFSKLPTNL  193



>gb|AAY86779.1| putative sugar transporter protein [Noccaea caerulescens]
Length=253

 Score =   249 bits (637),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 154/190 (81%), Gaps = 7/190 (4%)
 Frame = +3

Query  60   MTDGKLENNGVSGHIPAFD-------PPKKPPRNKYAMacsllaslasillGYDIGVMSG  218
            MT    EN  V    PA         PP KP RNKYA AC++LAS+ SILLGYDIGVMSG
Sbjct  1    MTGSTPENQAVRSPPPATKHLPESGPPPAKPKRNKYAFACAILASMTSILLGYDIGVMSG  60

Query  219  AIIYIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALL  398
            A+IYIK DLK +D+Q+ +L GSL ++SL GS AAGRTSDWIGRRYT+V+A  IFFAGALL
Sbjct  61   AMIYIKRDLKCTDLQIGILAGSLNIYSLVGSCAAGRTSDWIGRRYTIVLAGAIFFAGALL  120

Query  399  MGFATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGY  578
            MGF+ +YAFLM GRFVAGVGVGYALM+APVYTAEV+PASSRGFLTSFPEVFINAGI+LGY
Sbjct  121  MGFSPNYAFLMFGRFVAGVGVGYALMIAPVYTAEVAPASSRGFLTSFPEVFINAGIMLGY  180

Query  579  VSNFAFSKLP  608
            VSN AFSK P
Sbjct  181  VSNLAFSKFP  190



>gb|KHG20989.1| Polyol transporter 5 -like protein [Gossypium arboreum]
Length=539

 Score =   258 bits (660),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 143/190 (75%), Positives = 159/190 (84%), Gaps = 10/190 (5%)
 Frame = +3

Query  78   ENNGVSGHIPA---------FDPP-KKPPRNKYAMacsllaslasillGYDIGVMSGAII  227
            E NGV    P          F+P  KKP RNK+A AC++LASL SILLGYDIGVMSGAII
Sbjct  6    EQNGVVSTRPVMADNRNFADFEPAVKKPKRNKFAFACAILASLTSILLGYDIGVMSGAII  65

Query  228  YIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGF  407
            YI++DLKI+DVQ E+L+G L V+SL GS AAGRTSDW+GRRYT+V+A  IFF GALLMGF
Sbjct  66   YIQEDLKINDVQKEILMGILNVYSLVGSCAAGRTSDWVGRRYTIVLAGAIFFLGALLMGF  125

Query  408  ATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSN  587
            AT YAFLMVGRFVAG+GVGYALM+APVYTAEVSPASSRGFLTSFPEVFIN GILLGYVSN
Sbjct  126  ATSYAFLMVGRFVAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYVSN  185

Query  588  FAFSKLPTHL  617
            +AFSKLPT L
Sbjct  186  YAFSKLPTDL  195



>gb|KJB32189.1| hypothetical protein B456_005G228500 [Gossypium raimondii]
Length=539

 Score =   258 bits (659),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 143/190 (75%), Positives = 159/190 (84%), Gaps = 10/190 (5%)
 Frame = +3

Query  78   ENNGVSGHIPA---------FDPP-KKPPRNKYAMacsllaslasillGYDIGVMSGAII  227
            E NGV    P          F+P  KKP RNK+A AC++LASL SILLGYDIGVMSGAII
Sbjct  6    EQNGVVSTRPVMADNRSFADFEPAVKKPKRNKFAFACAILASLTSILLGYDIGVMSGAII  65

Query  228  YIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGF  407
            YI++DLKI+DVQ E+L+G L V+SL GS AAGRTSDW+GRRYT+V+A  IFF GALLMGF
Sbjct  66   YIQEDLKINDVQKEILMGILNVYSLVGSCAAGRTSDWVGRRYTIVLAGAIFFLGALLMGF  125

Query  408  ATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSN  587
            AT YAFLMVGRFVAG+GVGYALM+APVYTAEVSPASSRGFLTSFPEVFIN GILLGYVSN
Sbjct  126  ATSYAFLMVGRFVAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYVSN  185

Query  588  FAFSKLPTHL  617
            +AFSKLPT L
Sbjct  186  YAFSKLPTDL  195



>gb|KJB12315.1| hypothetical protein B456_002G011400 [Gossypium raimondii]
Length=536

 Score =   258 bits (659),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 164/193 (85%), Gaps = 7/193 (4%)
 Frame = +3

Query  60   MTDGKLENNGVSGHIPA-------FDPPKKPPRNKYAMacsllaslasillGYDIGVMSG  218
            M+  + +NNGVS  + A       F+  KKP RNK+A ACS+LASLASILLGYDIGVMSG
Sbjct  1    MSGFEADNNGVSISVAAGNKTVADFEVSKKPKRNKFAFACSILASLASILLGYDIGVMSG  60

Query  219  AIIYIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALL  398
            AIIYIKDDLKISDVQVE+LVG L ++ L G+ AAGRTSDWIGRRYT+VVA+ IFF GALL
Sbjct  61   AIIYIKDDLKISDVQVEILVGILNLYCLIGAYAAGRTSDWIGRRYTIVVAAAIFFVGALL  120

Query  399  MGFATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGY  578
            MGFAT+YAFLMVGRFVAG+GVG+AL++APVYTAEVSPASSRGFL SFPEVFIN G+LLGY
Sbjct  121  MGFATNYAFLMVGRFVAGIGVGFALLIAPVYTAEVSPASSRGFLNSFPEVFINIGLLLGY  180

Query  579  VSNFAFSKLPTHL  617
            VSN+AFSKL   L
Sbjct  181  VSNYAFSKLRADL  193



>ref|XP_004148857.1| PREDICTED: polyol transporter 5-like [Cucumis sativus]
 gb|KGN61777.1| hypothetical protein Csa_2G245410 [Cucumis sativus]
Length=533

 Score =   258 bits (658),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 132/168 (79%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +3

Query  102  IPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVG  281
            +P FDPPKK  RNK+++AC+ LAS+ S+LLGYDIGVMSGA ++IK+D ++SD ++E+LVG
Sbjct  20   LPDFDPPKKNKRNKFSLACATLASMTSVLLGYDIGVMSGAAMFIKEDFRLSDTKIEILVG  79

Query  282  SLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGV  461
             L ++SL GSAAAGRTSDWIGRRYTMVVA+VIFFAGALLMGFAT Y+FLM GRFVAGVGV
Sbjct  80   ILNLYSLIGSAAAGRTSDWIGRRYTMVVAAVIFFAGALLMGFATSYSFLMFGRFVAGVGV  139

Query  462  GYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKL  605
            GYALM+APVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSN+ FSK+
Sbjct  140  GYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNYGFSKV  187



>ref|XP_006423215.1| hypothetical protein CICLE_v10028170mg [Citrus clementina]
 gb|ESR36455.1| hypothetical protein CICLE_v10028170mg [Citrus clementina]
Length=535

 Score =   258 bits (658),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 149/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  111  FDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSLA  290
            FDP KKP RN YA   ++LAS+ SILLGYDIGVMSGA +YIKDD K+SD Q+E+L+G L 
Sbjct  24   FDPQKKPKRNLYASGAAILASMTSILLGYDIGVMSGAALYIKDDFKVSDTQIEILIGILN  83

Query  291  VFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGYA  470
            ++SL GS AAGRTSDWIGRRYT+V+A  IFFAGALLMGFAT+YAFLM GRFVAGVGVGYA
Sbjct  84   IYSLIGSLAAGRTSDWIGRRYTIVLAGAIFFAGALLMGFATNYAFLMGGRFVAGVGVGYA  143

Query  471  LMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            LM+APVYTAE+SPAS+RGFLTSFPEVFIN GILLGYVSN+ FSKLP HL
Sbjct  144  LMIAPVYTAELSPASTRGFLTSFPEVFINGGILLGYVSNYGFSKLPLHL  192



>ref|XP_006487182.1| PREDICTED: polyol transporter 5-like [Citrus sinensis]
Length=535

 Score =   257 bits (657),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 149/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  111  FDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSLA  290
            FDP KKP RN YA   ++LAS+ SILLGYDIGVMSGA +YIKDD K+SD Q+E+L+G L 
Sbjct  24   FDPQKKPKRNLYASGAAILASMTSILLGYDIGVMSGAALYIKDDFKVSDTQIEILIGILN  83

Query  291  VFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGYA  470
            ++SL GS AAGRTSDWIGRRYT+V+A  IFFAGALLMGFAT+YAFLM GRFVAGVGVGYA
Sbjct  84   IYSLIGSLAAGRTSDWIGRRYTIVLAGAIFFAGALLMGFATNYAFLMGGRFVAGVGVGYA  143

Query  471  LMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            LM+APVYTAE+SPAS+RGFLTSFPEVFIN GILLGYVSN+ FSKLP HL
Sbjct  144  LMIAPVYTAELSPASTRGFLTSFPEVFINGGILLGYVSNYGFSKLPLHL  192



>ref|NP_001289249.1| polyol transporter 5-like [Pyrus x bretschneideri]
 ref|XP_009375824.1| PREDICTED: polyol transporter 5-like [Pyrus x bretschneideri]
 gb|AFM91103.1| sorbitol transporter [Pyrus x bretschneideri]
Length=526

 Score =   257 bits (656),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 137/191 (72%), Positives = 160/191 (84%), Gaps = 5/191 (3%)
 Frame = +3

Query  60   MTDGKLENNGVSGH-----IPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAI  224
            MTD + E+  ++G      I  FDPPKK    K+A+AC +LAS+ SILLGYDIGVMSGA 
Sbjct  3    MTDRRAEDKAITGQAQNTSIADFDPPKKAKTKKFAIACGVLASMTSILLGYDIGVMSGAS  62

Query  225  IYIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMG  404
            ++IK++LKISDVQVE+L G+L ++SL GSA AGRTSDWIGRRYT+V+A  IFF GALLMG
Sbjct  63   LFIKENLKISDVQVEILNGTLNLYSLIGSALAGRTSDWIGRRYTIVLAGTIFFIGALLMG  122

Query  405  FATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVS  584
            FA +YAFLM GRFVAGVGVGYALM+APVYTAE+SPAS RGFLTSFPEVF+N GILLGYVS
Sbjct  123  FAPNYAFLMFGRFVAGVGVGYALMIAPVYTAEISPASYRGFLTSFPEVFVNIGILLGYVS  182

Query  585  NFAFSKLPTHL  617
            N+AFSKLP HL
Sbjct  183  NYAFSKLPIHL  193



>ref|XP_010690917.1| PREDICTED: polyol transporter 5 isoform X2 [Beta vulgaris subsp. 
vulgaris]
 gb|AAB68029.1| putative sugar transporter; member of major facilitative superfamily; 
integral membrane protein [Beta vulgaris]
Length=545

 Score =   257 bits (657),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 136/173 (79%), Positives = 152/173 (88%), Gaps = 1/173 (1%)
 Frame = +3

Query  102  IPAFDPPKKPP-RNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLV  278
            I  FDP KKPP RNK+A AC+ LAS+ S+LLGYDIGVMSGAIIY+K+D  ISD Q+ +LV
Sbjct  21   IADFDPLKKPPKRNKFAFACATLASMTSVLLGYDIGVMSGAIIYLKEDWHISDTQIGVLV  80

Query  279  GSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVG  458
            G L ++ LFGS AAGRTSDWIGRRYT+V+A  IFF GALLMGFAT+YAFLMVGRFV G+G
Sbjct  81   GILNIYCLFGSFAAGRTSDWIGRRYTIVLAGAIFFVGALLMGFATNYAFLMVGRFVTGIG  140

Query  459  VGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            VGYALM+APVYTAEVSPASSRGFLTSFPEVFINAGILLGY+SN AFS LPTHL
Sbjct  141  VGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYISNLAFSSLPTHL  193



>ref|XP_009344435.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=526

 Score =   257 bits (656),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 133/191 (70%), Positives = 161/191 (84%), Gaps = 5/191 (3%)
 Frame = +3

Query  60   MTDGKLENNGVSG-----HIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAI  224
            M D ++ +N V+G      I  FDPPKKP  +K+A+AC+LLA   S+LLGYDIGVMSGA 
Sbjct  1    MADQRVNDNAVTGGPQNTSIEDFDPPKKPKTSKFAIACALLACTTSVLLGYDIGVMSGAS  60

Query  225  IYIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMG  404
            ++IK++LKISDVQVE+L G+L ++SL GSA AGRTSDWIGR+YT+V+A VIF  GALLMG
Sbjct  61   LFIKENLKISDVQVEILAGTLNIYSLLGSAFAGRTSDWIGRKYTIVLAGVIFLVGALLMG  120

Query  405  FATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVS  584
            FAT+YAFLM GRFVAGVGVGY +M+APVYTAE+SPAS RGFLTSFPEVF+N GILLGY++
Sbjct  121  FATNYAFLMFGRFVAGVGVGYGMMIAPVYTAEISPASFRGFLTSFPEVFVNVGILLGYIA  180

Query  585  NFAFSKLPTHL  617
            N+AFSKLP HL
Sbjct  181  NYAFSKLPLHL  191



>ref|XP_010690916.1| PREDICTED: polyol transporter 5 isoform X1 [Beta vulgaris subsp. 
vulgaris]
 gb|AAB68028.1| putative sugar transporter; member of major facilitative superfamily; 
integral membrane protein [Beta vulgaris]
Length=549

 Score =   257 bits (657),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 136/173 (79%), Positives = 152/173 (88%), Gaps = 1/173 (1%)
 Frame = +3

Query  102  IPAFDPPKKPP-RNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLV  278
            I  FDP KKPP RNK+A AC+ LAS+ S+LLGYDIGVMSGAIIY+K+D  ISD Q+ +LV
Sbjct  21   IADFDPLKKPPKRNKFAFACATLASMTSVLLGYDIGVMSGAIIYLKEDWHISDTQIGVLV  80

Query  279  GSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVG  458
            G L ++ LFGS AAGRTSDWIGRRYT+V+A  IFF GALLMGFAT+YAFLMVGRFV G+G
Sbjct  81   GILNIYCLFGSFAAGRTSDWIGRRYTIVLAGAIFFVGALLMGFATNYAFLMVGRFVTGIG  140

Query  459  VGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            VGYALM+APVYTAEVSPASSRGFLTSFPEVFINAGILLGY+SN AFS LPTHL
Sbjct  141  VGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYISNLAFSSLPTHL  193



>ref|XP_004300990.1| PREDICTED: polyol transporter 5-like [Fragaria vesca subsp. vesca]
Length=530

 Score =   257 bits (656),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 160/191 (84%), Gaps = 5/191 (3%)
 Frame = +3

Query  60   MTDGKLENNG-----VSGHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAI  224
            M D + E NG         I  FDP  KP RN+YA AC++LAS+ SILLGYDIGVMSGA 
Sbjct  1    MADRRAEENGQPTQSTKKAIEDFDPAPKPKRNRYAFACAMLASMTSILLGYDIGVMSGAA  60

Query  225  IYIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMG  404
            I+IKDDLKISDVQVE+LVG L ++SL GSAAAGRTSDWIGRRYT+V+A  IFFAGALLMG
Sbjct  61   IFIKDDLKISDVQVEVLVGILNLYSLIGSAAAGRTSDWIGRRYTIVLAGAIFFAGALLMG  120

Query  405  FATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVS  584
            FAT+Y+FLM GRFVAG+GVGYALM+APVYT EVSPASSRGFLTSF ++FINAGILLGY+S
Sbjct  121  FATNYSFLMFGRFVAGIGVGYALMIAPVYTVEVSPASSRGFLTSFADMFINAGILLGYIS  180

Query  585  NFAFSKLPTHL  617
            N+AFSKL  +L
Sbjct  181  NWAFSKLALNL  191



>ref|XP_012069670.1| PREDICTED: polyol transporter 5-like [Jatropha curcas]
 gb|KDP46229.1| hypothetical protein JCGZ_10069 [Jatropha curcas]
Length=514

 Score =   256 bits (654),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 126/142 (89%), Positives = 134/142 (94%), Gaps = 0/142 (0%)
 Frame = +3

Query  192  GYDIGVMSGAIIYIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVAS  371
            GYDIGVMSGA IYIKDDLKISD+QVE+LVG+L ++SL GSAAAGRTSDWIGRRYT+VVA 
Sbjct  27   GYDIGVMSGAAIYIKDDLKISDLQVEVLVGTLNIYSLVGSAAAGRTSDWIGRRYTIVVAG  86

Query  372  VIFFAGALLMGFATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVF  551
             IFF GALLMGFAT YAFLMVGRFVAG+GVGYALM+APVYTAEVSPASSRGFLTSFPEVF
Sbjct  87   AIFFVGALLMGFATTYAFLMVGRFVAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVF  146

Query  552  INAGILLGYVSNFAFSKLPTHL  617
            IN GILLGYVSNFAFSKLPTHL
Sbjct  147  INGGILLGYVSNFAFSKLPTHL  168



>ref|XP_006406559.1| hypothetical protein EUTSA_v10020495mg [Eutrema salsugineum]
 gb|ESQ48012.1| hypothetical protein EUTSA_v10020495mg [Eutrema salsugineum]
Length=529

 Score =   256 bits (655),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 139/192 (72%), Positives = 157/192 (82%), Gaps = 6/192 (3%)
 Frame = +3

Query  60   MTDGKLENNGV------SGHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGA  221
            MT    EN  V      + H+P   PP KP RNKYA AC++LAS+ SILLGYDIGVMSGA
Sbjct  1    MTGFTPENQAVMSPAQGTKHVPELGPPAKPKRNKYAFACAILASMTSILLGYDIGVMSGA  60

Query  222  IIYIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLM  401
            +IYIK DLKISD+Q+ +L G L ++SL GS AAG+TSDWIGRRYT+V+A  IFFAGALLM
Sbjct  61   MIYIKRDLKISDLQIGILAGILNIYSLIGSCAAGKTSDWIGRRYTIVLAGAIFFAGALLM  120

Query  402  GFATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYV  581
            GFA +YAFLM GRFVAG+GVGYALM+APVYTAEVSPASSRGFLTSFPEVFINAGI+LGYV
Sbjct  121  GFAPNYAFLMFGRFVAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGIMLGYV  180

Query  582  SNFAFSKLPTHL  617
            SN AFSK P  L
Sbjct  181  SNLAFSKFPLKL  192



>gb|EPS69995.1| sugar transport protein [Genlisea aurea]
Length=530

 Score =   256 bits (654),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 154/169 (91%), Gaps = 0/169 (0%)
 Frame = +3

Query  111  FDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSLA  290
            FDPPKKP RNKYA+AC+ LAS+ SILLGYDIGVMSGAIIYI+ D++++DVQ E+++G L 
Sbjct  19   FDPPKKPKRNKYALACAFLASMTSILLGYDIGVMSGAIIYIRRDIRMTDVQQEVIMGILN  78

Query  291  VFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGYA  470
            ++SL GSA AGRTSDW+GRRYT+++A  IFF GALLMGFAT+YAFLMVGRFVAG+GVGYA
Sbjct  79   LYSLIGSALAGRTSDWLGRRYTIILAGAIFFFGALLMGFATNYAFLMVGRFVAGIGVGYA  138

Query  471  LMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            LM+APVYTAEV+PASSRGFLTSFPEVFIN GILLGYVSN+ FSK+P HL
Sbjct  139  LMIAPVYTAEVAPASSRGFLTSFPEVFINFGILLGYVSNYGFSKIPQHL  187



>ref|NP_001280902.1| putative polyol transporter 1 [Malus domestica]
 dbj|BAD42343.1| sorbitol transporter [Malus domestica]
Length=526

 Score =   256 bits (653),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 134/191 (70%), Positives = 159/191 (83%), Gaps = 5/191 (3%)
 Frame = +3

Query  60   MTDGKLENNGVSG-----HIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAI  224
            M D + E N V+G      I  FDPP KP  +K+A+AC+LLA   S+LLGYDIGVMSGA 
Sbjct  1    MADRRAEENAVTGGPQNTSIEDFDPPMKPKTSKFAIACALLACTTSVLLGYDIGVMSGAS  60

Query  225  IYIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMG  404
            +YI+ +LKISDVQVE+L G+L ++SL GSA AGRTSDWIGR+YT+V+A VIF  GALLMG
Sbjct  61   LYIQKNLKISDVQVEVLAGTLNIYSLLGSAFAGRTSDWIGRKYTIVLAGVIFLVGALLMG  120

Query  405  FATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVS  584
            FAT+YAFLMVGRFVAGVGVGY +M+APVYTAE+SPAS RGFLTSFPEVF+N GILLGY++
Sbjct  121  FATNYAFLMVGRFVAGVGVGYGMMIAPVYTAEISPASFRGFLTSFPEVFVNVGILLGYIA  180

Query  585  NFAFSKLPTHL  617
            N+AFSKLP HL
Sbjct  181  NYAFSKLPLHL  191



>ref|XP_004507415.1| PREDICTED: polyol transporter 5-like [Cicer arietinum]
Length=526

 Score =   255 bits (651),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 133/186 (72%), Positives = 157/186 (84%), Gaps = 0/186 (0%)
 Frame = +3

Query  60   MTDGKLENNGVSGHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKD  239
            M++GK+        +  FDP KKP RN YA AC++LAS+ SILLGYDIGVMSGA IYI+ 
Sbjct  1    MSEGKVVEAKAPQTLHDFDPQKKPKRNMYAFACAMLASMTSILLGYDIGVMSGAAIYIQR  60

Query  240  DLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDY  419
            DLK+SDVQ+E+L+G + ++SL GS  AGRTSDWIGRRYT+V A VIFFAGALLMGF+ +Y
Sbjct  61   DLKVSDVQIEILLGIINIYSLIGSCLAGRTSDWIGRRYTIVFAGVIFFAGALLMGFSPNY  120

Query  420  AFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFS  599
            +FLM GRFVAGVG+GYALM+APVYTAEVSPASSRGFLTSFPEVFIN GIL+GY+SN+AFS
Sbjct  121  SFLMFGRFVAGVGIGYALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILVGYISNYAFS  180

Query  600  KLPTHL  617
            KL  HL
Sbjct  181  KLSLHL  186



>emb|CDY61985.1| BnaC03g73840D [Brassica napus]
Length=530

 Score =   255 bits (651),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 134/173 (77%), Positives = 150/173 (87%), Gaps = 0/173 (0%)
 Frame = +3

Query  99   HIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLV  278
            H+P   P  KP RNKYA AC++LAS+ SILLGYDIGVMSGA+IYIK DLKISD+Q+ +L 
Sbjct  26   HVPELGPQAKPKRNKYAFACAILASMTSILLGYDIGVMSGAMIYIKRDLKISDLQIGILA  85

Query  279  GSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVG  458
            G L ++SL GS AAGRTSDWIGRRYT+V+A  IFFAGALLMGFA +YAFLM GRFVAG+G
Sbjct  86   GILNIYSLLGSCAAGRTSDWIGRRYTIVLAGAIFFAGALLMGFAPNYAFLMFGRFVAGIG  145

Query  459  VGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            VGYALM+APVYTAEVSPASSRGFLTSFPEVFINAGI+LGYVSN AFSK P  L
Sbjct  146  VGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGIMLGYVSNLAFSKFPLKL  198



>ref|XP_008345143.1| PREDICTED: polyol transporter 5-like [Malus domestica]
Length=527

 Score =   254 bits (649),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 159/190 (84%), Gaps = 4/190 (2%)
 Frame = +3

Query  60   MTDGKLENNGVSGH----IPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAII  227
            M D   +NN VSG     I  FDPP KP   K+A+AC++LAS+ SILLGYDIGVMSGA +
Sbjct  1    MADQAADNNVVSGQPQNSIADFDPPTKPKTKKFAVACAVLASMTSILLGYDIGVMSGASL  60

Query  228  YIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGF  407
            +IK++L ISDVQVE+L G+L ++SL GSA AG+TSDWIGRRYT+V+A  IFF GALLMGF
Sbjct  61   FIKENLNISDVQVEVLNGTLNIYSLIGSALAGKTSDWIGRRYTIVLAGTIFFIGALLMGF  120

Query  408  ATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSN  587
            A +YAFLM GRF+AGVGVGYALM+APVYTAE+SPAS RGFLTSFPEVF+N GILLGYVSN
Sbjct  121  APNYAFLMFGRFIAGVGVGYALMIAPVYTAEISPASFRGFLTSFPEVFVNVGILLGYVSN  180

Query  588  FAFSKLPTHL  617
            FAF+KLP HL
Sbjct  181  FAFAKLPIHL  190



>ref|XP_009135601.1| PREDICTED: polyol transporter 5 [Brassica rapa]
Length=532

 Score =   254 bits (648),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 134/175 (77%), Positives = 151/175 (86%), Gaps = 0/175 (0%)
 Frame = +3

Query  93   SGHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVEL  272
            + H+P   P  KP RNKYA AC++LAS+ SILLGYDIGVMSGA+IYIK DLKISD+Q+ +
Sbjct  24   TKHVPELGPQAKPKRNKYAFACAILASMTSILLGYDIGVMSGAMIYIKRDLKISDLQIGI  83

Query  273  LVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAG  452
            L G L ++SL GS AAGRTSDWIGRRYT+V+A  IFFAGALLMGFA +YAFLM GRFVAG
Sbjct  84   LAGILNIYSLLGSCAAGRTSDWIGRRYTIVLAGAIFFAGALLMGFAPNYAFLMFGRFVAG  143

Query  453  VGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            +GVGYALM+APVYTAEVSPASSRGFLTSFPEVFINAGI+LGYVSN AFSK P  L
Sbjct  144  IGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGIMLGYVSNLAFSKFPLKL  198



>gb|ACB86853.1| mannitol transporter [Citrus sinensis]
Length=535

 Score =   254 bits (648),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 149/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  111  FDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSLA  290
            FDP KKP RN YA   ++LAS+ SILLGYDIGVMSGA +YIKDDLK+SD ++E+L+G L 
Sbjct  24   FDPQKKPKRNLYASGAAILASMTSILLGYDIGVMSGAALYIKDDLKVSDTKIEILMGILN  83

Query  291  VFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGYA  470
            ++SL GS AAGRTSDWIGRRYT+V+A  IFFAGALLMGFAT+YAFLM GRF AG+GVGYA
Sbjct  84   IYSLIGSLAAGRTSDWIGRRYTIVLAGAIFFAGALLMGFATNYAFLMGGRFGAGIGVGYA  143

Query  471  LMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            LM+APVYTAE+SPAS+RGFLTSFPEVFIN GILLGYVSN+ FSKLP HL
Sbjct  144  LMIAPVYTAELSPASTRGFLTSFPEVFINGGILLGYVSNYGFSKLPLHL  192



>ref|XP_006487181.1| PREDICTED: polyol transporter 5-like [Citrus sinensis]
Length=539

 Score =   254 bits (648),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  111  FDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSLA  290
            FDP KKP RN YA   ++LAS+ SILLGYDIGVMSGA +YIKDD K+SD ++E+L+G L 
Sbjct  24   FDPQKKPKRNLYASGAAILASMTSILLGYDIGVMSGAALYIKDDFKVSDTKIEILIGILN  83

Query  291  VFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGYA  470
            +FSL GS AAGRTSDWIGRRYT+V+A  IFFAGALLMGFAT+YAFLM GRFVAGVGVGYA
Sbjct  84   IFSLIGSLAAGRTSDWIGRRYTIVLAGAIFFAGALLMGFATNYAFLMGGRFVAGVGVGYA  143

Query  471  LMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
             ++APVYTAE+SPAS+RGFLTSFPEVFIN GILLGYVSN+ FSKLP HL
Sbjct  144  ALIAPVYTAELSPASTRGFLTSFPEVFINGGILLGYVSNYGFSKLPLHL  192



>ref|XP_011088358.1| PREDICTED: polyol transporter 5-like [Sesamum indicum]
Length=532

 Score =   253 bits (647),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 161/191 (84%), Gaps = 8/191 (4%)
 Frame = +3

Query  60   MTDGKLENNGVSGH-----IPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAI  224
            M DG    NGVS       IPAFDPP+KP RNKYA+ACS LAS+ SILLGYDIGVMSGAI
Sbjct  1    MADGMSARNGVSSAPSHLPIPAFDPPRKPKRNKYALACSFLASMTSILLGYDIGVMSGAI  60

Query  225  IYIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMG  404
            IYI+ ++ ++DVQ E+++G L ++SL GSAAAGRTSD    RYT++ A  IFFAGALLMG
Sbjct  61   IYIRKNIHMTDVQKEVIMGILNLYSLLGSAAAGRTSDC---RYTIIFAGAIFFAGALLMG  117

Query  405  FATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVS  584
            FAT YAFLMVGRFVAG+GVGYALM+APVYTAEV+PAS+RGFLTSFPEVFIN GILLGYVS
Sbjct  118  FATSYAFLMVGRFVAGIGVGYALMIAPVYTAEVAPASTRGFLTSFPEVFINFGILLGYVS  177

Query  585  NFAFSKLPTHL  617
            N+AFSKLPT+L
Sbjct  178  NYAFSKLPTNL  188



>ref|XP_006423216.1| hypothetical protein CICLE_v10028174mg [Citrus clementina]
 gb|ESR36456.1| hypothetical protein CICLE_v10028174mg [Citrus clementina]
Length=535

 Score =   253 bits (647),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  111  FDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSLA  290
            FDP KKP RN YA   ++LAS+ SILLGYDIGVMSGA +YIKDD K+SD ++E+L+G L 
Sbjct  24   FDPQKKPKRNLYASGAAILASMTSILLGYDIGVMSGAALYIKDDFKVSDTKIEILIGILN  83

Query  291  VFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGYA  470
            +FSL GS AAGRTSDWIGRRYT+V+A  IFFAGALLMGFAT+YAFLM GRFVAGVGVGYA
Sbjct  84   IFSLIGSLAAGRTSDWIGRRYTIVLAGAIFFAGALLMGFATNYAFLMGGRFVAGVGVGYA  143

Query  471  LMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
             ++APVYTAE+SPAS+RGFLTSFPEVFIN GILLGYVSN+ FSKLP HL
Sbjct  144  ALIAPVYTAELSPASTRGFLTSFPEVFINGGILLGYVSNYGFSKLPLHL  192



>ref|XP_011037561.1| PREDICTED: polyol transporter 5 [Populus euphratica]
 ref|XP_011037562.1| PREDICTED: polyol transporter 5 [Populus euphratica]
 ref|XP_011037564.1| PREDICTED: polyol transporter 5 [Populus euphratica]
 ref|XP_011037565.1| PREDICTED: polyol transporter 5 [Populus euphratica]
 ref|XP_011037566.1| PREDICTED: polyol transporter 5 [Populus euphratica]
 ref|XP_011037567.1| PREDICTED: polyol transporter 5 [Populus euphratica]
Length=531

 Score =   253 bits (646),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 153/169 (91%), Gaps = 0/169 (0%)
 Frame = +3

Query  111  FDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSLA  290
            FDP KKP RNKYA AC++LAS+ASILLGYDIGVMSGA  YI+ DLK+SDVQV LLVG+L 
Sbjct  25   FDPVKKPKRNKYAFACAILASVASILLGYDIGVMSGAKDYIQTDLKLSDVQVGLLVGTLN  84

Query  291  VFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGYA  470
             +SL GSAAAG TSDWIGRRYT+VVA  +FF GALLMGF+T+YAFLMV RFVAG+GVG+A
Sbjct  85   WYSLVGSAAAGVTSDWIGRRYTIVVAGAVFFTGALLMGFSTNYAFLMVARFVAGIGVGFA  144

Query  471  LMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            LM+APVYT EVSPASSRGFLTSFPEVFINAGILLGYVSN+AFSKLPT+L
Sbjct  145  LMIAPVYTTEVSPASSRGFLTSFPEVFINAGILLGYVSNYAFSKLPTNL  193



>ref|XP_009602627.1| PREDICTED: polyol transporter 5-like [Nicotiana tomentosiformis]
Length=531

