BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig2483

Length=1059
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AHW50672.1|  cadmium/zinc-transporting ATPase HMA1                   295   1e-88   Nicotiana tabacum [American tobacco]
ref|XP_009798582.1|  PREDICTED: LOW QUALITY PROTEIN: probable cad...    294   3e-88   Nicotiana sylvestris
ref|XP_009588513.1|  PREDICTED: LOW QUALITY PROTEIN: probable cad...    291   5e-87   
ref|XP_006339845.1|  PREDICTED: probable cadmium/zinc-transportin...    288   4e-86   Solanum tuberosum [potatoes]
ref|XP_004231883.1|  PREDICTED: probable cadmium/zinc-transportin...    282   7e-84   Solanum lycopersicum
gb|EYU44446.1|  hypothetical protein MIMGU_mgv1a001251mg                278   4e-82   Erythranthe guttata [common monkey flower]
ref|XP_011099314.1|  PREDICTED: probable cadmium/zinc-transportin...    277   6e-82   Sesamum indicum [beniseed]
gb|KGN63370.1|  hypothetical protein Csa_2G433360                       271   2e-79   Cucumis sativus [cucumbers]
ref|XP_004151907.1|  PREDICTED: probable cadmium/zinc-transportin...    270   3e-79   Cucumis sativus [cucumbers]
ref|XP_007208172.1|  hypothetical protein PRUPE_ppa001453mg             269   6e-79   Prunus persica
ref|XP_008462778.1|  PREDICTED: probable cadmium/zinc-transportin...    268   1e-78   Cucumis melo [Oriental melon]
ref|XP_008238762.1|  PREDICTED: probable cadmium/zinc-transportin...    268   2e-78   Prunus mume [ume]
gb|KDO79068.1|  hypothetical protein CISIN_1g003598mg                   259   1e-77   Citrus sinensis [apfelsine]
ref|XP_011006989.1|  PREDICTED: probable cadmium/zinc-transportin...    265   3e-77   Populus euphratica
ref|XP_010271184.1|  PREDICTED: probable cadmium/zinc-transportin...    265   3e-77   Nelumbo nucifera [Indian lotus]
ref|XP_006466544.1|  PREDICTED: probable cadmium/zinc-transportin...    263   2e-76   Citrus sinensis [apfelsine]
ref|XP_010652768.1|  PREDICTED: probable cadmium/zinc-transportin...    262   2e-76   Vitis vinifera
ref|XP_002524927.1|  heavy metal cation transport atpase, putative      263   2e-76   Ricinus communis
ref|XP_008391510.1|  PREDICTED: LOW QUALITY PROTEIN: probable cad...    262   3e-76   
gb|KDO79067.1|  hypothetical protein CISIN_1g003598mg                   261   3e-76   Citrus sinensis [apfelsine]
ref|XP_002278549.1|  PREDICTED: probable cadmium/zinc-transportin...    261   4e-76   Vitis vinifera
ref|XP_006425990.1|  hypothetical protein CICLE_v10024910mg             261   6e-76   Citrus clementina [clementine]
gb|KDO79066.1|  hypothetical protein CISIN_1g003598mg                   261   6e-76   Citrus sinensis [apfelsine]
gb|EPS71968.1|  hypothetical protein M569_02788                         259   2e-75   Genlisea aurea
ref|XP_010095321.1|  putative cadmium/zinc-transporting ATPase HMA1     259   4e-75   
gb|KJB43826.1|  hypothetical protein B456_007G218200                    258   8e-75   Gossypium raimondii
ref|XP_009367661.1|  PREDICTED: probable cadmium/zinc-transportin...    258   1e-74   Pyrus x bretschneideri [bai li]
ref|XP_010531262.1|  PREDICTED: probable cadmium/zinc-transportin...    257   2e-74   
ref|XP_010526719.1|  PREDICTED: probable cadmium/zinc-transportin...    255   1e-73   Tarenaya hassleriana [spider flower]
gb|KEH31492.1|  cadmium/zinc-transporting ATPase, putative              253   4e-73   Medicago truncatula
ref|XP_008462846.1|  PREDICTED: probable cadmium/zinc-transportin...    253   7e-73   Cucumis melo [Oriental melon]
ref|XP_010446681.1|  PREDICTED: probable cadmium/zinc-transportin...    253   9e-73   Camelina sativa [gold-of-pleasure]
ref|XP_012079313.1|  PREDICTED: probable cadmium/zinc-transportin...    253   1e-72   Jatropha curcas
ref|XP_007047396.1|  Heavy metal atpase 1                               252   1e-72   
ref|XP_004287993.1|  PREDICTED: probable cadmium/zinc-transportin...    252   2e-72   Fragaria vesca subsp. vesca
ref|XP_010437243.1|  PREDICTED: probable cadmium/zinc-transportin...    251   3e-72   Camelina sativa [gold-of-pleasure]
ref|XP_006283120.1|  hypothetical protein CARUB_v10004142mg             251   5e-72   
gb|AID81882.1|  heavy metal ATPase transporter 1                        250   6e-72   Camelina sativa [gold-of-pleasure]
ref|XP_010432071.1|  PREDICTED: probable cadmium/zinc-transportin...    250   8e-72   Camelina sativa [gold-of-pleasure]
gb|KHN02627.1|  Putative cadmium/zinc-transporting ATPase HMA1, c...    250   9e-72   Glycine soja [wild soybean]
ref|XP_010432073.1|  PREDICTED: probable cadmium/zinc-transportin...    250   9e-72   Camelina sativa [gold-of-pleasure]
gb|KCW59485.1|  hypothetical protein EUGRSUZ_H02227                     250   1e-71   Eucalyptus grandis [rose gum]
ref|XP_010070608.1|  PREDICTED: probable cadmium/zinc-transportin...    250   1e-71   Eucalyptus grandis [rose gum]
ref|XP_007155886.1|  hypothetical protein PHAVU_003G240100g             249   1e-71   Phaseolus vulgaris [French bean]
emb|CDP02541.1|  unnamed protein product                                249   2e-71   Coffea canephora [robusta coffee]
emb|CDY46080.1|  BnaA09g42040D                                          247   2e-71   Brassica napus [oilseed rape]
ref|XP_009137459.1|  PREDICTED: probable cadmium/zinc-transportin...    249   2e-71   Brassica rapa
emb|CDX75636.1|  BnaA01g00660D                                          248   3e-71   
ref|XP_008352532.1|  PREDICTED: probable cadmium/zinc-transportin...    245   4e-71   
emb|CAB90352.1|  putative metal ATPase                                  248   6e-71   Arabidopsis thaliana [mouse-ear cress]
gb|AAY34978.1|  chloroplast heavy metal P-type ATPase precursor         247   7e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002866960.1|  hypothetical protein ARALYDRAFT_490893             247   1e-70   
ref|XP_003550994.1|  PREDICTED: probable cadmium/zinc-transportin...    246   1e-70   Glycine max [soybeans]
ref|NP_195444.1|  putative cadmium/zinc-transporting ATPase HMA1        246   2e-70   Arabidopsis thaliana [mouse-ear cress]
gb|KFK30352.1|  hypothetical protein AALP_AA7G250400                    245   5e-70   Arabis alpina [alpine rockcress]
ref|XP_010417081.1|  PREDICTED: probable cadmium/zinc-transportin...    245   5e-70   Camelina sativa [gold-of-pleasure]
ref|XP_004509102.1|  PREDICTED: probable cadmium/zinc-transportin...    245   6e-70   Cicer arietinum [garbanzo]
ref|XP_006411908.1|  hypothetical protein EUTSA_v10024415mg             244   7e-70   Eutrema salsugineum [saltwater cress]
ref|XP_010679546.1|  PREDICTED: probable cadmium/zinc-transportin...    244   1e-69   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010927513.1|  PREDICTED: probable cadmium/zinc-transportin...    243   2e-69   Elaeis guineensis
ref|XP_010927512.1|  PREDICTED: probable cadmium/zinc-transportin...    243   2e-69   Elaeis guineensis
ref|XP_006295445.1|  hypothetical protein CARUB_v10024548mg             241   8e-69   Capsella rubella
ref|XP_010429275.1|  PREDICTED: probable cadmium/zinc-transportin...    241   2e-68   Camelina sativa [gold-of-pleasure]
gb|KFK32755.1|  hypothetical protein AALP_AA6G284800                    240   2e-68   Arabis alpina [alpine rockcress]
emb|CDX69288.1|  BnaC01g01650D                                          239   1e-67   
ref|XP_002878674.1|  hypothetical protein ARALYDRAFT_343887             235   2e-66   
ref|XP_009417706.1|  PREDICTED: probable cadmium/zinc-transportin...    234   6e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006404810.1|  hypothetical protein EUTSA_v10000049mg             232   3e-65   Eutrema salsugineum [saltwater cress]
ref|XP_011623220.1|  PREDICTED: probable cadmium/zinc-transportin...    224   1e-62   Amborella trichopoda
ref|XP_003560477.1|  PREDICTED: probable cadmium/zinc-transportin...    222   8e-62   Brachypodium distachyon [annual false brome]
dbj|BAJ89769.1|  predicted protein                                      220   4e-61   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEE66260.1|  hypothetical protein OsJ_22445                          218   2e-60   Oryza sativa Japonica Group [Japonica rice]
gb|EEC81219.1|  hypothetical protein OsI_24259                          218   3e-60   Oryza sativa Indica Group [Indian rice]
ref|NP_001058417.1|  Os06g0690700                                       218   3e-60   
ref|NP_001141444.1|  uncharacterized protein LOC100273554               215   5e-60   Zea mays [maize]
ref|XP_006656409.1|  PREDICTED: probable cadmium/zinc-transportin...    217   8e-60   Oryza brachyantha
gb|EMS57324.1|  putative cadmium/zinc-transporting ATPase HMA1, c...    215   1e-59   Triticum urartu
ref|XP_011623223.1|  PREDICTED: probable cadmium/zinc-transportin...    214   1e-59   
gb|AFW69218.1|  hypothetical protein ZEAMMB73_697863                    214   3e-59   
ref|XP_008681454.1|  PREDICTED: uncharacterized protein LOC100273...    214   5e-59   Zea mays [maize]
dbj|BAK06002.1|  predicted protein                                      214   8e-59   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CCC14999.1|  heavy metal ATPase 1                                   214   9e-59   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008338386.1|  PREDICTED: probable cadmium/zinc-transportin...    213   1e-58   
ref|XP_004966187.1|  PREDICTED: probable cadmium/zinc-transportin...    210   2e-57   Setaria italica
ref|XP_011623222.1|  PREDICTED: probable cadmium/zinc-transportin...    204   1e-55   
gb|EMT13424.1|  Putative cadmium/zinc-transporting ATPase HMA1, c...    201   2e-54   
ref|XP_010271194.1|  PREDICTED: probable cadmium/zinc-transportin...    198   2e-53   Nelumbo nucifera [Indian lotus]
ref|XP_008798716.1|  PREDICTED: probable cadmium/zinc-transportin...    189   2e-50   
ref|XP_008675719.1|  PREDICTED: probable cadmium/zinc-transportin...    174   2e-49   Zea mays [maize]
dbj|BAK05651.1|  predicted protein                                      181   3e-49   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS55611.1|  putative cadmium/zinc-transporting ATPase HMA1, c...    179   7e-47   Triticum urartu
ref|XP_006380686.1|  hypothetical protein POPTR_0007s104802g            161   2e-43   
ref|XP_002986489.1|  hypothetical protein SELMODRAFT_182418             169   4e-43   
ref|XP_002964908.1|  hypothetical protein SELMODRAFT_167322             169   4e-43   
gb|ERN05712.1|  hypothetical protein AMTR_s00006p00237340               164   1e-41   Amborella trichopoda
ref|XP_010417082.1|  PREDICTED: probable cadmium/zinc-transportin...    163   2e-41   Camelina sativa [gold-of-pleasure]
ref|XP_006383535.1|  hypothetical protein POPTR_0005s18650g             155   5e-40   
ref|XP_001762609.1|  predicted protein                                  156   1e-38   
ref|XP_001780815.1|  predicted protein                                  146   5e-35   
ref|XP_007153577.1|  hypothetical protein PHAVU_003G047300g           99.4    3e-22   Phaseolus vulgaris [French bean]
ref|XP_007514984.1|  cadmium-translocating P-type ATPase              83.6    5e-14   Bathycoccus prasinos
ref|XP_003060286.1|  p-type ATPase superfamily                        81.6    2e-13   Micromonas pusilla CCMP1545
ref|XP_002505330.1|  cation-transporting p-type ATPase                80.5    5e-13   Micromonas commoda
ref|WP_020355591.1|  MULTISPECIES: cadmium-translocating P-type A...  76.6    6e-12   Chlamydia
ref|WP_011006853.1|  HAD family hydrolase                             76.6    7e-12   Chlamydia caviae
emb|CEG01764.1|  Cation-transporting P-type ATPase, subfamily IB      76.6    8e-12   Ostreococcus tauri
ref|WP_014946276.1|  HAD family hydrolase                             75.5    2e-11   Chlamydia psittaci
ref|WP_014947277.1|  HAD family hydrolase                             75.5    2e-11   Chlamydia psittaci
ref|XP_001421458.1|  P-ATPase family transporter: cadmium ion         75.1    2e-11   Ostreococcus lucimarinus CCE9901
ref|XP_001421427.1|  P-ATPase family transporter: cadmium/zinc io...  75.1    2e-11   Ostreococcus lucimarinus CCE9901
ref|WP_006343557.1|  HAD family hydrolase                             74.7    3e-11   Chlamydia psittaci
gb|AEB55908.1|  cadmium-translocating P-type ATPase                   74.7    3e-11   Chlamydia psittaci 6BC
ref|WP_014946930.1|  HAD family hydrolase                             74.7    3e-11   Chlamydia psittaci
ref|WP_014945350.1|  HAD family hydrolase                             74.7    3e-11   Chlamydia psittaci
ref|XP_005645930.1|  heavy metal translocatin                         74.7    3e-11   Coccomyxa subellipsoidea C-169
ref|XP_005845243.1|  hypothetical protein CHLNCDRAFT_136900           74.7    4e-11   Chlorella variabilis
gb|EPJ19566.1|  cadmium-translocating P-type ATPase                   74.3    4e-11   Chlamydia psittaci 02DC23
ref|WP_010232691.1|  HAD family hydrolase                             74.3    4e-11   Chlamydia muridarum [agent of mouse pneumonitis]
ref|WP_035407486.1|  HAD family hydrolase                             74.3    5e-11   Chlamydia suis
ref|WP_006344470.1|  HAD family hydrolase                             73.9    6e-11   Chlamydia abortus
ref|WP_011097388.1|  HAD family hydrolase                             73.9    6e-11   Chlamydia abortus
ref|WP_010229366.1|  HAD family hydrolase                             73.6    7e-11   Chlamydia muridarum [agent of mouse pneumonitis]
ref|WP_011457672.1|  HAD family hydrolase                             72.8    1e-10   Chlamydia felis
ref|WP_014518218.1|  HAD family hydrolase                             72.4    2e-10   Chlamydia pneumoniae
ref|WP_010883503.1|  HAD family hydrolase                             72.4    2e-10   Chlamydia pneumoniae
gb|ETR79629.1|  Lead, cadmium, zinc and mercury transporting ATPase   72.4    2e-10   Chlamydia pneumoniae B21
ref|WP_010892244.1|  HAD family hydrolase                             72.4    2e-10   
ref|WP_006341401.1|  ATPase                                           70.5    7e-10   Parachlamydia acanthamoebae
ref|WP_039383686.1|  ATPase                                           70.1    1e-09   Neochlamydia sp. TUME1
ref|WP_044882722.1|  ATPase                                           70.1    1e-09   Neochlamydia sp. EPS4
gb|KIC72628.1|  putative cadmium/zinc-transporting ATPase HMA1, c...  69.7    1e-09   Neochlamydia sp. EPS4
ref|WP_042240439.1|  ATPase                                           69.7    1e-09   Neochlamydia sp. S13
ref|WP_020370598.1|  MULTISPECIES: cadmium-translocating P-type A...  69.3    2e-09   Chlamydia ibidis
ref|WP_012727986.1|  HAD family hydrolase                             68.6    3e-09   Chlamydia trachomatis
ref|WP_009872104.1|  HAD family hydrolase                             68.6    3e-09   Chlamydia trachomatis
ref|WP_014541063.1|  HAD family hydrolase                             68.6    3e-09   Chlamydia trachomatis
ref|WP_009872881.1|  HAD family hydrolase                             68.6    3e-09   Chlamydia trachomatis
gb|EYE60727.1|  cadmium-translocating P-type ATPase                   68.6    3e-09   Bacteroides fragilis str. S6L5
ref|WP_034734702.1|  HAD family hydrolase                             68.6    4e-09   
ref|WP_021828664.1|  cadmium-translocating P-type ATPase              68.2    4e-09   Chlamydia gallinacea
ref|WP_024010970.1|  cadmium-translocating P-type ATPase              68.2    4e-09   Chlamydia pecorum
ref|WP_012263550.1|  HAD family hydrolase                             68.2    4e-09   Chlamydia trachomatis
ref|WP_021756909.1|  cadmium-translocating P-type ATPase              68.2    4e-09   Chlamydia pecorum
ref|WP_009873330.1|  HAD family hydrolase                             68.2    4e-09   Chlamydia trachomatis
ref|WP_015506573.1|  zinc/cadmium/mercury/lead-transporting ATPase    68.2    4e-09   Chlamydia trachomatis
ref|WP_021757537.1|  cadmium-translocating P-type ATPase              68.2    4e-09   Chlamydia pecorum
gb|AEB41191.1|  cadmium-translocating P-type ATPase                   67.8    5e-09   Chlamydia pecorum E58
gb|ADI38979.1|  heavy metal translocating ATPase, P-type              67.8    6e-09   Waddlia chondrophila WSU 86-1044
ref|WP_041941913.1|  ATPase                                           67.8    6e-09   
ref|XP_005705513.1|  metal transporting P-type ATPase                 67.8    7e-09   Galdieria sulphuraria
ref|WP_042103685.1|  ATPase                                           67.4    7e-09   Parachlamydiaceae bacterium HS-T3
ref|WP_013942882.1|  ATPase                                           66.2    2e-08   Simkania negevensis
ref|WP_036097748.1|  ATPase                                           65.9    2e-08   Listeria floridensis
gb|EUJ30302.1|  cadmium-translocating P-type ATPase                   65.9    2e-08   Listeria floridensis FSL S10-1187
ref|XP_011400702.1|  putative cadmium/zinc-transporting ATPase HM...  64.7    5e-08   Auxenochlorella protothecoides
emb|CEG25651.1|  cadmium-transporting ATPase                          64.3    8e-08   Bacillus sp. B-jedd
ref|WP_042349864.1|  ATPase                                           63.9    1e-07   Bacillus massiliogorillae
ref|WP_010761167.1|  heavy metal translocating P-type ATPase          63.9    1e-07   
ref|WP_036081150.1|  ATPase                                           63.5    1e-07   Listeria cornellensis
ref|WP_040980550.1|  metal ABC transporter ATPase                     63.2    2e-07   Oceanobacillus jeddahense
ref|WP_007542749.1|  ATPase                                           62.8    2e-07   Listeria fleischmannii
gb|EPP35803.1|  E1-E2 ATPase family protein                           58.9    3e-07   Chlamydia psittaci 84-8471/1
ref|XP_001697106.1|  heavy metal transporting ATPase                  62.8    3e-07   Chlamydomonas reinhardtii
gb|ERE43186.1|  hypothetical protein N036_37020                       61.6    4e-07   
ref|WP_017473159.1|  metal ABC transporter ATPase                     62.0    4e-07   Amphibacillus jilinensis
ref|WP_036086498.1|  ATPase                                           61.6    5e-07   Listeria booriae
ref|WP_016837892.1|  hypothetical protein                             61.6    5e-07   Ureibacillus thermosphaericus
ref|WP_007473773.1|  cadmium-translocating P-type ATPase              61.6    5e-07   Listeria fleischmannii
gb|KIY94537.1|  Cd2+/Zn2+-exporting ATPase                            60.8    6e-07   Monoraphidium neglectum
ref|WP_027320967.1|  ATPase                                           61.2    6e-07   Bacillus sp. URHB0009
gb|EOL43279.1|  heavy metal translocating P-type ATPase               61.2    7e-07   Enterococcus caccae ATCC BAA-1240
ref|WP_034860433.1|  ATPase                                           61.2    7e-07   
ref|WP_028393088.1|  ATPase                                           61.2    8e-07   Bacillus cihuensis
ref|WP_027347512.1|  ATPase                                           60.8    8e-07   Helcococcus sueciensis
ref|WP_034564885.1|  ATPase                                           58.9    9e-07   
ref|WP_035508554.1|  MULTISPECIES: ATPase                             60.8    1e-06   
ref|WP_024336013.1|  hypothetical protein                             60.5    1e-06   
ref|WP_042957256.1|  metal ABC transporter ATPase                     60.8    1e-06   Enterococcus faecium
ref|WP_002320192.1|  metal ABC transporter ATPase                     60.8    1e-06   Lactobacillales
ref|WP_027109173.1|  metal ABC transporter ATPase                     60.5    1e-06   Lacticigenium naphtae
ref|WP_035019975.1|  metal ABC transporter ATPase                     60.5    1e-06   Carnobacterium sp. WN1374
ref|WP_002340522.1|  heavy metal translocating P-type ATPase          60.5    1e-06   Enterococcus faecium
ref|WP_034536052.1|  metal ABC transporter ATPase                     60.5    1e-06   Carnobacterium inhibens
ref|WP_016629416.1|  cadmium-exporting ATPase                         60.5    1e-06   Enterococcus faecium
ref|WP_002342449.1|  heavy metal translocating P-type ATPase          60.5    1e-06   Enterococcus faecium
gb|EJY50509.1|  cadmium-exporting ATPase                              60.5    1e-06   Enterococcus faecium 506
gb|EJX69301.1|  cadmium-exporting ATPase                              60.5    1e-06   Enterococcus faecium P1190
ref|WP_002333371.1|  heavy metal translocating P-type ATPase          60.5    1e-06   Enterococcus faecium
ref|WP_007209263.1|  metal ABC transporter ATPase                     60.5    1e-06   Enterococcus
ref|WP_003680028.1|  metal ABC transporter ATPase                     60.5    1e-06   
ref|WP_042350547.1|  ATPase                                           60.1    2e-06   Bacillus massiliogorillae
ref|WP_025868775.1|  ATPase                                           60.1    2e-06   Enterococcus sp. TR
ref|WP_002330461.1|  heavy metal translocating P-type ATPase          60.1    2e-06   Enterococcus faecium
ref|WP_002316687.1|  MULTISPECIES: metal ABC transporter ATPase       60.1    2e-06   Enterococcus faecium
ref|WP_044981713.1|  zinc ABC transporter ATPase                      60.1    2e-06   Treponema denticola
ref|WP_044981792.1|  zinc ABC transporter ATPase                      59.7    2e-06   Treponema denticola
ref|WP_038125441.1|  zinc ABC transporter ATPase                      59.7    2e-06   Treponema denticola
ref|WP_010956962.1|  zinc ABC transporter ATPase                      59.7    2e-06   Treponema denticola
ref|WP_036086878.1|  metal ABC transporter ATPase                     59.7    2e-06   Leuconostoc pseudomesenteroides
ref|WP_044956710.1|  zinc ABC transporter ATPase                      59.7    2e-06   Treponema denticola
ref|WP_044909868.1|  zinc ABC transporter ATPase                      59.7    2e-06   Treponema denticola
ref|WP_041101592.1|  ATPase                                           59.7    2e-06   Bacillus badius
ref|WP_025516432.1|  ATPase P                                         59.7    2e-06   Bordetella trematum
ref|WP_038133943.1|  zinc ABC transporter ATPase                      59.7    2e-06   Treponema denticola
ref|WP_002668757.1|  zinc ABC transporter ATPase                      59.7    2e-06   
ref|WP_009498466.1|  ATPase                                           59.7    2e-06   Sporosarcina newyorkensis
ref|WP_002694306.1|  heavy metal translocating P-type ATPase          59.7    2e-06   
ref|WP_044979779.1|  zinc ABC transporter ATPase                      59.7    2e-06   Treponema putidum
ref|WP_002677948.1|  heavy metal translocating P-type ATPase          59.7    2e-06   
ref|WP_034679548.1|  ATPase                                           59.7    2e-06   
ref|WP_037562329.1|  ATPase                                           59.7    2e-06   
gb|EKU93181.1|  heavy metal translocating P-type ATPase               59.7    3e-06   Alloiococcus otitis ATCC 51267
ref|WP_040292691.1|  metal ABC transporter ATPase                     59.3    3e-06   Alloiococcus otitis
ref|WP_002671414.1|  heavy metal translocating P-type ATPase          59.7    3e-06   
gb|EMB39506.1|  heavy metal translocating P-type ATPase               59.7    3e-06   Treponema denticola ATCC 33520
ref|WP_002682710.1|  heavy metal translocating P-type ATPase          59.7    3e-06   
ref|WP_002678967.1|  heavy metal translocating P-type ATPase          59.7    3e-06   
ref|WP_002693626.1|  heavy metal translocating P-type ATPase          59.3    3e-06   
gb|EMB28453.1|  heavy metal translocating P-type ATPase               59.3    3e-06   Treponema denticola MYR-T
dbj|BAL52802.1|  heavy metal translocating P-type ATPase              59.3    3e-06   uncultured prokaryote
ref|WP_005980210.1|  cadmium transporter                              59.3    3e-06   Fusobacterium ulcerans
ref|WP_036197655.1|  ATPase                                           59.3    3e-06   Lysinibacillus sinduriensis
ref|WP_041071254.1|  ATPase                                           58.9    4e-06   Bacillus sp. OxB-1
ref|WP_026800065.1|  ATPase                                           58.9    4e-06   Pontibacillus halophilus
gb|ADC50439.1|  cadmium-transporting ATPase                           58.9    4e-06   Bacillus pseudofirmus OF4
ref|WP_000359042.1|  hypothetical protein                             58.9    4e-06   Streptococcus agalactiae
ref|WP_041822606.1|  ATPase                                           58.9    4e-06   Bacillus pseudofirmus
dbj|BAQ08727.1|  cadmium-transporting atpase                          58.9    4e-06   Bacillus sp. OxB-1
gb|EHR70978.1|  heavy metal translocating P-type ATPase               58.9    4e-06   Burkholderiales bacterium JOSHI_001
gb|EUJ42440.1|  hypothetical protein PRIP_16482                       58.5    4e-06   Listeria riparia FSL S10-1204
ref|WP_044901964.1|  zinc ABC transporter ATPase                      58.9    4e-06   Treponema denticola
ref|WP_022553426.1|  MULTISPECIES: Cd2+/Zn2+-exporting ATPase         58.9    4e-06   Bacillus
ref|WP_002339352.1|  heavy metal translocating P-type ATPase          58.9    4e-06   Enterococcus faecium
ref|WP_044957998.1|  zinc ABC transporter ATPase                      58.9    4e-06   Treponema denticola
ref|WP_008695532.1|  cadmium transporter                              58.9    4e-06   Fusobacterium ulcerans
ref|WP_011983511.1|  ATPase                                           58.9    4e-06   Bacillus cytotoxicus
ref|WP_003560548.1|  metal ABC transporter ATPase                     58.9    4e-06   
ref|WP_003554122.1|  metal ABC transporter ATPase                     58.9    4e-06   Lactobacillus brevis
ref|WP_034551081.1|  metal ABC transporter ATPase                     58.5    5e-06   Carnobacterium funditum
ref|WP_002289122.1|  MULTISPECIES: ATPase                             58.5    5e-06   Enterococcus
ref|WP_010724018.1|  heavy metal translocating P-type ATPase          58.5    5e-06   Enterococcus faecium
ref|WP_002325689.1|  heavy metal translocating P-type ATPase          58.5    5e-06   Enterococcus faecium
ref|WP_002336973.1|  heavy metal translocating P-type ATPase          58.5    5e-06   Enterococcus faecium
ref|WP_010721499.1|  heavy metal translocating P-type ATPase          58.5    5e-06   Enterococcus faecium
ref|WP_002331817.1|  heavy metal translocating P-type ATPase          58.5    5e-06   Enterococcus faecium
ref|WP_002330209.1|  heavy metal translocating P-type ATPase          58.5    5e-06   Enterococcus faecium
ref|WP_010829689.1|  heavy metal translocating P-type ATPase          58.5    5e-06   Enterococcus faecium
ref|WP_043286157.1|  exopolyphosphatase                               58.5    5e-06   
gb|EPF36091.1|  heavy metal translocating P-type ATPase               58.5    5e-06   Treponema denticola SP32
ref|WP_010699290.1|  heavy metal translocating P-type ATPase          58.5    5e-06   
ref|WP_002328569.1|  heavy metal translocating P-type ATPase          58.5    5e-06   Enterococcus faecium
ref|WP_024635292.1|  ATPase                                           58.5    5e-06   Enterococcus faecium
ref|WP_002342654.1|  heavy metal translocating P-type ATPase          58.5    5e-06   Enterococcus faecium
ref|WP_002335670.1|  heavy metal translocating P-type ATPase          58.5    5e-06   Enterococcus
ref|WP_002329131.1|  heavy metal translocating P-type ATPase          58.5    5e-06   Enterococcus
ref|WP_002375354.1|  ATPase                                           58.5    5e-06   Enterococcus faecium
ref|WP_002318443.1|  ATPase                                           58.5    5e-06   Enterococcus faecium
ref|WP_040614154.1|  4-deoxy-4-formamido-L-arabinose-phospho-UDP ...  58.5    6e-06   
ref|WP_002315132.1|  ATPase                                           58.5    6e-06   Enterococcus faecium
ref|WP_002327074.1|  heavy metal translocating P-type ATPase          58.5    6e-06   Enterococcus faecium
ref|WP_002374485.1|  ATPase                                           58.5    6e-06   Enterococcus faecium
ref|WP_024636352.1|  ATPase                                           58.2    6e-06   Enterococcus faecium
ref|WP_002292184.1|  ATPase                                           58.2    6e-06   Enterococcus faecium
ref|WP_029268008.1|  ATPase                                           58.2    6e-06   Virgibacillus alimentarius
ref|WP_010724580.1|  heavy metal translocating P-type ATPase          58.2    6e-06   Enterococcus faecium
ref|WP_002287715.1|  metal ABC transporter ATPase                     58.2    6e-06   
ref|WP_029317724.1|  ATPase                                           58.2    6e-06   Bacillus subtilis
ref|WP_028457539.1|  ATPase P                                         58.2    6e-06   Chloroflexus sp. Y-396-1
gb|EEV50567.1|  conserved hypothetical protein                        58.2    6e-06   Enterococcus faecium 1,141,733
ref|WP_031791151.1|  metal ABC transporter ATPase                     58.2    7e-06   Staphylococcus
dbj|GAK48745.1|  metal ABC transporter ATPase                         58.2    7e-06   Lactobacillus oryzae JCM 18671
ref|WP_013774134.1|  ATPase                                           58.2    7e-06   Melissococcus plutonius
ref|WP_015694819.1|  ATPase                                           58.2    7e-06   Melissococcus plutonius
ref|WP_034529764.1|  metal ABC transporter ATPase                     58.2    7e-06   Lactobacillus oryzae
ref|WP_038100228.1|  metal ABC transporter ATPase                     58.2    7e-06   Vagococcus lutrae
ref|WP_010732699.1|  heavy metal translocating P-type ATPase          58.2    7e-06   Enterococcus faecium
ref|WP_010697145.1|  heavy metal translocating P-type ATPase          58.2    7e-06   
gb|EST90777.1|  hypothetical protein T233_00048                       58.2    8e-06   Vagococcus lutrae LBD1
ref|WP_036070921.1|  ATPase                                           58.2    8e-06   Listeria aquatica
ref|WP_016853403.1|  ATPase                                           57.8    8e-06   
ref|WP_036559710.1|  4-deoxy-4-formamido-L-arabinose-phospho-UDP ...  58.2    8e-06   
ref|WP_040340381.1|  ATPase                                           57.8    8e-06   
gb|EIT86136.1|  heavy metal translocating P-type ATPase               57.8    8e-06   
gb|EJY49864.1|  cadmium-exporting ATPase                              57.8    9e-06   
ref|WP_004561556.1|  metal ABC transporter ATPase                     57.8    9e-06   
ref|WP_002345072.1|  ATPase                                           57.8    9e-06   
ref|WP_042454873.1|  ATPase                                           57.8    9e-06   
ref|WP_017369570.1|  metal ABC transporter ATPase                     57.8    1e-05   
ref|WP_031942292.1|  lead-, cadmium-, zinc- and mercury-transport...  57.8    1e-05   
ref|WP_003134160.1|  MULTISPECIES: metal ABC transporter ATPase       57.8    1e-05   
ref|WP_035445801.1|  metal ABC transporter ATPase                     57.4    1e-05   
ref|WP_005951419.1|  cadmium transporter                              57.4    1e-05   
ref|WP_003107290.1|  cation-transporting ATPase                       57.4    1e-05   
ref|WP_031459595.1|  ATPase P                                         57.4    1e-05   
ref|WP_039232900.1|  ATPase                                           57.4    1e-05   
ref|WP_003102764.1|  cation-transporting ATPase                       57.4    1e-05   
ref|WP_020061152.1|  ATPase                                           57.4    1e-05   
ref|WP_040037312.1|  MULTISPECIES: ATPase                             57.4    1e-05   
gb|EWS56606.1|  Cation-transporting ATPase PacS                       57.0    1e-05   
ref|WP_033534661.1|  ATPase P                                         57.4    1e-05   
ref|WP_045207259.1|  ATPase                                           57.4    1e-05   
ref|WP_035028446.1|  metal ABC transporter ATPase                     57.4    1e-05   
ref|WP_038457830.1|  MULTISPECIES: ATPase                             57.4    1e-05   
ref|WP_032871334.1|  ATPase                                           57.0    1e-05   
gb|KDP59308.1|  HAD ATPase, P-type, family IC domain protein          54.7    1e-05   
ref|WP_043021227.1|  ATPase                                           57.0    1e-05   
ref|WP_032603983.1|  metal ABC transporter ATPase                     54.7    1e-05   
ref|WP_010739118.1|  heavy metal translocating P-type ATPase          57.0    2e-05   
ref|WP_045749172.1|  hypothetical protein                             57.0    2e-05   
ref|WP_007409595.1|  MULTISPECIES: ATPase                             57.0    2e-05   
ref|WP_016180290.1|  cadmium-translocating P-type ATPase              57.0    2e-05   
ref|WP_020955734.1|  Zinc-transporting ATPase                         57.0    2e-05   
ref|WP_014417593.1|  MULTISPECIES: ATPase                             57.0    2e-05   
ref|WP_044801339.1|  ATPase                                           57.0    2e-05   
ref|WP_003154661.1|  ATPase                                           57.0    2e-05   
ref|WP_043867044.1|  ATPase                                           57.0    2e-05   
ref|WP_015388309.1|  ATPase                                           57.0    2e-05   
gb|ACZ39703.1|  heavy metal translocating P-type ATPase               57.0    2e-05   
ref|WP_041018267.1|  ATPase                                           57.0    2e-05   
ref|WP_039062989.1|  ATPase                                           57.0    2e-05   
ref|WP_044053151.1|  ATPase                                           57.0    2e-05   
ref|WP_024085232.1|  ATPase                                           57.0    2e-05   
ref|WP_015322842.1|  heavy metal translocating P-type ATPase          57.0    2e-05   
ref|WP_039251630.1|  ATPase                                           57.0    2e-05   
ref|WP_010744898.1|  heavy metal translocating P-type ATPase          57.0    2e-05   
ref|WP_007611033.1|  MULTISPECIES: ATPase                             57.0    2e-05   
ref|WP_014304908.1|  ATPase                                           57.0    2e-05   
ref|WP_017417664.1|  MULTISPECIES: ATPase                             57.0    2e-05   
gb|EUJ40176.1|  cadmium-transporting ATPase                           57.0    2e-05   
ref|WP_041400130.1|  metal ABC transporter ATPase                     57.0    2e-05   
ref|WP_035314277.1|  ATPase                                           56.6    2e-05   
ref|WP_031882951.1|  metal ABC transporter ATPase                     55.5    2e-05   
ref|WP_028274880.1|  metal ABC transporter ATPase                     56.6    2e-05   
ref|WP_010766182.1|  heavy metal translocating P-type ATPase          56.6    2e-05   
emb|CEN27601.1|  Zinc-transporting ATPase                             56.6    2e-05   
ref|WP_012256757.1|  MULTISPECIES: ATPase P                           56.6    2e-05   
ref|WP_028119528.1|  metal ABC transporter ATPase                     56.6    2e-05   
gb|ERN55038.1|  ATPase                                                56.6    2e-05   
ref|WP_033376188.1|  metal ABC transporter ATPase                     56.2    2e-05   
ref|WP_031311282.1|  ATPase                                           56.2    2e-05   
ref|WP_040832570.1|  metal ABC transporter ATPase                     56.2    2e-05   
ref|WP_036820973.1|  ATPase                                           56.2    3e-05   
ref|WP_043098269.1|  hypothetical protein                             56.6    3e-05   
ref|WP_005559331.1|  cadmium-translocating P-type ATPase              56.2    3e-05   
gb|KGP72076.1|  ATPase                                                56.2    3e-05   
gb|EHI68614.1|  putative cadmium-exporting ATPase                     56.2    3e-05   
ref|WP_028986505.1|  ATPase                                           56.2    3e-05   
ref|WP_024716269.1|  ATPase                                           56.2    3e-05   
gb|EWV08577.1|  hypothetical protein U622_02719                       55.5    3e-05   
ref|WP_045406961.1|  metal ABC transporter ATPase                     56.2    3e-05   
gb|AEF25982.1|  ppGpp synthetase                                      56.2    3e-05   
ref|WP_002835879.1|  zinc ABC transporter ATPase                      56.2    3e-05   
gb|EEV48955.1|  copper-transporting ATPase copA                       56.2    3e-05   
ref|WP_003105468.1|  metal ABC transporter ATPase                     56.2    3e-05   
ref|WP_004235360.1|  Lead, cadmium, zinc and mercury transporting...  55.8    3e-05   
ref|WP_002301365.1|  MULTISPECIES: metal ABC transporter ATPase       55.8    3e-05   
ref|WP_031907941.1|  metal ABC transporter ATPase                     55.5    3e-05   
ref|WP_041828740.1|  metal ABC transporter ATPase                     55.8    3e-05   
ref|WP_034552629.1|  ATPase                                           55.8    3e-05   
ref|WP_024572582.1|  ATPase                                           55.5    4e-05   
gb|EYF79795.1|  hypothetical protein V542_02636                       55.5    4e-05   
ref|WP_040373935.1|  ATPase                                           55.8    4e-05   
ref|WP_001083764.1|  ATPase                                           55.8    4e-05   
ref|WP_040517026.1|  ATPase                                           55.8    4e-05   
ref|WP_002841763.1|  zinc ABC transporter ATPase                      55.8    4e-05   
ref|WP_035413801.1|  ATPase                                           55.8    4e-05   
ref|WP_041450371.1|  metal ABC transporter ATPase                     55.8    4e-05   
dbj|BAM48289.1|  cation-transporting ATPase                           55.8    4e-05   
ref|WP_024029729.1|  cadmium-transporting ATPase                      55.8    4e-05   
ref|WP_034700671.1|  ATPase                                           55.8    4e-05   
ref|WP_016252292.1|  hypothetical protein                             55.8    4e-05   
ref|WP_024531627.1|  metal ABC transporter ATPase                     55.5    5e-05   
gb|EVI29343.1|  hypothetical protein T968_02574                       55.5    5e-05   
ref|WP_016202306.1|  cadmium-transporting ATPase                      55.5    5e-05   
ref|WP_001083762.1|  MULTISPECIES: ATPase                             55.5    5e-05   
ref|WP_001083761.1|  ATPase                                           55.5    5e-05   
ref|WP_042351800.1|  ATPase                                           55.5    5e-05   
ref|WP_019258249.1|  ATPase                                           55.5    5e-05   
ref|WP_001083763.1|  ATPase                                           55.5    5e-05   
gb|EQM96945.1|  heavy metal translocating P-type ATPase               55.5    5e-05   
ref|WP_040507891.1|  hypothetical protein                             55.5    5e-05   
ref|WP_003347842.1|  ATPase                                           55.5    5e-05   
gb|EXU80424.1|  ATPase P                                              55.5    5e-05   
ref|WP_035112012.1|  zinc ABC transporter ATPase                      55.5    6e-05   
ref|WP_036151842.1|  ATPase                                           55.5    6e-05   
ref|WP_035022993.1|  metal ABC transporter ATPase                     55.5    6e-05   
gb|EPJ32835.1|  cadmium-translocating P-type ATPase domain protein    52.8    6e-05   
ref|WP_025871198.1|  metal ABC transporter ATPase                     55.5    6e-05   
ref|WP_043931357.1|  ATPase                                           55.1    6e-05   
ref|WP_042509879.1|  metal ABC transporter ATPase                     55.1    6e-05   
ref|WP_003238966.1|  cadmium-translocating P-type ATPase              55.1    6e-05   
ref|WP_035434466.1|  ATPase                                           55.1    6e-05   
ref|WP_026908214.1|  ATPase                                           55.1    6e-05   
ref|WP_010780718.1|  heavy metal translocating P-type ATPase          55.1    6e-05   
ref|WP_011593070.1|  cadmium transporter                              55.1    6e-05   
ref|WP_029565459.1|  ATPase                                           55.1    6e-05   
ref|WP_035318989.1|  ATPase                                           55.1    6e-05   
gb|KEZ52710.1|  ATPase                                                55.1    6e-05   
ref|WP_045267822.1|  4-deoxy-4-formamido-L-arabinose-phospho-UDP ...  55.1    6e-05   
ref|WP_031916069.1|  metal ABC transporter ATPase                     55.1    6e-05   
ref|WP_031903424.1|  metal ABC transporter ATPase                     55.1    6e-05   
ref|WP_031783917.1|  metal ABC transporter ATPase                     55.1    7e-05   
ref|WP_003010378.1|  ATPase                                           55.1    7e-05   
ref|XP_005538949.1|  probable metal-transporting ATPase               55.1    7e-05   
gb|ENN32489.1|  heavy metal translocating P-type ATPase               55.1    7e-05   
ref|WP_031920865.1|  metal ABC transporter ATPase                     55.1    7e-05   
gb|ACB76762.1|  heavy metal translocating P-type ATPase               55.1    7e-05   
ref|WP_030137542.1|  metal ABC transporter ATPase                     55.1    7e-05   
gb|ACM17521.1|  copper-transporting ATPase CopA                       55.1    7e-05   
ref|WP_000790094.1|  metal ABC transporter ATPase                     55.1    7e-05   
ref|WP_043382493.1|  4-deoxy-4-formamido-L-arabinose-phospho-UDP ...  55.1    7e-05   
ref|WP_002485723.1|  MULTISPECIES: metal ABC transporter ATPase       55.1    7e-05   
gb|AGX31683.1|  cadmium and zinc resistance protein C                 55.1    7e-05   
ref|WP_042974911.1|  ATPase                                           55.1    7e-05   
ref|WP_003245873.1|  zinc-transporting ATPase                         55.1    7e-05   
gb|EZS41483.1|  hypothetical protein W583_02276                       55.1    7e-05   
gb|EEL47531.1|  Cadmium-transporting ATPase                           53.1    7e-05   
ref|WP_008419693.1|  cadmium-translocating P-type ATPase              55.1    7e-05   
ref|WP_011082543.1|  metal ABC transporter ATPase                     55.1    7e-05   
ref|WP_044891859.1|  ATPase                                           55.1    7e-05   
ref|WP_014113598.1|  ATPase                                           55.1    7e-05   
ref|WP_031797851.1|  metal ABC transporter ATPase                     55.1    7e-05   
ref|WP_043940109.1|  ATPase                                           55.1    7e-05   
ref|WP_041905256.1|  ATPase                                           55.1    7e-05   
gb|ABU58325.1|  heavy metal translocating P-type ATPase               55.1    7e-05   
ref|WP_037291410.1|  ATPase                                           55.1    7e-05   
ref|WP_021479402.1|  ATPase                                           55.1    7e-05   
ref|WP_031920603.1|  metal ABC transporter ATPase                     55.1    7e-05   
ref|WP_036460578.1|  metal ABC transporter ATPase                     54.7    8e-05   
ref|WP_017192150.1|  MULTISPECIES: hypothetical protein               55.1    8e-05   
ref|WP_036178014.1|  ATPase                                           54.7    8e-05   
ref|WP_007124776.1|  cobalt ABC transporter ATP-binding protein       54.7    8e-05   
ref|WP_017754411.1|  hypothetical protein                             54.7    8e-05   
ref|WP_003218630.1|  ATPase                                           54.7    8e-05   
ref|WP_041330662.1|  ATPase P                                         55.1    8e-05   
ref|WP_017175150.1|  MULTISPECIES: metal ABC transporter ATPase       54.7    8e-05   
ref|WP_044427787.1|  ATPase                                           54.7    8e-05   
ref|WP_038427624.1|  ATPase                                           54.7    9e-05   
ref|WP_007131707.1|  ATPase                                           54.7    9e-05   
ref|WP_003232436.1|  ATPase                                           54.7    9e-05   
gb|EOH98123.1|  heavy metal translocating P-type ATPase               54.7    9e-05   
ref|WP_034692404.1|  metal ABC transporter ATPase                     54.7    9e-05   
ref|WP_028405755.1|  ATPase                                           54.7    9e-05   
ref|WP_026858752.1|  metal ABC transporter ATPase                     54.7    9e-05   
ref|WP_041334447.1|  ATPase                                           54.7    9e-05   
ref|WP_032721444.1|  ATPase                                           54.7    9e-05   
ref|WP_014479642.1|  hypothetical protein                             54.7    9e-05   
ref|WP_045926890.1|  ATPase                                           54.7    9e-05   
ref|WP_033884240.1|  ATPase                                           54.7    9e-05   
ref|WP_015252204.1|  hypothetical protein                             54.7    9e-05   
ref|WP_014476642.1|  ATPase                                           54.7    9e-05   
ref|WP_042981688.1|  ATPase                                           54.7    9e-05   
ref|WP_029946375.1|  ATPase                                           54.7    9e-05   
ref|WP_041052614.1|  ATPase                                           54.7    9e-05   
ref|WP_038428887.1|  ATPase                                           54.7    9e-05   
ref|WP_017695055.1|  ATPase                                           54.7    9e-05   
ref|WP_010770671.1|  heavy metal translocating P-type ATPase          54.7    1e-04   
ref|WP_041344830.1|  ATPase                                           54.7    1e-04   
ref|WP_015383522.1|  Zn transporter                                   54.7    1e-04   
ref|WP_015715795.1|  ATPase                                           54.7    1e-04   
ref|WP_041337669.1|  ATPase                                           54.7    1e-04   
ref|WP_016936327.1|  ATPase                                           54.7    1e-04   
emb|CEG30698.1|  cadmium-transporting ATPase                          54.7    1e-04   
ref|WP_016175597.1|  cadmium-translocating P-type ATPase              54.3    1e-04   
ref|WP_041351232.1|  ATPase                                           54.7    1e-04   
ref|WP_036091458.1|  ATPase                                           54.3    1e-04   
ref|WP_010753770.1|  heavy metal translocating P-type ATPase          54.7    1e-04   
ref|WP_040929166.1|  metal ABC transporter ATPase                     54.3    1e-04   
gb|ABX81072.1|  cation-transporting ATPase, P-type                    54.3    1e-04   
ref|WP_021728442.1|  heavy metal-transporting ATPase                  54.3    1e-04   
ref|WP_021003340.1|  cadmium-translocating P-type ATPase              54.3    1e-04   
ref|WP_020999266.1|  cadmium-translocating P-type ATPase              54.3    1e-04   
ref|WP_041634641.1|  hypothetical protein                             54.3    1e-04   
ref|WP_028402278.1|  ATPase                                           54.3    1e-04   
ref|WP_042413310.1|  4-deoxy-4-formamido-L-arabinose-phospho-UDP ...  54.3    1e-04   
ref|WP_003075374.1|  metal ABC transporter ATPase                     54.3    1e-04   
ref|WP_040852737.1|  ATPase                                           54.3    1e-04   
ref|WP_009569681.1|  cadmium-translocating P-type ATPase              54.3    1e-04   
dbj|BAK53129.1|  copper-transporting ATPase                           54.3    1e-04   
gb|AGN25071.1|  heavy metal-translocating P-type ATPase               54.3    1e-04   
ref|WP_035032282.1|  ATPase                                           54.3    1e-04   
ref|WP_013710819.1|  metal ABC transporter ATPase                     54.3    1e-04   
ref|WP_037625904.1|  metal ABC transporter ATPase                     54.3    1e-04   
ref|WP_036832753.1|  ATPase                                           54.3    1e-04   
gb|KFF56830.1|  ATPase                                                54.3    1e-04   
ref|WP_006093365.1|  ATPase                                           54.3    1e-04   
ref|WP_034886626.1|  ATPase                                           54.3    1e-04   
gb|EFY08493.1|  cadmium-exporting ATPase                              54.3    1e-04   
ref|WP_043857396.1|  ATPase                                           54.3    1e-04   
ref|WP_010761639.1|  heavy metal translocating P-type ATPase          54.3    1e-04   
gb|EIM05771.1|  cadmium-transporting ATPase                           54.3    1e-04   
ref|WP_003141851.1|  metal ABC transporter ATPase                     54.3    1e-04   
ref|WP_011701452.1|  ATPase                                           54.3    1e-04   
ref|WP_013852427.1|  ATPase                                           53.9    1e-04   
gb|EHL76581.1|  heavy metal translocating P-type ATPase               53.9    1e-04   
ref|WP_044739903.1|  ATPase                                           53.9    1e-04   
ref|WP_032874714.1|  ATPase                                           53.9    1e-04   
ref|WP_002304112.1|  ppGpp synthetase                                 53.9    1e-04   
ref|WP_013352051.1|  ATPase                                           53.9    1e-04   
ref|WP_033795007.1|  ATPase                                           53.9    1e-04   