 Score =   253 bits (646),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 150/167 (90%), Gaps = 0/167 (0%)
 Frame = +3

Query  117  PPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSLAVF  296
            P K P RNKYA ACSLLAS+ S+LLGYD GVMSGA+IYIK+DLKISDVQ+E+LVG++ ++
Sbjct  25   PCKNPKRNKYAFACSLLASMTSVLLGYDTGVMSGAVIYIKEDLKISDVQIEILVGTINIY  84

Query  297  SLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGYALM  476
            SL G+A AGRTSDWIGRRYT++ AS IFFAGA+LMGFAT+Y FLM GRFVAG+GVGYALM
Sbjct  85   SLVGAALAGRTSDWIGRRYTIIFASAIFFAGAILMGFATNYGFLMFGRFVAGIGVGYALM  144

Query  477  VAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            +APVYTAEV+PAS RGF TSFPEVFIN G+LLGYVSN+AFSKLPT L
Sbjct  145  IAPVYTAEVAPASCRGFFTSFPEVFINGGVLLGYVSNYAFSKLPTKL  191



>gb|KFK30307.1| hypothetical protein AALP_AA7G244900 [Arabis alpina]
Length=526

 Score =   253 bits (645),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 137/192 (71%), Positives = 156/192 (81%), Gaps = 6/192 (3%)
 Frame = +3

Query  60   MTDGKLENNGV------SGHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGA  221
            MT    EN  V      + H+P   PP KP RNKYA AC++LAS+ SILLGYDIGVMSGA
Sbjct  1    MTGFTPENQAVPPPAPATKHVPELGPPVKPKRNKYAFACAILASMTSILLGYDIGVMSGA  60

Query  222  IIYIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLM  401
            +IYI+ DLKI+D+QV +L G L ++SL GS AAG+TSDWIGRRYT+V+A  IFFAGALLM
Sbjct  61   MIYIQRDLKITDIQVGILAGILNIYSLIGSCAAGKTSDWIGRRYTIVLAGAIFFAGALLM  120

Query  402  GFATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYV  581
            GFA +YAFLM GRFVAG+GVGYALM+APVYTAEVSPASSRGFLTSFPEVFINAGI+LGYV
Sbjct  121  GFAPNYAFLMFGRFVAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGIMLGYV  180

Query  582  SNFAFSKLPTHL  617
            SN AFS  P  L
Sbjct  181  SNLAFSNFPLKL  192



>gb|AIU41385.1| sorbitol transporter 1 [Prunus salicina]
Length=509

 Score =   251 bits (642),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 137/186 (74%), Positives = 159/186 (85%), Gaps = 3/186 (2%)
 Frame = +3

Query  60   MTDGKLENNGVSGHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKD  239
            MTD + E++ VSG  P     KKP RN YA+ C++LAS+ SILLGYDIGVMSGA IYI++
Sbjct  1    MTDHRAEDSAVSGQ-PLLK--KKPKRNLYAIGCAILASMTSILLGYDIGVMSGASIYIQE  57

Query  240  DLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDY  419
            DLKISDV+VE+L+G L ++SL GSAAAGRTSDWIGRRYT+V A  IFF GALLMGFAT+Y
Sbjct  58   DLKISDVEVEILIGILNLYSLIGSAAAGRTSDWIGRRYTIVFAGAIFFTGALLMGFATNY  117

Query  420  AFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFS  599
            AFLMVGRFVAG+GVGYALM+APVY AEVSPASSRG LTSFPEVF+N GILLGYV+N+AFS
Sbjct  118  AFLMVGRFVAGIGVGYALMIAPVYNAEVSPASSRGALTSFPEVFVNIGILLGYVANYAFS  177

Query  600  KLPTHL  617
             LP +L
Sbjct  178  GLPINL  183



>ref|XP_008387373.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=526

 Score =   252 bits (643),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 132/191 (69%), Positives = 158/191 (83%), Gaps = 5/191 (3%)
 Frame = +3

Query  60   MTDGKLENNGVSG-----HIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAI  224
            M D +   N V+       I   DPPKKP  +K+A+AC+LLA   S+LLGYDIGVMSGA 
Sbjct  1    MADQRANENAVTSGPQNTSIEDIDPPKKPKTSKFAIACALLACTTSVLLGYDIGVMSGAS  60

Query  225  IYIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMG  404
            ++IK++LKISDVQVE+L G+L ++SL GSA AGRTSDWIGR+YT+V+A VIF  GALLMG
Sbjct  61   LFIKENLKISDVQVEVLAGTLNIYSLLGSAFAGRTSDWIGRKYTIVLAGVIFLVGALLMG  120

Query  405  FATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVS  584
            FAT+YAFLMVGRFVAGVGVGY +M+APVYTAE+SPAS RGFLTSFPEVF+N GILLGY++
Sbjct  121  FATNYAFLMVGRFVAGVGVGYGMMIAPVYTAEISPASFRGFLTSFPEVFVNVGILLGYIA  180

Query  585  NFAFSKLPTHL  617
            N+AFSKLP HL
Sbjct  181  NYAFSKLPLHL  191



>ref|XP_008236797.1| PREDICTED: putative polyol transporter 2 [Prunus mume]
Length=531

 Score =   252 bits (643),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 133/191 (70%), Positives = 155/191 (81%), Gaps = 5/191 (3%)
 Frame = +3

Query  60   MTDGKLENNGVSGH-----IPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAI  224
            MTD K+E+N VSG      I  FDPP+KP  NK+A+AC+ LA + SILLGYDIGVMSGA 
Sbjct  4    MTDQKVEDNAVSGEPQNKRIADFDPPEKPNANKFAIACATLACMTSILLGYDIGVMSGAN  63

Query  225  IYIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMG  404
            I+IKDDLKI+DVQVE+L G+L ++SL GS  AG TSDWIGRRYT+V++  IFF GA+LMG
Sbjct  64   IFIKDDLKITDVQVEILAGTLNIYSLIGSGLAGVTSDWIGRRYTIVLSGTIFFVGAILMG  123

Query  405  FATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVS  584
             A  Y  LM GRFVAGVGVGY LM+APVYT E+SPA SRGFLTSFPEVF+N GILLGYVS
Sbjct  124  VAPGYGLLMFGRFVAGVGVGYGLMIAPVYTVEISPALSRGFLTSFPEVFVNVGILLGYVS  183

Query  585  NFAFSKLPTHL  617
            N+AFSKLP H+
Sbjct  184  NYAFSKLPVHM  194



>ref|XP_009345071.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=527

 Score =   251 bits (642),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 134/191 (70%), Positives = 159/191 (83%), Gaps = 5/191 (3%)
 Frame = +3

Query  60   MTDGKLENNGVSGH-----IPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAI  224
            MTD + ++  ++G      I  FDPPKK    K+A+AC +LAS+ SILLGYDIGVMSGA 
Sbjct  3    MTDRRADDQTITGEAQNTCIADFDPPKKAKTKKFAIACGILASMTSILLGYDIGVMSGAS  62

Query  225  IYIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMG  404
            ++IK++LKISDVQVE+L G+L ++SL GSA AGRTSDWIGRRYT+V+A  IFF GA+LMG
Sbjct  63   LFIKENLKISDVQVEILNGTLNLYSLIGSALAGRTSDWIGRRYTIVLAGTIFFIGAILMG  122

Query  405  FATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVS  584
             A +YAFLM GRFVAGVGVGYALM+APVYTAE+SPAS RGFLTSFPEVF+N GILLGYVS
Sbjct  123  LAPNYAFLMFGRFVAGVGVGYALMIAPVYTAEISPASFRGFLTSFPEVFVNIGILLGYVS  182

Query  585  NFAFSKLPTHL  617
            N+AFSKLP HL
Sbjct  183  NYAFSKLPIHL  193



>ref|XP_009336961.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=526

 Score =   251 bits (642),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 132/191 (69%), Positives = 159/191 (83%), Gaps = 5/191 (3%)
 Frame = +3

Query  60   MTDGKLENNGVSG-----HIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAI  224
            M D + E N V+G      I  FD P KP  +K+A+AC+LLA   S+LLGYDIGVMSGA 
Sbjct  1    MADRRAEENAVTGGPQNTSIEDFDRPMKPKTSKFAIACALLACTTSVLLGYDIGVMSGAS  60

Query  225  IYIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMG  404
            ++IK++LKISDVQVE+L G+L ++SL GSA AGRTSDWIGR+YT+V+A VIFF GALLMG
Sbjct  61   LFIKENLKISDVQVEVLAGTLNIYSLLGSAFAGRTSDWIGRKYTIVLAGVIFFVGALLMG  120

Query  405  FATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVS  584
            FAT+YAFLMVGRFVAGVGVG+ +M+APVYTAE+SPAS RGFLTSFPEVF+N GILLGY++
Sbjct  121  FATNYAFLMVGRFVAGVGVGFGMMIAPVYTAEISPASFRGFLTSFPEVFVNVGILLGYIA  180

Query  585  NFAFSKLPTHL  617
            N+A SKLP HL
Sbjct  181  NYALSKLPLHL  191



>ref|XP_008361285.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=527

 Score =   251 bits (641),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 134/191 (70%), Positives = 159/191 (83%), Gaps = 5/191 (3%)
 Frame = +3

Query  60   MTDGKLENNGVSGH-----IPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAI  224
            MTD + ++  ++G      I  FDPPKK    K+A+AC +LAS+ SILLGYDIGVMSGA 
Sbjct  3    MTDRRADDKTITGEAQNTCIADFDPPKKAKTKKFAIACGILASMTSILLGYDIGVMSGAS  62

Query  225  IYIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMG  404
            ++IK++LKISDVQVE+L G+L ++SL GSA AGRTSDWIGRRYT+V+A  IFF GA+LMG
Sbjct  63   LFIKENLKISDVQVEILNGTLNLYSLIGSALAGRTSDWIGRRYTIVLAGTIFFIGAILMG  122

Query  405  FATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVS  584
             A +YAFLM GRFVAGVGVGYALM+APVYTAE+SPAS RGFLTSFPEVF+N GILLGYVS
Sbjct  123  LAPNYAFLMFGRFVAGVGVGYALMIAPVYTAEISPASFRGFLTSFPEVFVNIGILLGYVS  182

Query  585  NFAFSKLPTHL  617
            N+AFSKLP HL
Sbjct  183  NYAFSKLPIHL  193



>ref|XP_010527590.1| PREDICTED: polyol transporter 5-like [Tarenaya hassleriana]
Length=519

 Score =   251 bits (640),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 132/172 (77%), Positives = 150/172 (87%), Gaps = 0/172 (0%)
 Frame = +3

Query  102  IPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVG  281
            +P    P KP RNK+A AC++LAS+ SILLGYDIGVMSGAIIYIK DLKI D ++++L G
Sbjct  19   VPEMSMPAKPKRNKFAFACAILASMTSILLGYDIGVMSGAIIYIKRDLKIGDGKIQVLTG  78

Query  282  SLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGV  461
             L +FSL GS AAGRTSDWIGRRYT+V+A  IFF GA+LMGFAT+YAFLM GRFVAG+GV
Sbjct  79   ILNIFSLIGSCAAGRTSDWIGRRYTIVLAGAIFFVGAILMGFATNYAFLMFGRFVAGIGV  138

Query  462  GYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            GYALM+APVYTAEVSPASSRGFL SFPEVFINAGILLGYVSN+AFSKLP +L
Sbjct  139  GYALMIAPVYTAEVSPASSRGFLNSFPEVFINAGILLGYVSNYAFSKLPENL  190



>gb|KEH30426.1| polyol/monosaccharide transporter 1 [Medicago truncatula]
Length=522

 Score =   251 bits (640),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 131/186 (70%), Positives = 155/186 (83%), Gaps = 0/186 (0%)
 Frame = +3

Query  60   MTDGKLENNGVSGHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKD  239
            M++GK+       ++  FDP KKP RNKYA AC++LAS+ SILLGYDIGVMSGA IYIK 
Sbjct  1    MSEGKIVEAKAQKNLQDFDPQKKPKRNKYAFACAMLASMTSILLGYDIGVMSGAAIYIKR  60

Query  240  DLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDY  419
            DLK+SD ++E+L+G + ++SL GS  AGRTSDWIGRRYT+V A  IFF GALLMGF+ +Y
Sbjct  61   DLKVSDGKIEVLLGIINIYSLIGSCLAGRTSDWIGRRYTIVFAGAIFFVGALLMGFSPNY  120

Query  420  AFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFS  599
             FLM GRFVAGVG+GYALM+APVYTAEVSPASSRGFLTSFPEVFIN+GILLGY+SN+AFS
Sbjct  121  NFLMFGRFVAGVGIGYALMIAPVYTAEVSPASSRGFLTSFPEVFINSGILLGYISNYAFS  180

Query  600  KLPTHL  617
            KL   L
Sbjct  181  KLSLKL  186



>ref|XP_002305419.2| hypothetical protein POPTR_0004s15960g [Populus trichocarpa]
 gb|EEE85930.2| hypothetical protein POPTR_0004s15960g [Populus trichocarpa]
Length=531

 Score =   251 bits (640),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 135/169 (80%), Positives = 152/169 (90%), Gaps = 0/169 (0%)
 Frame = +3

Query  111  FDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSLA  290
            FDP KKP RNK+A AC++ AS+ASILLGYDIGVMSGA  YI+ DLK+SDVQV LLVG+L 
Sbjct  25   FDPVKKPKRNKFAFACAITASVASILLGYDIGVMSGAKDYIQTDLKLSDVQVGLLVGTLN  84

Query  291  VFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGYA  470
             +SL GSAAAG TSDWIGRRYT+VVA  +FFAGALLMGF+T+YAFLMV RFVAG+GVG+A
Sbjct  85   WYSLVGSAAAGVTSDWIGRRYTIVVAGAVFFAGALLMGFSTNYAFLMVARFVAGIGVGFA  144

Query  471  LMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            LM+APVYT EVSPASSRGFLTSFPEVFIN GILLGYVSN+AFSKLPT+L
Sbjct  145  LMIAPVYTTEVSPASSRGFLTSFPEVFINVGILLGYVSNYAFSKLPTNL  193



>emb|CBI32562.3| unnamed protein product [Vitis vinifera]
Length=351

 Score =   245 bits (625),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = +3

Query  192  GYDIGVMSGAIIYIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVAS  371
            GYDIGVMSGA IYIK DLKISDV+VE+LVG L V+ LFGSAAAGRTSDWIGRRYT+V+AS
Sbjct  7    GYDIGVMSGAAIYIKKDLKISDVEVEILVGILNVYCLFGSAAAGRTSDWIGRRYTIVLAS  66

Query  372  VIFFAGALLMGFATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVF  551
            VIFF GALLMGFAT+Y FLMVGRFVAG+GVGYALM+APVY AEVSPASSRGF+TSFPEVF
Sbjct  67   VIFFLGALLMGFATNYVFLMVGRFVAGIGVGYALMIAPVYAAEVSPASSRGFITSFPEVF  126

Query  552  INAGILLGYVSNFAFSKLPTHL  617
            INAGIL GY+SN+AFSKLPT+L
Sbjct  127  INAGILFGYISNYAFSKLPTNL  148



>ref|XP_008387377.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=520

 Score =   250 bits (638),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 133/188 (71%), Positives = 156/188 (83%), Gaps = 2/188 (1%)
 Frame = +3

Query  60   MTDGKLENNGVSGH--IPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYI  233
            M D K +N   SG   I  FDPPK P   K+A+AC+ LAS+ SILLGYDIGVMSGA ++I
Sbjct  3    MADRKPQNTEASGQKTIADFDPPKAPKTKKFAIACATLASMTSILLGYDIGVMSGASLFI  62

Query  234  KDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFAT  413
            K++LKI+DVQVE+L G+L ++SL GSA AGRTSDWIGRRYT+V++  IFFAGALLMGFA 
Sbjct  63   KENLKITDVQVEVLNGTLNLYSLIGSALAGRTSDWIGRRYTIVLSGAIFFAGALLMGFAP  122

Query  414  DYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFA  593
            +YAFLM GRF+AGVGVGYALM+APVYTAE+SPAS RG LTSFPEVF+N GILLGYVSN+A
Sbjct  123  NYAFLMFGRFIAGVGVGYALMIAPVYTAEISPASFRGLLTSFPEVFVNVGILLGYVSNYA  182

Query  594  FSKLPTHL  617
             S LP HL
Sbjct  183  LSXLPIHL  190



>ref|XP_007199793.1| hypothetical protein PRUPE_ppa004456mg [Prunus persica]
 gb|EMJ00992.1| hypothetical protein PRUPE_ppa004456mg [Prunus persica]
Length=509

 Score =   249 bits (637),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 157/186 (84%), Gaps = 3/186 (2%)
 Frame = +3

Query  60   MTDGKLENNGVSGHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKD  239
            MTD + E N VSG  P     KKP RN YA+ C++LAS+ SILLGYDIGVMSGA IYI++
Sbjct  1    MTDHRAEANAVSGQ-PLLK--KKPKRNLYAIGCAILASMTSILLGYDIGVMSGASIYIQE  57

Query  240  DLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDY  419
            DLKI+DV+VE+L+G L ++SL GSAAAGRTSDWIGRRYT+V A  IFF GALLMGFAT++
Sbjct  58   DLKITDVEVEILIGILNLYSLIGSAAAGRTSDWIGRRYTIVFAGAIFFTGALLMGFATNF  117

Query  420  AFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFS  599
            AFLMVGRFVAG+GVGYALM+APVY AEVSPASSRG LTSFPEVF+N GILLGYV+N+AFS
Sbjct  118  AFLMVGRFVAGIGVGYALMIAPVYNAEVSPASSRGALTSFPEVFVNIGILLGYVANYAFS  177

Query  600  KLPTHL  617
             LP  L
Sbjct  178  GLPIDL  183



>gb|KHN39768.1| Polyol transporter 5 [Glycine soja]
Length=523

 Score =   249 bits (637),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 132/183 (72%), Positives = 154/183 (84%), Gaps = 1/183 (1%)
 Frame = +3

Query  60   MTDGKL-ENNGVSGHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIK  236
            MT+GKL E       +  FDPPKK  RNKYA AC++LAS+ SILLGYDIGVMSGA IYIK
Sbjct  1    MTEGKLVEAAEAHKTLQDFDPPKKRKRNKYAFACAMLASMTSILLGYDIGVMSGAAIYIK  60

Query  237  DDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATD  416
             DLK+SD Q+E+L+G + ++SL GS  AGRTSDWIGRRYT+V A  IFF GALLMGF+ +
Sbjct  61   RDLKVSDEQIEILLGIINLYSLIGSCLAGRTSDWIGRRYTIVFAGAIFFVGALLMGFSPN  120

Query  417  YAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAF  596
            Y+FLM GRFVAG+G+GYALM+APVYTAEVSPASSRGFLTSFPEVFIN GIL+GY+SN+AF
Sbjct  121  YSFLMFGRFVAGIGIGYALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILIGYISNYAF  180

Query  597  SKL  605
            SKL
Sbjct  181  SKL  183



>ref|XP_009345072.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=523

 Score =   249 bits (637),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 131/185 (71%), Positives = 157/185 (85%), Gaps = 5/185 (3%)
 Frame = +3

Query  78   ENNGVSG-----HIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDD  242
            E N V+G      I  FD PKKP  +K+A+AC+LLA   SILLG+DIGVMSGA ++IK++
Sbjct  7    EENAVTGGPQNTSIEDFDHPKKPKTSKFAIACALLACTTSILLGFDIGVMSGASLFIKEN  66

Query  243  LKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYA  422
            LKISDVQVE+L G+L ++SL GSA AGRTSDWIGR+YT+V+A VIF  GALLMGFAT+YA
Sbjct  67   LKISDVQVEVLAGTLNIYSLLGSALAGRTSDWIGRKYTIVLAGVIFLVGALLMGFATNYA  126

Query  423  FLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSK  602
            FLMVGRFVAGVGVGY +M+APVYTAE+SPAS RGFLTSFPEVF+N GILLGY++N+AF+K
Sbjct  127  FLMVGRFVAGVGVGYGMMIAPVYTAEISPASFRGFLTSFPEVFVNVGILLGYIANYAFAK  186

Query  603  LPTHL  617
            LP HL
Sbjct  187  LPLHL  191



>ref|XP_008236796.1| PREDICTED: polyol transporter 5-like [Prunus mume]
Length=509

 Score =   249 bits (636),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 135/186 (73%), Positives = 159/186 (85%), Gaps = 3/186 (2%)
 Frame = +3

Query  60   MTDGKLENNGVSGHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKD  239
            MTD + E++ VSG  P     KKP RN YA+ C++LAS+ SILLGYDIGVMSGA IYI++
Sbjct  1    MTDRRAEDSAVSGQ-PLLK--KKPKRNLYAIGCAILASMTSILLGYDIGVMSGASIYIQE  57

Query  240  DLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDY  419
            DLKI+DV+VE+L+G L ++SL GSAAAGRTSDWIGRRYT+V A  IFF GALLMGFAT++
Sbjct  58   DLKITDVEVEILIGILNLYSLIGSAAAGRTSDWIGRRYTIVFAGAIFFTGALLMGFATNF  117

Query  420  AFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFS  599
            AFLMVGRFVAG+GVGYALM+APVY AEVSPASSRG LTSFPEVF+N GILLGYV+N+AFS
Sbjct  118  AFLMVGRFVAGIGVGYALMIAPVYNAEVSPASSRGALTSFPEVFVNIGILLGYVANYAFS  177

Query  600  KLPTHL  617
             LP +L
Sbjct  178  GLPINL  183



>ref|XP_008236773.1| PREDICTED: putative polyol transporter 1 [Prunus mume]
 ref|XP_008236774.1| PREDICTED: putative polyol transporter 1 [Prunus mume]
Length=528

 Score =   249 bits (637),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 130/192 (68%), Positives = 157/192 (82%), Gaps = 6/192 (3%)
 Frame = +3

Query  60   MTDGKLENNGVSGH------IPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGA  221
            M D ++E+N VSG       I  FDPP+KP  NK+A+AC++LA   SILLGYDIGVMSGA
Sbjct  1    MADRRVEDNAVSGQLQNDHRIADFDPPQKPKTNKFAIACAILACTTSILLGYDIGVMSGA  60

Query  222  IIYIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLM  401
             I+I++DLK+SD ++ +L G+L ++SL GSA AGRTSDWIGRRYT+V++ VIFF GALLM
Sbjct  61   NIFIQNDLKLSDTEIAVLAGTLNIYSLIGSALAGRTSDWIGRRYTVVLSGVIFFVGALLM  120

Query  402  GFATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYV  581
            G A  YAFLM GRFVAG+GVGY LM+APVYT E+SP  SRGFLTSFPEVF+N GILLGYV
Sbjct  121  GLAPGYAFLMFGRFVAGIGVGYGLMIAPVYTVEISPTLSRGFLTSFPEVFVNLGILLGYV  180

Query  582  SNFAFSKLPTHL  617
            SN+AFSKLPT+L
Sbjct  181  SNYAFSKLPTNL  192



>gb|AAO39267.1|AF482011_1 sorbitol transporter [Prunus cerasus]
Length=509

 Score =   249 bits (635),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 156/186 (84%), Gaps = 3/186 (2%)
 Frame = +3

Query  60   MTDGKLENNGVSGHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKD  239
            MTD + ++N VSG  P     KKP RN YA+ C++LAS+ SILLGYDIGVMSGA IYI+ 
Sbjct  1    MTDRRAQDNAVSGQ-PLLK--KKPKRNLYAIGCAILASMTSILLGYDIGVMSGASIYIQK  57

Query  240  DLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDY  419
            DLKISDV+VE+L+G L ++SL GSAAAGRTSDWIGRRYT+V A  IFF GALLMG AT+Y
Sbjct  58   DLKISDVEVEILIGILNLYSLIGSAAAGRTSDWIGRRYTIVFAGAIFFTGALLMGLATNY  117

Query  420  AFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFS  599
            AFLMVGRFVAG+GVGYALM+APVY AEVSPASSRG LTSFPEVF+N GILLGYV+N+AFS
Sbjct  118  AFLMVGRFVAGIGVGYALMIAPVYNAEVSPASSRGALTSFPEVFVNIGILLGYVANYAFS  177

Query  600  KLPTHL  617
             LP  L
Sbjct  178  GLPIDL  183



>ref|XP_006856084.1| PREDICTED: polyol transporter 5 [Amborella trichopoda]
 gb|ERN17551.1| hypothetical protein AMTR_s00059p00122840 [Amborella trichopoda]
Length=518

 Score =   249 bits (636),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 148/165 (90%), Gaps = 0/165 (0%)
 Frame = +3

Query  123  KKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSLAVFSL  302
            +KP RNKYA+AC+ LAS+ SILLGYDIGVMSGA+I+IK+DL+ISDV+VE+LVGSL ++ L
Sbjct  17   EKPKRNKYALACAFLASMTSILLGYDIGVMSGAVIFIKEDLRISDVEVEILVGSLNIYCL  76

Query  303  FGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGYALMVA  482
             GS AAGRTSDWIGRRYT+V AS IFF GAL+MGFA +YAFLM GR VAG+GVGYALM+A
Sbjct  77   IGSFAAGRTSDWIGRRYTIVFASAIFFVGALMMGFAPNYAFLMAGRVVAGIGVGYALMIA  136

Query  483  PVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            PVYTAEV+PAS RGFLTSFPEVFINAGIL GYVSNFAF +LP HL
Sbjct  137  PVYTAEVAPASCRGFLTSFPEVFINAGILFGYVSNFAFERLPLHL  181



>emb|CAJ29291.1| putative polyol transporter protein 4 [Lotus japonicus]
Length=519

 Score =   249 bits (636),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 155/185 (84%), Gaps = 3/185 (2%)
 Frame = +3

Query  60   MTDGKL---ENNGVSGHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIY  230
            MT+GK+     N    ++  FDP KKP RNKYA AC++LAS+ SILLGYDIGVMSGA IY
Sbjct  1    MTEGKVVTEAENANQKNLQDFDPQKKPKRNKYAFACAMLASMTSILLGYDIGVMSGAAIY  60

Query  231  IKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFA  410
            IK DLK+SDV++E+L+G + ++SL GS  AGRTSDWIGRRYT+V A  IFF GALLMGF+
Sbjct  61   IKRDLKVSDVKIEILLGIINLYSLIGSGLAGRTSDWIGRRYTIVFAGAIFFVGALLMGFS  120

Query  411  TDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNF  590
             +Y FLM GRF+AG+G+GYALM+APVYTAEVSPASSRGFLTSFPEVFIN GILLGY+SNF
Sbjct  121  PNYWFLMFGRFIAGIGIGYALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYISNF  180

Query  591  AFSKL  605
            AFSKL
Sbjct  181  AFSKL  185



>ref|XP_009375822.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=520

 Score =   249 bits (635),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 133/188 (71%), Positives = 158/188 (84%), Gaps = 2/188 (1%)
 Frame = +3

Query  60   MTDGKLENNGVSGH--IPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYI  233
            M D K E+   SG   I  FDPPK     K+A+AC++LAS+ SILLGYDIGVMSGA ++I
Sbjct  3    MADRKPEDTEASGQKTIADFDPPKAAKTKKFAVACAILASMTSILLGYDIGVMSGASLFI  62

Query  234  KDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFAT  413
            K++LKI+DVQVE+L G+L ++SL GSA AGRTSDWIGRRYT+V++  IFFAGALLMGFA 
Sbjct  63   KENLKITDVQVEVLNGTLNLYSLIGSALAGRTSDWIGRRYTIVLSGAIFFAGALLMGFAP  122

Query  414  DYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFA  593
            +YAFLM GRF+AGVGVGYALM+APVYTAE+SPAS RGFLTSFPEVF+N GILLGYVSN+A
Sbjct  123  NYAFLMFGRFIAGVGVGYALMIAPVYTAEISPASFRGFLTSFPEVFVNVGILLGYVSNYA  182

Query  594  FSKLPTHL  617
             +KLP HL
Sbjct  183  LAKLPIHL  190



>ref|XP_006349565.1| PREDICTED: polyol transporter 5-like [Solanum tuberosum]
Length=518

 Score =   248 bits (634),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 156/187 (83%), Gaps = 1/187 (1%)
 Frame = +3

Query  60   MTDGKLENN-GVSGHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIK  236
            M +  LE    +S  IP F P KKP RNKYA ACSLLAS+ S+LLGYD GVMSGA+IYIK
Sbjct  1    MENQSLEKKVMISNKIPEFVPLKKPKRNKYAFACSLLASMTSVLLGYDTGVMSGAVIYIK  60

Query  237  DDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATD  416
            +DLKISDV +E+LVG++ ++SL G+A AGRTSDWIGRRYT+++AS IF  GALLMGFA +
Sbjct  61   EDLKISDVAIEVLVGTINIYSLVGAAIAGRTSDWIGRRYTIILASGIFLVGALLMGFAPN  120

Query  417  YAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAF  596
            Y FLM GRFVAG+GVGYALM+APVYTAEV+PAS RGF TSFPEVFINAG+LLGY++N+AF
Sbjct  121  YWFLMFGRFVAGIGVGYALMIAPVYTAEVAPASCRGFCTSFPEVFINAGVLLGYIANYAF  180

Query  597  SKLPTHL  617
            S LP  L
Sbjct  181  SMLPLKL  187



>ref|XP_009112300.1| PREDICTED: polyol transporter 5 [Brassica rapa]
 emb|CDY18552.1| BnaA01g26430D [Brassica napus]
Length=529

 Score =   249 bits (635),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 136/192 (71%), Positives = 153/192 (80%), Gaps = 6/192 (3%)
 Frame = +3

Query  60   MTDGKLENNGV------SGHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGA  221
            MT    EN  V      + H+P   PP KP RNKYA AC++LAS+ SILLGYDIGVMSGA
Sbjct  1    MTGLTPENQTVPTTAPATKHVPELGPPVKPKRNKYAFACAILASMTSILLGYDIGVMSGA  60

Query  222  IIYIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLM  401
            +IYIK D KI+D+QV +L G L +FSL GS AAG+TSDWIGRR T+V A  IFFAGA+LM
Sbjct  61   LIYIKRDFKITDLQVSILAGILNIFSLIGSCAAGKTSDWIGRRNTIVFAGAIFFAGAILM  120

Query  402  GFATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYV  581
            G A +YAFLM GRFVAGVGVGYALM+APVYTAEV+PASSRGFLTSFPEVFINAGI+LGYV
Sbjct  121  GLAPNYAFLMFGRFVAGVGVGYALMIAPVYTAEVAPASSRGFLTSFPEVFINAGIMLGYV  180

Query  582  SNFAFSKLPTHL  617
            SN AFSK P  L
Sbjct  181  SNLAFSKFPLKL  192



>ref|XP_007200667.1| hypothetical protein PRUPE_ppa015294mg [Prunus persica]
 gb|EMJ01866.1| hypothetical protein PRUPE_ppa015294mg [Prunus persica]
Length=538

 Score =   249 bits (635),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 131/191 (69%), Positives = 155/191 (81%), Gaps = 5/191 (3%)
 Frame = +3

Query  60   MTDGKLENNGVSGH-----IPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAI  224
            MTD K+E+N VSG      I  FDPP+KP  +K+A+AC+ LA + SILLGYDIGVMSGA 
Sbjct  1    MTDRKVEDNAVSGEPQNKRIADFDPPEKPNASKFAIACATLACMTSILLGYDIGVMSGAN  60

Query  225  IYIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMG  404
            I+IKDDLKI+DVQVE+L G+L ++SL GS  AG TSDWIGRRYT+V++  IFF GA+LMG
Sbjct  61   IFIKDDLKITDVQVEVLAGTLNIYSLIGSGLAGVTSDWIGRRYTIVLSGTIFFIGAILMG  120

Query  405  FATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVS  584
             A  Y  LM GRFVAG+GVGY LM+APVYT E+SPA SRGFLTSFPEVF+N GILLGYVS
Sbjct  121  VAPGYGLLMFGRFVAGIGVGYGLMIAPVYTVEISPALSRGFLTSFPEVFVNVGILLGYVS  180