>gb|AHW50672.1| cadmium/zinc-transporting ATPase HMA1 [Nicotiana tabacum]
Length=805

 Score =   295 bits (755),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 181/281 (64%), Positives = 211/281 (75%), Gaps = 5/281 (2%)
 Frame = +1

Query  220   MEALRFQASFTQLELSVYKtrtrrrrLAAHRNLQLYPARCAAAFVLTPRAAYLRR--CYV  393
             MEALR   SF  +  S+YKTR R   +  +RN+ L   +   +  +     +  R  C  
Sbjct  1     MEALRLSTSFAGINFSIYKTRRR---IKVNRNVLLSSLKSKPSISIRSSTQFRGRIHCAA  57

Query  394   SSCSahnhnhghdhnhahrhhhhgddESDDEQLTKPQEVLLKFADAIRWSHLANFLREHL  573
              +C   +H+H H  +     HHH   +  D +LTK QE+ LKFA AIRW+HLAN LREHL
Sbjct  58    CNCGHSHHHHHHHDHEHGHDHHHHGHDEGDGKLTKSQELFLKFARAIRWTHLANILREHL  117

Query  574   ElccssaalfiaaaacPYVLPKPAVKPLQRAFAVIAFPLVGVSASLDALMDVAGGKINIH  753
             ELCC SAALFIAAAACPY LP+PAV PLQR F +IAFPLVGVSASLDALMD+ GGKINIH
Sbjct  118   ELCCCSAALFIAAAACPYFLPQPAVLPLQRVFTLIAFPLVGVSASLDALMDITGGKINIH  177

Query  754   VLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTRCSKVDVKELKENHPDFALLLDV  933
             VLMALA FASVFMGN LEGGLLLAMFNLAHIAEE+FT  SK DVKELKENHP+FAL+L V
Sbjct  178   VLMALAAFASVFMGNILEGGLLLAMFNLAHIAEEYFTSRSKGDVKELKENHPEFALVLHV  237

Query  934   NNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVDCEV  1056
             +N++ PSF+DL Y +VPVSDL+VGSFILV+AGESVPVDCEV
Sbjct  238   DNQTLPSFADLTYSEVPVSDLEVGSFILVKAGESVPVDCEV  278



>ref|XP_009798582.1| PREDICTED: LOW QUALITY PROTEIN: probable cadmium/zinc-transporting 
ATPase HMA1, chloroplastic [Nicotiana sylvestris]
Length=802

 Score =   294 bits (752),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 183/279 (66%), Positives = 216/279 (77%), Gaps = 7/279 (3%)
 Frame = +1

Query  220   MEALRFQASFTQLELSVYKtrtrrrrLAAHRNLQLYPARCAAAFVLTPRAAYLRRCYVSS  399
             MEALR   SFT +  S+YKTR R   +  +RN+ L   +   +  +     +  R + ++
Sbjct  1     MEALRLSTSFTGINCSIYKTRRR---IKVNRNVLLSSLKPKPSISIRSSTQFRSRIHCAA  57

Query  400   CSahnhnhghdhnhahrhhhhgddESDDEQLTKPQEVLLKFADAIRWSHLANFLREHLEl  579
             C+  + +H H H+H H HHH      DD +LTK QE+ LKFA AIRW+HLAN LREHLEL
Sbjct  58    CNCGHSHHDHSHDHHHHHHH----GHDDGKLTKSQELFLKFARAIRWTHLANILREHLEL  113

Query  580   ccssaalfiaaaacPYVLPKPAVKPLQRAFAVIAFPLVGVSASLDALMDVAGGKINIHVL  759
             CC SAALFIAAAACPY LP+PAV PLQR F +IAFPLVGVSASLDALMD+ GGKINIHVL
Sbjct  114   CCCSAALFIAAAACPYFLPQPAVLPLQRVFTLIAFPLVGVSASLDALMDITGGKINIHVL  173

Query  760   MALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTRCSKVDVKELKENHPDFALLLDVNN  939
             MALA FASVFMGN LEGGLLLAMFNLAHIAE++FT  SK DVKELKENHP+FAL+L V+N
Sbjct  174   MALAAFASVFMGNILEGGLLLAMFNLAHIAEDYFTSRSKGDVKELKENHPEFALVLHVDN  233

Query  940   ESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVDCEV  1056
             ++ PSF+DL Y +VPVSDL+VGSFILV+AGESVPVDCEV
Sbjct  234   QTLPSFADLTYSEVPVSDLEVGSFILVKAGESVPVDCEV  272



>ref|XP_009588513.1| PREDICTED: LOW QUALITY PROTEIN: probable cadmium/zinc-transporting 
ATPase HMA1, chloroplastic [Nicotiana tomentosiformis]
Length=812

 Score =   291 bits (744),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 179/285 (63%), Positives = 212/285 (74%), Gaps = 9/285 (3%)
 Frame = +1

Query  220   MEALRFQASFTQLELSVYKtrtrrrrLAAHRNLQLYPARCAAAFVLTPRAAYLRRCYVSS  399
             MEALR   SF  +  S+YKTR R   +  +RN+ L   +   +  +     +  R + ++
Sbjct  1     MEALRLSTSFAGINCSIYKTRRR---IKVNRNVLLSSLKSKPSISIRSSTQFRGRIHCAA  57

Query  400   CS------ahnhnhghdhnhahrhhhhgddESDDEQLTKPQEVLLKFADAIRWSHLANFL  561
             C+       H+H+     +     HHH   +  D +LTK QE+ LKFA AIRW+HLAN L
Sbjct  58    CNCGHSHHHHHHHDHDHDHEHGHDHHHHGHDEGDGKLTKSQELFLKFARAIRWTHLANIL  117

Query  562   REHLElccssaalfiaaaacPYVLPKPAVKPLQRAFAVIAFPLVGVSASLDALMDVAGGK  741
             REHLELCC SAALFIAAAACPY LP+PAV PLQR F +IAFPLVGVSASLDALMD+ GGK
Sbjct  118   REHLELCCCSAALFIAAAACPYFLPQPAVLPLQRVFTLIAFPLVGVSASLDALMDITGGK  177

Query  742   INIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTRCSKVDVKELKENHPDFAL  921
             INIHVLMALA FASVFMGN LEGGLLLAMFNLAHIAEE+FT  SK DVKELKENHP+FAL
Sbjct  178   INIHVLMALAAFASVFMGNILEGGLLLAMFNLAHIAEEYFTSRSKGDVKELKENHPEFAL  237

Query  922   LLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVDCEV  1056
             +L V+N++ PSF+DL Y +VPVSDL+VGSFILV+AGESVPVDCEV
Sbjct  238   VLHVDNQTLPSFADLTYSEVPVSDLEVGSFILVKAGESVPVDCEV  282



>ref|XP_006339845.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic-like 
[Solanum tuberosum]
Length=817

 Score =   288 bits (738),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 181/284 (64%), Positives = 215/284 (76%), Gaps = 8/284 (3%)
 Frame = +1

Query  220   MEALRFQASFTQLELSVYKtrtrrrrLAAHRNLQLYPARCAAAFVLTPRAAYLRRCYVSS  399
             MEALR   SF  +  S+YK+  R   L  +RNL L   +  ++  +   A +  R + S+
Sbjct  1     MEALRLSTSFAGINCSIYKSTRR---LKVNRNLLLSSLKPKSSVPIRSSAQFRGRIHCSA  57

Query  400   CSahnhnhghdhnhahrhhhhgdd-----ESDDEQLTKPQEVLLKFADAIRWSHLANFLR  564
             CS  +H+H H H+     HH+        +  D +LTK QEV LKFA+AIRW+ LAN+LR
Sbjct  58    CSCSSHSHHHHHHDHSHDHHNHHHHHHGPDEGDGKLTKFQEVFLKFANAIRWTQLANYLR  117

Query  565   EHLElccssaalfiaaaacPYVLPKPAVKPLQRAFAVIAFPLVGVSASLDALMDVAGGKI  744
             E+LELCC SA LFIAAA CPY LPKPAV PLQR FA+IAFPLVGVSASLDAL+D+ GGKI
Sbjct  118   ENLELCCCSAVLFIAAAVCPYFLPKPAVLPLQRIFALIAFPLVGVSASLDALVDITGGKI  177

Query  745   NIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTRCSKVDVKELKENHPDFALL  924
             NIHVLMALA FASVFMGN LEGGLLLAMFNLAHIAEE+FT  SK DVKELKENHP+FAL+
Sbjct  178   NIHVLMALAAFASVFMGNVLEGGLLLAMFNLAHIAEEYFTSRSKGDVKELKENHPEFALV  237

Query  925   LDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVDCEV  1056
             L V+N++ PSF+DL Y +VPVSDL+VGSFILV+AGESVPVDCEV
Sbjct  238   LHVDNQTLPSFTDLSYIEVPVSDLEVGSFILVKAGESVPVDCEV  281



>ref|XP_004231883.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
[Solanum lycopersicum]
Length=821

 Score =   282 bits (722),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 180/288 (63%), Positives = 214/288 (74%), Gaps = 12/288 (4%)
 Frame = +1

Query  220   MEALRFQASFTQLELSVYKtrtrrrrLAAHRNLQLYPARCAAAFVLTPRAAYLRRCYVSS  399
             MEALR   SF+ +  S+YK+  R   L  +RNL     +  ++  +   A +  R + S+
Sbjct  1     MEALRLSTSFSGINCSIYKSTRR---LKVNRNLLFSSLKPISSVPIRSSAQFRGRIHCSA  57

Query  400   CSahnhnhghdhnhahrhhhhgddE---------SDDEQLTKPQEVLLKFADAIRWSHLA  552
             CS  +H+H H H+H    H H +             D +LTK QEV LKFA+AIRW+ LA
Sbjct  58    CSCSSHSHQHHHHHHDHSHDHHNHHHHHHHHGHDEGDGKLTKFQEVFLKFANAIRWTQLA  117