Query  585  NFAFSKLPTHL  617
            N+AFSKLP H+
Sbjct  181  NYAFSKLPVHM  191



>ref|XP_007131851.1| hypothetical protein PHAVU_011G046700g [Phaseolus vulgaris]
 gb|ESW03845.1| hypothetical protein PHAVU_011G046700g [Phaseolus vulgaris]
Length=518

 Score =   248 bits (634),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 155/187 (83%), Gaps = 4/187 (2%)
 Frame = +3

Query  60   MTDGK-LENNGVSGHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIK  236
            MT+GK +E   + G    F+  KKP RNKYA  C++LAS+ SILLGYDIGVMSGA IYIK
Sbjct  1    MTEGKGIEARKIVGD---FNSSKKPKRNKYAFGCAILASMTSILLGYDIGVMSGAAIYIK  57

Query  237  DDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATD  416
             DLK+SDVQ+E+L+G + ++SL GS  AGRTSDWIGRRYT+V A  IFFAGALLMGF+ +
Sbjct  58   RDLKVSDVQIEILMGIINLYSLIGSCLAGRTSDWIGRRYTIVFAGTIFFAGALLMGFSPN  117

Query  417  YAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAF  596
            Y FLM GRFVAG+G+GYALM+APVYTAEVSPASSRGFLTSFPEVFIN GILLGYVSNFAF
Sbjct  118  YLFLMFGRFVAGIGIGYALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYVSNFAF  177

Query  597  SKLPTHL  617
            SK+   L
Sbjct  178  SKMTLKL  184



>gb|KHN25361.1| Polyol transporter 5 [Glycine soja]
Length=521

 Score =   248 bits (633),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 131/183 (72%), Positives = 153/183 (84%), Gaps = 1/183 (1%)
 Frame = +3

Query  60   MTDGKL-ENNGVSGHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIK  236
            MT GK+ E       +  FDPPKK  RNKYA AC++LAS+ SILLGYDIGVMSGA +YIK
Sbjct  1    MTQGKIVEAAEAHKTLEDFDPPKKRKRNKYAFACAVLASMTSILLGYDIGVMSGAALYIK  60

Query  237  DDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATD  416
             DLK+SDVQ+E+L+G + ++SL GS  AGRTSDWIGRRYT+V A  IFF GALLMGF+ +
Sbjct  61   RDLKVSDVQIEILLGIINLYSLIGSCLAGRTSDWIGRRYTIVFAGAIFFVGALLMGFSPN  120

Query  417  YAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAF  596
            Y+FLM GRFVAG+G+GYALM+APVYTAEVSPASSRGFLTSFPEVFIN GILLGY+SN+ F
Sbjct  121  YSFLMFGRFVAGIGIGYALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYISNYGF  180

Query  597  SKL  605
            SKL
Sbjct  181  SKL  183



>ref|XP_003541068.1| PREDICTED: polyol transporter 5-like [Glycine max]
Length=523

 Score =   248 bits (633),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 131/183 (72%), Positives = 153/183 (84%), Gaps = 1/183 (1%)
 Frame = +3

Query  60   MTDGKL-ENNGVSGHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIK  236
            MT GK+ E       +  FDPPKK  RNKYA AC++LAS+ SILLGYDIGVMSGA +YIK
Sbjct  1    MTQGKIVEAAEAHKTLEDFDPPKKRKRNKYAFACAVLASMTSILLGYDIGVMSGAALYIK  60

Query  237  DDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATD  416
             DLK+SDVQ+E+L+G + ++SL GS  AGRTSDWIGRRYT+V A  IFF GALLMGF+ +
Sbjct  61   RDLKVSDVQIEILLGIINLYSLIGSCLAGRTSDWIGRRYTIVFAGAIFFVGALLMGFSPN  120

Query  417  YAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAF  596
            Y+FLM GRFVAG+G+GYALM+APVYTAEVSPASSRGFLTSFPEVFIN GILLGY+SN+ F
Sbjct  121  YSFLMFGRFVAGIGIGYALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYISNYGF  180

Query  597  SKL  605
            SKL
Sbjct  181  SKL  183



>gb|KJB12316.1| hypothetical protein B456_002G011500 [Gossypium raimondii]
Length=533

 Score =   248 bits (633),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 161/193 (83%), Gaps = 7/193 (4%)
 Frame = +3

Query  60   MTDGKLENNGVSGHIPA-------FDPPKKPPRNKYAMacsllaslasillGYDIGVMSG  218
            M+  + +N+GVS  +         F+  KKP RNK+A AC++LASLASILLGYDIGVMSG
Sbjct  1    MSGFEADNHGVSISVAVDNKTLADFEVLKKPKRNKFAFACAILASLASILLGYDIGVMSG  60

Query  219  AIIYIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALL  398
            AI+YIKDDLKISDVQVE+LVG L ++ L G+  AGRTSDWIGRRYT+VVA+ IFF GALL
Sbjct  61   AILYIKDDLKISDVQVEILVGILNLYCLIGAYVAGRTSDWIGRRYTIVVAASIFFVGALL  120

Query  399  MGFATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGY  578
            MGFAT+Y FLMVGRFV G+GVG+AL++APVYTAEVSPAS+RGFL SFPEVFINAG+LLGY
Sbjct  121  MGFATNYTFLMVGRFVTGIGVGFALLIAPVYTAEVSPASARGFLNSFPEVFINAGLLLGY  180

Query  579  VSNFAFSKLPTHL  617
            VSN+AFSKL   L
Sbjct  181  VSNYAFSKLRADL  193



>ref|XP_006349557.1| PREDICTED: polyol transporter 5-like [Solanum tuberosum]
Length=519

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +3

Query  123  KKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSLAVFSL  302
            K P RNKYA+ACSLLAS+ SILLGYD GVMSGA+IYIK+DLKISDVQ+E+LVG++ ++SL
Sbjct  10   KSPKRNKYALACSLLASMTSILLGYDTGVMSGAVIYIKEDLKISDVQIEILVGTINIYSL  69

Query  303  FGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGYALMVA  482
             G+A AGRTSDWIGRRYT+++AS+IFF GA+LMGFA +Y FLM GRFVAG+GVGYALM+A
Sbjct  70   VGAAIAGRTSDWIGRRYTIILASLIFFVGAILMGFAPNYWFLMFGRFVAGIGVGYALMIA  129

Query  483  PVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            PVYTAEV+PAS RGF TSFPEVFIN G+LLGY+SN+AFSKLPT L
Sbjct  130  PVYTAEVAPASCRGFFTSFPEVFINGGVLLGYISNYAFSKLPTKL  174



>ref|XP_004148312.2| PREDICTED: polyol transporter 5-like [Cucumis sativus]
 gb|KGN44323.1| Sugar transporter [Cucumis sativus]
Length=516

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 149/166 (90%), Gaps = 0/166 (0%)
 Frame = +3

Query  120  PKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSLAVFS  299
            PKKP RNKYA  C++LAS+ASILLGYD+GVMSGA IYIK D +I+DVQ E+++G + +++
Sbjct  14   PKKPKRNKYAFMCAILASMASILLGYDVGVMSGAAIYIKKDFQINDVQEEVMIGVINLYA  73

Query  300  LFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGYALMV  479
            L G+AAAGRTSDWIGRRYTMV+A VIFF GA+LMGFAT+Y FLM GRFVAG+GVGYALM+
Sbjct  74   LIGAAAAGRTSDWIGRRYTMVLAGVIFFLGAILMGFATNYEFLMFGRFVAGIGVGYALMI  133

Query  480  APVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            +PVYTAEVSPASSRGFLTSFPEVFIN G+LLGY+SNF FSKLP HL
Sbjct  134  SPVYTAEVSPASSRGFLTSFPEVFINFGVLLGYISNFFFSKLPLHL  179



>ref|XP_006384498.1| hypothetical protein POPTR_0004s15900g [Populus trichocarpa]
 gb|ERP62295.1| hypothetical protein POPTR_0004s15900g [Populus trichocarpa]
Length=503

 Score =   247 bits (630),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 135/169 (80%), Positives = 152/169 (90%), Gaps = 0/169 (0%)
 Frame = +3

Query  111  FDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSLA  290
            FDP KKP  NK+A AC++LAS+ASILLGYDIGVMSGA  YIK DLK+SD QV LLVG+L 
Sbjct  25   FDPVKKPKGNKFAFACAILASMASILLGYDIGVMSGAKDYIKIDLKLSDTQVGLLVGTLN  84

Query  291  VFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGYA  470
             +SL GSAAAG TSDWIGRRYT+VVA  +FFAGALLMGF+T+YAFLMV RFV G+GVG+A
Sbjct  85   WYSLVGSAAAGVTSDWIGRRYTIVVAGAVFFAGALLMGFSTNYAFLMVARFVTGIGVGFA  144

Query  471  LMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            LM+APVYTAEVSPASSRGFLTSFPEVFINAGIL+GYVSN+AFSKLPT+L
Sbjct  145  LMIAPVYTAEVSPASSRGFLTSFPEVFINAGILIGYVSNYAFSKLPTNL  193



>ref|XP_008236860.1| PREDICTED: putative polyol transporter 1 [Prunus mume]
Length=525

 Score =   247 bits (630),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 156/191 (82%), Gaps = 5/191 (3%)
 Frame = +3

Query  60   MTDGKLENNGVSGH-----IPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAI  224
            M D   E+  +SG      I  FDPP+KP RNK+A+ACS+LA + SILLGYDIGVMSGA 
Sbjct  1    MADPIAEDKAISGQPKNTVIADFDPPQKPKRNKFAIACSILACMTSILLGYDIGVMSGAN  60

Query  225  IYIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMG  404
            ++I+DDLKI+DVQ+++L G+L ++SL GSA AGRTSDWIGRRYT+V++  IFF GA+LMG
Sbjct  61   LFIQDDLKINDVQIQILTGTLNIYSLIGSALAGRTSDWIGRRYTVVLSGAIFFVGAILMG  120

Query  405  FATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVS  584
             A  Y FLM GRFVAG+GVGY LM++PVYTAE++P  SRGFLTSFPEVF+N GILLGYVS
Sbjct  121  VAPGYGFLMFGRFVAGIGVGYGLMISPVYTAEIAPTLSRGFLTSFPEVFVNIGILLGYVS  180

Query  585  NFAFSKLPTHL  617
            N+AFSKLP HL
Sbjct  181  NYAFSKLPAHL  191



>dbj|BAM66296.1| sorbitol transporter, partial [Pyrus pyrifolia]
 dbj|BAM66297.1| sorbitol transporter, partial [Pyrus pyrifolia]
Length=454

 Score =   245 bits (625),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 120/141 (85%), Positives = 133/141 (94%), Gaps = 0/141 (0%)
 Frame = +3

Query  195  YDIGVMSGAIIYIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASV  374
            YDIGVMSGA IYI+ DLKISDVQ+E+L+G L V+SLFGSAAAGRTSDWIGRRYT+V+A  
Sbjct  1    YDIGVMSGAAIYIQKDLKISDVQIEILLGILNVYSLFGSAAAGRTSDWIGRRYTIVLAGA  60

Query  375  IFFAGALLMGFATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFI  554
            IFFAGALLMGFAT+Y FLMVGRFVAG+GVGYALM+APVYTAEVSPASSRGFLTSFPEVF+
Sbjct  61   IFFAGALLMGFATNYVFLMVGRFVAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFV  120

Query  555  NAGILLGYVSNFAFSKLPTHL  617
            N GILLGYVSN+AFSKLPT+L
Sbjct  121  NVGILLGYVSNYAFSKLPTNL  141



>ref|XP_008387376.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=520

 Score =   246 bits (629),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 132/188 (70%), Positives = 155/188 (82%), Gaps = 2/188 (1%)
 Frame = +3

Query  60   MTDGKLENNGVSGH--IPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYI  233
            M D K +N   SG   I  FDPPK     K+A+AC+ LAS+ SILLGYDIGVMSGA ++I
Sbjct  3    MADRKPQNTEASGQKTIADFDPPKAXKTKKFAIACATLASMTSILLGYDIGVMSGASLFI  62

Query  234  KDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFAT  413
            K++LKI+DVQVE+L G+L ++SL GSA AGRTSDWIGRRYT+V++  IFFAGALLMGFA 
Sbjct  63   KENLKITDVQVEVLNGTLNLYSLIGSALAGRTSDWIGRRYTIVLSGAIFFAGALLMGFAP  122

Query  414  DYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFA  593
            +YAFLM GRF+AGVGVGYALM+APVYTAE+SPAS RG LTSFPEVF+N GILLGYVSN+A
Sbjct  123  NYAFLMFGRFIAGVGVGYALMIAPVYTAEISPASFRGLLTSFPEVFVNVGILLGYVSNYA  182

Query  594  FSKLPTHL  617
             S LP HL
Sbjct  183  LSXLPIHL  190



>ref|XP_011078883.1| PREDICTED: polyol transporter 5-like isoform X1 [Sesamum indicum]
Length=526

 Score =   246 bits (629),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 147/166 (89%), Gaps = 0/166 (0%)
 Frame = +3

Query  120  PKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSLAVFS  299
            P K  RNKYA+A S+LAS+ S+LLGYD GVMSGA IYIK DLKISDVQ+E+LVG++ ++S
Sbjct  31   PTKHKRNKYALAISVLASMTSVLLGYDTGVMSGATIYIKRDLKISDVQIEILVGTINIYS  90

Query  300  LFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGYALMV  479
            L GSA AGRTSDWIGRRYT+V AS IFFAGA+LMGFA +YAFLMVGRFVAG+GVGYALM+
Sbjct  91   LLGSAVAGRTSDWIGRRYTIVFASAIFFAGAILMGFAANYAFLMVGRFVAGIGVGYALMI  150

Query  480  APVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            APVY AEV+PAS RGFLTSFPEVFIN G+LLGYVSN+AF+KLP  L
Sbjct  151  APVYAAEVAPASCRGFLTSFPEVFINFGVLLGYVSNYAFAKLPLKL  196



>gb|ACJ85869.1| unknown [Medicago truncatula]
 gb|AFK48997.1| unknown [Medicago truncatula]
Length=434

 Score =   244 bits (622),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  111  FDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSLA  290
            FD  KKP  NK+A AC++LAS+ SILLGYDIGVMSGA+IYIK DLK+S+VQ+E+LVG + 
Sbjct  16   FDSQKKPESNKFAFACAILASMTSILLGYDIGVMSGAVIYIKRDLKLSNVQIEILVGIIN  75

Query  291  VFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGYA  470
            +FSL GS  AGRTSDWIGRRYT+V+A  IFFAGALLMGF+ ++AFLM  RF+AG+G+GYA
Sbjct  76   LFSLIGSCLAGRTSDWIGRRYTIVLAGSIFFAGALLMGFSPNFAFLMFARFIAGIGIGYA  135

Query  471  LMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            LM+APVYTAEVSPASSRGFLTSFPEVFIN GILLGY+SN+ FSKLP  L
Sbjct  136  LMIAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYISNYGFSKLPLRL  184



>gb|AAT06053.2| sorbitol transporter [Malus domestica]
Length=533

 Score =   246 bits (629),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 125/190 (66%), Positives = 156/190 (82%), Gaps = 4/190 (2%)
 Frame = +3

Query  60   MTDGKLENNGVSGH----IPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAII  227
            MTD   ++N VS      I  FDPP+KP RNKYA AC++LAS+ SIL+GYDIGVMSGA I
Sbjct  1    MTDRTTDDNTVSSQPQKTIADFDPPQKPKRNKYAFACAILASMTSILMGYDIGVMSGASI  60

Query  228  YIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGF  407
            YI+ DLK++D Q+E+++G + ++SL GSA AG+TSDW+GRRYT+V++  IFF GA+LMGF
Sbjct  61   YIEKDLKVTDTQIEIMIGVIEIYSLIGSAMAGKTSDWVGRRYTIVISGAIFFIGAILMGF  120

Query  408  ATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSN  587
            +T+Y FLM GRFVAG+GVGYAL +APVY+AEVSP SSRGFLTSFPEVF+N GILLGY+SN
Sbjct  121  STNYTFLMCGRFVAGIGVGYALTIAPVYSAEVSPTSSRGFLTSFPEVFVNIGILLGYLSN  180

Query  588  FAFSKLPTHL  617
            +AFS  P  L
Sbjct  181  YAFSFCPLDL  190



>ref|XP_008795608.1| PREDICTED: putative polyol transporter 1 [Phoenix dactylifera]
Length=522

 Score =   246 bits (628),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 134/191 (70%), Positives = 158/191 (83%), Gaps = 5/191 (3%)
 Frame = +3

Query  60   MTDGKLENNGVSGHIPAFDPPK----KPPR-NKYAMacsllaslasillGYDIGVMSGAI  224
            MTD K E   V+  +P    P+    +P R NKYA  C++LAS+ SILLGYDIGVMSGA 
Sbjct  1    MTDQKPEATKVASQVPHDSLPEAVAPRPRRKNKYAFGCAMLASMTSILLGYDIGVMSGAA  60

Query  225  IYIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMG  404
            I+I+DDL ++D Q+E+L+G L ++SL GS AAGRTSDWIGRRYT+V A+VIFF GA++MG
Sbjct  61   IFIQDDLHVTDTQIEILLGILNLYSLVGSLAAGRTSDWIGRRYTIVFAAVIFFVGAIMMG  120

Query  405  FATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVS  584
             A +YAFLMVGRFVAGVGVGYALM+APVYTAEV+PASSRGFLTSF EVFIN+GILLGYVS
Sbjct  121  LAPNYAFLMVGRFVAGVGVGYALMIAPVYTAEVAPASSRGFLTSFAEVFINSGILLGYVS  180

Query  585  NFAFSKLPTHL  617
            NFAFSKLP HL
Sbjct  181  NFAFSKLPEHL  191



>emb|CDX95491.1| BnaC01g33830D [Brassica napus]
Length=531

 Score =   246 bits (628),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 130/175 (74%), Positives = 147/175 (84%), Gaps = 0/175 (0%)
 Frame = +3

Query  93   SGHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVEL  272
            + H+P   PP KP RNKYA AC++LAS+ SILLGYDIGVMSGA+IYIK D KI+D+QV +
Sbjct  18   TKHVPELGPPLKPKRNKYAFACAILASMTSILLGYDIGVMSGALIYIKRDFKITDLQVSI  77

Query  273  LVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAG  452
            L G L +FSL GS AAG+TSDWIGRR T+V A  IFFAGA+LMG A +Y FLM GRFVAG
Sbjct  78   LAGILNIFSLIGSCAAGKTSDWIGRRNTIVFAGAIFFAGAILMGLAPNYDFLMFGRFVAG  137

Query  453  VGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            VGVGYALM+APVYTAEV+PASSRGFLTSFPEVFINAGI+LGYVSN AFSK P  L
Sbjct  138  VGVGYALMIAPVYTAEVAPASSRGFLTSFPEVFINAGIMLGYVSNLAFSKFPLKL  192



>gb|AAL85876.2|AF480069_1 mannitol transporter [Apium graveolens Dulce Group]
 gb|ABH03025.1| mannitol transporter MaT2 [Apium graveolens]
Length=524

 Score =   246 bits (627),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  111  FDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSLA  290
            FD  KKP RNKYA  C++LAS+ S+LLGYDIGVMSGA IYIKD L +SDV++E++VG + 
Sbjct  24   FDAVKKPKRNKYAFGCAILASMTSVLLGYDIGVMSGAAIYIKDQLHVSDVKLEIVVGIIN  83

Query  291  VFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGYA  470
             FSL GSA AGRTSDWIGRRYTMV+A  IFF GA+LMGFAT+Y+FLM GRFVAG+GVGYA
Sbjct  84   FFSLVGSALAGRTSDWIGRRYTMVLAGAIFFVGAILMGFATNYSFLMFGRFVAGIGVGYA  143

Query  471  LMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            LM+APVYTAEVS ASSRGFLTSFPEVFIN G+LLGYVSN+AFSKLP +L
Sbjct  144  LMIAPVYTAEVSSASSRGFLTSFPEVFINIGVLLGYVSNYAFSKLPANL  192



>ref|XP_007200254.1| hypothetical protein PRUPE_ppa015090mg [Prunus persica]
 ref|XP_007200263.1| hypothetical protein PRUPE_ppa014975mg [Prunus persica]
 gb|EMJ01453.1| hypothetical protein PRUPE_ppa015090mg [Prunus persica]
 gb|EMJ01462.1| hypothetical protein PRUPE_ppa014975mg [Prunus persica]
Length=527

 Score =   245 bits (626),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 128/192 (67%), Positives = 156/192 (81%), Gaps = 6/192 (3%)
 Frame = +3

Query  60   MTDGKLENNGVSGH------IPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGA  221
            M D ++E++ VSG       I  FDPP+KP  NK+A+AC++LA   SILLGYDIGVMSGA
Sbjct  1    MADRRVEDSAVSGQLQNDHRIADFDPPQKPKTNKFAIACAILACTTSILLGYDIGVMSGA  60

Query  222  IIYIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLM  401
             I+I++DLK+SD ++ +L G+L ++SL GSA AGRTSDWIGRRYT+V++ VIFF GALLM
Sbjct  61   NIFIQNDLKLSDTEIAVLAGTLNIYSLIGSALAGRTSDWIGRRYTVVLSGVIFFVGALLM  120

Query  402  GFATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYV  581
            G A  YAFLM GRFVAG+GVGY LM+APVYT E+SP   RGFLTSFPEVF+N GILLGYV
Sbjct  121  GLAPGYAFLMFGRFVAGIGVGYGLMIAPVYTVEISPTLDRGFLTSFPEVFVNLGILLGYV  180

Query  582  SNFAFSKLPTHL  617
            SN+AFSKLPT+L
Sbjct  181  SNYAFSKLPTNL  192



>ref|XP_007199207.1| hypothetical protein PRUPE_ppa021762mg [Prunus persica]
 gb|EMJ00406.1| hypothetical protein PRUPE_ppa021762mg [Prunus persica]
Length=528

 Score =   245 bits (626),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 155/191 (81%), Gaps = 5/191 (3%)
 Frame = +3

Query  60   MTDGKLENNGVSGH-----IPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAI  224
            M D   E+  +SG      I  FDPP+KP RNK+A+ACS+LA + SILLGYDIGVMSGA 
Sbjct  1    MADPIAEDKAISGQPKNTVIADFDPPQKPKRNKFAIACSILACMTSILLGYDIGVMSGAN  60

Query  225  IYIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMG  404
            ++I+DDLKI+DVQ+++L G+L ++SL GS  AGRTSDWIGRRYT+V++  IFF GA+LMG
Sbjct  61   LFIQDDLKINDVQIQILTGTLNIYSLVGSGLAGRTSDWIGRRYTVVLSGAIFFVGAILMG  120

Query  405  FATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVS  584
             A  Y FLM GRFVAG+GVGY LM++PVYTAE++P  SRGFLTSFPEVF+N GILLGYVS
Sbjct  121  VAPGYGFLMFGRFVAGIGVGYGLMISPVYTAEIAPTLSRGFLTSFPEVFVNIGILLGYVS  180

Query  585  NFAFSKLPTHL  617
            N+AFSKLP HL
Sbjct  181  NYAFSKLPAHL  191



>ref|XP_007200033.1| hypothetical protein PRUPE_ppa024323mg [Prunus persica]
 gb|EMJ01232.1| hypothetical protein PRUPE_ppa024323mg [Prunus persica]
Length=534

 Score =   245 bits (626),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 128/192 (67%), Positives = 156/192 (81%), Gaps = 6/192 (3%)
 Frame = +3

Query  60   MTDGKLENNGVSGH------IPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGA  221
            M D ++E++ VSG       I  FDPP+KP  NK+A+AC++LA   SILLGYDIGVMSGA
Sbjct  1    MADRRVEDSAVSGQLQNDHRIADFDPPQKPKTNKFAIACAILACTTSILLGYDIGVMSGA  60

Query  222  IIYIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLM  401
             I+I++DLK+SD ++ +L G+L ++SL GSA AGRTSDWIGRRYT+V++ VIFF GALLM
Sbjct  61   NIFIQNDLKLSDTEIAVLAGTLNIYSLIGSALAGRTSDWIGRRYTVVLSGVIFFVGALLM  120

Query  402  GFATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYV  581
            G A  YAFLM GRFVAG+GVGY LM+APVYT E+SP   RGFLTSFPEVF+N GILLGYV
Sbjct  121  GLAPGYAFLMFGRFVAGIGVGYGLMIAPVYTVEISPTLDRGFLTSFPEVFVNLGILLGYV  180

Query  582  SNFAFSKLPTHL  617
            SN+AFSKLPT+L
Sbjct  181  SNYAFSKLPTNL  192



>ref|XP_003539021.2| PREDICTED: polyol transporter 5-like [Glycine max]
Length=312

 Score =   239 bits (609),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 145/170 (85%), Gaps = 1/170 (1%)
 Frame = +3

Query  111  FDPP-KKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSL  287
            FDPP KKP RN YA AC++LA+  SILLGYDIGVMSGA IYIK DLK+SDVQ+E+L+G  
Sbjct  21   FDPPIKKPKRNTYAFACAMLATTTSILLGYDIGVMSGAAIYIKKDLKVSDVQIEILIGIF  80

Query  288  AVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGY  467
             ++SL GS  AGRTSDWIGRRYT+V A  IFFAGA+LMGF+ +YAFLM GRFVAG+G+GY
Sbjct  81   NLYSLIGSCLAGRTSDWIGRRYTIVFAGAIFFAGAILMGFSPNYAFLMFGRFVAGIGMGY  140

Query  468  ALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
             LM+APVYT+EVSPASSRGFLTSF EVFIN GILLGY+SN+AFSK+   L
Sbjct  141  GLMIAPVYTSEVSPASSRGFLTSFTEVFINVGILLGYISNYAFSKMTLKL  190



>ref|XP_007200117.1| hypothetical protein PRUPE_ppa018884mg [Prunus persica]
 gb|EMJ01316.1| hypothetical protein PRUPE_ppa018884mg [Prunus persica]
Length=527

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 128/192 (67%), Positives = 155/192 (81%), Gaps = 6/192 (3%)
 Frame = +3

Query  60   MTDGKLENNGVSGH------IPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGA  221
            M D ++E + VSG       I  FDPP+KP  NK+A+AC++LA   SILLGYDIGVMSGA
Sbjct  1    MADRRVEESAVSGQLQNDHRIADFDPPQKPKTNKFAIACAILACTTSILLGYDIGVMSGA  60

Query  222  IIYIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLM  401
             I+I++DLK+SD ++ +L G+L ++SL GSA AGRTSDWIGRRYT+V++ VIFF GALLM
Sbjct  61   NIFIQNDLKLSDTEIAVLAGTLNIYSLIGSALAGRTSDWIGRRYTVVLSGVIFFVGALLM  120

Query  402  GFATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYV  581
            G A  YAFLM GRFVAG+GVGY LM+APVYT E+SP   RGFLTSFPEVF+N GILLGYV
Sbjct  121  GLAPGYAFLMFGRFVAGIGVGYGLMIAPVYTVEISPTLDRGFLTSFPEVFVNLGILLGYV  180

Query  582  SNFAFSKLPTHL  617
            SN+AFSKLPT+L
Sbjct  181  SNYAFSKLPTNL  192



>dbj|BAM66295.1| sorbitol transporter, partial [Pyrus pyrifolia]
Length=454

 Score =   243 bits (620),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 132/141 (94%), Gaps = 0/141 (0%)
 Frame = +3

Query  195  YDIGVMSGAIIYIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASV  374
            YDIGVMSGA IYIKDDLKISDV+VE+L+G L ++SL GSAAAGRTSDW+GRRYT+V+A  
Sbjct  1    YDIGVMSGAAIYIKDDLKISDVEVEVLLGILNLYSLIGSAAAGRTSDWVGRRYTIVLAGA  60

Query  375  IFFAGALLMGFATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFI  554
            IFF GALLMGFAT+YAFLM GRFVAG+GVGYALM+APVYTAEVSPASSRGFLTSFPEVFI
Sbjct  61   IFFVGALLMGFATNYAFLMFGRFVAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFI  120

Query  555  NAGILLGYVSNFAFSKLPTHL  617
            N+GILLGYVSN+AFSKLP HL
Sbjct  121  NSGILLGYVSNYAFSKLPKHL  141



>ref|XP_008791366.1| PREDICTED: polyol transporter 5-like [Phoenix dactylifera]
Length=507

 Score =   244 bits (623),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = +3

Query  114  DPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSLAV  293
            + PKKPPRNKYA+AC+ LAS+ SILLGYDI VMSGA ++IK DLKI+D Q+E+L G + +
Sbjct  2    EKPKKPPRNKYALACATLASMTSILLGYDIAVMSGASVFIKKDLKINDTQIEILAGIINI  61

Query  294  FSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGYAL  473
            FSL GS AAGRTSDWIGRRYT++ A+ IFFAGALLMGFAT+YAFLMVGRF+AGVGVGYAL
Sbjct  62   FSLVGSIAAGRTSDWIGRRYTIIFAAAIFFAGALLMGFATNYAFLMVGRFIAGVGVGYAL  121

Query  474  MVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            M+APVYTAEV+P SSRGFLTSFPEVFIN+G+LLGYVSNFAF+KLP HL
Sbjct  122  MIAPVYTAEVAPTSSRGFLTSFPEVFINSGVLLGYVSNFAFAKLPYHL  169



>emb|CDP10064.1| unnamed protein product [Coffea canephora]
Length=521

 Score =   244 bits (622),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 153/172 (89%), Gaps = 0/172 (0%)
 Frame = +3

Query  102  IPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVG  281
            IP F PP +P RNKY++AC+LLAS+ SILLGYD GVMSGA +YIK DL +SDVQ+E+LVG
Sbjct  17   IPDFGPPPRPKRNKYSLACALLASMTSILLGYDTGVMSGATLYIKQDLHVSDVQIEILVG  76

Query  282  SLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGV  461
            ++ ++SL GSA AG+TSD +GRRYT+V+A+V+FF GA LMGFAT+YAFLM GRFVAG+GV
Sbjct  77   TINIYSLVGSAIAGKTSDMVGRRYTIVIAAVVFFVGAFLMGFATNYAFLMFGRFVAGIGV  136

Query  462  GYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            GYALM+APVYTAEV+P+SSRGFLTSFPEVFIN G+LLGYVSN+ F+KLP +L
Sbjct  137  GYALMIAPVYTAEVAPSSSRGFLTSFPEVFINFGVLLGYVSNYFFAKLPVNL  188



>ref|XP_008775333.1| PREDICTED: polyol transporter 5-like [Phoenix dactylifera]
Length=528

 Score =   243 bits (621),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 157/190 (83%), Gaps = 4/190 (2%)
 Frame = +3

Query  60   MTDGKLENNGVSGHIP----AFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAII  227
            M D K     +S   P    A + PKKPPRNKYA+AC+ LAS+ SIL GYD+ VMSGA +
Sbjct  1    MDDQKPRAPAISDPPPNQTLALEKPKKPPRNKYALACATLASMTSILSGYDVAVMSGASV  60

Query  228  YIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGF  407
            +I+ DL+I+D Q+E+L G + +FSL GS AAGRTSDWIGRRYT++ A+ IFFAGALLMG 
Sbjct  61   FIQKDLEINDTQIEILAGIINIFSLVGSVAAGRTSDWIGRRYTIIFAAAIFFAGALLMGL  120

Query  408  ATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSN  587
            AT+YAFLMVGRFVAGVGVGYALM+APVYTAEV+P SSRGFLTSFPEVFIN+G+LLGYVSN
Sbjct  121  ATNYAFLMVGRFVAGVGVGYALMIAPVYTAEVAPTSSRGFLTSFPEVFINSGVLLGYVSN  180

Query  588  FAFSKLPTHL  617
            FAF+KLP HL
Sbjct  181  FAFAKLPDHL  190



>ref|XP_010527594.1| PREDICTED: polyol transporter 5-like isoform X4 [Tarenaya hassleriana]
Length=526