Query  553   NFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRAFAVIAFPLVGVSASLDALMDVA  732
             N+LRE+LELCC SA LFIAAA CPY LP PAV PLQR FA+IAFPLVGVSASLDAL+D+ 
Sbjct  118   NYLRENLELCCCSAVLFIAAAVCPYFLPGPAVLPLQRIFALIAFPLVGVSASLDALVDIT  177

Query  733   GGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTRCSKVDVKELKENHPD  912
             GGKINIHVLMALA FASVFMGN LEGGLLLAMFNLAHIAEE+FT  SK DVKELKENHP+
Sbjct  178   GGKINIHVLMALAAFASVFMGNVLEGGLLLAMFNLAHIAEEYFTSRSKGDVKELKENHPE  237

Query  913   FALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVDCEV  1056
             FAL+L V+N++ PSF+DL Y +VPVSDL+VGSFILV+AGESVPVDCEV
Sbjct  238   FALVLHVDNQTLPSFTDLSYIEVPVSDLEVGSFILVKAGESVPVDCEV  285



>gb|EYU44446.1| hypothetical protein MIMGU_mgv1a001251mg [Erythranthe guttata]
Length=853

 Score =   278 bits (711),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 148/190 (78%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = +1

Query  490   LTKPQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRAF  669
             LTKPQE  L+FA+ I+W+ LANFLREHLELCC +AALF+AAAACPY+LPKPAVKPLQ AF
Sbjct  136   LTKPQESFLRFAERIKWADLANFLREHLELCCCAAALFLAAAACPYLLPKPAVKPLQTAF  195

Query  670   AVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIA  849
             +++AFPLVGVSAS DA MD+ GGKINIHVLMALA FASVFMGN LEGGLLLAMFNLAHIA
Sbjct  196   SLVAFPLVGVSASFDAAMDIVGGKINIHVLMALAAFASVFMGNPLEGGLLLAMFNLAHIA  255

Query  850   EEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAG  1029
             EE+FT  SK+DVKELKENHP+FA  LDV N +  SFSDL Y KVPV+DL+VGS++LV+AG
Sbjct  256   EEYFTSRSKIDVKELKENHPEFAYELDVQNGNFQSFSDLMYHKVPVNDLEVGSYLLVKAG  315

Query  1030  ESVPVDCEVF  1059
             ESVPVDCEV 
Sbjct  316   ESVPVDCEVL  325



>ref|XP_011099314.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
[Sesamum indicum]
Length=812

 Score =   277 bits (708),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 148/193 (77%), Positives = 171/193 (89%), Gaps = 3/193 (2%)
 Frame = +1

Query  481   DEQLTKPQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQ  660
             D  LTK QE  L FA+AI+W+ LANFLREHLELCC +AALF+AAAACPY LPKPAVKPLQ
Sbjct  86    DAPLTKSQEAFLSFAEAIKWTDLANFLREHLELCCCAAALFVAAAACPYFLPKPAVKPLQ  145

Query  661   RAFAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLA  840
             +AF +IAFPLVGVSAS DA +D+ GGKINIHVLMALA FASVFMGN+LEGGLLLAMFNLA
Sbjct  146   QAFTLIAFPLVGVSASFDAAVDIMGGKINIHVLMALAAFASVFMGNALEGGLLLAMFNLA  205

Query  841   HIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILV  1020
             HIAEE+FT  S++DVKELKENHP+FAL+L   N +SP+FSDL Y +VPV+DL++GS+ILV
Sbjct  206   HIAEEYFTSRSRIDVKELKENHPEFALVL---NRNSPNFSDLMYHEVPVNDLEIGSYILV  262

Query  1021  QAGESVPVDCEVF  1059
             +AGESVPVDCEVF
Sbjct  263   KAGESVPVDCEVF  275



>gb|KGN63370.1| hypothetical protein Csa_2G433360 [Cucumis sativus]
Length=818

 Score =   271 bits (692),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 137/196 (70%), Positives = 169/196 (86%), Gaps = 0/196 (0%)
 Frame = +1

Query  472   ESDDEQLTKPQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVK  651
             +SD  +LT  Q+  ++FA+AIRW+ LAN+LREHL +CC SAALF+ AAA PY++PKPAVK
Sbjct  94    DSDGVELTGAQKAFVRFAEAIRWTDLANYLREHLHMCCGSAALFVTAAAFPYLVPKPAVK  153

Query  652   PLQRAFAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMF  831
             PLQ  F  +AFPLVGVSASLDAL D++GGK+NIHVLMALA FAS+FMGN LEGGLLL MF
Sbjct  154   PLQNVFIAVAFPLVGVSASLDALTDISGGKVNIHVLMALAAFASIFMGNPLEGGLLLVMF  213

Query  832   NLAHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSF  1011
             N+AHIAEE+FT+ S +DVKELKE+HPDFAL+LDVN+++ P  SDL +++VPV D+KVGS+
Sbjct  214   NMAHIAEEYFTKQSMIDVKELKESHPDFALVLDVNDDNLPDTSDLEHRRVPVRDVKVGSY  273

Query  1012  ILVQAGESVPVDCEVF  1059
             ILV AGESVPVDCEV+
Sbjct  274   ILVGAGESVPVDCEVY  289



>ref|XP_004151907.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
[Cucumis sativus]
Length=823

 Score =   270 bits (691),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 137/196 (70%), Positives = 169/196 (86%), Gaps = 0/196 (0%)
 Frame = +1

Query  472   ESDDEQLTKPQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVK  651
             +SD  +LT  Q+  ++FA+AIRW+ LAN+LREHL +CC SAALF+ AAA PY++PKPAVK
Sbjct  94    DSDGVELTGAQKAFVRFAEAIRWTDLANYLREHLHMCCGSAALFVTAAAFPYLVPKPAVK  153

Query  652   PLQRAFAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMF  831
             PLQ  F  +AFPLVGVSASLDAL D++GGK+NIHVLMALA FAS+FMGN LEGGLLL MF
Sbjct  154   PLQNVFIAVAFPLVGVSASLDALTDISGGKVNIHVLMALAAFASIFMGNPLEGGLLLVMF  213

Query  832   NLAHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSF  1011
             N+AHIAEE+FT+ S +DVKELKE+HPDFAL+LDVN+++ P  SDL +++VPV D+KVGS+
Sbjct  214   NMAHIAEEYFTKQSMIDVKELKESHPDFALVLDVNDDNLPDTSDLEHRRVPVRDVKVGSY  273

Query  1012  ILVQAGESVPVDCEVF  1059
             ILV AGESVPVDCEV+
Sbjct  274   ILVGAGESVPVDCEVY  289



>ref|XP_007208172.1| hypothetical protein PRUPE_ppa001453mg [Prunus persica]
 gb|EMJ09371.1| hypothetical protein PRUPE_ppa001453mg [Prunus persica]
Length=825

 Score =   269 bits (688),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 138/192 (72%), Positives = 169/192 (88%), Gaps = 0/192 (0%)
 Frame = +1

Query  484   EQLTKPQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQR  663
             ++LT PQ+  ++FA A+RW+ LA+FLREHL+LC  S  LF+AAAACPY++PK AVKP+Q 
Sbjct  89    DELTGPQKQFVRFAKAVRWTDLADFLREHLQLCFCSTTLFLAAAACPYLMPKLAVKPMQN  148

Query  664   AFAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAH  843
             AF +IAFPLVGVSA+LDAL D++GGK+NIHVLMALA FASVFMGN+LEGGLLLAMFNLAH
Sbjct  149   AFILIAFPLVGVSAALDALTDISGGKVNIHVLMALAAFASVFMGNALEGGLLLAMFNLAH  208

Query  844   IAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQ  1023
             IAEE+FT  S +DVKELKEN+PDFAL+LD+N+E  P+ S+L Y++VPV D++VGSFILV 
Sbjct  209   IAEEYFTSRSMIDVKELKENYPDFALVLDINDEELPNTSNLAYKQVPVHDIQVGSFILVG  268

Query  1024  AGESVPVDCEVF  1059
             AGESVPVDCEVF
Sbjct  269   AGESVPVDCEVF  280



>ref|XP_008462778.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
[Cucumis melo]
Length=823

 Score =   268 bits (686),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 136/196 (69%), Positives = 169/196 (86%), Gaps = 0/196 (0%)
 Frame = +1

Query  472   ESDDEQLTKPQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVK  651
             +SD  +LT  Q+  ++FA+AIRW+ LAN+LREHL +CC SAALF+ AAA PY++PKPAVK
Sbjct  94    DSDRVELTGTQKAFVRFAEAIRWTDLANYLREHLHMCCGSAALFVTAAAFPYLVPKPAVK  153

Query  652   PLQRAFAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMF  831
             PLQ  F  +AFPLVGVSASLDAL D++GGK+NIHVLMALA FAS+FMGN LEGGLLL MF
Sbjct  154   PLQNVFIAVAFPLVGVSASLDALTDISGGKVNIHVLMALAAFASIFMGNPLEGGLLLVMF  213

Query  832   NLAHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSF  1011
             N+AHIAEE+FT+ S +DVKELKE+HPDFAL+LDVN+++ P  SDL +++VPV D++VGS+
Sbjct  214   NMAHIAEEYFTKQSMIDVKELKESHPDFALVLDVNDDNLPDTSDLEHRRVPVRDVEVGSY  273

Query  1012  ILVQAGESVPVDCEVF  1059
             ILV AGESVPVDCEV+
Sbjct  274   ILVGAGESVPVDCEVY  289



>ref|XP_008238762.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
[Prunus mume]
Length=825

 Score =   268 bits (685),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 138/192 (72%), Positives = 169/192 (88%), Gaps = 0/192 (0%)
 Frame = +1

Query  484   EQLTKPQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQR  663
             ++LT P++  ++FA A+RW+ LA+FLREHL+LC  S ALF+AA ACPY++PK AVKP+Q 
Sbjct  89    DELTGPRKQFVRFAKAVRWTDLADFLREHLQLCICSTALFLAAGACPYLMPKLAVKPMQN  148

Query  664   AFAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAH  843
             AF +IAFPLVGVSA+LDAL D++GGK+NIHVLMALA FASVFMGN+LEGGLLLAMFNLAH
Sbjct  149   AFILIAFPLVGVSAALDALTDISGGKVNIHVLMALAAFASVFMGNALEGGLLLAMFNLAH  208

Query  844   IAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQ  1023
             IAEE+FT  S +DVKELKEN+PDFAL+LD+N+E  P+ S+L Y++VPV DL+VGSFILV 
Sbjct  209   IAEEYFTSRSMIDVKELKENYPDFALVLDINDEELPNTSNLAYKQVPVHDLQVGSFILVG  268

Query  1024  AGESVPVDCEVF  1059
             AGESVPVDCEVF
Sbjct  269   AGESVPVDCEVF  280



>gb|KDO79068.1| hypothetical protein CISIN_1g003598mg [Citrus sinensis]
Length=536

 Score =   259 bits (663),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 138/195 (71%), Positives = 167/195 (86%), Gaps = 0/195 (0%)
 Frame = +1

Query  475   SDDEQLTKPQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKP  654
             +D  +L+ PQ+ ++KFA A RW  LANFLREHL+LCC +AALF+AAAACPY+LPKPA+KP
Sbjct  77    NDCSELSGPQKAVIKFAKATRWLDLANFLREHLQLCCCAAALFLAAAACPYLLPKPAIKP  136

Query  655   LQRAFAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFN  834
             LQ AF  +AFPLVGVSASLDAL D+AGGK+NIHVLMA A FAS+FMGNSLEGGLLLAMFN
Sbjct  137   LQNAFLAVAFPLVGVSASLDALTDIAGGKVNIHVLMAFAAFASIFMGNSLEGGLLLAMFN  196

Query  835   LAHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFI  1014
             LAHIAEE FT  + VDVKELKEN+PD  L+L+V++++ P  SDL Y+ VPV D++VGS+I
Sbjct  197   LAHIAEEFFTSRAMVDVKELKENYPDSVLVLNVDDDNLPDVSDLAYRSVPVHDVEVGSYI  256

Query  1015  LVQAGESVPVDCEVF  1059
             LV AGE+VPVDCEV+
Sbjct  257   LVGAGEAVPVDCEVY  271



>ref|XP_011006989.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
[Populus euphratica]
Length=830

 Score =   265 bits (677),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 161/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  487   QLTKPQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRA  666
             QLT PQ  LLKFA A+ W  LAN LREHL+LCC SAALFI AAACPY++PKPAVKPLQ A
Sbjct  103   QLTGPQRALLKFAKALGWMDLANLLREHLQLCCCSAALFITAAACPYMIPKPAVKPLQNA  162

Query  667   FAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHI  846
               ++AFPLVGVSASLDAL D+AGGK+NIHVLMALAGFAS+FMGN+LEGGLLLAMFNLAHI
Sbjct  163   LMLVAFPLVGVSASLDALTDIAGGKVNIHVLMALAGFASIFMGNALEGGLLLAMFNLAHI  222

Query  847   AEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQA  1026
             AEE FT  S +DVKELKEN+PD  L+LDVN++  P  SDL Y+ VPV D++VG +ILV  
Sbjct  223   AEEFFTSRSVIDVKELKENYPDSTLVLDVNDDKPPDVSDLSYKSVPVHDIEVGCYILVGT  282

Query  1027  GESVPVDCEVF  1059
             GE+VPVDCEVF
Sbjct  283   GEAVPVDCEVF  293



>ref|XP_010271184.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
isoform X1 [Nelumbo nucifera]
Length=831

 Score =   265 bits (676),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 162/194 (84%), Gaps = 0/194 (0%)
 Frame = +1

Query  478   DDEQLTKPQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPL  657
             +D +L K QE +L+FA  I W  LANFLREHL+LCC S AL +AAA+CPY+LPKP VKPL
Sbjct  101   EDAKLNKSQEAVLRFAKTIGWYDLANFLREHLQLCCCSTALLLAAASCPYLLPKPTVKPL  160

Query  658   QRAFAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNL  837
             Q AF VIAFPLVGVSA+LDAL D+  G++NIHVLMALA FASVFMGNSLEGGLLLAMFNL
Sbjct  161   QNAFIVIAFPLVGVSAALDALTDITAGRVNIHVLMALAAFASVFMGNSLEGGLLLAMFNL  220

Query  838   AHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFIL  1017
             AHIAEE+FT  S VDVKELKEN+PDF L+L+V  +  P FSDL Y++VPV DL+VGS+IL
Sbjct  221   AHIAEEYFTSRSMVDVKELKENYPDFVLVLEVEGDKVPRFSDLSYKRVPVHDLEVGSYIL  280

Query  1018  VQAGESVPVDCEVF  1059
             V+AGESVPVD EV 
Sbjct  281   VRAGESVPVDGEVL  294



>ref|XP_006466544.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic-like 
[Citrus sinensis]
Length=808

 Score =   263 bits (671),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 139/195 (71%), Positives = 167/195 (86%), Gaps = 0/195 (0%)
 Frame = +1

Query  475   SDDEQLTKPQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKP  654
             +D  QL+ PQ+ ++KFA A RW  LANFLREHL+LCC +AALF+AAAACPY+LPKPA+KP
Sbjct  77    NDCSQLSGPQKAVIKFAKATRWLDLANFLREHLQLCCCAAALFLAAAACPYLLPKPAIKP  136

Query  655   LQRAFAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFN  834
             LQ AF  +AFPLVGVSASLDAL D+AGGK+NIHVLMA A FAS+FMGNSLEGGLLLAMFN
Sbjct  137   LQNAFLAVAFPLVGVSASLDALTDIAGGKVNIHVLMAFAAFASIFMGNSLEGGLLLAMFN  196

Query  835   LAHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFI  1014
             LAHIAEE FT  + VDVKELKEN+PD  L+L+V++++ P  SDL Y+ VPV D++VGS+I
Sbjct  197   LAHIAEEFFTSRAMVDVKELKENYPDSVLVLNVDDDNLPDVSDLAYRSVPVHDVEVGSYI  256

Query  1015  LVQAGESVPVDCEVF  1059
             LV AGE+VPVDCEV+
Sbjct  257   LVGAGEAVPVDCEVY  271



>ref|XP_010652768.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
isoform X2 [Vitis vinifera]
Length=770

 Score =   262 bits (669),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 163/190 (86%), Gaps = 0/190 (0%)
 Frame = +1

Query  490   LTKPQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRAF  669
             L++ QE  L+ A AIRW+ LA+FLRE+L LCC S  LF+AAAACPY++PKPAVKPLQ AF
Sbjct  103   LSRTQESFLRIAKAIRWADLADFLRENLHLCCCSTGLFLAAAACPYLIPKPAVKPLQNAF  162

Query  670   AVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIA  849
               +AFPLVGVSASLDAL+D+ GGK+NIHVLMALA FASVFMGN LEGGLLLAMFNLAHIA
Sbjct  163   IFVAFPLVGVSASLDALIDITGGKVNIHVLMALAAFASVFMGNPLEGGLLLAMFNLAHIA  222

Query  850   EEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAG  1029
             EE+FT  S VDVKELKEN+PDFAL+L+VNN   P+FS L Y+KVPV D++VGS+ILV+ G
Sbjct  223   EEYFTSRSVVDVKELKENYPDFALVLEVNNNKPPNFSHLAYKKVPVHDVEVGSYILVKDG  282

Query  1030  ESVPVDCEVF  1059
             E VPVDCEVF
Sbjct  283   EFVPVDCEVF  292



>ref|XP_002524927.1| heavy metal cation transport atpase, putative [Ricinus communis]
 gb|EEF37424.1| heavy metal cation transport atpase, putative [Ricinus communis]
Length=820

 Score =   263 bits (671),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 140/195 (72%), Positives = 163/195 (84%), Gaps = 0/195 (0%)
 Frame = +1

Query  475   SDDEQLTKPQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKP  654
              D E+L+ PQ  L+ FA A++W  LAN LRE+L+LCC SAALF+AAAACPY++P P VKP
Sbjct  89    GDVEELSGPQRALINFAKAVKWIDLANLLRENLQLCCCSAALFVAAAACPYLIPNPVVKP  148

Query  655   LQRAFAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFN  834
             +Q AF ++AFPLVGVSASLDAL DV GGK+NIHVLMALA F+SVFMGN+LEGGLLLAMFN
Sbjct  149   IQNAFIIVAFPLVGVSASLDALTDVTGGKVNIHVLMALAAFSSVFMGNALEGGLLLAMFN  208

Query  835   LAHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFI  1014
             LAHIAEE FT  S VDVKELKE+HPD AL+LDVN+E  P  SDL Y+ +PV D+KVGSFI
Sbjct  209   LAHIAEEFFTSRSMVDVKELKESHPDSALVLDVNDEKLPDLSDLSYESIPVHDVKVGSFI  268

Query  1015  LVQAGESVPVDCEVF  1059
             LV  GE+VPVDCEVF
Sbjct  269   LVGTGEAVPVDCEVF  283



>ref|XP_008391510.1| PREDICTED: LOW QUALITY PROTEIN: probable cadmium/zinc-transporting 
ATPase HMA1, chloroplastic [Malus domestica]
Length=835

 Score =   262 bits (670),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 166/191 (87%), Gaps = 0/191 (0%)
 Frame = +1

Query  487   QLTKPQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRA  666
             +LT  Q+  + FA A+RW+ LA+FLREHL+LC  SAAL +AAAACPY++PKPAVKP+Q A
Sbjct  108   ELTGSQKQFVAFAKAVRWTDLADFLREHLQLCFCSAALLLAAAACPYLMPKPAVKPMQNA  167

Query  667   FAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHI  846
             F ++AFPLVGVSA+LDAL D++GGK+NIHVLMALA FASVFMGN+LEGGLLLAMFNLAHI
Sbjct  168   FILVAFPLVGVSAALDALTDLSGGKVNIHVLMALAAFASVFMGNALEGGLLLAMFNLAHI  227