 Score =   243 bits (620),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 146/167 (87%), Gaps = 0/167 (0%)
 Frame = +3

Query  117  PPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSLAVF  296
            PP+KP RNK+A  C++L S+  ILLGYDIGVMSGAIIYIK DLKISD Q+E+LVG L ++
Sbjct  17   PPEKPKRNKFAFVCAILVSMTLILLGYDIGVMSGAIIYIKRDLKISDGQIEILVGILNIY  76

Query  297  SLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGYALM  476
            S+ G+  AGRTSD IGRRYT+V+A  IFFAGA+LMGFAT+YAFLM GRFVAG GVG+A M
Sbjct  77   SVVGACFAGRTSDLIGRRYTIVLAGGIFFAGAILMGFATNYAFLMFGRFVAGFGVGFAGM  136

Query  477  VAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            +APVYTAE+SPASSRGFL SFPEVF+NAGILLGYVSNFAFSKLP HL
Sbjct  137  IAPVYTAEISPASSRGFLNSFPEVFVNAGILLGYVSNFAFSKLPLHL  183



>ref|XP_010527593.1| PREDICTED: polyol transporter 5-like isoform X3 [Tarenaya hassleriana]
Length=528

 Score =   243 bits (619),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 146/167 (87%), Gaps = 0/167 (0%)
 Frame = +3

Query  117  PPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSLAVF  296
            PP+KP RNK+A  C++L S+  ILLGYDIGVMSGAIIYIK DLKISD Q+E+LVG L ++
Sbjct  17   PPEKPKRNKFAFVCAILVSMTLILLGYDIGVMSGAIIYIKRDLKISDGQIEILVGILNIY  76

Query  297  SLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGYALM  476
            S+ G+  AGRTSD IGRRYT+V+A  IFFAGA+LMGFAT+YAFLM GRFVAG GVG+A M
Sbjct  77   SVVGACFAGRTSDLIGRRYTIVLAGGIFFAGAILMGFATNYAFLMFGRFVAGFGVGFAGM  136

Query  477  VAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            +APVYTAE+SPASSRGFL SFPEVF+NAGILLGYVSNFAFSKLP HL
Sbjct  137  IAPVYTAEISPASSRGFLNSFPEVFVNAGILLGYVSNFAFSKLPLHL  183



>ref|XP_010527592.1| PREDICTED: polyol transporter 5-like isoform X2 [Tarenaya hassleriana]
Length=532

 Score =   243 bits (619),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 146/167 (87%), Gaps = 0/167 (0%)
 Frame = +3

Query  117  PPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSLAVF  296
            PP+KP RNK+A  C++L S+  ILLGYDIGVMSGAIIYIK DLKISD Q+E+LVG L ++
Sbjct  17   PPEKPKRNKFAFVCAILVSMTLILLGYDIGVMSGAIIYIKRDLKISDGQIEILVGILNIY  76

Query  297  SLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGYALM  476
            S+ G+  AGRTSD IGRRYT+V+A  IFFAGA+LMGFAT+YAFLM GRFVAG GVG+A M
Sbjct  77   SVVGACFAGRTSDLIGRRYTIVLAGGIFFAGAILMGFATNYAFLMFGRFVAGFGVGFAGM  136

Query  477  VAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            +APVYTAE+SPASSRGFL SFPEVF+NAGILLGYVSNFAFSKLP HL
Sbjct  137  IAPVYTAEISPASSRGFLNSFPEVFVNAGILLGYVSNFAFSKLPLHL  183



>ref|XP_010527591.1| PREDICTED: polyol transporter 5-like isoform X1 [Tarenaya hassleriana]
Length=537

 Score =   242 bits (618),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 146/167 (87%), Gaps = 0/167 (0%)
 Frame = +3

Query  117  PPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSLAVF  296
            PP+KP RNK+A  C++L S+  ILLGYDIGVMSGAIIYIK DLKISD Q+E+LVG L ++
Sbjct  17   PPEKPKRNKFAFVCAILVSMTLILLGYDIGVMSGAIIYIKRDLKISDGQIEILVGILNIY  76

Query  297  SLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGYALM  476
            S+ G+  AGRTSD IGRRYT+V+A  IFFAGA+LMGFAT+YAFLM GRFVAG GVG+A M
Sbjct  77   SVVGACFAGRTSDLIGRRYTIVLAGGIFFAGAILMGFATNYAFLMFGRFVAGFGVGFAGM  136

Query  477  VAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            +APVYTAE+SPASSRGFL SFPEVF+NAGILLGYVSNFAFSKLP HL
Sbjct  137  IAPVYTAEISPASSRGFLNSFPEVFVNAGILLGYVSNFAFSKLPLHL  183



>ref|XP_007200584.1| hypothetical protein PRUPE_ppa007633mg [Prunus persica]
 gb|EMJ01783.1| hypothetical protein PRUPE_ppa007633mg [Prunus persica]
Length=335

 Score =   236 bits (603),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = +3

Query  198  DIGVMSGAIIYIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVI  377
            DIGVMSGA IYIK DLK+SDV++E+L+G L ++SL GSAAAGRTSDWIGRRYT+V+A  I
Sbjct  26   DIGVMSGAAIYIKKDLKVSDVEIEVLIGILNLYSLIGSAAAGRTSDWIGRRYTIVLAGAI  85

Query  378  FFAGALLMGFATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFIN  557
            FFAGALLMGFA +YAFLM GRF+AG+GVGYALM+APVYTAEVSPASSRGFLTSFPEVFIN
Sbjct  86   FFAGALLMGFAPNYAFLMFGRFIAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFIN  145

Query  558  AGILLGYVSNFAFSKLPTHL  617
            AGIL GYVSN+ FSKLPTHL
Sbjct  146  AGILFGYVSNYGFSKLPTHL  165



>emb|CAD58709.1| polyol transporter [Plantago major]
 emb|CAR82415.1| polyol transporter [Plantago major]
Length=529

 Score =   242 bits (617),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 148/167 (89%), Gaps = 1/167 (1%)
 Frame = +3

Query  120  PKKP-PRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSLAVF  296
            PKKP  RNKYA+A S+LAS+ S+LLGYD GVMSGA  +I++DL I+DVQVELLVG++ ++
Sbjct  33   PKKPLKRNKYALAISILASMTSVLLGYDCGVMSGATQFIQEDLIITDVQVELLVGTINIY  92

Query  297  SLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGYALM  476
            SL GSA AGRTSDW+GRRYT+V AS IFF GA+LMGFAT+YAFLMVGRFVAG+GVGYALM
Sbjct  93   SLVGSAVAGRTSDWVGRRYTIVFASTIFFLGAILMGFATNYAFLMVGRFVAGIGVGYALM  152

Query  477  VAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            +APVY AEV+PAS RGFLTSFPEVFIN G+LLGYVSNFAF+KLP  L
Sbjct  153  IAPVYAAEVAPASCRGFLTSFPEVFINFGVLLGYVSNFAFAKLPLTL  199



>gb|ERN17552.1| hypothetical protein AMTR_s00059p00123280 [Amborella trichopoda]
Length=513

 Score =   241 bits (615),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 148/165 (90%), Gaps = 0/165 (0%)
 Frame = +3

Query  123  KKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSLAVFSL  302
            +KP RNKYA+AC+ LAS+ SILLGYDIGVMSGAI++IKDDL I+DV+VE+LVGSL +FSL
Sbjct  14   EKPQRNKYALACATLASMTSILLGYDIGVMSGAILFIKDDLHINDVEVEILVGSLNIFSL  73

Query  303  FGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGYALMVA  482
             GSAAAGRTSD+IGRRYT+V A  IFF GAL+MGFA +YAFLM GR VAG+GVGYALM+A
Sbjct  74   IGSAAAGRTSDYIGRRYTIVFAGGIFFVGALMMGFAPNYAFLMAGRVVAGIGVGYALMIA  133

Query  483  PVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            PVYTAEV+PASSRGFLTSFPEVFIN GILLGYVSN+ F++LP  L
Sbjct  134  PVYTAEVAPASSRGFLTSFPEVFINLGILLGYVSNYVFARLPEDL  178



>ref|XP_004500821.1| PREDICTED: polyol transporter 5-like [Cicer arietinum]
Length=517

 Score =   241 bits (615),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 148/170 (87%), Gaps = 1/170 (1%)
 Frame = +3

Query  111  FDPPKKPPR-NKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSL  287
            FDP KK P  NK+A AC++LAS+ SILLGYDIGVMSGA+IYI+ DLK+SDVQ+E+LVG +
Sbjct  19   FDPQKKKPESNKFAFACAILASMTSILLGYDIGVMSGAVIYIRRDLKLSDVQIEILVGII  78

Query  288  AVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGY  467
             +FSL GS  AGRTSDWIGRRYT+V+A  IFFAGA+LMGF+ ++ FLM  RF+AG+G+GY
Sbjct  79   NLFSLIGSCLAGRTSDWIGRRYTIVLAGAIFFAGAILMGFSPNFPFLMFARFIAGIGIGY  138

Query  468  ALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            ALM+APVYTAEVSPASSRGFLTSFPEVFIN GILLGY+SN+ FSKLP  L
Sbjct  139  ALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYISNYGFSKLPLEL  188



>ref|XP_003603886.1| Mannitol transporter [Medicago truncatula]
 gb|AES74137.1| polyol/monosaccharide transporter 1 [Medicago truncatula]
Length=514

 Score =   241 bits (615),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 147/169 (87%), Gaps = 0/169 (0%)
 Frame = +3

Query  111  FDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSLA  290
            FD  KKP  NK+A AC++LAS+ SILLGYDIGVMSGA+IYIK DLK+S+VQ+E+LVG + 
Sbjct  16   FDSQKKPESNKFAFACAILASMTSILLGYDIGVMSGAVIYIKRDLKLSNVQIEILVGIIN  75

Query  291  VFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGYA  470
            +FSL GS  AGRTSDWIGRRYT+V+A  IFFAGALLMGF+ ++AFLM  RF+AG+G+GYA
Sbjct  76   LFSLIGSCLAGRTSDWIGRRYTIVLAGSIFFAGALLMGFSPNFAFLMFARFIAGIGIGYA  135

Query  471  LMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            LM+APVYTAEVSPASSRGFLTSFPEVFIN GILLGY+SN+ FSKL   L
Sbjct  136  LMIAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYISNYGFSKLSLRL  184



>dbj|BAJ93158.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=520

 Score =   241 bits (615),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 151/180 (84%), Gaps = 1/180 (1%)
 Frame = +3

Query  81   NNGVSGHIPAFDPP-KKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISD  257
            +  V+  IPA + P K+PP NKYA+AC++LAS+ SILLGYD+ VMSGA I++K DL I+D
Sbjct  2    SKDVAADIPAAEAPAKRPPLNKYALACAILASMNSILLGYDVSVMSGAQIFMKRDLNITD  61

Query  258  VQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVG  437
             Q+E+L G + +FSL GS AAGRTSDWIGRRYTMV+ASVIFFAGAL+MG A  YA LM+G
Sbjct  62   TQIEILAGIINIFSLVGSLAAGRTSDWIGRRYTMVLASVIFFAGALIMGLAPSYAVLMLG  121

Query  438  RFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            RFVAGVGVGYALM+APVYTAEV+P S+RG LTSFPEVFIN G+LLGY+SNFAF  LP HL
Sbjct  122  RFVAGVGVGYALMIAPVYTAEVAPTSARGLLTSFPEVFINTGVLLGYISNFAFHGLPVHL  181



>ref|XP_006299557.1| hypothetical protein CARUB_v10015731mg [Capsella rubella]
 gb|EOA32455.1| hypothetical protein CARUB_v10015731mg [Capsella rubella]
Length=511

 Score =   241 bits (614),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 155/180 (86%), Gaps = 3/180 (2%)
 Frame = +3

Query  78   ENNGVSGHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISD  257
            E  GV   +P  +PP+   R++YA AC++LAS+ SI+LGYDIGVMSGA I+IKDDLK+SD
Sbjct  6    EEQGVVVAVP--EPPRGN-RSRYAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSD  62

Query  258  VQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVG  437
            VQ+E+L+G L ++SL GS AAGRTSDW+GRRYT+V+A   FF GALLMGFAT+Y F+MVG
Sbjct  63   VQLEILMGILNIYSLIGSGAAGRTSDWLGRRYTIVLAGAFFFCGALLMGFATNYPFIMVG  122

Query  438  RFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            RFVAG+GVGYA+M+APVYTAEV+PASSRGFL+SFPE+FIN GILLGYVSN+ FSKLP HL
Sbjct  123  RFVAGIGVGYAMMIAPVYTAEVAPASSRGFLSSFPEIFINIGILLGYVSNYFFSKLPEHL  182



>dbj|BAJ86116.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97918.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=520

 Score =   241 bits (615),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 151/180 (84%), Gaps = 1/180 (1%)
 Frame = +3

Query  81   NNGVSGHIPAFDPP-KKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISD  257
            +  V+  IPA + P K+PP NKYA+AC++LAS+ SILLGYD+ VMSGA I++K DL I+D
Sbjct  2    SKDVAADIPAAEAPAKRPPLNKYALACAILASMNSILLGYDVSVMSGAQIFMKRDLNITD  61

Query  258  VQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVG  437
             Q+E+L G + +FSL GS AAGRTSDWIGRRYTMV+ASVIFFAGAL+MG A  YA LM+G
Sbjct  62   TQIEILAGIINIFSLVGSLAAGRTSDWIGRRYTMVLASVIFFAGALIMGLAPSYAVLMLG  121

Query  438  RFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            RFVAGVGVGYALM+APVYTAEV+P S+RG LTSFPEVFIN G+LLGY+SNFAF  LP HL
Sbjct  122  RFVAGVGVGYALMIAPVYTAEVAPTSARGLLTSFPEVFINTGVLLGYISNFAFHGLPVHL  181



>ref|XP_002885281.1| ATPLT5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61540.1| ATPLT5 [Arabidopsis lyrata subsp. lyrata]
Length=538

 Score =   241 bits (616),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 131/174 (75%), Positives = 150/174 (86%), Gaps = 1/174 (1%)
 Frame = +3

Query  99   HIPAFDPPKKPP-RNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELL  275
            H+P    P KPP RNKYA AC++LAS+ SILLGYDIGVMSGA+IYIK DLKISD+++ +L
Sbjct  19   HVPESVLPAKPPKRNKYAFACAILASMTSILLGYDIGVMSGAMIYIKRDLKISDLEIGIL  78

Query  276  VGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGV  455
             GSL ++SL GS AAG+TSD IGRRYT+V+A  IFFAGA+LMG A +YAFLM GRFVAG+
Sbjct  79   AGSLNIYSLIGSCAAGKTSDLIGRRYTIVLAGAIFFAGAILMGLAPNYAFLMFGRFVAGI  138

Query  456  GVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            GVGYALM+APVYTAEVSPASSRGFLTSFPEVFINAGI+LGYVSN AFSK P  L
Sbjct  139  GVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGIMLGYVSNLAFSKFPLKL  192



>ref|NP_188513.1| polyol transporter 5 [Arabidopsis thaliana]
 sp|Q8VZ80.2|PLT5_ARATH RecName: Full=Polyol transporter 5; AltName: Full=Protein POLYOL 
TRANSPORTER 5; Short=AtPLT5; AltName: Full=Sugar-proton 
symporter PLT5 [Arabidopsis thaliana]
 dbj|BAB01812.1| sugar transporter protein [Arabidopsis thaliana]
 gb|AEE76153.1| polyol transporter 5 [Arabidopsis thaliana]
Length=539

 Score =   241 bits (616),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 128/171 (75%), Positives = 148/171 (87%), Gaps = 1/171 (1%)
 Frame = +3

Query  99   HIPAFDPPKKPP-RNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELL  275
            H+P    P KPP RN YA AC++LAS+ SILLGYDIGVMSGA+IYIK DLKI+D+Q+ +L
Sbjct  19   HVPESVLPAKPPKRNNYAFACAILASMTSILLGYDIGVMSGAMIYIKRDLKINDLQIGIL  78

Query  276  VGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGV  455
             GSL ++SL GS AAGRTSDWIGRRYT+V+A  IFFAGA+LMG + +YAFLM GRF+AG+
Sbjct  79   AGSLNIYSLIGSCAAGRTSDWIGRRYTIVLAGAIFFAGAILMGLSPNYAFLMFGRFIAGI  138

Query  456  GVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLP  608
            GVGYALM+APVYTAEVSPASSRGFL SFPEVFINAGI+LGYVSN AFS LP
Sbjct  139  GVGYALMIAPVYTAEVSPASSRGFLNSFPEVFINAGIMLGYVSNLAFSNLP  189



>ref|XP_009121242.1| PREDICTED: putative polyol transporter 1, partial [Brassica rapa]
Length=247

 Score =   233 bits (593),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 150/175 (86%), Gaps = 0/175 (0%)
 Frame = +3

Query  93   SGHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVEL  272
             G + A     +  R+++A AC++LAS+ SI+LGYDIGVMSGA I+IK+DLK+SDVQ+E+
Sbjct  8    KGVVTAEAEAPRGNRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKEDLKLSDVQLEI  67

Query  273  LVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAG  452
            L+G L ++SL GS AAGRTSDWIGRRYT+V+A   FF GALLMGFAT+Y F+MVGRFVAG
Sbjct  68   LMGILNIYSLVGSGAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAG  127

Query  453  VGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            +GVGYA+M+APVYTAEV+PA+SRGFL+SFPE+FIN GILLGYVSN+ FSKLP HL
Sbjct  128  IGVGYAMMIAPVYTAEVAPATSRGFLSSFPEIFINIGILLGYVSNYFFSKLPVHL  182



>ref|NP_179209.1| polyol/monosaccharide transporter 1 [Arabidopsis thaliana]
 sp|Q9XIH7.1|PLT1_ARATH RecName: Full=Putative polyol transporter 1 [Arabidopsis thaliana]
 gb|AAD26954.1| putative sugar transporter [Arabidopsis thaliana]
 gb|AEC06467.1| polyol/monosaccharide transporter 1 [Arabidopsis thaliana]
Length=511

 Score =   241 bits (614),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 127/182 (70%), Positives = 156/182 (86%), Gaps = 1/182 (1%)
 Frame = +3

Query  75   LENNGV-SGHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKI  251
            + ++GV  G + A   P +  R++YA AC++LAS+ SI+LGYDIGVMSGA I+IKDDLK+
Sbjct  1    MNSSGVEQGVVIAESEPPRGNRSRYAFACAILASMTSIILGYDIGVMSGASIFIKDDLKL  60

Query  252  SDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLM  431
            SDVQ+E+L+G L ++SL GS AAGRTSDW+GRRYT+V+A   FF GALLMGFAT+Y F+M
Sbjct  61   SDVQLEILMGILNIYSLVGSGAAGRTSDWLGRRYTIVLAGAFFFCGALLMGFATNYPFIM  120

Query  432  VGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPT  611
            VGRFVAG+GVGYA+M+APVYTAEV+PASSRGFLTSFPE+FIN GILLGYVSN+ FSKLP 
Sbjct  121  VGRFVAGIGVGYAMMIAPVYTAEVAPASSRGFLTSFPEIFINIGILLGYVSNYFFSKLPE  180

Query  612  HL  617
            HL
Sbjct  181  HL  182



>ref|XP_010909852.1| PREDICTED: putative polyol transporter 1 [Elaeis guineensis]
Length=520

 Score =   240 bits (612),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 133/191 (70%), Positives = 158/191 (83%), Gaps = 5/191 (3%)
 Frame = +3

Query  60   MTDGKLENNGVSGHIPAFDPP----KKPPRNK-YAMacsllaslasillGYDIGVMSGAI  224
            M+D K E   V+   P+   P     +  RNK +A AC++LAS+ SILLGYDIGVMSGA 
Sbjct  1    MSDRKPEATKVASQGPSVSLPYAVTPRLRRNKRFAFACAMLASMTSILLGYDIGVMSGAA  60

Query  225  IYIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMG  404
            I+IKDDL +SD Q+E+L+G L ++SL GS AAGRTSDWIGRRYT+V A+VIFF GA++MG
Sbjct  61   IFIKDDLHVSDTQIEILLGILNLYSLVGSLAAGRTSDWIGRRYTIVFAAVIFFIGAIMMG  120

Query  405  FATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVS  584
             A +YAFLMVGRFVAGVGVGYALM+APVYTAEV+PASSRGFLTSFPEVFIN+GILLGYVS
Sbjct  121  LAPNYAFLMVGRFVAGVGVGYALMIAPVYTAEVAPASSRGFLTSFPEVFINSGILLGYVS  180

Query  585  NFAFSKLPTHL  617
            NFAF++LP HL
Sbjct  181  NFAFARLPQHL  191



>emb|CAD58710.1| polyol transporter [Plantago major]
Length=530

 Score =   240 bits (613),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 146/167 (87%), Gaps = 1/167 (1%)
 Frame = +3

Query  120  PKKP-PRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSLAVF  296
            PKKP  RNKYA+A S+LAS+ S+LLGYD GVMSGA +YIKDDLKISDVQVELLVG++ ++
Sbjct  34   PKKPVTRNKYALAISILASMTSVLLGYDTGVMSGATLYIKDDLKISDVQVELLVGTINIY  93

Query  297  SLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGYALM  476
            SL GSA AGRTSDW+GRRYT V ASV+FF GA+LMG AT+Y FLM GRFVAG+GVGYALM
Sbjct  94   SLVGSAVAGRTSDWVGRRYTTVFASVVFFVGAILMGIATNYVFLMAGRFVAGIGVGYALM  153

Query  477  VAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            +APVY AEV+PAS RGFLTSFPEVFIN G+LLG+VSN+AF+K P  L
Sbjct  154  IAPVYAAEVAPASCRGFLTSFPEVFINFGVLLGFVSNYAFAKFPLKL  200



>ref|NP_001049269.1| Os03g0197100 [Oryza sativa Japonica Group]
 gb|ABF94464.1| mannitol transporter, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11183.1| Os03g0197100 [Oryza sativa Japonica Group]
 gb|EAY88905.1| hypothetical protein OsI_10384 [Oryza sativa Indica Group]
 gb|EAZ25930.1| hypothetical protein OsJ_09774 [Oryza sativa Japonica Group]
 dbj|BAG91937.1| unnamed protein product [Oryza sativa Japonica Group]
Length=517

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 147/170 (86%), Gaps = 0/170 (0%)
 Frame = +3

Query  108  AFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSL  287
            A  P K+PP NKYA  C+LLAS+ S+LLGYDI VMSGA I++K+DLKI+D Q+E+L G +
Sbjct  10   AVAPAKRPPINKYAFGCALLASMNSVLLGYDISVMSGAQIFMKEDLKITDTQIEILAGVI  69

Query  288  AVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGY  467
             ++SLFGS AAG TSDW+GRRYTMV+A+ IFF GALLMG A +YAFLM GRFVAG+GVGY
Sbjct  70   NIYSLFGSLAAGMTSDWLGRRYTMVLAAAIFFTGALLMGLAPNYAFLMAGRFVAGIGVGY  129

Query  468  ALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            ALM+APVYTAEV+P S+RGFLTSFPEVF N+GILLGYVSNFAF++LP HL
Sbjct  130  ALMIAPVYTAEVAPTSARGFLTSFPEVFNNSGILLGYVSNFAFARLPVHL  179



>ref|XP_010516958.1| PREDICTED: putative polyol transporter 2 [Camelina sativa]
Length=511

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 150/168 (89%), Gaps = 1/168 (1%)
 Frame = +3

Query  114  DPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSLAV  293
            +PP+   R +YA AC++LAS+ SI+LGYDIGVMSGA I+IKDDLK+SDVQ+E+L+G L +
Sbjct  16   EPPRGN-RTQYAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDVQLEILMGILNI  74

Query  294  FSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGYAL  473
            +SL GS AAGRTSDWIGRRYT+V+A V FF GALLMGFAT+Y F+MVGRFVAG+GVGYA+
Sbjct  75   YSLIGSGAAGRTSDWIGRRYTIVLAGVFFFCGALLMGFATNYPFIMVGRFVAGIGVGYAM  134

Query  474  MVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            M+APVYTAEV+PASSRGFL+SFPE+FIN GILLG+VSN+ FSKLP HL
Sbjct  135  MIAPVYTAEVAPASSRGFLSSFPEIFINIGILLGFVSNYFFSKLPEHL  182



>ref|XP_010468639.1| PREDICTED: putative polyol transporter 2 [Camelina sativa]
Length=511

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 151/174 (87%), Gaps = 0/174 (0%)
 Frame = +3

Query  96   GHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELL  275
            G + A   P +  R++YA AC++LAS+ SI+LGYDIGVMSGA I+IKDDLK+SDVQ+E+L
Sbjct  9    GVVVAEPEPPRGNRSQYAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDVQLEIL  68

Query  276  VGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGV  455
            +G L ++SL GS AAGRTSDWIGRRYT+V+A   FF GALLMGFAT+Y F+MVGRFVAG+
Sbjct  69   MGILNIYSLIGSGAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAGI  128

Query  456  GVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            GVGYA+M+APVYTAEV+PASSRGFL+SFPE+FIN GILLGYVSN+ FSKLP HL
Sbjct  129  GVGYAMMIAPVYTAEVAPASSRGFLSSFPEIFINIGILLGYVSNYFFSKLPEHL  182



>ref|XP_007135989.1| hypothetical protein PHAVU_009G008900g [Phaseolus vulgaris]
 gb|ESW07983.1| hypothetical protein PHAVU_009G008900g [Phaseolus vulgaris]
Length=514

 Score =   239 bits (610),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 146/169 (86%), Gaps = 0/169 (0%)
 Frame = +3

Query  111  FDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSLA  290
            FDP K P RNK+A AC++LAS+ SILLGYD+GVMSGA+IYIK DLK++DVQ+E++VG + 
Sbjct  15   FDPKKAPKRNKFAFACAILASMTSILLGYDVGVMSGAVIYIKRDLKLTDVQIEIVVGIIN  74

Query  291  VFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGYA  470
            ++SL GS  AGRTSDWIGRRYT+V+A  IFF GA+LMGF+ +Y FLM  RFVAGVG+GYA
Sbjct  75   LYSLIGSCLAGRTSDWIGRRYTIVLAGGIFFMGAILMGFSPNYPFLMFARFVAGVGIGYA  134

Query  471  LMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            LM+APVYTAEVSP S RGFLTSFPEVF+N GILLGY+SN+ FSKLP H+
Sbjct  135  LMIAPVYTAEVSPPSCRGFLTSFPEVFVNGGILLGYISNYGFSKLPLHM  183



>ref|XP_007131850.1| hypothetical protein PHAVU_011G046600g [Phaseolus vulgaris]
 gb|ESW03844.1| hypothetical protein PHAVU_011G046600g [Phaseolus vulgaris]
Length=510

 Score =   239 bits (609),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 149/189 (79%), Gaps = 9/189 (5%)
 Frame = +3

Query  51   SVVMTDGKLENNGVSGHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIY  230
             VV TD  LE+         FDPPKK   NKYA  C++LAS   ILLGYDIGVM+GA IY
Sbjct  5    KVVETDKTLED---------FDPPKKHKTNKYAFGCAILASTTCILLGYDIGVMTGAAIY  55

Query  231  IKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFA  410
            IK DLK+SDVQ+E+L+G + ++SL GS  AGRTSDW+GRRYT+V A  IFFAGALLMGF+
Sbjct  56   IKRDLKVSDVQIEILLGIINLYSLIGSCVAGRTSDWLGRRYTIVFAGTIFFAGALLMGFS  115

Query  411  TDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNF  590
             +Y+FLM GRFVAG+G+GYALM+ PVY+AEVSPAS RGFLTSF EVFIN GILLGY+SN+
Sbjct  116  PNYSFLMFGRFVAGIGIGYALMIGPVYSAEVSPASYRGFLTSFTEVFINGGILLGYISNY  175

Query  591  AFSKLPTHL  617
            AFSK+   L
Sbjct  176  AFSKMTLKL  184



>ref|XP_011078884.1| PREDICTED: polyol transporter 5-like isoform X2 [Sesamum indicum]
Length=524

 Score =   239 bits (610),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 146/166 (88%), Gaps = 2/166 (1%)
 Frame = +3

Query  120  PKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSLAVFS  299
            P K  RNKYA+A S+LAS+ S+LLGY  GVMSGA IYIK DLKISDVQ+E+LVG++ ++S
Sbjct  31   PTKHKRNKYALAISVLASMTSVLLGY--GVMSGATIYIKRDLKISDVQIEILVGTINIYS  88

Query  300  LFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGYALMV  479
            L GSA AGRTSDWIGRRYT+V AS IFFAGA+LMGFA +YAFLMVGRFVAG+GVGYALM+
Sbjct  89   LLGSAVAGRTSDWIGRRYTIVFASAIFFAGAILMGFAANYAFLMVGRFVAGIGVGYALMI  148

Query  480  APVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            APVY AEV+PAS RGFLTSFPEVFIN G+LLGYVSN+AF+KLP  L
Sbjct  149  APVYAAEVAPASCRGFLTSFPEVFINFGVLLGYVSNYAFAKLPLKL  194



>ref|XP_008447049.1| PREDICTED: polyol transporter 5 [Cucumis melo]
Length=516

 Score =   239 bits (609),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 146/161 (91%), Gaps = 0/161 (0%)
 Frame = +3

Query  135  RNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSLAVFSLFGSA  314
            RNKYA  C++LAS+ASILLGYD+GVMSGA IYIK D +I+DVQ E+++G + +++L G+A
Sbjct  19   RNKYAFMCAILASMASILLGYDVGVMSGAAIYIKKDFEITDVQEEVMIGVINLYALIGAA  78

Query  315  AAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGYALMVAPVYT  494
            AAGRTSDWIGRRYTMV+A VIFF GA+LMGFAT+Y FLM GRFVAG+GVGYALM++PVYT
Sbjct  79   AAGRTSDWIGRRYTMVLAGVIFFLGAVLMGFATNYGFLMFGRFVAGIGVGYALMISPVYT  138

Query  495  AEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            AEVSPASSRGFLTSFPEVFIN G++LGY+SNFAFSKLP HL
Sbjct  139  AEVSPASSRGFLTSFPEVFINFGVMLGYISNFAFSKLPLHL  179



>gb|KCW55335.1| hypothetical protein EUGRSUZ_I01255 [Eucalyptus grandis]
Length=467

 Score =   237 bits (605),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 146/167 (87%), Gaps = 0/167 (0%)
 Frame = +3

Query  117  PPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSLAVF  296
            P K+PPRNKYA AC++LAS+ SILLGYDIGVMSGA I IK  L ++DV+VE+LVG + ++
Sbjct  28   PKKRPPRNKYAFACAILASMTSILLGYDIGVMSGAAIPIKKQLHLNDVEVEVLVGIINLY  87

Query  297  SLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGYALM  476
            SL GSA AGRTSDW+GRRYTMV+A  IFF GA+LM FA +YAFLM GRFVAG+GVGYALM
Sbjct  88   SLLGSAVAGRTSDWVGRRYTMVIAGAIFFVGAILMAFAFNYAFLMFGRFVAGIGVGYALM  147

Query  477  VAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            +APVYTAEVSPAS+RGFLTSFPEVFIN G+LLGYVSN+ F+KLP +L
Sbjct  148  IAPVYTAEVSPASARGFLTSFPEVFINFGVLLGYVSNYVFNKLPINL  194



>ref|XP_010484928.1| PREDICTED: putative polyol transporter 1 [Camelina sativa]
Length=512

 Score =   238 bits (608),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 155/180 (86%), Gaps = 3/180 (2%)
 Frame = +3

Query  78   ENNGVSGHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISD  257
            E  GV+  +   +PP+   R+++A AC++LAS+ SI+LGYDIGVMSGA I+IKDDLK+SD
Sbjct  6    EERGVA--VTELEPPRGN-RSRFAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSD  62