Query  847   AEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQA  1026
             AEE+FT  S +DVKELKEN+PDFAL+LD+N+   P+ S+L Y++VPV DL+VGS+I V A
Sbjct  228   AEEYFTSRSMIDVKELKENYPDFALVLDINDGQLPNTSELEYKQVPVHDLQVGSYIFVGA  287

Query  1027  GESVPVDCEVF  1059
             GESVPVDCEVF
Sbjct  288   GESVPVDCEVF  298



>gb|KDO79067.1| hypothetical protein CISIN_1g003598mg [Citrus sinensis]
Length=750

 Score =   261 bits (666),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 138/195 (71%), Positives = 167/195 (86%), Gaps = 0/195 (0%)
 Frame = +1

Query  475   SDDEQLTKPQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKP  654
             +D  +L+ PQ+ ++KFA A RW  LANFLREHL+LCC +AALF+AAAACPY+LPKPA+KP
Sbjct  77    NDCSELSGPQKAVIKFAKATRWLDLANFLREHLQLCCCAAALFLAAAACPYLLPKPAIKP  136

Query  655   LQRAFAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFN  834
             LQ AF  +AFPLVGVSASLDAL D+AGGK+NIHVLMA A FAS+FMGNSLEGGLLLAMFN
Sbjct  137   LQNAFLAVAFPLVGVSASLDALTDIAGGKVNIHVLMAFAAFASIFMGNSLEGGLLLAMFN  196

Query  835   LAHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFI  1014
             LAHIAEE FT  + VDVKELKEN+PD  L+L+V++++ P  SDL Y+ VPV D++VGS+I
Sbjct  197   LAHIAEEFFTSRAMVDVKELKENYPDSVLVLNVDDDNLPDVSDLAYRSVPVHDVEVGSYI  256

Query  1015  LVQAGESVPVDCEVF  1059
             LV AGE+VPVDCEV+
Sbjct  257   LVGAGEAVPVDCEVY  271



>ref|XP_002278549.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
isoform X1 [Vitis vinifera]
 emb|CBI33768.3| unnamed protein product [Vitis vinifera]
Length=829

 Score =   261 bits (668),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 163/190 (86%), Gaps = 0/190 (0%)
 Frame = +1

Query  490   LTKPQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRAF  669
             L++ QE  L+ A AIRW+ LA+FLRE+L LCC S  LF+AAAACPY++PKPAVKPLQ AF
Sbjct  103   LSRTQESFLRIAKAIRWADLADFLRENLHLCCCSTGLFLAAAACPYLIPKPAVKPLQNAF  162

Query  670   AVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIA  849
               +AFPLVGVSASLDAL+D+ GGK+NIHVLMALA FASVFMGN LEGGLLLAMFNLAHIA
Sbjct  163   IFVAFPLVGVSASLDALIDITGGKVNIHVLMALAAFASVFMGNPLEGGLLLAMFNLAHIA  222

Query  850   EEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAG  1029
             EE+FT  S VDVKELKEN+PDFAL+L+VNN   P+FS L Y+KVPV D++VGS+ILV+ G
Sbjct  223   EEYFTSRSVVDVKELKENYPDFALVLEVNNNKPPNFSHLAYKKVPVHDVEVGSYILVKDG  282

Query  1030  ESVPVDCEVF  1059
             E VPVDCEVF
Sbjct  283   EFVPVDCEVF  292



>ref|XP_006425990.1| hypothetical protein CICLE_v10024910mg [Citrus clementina]
 gb|ESR39230.1| hypothetical protein CICLE_v10024910mg [Citrus clementina]
Length=808

 Score =   261 bits (667),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 138/195 (71%), Positives = 167/195 (86%), Gaps = 0/195 (0%)
 Frame = +1

Query  475   SDDEQLTKPQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKP  654
             +D  +L+ PQ+ ++KFA A RW  LANFLREHL+LCC +AALF+AAAACPY+LPKPA+KP
Sbjct  77    NDCSELSGPQKAVIKFAKATRWLDLANFLREHLQLCCCAAALFLAAAACPYLLPKPAIKP  136

Query  655   LQRAFAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFN  834
             LQ AF  +AFPLVGVSASLDAL D+AGGK+NIHVLMA A FAS+FMGNSLEGGLLLAMFN
Sbjct  137   LQNAFLAVAFPLVGVSASLDALTDIAGGKVNIHVLMAFAAFASIFMGNSLEGGLLLAMFN  196

Query  835   LAHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFI  1014
             LAHIAEE FT  + VDVKELKEN+PD  L+L+V++++ P  SDL Y+ VPV D++VGS+I
Sbjct  197   LAHIAEEFFTSRAMVDVKELKENYPDSVLVLNVDDDNLPDVSDLAYRSVPVHDVEVGSYI  256

Query  1015  LVQAGESVPVDCEVF  1059
             LV AGE+VPVDCEV+
Sbjct  257   LVGAGEAVPVDCEVY  271



>gb|KDO79066.1| hypothetical protein CISIN_1g003598mg [Citrus sinensis]
Length=808

 Score =   261 bits (666),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 138/195 (71%), Positives = 167/195 (86%), Gaps = 0/195 (0%)
 Frame = +1

Query  475   SDDEQLTKPQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKP  654
             +D  +L+ PQ+ ++KFA A RW  LANFLREHL+LCC +AALF+AAAACPY+LPKPA+KP
Sbjct  77    NDCSELSGPQKAVIKFAKATRWLDLANFLREHLQLCCCAAALFLAAAACPYLLPKPAIKP  136

Query  655   LQRAFAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFN  834
             LQ AF  +AFPLVGVSASLDAL D+AGGK+NIHVLMA A FAS+FMGNSLEGGLLLAMFN
Sbjct  137   LQNAFLAVAFPLVGVSASLDALTDIAGGKVNIHVLMAFAAFASIFMGNSLEGGLLLAMFN  196

Query  835   LAHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFI  1014
             LAHIAEE FT  + VDVKELKEN+PD  L+L+V++++ P  SDL Y+ VPV D++VGS+I
Sbjct  197   LAHIAEEFFTSRAMVDVKELKENYPDSVLVLNVDDDNLPDVSDLAYRSVPVHDVEVGSYI  256

Query  1015  LVQAGESVPVDCEVF  1059
             LV AGE+VPVDCEV+
Sbjct  257   LVGAGEAVPVDCEVY  271



>gb|EPS71968.1| hypothetical protein M569_02788, partial [Genlisea aurea]
Length=772

 Score =   259 bits (662),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 136/193 (70%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = +1

Query  481   DEQLTKPQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQ  660
             D  LT+ Q   L  A  I+W+ LA+ LREH ELCC +AALFI AAA  ++LPKPA+KP Q
Sbjct  79    DPSLTRSQRAFLSLARFIKWTDLADLLREHFELCCCAAALFIGAAASSFLLPKPAIKPFQ  138

Query  661   RAFAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLA  840
             +A  +IAFPLVGVSAS DA MD+ GGKINIHVLMALA FASVF+GN+LEGGLLLAMFNLA
Sbjct  139   QACTLIAFPLVGVSASFDAAMDILGGKINIHVLMALAAFASVFLGNALEGGLLLAMFNLA  198

Query  841   HIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILV  1020
             HIAEE+FTR S++DVKELKENHP+FAL+L+V + + PSFSD++Y +VPV+DLK+GS+ILV
Sbjct  199   HIAEEYFTRRSRIDVKELKENHPEFALMLEVESGNLPSFSDVKYVEVPVNDLKIGSYILV  258

Query  1021  QAGESVPVDCEVF  1059
             +AGESVPVDCEVF
Sbjct  259   KAGESVPVDCEVF  271



>ref|XP_010095321.1| putative cadmium/zinc-transporting ATPase HMA1 [Morus notabilis]
 gb|EXB59532.1| putative cadmium/zinc-transporting ATPase HMA1 [Morus notabilis]
Length=830

 Score =   259 bits (662),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 169/191 (88%), Gaps = 0/191 (0%)
 Frame = +1

Query  487   QLTKPQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRA  666
             +L + Q+  L+FA A+RW+ LANFLRE+L LCC SAALF+AAAA P++LPKPAVKPLQ A
Sbjct  105   ELKESQKAFLRFAKAVRWTELANFLRENLLLCCVSAALFVAAAAFPHLLPKPAVKPLQNA  164

Query  667   FAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHI  846
             F ++AFPLVGVSASLDAL+D++GGK+NIHVLMALA FASVFMGN+LEGGLLLAMFNLAHI
Sbjct  165   FLLVAFPLVGVSASLDALIDISGGKVNIHVLMALAAFASVFMGNALEGGLLLAMFNLAHI  224

Query  847   AEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQA  1026
             AEE+FT  S +DVKELKENHP+FAL+LD+N++  P+  DL Y++VPV ++++GS+IL+ A
Sbjct  225   AEEYFTSRSMIDVKELKENHPEFALVLDMNDDRLPNTFDLAYKRVPVHNVEMGSYILIGA  284

Query  1027  GESVPVDCEVF  1059
             GESVPVDCEVF
Sbjct  285   GESVPVDCEVF  295



>gb|KJB43826.1| hypothetical protein B456_007G218200 [Gossypium raimondii]
Length=826

 Score =   258 bits (659),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 164/191 (86%), Gaps = 0/191 (0%)
 Frame = +1

Query  487   QLTKPQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRA  666
             QL  PQ+ ++ FA AIRW  LANFLREHL LCC + ALFIAAAA PY++PKPAVKPLQ +
Sbjct  100   QLNGPQKAVIGFAKAIRWMDLANFLREHLHLCCCATALFIAAAAFPYLVPKPAVKPLQNS  159

Query  667   FAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHI  846
             F V+AFPLVGVSA+LDA+ D+AGGK+NIHVLMALA FASVFMGN+LEGGLLLAMFNLAHI
Sbjct  160   FLVLAFPLVGVSAALDAITDIAGGKVNIHVLMALAAFASVFMGNALEGGLLLAMFNLAHI  219

Query  847   AEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQA  1026
             AEE FT  S +DVKELKEN+PD AL+L++++++ P+ SDL Y+ +PV D++VGS+ILV  
Sbjct  220   AEEFFTSRSMIDVKELKENYPDSALVLNLDDDNLPNVSDLSYRSIPVHDVEVGSYILVTT  279

Query  1027  GESVPVDCEVF  1059
             GE+VPVDCEVF
Sbjct  280   GEAVPVDCEVF  290



>ref|XP_009367661.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
[Pyrus x bretschneideri]
Length=830

 Score =   258 bits (658),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 134/191 (70%), Positives = 165/191 (86%), Gaps = 0/191 (0%)
 Frame = +1

Query  487   QLTKPQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRA  666
             +LT  Q+  ++FA A+RW+ LA+FLREHL+LC  SAAL +AAAACPY++PK A KP+Q A
Sbjct  103   ELTGSQKQFVRFAKAVRWTDLADFLREHLQLCFCSAALLLAAAACPYLMPKLAAKPMQNA  162

Query  667   FAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHI  846
             F ++AFPLVGVSA+LDAL D++GGK+NIHVLMALA FASVFMGN+LEGGLLLAMFNLAHI
Sbjct  163   FILVAFPLVGVSAALDALTDLSGGKVNIHVLMALAAFASVFMGNALEGGLLLAMFNLAHI  222

Query  847   AEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQA  1026
             AEE+FT  S +DVKELKEN+PDFAL+LD+N+   P+ S+L Y++VPV DL+VGS+I V A
Sbjct  223   AEEYFTSRSMIDVKELKENYPDFALVLDINDGQLPNTSELEYKQVPVHDLQVGSYIFVGA  282

Query  1027  GESVPVDCEVF  1059
             GESVPVDCEVF
Sbjct  283   GESVPVDCEVF  293



>ref|XP_010531262.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010531263.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
isoform X2 [Tarenaya hassleriana]
Length=822

 Score =   257 bits (657),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 161/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  487   QLTKPQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRA  666
             +L  PQ+ L+ FA  + W  LA+FLREHL+LCCSSAALF+AA ACPY++PKP +KPLQ A
Sbjct  99    ELNGPQKALIGFARTVGWVRLADFLREHLQLCCSSAALFLAAGACPYLVPKPYIKPLQNA  158

Query  667   FAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHI  846
             F V+ FPLVGVSASLDALMD+AGGK+NIHVLMALA FASVFMGN+LEGGLLLAMFNLAHI
Sbjct  159   FMVVGFPLVGVSASLDALMDIAGGKVNIHVLMALAAFASVFMGNALEGGLLLAMFNLAHI  218

Query  847   AEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQA  1026
             AEE FT  S VDVKELKE++PD AL++D NN+  P+FSD  Y+ VPV D++VGSFILV  
Sbjct  219   AEEFFTSRSMVDVKELKESNPDSALVIDANNDDVPNFSDFSYKSVPVHDVEVGSFILVGT  278

Query  1027  GESVPVDCEVF  1059
             GE VPVDCE++
Sbjct  279   GEIVPVDCEIY  289



>ref|XP_010526719.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
isoform X1 [Tarenaya hassleriana]
Length=826

 Score =   255 bits (651),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 161/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  487   QLTKPQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRA  666
             +LT PQ+ L  FA  + W  LANFLREHL+LCCSSAALF+AAAACPY++PKP VKPLQ A
Sbjct  106   ELTGPQKALTGFARTVGWVRLANFLREHLQLCCSSAALFLAAAACPYLIPKPYVKPLQNA  165

Query  667   FAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHI  846
             F  + FPLVGVSASLDALMD+AGGK+NIHVLMALA FASVFMGN+LEGGLLLAMFNLAHI
Sbjct  166   FMAVGFPLVGVSASLDALMDIAGGKVNIHVLMALAAFASVFMGNALEGGLLLAMFNLAHI  225

Query  847   AEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQA  1026
             AEE FT  S VDVKELKE++PD AL++DVN+   P+ SDL Y+ VPV D++VGS+ILV  
Sbjct  226   AEEFFTSRSMVDVKELKESNPDSALVIDVNDGDVPNVSDLSYRSVPVHDVEVGSYILVGT  285

Query  1027  GESVPVDCEVF  1059
             GE VPVDCEV+
Sbjct  286   GEIVPVDCEVY  296



>gb|KEH31492.1| cadmium/zinc-transporting ATPase, putative [Medicago truncatula]
Length=818

 Score =   253 bits (647),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 131/194 (68%), Positives = 162/194 (84%), Gaps = 0/194 (0%)
 Frame = +1

Query  478   DDEQLTKPQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPL  657
             DD  LT PQ+ ++ FA A +W  LANFLREHL LCC+S ALF+AAA CP+ LPK  +KP+
Sbjct  88    DDVNLTGPQKAIISFAKATKWIDLANFLREHLYLCCASTALFVAAAICPHTLPKSLIKPV  147

Query  658   QRAFAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNL  837
             Q +F ++AFPLVGVSASLDAL++++GGK+NIHVLMA+A FA++FMGN+LEGGLLLAMFNL
Sbjct  148   QNSFILVAFPLVGVSASLDALIEISGGKVNIHVLMAMAAFATIFMGNALEGGLLLAMFNL  207

Query  838   AHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFIL  1017
             AHIAEE+FT  S VDVKELKEN+P+FAL+LD  +   P+  DL YQ+VPV D+ VGS++L
Sbjct  208   AHIAEEYFTSRSMVDVKELKENNPEFALVLDTKDNKLPNTFDLAYQRVPVHDITVGSYVL  267

Query  1018  VQAGESVPVDCEVF  1059
             V AGESVPVDCEVF
Sbjct  268   VGAGESVPVDCEVF  281



>ref|XP_008462846.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
[Cucumis melo]
Length=823

 Score =   253 bits (646),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 131/191 (69%), Positives = 161/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  487   QLTKPQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRA  666
             +L+ PQ+ ++ FA A RW+ LA +LRE L+LCC S ALF+AAA CPY++PKP VKPLQ A
Sbjct  98    ELSGPQKAVIGFAKATRWTDLAKYLRESLQLCCCSMALFVAAAVCPYLVPKPIVKPLQIA  157

Query  667   FAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHI  846
             F VI FPLVGVS++LDAL D++GGK+NIHVLMALA FAS+FMGN+LEGGLLLAMFNL+HI
Sbjct  158   FIVIGFPLVGVSSALDALTDISGGKVNIHVLMALAAFASIFMGNALEGGLLLAMFNLSHI  217

Query  847   AEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQA  1026
             AEE+FT  + +DVKELKEN+PDFAL+LD N+   P+ +DL YQKVPV D++V S+ILV A
Sbjct  218   AEEYFTSRAMIDVKELKENYPDFALVLDTNDGEVPNITDLSYQKVPVQDVEVDSYILVGA  277

Query  1027  GESVPVDCEVF  1059
             GE VPVDCEVF
Sbjct  278   GEFVPVDCEVF  288



>ref|XP_010446681.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
[Camelina sativa]
Length=821

 Score =   253 bits (645),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 136/189 (72%), Positives = 159/189 (84%), Gaps = 0/189 (0%)
 Frame = +1

Query  493   TKPQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRAFA  672
             +KPQ+VL  FA AI W  LANFLREHL LCCSSA +F+AAAACPY++PKP +K LQ AF 
Sbjct  99    SKPQKVLFGFAKAIGWVRLANFLREHLHLCCSSAVMFLAAAACPYLVPKPYIKSLQNAFM  158

Query  673   VIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAE  852
             ++ FPLVGVSASLDALMD+AGGK+NIHVLMALA FASVFMGN+LEGGLLLAMFNLAHIAE
Sbjct  159   IVGFPLVGVSASLDALMDIAGGKVNIHVLMALAAFASVFMGNALEGGLLLAMFNLAHIAE  218

Query  853   EHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGE  1032
             E FT  S VDVKELKE++PD ALL++V N + P+ SDL Y+ VPV  ++VGS+ILV  GE
Sbjct  219   EFFTSRSMVDVKELKESNPDSALLIEVKNGNVPNISDLSYKSVPVHSVEVGSYILVGTGE  278

Query  1033  SVPVDCEVF  1059
              VPVDCEV+
Sbjct  279   IVPVDCEVY  287



>ref|XP_012079313.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
[Jatropha curcas]
 gb|KDP31998.1| hypothetical protein JCGZ_12459 [Jatropha curcas]
Length=839

 Score =   253 bits (645),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 154/191 (81%), Gaps = 0/191 (0%)
 Frame = +1

Query  487   QLTKPQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRA  666
             +L+  Q   + FA A+ W  LAN LREHL+L C SAALF+AAA CPY++PKP VKPLQ  
Sbjct  112   ELSGAQRSFISFAKAVGWMDLANLLREHLQLTCCSAALFVAAAVCPYLIPKPIVKPLQNT  171

Query  667   FAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHI  846
             F +IAFPLVGVSAS DAL+DV GGK+NIHVLMALA FAS+FMGN+LEGGLLLAMFNLAHI
Sbjct  172   FMIIAFPLVGVSASFDALIDVTGGKVNIHVLMALAAFASLFMGNALEGGLLLAMFNLAHI  231

Query  847   AEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQA  1026
             AEE FT  S VDVKELKENHP  AL+LDVN+E     SDL Y+ VPV D+KVGS+ILV  
Sbjct  232   AEEFFTSRSMVDVKELKENHPASALVLDVNDEKQLDLSDLSYKSVPVHDVKVGSYILVGT  291

Query  1027  GESVPVDCEVF  1059
             GE+VPVDCEVF
Sbjct  292   GEAVPVDCEVF  302



>ref|XP_007047396.1| Heavy metal atpase 1 [Theobroma cacao]
 gb|EOX91553.1| Heavy metal atpase 1 [Theobroma cacao]
Length=813

 Score =   252 bits (644),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 132/191 (69%), Positives = 164/191 (86%), Gaps = 0/191 (0%)
 Frame = +1

Query  487   QLTKPQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRA  666
             +L+ PQ  ++ FA A+RW  LAN+LREHL+LCC + ALF+AAAACPY+LPKPAVKPLQ +
Sbjct  87    KLSGPQGAVIGFAKAVRWMDLANYLREHLQLCCCATALFLAAAACPYLLPKPAVKPLQNS  146