Query  258  VQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVG  437
            +Q+E+L+G L ++SL GS AAGRTSDWIGRRYT+V+A   FF GALLMGFAT+Y F+MVG
Sbjct  63   IQLEILMGILNIYSLIGSGAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVG  122

Query  438  RFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            RFVAG+GVGYA+M+APVYTAEV+PASSRGFL+SFPE+FIN GILLGY+SN+ FSKLP HL
Sbjct  123  RFVAGIGVGYAMMIAPVYTAEVAPASSRGFLSSFPEIFINIGILLGYLSNYFFSKLPEHL  182



>ref|XP_002886203.1| hypothetical protein ARALYDRAFT_343514 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62462.1| hypothetical protein ARALYDRAFT_343514 [Arabidopsis lyrata subsp. 
lyrata]
Length=511

 Score =   238 bits (608),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 151/175 (86%), Gaps = 0/175 (0%)
 Frame = +3

Query  93   SGHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVEL  272
             G + A   P +  R++YA AC++LAS+ SI+LGYDIGVMSGA I+IKDDLK+SDVQ+E+
Sbjct  8    QGVVIADSEPPRGNRSRYAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDVQLEI  67

Query  273  LVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAG  452
            L+G L ++SL GS AAGRTSDWIGRR+T+V+A   FF GALLMGFAT+Y F+MVGRFVAG
Sbjct  68   LMGILNIYSLIGSGAAGRTSDWIGRRFTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAG  127

Query  453  VGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            +GVGYA+M+APVYTAEV+PASSRGFL+SFPE+FIN GILLGYVSN+ FSKLP HL
Sbjct  128  IGVGYAMMIAPVYTAEVAPASSRGFLSSFPEIFINIGILLGYVSNYFFSKLPEHL  182



>ref|NP_001147446.1| sorbitol transporter [Zea mays]
 gb|ACF84429.1| unknown [Zea mays]
 gb|ACG27557.1| sorbitol transporter [Zea mays]
 tpg|DAA43973.1| TPA: Sorbitol transporter [Zea mays]
Length=525

 Score =   238 bits (608),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 153/187 (82%), Gaps = 1/187 (1%)
 Frame = +3

Query  60   MTDGKLENNGVSGHIPAFDPP-KKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIK  236
            M++ K  +    G IPA + P K+PP NKYA+AC++LAS+ SILLGYD+ VMSGA +++K
Sbjct  1    MSNSKQHDAADDGGIPAPEAPAKRPPLNKYALACAVLASMNSILLGYDVSVMSGAQLFMK  60

Query  237  DDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATD  416
             DLKI+D Q+E+L G + ++SL GS AAGRTSDW+GRRYTMV+A+ IFFAGAL+MG A  
Sbjct  61   QDLKITDTQIEILAGIINIYSLVGSLAAGRTSDWLGRRYTMVLAAAIFFAGALIMGLAPS  120

Query  417  YAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAF  596
            Y  LM+GRFVAGVGVGYALM+APVYTAEVSP S+RG LTSFPEVFIN G+LLGYVSN+AF
Sbjct  121  YTILMLGRFVAGVGVGYALMIAPVYTAEVSPTSARGLLTSFPEVFINTGVLLGYVSNYAF  180

Query  597  SKLPTHL  617
              LP HL
Sbjct  181  HGLPVHL  187



>ref|NP_001236592.1| sorbitol-like transporter [Glycine max]
 emb|CAD91337.1| sorbitol-like transporter [Glycine max]
Length=523

 Score =   238 bits (608),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 127/183 (69%), Positives = 148/183 (81%), Gaps = 1/183 (1%)
 Frame = +3

Query  60   MTDGKL-ENNGVSGHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIK  236
            MT+GKL E       +  FDPPKK  RNKYA AC++LAS+ SILLGYDIGVMSGA IYIK
Sbjct  1    MTEGKLVEAAEAHKTLQDFDPPKKRKRNKYAFACAMLASMTSILLGYDIGVMSGAAIYIK  60

Query  237  DDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATD  416
             DLK+SD Q+E+L+G + ++SL GS  AGRTSDWIGRRYT+ +   IF  G+ LMGF   
Sbjct  61   RDLKVSDEQIEILLGIINLYSLIGSCLAGRTSDWIGRRYTIGLGGAIFLVGSTLMGFYPH  120

Query  417  YAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAF  596
            Y+FLM GRFVAG+G+GYALM+APVYTAEVSPASSRGFLTSFPEVFIN GILLGY+SN+ F
Sbjct  121  YSFLMCGRFVAGIGIGYALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYISNYGF  180

Query  597  SKL  605
            SKL
Sbjct  181  SKL  183



>ref|XP_010507195.1| PREDICTED: polyol transporter 5 [Camelina sativa]
Length=534

 Score =   238 bits (608),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 145/167 (87%), Gaps = 0/167 (0%)
 Frame = +3

Query  117  PPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSLAVF  296
            P K P +N+YA AC++LAS+ SILLGYDIGVMSGA+IYIK DLKI+D Q+ +L GSL ++
Sbjct  27   PAKPPKKNRYAFACAILASMTSILLGYDIGVMSGAMIYIKRDLKITDTQIGILAGSLNIY  86

Query  297  SLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGYALM  476
            SL GS AAG+TSDWIGRRYT+V+A  IFFAGA+LMG A +YAFLM GRF+AG+GVGYALM
Sbjct  87   SLIGSCAAGKTSDWIGRRYTIVLAGAIFFAGAILMGLAPNYAFLMFGRFIAGIGVGYALM  146

Query  477  VAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            +APVYTAEV+PASSRGFL SFPEVFINAGI+LGYVSN AFSK P  L
Sbjct  147  IAPVYTAEVAPASSRGFLNSFPEVFINAGIMLGYVSNLAFSKFPLKL  193



>gb|EMS50618.1| Polyol transporter 5 [Triticum urartu]
Length=311

 Score =   232 bits (591),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 147/173 (85%), Gaps = 1/173 (1%)
 Frame = +3

Query  102  IPAFDPP-KKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLV  278
            IPA + P K+ P NKYA+AC++LAS+ SILLGYD+ VMSGA I++K DL I+D Q+E+L 
Sbjct  9    IPAGEAPAKRAPLNKYALACAILASMNSILLGYDVSVMSGAQIFMKRDLHITDTQIEVLA  68

Query  279  GSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVG  458
            G + +FSL GS AAGRTSDWIGRRYTMV+ASVIFFAGAL+MG A  YA LM+GRFVAGVG
Sbjct  69   GIINIFSLVGSLAAGRTSDWIGRRYTMVLASVIFFAGALIMGLAPGYAVLMLGRFVAGVG  128

Query  459  VGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            VGYALM+APVYTAEV+P S+RG LTSFPEVFIN G+LLGY+SN+AF  LP HL
Sbjct  129  VGYALMIAPVYTAEVAPTSARGLLTSFPEVFINTGVLLGYISNYAFHGLPVHL  181



>ref|XP_010435020.1| PREDICTED: putative polyol transporter 2 [Camelina sativa]
Length=511

 Score =   238 bits (606),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 154/180 (86%), Gaps = 3/180 (2%)
 Frame = +3

Query  78   ENNGVSGHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISD  257
            E  GV   +   +PP+   R+++A AC++LAS+ SI+LGYDIGVMSGA I+IKDDLK+SD
Sbjct  6    EERGVV--VVELEPPRGN-RSRFAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSD  62

Query  258  VQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVG  437
            +Q+E+L+G L ++SL GS AAGRTSDWIGRRYT+V+A   FF GALLMGFAT+Y F+MVG
Sbjct  63   IQLEILMGILNIYSLIGSGAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVG  122

Query  438  RFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            RFVAG+GVGYA+M+APVYTAEV+PASSRGFL+SFPE+FIN GILLGYVSN+ FSKLP HL
Sbjct  123  RFVAGIGVGYAMMIAPVYTAEVAPASSRGFLSSFPEIFINIGILLGYVSNYFFSKLPDHL  182



>ref|XP_007201628.1| hypothetical protein PRUPE_ppa021469mg [Prunus persica]
 gb|EMJ02827.1| hypothetical protein PRUPE_ppa021469mg [Prunus persica]
Length=490

 Score =   237 bits (604),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = +3

Query  111  FDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSLA  290
            FDPP+KP RNK+A+ACSL+A   SILLGYDIGVMSGA ++I+DDLKI+DVQ+++L G+L 
Sbjct  9    FDPPQKPKRNKFAIACSLMACTTSILLGYDIGVMSGANLFIQDDLKINDVQIQILTGTLN  68

Query  291  VFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGYA  470
            ++S+ GSA AGRTSDWIGRRYT  ++  IF  GA+LMG A  Y FLM GRFVAG+GVGY 
Sbjct  69   IYSVLGSALAGRTSDWIGRRYTAFLSGAIFSVGAILMGVAQGYTFLMFGRFVAGIGVGYG  128

Query  471  LMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            LM++PVYTAE++P  SRGFLTSFPEVF+N GILLGYVSN+AFSKLP HL
Sbjct  129  LMISPVYTAEIAPTLSRGFLTSFPEVFVNIGILLGYVSNYAFSKLPAHL  177



>emb|CDP17996.1| unnamed protein product [Coffea canephora]
Length=525

 Score =   238 bits (606),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 149/179 (83%), Gaps = 0/179 (0%)
 Frame = +3

Query  81   NNGVSGHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDV  260
              GV    P F PP K  +NKYA+AC+LLA ++S+LLGYD GVMSG +IYI+ DLKISDV
Sbjct  10   TRGVESSNPDFGPPPKATKNKYALACALLACMSSVLLGYDTGVMSGGMIYIQRDLKISDV  69

Query  261  QVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGR  440
            Q E+LVG++ V+SL GSA AGRT DW+GRRYT+ +A VIFF GA LM FAT+YAFLMVGR
Sbjct  70   QKEVLVGTINVYSLLGSAIAGRTCDWVGRRYTIAMAGVIFFVGAFLMAFATNYAFLMVGR  129

Query  441  FVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            FVAG+GVGYA+M+APVY+AE+SP S RGF+TSF EVFIN G+LLGYVSN+ F+KLPT+L
Sbjct  130  FVAGIGVGYAMMIAPVYSAEISPRSIRGFITSFTEVFINFGVLLGYVSNYFFAKLPTNL  188



>ref|XP_002884156.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60415.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=511

 Score =   237 bits (605),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 151/174 (87%), Gaps = 0/174 (0%)
 Frame = +3

Query  96   GHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELL  275
            G + A   P +  R+++A AC++LAS+ SI+LGYDIGVMSGA I+IKDDLK+SDVQ+E+L
Sbjct  9    GVVVADSEPPRGNRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDVQLEIL  68

Query  276  VGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGV  455
            +G L ++SL GS AAGRTSDWIGRRYT+V+A   FF GALLMGFAT+Y F+MVGRFVAG+
Sbjct  69   MGILNIYSLIGSGAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAGI  128

Query  456  GVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            GVGYA+M+APVYTAEV+PASSRGFL+SFPE+FIN GILLGYVSN+ F+KLP HL
Sbjct  129  GVGYAMMIAPVYTAEVAPASSRGFLSSFPEIFINIGILLGYVSNYFFAKLPEHL  182



>ref|XP_010254894.1| PREDICTED: polyol transporter 5-like [Nelumbo nucifera]
Length=504

 Score =   237 bits (605),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 148/184 (80%), Gaps = 1/184 (1%)
 Frame = +3

Query  66   DGKLENNGVSGHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDL  245
            D K+E + V   I   + P K  R K+A+ C+ LAS+ SILLGYD GVMSGAII+IKDDL
Sbjct  5    DQKIETSAVH-EILEIESPNKYRRKKFALTCATLASMISILLGYDTGVMSGAIIFIKDDL  63

Query  246  KISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAF  425
            KI+D Q+E+LVG + + SL GS AAGRTSDWIGRRYT+V A+VIFF GALLMG A +YA 
Sbjct  64   KINDTQIEVLVGIINLCSLVGSVAAGRTSDWIGRRYTIVFAAVIFFVGALLMGLAPNYAV  123

Query  426  LMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKL  605
            LM GR VAG GVGYALM+APVYTAE++PA SRG LTSF E+FINAG+LLGYVSNFAFSKL
Sbjct  124  LMAGRIVAGFGVGYALMIAPVYTAELAPALSRGLLTSFTEIFINAGVLLGYVSNFAFSKL  183

Query  606  PTHL  617
            P HL
Sbjct  184  PEHL  187



>gb|KFK41272.1| hypothetical protein AALP_AA2G108500 [Arabis alpina]
Length=444

 Score =   235 bits (600),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 155/182 (85%), Gaps = 1/182 (1%)
 Frame = +3

Query  75   LENNGV-SGHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKI  251
            + ++GV  G   A   P +  R+++A AC++LAS+ SI+LGYDIGVMSGA I+IKDDLK+
Sbjct  1    MSSSGVEQGVAVAESEPPRGNRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKL  60

Query  252  SDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLM  431
            SDVQ+E+L+G L ++SL GS AAGRTSDWIGRRYT+V+A   FF GALLMGFAT+Y F+M
Sbjct  61   SDVQLEILMGILNIYSLVGSGAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIM  120

Query  432  VGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPT  611
            VGRFVAG+GVGYA+M+APVYTAEV+PASSRGFL+SFPE+FIN GILLGYVSN+ F+KLP 
Sbjct  121  VGRFVAGIGVGYAMMIAPVYTAEVAPASSRGFLSSFPEIFINIGILLGYVSNYFFAKLPE  180

Query  612  HL  617
            H+
Sbjct  181  HI  182



>ref|XP_010442571.1| PREDICTED: putative polyol transporter 2 [Camelina sativa]
Length=518

 Score =   237 bits (605),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 151/174 (87%), Gaps = 0/174 (0%)
 Frame = +3

Query  96   GHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELL  275
            G + A   P +  R+++A AC++LAS+ SI+LGYDIGVMSGA I+IKDDLK+SDVQ+E+L
Sbjct  9    GVVVAEPEPPRGNRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDVQLEIL  68

Query  276  VGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGV  455
            +G L ++S+ GS AAGRTSDWIGRRYT+V+A   FF GALLMGFAT+Y F+MVGRFVAG+
Sbjct  69   MGILNIYSIIGSGAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAGI  128

Query  456  GVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            GVGYA+M+APVYTAEV+PASSRGFL+SFPE+FIN GILLGYVSN+ FSKLP HL
Sbjct  129  GVGYAMMIAPVYTAEVAPASSRGFLSSFPEIFINIGILLGYVSNYFFSKLPEHL  182



>ref|XP_003558585.1| PREDICTED: putative polyol transporter 1 [Brachypodium distachyon]
Length=526

 Score =   237 bits (605),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 147/170 (86%), Gaps = 0/170 (0%)
 Frame = +3

Query  108  AFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSL  287
            A  P K+PP NKYA AC+LLAS+ S+LLGYDI VMSGA +++K+DLKI+D Q+E+L G +
Sbjct  16   AVAPAKRPPINKYAFACALLASMNSVLLGYDISVMSGAQLFMKEDLKITDTQIEILAGVI  75

Query  288  AVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGY  467
             ++SLFGS AAG TSDW+GRRYTMV+A+ IFF GALLMG A +YAFLM GRFVAG+GVGY
Sbjct  76   NIYSLFGSLAAGLTSDWLGRRYTMVLAAAIFFTGALLMGLAPNYAFLMAGRFVAGIGVGY  135

Query  468  ALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            ALM+APVYTAEV+P S+RGFLTSFPEVF N GILLGYVSNFAF++LP HL
Sbjct  136  ALMIAPVYTAEVAPTSARGFLTSFPEVFNNFGILLGYVSNFAFARLPVHL  185



>gb|KFK40045.1| hypothetical protein AALP_AA3G322700 [Arabis alpina]
Length=487

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 124/186 (67%), Positives = 155/186 (83%), Gaps = 4/186 (2%)
 Frame = +3

Query  60   MTDGKLENNGVSGHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKD  239
            M+  ++E     G   A   P +  R+++A AC++LAS+ SI+LGYDIGVMSGA I+IKD
Sbjct  1    MSSSRVEQ----GLAVAESEPPRGNRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKD  56

Query  240  DLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDY  419
            DLK+SDVQ+E+L+G L ++SL GS AAGRTSDWIGRRYT+V+A   FF GALLMGFAT+Y
Sbjct  57   DLKLSDVQLEILMGILNIYSLVGSGAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNY  116

Query  420  AFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFS  599
             F+MVGRF+AG+GVGYA+M+APVYTAEV+PASSRGFL+SFPE+FIN GILLGYVSN+ F+
Sbjct  117  PFIMVGRFIAGIGVGYAMMIAPVYTAEVAPASSRGFLSSFPEIFINIGILLGYVSNYFFA  176

Query  600  KLPTHL  617
            KLP HL
Sbjct  177  KLPEHL  182



>ref|XP_010254895.1| PREDICTED: polyol transporter 5-like [Nelumbo nucifera]
Length=531

 Score =   237 bits (605),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 125/185 (68%), Positives = 149/185 (81%), Gaps = 5/185 (3%)
 Frame = +3

Query  63   TDGKLENNGVSGHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDD  242
            T+ K+E N     I     P K    ++AMAC+ +AS+ SILLGYDIGVMSGA+I+IKD+
Sbjct  4    TEQKMEKN-----IALTGTPAKRQNKRFAMACATIASMVSILLGYDIGVMSGAVIFIKDN  58

Query  243  LKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYA  422
            L I+D QVE+LVG   ++SL GS AAGRTSDWIGRR T++ A+VIFF GAL+MG A +YA
Sbjct  59   LHITDTQVEILVGVFHLYSLIGSTAAGRTSDWIGRRCTIIFAAVIFFVGALMMGLAPNYA  118

Query  423  FLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSK  602
            FLMVGRFVAG+GVGYALM+APVYTAEV+P S RGFLTSFPEVFIN GILLGYVSN+AF+ 
Sbjct  119  FLMVGRFVAGIGVGYALMIAPVYTAEVAPTSCRGFLTSFPEVFINGGILLGYVSNYAFAG  178

Query  603  LPTHL  617
            LP HL
Sbjct  179  LPNHL  183



>ref|XP_006649563.1| PREDICTED: polyol transporter 5-like [Oryza brachyantha]
Length=521

 Score =   237 bits (604),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = +3

Query  123  KKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSLAVFSL  302
            K+PP NKYA  C+LLAS+ S+LLGYDI VMSGA I++K+DLKI+D Q+E+L G + ++SL
Sbjct  16   KRPPINKYAFGCALLASMNSVLLGYDISVMSGAQIFMKEDLKITDTQIEILAGVINIYSL  75

Query  303  FGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGYALMVA  482
            FGS AAG TSDW+GRRYTMV+A+ IFF GALLMG A +YAFLM GRFVAG+GVGYALM+A
Sbjct  76   FGSLAAGLTSDWLGRRYTMVLAAAIFFTGALLMGLAPNYAFLMAGRFVAGIGVGYALMIA  135

Query  483  PVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            PVYTAEV+P S+RGFLTSFPEVF N+GILLGYVSNFAF++LP HL
Sbjct  136  PVYTAEVAPTSARGFLTSFPEVFNNSGILLGYVSNFAFARLPVHL  180



>ref|XP_010028575.1| PREDICTED: polyol transporter 5-like [Eucalyptus grandis]
Length=544

 Score =   237 bits (605),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 146/167 (87%), Gaps = 0/167 (0%)
 Frame = +3

Query  117  PPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSLAVF  296
            P K+PPRNKYA AC++LAS+ SILLGYDIGVMSGA I IK  L ++DV+VE+LVG + ++
Sbjct  28   PKKRPPRNKYAFACAILASMTSILLGYDIGVMSGAAIPIKKQLHLNDVEVEVLVGIINLY  87

Query  297  SLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGYALM  476
            SL GSA AGRTSDW+GRRYTMV+A  IFF GA+LM FA +YAFLM GRFVAG+GVGYALM
Sbjct  88   SLLGSAVAGRTSDWVGRRYTMVIAGAIFFVGAILMAFAFNYAFLMFGRFVAGIGVGYALM  147

Query  477  VAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            +APVYTAEVSPAS+RGFLTSFPEVFIN G+LLGYVSN+ F+KLP +L
Sbjct  148  IAPVYTAEVSPASARGFLTSFPEVFINFGVLLGYVSNYVFNKLPINL  194



>ref|XP_010472942.1| PREDICTED: putative polyol transporter 2 [Camelina sativa]
Length=511

 Score =   236 bits (603),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 151/174 (87%), Gaps = 0/174 (0%)
 Frame = +3

Query  96   GHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELL  275
            G + A   P +  R+++A AC++LAS+ SI+LGYDIGVMSGA I+IKDDLK+SD+Q+E+L
Sbjct  9    GVVVAEPEPPRGNRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDIQLEIL  68

Query  276  VGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGV  455
            +G L ++SL GS AAGRTSDWIGRRYT+V+A   FF GALLMGFAT+Y F+MVGRF+AG+
Sbjct  69   MGILNIYSLIGSGAAGRTSDWIGRRYTIVLAGSFFFCGALLMGFATNYPFIMVGRFIAGI  128

Query  456  GVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            GVGYA+M+APVYTAEV+PASSRGFL+SFPE+FIN GILLGYVSN+ FSKLP HL
Sbjct  129  GVGYAMMIAPVYTAEVAPASSRGFLSSFPEIFINIGILLGYVSNYFFSKLPEHL  182



>ref|XP_006577924.1| PREDICTED: polyol transporter 5-like [Glycine max]
Length=509

 Score =   236 bits (603),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 125/186 (67%), Positives = 148/186 (80%), Gaps = 3/186 (2%)
 Frame = +3

Query  60   MTDGKLENNGVSGHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKD  239
            M +GK         +  FDP K P RNKYA AC++LAS+ SILLGYD+GVMSGAIIYIK 
Sbjct  1    MAEGK---TATQKSLQDFDPQKTPRRNKYAFACAILASMTSILLGYDVGVMSGAIIYIKR  57

Query  240  DLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDY  419
            DLK++DVQ+E+LVG + ++SL GS  AGRTSDWIGRRYT+V+A  IFFAGA+LMG + +Y
Sbjct  58   DLKLTDVQIEILVGIINLYSLIGSCLAGRTSDWIGRRYTIVLAGSIFFAGAILMGISPNY  117

Query  420  AFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFS  599
             FLM  RF+AGVG+GYALM+APVYT EVSP S RGFLTSFPEVFIN GILLGY+SN+ FS
Sbjct  118  PFLMFARFIAGVGIGYALMIAPVYTTEVSPPSCRGFLTSFPEVFINGGILLGYISNYGFS  177

Query  600  KLPTHL  617
            KL   L
Sbjct  178  KLSLEL  183



>ref|XP_010495901.1| PREDICTED: putative polyol transporter 1 [Camelina sativa]
Length=511

 Score =   236 bits (603),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 151/174 (87%), Gaps = 0/174 (0%)
 Frame = +3

Query  96   GHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELL  275
            G + A   P +  R+++A AC++LAS+ SI+LGYDIGVMSGA I+IKDDLK+SD+Q+E+L
Sbjct  9    GVVVAEPEPPRGNRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDIQLEIL  68

Query  276  VGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGV  455
            +G L ++SL GS AAGRTSDW+GRRYT+V+A   FF GALLMGFAT+Y F+MVGRFVAG+
Sbjct  69   MGILNIYSLIGSGAAGRTSDWMGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAGI  128

Query  456  GVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            GVGYA+M+APVYTAEV+PASSRGFL+SFPE+FIN GILLGYVSN+ FSKLP HL
Sbjct  129  GVGYAMMIAPVYTAEVAPASSRGFLSSFPEIFINIGILLGYVSNYFFSKLPEHL  182



>ref|XP_010472919.1| PREDICTED: putative polyol transporter 2 [Camelina sativa]
Length=511

 Score =   236 bits (603),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 151/174 (87%), Gaps = 0/174 (0%)
 Frame = +3

Query  96   GHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELL  275
            G + A   P +  R+++A AC++LAS+ SI+LGYDIGVMSGA I+IKDDLK+SD+Q+E+L
Sbjct  9    GVVVAEPEPPRGNRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDIQLEIL  68

Query  276  VGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGV  455
            +G L ++SL GS AAGRTSDWIGRRYT+V+A   FF GALLMGFAT+Y F+MVGRF+AG+
Sbjct  69   MGILNIYSLIGSGAAGRTSDWIGRRYTIVLAGSFFFCGALLMGFATNYPFIMVGRFIAGI  128

Query  456  GVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            GVGYA+M+APVYTAEV+PASSRGFL+SFPE+FIN GILLGYVSN+ FSKLP HL
Sbjct  129  GVGYAMMIAPVYTAEVAPASSRGFLSSFPEIFINIGILLGYVSNYFFSKLPEHL  182



>ref|XP_010465998.1| PREDICTED: polyol transporter 5-like [Camelina sativa]
Length=534

 Score =   237 bits (604),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 149/175 (85%), Gaps = 2/175 (1%)
 Frame = +3

Query  99   HIPA-FDPPKKPPR-NKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVEL  272
            H+P+    P KPP+ N+YA AC++LAS+ SILLGYDIGVMSGA+IYIK DL I+D Q+ +
Sbjct  19   HVPSELGVPAKPPKKNRYAFACAILASMTSILLGYDIGVMSGAMIYIKRDLDITDTQIGI  78

Query  273  LVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAG  452
            L GSL ++SL GS AAG+TSDWIGRRYT+V+A  IFFAGA+LMG A +YAFLM GRF+AG
Sbjct  79   LAGSLNIYSLIGSCAAGKTSDWIGRRYTIVLAGAIFFAGAILMGLAPNYAFLMFGRFIAG  138

Query  453  VGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            +GVGYALM+APVYTAEV+PASSRGFL SFPEVFINAGI+LGYVSN AFSK P  L
Sbjct  139  IGVGYALMIAPVYTAEVAPASSRGFLNSFPEVFINAGIMLGYVSNLAFSKFPLKL  193



>ref|XP_009342010.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=529

 Score =   236 bits (603),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 159/190 (84%), Gaps = 4/190 (2%)
 Frame = +3

Query  60   MTDGKLENNGVSGH----IPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAII  227
            M D + ENN V G     I  FDPPKKP   K+A+AC++LAS+ SILLGYDIGVMSGA +
Sbjct  3    MADQRAENNVVFGQHQNSIADFDPPKKPKTKKFAIACAVLASMTSILLGYDIGVMSGASL  62

Query  228  YIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGF  407
            +IK++L ISDVQVE+L G+L ++SL GSA AG+TSDWIGRRYT+V+A  IFF GALLMGF
Sbjct  63   FIKENLNISDVQVEVLNGTLNIYSLIGSALAGKTSDWIGRRYTIVLAGTIFFIGALLMGF  122

Query  408  ATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSN  587
            A +YAFLM GRF+AGVGVGYALM+APVYTAE+SPAS RGFLTSFPEVF+N GILLGYVSN
Sbjct  123  APNYAFLMFGRFIAGVGVGYALMIAPVYTAEISPASFRGFLTSFPEVFVNVGILLGYVSN  182

Query  588  FAFSKLPTHL  617
            FA +KLP HL
Sbjct  183  FALAKLPIHL  192



>ref|XP_006409469.1| hypothetical protein EUTSA_v10023129mg [Eutrema salsugineum]
 gb|ESQ50922.1| hypothetical protein EUTSA_v10023129mg [Eutrema salsugineum]
Length=511

 Score =   236 bits (601),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 154/182 (85%), Gaps = 1/182 (1%)
 Frame = +3

Query  75   LENNGV-SGHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKI  251
            + ++GV  G + +   P +  R+++A AC++LAS+ SI+LGYDIGVMSGA I+IKDDLK+
Sbjct  1    MNSSGVEQGVVVSESEPPRGNRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKL  60

Query  252  SDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLM  431
            SDVQ E+L+G L ++SL GS  AGRTSDWIGRRYT+V+A   FF GALLMGFAT+Y F+M
Sbjct  61   SDVQFEILMGILNIYSLIGSGMAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIM  120

Query  432  VGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPT  611
            VGRFVAG+GVGYA+M+APVYTAEV+PASSRGFL+SFPE+FIN GILLGYVSN+ FSKLP 
Sbjct  121  VGRFVAGIGVGYAMMIAPVYTAEVAPASSRGFLSSFPEIFINIGILLGYVSNYFFSKLPE  180

Query  612  HL  617
            HL
Sbjct  181  HL  182



>ref|XP_010527595.1| PREDICTED: polyol transporter 5-like [Tarenaya hassleriana]
Length=334

 Score =   231 bits (588),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 143/165 (87%), Gaps = 0/165 (0%)
 Frame = +3

Query  123  KKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSLAVFSL  302
            ++P RN++   C++L S+  ILLGYDIGVMSGAIIYIK D+K+SDVQ+E+LVG L+++SL
Sbjct  8    ERPKRNRFPFVCAILVSMILILLGYDIGVMSGAIIYIKRDMKLSDVQIEILVGILSIYSL  67

Query  303  FGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGYALMVA  482
             GS+ AGRTSDWIGRRYT+V+A  IFFAGALLMGFATDYAFLM GRFVAG  +G+A M+A
Sbjct  68   VGSSLAGRTSDWIGRRYTIVLAGGIFFAGALLMGFATDYAFLMFGRFVAGFSIGFAGMIA  127

Query  483  PVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            PVY AE+SPASSRGFLTSFPEV +N GILLGYVSN+AFS+LP  L
Sbjct  128  PVYIAEISPASSRGFLTSFPEVSVNVGILLGYVSNYAFSRLPLGL  172



>ref|XP_010487804.1| PREDICTED: polyol transporter 5-like [Camelina sativa]
Length=535

 Score =   236 bits (602),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 145/167 (87%), Gaps = 0/167 (0%)
 Frame = +3

Query  117  PPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSLAVF  296
            P K P +N+YA AC++LAS+ SILLGYDIGVMSGA+IYIK DLKISD ++ +L GSL ++
Sbjct  27   PGKPPKKNRYAFACAILASMTSILLGYDIGVMSGAMIYIKRDLKISDFEIGVLAGSLNIY  86

Query  297  SLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGYALM  476
            SL GS AAG+TSDWIGRRYT+V+A  IFFAGA+LMG A +YAFLM GRF+AG+GVGYALM
Sbjct  87   SLIGSCAAGKTSDWIGRRYTIVLAGAIFFAGAILMGLAPNYAFLMFGRFIAGIGVGYALM  146

Query  477  VAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            +APVYTAEV+PASSRGFL SFPEVFINAGI+LGYVSN AFSK P  L
Sbjct  147  IAPVYTAEVAPASSRGFLNSFPEVFINAGIMLGYVSNLAFSKFPLKL  193



>ref|XP_008668471.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 tpg|DAA43976.1| TPA: hypothetical protein ZEAMMB73_311171 [Zea mays]
Length=524

 Score =   236 bits (601),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 147/170 (86%), Gaps = 0/170 (0%)
 Frame = +3

Query  108  AFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSL  287
            A  P K+PP NKYA AC+LLAS+ S+LLGYDI VMSGA +++K+DLKI+D Q+E+L G +
Sbjct  11   AVAPAKRPPINKYAFACALLASMNSVLLGYDISVMSGAQLFMKEDLKITDTQIEILAGVI  70

Query  288  AVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGY  467
             ++SLFGS AAG TSDW+GRRYTMV+A+ IFF GALLMGFA  Y FLMVGRFVAG+GVG+
Sbjct  71   NIYSLFGSLAAGLTSDWLGRRYTMVLAAAIFFTGALLMGFAPGYGFLMVGRFVAGIGVGF  130

Query  468  ALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            ALM+APVYTAEV+P S+RGFLTSFPEVF N GILLGYVSNFAF++LP HL
Sbjct  131  ALMIAPVYTAEVAPTSARGFLTSFPEVFNNFGILLGYVSNFAFARLPVHL  180



>ref|XP_009350912.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=527

 Score =   236 bits (602),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 159/190 (84%), Gaps = 4/190 (2%)
 Frame = +3