Query  667   FAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHI  846
             F  +AFPLVGVSA+LDA+ D+AGGK+NIHVLMALA FASVFMGN+LEGGLLLAMFNLAHI
Sbjct  147   FLFVAFPLVGVSAALDAITDIAGGKVNIHVLMALAAFASVFMGNALEGGLLLAMFNLAHI  206

Query  847   AEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQA  1026
             AEE FT  S VDVKELKEN+PD  L+L++++++ P+ S+L Y+ VPV D++VGS+ILV  
Sbjct  207   AEEFFTSRSMVDVKELKENYPDSVLVLNLDDDNLPNVSNLSYRNVPVHDVEVGSYILVGT  266

Query  1027  GESVPVDCEVF  1059
             GE+VPVDCEVF
Sbjct  267   GEAVPVDCEVF  277



>ref|XP_004287993.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=874

 Score =   252 bits (644),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 134/195 (69%), Positives = 164/195 (84%), Gaps = 0/195 (0%)
 Frame = +1

Query  475   SDDEQLTKPQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKP  654
              D  +LT  Q+  + FA A+RW+ LA+FLREHL LC  SAALF+AAAACPYV PK A K 
Sbjct  140   GDCAELTGAQKAFIGFAKAVRWTDLADFLREHLHLCFCSAALFLAAAACPYVAPKLAAKT  199

Query  655   LQRAFAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFN  834
             +Q AF ++AFPLVG+SA+LDA+ D++GGK+NIHVLMALA FASVFMGN+LEGGLLLAMFN
Sbjct  200   VQNAFMIVAFPLVGISAALDAITDISGGKVNIHVLMALAAFASVFMGNALEGGLLLAMFN  259

Query  835   LAHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFI  1014
             LAHIAEE+FT  S +DVKELKEN+PD AL+LD+++E  P  S+L+Y++VPV DL+VGS+I
Sbjct  260   LAHIAEEYFTSRSMIDVKELKENYPDSALVLDMDDEQVPDTSNLKYKQVPVHDLQVGSYI  319

Query  1015  LVQAGESVPVDCEVF  1059
             LV AGESVPVDCEVF
Sbjct  320   LVGAGESVPVDCEVF  334



>ref|XP_010437243.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
[Camelina sativa]
Length=816

 Score =   251 bits (641),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 135/189 (71%), Positives = 158/189 (84%), Gaps = 0/189 (0%)
 Frame = +1

Query  493   TKPQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRAFA  672
             +KPQ+VL  FA AI W  LANFLREHL LCCSSA +F+AAAACPY++PKP +K LQ AF 
Sbjct  96    SKPQKVLFGFAKAIGWVRLANFLREHLHLCCSSAVMFLAAAACPYLVPKPYIKSLQNAFM  155

Query  673   VIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAE  852
             ++ FPLVGVSASLDALMD+AGGK+NIHVLMALA FASVFMGN+LEGGLLLAMFNLAHIAE
Sbjct  156   IVGFPLVGVSASLDALMDIAGGKVNIHVLMALAAFASVFMGNALEGGLLLAMFNLAHIAE  215

Query  853   EHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGE  1032
             E FT  S VDVKELKE++PD ALL++V N + P+ SD  Y+ VPV  ++VGS+ILV  GE
Sbjct  216   EFFTSRSMVDVKELKESNPDSALLIEVKNGNVPNISDFSYKSVPVHSVEVGSYILVGTGE  275

Query  1033  SVPVDCEVF  1059
              VPVDCEV+
Sbjct  276   IVPVDCEVY  284



>ref|XP_006283120.1| hypothetical protein CARUB_v10004142mg [Capsella rubella]
 gb|EOA16018.1| hypothetical protein CARUB_v10004142mg [Capsella rubella]
Length=822

 Score =   251 bits (640),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = +1

Query  493   TKPQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRAFA  672
             +KPQ+VL  FA AI W  LANFLREHL LCCSSAA+F+AAAACPY++PKP +K LQ AF 
Sbjct  102   SKPQKVLFGFAKAIGWVRLANFLREHLHLCCSSAAMFLAAAACPYLVPKPYIKSLQNAFM  161

Query  673   VIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAE  852
             ++ FPLVGVSASLDALMD+AGGK+NIHVLMALA FASVFMGN+LEGGLLLAMFNLAHIAE
Sbjct  162   IVGFPLVGVSASLDALMDIAGGKVNIHVLMALAAFASVFMGNALEGGLLLAMFNLAHIAE  221

Query  853   EHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGE  1032
             E FT  S VDVKELKE++PD ALL++V N + P+ SDL Y+ VPV  ++VGS+ILV  GE
Sbjct  222   EFFTSRSMVDVKELKESNPDSALLIEVINGNVPNISDLSYKSVPVHSVEVGSYILVGTGE  281

Query  1033  SVPVDCEVF  1059
              VPVDCEV+
Sbjct  282   IVPVDCEVY  290



>gb|AID81882.1| heavy metal ATPase transporter 1 [Camelina sativa]
Length=819

 Score =   250 bits (639),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 149/244 (61%), Positives = 181/244 (74%), Gaps = 2/244 (1%)
 Frame = +1

Query  328   PARCAAAFVLTPRAAYLRRCYVSSCSahnhnhghdhnhahrhhhhgddESDDEQLTKPQE  507
             P R +A+ +L PR+  LR         H+ +  + H+H H  H     E   E  +KPQ+
Sbjct  43    PLRNSASLILPPRSIRLRAVEDHHHDHHHDDEQNHHHHHHHQHGCCSVELKAE--SKPQK  100

Query  508   VLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRAFAVIAFP  687
              L  FA AI W  LANFLREHL LCCSSA +F+AAAACPY++PKP +K LQ AF ++ FP
Sbjct  101   ALFGFAKAIGWVRLANFLREHLHLCCSSAVMFLAAAACPYLVPKPYIKSLQNAFMIVGFP  160

Query  688   LVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTR  867
             LVGVSASLDALMD+AGGK+NIHVLMALA FASVFMGN+LEGGLLLAMFNLAHIAEE FT 
Sbjct  161   LVGVSASLDALMDIAGGKVNIHVLMALAAFASVFMGNALEGGLLLAMFNLAHIAEEFFTS  220

Query  868   CSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVD  1047
              S VDVKELKE++PD ALL+++ N + P+ SDL Y+ VPV  ++VGS+ILV  GE VPVD
Sbjct  221   RSMVDVKELKESNPDSALLIEMKNGNVPNISDLSYKSVPVHSVEVGSYILVGTGEIVPVD  280

Query  1048  CEVF  1059
             CEV+
Sbjct  281   CEVY  284



>ref|XP_010432071.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
isoform X1 [Camelina sativa]
Length=821

 Score =   250 bits (638),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 149/244 (61%), Positives = 181/244 (74%), Gaps = 2/244 (1%)
 Frame = +1

Query  328   PARCAAAFVLTPRAAYLRRCYVSSCSahnhnhghdhnhahrhhhhgddESDDEQLTKPQE  507
             P R +A+ +L PR+  LR         H+ +  + H+H H  H     E   E  +KPQ+
Sbjct  43    PLRNSASLILPPRSIRLRAVEDHHHDHHHDDEQNHHHHHHHQHGCCSVELKAE--SKPQK  100

Query  508   VLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRAFAVIAFP  687
              L  FA AI W  LANFLREHL LCCSSA +F+AAAACPY++PKP +K LQ AF ++ FP
Sbjct  101   ALFGFAKAIGWVRLANFLREHLHLCCSSAVMFLAAAACPYLVPKPYIKSLQNAFMIVGFP  160

Query  688   LVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTR  867
             LVGVSASLDALMD+AGGK+NIHVLMALA FASVFMGN+LEGGLLLAMFNLAHIAEE FT 
Sbjct  161   LVGVSASLDALMDIAGGKVNIHVLMALAAFASVFMGNALEGGLLLAMFNLAHIAEEFFTS  220

Query  868   CSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVD  1047
              S VDVKELKE++PD ALL+++ N + P+ SDL Y+ VPV  ++VGS+ILV  GE VPVD
Sbjct  221   RSMVDVKELKESNPDSALLIEMKNGNVPNISDLSYKSVPVHSVEVGSYILVGTGEIVPVD  280

Query  1048  CEVF  1059
             CEV+
Sbjct  281   CEVY  284



>gb|KHN02627.1| Putative cadmium/zinc-transporting ATPase HMA1, chloroplastic 
[Glycine soja]
Length=824

 Score =   250 bits (638),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 158/190 (83%), Gaps = 0/190 (0%)
 Frame = +1

Query  490   LTKPQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRAF  669
             LT PQ+ ++ FA A RW  LA+ LREHL LCC S ALF+AAA CP+ LPKP +KPLQ + 
Sbjct  97    LTGPQKAVIAFAKATRWMDLADILREHLHLCCFSTALFVAAAICPHTLPKPLIKPLQNSL  156

Query  670   AVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIA  849
               +AFPLVGVSASLDAL++++ GK+NIHVLMA+A FAS+FMGNSLEGGLLLAMFNLAHIA
Sbjct  157   IFVAFPLVGVSASLDALLEISSGKVNIHVLMAMAAFASIFMGNSLEGGLLLAMFNLAHIA  216

Query  850   EEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAG  1029
             EE+FT  S VDV+ELKEN+PDFAL+LD N++  P+  DL Y++VPV D+ VGS+ILV AG
Sbjct  217   EEYFTSRSMVDVRELKENNPDFALVLDTNDDKLPNTFDLAYKRVPVHDVTVGSYILVGAG  276

Query  1030  ESVPVDCEVF  1059
             ESVPVDCEVF
Sbjct  277   ESVPVDCEVF  286



>ref|XP_010432073.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
isoform X2 [Camelina sativa]
Length=819

 Score =   250 bits (638),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 149/244 (61%), Positives = 181/244 (74%), Gaps = 2/244 (1%)
 Frame = +1

Query  328   PARCAAAFVLTPRAAYLRRCYVSSCSahnhnhghdhnhahrhhhhgddESDDEQLTKPQE  507
             P R +A+ +L PR+  LR         H+ +  + H+H H  H     E   E  +KPQ+
Sbjct  43    PLRNSASLILPPRSIRLRAVEDHHHDHHHDDEQNHHHHHHHQHGCCSVELKAE--SKPQK  100

Query  508   VLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRAFAVIAFP  687
              L  FA AI W  LANFLREHL LCCSSA +F+AAAACPY++PKP +K LQ AF ++ FP
Sbjct  101   ALFGFAKAIGWVRLANFLREHLHLCCSSAVMFLAAAACPYLVPKPYIKSLQNAFMIVGFP  160

Query  688   LVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTR  867
             LVGVSASLDALMD+AGGK+NIHVLMALA FASVFMGN+LEGGLLLAMFNLAHIAEE FT 
Sbjct  161   LVGVSASLDALMDIAGGKVNIHVLMALAAFASVFMGNALEGGLLLAMFNLAHIAEEFFTS  220

Query  868   CSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVD  1047
              S VDVKELKE++PD ALL+++ N + P+ SDL Y+ VPV  ++VGS+ILV  GE VPVD
Sbjct  221   RSMVDVKELKESNPDSALLIEMKNGNVPNISDLSYKSVPVHSVEVGSYILVGTGEIVPVD  280

Query  1048  CEVF  1059
             CEV+
Sbjct  281   CEVY  284



>gb|KCW59485.1| hypothetical protein EUGRSUZ_H02227 [Eucalyptus grandis]
Length=843

 Score =   250 bits (638),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 133/191 (70%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  487   QLTKPQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRA  666
             +LT  Q  L +FA A+ W  LAN LRE+L++CC SAALF+AAAACPY++PKP VKP Q +
Sbjct  113   ELTGAQRALGEFARAVGWVDLANLLRENLQMCCCSAALFVAAAACPYLVPKPVVKPFQNS  172

Query  667   FAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHI  846
               ++AFPLVGVSASLDAL D+A G++NIHVLMALAGFAS FMGN LEGGLLLAMFNLAHI
Sbjct  173   LMLVAFPLVGVSASLDALTDIAAGRVNIHVLMALAGFASTFMGNPLEGGLLLAMFNLAHI  232

Query  847   AEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQA  1026
             AEE+FT  S +DV+ELKEN+PDF L+LDV++E SP FSDL Y++VPV ++ VGS+ILV A
Sbjct  233   AEEYFTSRSMIDVRELKENYPDFVLVLDVDDEESPKFSDLAYRRVPVHNVAVGSYILVGA  292

Query  1027  GESVPVDCEVF  1059
             GESVPVDCEV 
Sbjct  293   GESVPVDCEVL  303



>ref|XP_010070608.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
[Eucalyptus grandis]
 gb|KCW59484.1| hypothetical protein EUGRSUZ_H02227 [Eucalyptus grandis]
Length=840

 Score =   250 bits (638),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 133/191 (70%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = +1

Query  487   QLTKPQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRA  666
             +LT  Q  L +FA A+ W  LAN LRE+L++CC SAALF+AAAACPY++PKP VKP Q +
Sbjct  113   ELTGAQRALGEFARAVGWVDLANLLRENLQMCCCSAALFVAAAACPYLVPKPVVKPFQNS  172

Query  667   FAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHI  846
               ++AFPLVGVSASLDAL D+A G++NIHVLMALAGFAS FMGN LEGGLLLAMFNLAHI
Sbjct  173   LMLVAFPLVGVSASLDALTDIAAGRVNIHVLMALAGFASTFMGNPLEGGLLLAMFNLAHI  232

Query  847   AEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQA  1026
             AEE+FT  S +DV+ELKEN+PDF L+LDV++E SP FSDL Y++VPV ++ VGS+ILV A
Sbjct  233   AEEYFTSRSMIDVRELKENYPDFVLVLDVDDEESPKFSDLAYRRVPVHNVAVGSYILVGA  292

Query  1027  GESVPVDCEVF  1059
             GESVPVDCEV 
Sbjct  293   GESVPVDCEVL  303



>ref|XP_007155886.1| hypothetical protein PHAVU_003G240100g [Phaseolus vulgaris]
 gb|ESW27880.1| hypothetical protein PHAVU_003G240100g [Phaseolus vulgaris]
Length=826

 Score =   249 bits (637),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 130/194 (67%), Positives = 156/194 (80%), Gaps = 0/194 (0%)
 Frame = +1

Query  478   DDEQLTKPQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPL  657
             D   LT PQ+ ++ FA A RW  LA+ LREHL LCC S  LF+AAA CP+ LPKP V+P 
Sbjct  101   DGANLTGPQKAVIAFAKATRWMDLADILREHLHLCCFSTVLFVAAAICPHTLPKPLVRPF  160

Query  658   QRAFAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNL  837
             Q +   IAFPLVGVSASLDAL++++ GK+NIHVLMA+A FAS+FMGNSLEGGLLLAMFNL
Sbjct  161   QNSLIFIAFPLVGVSASLDALIEISSGKVNIHVLMAMAAFASIFMGNSLEGGLLLAMFNL  220

Query  838   AHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFIL  1017
             AHIAEEHFT  S VDV+ELKEN+PDFAL+LD  ++  P+  DL Y+++PV D+ VGS+IL
Sbjct  221   AHIAEEHFTSRSMVDVRELKENNPDFALVLDTKDDKLPNTFDLAYKRIPVHDVTVGSYIL  280

Query  1018  VQAGESVPVDCEVF  1059
             V AGESVPVDCEVF
Sbjct  281   VGAGESVPVDCEVF  294



>emb|CDP02541.1| unnamed protein product [Coffea canephora]
Length=820

 Score =   249 bits (636),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 137/192 (71%), Positives = 159/192 (83%), Gaps = 1/192 (1%)
 Frame = +1

Query  487   QLTKPQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRA  666
             +LTK Q   L FA A++W+ LANFLREHLELCC SAALFIAAAA PY+ PK   + LQ+ 
Sbjct  94    KLTKSQLAFLNFARAVKWTQLANFLREHLELCCCSAALFIAAAASPYLAPKAVARTLQQV  153

Query  667   FAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHI  846
             F ++AFPLVGVSAS DA+MD+AGGKINIHVLMALA FASVFMGN LEGGLLLAMFNLAHI
Sbjct  154   FTLVAFPLVGVSASFDAIMDIAGGKINIHVLMALAAFASVFMGNFLEGGLLLAMFNLAHI  213

Query  847   AE-EHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQ  1023
              +  +FT  SK+DVKELKENHP+FAL+LD      PSFSDL Y +VPV+DL+V S+ILV+
Sbjct  214   GKFLYFTSQSKIDVKELKENHPEFALVLDTKYGKLPSFSDLTYHEVPVNDLEVNSYILVK  273

Query  1024  AGESVPVDCEVF  1059
             AGESVPVDCEV+
Sbjct  274   AGESVPVDCEVY  285



>emb|CDY46080.1| BnaA09g42040D [Brassica napus]
Length=675

 Score =   247 bits (630),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 162/187 (87%), Gaps = 0/187 (0%)
 Frame = +1

Query  499   PQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRAFAVI  678
             PQ+VL++FA AI W  LANFLREHL LCC+SA LFI AAACPY++PKP +KPLQ +F ++
Sbjct  89    PQKVLIEFAKAIGWIRLANFLREHLYLCCTSAVLFITAAACPYLIPKPYIKPLQNSFMIV  148

Query  679   AFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEH  858
             AFPLVG+SASLDA+MDVAGGK+NIHVLMALA FASVFMGN+LEGGLLL+MFNLAHIAEE 
Sbjct  149   AFPLVGISASLDAIMDVAGGKVNIHVLMALAAFASVFMGNALEGGLLLSMFNLAHIAEEF  208

Query  859   FTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESV  1038
             FT  S VDVKELKE++P+ AL++DV+N++ P+F DL Y+ V + +++VGS+ILV  GE V
Sbjct  209   FTSRSMVDVKELKESNPETALVIDVDNDNVPNFFDLSYKSVHLHNVEVGSYILVGTGEIV  268

Query  1039  PVDCEVF  1059
             PVDC+V+
Sbjct  269   PVDCQVY  275



>ref|XP_009137459.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
[Brassica rapa]
Length=818

 Score =   249 bits (635),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 157/189 (83%), Gaps = 0/189 (0%)
 Frame = +1

Query  493   TKPQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRAFA  672
             +KPQ+ L  FA AI W  LANFLREHL LCCSSAALF+AAAACPY  PKP VK LQ AF 
Sbjct  97    SKPQKALFGFAKAIGWVRLANFLREHLHLCCSSAALFVAAAACPYFAPKPYVKSLQHAFM  156

Query  673   VIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAE  852
             ++ FPLVGVSASLDALMD+AGGK+NIHVLMALA FASVFMGN+LEGGLLLAMFNLAHIAE
Sbjct  157   IVGFPLVGVSASLDALMDIAGGKVNIHVLMALAAFASVFMGNALEGGLLLAMFNLAHIAE  216

Query  853   EHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGE  1032
             E FT  S VDVKELKE++PD ALL++V N + P+ SDL Y+ VPV  ++VGS+ILV  GE
Sbjct  217   EFFTSRSMVDVKELKESNPDSALLIEVKNGNVPNISDLSYKSVPVHSVEVGSYILVGTGE  276

Query  1033  SVPVDCEVF  1059
              VPVDCEV+
Sbjct  277   IVPVDCEVY  285



>emb|CDX75636.1| BnaA01g00660D [Brassica napus]
Length=817

 Score =   248 bits (634),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 157/189 (83%), Gaps = 0/189 (0%)
 Frame = +1

Query  493   TKPQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRAFA  672
             +KPQ+ L  FA AI W  LANFLREHL LCCSSAALF+AAAACPY  PKP VK LQ AF 
Sbjct  96    SKPQKALFGFAKAIGWVRLANFLREHLHLCCSSAALFVAAAACPYFAPKPYVKSLQHAFM  155