Query  60   MTDGKLENNGVSGH----IPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAII  227
            M D + ENN V G     I  FDPPKKP   K+A+AC++LAS+ SILLGYDIGVMSGA +
Sbjct  1    MADQRAENNVVFGQPQNSIADFDPPKKPKTKKFAVACAVLASMTSILLGYDIGVMSGASL  60

Query  228  YIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGF  407
            +IK++L ISDVQVE+L G+L ++SL GSA AG+TSDWIGRRYT+V+A  IFF GALLMGF
Sbjct  61   FIKENLNISDVQVEVLNGTLNIYSLIGSALAGKTSDWIGRRYTIVLAGTIFFIGALLMGF  120

Query  408  ATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSN  587
            A +YAFLM GRF+AGVGVGYALM+APVYTAE+SPAS RGFLTSFPEVF+N GILLGYVSN
Sbjct  121  APNYAFLMFGRFIAGVGVGYALMIAPVYTAEISPASFRGFLTSFPEVFVNVGILLGYVSN  180

Query  588  FAFSKLPTHL  617
            FA +KLP HL
Sbjct  181  FALAKLPIHL  190



>ref|XP_008465477.1| PREDICTED: polyol transporter 5-like [Cucumis melo]
Length=517

 Score =   236 bits (601),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 155/186 (83%), Gaps = 1/186 (1%)
 Frame = +3

Query  60   MTDGKLENNGVSGHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKD  239
            M+D + E + +S H  A  P  KP RN YA ACS +AS+AS+LLGYDIGVMSGA+I+I+ 
Sbjct  1    MSDRQHETSSISYH-SAPPPATKPKRNYYAFACSTMASMASVLLGYDIGVMSGAVIFIQK  59

Query  240  DLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDY  419
            D KISDV++E+LVG ++++++ G+AAAGRTSDWIGRRYTM +A+  FF GA+LMG +T+Y
Sbjct  60   DFKISDVKLEILVGIISLYAILGTAAAGRTSDWIGRRYTMGLAAAFFFVGAILMGLSTNY  119

Query  420  AFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFS  599
            +FLM GRF AG+G+G+A ++APVYT E+SPA+SRG  TSFPE+FIN GILLGYVSNFAFS
Sbjct  120  SFLMFGRFFAGIGIGFASLIAPVYTTEISPAASRGCFTSFPEIFINVGILLGYVSNFAFS  179

Query  600  KLPTHL  617
            KLPTHL
Sbjct  180  KLPTHL  185



>ref|XP_009342008.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=527

 Score =   236 bits (601),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 159/190 (84%), Gaps = 4/190 (2%)
 Frame = +3

Query  60   MTDGKLENNGVSGH----IPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAII  227
            M D + ENN V G     I  FDPPKKP   K+A+AC++LAS+ SILLGYDIGVMSGA +
Sbjct  1    MADQRAENNVVFGQPQNSIADFDPPKKPKTKKFAVACAVLASMTSILLGYDIGVMSGASL  60

Query  228  YIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGF  407
            +IK++L ISDVQVE+L G+L ++SL GSA AG+TSDWIGRRYT+V+A  IFF GALLMGF
Sbjct  61   FIKENLNISDVQVEVLNGTLNIYSLIGSALAGKTSDWIGRRYTIVLAGTIFFIGALLMGF  120

Query  408  ATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSN  587
            A +YAFLM GRF+AGVGVGYALM+APVYTAE+SPAS RGFLTSFPEVF+N GILLGYVSN
Sbjct  121  APNYAFLMFGRFIAGVGVGYALMIAPVYTAEISPASFRGFLTSFPEVFVNVGILLGYVSN  180

Query  588  FAFSKLPTHL  617
            FA +KLP HL
Sbjct  181  FALAKLPIHL  190



>ref|XP_010442448.1| PREDICTED: putative polyol transporter 2 [Camelina sativa]
Length=511

 Score =   235 bits (600),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 153/180 (85%), Gaps = 3/180 (2%)
 Frame = +3

Query  78   ENNGVSGHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISD  257
            E  GV    P  +PP+   RN++A AC++LAS+ SI+LGYDIGV+SGA I+IKDDLK+SD
Sbjct  6    EQQGVVVAEP--EPPRGN-RNRFAFACAILASMTSIILGYDIGVISGAAIFIKDDLKLSD  62

Query  258  VQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVG  437
            VQ+E+L+G L ++S+ GS  AGRTSDWIGRRYT+V+A   FF GA+LMGFAT+Y F+MVG
Sbjct  63   VQLEILMGILNIYSIIGSGVAGRTSDWIGRRYTIVLAGAFFFCGAILMGFATNYPFIMVG  122

Query  438  RFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            RFVAG+GVGYA+M+APVYTAEV+PASSRGFL+SFPE+FIN GILLGYVSN+ FSKLP HL
Sbjct  123  RFVAGIGVGYAMMIAPVYTAEVAPASSRGFLSSFPEIFINIGILLGYVSNYFFSKLPEHL  182



>ref|XP_009342009.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=529

 Score =   235 bits (600),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 159/190 (84%), Gaps = 4/190 (2%)
 Frame = +3

Query  60   MTDGKLENNGVSGH----IPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAII  227
            M D K +NN VS      I  FDPPKKP   K+A+AC++LAS+ SILLGYDIGVMSGA +
Sbjct  3    MADQKSKNNVVSDQPQNSIADFDPPKKPKTKKFAVACAVLASMTSILLGYDIGVMSGASL  62

Query  228  YIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGF  407
            +IK++L ISDVQVE+L G+L ++SL GSA AG+TSDWIGRRYT+V+A  IFF GALLMGF
Sbjct  63   FIKENLNISDVQVEVLNGTLNIYSLIGSALAGKTSDWIGRRYTIVLAGTIFFIGALLMGF  122

Query  408  ATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSN  587
            A +YAFLM GRF+AGVGVGYALM+APVYTAE+SPAS RGFLTSFPEVF+N GILLGYVSN
Sbjct  123  APNYAFLMFGRFIAGVGVGYALMIAPVYTAEISPASFRGFLTSFPEVFVNVGILLGYVSN  182

Query  588  FAFSKLPTHL  617
            FA +KLP HL
Sbjct  183  FALAKLPIHL  192



>ref|NP_179210.1| polyol/monosaccharide transporter 2 [Arabidopsis thaliana]
 sp|Q9XIH6.1|PLT2_ARATH RecName: Full=Putative polyol transporter 2 [Arabidopsis thaliana]
 gb|AAD26955.1| putative sugar transporter [Arabidopsis thaliana]
 gb|AEC06468.1| polyol/monosaccharide transporter 2 [Arabidopsis thaliana]
Length=511

 Score =   235 bits (599),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 150/174 (86%), Gaps = 0/174 (0%)
 Frame = +3

Query  96   GHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELL  275
            G + A   P +  R+++A AC++LAS+ SI+LGYDIGVMSGA I+IKDDLK+SDVQ+E+L
Sbjct  9    GVVVAESEPPRGNRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDVQLEIL  68

Query  276  VGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGV  455
            +G L ++SL GS AAGRTSDWIGRRYT+V+A   FF GALLMGFAT+Y F+MVGRFVAG+
Sbjct  69   MGILNIYSLIGSGAAGRTSDWIGRRYTIVLAGFFFFCGALLMGFATNYPFIMVGRFVAGI  128

Query  456  GVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            GVGYA+M+APVYT EV+PASSRGFL+SFPE+FIN GILLGYVSN+ F+KLP H+
Sbjct  129  GVGYAMMIAPVYTTEVAPASSRGFLSSFPEIFINIGILLGYVSNYFFAKLPEHI  182



>dbj|BAJ86526.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=520

 Score =   235 bits (599),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 146/170 (86%), Gaps = 0/170 (0%)
 Frame = +3

Query  108  AFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSL  287
            A  P K+PP NKYA AC+LLAS+ S+LLGYDI VMSGA +++K+DLKI+D Q+E+L G +
Sbjct  11   AMAPAKRPPINKYAFACALLASMNSVLLGYDISVMSGAQLFMKEDLKITDTQIEILAGII  70

Query  288  AVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGY  467
            +++SL GS  AG TSDW+GRRYTMV+A+ IFF GALLMG A +YAFLM GRFVAG+GVGY
Sbjct  71   SIYSLLGSLMAGLTSDWLGRRYTMVLAAAIFFTGALLMGLAPNYAFLMAGRFVAGIGVGY  130

Query  468  ALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            ALM+APVYTAEV+P SSRGFLT+FPEVF N GILLGYVSNFAF++LP HL
Sbjct  131  ALMIAPVYTAEVAPTSSRGFLTTFPEVFNNFGILLGYVSNFAFARLPVHL  180



>ref|XP_008795606.1| PREDICTED: polyol transporter 5-like isoform X1 [Phoenix dactylifera]
Length=522

 Score =   235 bits (599),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 131/193 (68%), Positives = 158/193 (82%), Gaps = 9/193 (5%)
 Frame = +3

Query  60   MTDGKLENNGVSGHIP------AFDPPKKPPRNK-YAMacsllaslasillGYDIGVMSG  218
            MTD K E   V+  +P      A  P  +P  NK YA AC++LAS+ SILLGYDIGVMSG
Sbjct  1    MTDQKPEATKVAPQVPHDSLLEAVAP--RPRHNKRYAFACAMLASMTSILLGYDIGVMSG  58

Query  219  AIIYIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALL  398
            A +++KDDL ++D Q+E+L+G L +FS+ GS AAGRTSDWIGRRYT+V A+VIFF GA++
Sbjct  59   AALFMKDDLHVNDTQIEILLGILNLFSIVGSLAAGRTSDWIGRRYTIVFAAVIFFVGAIM  118

Query  399  MGFATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGY  578
            MG A +YAFLMVGRFVAGVGVGYAL++APVYT E++PASSRGFLTSFPEVFIN+GILLGY
Sbjct  119  MGLAPNYAFLMVGRFVAGVGVGYALVIAPVYTTELAPASSRGFLTSFPEVFINSGILLGY  178

Query  579  VSNFAFSKLPTHL  617
            VSNFAFSKLP +L
Sbjct  179  VSNFAFSKLPVNL  191



>ref|NP_001150711.1| LOC100284344 [Zea mays]
 gb|ACG40102.1| polyol transporter protein 4 [Zea mays]
 gb|AFW89354.1| polyol transporter protein 4 [Zea mays]
Length=531

 Score =   235 bits (600),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 122/170 (72%), Positives = 146/170 (86%), Gaps = 0/170 (0%)
 Frame = +3

Query  108  AFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSL  287
            A  P K+PP NKYA AC+LLAS+ S+LLGYDI VMSGA +++K+DLKI+D Q+E+L G +
Sbjct  11   AVAPAKRPPINKYAFACALLASMNSVLLGYDISVMSGAQLFMKEDLKITDTQIEILAGVI  70

Query  288  AVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGY  467
             ++SLFGS AAG TSDW+GRRYTMV+A+ IFF GALLMG A DY FLM GRFVAG+GVG+
Sbjct  71   NIYSLFGSLAAGLTSDWLGRRYTMVLAAAIFFTGALLMGLAPDYGFLMAGRFVAGIGVGF  130

Query  468  ALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            ALM+APVYTAEV+P S+RGFLTSFPEVF N GILLGYVSNFAF++LP HL
Sbjct  131  ALMIAPVYTAEVAPTSARGFLTSFPEVFNNFGILLGYVSNFAFARLPVHL  180



>ref|XP_004985338.1| PREDICTED: polyol transporter 5-like isoform X2 [Setaria italica]
Length=504

 Score =   234 bits (596),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 149/182 (82%), Gaps = 1/182 (1%)
 Frame = +3

Query  75   LENNGVSGHIPAFDPP-KKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKI  251
            +     S  IPA + P K+ P NKYA+AC++LAS+ SILLGYD+ VMSGA +++K DLKI
Sbjct  1    MSKQDASDGIPAAEAPAKRRPLNKYALACAILASMNSILLGYDVSVMSGAQLFMKQDLKI  60

Query  252  SDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLM  431
            +D Q+E+L G + ++SL GS AAGRTSDWIGRRYTMV+A+ IFFAGAL+MG A  YA LM
Sbjct  61   TDTQIEILAGIINIYSLVGSLAAGRTSDWIGRRYTMVLAAAIFFAGALIMGLAPSYAILM  120

Query  432  VGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPT  611
            +GRFVAGVGVGYALM+APVYTAEV+P S+RG LTSFPEVFIN G+LLGYVSN+AF  LP 
Sbjct  121  LGRFVAGVGVGYALMIAPVYTAEVAPTSARGLLTSFPEVFINTGVLLGYVSNYAFHSLPV  180

Query  612  HL  617
            HL
Sbjct  181  HL  182



>ref|XP_010445995.1| PREDICTED: putative polyol transporter 2 [Camelina sativa]
Length=511

 Score =   234 bits (596),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 150/174 (86%), Gaps = 0/174 (0%)
 Frame = +3

Query  96   GHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELL  275
            G + A   P +  R+++A AC++LAS+ SI+LGYDIGVMSGA I+IKDDLK+SDVQ+E+L
Sbjct  9    GVVVAEPKPPRGNRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDVQLEVL  68

Query  276  VGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGV  455
            +G L ++S+ GS AAGRTSDWIGRRYT+V+A   FF GALLMGFAT+Y F+MVGRFVAG+
Sbjct  69   MGILNIYSIIGSGAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAGI  128

Query  456  GVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            GVGYA+M+APVYTAEV+PASSRGFL+ FPE+FIN GILLGYVSN+ FSKLP HL
Sbjct  129  GVGYAMMIAPVYTAEVAPASSRGFLSFFPEIFINIGILLGYVSNYFFSKLPEHL  182



>ref|XP_008359575.1| PREDICTED: LOW QUALITY PROTEIN: polyol transporter 5-like [Malus 
domestica]
Length=527

 Score =   234 bits (597),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 158/190 (83%), Gaps = 4/190 (2%)
 Frame = +3

Query  60   MTDGKLENNGVSGH----IPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAII  227
            M D + ENN VSG     I  FDPPKKP   K+A+AC++LAS+ SILLGYDIGVMS A +
Sbjct  1    MADQRAENNVVSGQPQNSIADFDPPKKPKTKKFAVACAVLASMTSILLGYDIGVMSXASL  60

Query  228  YIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGF  407
            +IK++L ISDVQVE+L G+  ++SL GSA AG+TSDWIGRRYT+V+A  IFF GALLMGF
Sbjct  61   FIKENLNISDVQVEVLNGTXNIYSLIGSALAGKTSDWIGRRYTIVLAETIFFIGALLMGF  120

Query  408  ATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSN  587
            A +YAFLM GRF+AGVGVGYALM+APVYTAE+SPAS RGFLTSFPEVF+N GILLGYVSN
Sbjct  121  APNYAFLMFGRFIAGVGVGYALMIAPVYTAEISPASFRGFLTSFPEVFVNVGILLGYVSN  180

Query  588  FAFSKLPTHL  617
            FA ++LP HL
Sbjct  181  FALAELPIHL  190



>ref|XP_008800420.1| PREDICTED: polyol transporter 5-like [Phoenix dactylifera]
Length=526

 Score =   234 bits (596),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 126/190 (66%), Positives = 149/190 (78%), Gaps = 4/190 (2%)
 Frame = +3

Query  60   MTDGKLENNGVSGHIP----AFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAII  227
            M D K +   +S   P    A + PKKPPRNKYA+AC+ LAS+ SIL GYD  VMSGA +
Sbjct  1    MDDQKAKAPAISDPPPNQTLALEKPKKPPRNKYALACATLASMISILSGYDGAVMSGASV  60

Query  228  YIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGF  407
            +I+  LKI+D QVE+L G +  F+L GS AAGRTSDWIGRRYT++ A+ IF AGALLMG 
Sbjct  61   FIQKYLKINDTQVEILAGIINPFALVGSIAAGRTSDWIGRRYTIIFAAAIFLAGALLMGL  120

Query  408  ATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSN  587
            A +YA LMVGR VAGVG+GYALM+APVYTAE++P SSRGFLTSFP +FINAGILLGYVSN
Sbjct  121  APNYAILMVGRLVAGVGIGYALMIAPVYTAEIAPTSSRGFLTSFPALFINAGILLGYVSN  180

Query  588  FAFSKLPTHL  617
             AF+KLP HL
Sbjct  181  LAFAKLPDHL  190



>ref|XP_008466921.1| PREDICTED: putative polyol transporter 1, partial [Cucumis melo]
Length=200

 Score =   224 bits (571),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = +3

Query  210  MSGAIIYIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAG  389
            MSGA I+IKDD K+SD ++E+LVG L ++SL GSAAAGRTSDWIGRRYTMVVA+VIFFAG
Sbjct  1    MSGAAIFIKDDFKLSDTKIEILVGILNLYSLIGSAAAGRTSDWIGRRYTMVVAAVIFFAG  60

Query  390  ALLMGFATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGIL  569
            ALLMGFAT+Y+FLM GRFVAGVGVGYALM+APVYTAEVSPASSRGFLTSFPEVFINAGIL
Sbjct  61   ALLMGFATNYSFLMFGRFVAGVGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGIL  120

Query  570  LGYVSNFAFSKL  605
            LGYVSN+ FSK+
Sbjct  121  LGYVSNYGFSKV  132



>ref|XP_009121227.1| PREDICTED: putative polyol transporter 1 [Brassica rapa]
Length=511

 Score =   233 bits (595),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 150/175 (86%), Gaps = 0/175 (0%)
 Frame = +3

Query  93   SGHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVEL  272
             G + A     +  R+++A AC++LAS+ SI+LGYDIGVMSGA I+IK+DLK+SDVQ+E+
Sbjct  8    KGVVTAEAEAPRGNRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKEDLKLSDVQLEI  67

Query  273  LVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAG  452
            L+G L ++SL GS AAGRTSDWIGRRYT+V+A   FF GALLMGFAT+Y F+MVGRFVAG
Sbjct  68   LMGILNIYSLVGSGAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAG  127

Query  453  VGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            +GVGYA+M+APVYTAEV+PA+SRGFL+SFPE+FIN GILLGYVSN+ FSKLP HL
Sbjct  128  IGVGYAMMIAPVYTAEVAPATSRGFLSSFPEIFINIGILLGYVSNYFFSKLPVHL  182



>ref|XP_004985337.1| PREDICTED: polyol transporter 5-like isoform X1 [Setaria italica]
Length=517

 Score =   233 bits (595),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 149/182 (82%), Gaps = 1/182 (1%)
 Frame = +3

Query  75   LENNGVSGHIPAFDPP-KKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKI  251
            +     S  IPA + P K+ P NKYA+AC++LAS+ SILLGYD+ VMSGA +++K DLKI
Sbjct  1    MSKQDASDGIPAAEAPAKRRPLNKYALACAILASMNSILLGYDVSVMSGAQLFMKQDLKI  60

Query  252  SDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLM  431
            +D Q+E+L G + ++SL GS AAGRTSDWIGRRYTMV+A+ IFFAGAL+MG A  YA LM
Sbjct  61   TDTQIEILAGIINIYSLVGSLAAGRTSDWIGRRYTMVLAAAIFFAGALIMGLAPSYAILM  120

Query  432  VGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPT  611
            +GRFVAGVGVGYALM+APVYTAEV+P S+RG LTSFPEVFIN G+LLGYVSN+AF  LP 
Sbjct  121  LGRFVAGVGVGYALMIAPVYTAEVAPTSARGLLTSFPEVFINTGVLLGYVSNYAFHSLPV  180

Query  612  HL  617
            HL
Sbjct  181  HL  182



>emb|CDP18000.1| unnamed protein product [Coffea canephora]
Length=507

 Score =   233 bits (594),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 149/179 (83%), Gaps = 0/179 (0%)
 Frame = +3

Query  81   NNGVSGHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDV  260
              GV    P   PP KP RNKYA+AC+LLA ++S+LLGYD GVMSGA+IYI+ DLKI+DV
Sbjct  10   TRGVGLSNPDSVPPPKPKRNKYALACALLACMSSVLLGYDTGVMSGAMIYIQRDLKINDV  69

Query  261  QVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGR  440
            Q E+LVG++ V+SL GSA AGRT DWIGRRYT+ +A VIFFAGA+LM  AT+YAFLM GR
Sbjct  70   QKEILVGTINVYSLLGSAIAGRTCDWIGRRYTIAMAGVIFFAGAILMACATNYAFLMFGR  129

Query  441  FVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            FVAG+GVGYALM+APVY+AE+SP S RGF+TSF EVFIN G+LLGYVSN+ F+KL T+L
Sbjct  130  FVAGLGVGYALMIAPVYSAEISPRSIRGFITSFTEVFINFGVLLGYVSNYFFAKLATNL  188



>ref|XP_008245258.1| PREDICTED: polyol transporter 5-like [Prunus mume]
Length=511

 Score =   233 bits (594),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = +3

Query  111  FDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSLA  290
            FDP  KP RNK+A+ACSLLA   SILLGYDIGVMSGA + I+DDLKI+DVQ+++L G+L 
Sbjct  9    FDPSLKPKRNKFAIACSLLACTPSILLGYDIGVMSGANLSIQDDLKINDVQIQILTGTLN  68

Query  291  VFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGYA  470
            ++S+ GSA AGRTSDWIGRRYT V++  IFF GA+LMGFA  YAFLM GRFVAG+GVGY 
Sbjct  69   IYSVIGSALAGRTSDWIGRRYTAVLSGAIFFVGAILMGFAPGYAFLMFGRFVAGIGVGYG  128

Query  471  LMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            LM++PVYTAE++P  SRGFLTSFPEVF+N GILLGYVSN+AFSKLP  L
Sbjct  129  LMISPVYTAEIAPTLSRGFLTSFPEVFVNIGILLGYVSNYAFSKLPAPL  177



>ref|NP_001281038.1| polyol transporter 5-like [Malus domestica]
 gb|AAO88965.1| sorbitol transporter [Malus domestica]
Length=481

 Score =   232 bits (592),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = +3

Query  192  GYDIGVMSGAIIYIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVAS  371
            GYDIGVMSGA ++IK++LKISDVQVE++ G+L ++SL GSA AGRTSDWIGRRYT+V+A 
Sbjct  7    GYDIGVMSGASLFIKENLKISDVQVEIMNGTLNLYSLIGSALAGRTSDWIGRRYTIVLAG  66

Query  372  VIFFAGALLMGFATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVF  551
             IFF GALLMGFA +YAFLM GRFVAGVGVGYALM+APVYTAE+SPAS RGFLTSFPEVF
Sbjct  67   TIFFIGALLMGFAPNYAFLMFGRFVAGVGVGYALMIAPVYTAEISPASFRGFLTSFPEVF  126

Query  552  INAGILLGYVSNFAFSKLPTHL  617
            +N GILLGYVSN+AFSKLP HL
Sbjct  127  VNIGILLGYVSNYAFSKLPIHL  148



>gb|AEX55225.1| sugar transporter [Allium sativum]
Length=522

 Score =   233 bits (594),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 151/185 (82%), Gaps = 1/185 (1%)
 Frame = +3

Query  60   MTDGKLENNGVSGHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKD  239
            M    L++N +     A  PP+     ++A AC+LLAS+ SILLGYDIGVMSGA ++IKD
Sbjct  1    MKGDNLDSNIIPNE-KADGPPRTKKNTRFASACALLASMTSILLGYDIGVMSGAALFIKD  59

Query  240  DLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDY  419
            DL +SD Q+E+L+G L ++SL GS AAGRTSDWIGRRYT+V A+VIFF GA++MG + +Y
Sbjct  60   DLNVSDTQIEILLGILNLYSLLGSFAAGRTSDWIGRRYTIVFAAVIFFVGAIMMGLSPNY  119

Query  420  AFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFS  599
            AFLMVGRFVAG+GVGYALM+APVYTAEVSPASSRGFLTSFPE+FIN GILLGYVSNFAF 
Sbjct  120  AFLMVGRFVAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEMFINLGILLGYVSNFAFK  179

Query  600  KLPTH  614
             LP H
Sbjct  180  GLPRH  184



>ref|XP_009407915.1| PREDICTED: putative polyol transporter 1 [Musa acuminata subsp. 
malaccensis]
Length=520

 Score =   233 bits (594),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 146/167 (87%), Gaps = 0/167 (0%)
 Frame = +3

Query  117  PPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSLAVF  296
            PP K   NKYA  C++LASLASILLGYDIGVMSGA ++IKDDLK++D Q+E+L+G L ++
Sbjct  19   PPPKRGYNKYATGCAMLASLASILLGYDIGVMSGAELFIKDDLKLNDTQIEILLGVLNLY  78

Query  297  SLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGYALM  476
            SL GS AAG TSDWIGRRYT+V A+ IFF GALLMGFAT+YAFLMVGRFVAG+GVGYALM
Sbjct  79   SLVGSFAAGFTSDWIGRRYTIVFAATIFFTGALLMGFATNYAFLMVGRFVAGIGVGYALM  138

Query  477  VAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            +AP YTAEV+PASSRGFLTSFPEVFIN+GILLGYVSN+AFS L   L
Sbjct  139  IAPTYTAEVAPASSRGFLTSFPEVFINSGILLGYVSNYAFSHLRESL  185



>gb|EAY88906.1| hypothetical protein OsI_10385 [Oryza sativa Indica Group]
Length=521

 Score =   233 bits (594),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 149/176 (85%), Gaps = 1/176 (1%)
 Frame = +3

Query  93   SGHIPAFDPP-KKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVE  269
            S  +PA + P K+ P NKYA+AC++LAS+ SILLGYDI VMSGA  ++K DL ISD +VE
Sbjct  6    SSDVPAAEAPAKRAPLNKYALACAILASMNSILLGYDISVMSGAQKFMKKDLNISDAKVE  65

Query  270  LLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVA  449
            +L G + ++SL GS AAGRTSDWIGRRYTMV+ASVIFFAGAL+MG A  YA +M+GRFVA
Sbjct  66   VLAGIINIYSLVGSLAAGRTSDWIGRRYTMVLASVIFFAGALIMGLAPSYAIVMLGRFVA  125

Query  450  GVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            GVGVGYALM+APVYTAEV+P S+RG LTSFPEVFINAG+LLGYVSNFAF +LP H+
Sbjct  126  GVGVGYALMIAPVYTAEVAPTSARGLLTSFPEVFINAGVLLGYVSNFAFYRLPLHI  181



>ref|XP_009350914.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=529

 Score =   233 bits (593),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 158/190 (83%), Gaps = 4/190 (2%)
 Frame = +3

Query  60   MTDGKLENNGVSGH----IPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAII  227
            M D K +NN VS      I  FDPPKKP   K+A+AC++LAS+ SILLGYDIGVMSGA +
Sbjct  3    MADQKSKNNVVSDQPQNSIADFDPPKKPKTKKFAVACAVLASMTSILLGYDIGVMSGASL  62

Query  228  YIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGF  407
            +IK++L ISDVQVE+L G+L ++SL GSA AG+TSDWIGRRYT+V+A  IFF GALLMGF
Sbjct  63   FIKENLNISDVQVEVLNGTLNIYSLIGSALAGKTSDWIGRRYTIVLAGTIFFIGALLMGF  122

Query  408  ATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSN  587
            A +YAFLM GRF+AGVGVGYALM+APVYTAE+SPAS RGFLTSFPEVF+N GILLGYVSN
Sbjct  123  APNYAFLMFGRFIAGVGVGYALMIAPVYTAEISPASFRGFLTSFPEVFVNVGILLGYVSN  182

Query  588  FAFSKLPTHL  617
            F  +KLP HL
Sbjct  183  FPLAKLPIHL  192



>ref|XP_008653287.1| PREDICTED: polyol transporter 5-like [Zea mays]
 tpg|DAA63325.1| TPA: hypothetical protein ZEAMMB73_442702 [Zea mays]
Length=513

 Score =   232 bits (592),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 129/175 (74%), Positives = 148/175 (85%), Gaps = 0/175 (0%)
 Frame = +3

Query  93   SGHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVEL  272
            S  +PA   P K    K+A AC++LAS+ SILLGYDIGVMSGA +YIK DLKISDV++E+
Sbjct  3    SAPLPAAIEPGKKGNVKFAFACAILASMTSILLGYDIGVMSGASLYIKKDLKISDVKLEI  62

Query  273  LVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAG  452
            L+G L V+SL GS AAGRTSDWIGRRYT+V A+VIFFAGA LMGFA +Y  LM GRFVAG
Sbjct  63   LMGILNVYSLIGSFAAGRTSDWIGRRYTIVFAAVIFFAGAFLMGFAVNYWMLMFGRFVAG  122

Query  453  VGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            +GVGYALM+APVYTAEVSPAS+RGFLTSFPEVFIN GILLGYVSN+AFS+LP  L
Sbjct  123  IGVGYALMIAPVYTAEVSPASARGFLTSFPEVFINFGILLGYVSNYAFSRLPLRL  177



>gb|AAY88181.2| mannitol transporter 1 [Olea europaea]
Length=480

 Score =   231 bits (590),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +3

Query  192  GYDIGVMSGAIIYIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVAS  371
            GYDIGVMSGA IYIKD L +SDV++E++VG +  FSL GSA AGRTSDWIGRRYTMV+A 
Sbjct  7    GYDIGVMSGAAIYIKDQLHVSDVKLEIVVGIINFFSLVGSALAGRTSDWIGRRYTMVLAG  66

Query  372  VIFFAGALLMGFATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVF  551
             IFF GA+LMGFAT+Y+FLM GRFVAG+GVGYALM+APVYTAEVSPASSRGFLTSFPEVF
Sbjct  67   AIFFVGAILMGFATNYSFLMFGRFVAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVF  126

Query  552  INAGILLGYVSNFAFSKLPTHL  617
            IN G+LLGYVSN+AFSKLP +L
Sbjct  127  INIGVLLGYVSNYAFSKLPANL  148



>gb|EEE58504.1| hypothetical protein OsJ_09775 [Oryza sativa Japonica Group]
Length=521

 Score =   232 bits (592),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 149/176 (85%), Gaps = 1/176 (1%)
 Frame = +3

Query  93   SGHIPAFDPP-KKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVE  269
            S  +PA + P K+ P NKYA+AC++LAS+ SILLGYDI VMSGA  ++K DL ISD +VE
Sbjct  6    SSDVPAAEAPAKRAPLNKYALACAILASMNSILLGYDISVMSGAQKFMKKDLNISDAKVE  65

Query  270  LLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVA  449
            +L G + ++SL GS AAGRTSDWIGRRYTMV+ASVIFFAGAL+MG A  YA +M+GRFVA
Sbjct  66   VLAGIINIYSLVGSLAAGRTSDWIGRRYTMVLASVIFFAGALIMGLAPSYAIVMLGRFVA  125

Query  450  GVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            GVGVGYALM+APVYTAEV+P S+RG LTSFPEVFINAG+LLGYVSNFAF +LP H+
Sbjct  126  GVGVGYALMIAPVYTAEVAPTSARGLLTSFPEVFINAGVLLGYVSNFAFYRLPLHI  181



>ref|XP_007042751.1| Polyol/monosaccharide transporter 5, putative [Theobroma cacao]
 gb|EOX98582.1| Polyol/monosaccharide transporter 5, putative [Theobroma cacao]
Length=532

 Score =   232 bits (592),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 127/187 (68%), Positives = 150/187 (80%), Gaps = 6/187 (3%)
 Frame = +3

Query  75   LENNGVSGHI------PAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIK  236
            +EN  VS  +        F+P  KP RN +A AC++LASL +ILLGYDIGVMSGAII+IK
Sbjct  6    VENTVVSAQLIDNKTLADFEPANKPKRNLFAFACAVLASLTTILLGYDIGVMSGAIIFIK  65

Query  237  DDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATD  416
             DLKI+DVQVE+LVG L +  L GS AAGRTSDWIGRRYT+V+A+ IFF GALLM FAT+
Sbjct  66   KDLKINDVQVEILVGILNLCCLVGSFAAGRTSDWIGRRYTIVLANAIFFVGALLMAFATN  125

Query  417  YAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAF  596
            YA LM GRF+ G+G G+A+M+A VYTAE+SPASSRGFLTSF EV IN GILLGYVSN+AF
Sbjct  126  YALLMFGRFIGGIGAGFAIMIALVYTAELSPASSRGFLTSFTEVSINGGILLGYVSNYAF  185

Query  597  SKLPTHL  617
            SKLP +L
Sbjct  186  SKLPMNL  192



>emb|CDY46217.1| BnaA07g03530D [Brassica napus]
Length=512

 Score =   231 bits (590),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 121/185 (65%), Positives = 155/185 (84%), Gaps = 4/185 (2%)
 Frame = +3

Query  63   TDGKLENNGVSGHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDD  242
            +  ++E   V+  + A     +  R+++A AC++LAS+ SI+LGYDIGVMSGA I+IK+D
Sbjct  3    SSAEVEKGVVTAEVEA----PRGNRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKED  58

Query  243  LKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYA  422
            LK+SDVQ+E+L+G L ++SL GS AAGRTSDWIGRRYT+V+A   FF GALLMGFAT+Y 
Sbjct  59   LKLSDVQLEILMGILNIYSLVGSGAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYP  118

Query  423  FLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSK  602
            F+MVGRFVAG+GVGYA+M+APVYTAEV+PA+SRGFL+SFPE+FIN GILLGYVSN+ F+K
Sbjct  119  FIMVGRFVAGIGVGYAMMIAPVYTAEVAPATSRGFLSSFPEIFINIGILLGYVSNYFFAK  178

Query  603  LPTHL  617
            LP HL
Sbjct  179  LPGHL  183



>ref|XP_009121388.1| PREDICTED: LOW QUALITY PROTEIN: putative polyol transporter 1 
[Brassica rapa]
Length=511

 Score =   231 bits (590),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = +3

Query  135  RNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSLAVFSLFGSA  314
            R+++A AC++LAS+ SI+LGYDIGVMSGA I+IK+DLK+SDVQ+E+L+G L ++SL GS 
Sbjct  22   RSRFAFACAILASMTSIILGYDIGVMSGAAIFIKEDLKLSDVQLEILMGILNIYSLVGSG  81

Query  315  AAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGYALMVAPVYT  494
            AAGRTSDWIGRRYT+V+A   FF GALLMGFAT+Y F+MVGRFVAG+GVGYA+M+APVYT
Sbjct  82   AAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAGIGVGYAMMIAPVYT  141

Query  495  AEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            AEV+PA+SRGFL+SFPE+FIN GILLGYV N+ FSKLP HL
Sbjct  142  AEVAPATSRGFLSSFPEIFINIGILLGYVXNYFFSKLPVHL  182



>ref|XP_002463086.1| hypothetical protein SORBIDRAFT_02g037590 [Sorghum bicolor]
 gb|EER99607.1| hypothetical protein SORBIDRAFT_02g037590 [Sorghum bicolor]
Length=505

 Score =   231 bits (589),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 120/166 (72%), Positives = 145/166 (87%), Gaps = 0/166 (0%)
 Frame = +3

Query  120  PKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSLAVFS  299
            P+K    KYA  C++LAS+A I++GYDIGVMSGA IYIK DL I+DVQ+E+++G L ++S
Sbjct  7    PRKKSNVKYASMCAILASMAVIIVGYDIGVMSGAAIYIKKDLNITDVQLEIVMGILNIYS  66

Query  300  LFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGYALMV  479
            L GS AAGRTSDWIGRR+T+V A+VIFFAG+LLMGFA +YA LM GRFVAGVGVGYA+M+
Sbjct  67   LIGSFAAGRTSDWIGRRFTVVFAAVIFFAGSLLMGFAVNYAMLMAGRFVAGVGVGYAIMI  126

Query  480  APVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            APVYTAE+SPA+ RGFLTSFPEVFIN GILLGYVSNFAF++LP +L
Sbjct  127  APVYTAEISPAAVRGFLTSFPEVFINVGILLGYVSNFAFARLPLYL  172



>ref|XP_002468337.1| hypothetical protein SORBIDRAFT_01g044010 [Sorghum bicolor]
 gb|EER95335.1| hypothetical protein SORBIDRAFT_01g044010 [Sorghum bicolor]
Length=524

 Score =   231 bits (590),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 144/165 (87%), Gaps = 0/165 (0%)
 Frame = +3

Query  123  KKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSLAVFSL  302
            K+PP NKYA AC+LLAS+ S+LLGYDI VMSGA +++K+DLKI+D Q+E+L G + ++SL
Sbjct  16   KRPPINKYAFACALLASMNSVLLGYDISVMSGAQLFMKEDLKITDTQIEILAGVINIYSL  75

Query  303  FGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGYALMVA  482
            FGS AAG TSDW+GRRYTMV+A+ IFF GALLMG A DY  LMVGRFVAG+GVG+ALM+A
Sbjct  76   FGSLAAGFTSDWLGRRYTMVLAAAIFFTGALLMGLAPDYGLLMVGRFVAGIGVGFALMIA  135

Query  483  PVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            PVYTAEV+P S+RGFLTSFPEVF N GILLGYVSNFAF++LP HL
Sbjct  136  PVYTAEVAPTSARGFLTSFPEVFNNFGILLGYVSNFAFARLPVHL  180



>ref|XP_009375838.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=528

 Score =   231 bits (590),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 134/189 (71%), Positives = 158/189 (84%), Gaps = 3/189 (2%)
 Frame = +3

Query  60   MTDGKLENNGVSGH---IPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIY  230
            M D + +NN VS     I  FDPPKKP   K+A+AC++LAS+ SILLGYDIGVMSGA ++
Sbjct  3    MADQRAKNNVVSSQPQNIVDFDPPKKPKTKKFAVACAILASMTSILLGYDIGVMSGASLF  62

Query  231  IKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFA  410
            IK++L ISDVQVE+L G+L ++SL GSA AG+TSDWIGRRYT+V+A  IFF GALLMGFA
Sbjct  63   IKENLNISDVQVEVLNGTLNIYSLIGSALAGKTSDWIGRRYTIVLAGTIFFIGALLMGFA  122

Query  411  TDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNF  590
             +YAFLM GRF+AGVGVGYALM+APV TAE+SPAS RGFLTSFPEVF+N GILLGYVSNF
Sbjct  123  PNYAFLMFGRFIAGVGVGYALMIAPVSTAEISPASFRGFLTSFPEVFVNVGILLGYVSNF  182

Query  591  AFSKLPTHL  617
            A +KLP HL
Sbjct  183  ALAKLPIHL  191



>emb|CDY46218.1| BnaA07g03520D [Brassica napus]
Length=511

 Score =   231 bits (589),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 150/175 (86%), Gaps = 0/175 (0%)
 Frame = +3

Query  93   SGHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVEL  272
             G + A     +  R+++A AC++LAS+ SI+LGYDIGVMSGA I+IK+DLK+SDVQ+E+
Sbjct  8    KGVVTAEAEAPRGNRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKEDLKLSDVQLEI  67

Query  273  LVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAG  452
            L+G L ++SL GS AAGRTSDWIGRRYT+V+A   FF GALLMGFAT+Y F+MVGRFVAG
Sbjct  68   LMGILNIYSLVGSGAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAG  127

Query  453  VGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            +GVGYA+M+APVYTAEV+PA+SRGFL+SFPE+FIN GILLGYVSN+ F+KLP H+
Sbjct  128  IGVGYAMMIAPVYTAEVAPATSRGFLSSFPEIFINIGILLGYVSNYFFAKLPVHI  182



>ref|XP_009780685.1| PREDICTED: polyol transporter 5-like [Nicotiana sylvestris]
Length=174

 Score =   220 bits (561),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = +3

Query  117  PPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSLAVF  296
            P KK  RNKYA ACSLLAS+ S+LLGYD GVMSGA+IYIK+DLKISDVQ+E+LVG++ ++
Sbjct  25   PCKKSKRNKYAFACSLLASMTSVLLGYDTGVMSGAVIYIKEDLKISDVQIEILVGTINIY  84

Query  297  SLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGYALM  476
            SL G+A AGRTSDWIGRRYT++ AS IFFAGA+LMGFAT+Y FLM GRFVAG+GVGYALM
Sbjct  85   SLVGAALAGRTSDWIGRRYTIIFASAIFFAGAILMGFATNYGFLMFGRFVAGIGVGYALM  144

Query  477  VAPVYTAEVSPASSRGFLTSFPEVFINAG  563
            +APVYTAEV+PAS RGF TSFPEVFIN G
Sbjct  145  IAPVYTAEVAPASCRGFFTSFPEVFINGG  173



>ref|XP_004148314.2| PREDICTED: polyol transporter 5-like [Cucumis sativus]
 gb|KGN44327.1| hypothetical protein Csa_7G253820 [Cucumis sativus]
Length=519

 Score =   231 bits (588),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 153/186 (82%), Gaps = 1/186 (1%)
 Frame = +3

Query  60   MTDGKLENNGVSGHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKD  239
            M D + E + +S H  A  P  KP RN YA ACS +AS+AS+LLGYDIGVMSGA+I+I+ 
Sbjct  1    MADRQHETSSISYH-SAPPPTNKPKRNYYAFACSTMASMASVLLGYDIGVMSGAVIFIQK  59

Query  240  DLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDY  419
            D +ISDV++E+LVG ++++++ G+AAAGR SDWIGRRYTM +A+  FF GA+LMG +T+Y
Sbjct  60   DFQISDVKLEILVGIISLYAIIGTAAAGRISDWIGRRYTMGLAAAFFFVGAILMGLSTNY  119

Query  420  AFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFS  599
            +FLM GRF AG+G+G+A ++APVYT E+SPA+SRG  TSFPE+FIN GILLGYVSNFAFS
Sbjct  120  SFLMFGRFFAGIGIGFASLIAPVYTTEISPAASRGCFTSFPEIFINVGILLGYVSNFAFS  179

Query  600  KLPTHL  617
            KLPTHL
Sbjct  180  KLPTHL  185



>ref|XP_009378956.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=530

 Score =   231 bits (589),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 159/191 (83%), Gaps = 5/191 (3%)
 Frame = +3

Query  60   MTDGKLENNGVSGH----IPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAII  227
            M D + ENN V G     I  FDPPKKP   K+A+AC++LAS+ SILLGYDIGVMSGA +
Sbjct  3    MADQRAENNVVFGQPHNSIADFDPPKKPKTKKFAVACAVLASMTSILLGYDIGVMSGASL  62

Query  228  YIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGF  407
            +IK++L ISDVQVE+L G+L ++SL GSA AG+TSDWIGRRYT+V+A  IFF GALLMGF
Sbjct  63   FIKENLNISDVQVEVLNGTLNIYSLIGSALAGKTSDWIGRRYTIVLAGTIFFIGALLMGF  122

Query  408  ATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGF-LTSFPEVFINAGILLGYVS  584
            A +YAFLM GRF+AGVGVGYALM+APVYTAE+SPAS RGF LTSFPEVF+N GILLGYVS
Sbjct  123  APNYAFLMFGRFIAGVGVGYALMIAPVYTAEISPASFRGFLLTSFPEVFVNVGILLGYVS  182

Query  585  NFAFSKLPTHL  617
            NFA +KLP HL
Sbjct  183  NFALAKLPIHL  193



>gb|KCW62858.1| hypothetical protein EUGRSUZ_G00452 [Eucalyptus grandis]
Length=529

 Score =   231 bits (588),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 146/168 (87%), Gaps = 0/168 (0%)
 Frame = +3

Query  114  DPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSLAV  293
            +  K P +NKYA AC++LAS+ S+LLGYD+GVMSGAII++ ++LKI+ V+VE+L+G + +
Sbjct  17   NQRKSPRKNKYAFACAILASMTSVLLGYDVGVMSGAIIFVVEELKINHVEVEVLMGVINL  76

Query  294  FSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGYAL  473
            +SL GSA AGRTSDWIGRRYT+V++  IFFAGALLMG A +YAFLM GRFVAG+GVGY L
Sbjct  77   YSLVGSAMAGRTSDWIGRRYTIVLSGAIFFAGALLMGLAPNYAFLMFGRFVAGIGVGYGL  136

Query  474  MVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            M+APVYTAEVSP SSRGFLTSFPEVFIN G+LLGY+SN+AFSKLP  L
Sbjct  137  MIAPVYTAEVSPVSSRGFLTSFPEVFINLGVLLGYISNYAFSKLPLKL  184



>ref|XP_004985339.1| PREDICTED: polyol transporter 5-like [Setaria italica]
Length=523

 Score =   231 bits (588),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 143/165 (87%), Gaps = 0/165 (0%)
 Frame = +3

Query  123  KKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSLAVFSL  302
            K+ P NKYA A +LLAS+ S+LLGYDI VMSGA +++K+DLKI+D Q+E+L G + ++SL
Sbjct  16   KRAPINKYAFASALLASMNSVLLGYDISVMSGAQLFMKEDLKITDTQIEILAGVINIYSL  75

Query  303  FGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGYALMVA  482
            FGS AAG TSDW+GRRYTMV+A+ IFF GALLMG A DYA LMVGRFVAG+GVG+ALM+A
Sbjct  76   FGSLAAGFTSDWLGRRYTMVLAAAIFFTGALLMGLAPDYALLMVGRFVAGIGVGFALMIA  135

Query  483  PVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            PVYTAEV+P S+RGFLTSFPEVF N GILLGYVSNFAF++LP HL
Sbjct  136  PVYTAEVAPTSARGFLTSFPEVFNNFGILLGYVSNFAFARLPVHL  180



>emb|CDP02097.1| unnamed protein product [Coffea canephora]
Length=512

 Score =   230 bits (586),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 122/185 (66%), Positives = 154/185 (83%), Gaps = 4/185 (2%)
 Frame = +3

Query  75   LENNGVSGHI----PAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDD  242
            L+N  V+G +    P   PP KP RN  A+AC+LLA ++S+LLGYD GVMSGA+IYIK D
Sbjct  5    LQNPAVAGALESSNPDSGPPPKPKRNTLALACALLACMSSVLLGYDTGVMSGAMIYIKRD  64

Query  243  LKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYA  422
            LKISDV+VE+LVG++ V+SL GS  AGRT DW+GRRYT+V+A VIF AGA LM FAT Y+
Sbjct  65   LKISDVRVEILVGTINVYSLVGSTIAGRTCDWVGRRYTIVIAGVIFLAGAFLMTFATTYS  124

Query  423  FLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSK  602
            FLM+GRF+AG+GVG+A+M+APVY+AE+SP S+RGF+TSF EVFIN G+LLGYVSN+ F+K
Sbjct  125  FLMIGRFIAGIGVGFAMMIAPVYSAEISPRSARGFITSFTEVFINFGVLLGYVSNYFFAK  184

Query  603  LPTHL  617
            LPT+L
Sbjct  185  LPTNL  189



>gb|ABX71752.1| mannitol transporter [Apium graveolens]
Length=524

 Score =   230 bits (587),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 128/171 (75%), Positives = 147/171 (86%), Gaps = 0/171 (0%)
 Frame = +3

Query  105  PAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGS  284
            P FD  KKP  NKYA ACS+LAS+ SILLGYD GVMSGA IYIK DL+ +DVQ+E++VG 
Sbjct  21   PLFDAEKKPKNNKYAFACSILASMTSILLGYDTGVMSGAAIYIKKDLRFTDVQIEIIVGI  80

Query  285  LAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVG  464
            + +FSL GS  AGRTSDWIGRRYTMV+A  IFFAGA LMG AT++ FLMVGRFVAG+GVG
Sbjct  81   INIFSLLGSFLAGRTSDWIGRRYTMVLAGGIFFAGAFLMGCATNFEFLMVGRFVAGIGVG  140

Query  465  YALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            YA+M+APVYT EV+PASSRGFLTSFPEVFINAG++LGYVSNFAF+KLP  L
Sbjct  141  YAMMIAPVYTTEVAPASSRGFLTSFPEVFINAGVMLGYVSNFAFAKLPLWL  191



>ref|XP_008245305.1| PREDICTED: polyol transporter 5-like [Prunus mume]
Length=511

 Score =   230 bits (586),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 142/169 (84%), Gaps = 0/169 (0%)
 Frame = +3

Query  111  FDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSLA  290
            FDPP+KP  NK+A+ACSL+A   SIL GYDIGVMSGA ++IKDDLKI+D+Q+++  G+L 
Sbjct  9    FDPPQKPKINKFAIACSLMACTTSILHGYDIGVMSGAYLFIKDDLKINDLQIQIFTGTLN  68

Query  291  VFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGYA  470
            ++S+ GSA AGRTSDWIGR+YT V++  IFF GA+LMG A  YAFLM GRFVAG+GVGY 
Sbjct  69   IYSVIGSALAGRTSDWIGRQYTAVLSGAIFFVGAILMGVAPGYAFLMFGRFVAGIGVGYG  128

Query  471  LMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            LM++PVYTAE++P  SRGFLTSFPEVF+N GILLGYVSN  FSKLP +L
Sbjct  129  LMISPVYTAEIAPTLSRGFLTSFPEVFLNIGILLGYVSNCVFSKLPANL  177



>gb|EYU37769.1| hypothetical protein MIMGU_mgv1a005015mg [Erythranthe guttata]
Length=500

 Score =   229 bits (584),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = +3

Query  126  KPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSLAVFSLF  305
            K   NKYA+ACS+LAS+ SILLGYDIGVMSGAIIYI+ DLKI+DVQ E+++G L ++SL 
Sbjct  5    KAKTNKYALACSILASMTSILLGYDIGVMSGAIIYIQKDLKITDVQTEVVMGILNLYSLI  64

Query  306  GSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGYALMVAP  485
            GSAAAGRTSDWIGRRYT+V A VIFFAGALLMGFAT+YAFLM GRFVAGVGVG+A+M+AP
Sbjct  65   GSAAAGRTSDWIGRRYTIVFAGVIFFAGALLMGFATNYAFLMAGRFVAGVGVGFAMMIAP  124

Query  486  VYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLP  608
            VY AEVSP +SRG  TS PEVFIN GILLGYVSN AFS LP
Sbjct  125  VYAAEVSPPASRGLFTSLPEVFINIGILLGYVSNVAFSGLP  165



>ref|XP_008447047.1| PREDICTED: polyol transporter 5-like [Cucumis melo]
Length=519

 Score =   229 bits (584),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 147/186 (79%), Gaps = 4/186 (2%)
 Frame = +3

Query  60   MTDGKLENNGVSGHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKD  239
            M   K E + +S H     PP    RN YA  CS +AS+AS+LLGYDIGVMSGA I+I++
Sbjct  13   MAHQKDETSSISDH----SPPPAAKRNNYAFVCSTMASMASVLLGYDIGVMSGAAIFIQE  68

Query  240  DLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDY  419
            D +ISD++VE+LVG ++++S+ GS AAGRTSDWIGRRYTM +A+  F  GA+LMG AT+Y
Sbjct  69   DFRISDLEVEILVGIISLYSILGSVAAGRTSDWIGRRYTMGIAAAFFLVGAVLMGLATNY  128

Query  420  AFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFS  599
            AFLM GRF AGVG G+A ++APVYTAE+SPA+SRG  T+FPE+FIN GILLGYVSNFAFS
Sbjct  129  AFLMFGRFFAGVGTGFAGLIAPVYTAEISPAASRGCFTTFPEIFINVGILLGYVSNFAFS  188

Query  600  KLPTHL  617
            K PTHL
Sbjct  189  KFPTHL  194



>gb|EMS55536.1| Polyol transporter 5 [Triticum urartu]
Length=515

 Score =   229 bits (583),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 148/172 (86%), Gaps = 0/172 (0%)
 Frame = +3

Query  102  IPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVG  281
            +PA   PKK    ++A AC++LAS+ SILLGYDIGVMSGA +YI+ DLKI+D Q+E+L+G
Sbjct  6    LPAAVEPKKKGNVRFAFACAILASMTSILLGYDIGVMSGASLYIQKDLKINDTQLEVLMG  65

Query  282  SLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGV  461
             L V+SL GS AAGRTSDWIGRR+T+V A+VIFFAGAL+MGF+ +YA LM GRFVAG+GV
Sbjct  66   ILNVYSLIGSFAAGRTSDWIGRRFTIVFAAVIFFAGALIMGFSVNYAMLMFGRFVAGIGV  125

Query  462  GYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            GYALM+APVYTAEVSPAS+RGFLTSFPEVFIN GILLGYVSNFAF++L   L
Sbjct  126  GYALMIAPVYTAEVSPASARGFLTSFPEVFINFGILLGYVSNFAFARLSLRL  177



>ref|XP_009395604.1| PREDICTED: putative polyol transporter 1 [Musa acuminata subsp. 
malaccensis]
Length=561

 Score =   230 bits (586),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 155/190 (82%), Gaps = 7/190 (4%)
 Frame = +3

Query  51   SVVMTDGKLENNGVSGHIPAFDPPKKPPRNK-YAMacsllaslasillGYDIGVMSGAII  227
            S VM D K E N +    PA        RNK +A AC++LAS+ASILLGYDIGVMSGA I
Sbjct  47   STVMGDQKPEANIMEAVAPA------KSRNKMFAFACAVLASMASILLGYDIGVMSGAAI  100

Query  228  YIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGF  407
            +IKDDLKISDVQVE+L+G L ++SL GS AAG TSDWIGRRYT+V A+ IFF GA+LMGF
Sbjct  101  FIKDDLKISDVQVEILLGILNLYSLVGSYAAGFTSDWIGRRYTIVFAAGIFFVGAILMGF  160

Query  408  ATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSN  587
            AT+YAFLM GRFVAG+GVGYALM+APVYTAE++PASSRGFLTSFPEVFIN+GILLGYVSN
Sbjct  161  ATNYAFLMAGRFVAGIGVGYALMIAPVYTAEIAPASSRGFLTSFPEVFINSGILLGYVSN  220

Query  588  FAFSKLPTHL  617
            + F+ L   L
Sbjct  221  YGFAHLRQSL  230



>ref|XP_006657888.1| PREDICTED: polyol transporter 5-like [Oryza brachyantha]
Length=510

 Score =   228 bits (582),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 148/175 (85%), Gaps = 0/175 (0%)
 Frame = +3

Query  93   SGHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVEL  272
            S  +P    PKK    K+A AC++L+S+ SILLGYDIGVMSGA +YIK DLK+SD +VE+
Sbjct  3    SAALPEAVAPKKKGNFKFAFACAILSSMTSILLGYDIGVMSGASLYIKKDLKLSDGKVEV  62

Query  273  LVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAG  452
            L+G L ++SL GS AAGRTSDWIGRRYT+V A+VIFFAGALLMGF+ ++  LM GRFVAG
Sbjct  63   LMGILNLYSLIGSFAAGRTSDWIGRRYTIVFAAVIFFAGALLMGFSVNFGMLMFGRFVAG  122

Query  453  VGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            +GVGYALM+APVYTAEVSPAS+RGFLTSFPEVFIN GILLGYVSN+AFS+LP  L
Sbjct  123  IGVGYALMIAPVYTAEVSPASARGFLTSFPEVFINFGILLGYVSNYAFSRLPLRL  177



>ref|XP_006297395.1| hypothetical protein CARUB_v10013420mg [Capsella rubella]
 gb|EOA30293.1| hypothetical protein CARUB_v10013420mg [Capsella rubella]
Length=536

 Score =   229 bits (584),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 144/174 (83%), Gaps = 1/174 (1%)
 Frame = +3

Query  99   HIPAFDPPKKPPR-NKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELL  275
            H+       KPP+ NKYA AC++LAS+ SILLGYDIGVMSGA+IYIK DL ISD ++ +L
Sbjct  18   HVSELGVSAKPPKMNKYAFACAILASMTSILLGYDIGVMSGAMIYIKRDLNISDFKIGIL  77

Query  276  VGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGV  455
             G L +FSL GS AAG+TSD IGRRYT+V+A  IFFAGA+LMG A +YAFLM GRFVAG+
Sbjct  78   AGILNIFSLIGSCAAGKTSDLIGRRYTIVLAGAIFFAGAILMGLAPNYAFLMFGRFVAGI  137

Query  456  GVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            GVGYALM+APVYTAEVSPASSRGFLTSFPEVFINAGI+LGYVSN AFS  P  L
Sbjct  138  GVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGIMLGYVSNLAFSNFPLKL  191



>ref|XP_006649564.1| PREDICTED: polyol transporter 5-like [Oryza brachyantha]
Length=518

 Score =   229 bits (583),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 147/173 (85%), Gaps = 1/173 (1%)
 Frame = +3

Query  93   SGHIPAFDPP-KKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVE  269
            S  IPA + P K+ P NKYA+AC++LAS+ SILLGYDI VMSGA  ++K+DL ISD ++ 
Sbjct  6    SDEIPAAEAPAKRAPLNKYALACAVLASMNSILLGYDISVMSGAQKFMKEDLNISDTKIA  65

Query  270  LLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVA  449
            +L G + ++SL GS AAGRTSDWIGRRYTMV+A+VIFFAGAL+MG A  YA LM+GRFVA
Sbjct  66   ILAGIINIYSLVGSLAAGRTSDWIGRRYTMVLAAVIFFAGALIMGLAPSYAILMLGRFVA  125

Query  450  GVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLP  608
            GVGVGYALM+APVYTAEV+PAS+RG LTSFPEVFIN G+LLGYVSNFAF +LP
Sbjct  126  GVGVGYALMIAPVYTAEVAPASARGLLTSFPEVFINTGVLLGYVSNFAFYRLP  178



>ref|XP_008795604.1| PREDICTED: putative polyol transporter 1 [Phoenix dactylifera]
Length=522

 Score =   229 bits (583),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 154/191 (81%), Gaps = 5/191 (3%)
 Frame = +3

Query  60   MTDGKLENNGVSGHIPAFDPPK----KPPRNK-YAMacsllaslasillGYDIGVMSGAI  224
            MTD K E   V+   P     +    +P  NK YA AC++LAS+ SI+LGYDIGVMSGA 
Sbjct  1    MTDQKPEATKVASQGPHDSLAEAVIPRPRHNKRYACACAMLASMTSIILGYDIGVMSGAA  60

Query  225  IYIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMG  404
            ++I+DDL ++D Q+E+L+G L ++S+ GS AAGRTSDWIGRRYT+V A+VIFF GA++MG
Sbjct  61   LFIEDDLHVNDTQIEILLGILNLYSIVGSLAAGRTSDWIGRRYTIVFAAVIFFVGAIMMG  120

Query  405  FATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVS  584
             A +YAFLMVGRFVAGVGVGYA ++A VYTAEV+PASSRGFLTSFPEVFIN GILLGYVS
Sbjct  121  LAPNYAFLMVGRFVAGVGVGYAAVIAAVYTAEVAPASSRGFLTSFPEVFINCGILLGYVS  180

Query  585  NFAFSKLPTHL  617
            NFAFSKLP +L
Sbjct  181  NFAFSKLPENL  191



>gb|EAZ04480.1| hypothetical protein OsI_26629 [Oryza sativa Indica Group]
Length=510

 Score =   228 bits (582),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 147/175 (84%), Gaps = 0/175 (0%)
 Frame = +3

Query  93   SGHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVEL  272
            S  +P    PKK    ++A AC++LAS+ SILLGYDIGVMSGA +YIK D  ISD +VE+
Sbjct  3    SAALPEAVAPKKKGNVRFAFACAILASMTSILLGYDIGVMSGASLYIKKDFNISDGKVEV  62

Query  273  LVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAG  452
            L+G L ++SL GS AAGRTSDWIGRRYT+V A+VIFFAGA LMGFA +YA LM GRFVAG
Sbjct  63   LMGILNLYSLIGSFAAGRTSDWIGRRYTIVFAAVIFFAGAFLMGFAVNYAMLMFGRFVAG  122

Query  453  VGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            +GVGYALM+APVYTAEVSPAS+RGFLTSFPEVFIN GILLGYVSN+AFS+LP +L
Sbjct  123  IGVGYALMIAPVYTAEVSPASARGFLTSFPEVFINFGILLGYVSNYAFSRLPLNL  177



>dbj|BAC83310.1| putative sorbitol transporter [Oryza sativa Japonica Group]
 gb|EAZ40438.1| hypothetical protein OsJ_24893 [Oryza sativa Japonica Group]
Length=510

 Score =   228 bits (582),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 147/175 (84%), Gaps = 0/175 (0%)
 Frame = +3

Query  93   SGHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVEL  272
            S  +P    PKK    ++A AC++LAS+ SILLGYDIGVMSGA +YIK D  ISD +VE+
Sbjct  3    SAALPEAVAPKKKGNVRFAFACAILASMTSILLGYDIGVMSGASLYIKKDFNISDGKVEV  62

Query  273  LVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAG  452
            L+G L ++SL GS AAGRTSDWIGRRYT+V A+VIFFAGA LMGFA +YA LM GRFVAG
Sbjct  63   LMGILNLYSLIGSFAAGRTSDWIGRRYTIVFAAVIFFAGAFLMGFAVNYAMLMFGRFVAG  122

Query  453  VGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            +GVGYALM+APVYTAEVSPAS+RGFLTSFPEVFIN GILLGYVSN+AFS+LP +L
Sbjct  123  IGVGYALMIAPVYTAEVSPASARGFLTSFPEVFINFGILLGYVSNYAFSRLPLNL  177



>ref|XP_009407903.1| PREDICTED: polyol transporter 5-like [Musa acuminata subsp. malaccensis]
Length=507

 Score =   228 bits (581),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 138/166 (83%), Gaps = 0/166 (0%)
 Frame = +3

Query  120  PKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSLAVFS  299
            P+KP RN YA+ CS LAS+ SI+ GYD+ VMSGA ++IK+DLKI D ++E+L G + V+S
Sbjct  4    PEKPKRNMYALGCSCLASMTSIVSGYDVAVMSGANLFIKNDLKIDDTKIEILAGIINVYS  63

Query  300  LFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGYALMV  479
            + GS AAGRTSDWIGRRYTM++A  IFF GAL+M  A +YA LM GRFVAGVGVGYA M+
Sbjct  64   IIGSIAAGRTSDWIGRRYTMILACAIFFTGALVMALAPNYAILMAGRFVAGVGVGYAFMI  123

Query  480  APVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            APVY AEV+PASSRGFLTSFPEVFIN G+LLGYVSNFAF+ LP HL
Sbjct  124  APVYAAEVAPASSRGFLTSFPEVFINFGVLLGYVSNFAFAGLPEHL  169



>emb|CAR82416.1| polyol transporter [Plantago major]
Length=181

 Score =   218 bits (555),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 131/147 (89%), Gaps = 1/147 (1%)
 Frame = +3

Query  120  PKKP-PRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSLAVF  296
            PKKP  RNKYA+A S+LAS+ S+LLGYD GVMSGA +YIKDDLKISDVQVELLVG++ ++
Sbjct  34   PKKPVTRNKYALAISILASMTSVLLGYDTGVMSGATLYIKDDLKISDVQVELLVGTINIY  93

Query  297  SLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGYALM  476
            SL GSA AGRTSDW+GRRYT+V ASV+FF GA+LMG AT+Y FLM GRFVAG+GVGYALM
Sbjct  94   SLVGSAVAGRTSDWVGRRYTIVFASVVFFVGAILMGIATNYVFLMAGRFVAGIGVGYALM  153

Query  477  VAPVYTAEVSPASSRGFLTSFPEVFIN  557
            +APVY AEV+PAS RGFLTSFPEVFIN
Sbjct  154  IAPVYAAEVAPASCRGFLTSFPEVFIN  180



>ref|XP_004958139.1| PREDICTED: putative polyol transporter 1-like [Setaria italica]
Length=508

 Score =   228 bits (581),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 142/166 (86%), Gaps = 0/166 (0%)
 Frame = +3