Query  673   VIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAE  852
             ++ FPLVGVSASLDALMD+AGGK+NIHVLMALA FASVFMGN+LEGGLLLAMFNLAHIAE
Sbjct  156   IVGFPLVGVSASLDALMDIAGGKVNIHVLMALAAFASVFMGNALEGGLLLAMFNLAHIAE  215

Query  853   EHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGE  1032
             E FT  S VDVKELKE++PD ALL++V N + P+ SDL Y+ VPV  ++VGS+ILV  GE
Sbjct  216   EFFTSRSMVDVKELKESNPDSALLIEVKNGNVPNISDLSYKSVPVHSVEVGSYILVGTGE  275

Query  1033  SVPVDCEVF  1059
              VPVDCEV+
Sbjct  276   IVPVDCEVY  284



>ref|XP_008352532.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic, 
partial [Malus domestica]
Length=639

 Score =   245 bits (625),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 132/196 (67%), Positives = 164/196 (84%), Gaps = 3/196 (2%)
 Frame = +1

Query  478   DDEQLTKPQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPL  657
             D  +LT  Q+ L++FA A+RW+ LA+FLREHL+LC  SA+L +AAA CPYV+ K AVKP+
Sbjct  3     DYGELTGTQKQLVRFAKAVRWTDLADFLREHLQLCFCSASLLLAAAVCPYVMLKLAVKPM  62

Query  658   QRAFAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNL  837
             Q AF ++AFPLVGVSA+LDAL D++GGK+NIHVL ALA FASVFMGN+LEGGLLLAMFNL
Sbjct  63    QNAFILVAFPLVGVSAALDALTDLSGGKVNIHVLTALAAFASVFMGNALEGGLLLAMFNL  122

Query  838   AHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFIL  1017
             AHIAEE+FT  S +DVK+LKENHPDFAL+LD+N+   P+ SDL  ++VPV +L+VGS+IL
Sbjct  123   AHIAEEYFTSRSMIDVKDLKENHPDFALVLDINDGQLPNTSDLANKQVPVHNLQVGSYIL  182

Query  1018  VQAGE---SVPVDCEV  1056
             V AGE   +VPVDCEV
Sbjct  183   VGAGEVIPTVPVDCEV  198



>emb|CAB90352.1| putative metal ATPase [Arabidopsis thaliana]
Length=819

 Score =   248 bits (632),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 132/189 (70%), Positives = 159/189 (84%), Gaps = 0/189 (0%)
 Frame = +1

Query  493   TKPQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRAFA  672
             +KPQ+VL  FA AI W  LAN+LREHL LCCS+AA+F+AAA CPY+ P+P +K LQ AF 
Sbjct  100   SKPQKVLFGFAKAIGWVRLANYLREHLHLCCSAAAMFLAAAVCPYLAPEPYIKSLQNAFM  159

Query  673   VIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAE  852
             ++ FPLVGVSASLDALMD+AGGK+NIHVLMALA FASVFMGN+LEGGLLLAMFNLAHIAE
Sbjct  160   IVGFPLVGVSASLDALMDIAGGKVNIHVLMALAAFASVFMGNALEGGLLLAMFNLAHIAE  219

Query  853   EHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGE  1032
             E FT  S VDVKELKE++PD ALL++V+N + P+ SDL Y+ VPV  ++VGS++LV  GE
Sbjct  220   EFFTSRSMVDVKELKESNPDSALLIEVHNGNVPNISDLSYKSVPVHSVEVGSYVLVGTGE  279

Query  1033  SVPVDCEVF  1059
              VPVDCEV+
Sbjct  280   IVPVDCEVY  288



>gb|AAY34978.1| chloroplast heavy metal P-type ATPase precursor [Arabidopsis 
thaliana]
Length=819

 Score =   247 bits (631),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 132/189 (70%), Positives = 158/189 (84%), Gaps = 0/189 (0%)
 Frame = +1

Query  493   TKPQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRAFA  672
             +KPQ+VL  FA AI W  LAN+LREHL LCCS+AA+F+AAA CPY+ P+P +K LQ AF 
Sbjct  100   SKPQKVLFGFAKAIGWVRLANYLREHLHLCCSAAAMFLAAAVCPYLAPEPYIKSLQNAFM  159

Query  673   VIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAE  852
             ++ FPLVGVSASLDALMD+AGGK+NIHVLMALA FASVFMGN+LEGGLLLAMFNLAHIAE
Sbjct  160   IVGFPLVGVSASLDALMDIAGGKVNIHVLMALAAFASVFMGNALEGGLLLAMFNLAHIAE  219

Query  853   EHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGE  1032
             E FT  S VDVKELKE++PD ALL++V+N + P+ SDL Y+ VPV  +KVGS++LV  GE
Sbjct  220   EFFTSRSMVDVKELKESNPDSALLIEVHNGNVPNISDLSYKSVPVHSVKVGSYVLVGTGE  279

Query  1033  SVPVDCEVF  1059
              VPVDCE +
Sbjct  280   IVPVDCEAY  288



>ref|XP_002866960.1| hypothetical protein ARALYDRAFT_490893 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43219.1| hypothetical protein ARALYDRAFT_490893 [Arabidopsis lyrata subsp. 
lyrata]
Length=826

 Score =   247 bits (630),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 134/189 (71%), Positives = 158/189 (84%), Gaps = 0/189 (0%)
 Frame = +1

Query  493   TKPQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRAFA  672
             +KPQ+VL  FA  I W  LAN+LREHL LCCS+AA+F+AAAACPY+ PKP +K LQ AF 
Sbjct  104   SKPQKVLFGFAKTIGWVRLANYLREHLHLCCSAAAMFLAAAACPYLAPKPYIKSLQNAFM  163

Query  673   VIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAE  852
             ++ FPLVGVSASLDALMD+AGGK+NIHVLMALA FASVFMGN+LEGGLLLAMFNLAHIAE
Sbjct  164   IVGFPLVGVSASLDALMDIAGGKVNIHVLMALAAFASVFMGNALEGGLLLAMFNLAHIAE  223

Query  853   EHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGE  1032
             E FT  S VDVKELKE++PD ALL++V N + P+ SDL Y+ VPV  ++VGS+ILV  GE
Sbjct  224   EFFTSRSMVDVKELKESNPDSALLIEVLNGNVPNISDLSYKSVPVHSVEVGSYILVGTGE  283

Query  1033  SVPVDCEVF  1059
              VPVDCEV+
Sbjct  284   IVPVDCEVY  292



>ref|XP_003550994.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic-like 
[Glycine max]
 gb|KHN27067.1| Putative cadmium/zinc-transporting ATPase HMA1, chloroplastic 
[Glycine soja]
Length=817

 Score =   246 bits (629),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 132/192 (69%), Positives = 157/192 (82%), Gaps = 1/192 (1%)
 Frame = +1

Query  487   QLTKPQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRA  666
              LT PQ+ ++ FA A RW  LA+ LREHL LCC S ALF+AAA CP+ LPKP VKPLQ +
Sbjct  89    NLTGPQKAVIAFAKATRWMDLADILREHLHLCCFSTALFVAAAICPHTLPKPLVKPLQNS  148

Query  667   FAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHI  846
                +AFPLVGVSASLDAL++++ GK+NIHVLMA+A FAS+FMGNSLEGGLLLAMFNLAHI
Sbjct  149   LIFVAFPLVGVSASLDALIEISSGKVNIHVLMAMAAFASIFMGNSLEGGLLLAMFNLAHI  208

Query  847   AEEHFTRCSKVDVKELKENHPDFALLLDVNNESS-PSFSDLRYQKVPVSDLKVGSFILVQ  1023
             AEE+FT  S VDV+ELKEN+PDFAL+LD N++   P+  DL Y++VPV D+ VGSFILV 
Sbjct  209   AEEYFTSRSMVDVRELKENNPDFALVLDTNDDDKLPNTFDLAYKRVPVHDVTVGSFILVG  268

Query  1024  AGESVPVDCEVF  1059
              GESVPVDCEVF
Sbjct  269   TGESVPVDCEVF  280



>ref|NP_195444.1| putative cadmium/zinc-transporting ATPase HMA1 [Arabidopsis thaliana]
 sp|Q9M3H5.2|HMA1_ARATH RecName: Full=Probable cadmium/zinc-transporting ATPase HMA1, 
chloroplastic; AltName: Full=Protein HEAVY METAL ATPASE 1; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAB16773.1| Cu2+-transporting ATPase-like protein [Arabidopsis thaliana]
 emb|CAB80393.1| Cu2+-transporting ATPase-like protein [Arabidopsis thaliana]
 emb|CAI43274.1| putative metal-transporting ATPase [Arabidopsis thaliana]
 gb|AEE86775.1| putative cadmium/zinc-transporting ATPase HMA1 [Arabidopsis thaliana]
Length=819

 Score =   246 bits (628),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 131/189 (69%), Positives = 159/189 (84%), Gaps = 0/189 (0%)
 Frame = +1

Query  493   TKPQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRAFA  672
             +KPQ++L  FA AI W  LAN+LREHL LCCS+AA+F+AAA CPY+ P+P +K LQ AF 
Sbjct  100   SKPQKMLFGFAKAIGWVRLANYLREHLHLCCSAAAMFLAAAVCPYLAPEPYIKSLQNAFM  159

Query  673   VIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAE  852
             ++ FPLVGVSASLDALMD+AGGK+NIHVLMALA FASVFMGN+LEGGLLLAMFNLAHIAE
Sbjct  160   IVGFPLVGVSASLDALMDIAGGKVNIHVLMALAAFASVFMGNALEGGLLLAMFNLAHIAE  219

Query  853   EHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGE  1032
             E FT  S VDVKELKE++PD ALL++V+N + P+ SDL Y+ VPV  ++VGS++LV  GE
Sbjct  220   EFFTSRSMVDVKELKESNPDSALLIEVHNGNVPNISDLSYKSVPVHSVEVGSYVLVGTGE  279

Query  1033  SVPVDCEVF  1059
              VPVDCEV+
Sbjct  280   IVPVDCEVY  288



>gb|KFK30352.1| hypothetical protein AALP_AA7G250400 [Arabis alpina]
Length=823

 Score =   245 bits (626),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 133/189 (70%), Positives = 156/189 (83%), Gaps = 0/189 (0%)
 Frame = +1

Query  493   TKPQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRAFA  672
             +K Q++L  FA AI W  LANFLRE+L LCCSSA LF+AAA CPY  PKP +KPLQ AF 
Sbjct  99    SKSQKLLFGFAKAIGWIRLANFLRENLHLCCSSAVLFLAAALCPYFAPKPYIKPLQNAFM  158

Query  673   VIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAE  852
             ++ FPLVGVSASLDALMD+AGGK+NIHVLMALA FASVFMGN+LEGGLLLAMFNLAHIAE
Sbjct  159   IVGFPLVGVSASLDALMDIAGGKVNIHVLMALAAFASVFMGNALEGGLLLAMFNLAHIAE  218

Query  853   EHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGE  1032
             E FT  S VDVKELKE++PD ALL++V N + P+ SDL Y+ VPV  ++VGS++LV  GE
Sbjct  219   EFFTSRSMVDVKELKESNPDSALLIEVKNGNVPNMSDLSYKSVPVHSVEVGSYVLVGTGE  278

Query  1033  SVPVDCEVF  1059
              VPVDCEV+
Sbjct  279   IVPVDCEVY  287



>ref|XP_010417081.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
isoform X1 [Camelina sativa]
Length=824

 Score =   245 bits (625),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 128/188 (68%), Positives = 156/188 (83%), Gaps = 0/188 (0%)
 Frame = +1

Query  496   KPQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRAFAV  675
             +PQ++L KFA AI W  LANFLREHL LC SSA LF+AAAA P+ +PKP V P+Q +F V
Sbjct  98    QPQKILTKFAKAIGWIRLANFLREHLHLCTSSAVLFLAAAASPHFIPKPYVTPIQNSFIV  157

Query  676   IAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEE  855
             +AFPLVG+SASLDALMD+AGG++NIHVLMALA FASVFMGN+LEGGLLL MFNLAHIAEE
Sbjct  158   VAFPLVGISASLDALMDIAGGRVNIHVLMALAAFASVFMGNALEGGLLLVMFNLAHIAEE  217

Query  856   HFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGES  1035
              FT  S VDVKELKE++PD AL++DVN+ + P+F D  Y+ V V +++VGS+ILV  GE 
Sbjct  218   FFTSRSVVDVKELKESNPDSALVIDVNDANVPNFFDFSYKSVNVHNVQVGSYILVGTGEV  277

Query  1036  VPVDCEVF  1059
             VPVDC+V+
Sbjct  278   VPVDCQVY  285



>ref|XP_004509102.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic-like 
[Cicer arietinum]
Length=839

 Score =   245 bits (625),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 129/194 (66%), Positives = 158/194 (81%), Gaps = 0/194 (0%)
 Frame = +1

Query  478   DDEQLTKPQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPL  657
             D   LT PQ+ ++ FA A +W  LAN LREHL LCC SAALF+AAA CP+ LPK  +KP 
Sbjct  109   DYANLTGPQKAIISFAKATKWMDLANILREHLHLCCFSAALFVAAAICPHTLPKSLIKPF  168

Query  658   QRAFAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNL  837
             Q +  ++AFPLVGVSASLDAL++++ GK+NIHVLMA+A FAS+FMGNSLEGGLLLAMFNL
Sbjct  169   QNSLILVAFPLVGVSASLDALIEISSGKVNIHVLMAMAAFASIFMGNSLEGGLLLAMFNL  228

Query  838   AHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFIL  1017
             AHIAE++FT  S VDVKELKEN+PDFAL+LD  ++  P+  DL Y++VPV D+ VGS++L
Sbjct  229   AHIAEDYFTGRSMVDVKELKENYPDFALVLDTKDDKLPNTFDLAYKRVPVHDITVGSYVL  288

Query  1018  VQAGESVPVDCEVF  1059
             V AGESVPVDCEVF
Sbjct  289   VGAGESVPVDCEVF  302



>ref|XP_006411908.1| hypothetical protein EUTSA_v10024415mg [Eutrema salsugineum]
 gb|ESQ53361.1| hypothetical protein EUTSA_v10024415mg [Eutrema salsugineum]
Length=822

 Score =   244 bits (624),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 136/189 (72%), Positives = 157/189 (83%), Gaps = 0/189 (0%)
 Frame = +1

Query  493   TKPQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRAFA  672
             +K Q++L  FA AI W  LANFLREHL LCCSSAALF+AAAACPY  PKP +K LQ AF 
Sbjct  101   SKSQKLLFGFAKAIGWVRLANFLREHLHLCCSSAALFLAAAACPYFAPKPYIKSLQNAFM  160

Query  673   VIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAE  852
             ++ FPLVGVSASLDALMD+AGGK+NIHVLMALA FASVFMGN+LEGGLLLAMFNLAHIAE
Sbjct  161   IVGFPLVGVSASLDALMDLAGGKVNIHVLMALAAFASVFMGNALEGGLLLAMFNLAHIAE  220

Query  853   EHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGE  1032
             E FT  S VDVKELKE++PD ALL++V N + P+ SDL Y+ VPV  ++VGS+ILV  GE
Sbjct  221   EFFTSRSMVDVKELKESNPDSALLIEVKNGNVPNISDLSYKSVPVHSVEVGSYILVGTGE  280

Query  1033  SVPVDCEVF  1059
              VPVDCEV+
Sbjct  281   IVPVDCEVY  289



>ref|XP_010679546.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=827

 Score =   244 bits (622),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 157/193 (81%), Gaps = 0/193 (0%)
 Frame = +1

Query  478   DDEQLTKPQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPL  657
             D+ +L+K QE +  FA AI W  LAN LRE+L+LCC S AL +AA+A PY++PKP +KPL
Sbjct  96    DEVRLSKFQEKVFGFAKAIGWVDLANILRENLQLCCCSMALLLAASASPYLVPKPVIKPL  155

Query  658   QRAFAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNL  837
             Q AF  +AFPLVGV AS DALMD+AGGK+NIHVLMALA FASVFMGN LEGGLL+AMFNL
Sbjct  156   QNAFIFLAFPLVGVPASFDALMDIAGGKVNIHVLMALAAFASVFMGNPLEGGLLIAMFNL  215

Query  838   AHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFIL  1017
             AHIAEE+FT  S VDV+ELKE +PD AL+LDV+   +P+FS + Y+KVPV+++ VGSF+L
Sbjct  216   AHIAEEYFTSRSMVDVRELKETYPDSALVLDVDKNKTPTFSSVSYKKVPVTEIGVGSFVL  275

Query  1018  VQAGESVPVDCEV  1056
             VQAGE VPVD  V
Sbjct  276   VQAGEFVPVDSVV  288



>ref|XP_010927513.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
isoform X2 [Elaeis guineensis]
Length=807

 Score =   243 bits (621),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 156/193 (81%), Gaps = 0/193 (0%)
 Frame = +1

Query  481   DEQLTKPQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQ  660
             + +L + QE +++FA A+ W+ LA+ LREHL+LCC S AL + A+ACPYVLP  A K LQ
Sbjct  107   EGELNRAQEGIIRFAKAVGWADLADLLREHLQLCCCSMALLLLASACPYVLPDRAAKSLQ  166

Query  661   RAFAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLA  840
                  IAFPLVGVSA+LDA++++A G +NIHVLMALA FASVFMGNSLEG LLLAMFNLA
Sbjct  167   NGLIAIAFPLVGVSAALDAVLNLAAGTVNIHVLMALAAFASVFMGNSLEGALLLAMFNLA  226

Query  841   HIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILV  1020
             HIAEE+FT  S +DVKELK+NHPDFALLL+VN +  P FS L Y K+PV DLKVGS+ILV
Sbjct  227   HIAEEYFTSRSMIDVKELKDNHPDFALLLEVNGDRLPQFSKLNYTKIPVHDLKVGSYILV  286

Query  1021  QAGESVPVDCEVF  1059
             +AGE+VPVD EVF
Sbjct  287   RAGEAVPVDGEVF  299



>ref|XP_010927512.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
isoform X1 [Elaeis guineensis]
Length=836

 Score =   243 bits (621),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 156/193 (81%), Gaps = 0/193 (0%)
 Frame = +1

Query  481   DEQLTKPQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQ  660
             + +L + QE +++FA A+ W+ LA+ LREHL+LCC S AL + A+ACPYVLP  A K LQ
Sbjct  107   EGELNRAQEGIIRFAKAVGWADLADLLREHLQLCCCSMALLLLASACPYVLPDRAAKSLQ  166

Query  661   RAFAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLA  840
                  IAFPLVGVSA+LDA++++A G +NIHVLMALA FASVFMGNSLEG LLLAMFNLA
Sbjct  167   NGLIAIAFPLVGVSAALDAVLNLAAGTVNIHVLMALAAFASVFMGNSLEGALLLAMFNLA  226

Query  841   HIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILV  1020
             HIAEE+FT  S +DVKELK+NHPDFALLL+VN +  P FS L Y K+PV DLKVGS+ILV
Sbjct  227   HIAEEYFTSRSMIDVKELKDNHPDFALLLEVNGDRLPQFSKLNYTKIPVHDLKVGSYILV  286

Query  1021  QAGESVPVDCEVF  1059
             +AGE+VPVD EVF
Sbjct  287   RAGEAVPVDGEVF  299



>ref|XP_006295445.1| hypothetical protein CARUB_v10024548mg [Capsella rubella]
 gb|EOA28343.1| hypothetical protein CARUB_v10024548mg [Capsella rubella]
Length=788

 Score =   241 bits (615),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 124/188 (66%), Positives = 154/188 (82%), Gaps = 0/188 (0%)
 Frame = +1

Query  496   KPQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRAFAV  675
             KPQ++L+KFA A  W  LANFLREH  LC SSA LF+ AAA P+ +PKP V P+Q +   
Sbjct  93    KPQKLLIKFAKATGWIRLANFLREHFHLCFSSAVLFLVAAASPHFIPKPYVTPIQNSLMT  152