Query  120  PKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSLAVFS  299
            PKK     YA  CS+LAS+ASI+LGYDIGVMSGA +YIK DLKI+DVQ+E+L+G L  +S
Sbjct  7    PKKKSNVTYAFICSILASMASIILGYDIGVMSGAALYIKKDLKITDVQLEILMGILNFYS  66

Query  300  LFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGYALMV  479
            L GS AAGRTSDWIGRR+T+VVA+  FF+GALLMG A DYA LM GRFVAGVGVGY LM+
Sbjct  67   LIGSFAAGRTSDWIGRRFTVVVAAAFFFSGALLMGLAGDYATLMFGRFVAGVGVGYGLMI  126

Query  480  APVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            APVYTAEVSPAS+RGFLTSF EVFIN GILLGYVSN+AF++LP HL
Sbjct  127  APVYTAEVSPASARGFLTSFSEVFINIGILLGYVSNYAFARLPLHL  172



>ref|XP_010497306.1| PREDICTED: putative polyol transporter 1, partial [Camelina sativa]
Length=182

 Score =   218 bits (555),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 110/163 (67%), Positives = 129/163 (79%), Gaps = 21/163 (13%)
 Frame = +3

Query  192  GYDIGVMSGAIIYIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVAS  371
            GYDIGVMSGA I+IKDDLK+SDVQ+E+L+G L ++SL GS AAGRTSDWIGRRYT+V+A 
Sbjct  7    GYDIGVMSGAAIFIKDDLKLSDVQLEILMGILNIYSLIGSGAAGRTSDWIGRRYTIVLAG  66

Query  372  VIFFAGALLMGFATDYAFLMVGRFVAGVGVGYALMVAPVY--------------------  491
              FF GALLMGFAT+Y F+MVGRF+AG+GVGYA+M+APVY                    
Sbjct  67   SFFFCGALLMGFATNYPFIMVGRFIAGIGVGYAMMIAPVYTAEVAPASSRGFLSSFPELI  126

Query  492  -TAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
             TAEV+PASSRGFL+SFPE+FIN GILLGYVSN+ FSKLP HL
Sbjct  127  VTAEVAPASSRGFLSSFPEIFINIGILLGYVSNYFFSKLPEHL  169



>ref|XP_006856085.2| PREDICTED: polyol transporter 5 [Amborella trichopoda]
Length=483

 Score =   227 bits (578),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +3

Query  192  GYDIGVMSGAIIYIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVAS  371
            GYDIGVMSGAI++IKDDL I+DV+VE+LVGSL +FSL GSAAAGRTSD+IGRRYT+V A 
Sbjct  7    GYDIGVMSGAILFIKDDLHINDVEVEILVGSLNIFSLIGSAAAGRTSDYIGRRYTIVFAG  66

Query  372  VIFFAGALLMGFATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVF  551
             IFF GAL+MGFA +YAFLM GR VAG+GVGYALM+APVYTAEV+PASSRGFLTSFPEVF
Sbjct  67   GIFFVGALMMGFAPNYAFLMAGRVVAGIGVGYALMIAPVYTAEVAPASSRGFLTSFPEVF  126

Query  552  INAGILLGYVSNFAFSKLPTHL  617
            IN GILLGYVSN+ F++LP  L
Sbjct  127  INLGILLGYVSNYVFARLPEDL  148



>ref|XP_003562817.1| PREDICTED: polyol transporter 5-like [Brachypodium distachyon]
Length=513

 Score =   227 bits (579),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 145/166 (87%), Gaps = 0/166 (0%)
 Frame = +3

Query  120  PKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSLAVFS  299
            PKK    ++A AC++LAS+ SILLGYDIGVMSGA ++IK DL+ISDVQVE+L+G L V+S
Sbjct  12   PKKKGNVRFAFACAILASMTSILLGYDIGVMSGASLFIKKDLQISDVQVEVLMGILNVYS  71

Query  300  LFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGYALMV  479
            L GS AAGRTSDWIGRRYT+V A+VIFFAGAL+MGF+ +Y  LM GRFVAG+GVGYALM+
Sbjct  72   LIGSFAAGRTSDWIGRRYTIVFAAVIFFAGALVMGFSVNYLMLMFGRFVAGIGVGYALMI  131

Query  480  APVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            APVYTAEVSPAS+RGFLTSFPEVFIN GILLGYVSN+AFS+L   L
Sbjct  132  APVYTAEVSPASARGFLTSFPEVFINFGILLGYVSNYAFSRLSLRL  177



>ref|XP_002440825.1| hypothetical protein SORBIDRAFT_09g007450 [Sorghum bicolor]
 gb|EES19255.1| hypothetical protein SORBIDRAFT_09g007450 [Sorghum bicolor]
Length=524

 Score =   227 bits (579),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 145/175 (83%), Gaps = 1/175 (1%)
 Frame = +3

Query  96   GHIPAFDPP-KKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVEL  272
            G IP  + P K+PP NKYA+AC++LAS+ SILLGYD  VMSGA ++IK+DLKISD ++E+
Sbjct  11   GGIPVVEAPAKRPPLNKYALACAVLASMNSILLGYDGAVMSGAQLFIKEDLKISDTKIEV  70

Query  273  LVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAG  452
            L G +++ SL GS AAGRTSDWIGRRYTMV+A+ IF AGAL+MG A  Y  LM+GR VAG
Sbjct  71   LAGIISISSLVGSLAAGRTSDWIGRRYTMVLAAAIFLAGALIMGLAPGYGVLMLGRCVAG  130

Query  453  VGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            VGVGYALMVAPVYTAEVSP S+RG LTSFPEVFIN G+LLGYVSN+AF  LP HL
Sbjct  131  VGVGYALMVAPVYTAEVSPTSARGLLTSFPEVFINTGVLLGYVSNYAFHSLPVHL  185



>ref|XP_007208924.1| hypothetical protein PRUPE_ppb008257mg [Prunus persica]
 gb|EMJ10123.1| hypothetical protein PRUPE_ppb008257mg [Prunus persica]
Length=270

 Score =   219 bits (559),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 140/167 (84%), Gaps = 3/167 (2%)
 Frame = +3

Query  60   MTDGKLENNGVSGHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKD  239
            MTD + E N VSG  P     KKP RN YA+ C++LAS+ SILLGYDIGVMSGA IYI++
Sbjct  1    MTDHRAEANAVSGQ-PLLK--KKPKRNLYAIGCAILASMTSILLGYDIGVMSGASIYIQE  57

Query  240  DLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDY  419
            DLKI+DV+VE+L+G L ++SL GSAAAGRTSDWIGRRYT+V A  IFF GALLMGFAT++
Sbjct  58   DLKITDVEVEILIGILNLYSLIGSAAAGRTSDWIGRRYTIVFAGAIFFTGALLMGFATNF  117

Query  420  AFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINA  560
            AFLMVGRFVAG+GVGYALM+APVY AEVSPASSRG LTSFPEV  +A
Sbjct  118  AFLMVGRFVAGIGVGYALMIAPVYNAEVSPASSRGALTSFPEVESDA  164



>ref|NP_001060108.1| Os07g0582400 [Oryza sativa Japonica Group]
 gb|AAL14615.1|AF416867_1 putative sugar transporter [Oryza sativa]
 dbj|BAF22022.1| Os07g0582400 [Oryza sativa Japonica Group]
Length=577

 Score =   228 bits (581),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 147/175 (84%), Gaps = 0/175 (0%)
 Frame = +3

Query  93   SGHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVEL  272
            S  +P    PKK    ++A AC++LAS+ SILLGYDIGVMSGA +YIK D  ISD +VE+
Sbjct  70   SAALPEAVAPKKKGNVRFAFACAILASMTSILLGYDIGVMSGASLYIKKDFNISDGKVEV  129

Query  273  LVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAG  452
            L+G L ++SL GS AAGRTSDWIGRRYT+V A+VIFFAGA LMGFA +YA LM GRFVAG
Sbjct  130  LMGILNLYSLIGSFAAGRTSDWIGRRYTIVFAAVIFFAGAFLMGFAVNYAMLMFGRFVAG  189

Query  453  VGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            +GVGYALM+APVYTAEVSPAS+RGFLTSFPEVFIN GILLGYVSN+AFS+LP +L
Sbjct  190  IGVGYALMIAPVYTAEVSPASARGFLTSFPEVFINFGILLGYVSNYAFSRLPLNL  244



>ref|XP_010229631.1| PREDICTED: putative polyol transporter 1 [Brachypodium distachyon]
Length=520

 Score =   226 bits (577),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 120/173 (69%), Positives = 145/173 (84%), Gaps = 0/173 (0%)
 Frame = +3

Query  99   HIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLV  278
             +P    PKK    KYA  C+++AS+ASI+LGYDIGV+SGA +YIK DLKI+D Q+E+LV
Sbjct  5    ELPEAVEPKKKSNLKYAFICAIVASMASIVLGYDIGVISGASLYIKKDLKITDAQLEILV  64

Query  279  GSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVG  458
            G L+++SL GS AAGRTSDWIGRR+T+V  S  FFAGALLMGFA  YA LM GRFVAG+G
Sbjct  65   GILSIYSLIGSFAAGRTSDWIGRRFTVVFVSAFFFAGALLMGFAGSYAMLMFGRFVAGIG  124

Query  459  VGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            VGYA+++APVYTAE+SPAS+RGFLTSFPEVFIN GILLGYVSN+AF++LP  L
Sbjct  125  VGYAMVIAPVYTAEISPASARGFLTSFPEVFINVGILLGYVSNYAFARLPLSL  177



>ref|XP_003558586.1| PREDICTED: polyol transporter 5-like [Brachypodium distachyon]
Length=521

 Score =   226 bits (577),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 140/162 (86%), Gaps = 0/162 (0%)
 Frame = +3

Query  123  KKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSLAVFSL  302
            K+ P NKYA+AC++LAS+ SILLGYD+ VMSGA I+IK DLK++D  +E+L G + +FSL
Sbjct  19   KRAPLNKYALACAVLASMNSILLGYDVSVMSGAQIFIKKDLKVTDTDIEILAGIINIFSL  78

Query  303  FGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGYALMVA  482
             GS AAGRTSDWIGRRYTMV+A+VIFFAGAL+MG A  YA LMVGRFVAGVGVGYALM+A
Sbjct  79   VGSLAAGRTSDWIGRRYTMVLAAVIFFAGALIMGLAPSYAVLMVGRFVAGVGVGYALMIA  138

Query  483  PVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLP  608
            PVYTAEV+P S+RG LTSFPEVFIN G+LLGY+SN+AF  LP
Sbjct  139  PVYTAEVAPTSARGLLTSFPEVFINTGVLLGYISNYAFHGLP  180



>ref|XP_011088360.1| PREDICTED: polyol transporter 5-like [Sesamum indicum]
Length=522

 Score =   226 bits (577),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 149/188 (79%), Gaps = 7/188 (4%)
 Frame = +3

Query  60   MTDGKLENNGVSGHIPAFDP--PKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYI  233
            M + K ENN        FDP  P KP RNK+A ACS LAS+ S+LLGYD+GVMSGAIIYI
Sbjct  1    MAEEKPENNAAF-----FDPAAPPKPTRNKFATACSFLASMTSVLLGYDVGVMSGAIIYI  55

Query  234  KDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFAT  413
            + DL+I+DVQ E+++G   +++L GSA AGR SD +GRR T+V A  IFF GAL MG AT
Sbjct  56   QRDLQITDVQKEVIMGIFGLYALIGSAIAGRISDRVGRRLTIVFAGAIFFFGALFMGLAT  115

Query  414  DYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFA  593
            +YAFLMVGRFVAG+GVG+ALM+APVYTAEV+PAS RG L SFPE+FIN GILLGYVSN A
Sbjct  116  NYAFLMVGRFVAGIGVGHALMIAPVYTAEVAPASCRGLLLSFPELFINIGILLGYVSNLA  175

Query  594  FSKLPTHL  617
            FSKLPT+L
Sbjct  176  FSKLPTNL  183



>dbj|BAJ85302.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=546

 Score =   226 bits (576),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 147/172 (85%), Gaps = 0/172 (0%)
 Frame = +3

Query  102  IPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVG  281
            +PA   PKK    ++A AC++LAS+ SILLGYDIGVMSGA +YI+ DLKI+D Q+E+L+G
Sbjct  37   LPAAVEPKKKGNVRFAFACAILASMTSILLGYDIGVMSGASLYIQKDLKINDTQLEVLMG  96

Query  282  SLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGV  461
             L V+SL GS AAGRTSDWIGRR+T+V A+VIFFAGAL+MG + +YA LM GRFVAG+GV
Sbjct  97   ILNVYSLVGSFAAGRTSDWIGRRFTIVFAAVIFFAGALIMGLSVNYAMLMFGRFVAGIGV  156

Query  462  GYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            GYALM+APVYTAEVSPAS+RGFLTSFPEVFIN GILLGYVSNFAF++L   L
Sbjct  157  GYALMIAPVYTAEVSPASARGFLTSFPEVFINFGILLGYVSNFAFARLSLRL  208



>gb|KJB12318.1| hypothetical protein B456_002G011700 [Gossypium raimondii]
Length=525

 Score =   225 bits (574),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 150/184 (82%), Gaps = 4/184 (2%)
 Frame = +3

Query  78   ENNGVS----GHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDL  245
            EN  VS     ++  F+  KKP ++K+A+ C++LASL S+LLGYDIGVMSGAII+IK DL
Sbjct  7    ENGAVSIRPADNLAVFEVSKKPKKSKFALGCAMLASLTSMLLGYDIGVMSGAIIFIKKDL  66

Query  246  KISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAF  425
            KISD Q+E+LVG L ++ L GS  AG  +DWIGRRYT+++A+VI F G+L MGF+ +YAF
Sbjct  67   KISDGQIEILVGILNLYCLVGSIVAGTIADWIGRRYTILLANVIIFVGSLFMGFSVNYAF  126

Query  426  LMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKL  605
            LMVGRF+AG+GVG+A+M A +Y AE+SPASSRGFLTSFPEV IN GILLGYVSN+AFSKL
Sbjct  127  LMVGRFIAGIGVGFAIMGAVLYNAEISPASSRGFLTSFPEVCINVGILLGYVSNYAFSKL  186

Query  606  PTHL  617
            PT +
Sbjct  187  PTRI  190



>gb|AAG43998.1|AF215837_1 mannitol transporter [Apium graveolens Dulce Group]
Length=513

 Score =   225 bits (573),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 150/173 (87%), Gaps = 1/173 (1%)
 Frame = +3

Query  102  IPAFDPPK-KPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLV  278
            + ++D  K KP RNKYA AC+LLAS+ SILLGYD GV+SGA IYIK+DL  SDVQ+E+++
Sbjct  8    VDSYDTNKPKPKRNKYAFACALLASMNSILLGYDTGVLSGASIYIKEDLHFSDVQIEIII  67

Query  279  GSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVG  458
            G + ++SL GSA AGRTSDWIGRRYTMV+A +IFF GA+ MG AT++AFLM GRFVAG+G
Sbjct  68   GIINIYSLLGSAIAGRTSDWIGRRYTMVLAGIIFFLGAIFMGLATNFAFLMFGRFVAGIG  127

Query  459  VGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            VGYA+M+APVYTAEV+P+SSRGFLTSFPEVFIN+G+LLGYVSNFAF+K P  L
Sbjct  128  VGYAMMIAPVYTAEVAPSSSRGFLTSFPEVFINSGVLLGYVSNFAFAKCPLWL  180



>ref|XP_002460923.1| hypothetical protein SORBIDRAFT_02g037570 [Sorghum bicolor]
 gb|EER97444.1| hypothetical protein SORBIDRAFT_02g037570 [Sorghum bicolor]
Length=510

 Score =   225 bits (573),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 144/175 (82%), Gaps = 0/175 (0%)
 Frame = +3

Query  93   SGHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVEL  272
            S  +P    P K    ++A AC++LAS+ SILLGYDIGVMSGA +YIK DL I+DVQ+E+
Sbjct  3    SAALPEAVEPGKKGNVRFAFACAILASMTSILLGYDIGVMSGASLYIKKDLGITDVQLEI  62

Query  273  LVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAG  452
            L+G L V+SL GS AAGRTSDWIGRRYT+V A+VIFFAGA LMGFA +Y  LM GRFVAG
Sbjct  63   LMGILNVYSLIGSFAAGRTSDWIGRRYTIVFAAVIFFAGAFLMGFAVNYGMLMFGRFVAG  122

Query  453  VGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            VGVGYALM+APVYTAEVSPAS+RGFLTSFPEVFIN GILLGYVSN+AFS L   L
Sbjct  123  VGVGYALMIAPVYTAEVSPASARGFLTSFPEVFINFGILLGYVSNYAFSHLSLRL  177



>ref|XP_009396401.1| PREDICTED: polyol transporter 5-like [Musa acuminata subsp. malaccensis]
Length=513

 Score =   225 bits (573),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 143/166 (86%), Gaps = 0/166 (0%)
 Frame = +3

Query  120  PKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSLAVFS  299
            P K    ++A AC++LAS+ SILLGYDIGVMSGA I+IKDDLKISD QVE+L+G L ++S
Sbjct  17   PAKRKSKRFAFACAMLASMTSILLGYDIGVMSGAAIFIKDDLKISDTQVEILLGILNLYS  76

Query  300  LFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGYALMV  479
            L GS AAG TSDWIGRRYT+V A+ IFF GALLMGFA +YAFLM GRFVAG+GVGYALM+
Sbjct  77   LVGSYAAGFTSDWIGRRYTIVFAAGIFFVGALLMGFAVNYAFLMFGRFVAGIGVGYALMI  136

Query  480  APVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            APVYTAEV+PASSRGFLTSFPEVFIN+GILLGYVSN+ F++L   L
Sbjct  137  APVYTAEVAPASSRGFLTSFPEVFINSGILLGYVSNYGFARLRESL  182



>ref|XP_010527168.1| PREDICTED: putative polyol transporter 1 [Tarenaya hassleriana]
Length=362

 Score =   221 bits (562),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 146/167 (87%), Gaps = 2/167 (1%)
 Frame = +3

Query  123  KKPPRNK--YAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSLAVF  296
            ++P R++  YA AC++LAS++SI+LGYDIGV+SGA I+I+DDLK+SD+Q+E+ +G L ++
Sbjct  14   QQPDRSRRLYATACAVLASMSSIVLGYDIGVVSGASIFIQDDLKLSDLQLEIFMGILNLY  73

Query  297  SLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGYALM  476
            S+ GS  AGRTSDWIGRRYT+V+A   F AGALLMGFAT+Y F+MVGRFVAG+GVGY +M
Sbjct  74   SIVGSGLAGRTSDWIGRRYTIVLAGCFFIAGALLMGFATNYPFIMVGRFVAGIGVGYGMM  133

Query  477  VAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            +APVYT EV+PASSRGFL+SFPE+FIN GILLGYVSNF F++LP HL
Sbjct  134  IAPVYTTEVAPASSRGFLSSFPEIFINIGILLGYVSNFFFAQLPEHL  180



>ref|XP_008800418.1| PREDICTED: polyol transporter 5-like [Phoenix dactylifera]
Length=528

 Score =   225 bits (573),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 129/190 (68%), Positives = 152/190 (80%), Gaps = 4/190 (2%)
 Frame = +3

Query  60   MTDGKLENNGVSGHIP----AFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAII  227
            M D K +   +S   P    A + PKKPPRNKYA+AC+ LAS+ SILLGYD  VMSGA +
Sbjct  1    MDDQKAKAPAISDPPPNQTLALEKPKKPPRNKYALACATLASMTSILLGYDGAVMSGASV  60

Query  228  YIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGF  407
            +I+  LKI+D QVE+L G ++ F+L GS AAGRTSDWIGRRYT++ A+ IFFAGALLMG 
Sbjct  61   FIQKYLKINDTQVEILAGIISPFALVGSIAAGRTSDWIGRRYTIIFAAAIFFAGALLMGL  120

Query  408  ATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSN  587
            A +YA LMVGR VAGVGVGYALM+APVYTAE++P SSRGFLTSFPEVFIN G+LLGYVSN
Sbjct  121  APNYAILMVGRLVAGVGVGYALMIAPVYTAEIAPTSSRGFLTSFPEVFINTGVLLGYVSN  180

Query  588  FAFSKLPTHL  617
            FAF+KLP  L
Sbjct  181  FAFAKLPDRL  190



>ref|XP_002467638.1| hypothetical protein SORBIDRAFT_01g031360 [Sorghum bicolor]
 gb|EER94636.1| hypothetical protein SORBIDRAFT_01g031360 [Sorghum bicolor]
Length=535

 Score =   224 bits (572),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 122/176 (69%), Positives = 147/176 (84%), Gaps = 1/176 (1%)
 Frame = +3

Query  81   NNGVSGHIP-AFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISD  257
            N   S  +P    PP+K    ++A AC++LAS+ SILLGYDIGVMSGA ++IK+DLKISD
Sbjct  10   NRAASDGLPDGVAPPRKKTNVRFAFACAILASMTSILLGYDIGVMSGAALFIKEDLKISD  69

Query  258  VQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVG  437
            V+VE+L+G L ++SL GS AAGRTSDWIGRR T+++A+VIFF GA +MGF+ +Y  LM G
Sbjct  70   VEVEVLLGILNLYSLLGSFAAGRTSDWIGRRLTIILAAVIFFVGAFMMGFSVNYPMLMAG  129

Query  438  RFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKL  605
            RFVAG+GVGYALM+APVYTAEVSPASSRGFLTSFPEVFIN GILLGYVSN+AFS L
Sbjct  130  RFVAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINIGILLGYVSNYAFSHL  185



>ref|XP_008368694.1| PREDICTED: polyol transporter 5-like [Malus domestica]
Length=485

 Score =   223 bits (569),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  198  DIGVMSGAIIYIKDDLKISDVQVELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVI  377
            DIGVMSGA ++IK++L ISDVQVE+L G+L ++SL GSA AG+TSDWIGRRYT+V+A  I
Sbjct  9    DIGVMSGASLFIKENLNISDVQVEVLNGTLNIYSLIGSALAGKTSDWIGRRYTIVLAGTI  68

Query  378  FFAGALLMGFATDYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFIN  557
            FF GALLMGFA +YAFLM GRF+AGVGVGYALM+APVYTAE+SPAS RGFLTSFPEVF+N
Sbjct  69   FFIGALLMGFAPNYAFLMFGRFIAGVGVGYALMIAPVYTAEISPASFRGFLTSFPEVFVN  128

Query  558  AGILLGYVSNFAFSKLPTHL  617
             GILLGYVSNFA +KLP HL
Sbjct  129  VGILLGYVSNFALAKLPIHL  148



>tpg|DAA45950.1| TPA: hypothetical protein ZEAMMB73_850316 [Zea mays]
Length=519

 Score =   223 bits (569),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 119/163 (73%), Positives = 143/163 (88%), Gaps = 0/163 (0%)
 Frame = +3

Query  117  PPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSLAVF  296
            PP+K    ++A AC++LAS+ SILLGYDIGVMSGA ++IK+DLKISDV+VE+L+G L ++
Sbjct  23   PPRKKSNVRFAFACAILASMTSILLGYDIGVMSGAALFIKEDLKISDVEVEVLLGILNLY  82

Query  297  SLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGYALM  476
            SL GS AAGRTSDWIGRR T+++A+VIFF GA +MGF+ +Y  LM GRFVAG+GVGYALM
Sbjct  83   SLIGSFAAGRTSDWIGRRLTIILAAVIFFVGAFMMGFSVNYPMLMAGRFVAGIGVGYALM  142

Query  477  VAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKL  605
            +APVYTAEVSPASSRGFLTSFPEVFIN GILLGYVSN+AFS L
Sbjct  143  IAPVYTAEVSPASSRGFLTSFPEVFINFGILLGYVSNYAFSHL  185



>gb|EMT15229.1| Putative polyol transporter 1 [Aegilops tauschii]
Length=348

 Score =   218 bits (556),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 142/172 (83%), Gaps = 4/172 (2%)
 Frame = +3

Query  114  DPPKKPPRNK----YAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVG  281
            +P    PRNK    YA  C+L AS+A+I+LGYD+GVMSGA +YIK DL+I+DVQ+E+++G
Sbjct  8    EPEAVHPRNKGNFKYAFTCALCASMATIVLGYDVGVMSGASLYIKRDLQITDVQLEIMMG  67

Query  282  SLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGV  461
             L+V++L GS    RTSDW+GRR T+V A+ IF  G+LLMGFA +YA LMVGRFV G+GV
Sbjct  68   ILSVYALIGSFLGARTSDWVGRRVTVVFAAAIFTTGSLLMGFAVNYAMLMVGRFVTGIGV  127

Query  462  GYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            GYA+MVAPVYTAEVSPAS+RGFLTSF EVFIN GILLGYVSN+AF++LP HL
Sbjct  128  GYAIMVAPVYTAEVSPASARGFLTSFTEVFINVGILLGYVSNYAFARLPLHL  179



>emb|CDP17999.1| unnamed protein product [Coffea canephora]
Length=503

 Score =   223 bits (567),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 117/177 (66%), Positives = 143/177 (81%), Gaps = 0/177 (0%)
 Frame = +3

Query  87   GVSGHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQV  266
            GV    P F PP K  +NKYA+ C+ LA ++S+LLGY+ GVMSGA+IYI+ DLKISDVQ 
Sbjct  12   GVESSNPDFGPPPKATKNKYALGCAFLACMSSVLLGYNAGVMSGAMIYIQRDLKISDVQK  71

Query  267  ELLVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFV  446
            E+L G + V+SL GSA AGRT DW+GRRYT+ +A VIFFAGA LM FAT+YAFLMVG FV
Sbjct  72   EVLGGIINVYSLLGSAIAGRTCDWVGRRYTIAMAGVIFFAGAFLMAFATNYAFLMVGLFV  131

Query  447  AGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            AG+GVGY LM+APVY+AE+SP S RGF+TSF +VF N G+LLGYVSN+ F+KL T+L
Sbjct  132  AGIGVGYGLMIAPVYSAEISPRSIRGFITSFTKVFSNLGVLLGYVSNYFFAKLATNL  188



>ref|XP_010905472.1| PREDICTED: polyol transporter 5-like [Elaeis guineensis]
Length=525

 Score =   223 bits (568),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 143/164 (87%), Gaps = 0/164 (0%)
 Frame = +3

Query  126  KPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSLAVFSLF  305
            KPP NKYA+AC+ LAS+ S LLGYDI VMSGA ++I+ DLK+SD Q+E+L G + ++SL 
Sbjct  24   KPPTNKYALACATLASMTSTLLGYDIAVMSGASVFIQKDLKVSDTQIEILAGVINLYSLI  83

Query  306  GSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGYALMVAP  485
            GS AAGRTSDWIGRRYT++ A+ IFFAGALLMG A +YA LMVGRFVAG+GVGYALM+AP
Sbjct  84   GSIAAGRTSDWIGRRYTIIFAAAIFFAGALLMGLAPNYAILMVGRFVAGIGVGYALMIAP  143

Query  486  VYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            VYTAEV+P S+RGFLTSFPEVFIN+G+LLGYVSNFAFSKL  H+
Sbjct  144  VYTAEVAPTSARGFLTSFPEVFINSGVLLGYVSNFAFSKLSYHI  187



>gb|AAN07021.1| putative mannitol transporter [Orobanche ramosa]
Length=519

 Score =   223 bits (567),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 143/175 (82%), Gaps = 0/175 (0%)
 Frame = +3

Query  93   SGHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVEL  272
            SG  P      KP +N YA+  S++AS+ SILLGYD GVMSGA +YIK DLKI+DVQVE+
Sbjct  14   SGGSPTKALINKPKKNMYALLISVMASMTSILLGYDTGVMSGATLYIKKDLKITDVQVEI  73

Query  273  LVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAG  452
            LVG + ++SL GSA AGRTSD++GRR T+V+ASVIFF GA +MG A +YA LMVGRFVAG
Sbjct  74   LVGLINIYSLIGSAVAGRTSDYLGRRITIVIASVIFFVGAAVMGLANNYAVLMVGRFVAG  133

Query  453  VGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            +GVGYALM+APVY AEV+PASSRGFLTSFPEVFIN G+LLGY+SN+AF+K    L
Sbjct  134  LGVGYALMIAPVYAAEVAPASSRGFLTSFPEVFINFGVLLGYLSNYAFAKFSLKL  188



>ref|XP_011659070.1| PREDICTED: polyol transporter 5-like [Cucumis sativus]
 gb|KGN44326.1| Mannitol transporter [Cucumis sativus]
Length=522

 Score =   222 bits (566),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 140/167 (84%), Gaps = 0/167 (0%)
 Frame = +3

Query  117  PPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELLVGSLAVF  296
            PP     N YA  CS +AS+AS+LLGYDIGVMSGA I+I++D KISD+QVE+LVG ++++
Sbjct  31   PPAAKRWNSYAFVCSTMASMASVLLGYDIGVMSGAAIFIQEDFKISDLQVEILVGIISLY  90

Query  297  SLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGVGVGYALM  476
            S+ GS AAGRTSDWIGRRYTM +A+  F  GA+LMG AT+YAFLM GRF AGVG G+A +
Sbjct  91   SILGSIAAGRTSDWIGRRYTMGIAAAFFLVGAVLMGLATNYAFLMFGRFFAGVGTGFAGL  150

Query  477  VAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            +APVYTAE+SPASSRG  T+FPE+FIN GILLGYVSNFAFSKLPT+L
Sbjct  151  IAPVYTAEISPASSRGCYTTFPEIFINVGILLGYVSNFAFSKLPTNL  197



>ref|XP_004983902.1| PREDICTED: polyol transporter 5-like isoform X2 [Setaria italica]
Length=523

 Score =   222 bits (566),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 145/174 (83%), Gaps = 0/174 (0%)
 Frame = +3

Query  96   GHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVELL  275
            G +P    PKK    ++A AC++LAS+ SILLGYDIGVMSGA ++IK+DL+ISDV+VE+L
Sbjct  16   GRLPDGVAPKKKTNVRFAFACAILASMTSILLGYDIGVMSGAALFIKEDLEISDVEVEIL  75

Query  276  VGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAGV  455
            +G L ++SL GS AAGRTSDWIGRR T+++A+ IFF GA +MGF+ +Y  LM GRFVAG+
Sbjct  76   LGILNLYSLIGSFAAGRTSDWIGRRLTIILAAAIFFVGAFIMGFSVNYPMLMAGRFVAGI  135

Query  456  GVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            GVGYALM+APVYTAEVSPASSRGFLTSFPEVFIN GILLGYVSN+AFS L   L
Sbjct  136  GVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINFGILLGYVSNYAFSHLSLKL  189



>ref|XP_003562818.1| PREDICTED: polyol transporter 5-like [Brachypodium distachyon]
Length=514

 Score =   222 bits (565),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 146/175 (83%), Gaps = 1/175 (1%)
 Frame = +3

Query  93   SGHIPAFDPPKKPPRNKYAMacsllaslasillGYDIGVMSGAIIYIKDDLKISDVQVEL  272
            S  +P    PKK    KYA  CS+LAS+A+I+LGYD+GVMSGA +YIK DL+I+DVQVE+
Sbjct  8    SASLPEAVEPKKS-NFKYAFTCSILASMATIVLGYDVGVMSGASLYIKKDLQITDVQVEI  66

Query  273  LVGSLAVFSLFGSAAAGRTSDWIGRRYTMVVASVIFFAGALLMGFATDYAFLMVGRFVAG  452
            L+G L++++L GS AA RTSDWIGRR T+V A+ IFF G+LLMGFA +YA LMVGRFV G
Sbjct  67   LIGILSLYALVGSFAASRTSDWIGRRVTVVFAATIFFTGSLLMGFAVNYAMLMVGRFVTG  126

Query  453  VGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPTHL  617
            +GVGYA+MVAPVYTAEVSPAS+RGFLTSF EVFIN GILLGYVSN+AF++LP  L
Sbjct  127  IGVGYAIMVAPVYTAEVSPASARGFLTSFTEVFINFGILLGYVSNYAFARLPLRL  181



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 885656638944