Query  676   IAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEE  855
             +AFPLVG+SASLDALMD+AGG++NIHVLMALA FASVFMGN+LEGGLLL MFNLAHIAEE
Sbjct  153   VAFPLVGISASLDALMDIAGGRVNIHVLMALAAFASVFMGNALEGGLLLTMFNLAHIAEE  212

Query  856   HFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGES  1035
              FT  S VDVKELKE++PD AL++DVN+E+ P+F DL Y+ V V +++VGS++LV  GE 
Sbjct  213   FFTSRSMVDVKELKESNPDSALVIDVNDENVPNFFDLSYKSVDVHNVQVGSYVLVGTGEI  272

Query  1036  VPVDCEVF  1059
             VP+DC+V+
Sbjct  273   VPMDCQVY  280



>ref|XP_010429275.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
[Camelina sativa]
Length=819

 Score =   241 bits (614),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 157/188 (84%), Gaps = 0/188 (0%)
 Frame = +1

Query  496   KPQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRAFAV  675
             +PQ++L KFA +I W  LANFLREHL LC SSA LF+AAAA P+ +PKP + P+Q +F +
Sbjct  100   QPQKLLTKFAKSIGWIRLANFLREHLHLCISSAVLFLAAAASPHFIPKPYITPIQNSFII  159

Query  676   IAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEE  855
             +AFPLVG+SASLDALMD+AGG++NIHVLMALA FASVFMGN+LEGGLLL MFNLAHIAEE
Sbjct  160   VAFPLVGISASLDALMDIAGGRVNIHVLMALAAFASVFMGNALEGGLLLVMFNLAHIAEE  219

Query  856   HFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGES  1035
              FT  S +DVKELKE++PD AL+++VN+++ P+F D  Y+ V V +++VGS+ILV  GE 
Sbjct  220   FFTSRSVIDVKELKESNPDSALVINVNDDNVPNFFDFSYKSVNVQNVQVGSYILVGTGEV  279

Query  1036  VPVDCEVF  1059
             VPVDC+V+
Sbjct  280   VPVDCQVY  287



>gb|KFK32755.1| hypothetical protein AALP_AA6G284800 [Arabis alpina]
Length=804

 Score =   240 bits (613),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 158/187 (84%), Gaps = 0/187 (0%)
 Frame = +1

Query  499   PQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRAFAVI  678
             PQ+VL+ FA +I W  +ANFLREHL LCCSSAA+FIA AACPY +PKP +  LQ +  ++
Sbjct  88    PQKVLIDFARSIGWIRVANFLREHLHLCCSSAAMFIAVAACPYFVPKPYITHLQNSLMIV  147

Query  679   AFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEH  858
             AFPLVG+SASLDALMD+AGGK+NIHVLMAL+ FASVF+GN+LEGGLLLAMFNLAHIAEE 
Sbjct  148   AFPLVGISASLDALMDIAGGKVNIHVLMALSAFASVFIGNALEGGLLLAMFNLAHIAEEL  207

Query  859   FTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESV  1038
             FT  S VDVKELKE +PD AL++DVNN++ P+F DL Y+ VPV +++VGS++LV  GE V
Sbjct  208   FTSRSMVDVKELKEINPDSALVIDVNNDNVPNFFDLSYKSVPVHNVQVGSYVLVGTGEVV  267

Query  1039  PVDCEVF  1059
             PVDC+V+
Sbjct  268   PVDCQVY  274



>emb|CDX69288.1| BnaC01g01650D [Brassica napus]
Length=819

 Score =   239 bits (609),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 157/189 (83%), Gaps = 0/189 (0%)
 Frame = +1

Query  493   TKPQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRAFA  672
             +KPQ+ L  FA AI W  LANFLREHL LCCSSAALF+AAAACP+  PKP VK LQ AF 
Sbjct  98    SKPQKALFGFAKAIGWVRLANFLREHLHLCCSSAALFVAAAACPFFAPKPYVKSLQHAFM  157

Query  673   VIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAE  852
             ++ FPLVGVSASLDALMD+AGGK+NIHVLMALA FASVFMGN+LEGGLLLAMFNLAHIAE
Sbjct  158   IVGFPLVGVSASLDALMDIAGGKVNIHVLMALAAFASVFMGNALEGGLLLAMFNLAHIAE  217

Query  853   EHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGE  1032
             E FT  S VDVKELKE++PD ALL++V N + P+ SDL Y+ VPV  ++VGS+ILV  GE
Sbjct  218   EFFTSRSMVDVKELKESNPDSALLIEVKNGNVPNISDLSYKSVPVHSVEVGSYILVGTGE  277

Query  1033  SVPVDCEVF  1059
              VPVDCEV+
Sbjct  278   IVPVDCEVY  286



>ref|XP_002878674.1| hypothetical protein ARALYDRAFT_343887 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54933.1| hypothetical protein ARALYDRAFT_343887 [Arabidopsis lyrata subsp. 
lyrata]
Length=821

 Score =   235 bits (600),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 127/187 (68%), Positives = 158/187 (84%), Gaps = 1/187 (1%)
 Frame = +1

Query  502   QEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVL-PKPAVKPLQRAFAVI  678
             Q++LLKFA AI W  LANFLRE+L LCCSS  LF+AAAACP+++ PKP + P+Q +F ++
Sbjct  93    QKLLLKFAKAIGWIRLANFLRENLHLCCSSVVLFLAAAACPHLMIPKPYITPIQNSFMIV  152

Query  679   AFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEH  858
             AFPLVG+SASLDALMD+AGGK+NIHVLMALA FASVFMGN+LEGGLLL MFNLAHIAEE 
Sbjct  153   AFPLVGISASLDALMDIAGGKVNIHVLMALAAFASVFMGNALEGGLLLTMFNLAHIAEEF  212

Query  859   FTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESV  1038
             FT  S +DVKEL E++PD AL++DVN+E+ P+F DL Y+ V V +++VGS+ILV  GE V
Sbjct  213   FTSRSMLDVKELNESNPDSALVIDVNDENVPNFFDLTYKSVHVKNVEVGSYILVGTGEIV  272

Query  1039  PVDCEVF  1059
             PVDC+V+
Sbjct  273   PVDCQVY  279



>ref|XP_009417706.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
[Musa acuminata subsp. malaccensis]
Length=861

 Score =   234 bits (597),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 126/186 (68%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  502   QEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRAFAVIA  681
             Q+ +L+FA A+ W+ LA+ LREHL+LCC S    + AAAC  +LP  A KPLQ A   +A
Sbjct  138   QKAVLRFAKAVGWADLADLLREHLQLCCCSMVSLLLAAACHCLLPGRAGKPLQNALIAVA  197

Query  682   FPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHF  861
             FPLVGVSA+LDA++ +A GK+NIHVLMALA FASVFMGNSLEGGLLLAMFNLAHIAEE+F
Sbjct  198   FPLVGVSAALDAIVIIASGKVNIHVLMALAAFASVFMGNSLEGGLLLAMFNLAHIAEEYF  257

Query  862   TRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVP  1041
             T  S +DVKELK+N PD+ALLLDVN +  P FS L Y KVPV DL+VGS+ILV+AGE+VP
Sbjct  258   TSQSMIDVKELKDNFPDYALLLDVNGDEPPQFSKLDYAKVPVCDLEVGSYILVRAGEAVP  317

Query  1042  VDCEVF  1059
             VD EVF
Sbjct  318   VDGEVF  323



>ref|XP_006404810.1| hypothetical protein EUTSA_v10000049mg [Eutrema salsugineum]
 gb|ESQ46263.1| hypothetical protein EUTSA_v10000049mg [Eutrema salsugineum]
Length=812

 Score =   232 bits (591),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 128/189 (68%), Positives = 161/189 (85%), Gaps = 2/189 (1%)
 Frame = +1

Query  499   PQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRAFAVI  678
             PQ+ L++FA AI W  LANFLR HL LCCSSA LFIAAAACPY++PKP +KP+Q +F ++
Sbjct  94    PQKTLIEFAKAIGWIRLANFLRNHLHLCCSSAILFIAAAACPYLIPKPYIKPIQNSFMIV  153

Query  679   AFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEH  858
             AFPL+G+SASLDALMD+AGGK+NIHVLMALA FASVFMGN+LEGGLLL+MFNLAHIAEE 
Sbjct  154   AFPLIGISASLDALMDLAGGKVNIHVLMALAAFASVFMGNALEGGLLLSMFNLAHIAEEF  213

Query  859   FTRCSKVDVKELKENHPDFALLL--DVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGE  1032
             FT  S VDVKELKE++PD AL++  D +++++P+F DL Y+ V V +++VGS+ILV  GE
Sbjct  214   FTSKSMVDVKELKESNPDSALVIDVDDDDDNAPNFFDLSYKSVHVHNVQVGSYILVGTGE  273

Query  1033  SVPVDCEVF  1059
              VPVDC+V+
Sbjct  274   IVPVDCQVY  282



>ref|XP_011623220.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
isoform X1 [Amborella trichopoda]
Length=823

 Score =   224 bits (572),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 118/194 (61%), Positives = 152/194 (78%), Gaps = 1/194 (1%)
 Frame = +1

Query  475   SDDEQLTKPQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKP  654
              + +QL   QE +L  A A  W+ LA+FLREHL+LCC S  L + A  CP+ LPKPA+KP
Sbjct  93    GERKQLNSSQEAILAMARACGWADLADFLREHLQLCCCSMGLLLMAVLCPHALPKPAIKP  152

Query  655   LQRAFAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFN  834
             +Q      AFPLVGVS++LDA++D+AGG++NIHVLMALA FASVFMGNSLEG LLLAMFN
Sbjct  153   VQNTLVAFAFPLVGVSSALDAVVDLAGGRVNIHVLMALAAFASVFMGNSLEGALLLAMFN  212

Query  835   LAHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFI  1014
             LAHIAEE+FT  +  DVKELKE+HPDFAL+L+ + +  P FS L Y+++PV ++ +G++I
Sbjct  213   LAHIAEEYFTSRAMNDVKELKESHPDFALVLE-SVDVPPHFSSLSYKRIPVHNVDMGAYI  271

Query  1015  LVQAGESVPVDCEV  1056
             LV+AGE+VPVD EV
Sbjct  272   LVRAGETVPVDGEV  285



>ref|XP_003560477.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
[Brachypodium distachyon]
Length=819

 Score =   222 bits (566),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 120/183 (66%), Positives = 148/183 (81%), Gaps = 0/183 (0%)
 Frame = +1

Query  511   LLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRAFAVIAFPL  690
             +++FA AI W+ +A+ LREHL++CC S  L + AA CP+V    +V+ LQ A   +AFPL
Sbjct  100   VMRFARAIGWAAVADALREHLQVCCISLGLLLMAAVCPHVALLNSVRRLQAALIAVAFPL  159

Query  691   VGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTRC  870
             VGVSA+LDAL+D+A GKINIHVLMALA FAS+FMGNSLEGGLLLAMFNLAHIAEE+FT  
Sbjct  160   VGVSAALDALLDIADGKINIHVLMALAAFASIFMGNSLEGGLLLAMFNLAHIAEEYFTSK  219

Query  871   SKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVDC  1050
             S  DV+ELKENHP+FALLL+ + + S  FS+L Y KVPV DL+VGS ILV+AGE+VPVD 
Sbjct  220   SMYDVRELKENHPEFALLLETSGDESAQFSNLSYTKVPVHDLEVGSHILVRAGEAVPVDG  279

Query  1051  EVF  1059
             EV+
Sbjct  280   EVY  282



>dbj|BAJ89769.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=774

 Score =   220 bits (560),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 149/184 (81%), Gaps = 0/184 (0%)
 Frame = +1

Query  508   VLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRAFAVIAFP  687
              +++ A AI W+ +A+ LR+HL++CC S  L + AAACP+V P  +V  LQ A   +AFP
Sbjct  109   TVMRLAKAIGWADIADALRDHLQVCCISLGLLLIAAACPHVAPLNSVGRLQAALIAVAFP  168

Query  688   LVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTR  867
             LVGVSA+LDAL+D+A G+I+IHVLMALA FASVFMGNSLEGGLLLAMF+LAH AEE+FTR
Sbjct  169   LVGVSAALDALVDIADGRIDIHVLMALAAFASVFMGNSLEGGLLLAMFSLAHTAEEYFTR  228

Query  868   CSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVD  1047
              S VDV+ELKENHP+FALLL+ + + S  FS+L + KVPV DLKVGS ILV+AGE+VPVD
Sbjct  229   KSMVDVRELKENHPEFALLLETSGDGSTRFSNLSHTKVPVHDLKVGSHILVRAGEAVPVD  288

Query  1048  CEVF  1059
              EV+
Sbjct  289   GEVY  292



>gb|EEE66260.1| hypothetical protein OsJ_22445 [Oryza sativa Japonica Group]
Length=803

 Score =   218 bits (556),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 119/182 (65%), Positives = 147/182 (81%), Gaps = 0/182 (0%)
 Frame = +1

Query  514   LKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRAFAVIAFPLV  693
             ++ A AI W+ +A+ LREHL+LCC S  L + AAACP++    +V+ LQ A   +AFPLV
Sbjct  1     MRVAKAIGWADVADALREHLQLCCISLGLLLIAAACPHIPVLNSVRRLQDALIAVAFPLV  60

Query  694   GVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTRCS  873
             GVSA+LDAL+++A GKINIHVLMALA FAS+FMGNSLEGGLLLAMFNLAHIAEEHFT  S
Sbjct  61    GVSAALDALVNIADGKINIHVLMALAAFASIFMGNSLEGGLLLAMFNLAHIAEEHFTSKS  120

Query  874   KVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVDCE  1053
              +DV+ELKENHP+FALLL+   + S  F++L Y KVPV DL+VGS ILV+AGE+VPVD E
Sbjct  121   MIDVRELKENHPEFALLLETCGDQSAQFANLCYTKVPVHDLEVGSHILVRAGEAVPVDGE  180

Query  1054  VF  1059
             V+
Sbjct  181   VY  182



>gb|EEC81219.1| hypothetical protein OsI_24259 [Oryza sativa Indica Group]
Length=827

 Score =   218 bits (555),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 148/183 (81%), Gaps = 0/183 (0%)
 Frame = +1

Query  511   LLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRAFAVIAFPL  690
             +++ A AI W+ +A+ LREHL+LCC S  L + AAACP++    +V+ LQ A   +AFPL
Sbjct  108   VMRVAKAIGWADVADALREHLQLCCISLGLLLIAAACPHIPVLNSVRRLQDALIAVAFPL  167

Query  691   VGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTRC  870
             VGVSA+LDAL+++A GKINIHVLMALA FAS+FMGNSLEGGLLLAMFNLAHIAEEHFT  
Sbjct  168   VGVSAALDALVNIADGKINIHVLMALAAFASIFMGNSLEGGLLLAMFNLAHIAEEHFTSK  227

Query  871   SKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVDC  1050
             S +DV+ELKENHP+FALLL+   + S  F++L Y KVPV DL+VGS ILV+AGE+VPVD 
Sbjct  228   SMIDVRELKENHPEFALLLETCGDQSAQFANLCYTKVPVHDLEVGSHILVRAGEAVPVDG  287

Query  1051  EVF  1059
             EV+
Sbjct  288   EVY  290



>ref|NP_001058417.1| Os06g0690700 [Oryza sativa Japonica Group]
 dbj|BAD45628.1| putative cadmium resistance protein [Oryza sativa Japonica Group]
 dbj|BAD54505.1| putative cadmium resistance protein [Oryza sativa Japonica Group]
 dbj|BAF20331.1| Os06g0690700 [Oryza sativa Japonica Group]
Length=822

 Score =   218 bits (555),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 148/183 (81%), Gaps = 0/183 (0%)
 Frame = +1

Query  511   LLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRAFAVIAFPL  690
             +++ A AI W+ +A+ LREHL+LCC S  L + AAACP++    +V+ LQ A   +AFPL
Sbjct  103   VMRVAKAIGWADVADALREHLQLCCISLGLLLIAAACPHIPVLNSVRRLQDALIAVAFPL  162

Query  691   VGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTRC  870
             VGVSA+LDAL+++A GKINIHVLMALA FAS+FMGNSLEGGLLLAMFNLAHIAEEHFT  
Sbjct  163   VGVSAALDALVNIADGKINIHVLMALAAFASIFMGNSLEGGLLLAMFNLAHIAEEHFTSK  222

Query  871   SKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVDC  1050
             S +DV+ELKENHP+FALLL+   + S  F++L Y KVPV DL+VGS ILV+AGE+VPVD 
Sbjct  223   SMIDVRELKENHPEFALLLETCGDQSAQFANLCYTKVPVHDLEVGSHILVRAGEAVPVDG  282

Query  1051  EVF  1059
             EV+
Sbjct  283   EVY  285



>ref|NP_001141444.1| uncharacterized protein LOC100273554 [Zea mays]
 gb|ACF86382.1| unknown [Zea mays]
Length=664

 Score =   215 bits (548),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 119/182 (65%), Positives = 145/182 (80%), Gaps = 0/182 (0%)
 Frame = +1

Query  514   LKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRAFAVIAFPLV  693
             ++ A AI W+++A+ LREHL LCC S  L + AAACP+V    +V  LQ A   +AFPLV
Sbjct  1     MRVARAIGWANVADALREHLHLCCISLGLLLIAAACPHVALLNSVSRLQAALIAVAFPLV  60

Query  694   GVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTRCS  873
             GVSA+LDAL+++A G+INIHVLMALA FAS+FMGN+LEGGLLLAMFNLAHIAEE+FT  S
Sbjct  61    GVSAALDALVNIADGRINIHVLMALAAFASIFMGNALEGGLLLAMFNLAHIAEEYFTSKS  120

Query  874   KVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVDCE  1053
               DV+ELKENHP+FALLL+ + E S  FS+L Y KVPV DL VGS ILV+AGE+VPVD E
Sbjct  121   MFDVRELKENHPEFALLLETSGEESVQFSNLSYTKVPVHDLDVGSHILVRAGEAVPVDGE  180

Query  1054  VF  1059
             V+
Sbjct  181   VY  182



>ref|XP_006656409.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic-like 
[Oryza brachyantha]
Length=831

 Score =   217 bits (552),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 147/183 (80%), Gaps = 0/183 (0%)
 Frame = +1

Query  511   LLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRAFAVIAFPL  690
             +++ A AI W+ +A  LREHL++CC S  L + AAACP++    +V+ LQ A   +AFPL
Sbjct  112   VMRVAKAIGWADVAEALREHLQVCCISLGLLLFAAACPHIPVLNSVRRLQDALIAVAFPL  171

Query  691   VGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTRC  870
             VGVSA+LDAL+++A GKINIHVLMALA FAS+FMGNSLEGGLLLAMFNLAHIAEEHFT  
Sbjct  172   VGVSAALDALVNIADGKINIHVLMALAAFASIFMGNSLEGGLLLAMFNLAHIAEEHFTSK  231

Query  871   SKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVDC  1050
             S +DV+ELKENHP+FALLL+   + S  F++L Y KVPV DL+VGS ILV+AGE+VPVD 
Sbjct  232   SMIDVRELKENHPEFALLLETCGDQSAQFANLCYTKVPVHDLEVGSHILVRAGEAVPVDG  291

Query  1051  EVF  1059
             EV+
Sbjct  292   EVY  294



>gb|EMS57324.1| putative cadmium/zinc-transporting ATPase HMA1, chloroplastic 
[Triticum urartu]
Length=718

 Score =   215 bits (548),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 144/182 (79%), Gaps = 0/182 (0%)
 Frame = +1

Query  514   LKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRAFAVIAFPLV  693
             ++ A AI W+ +A+ LREHL+LCC S  L + AA CP+V    +V  L  A   IAFPLV
Sbjct  1     MRMARAIGWADVADALREHLQLCCISLGLLLMAAVCPHVPLLNSVGRLPAALIAIAFPLV  60

Query  694   GVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTRCS  873
             GVSA+LDAL+D+A GKINIHVLMALA FAS+FMGNSLEGGLLLAMFNLAHIAEE+FT  S
Sbjct  61    GVSAALDALVDIADGKINIHVLMALAAFASIFMGNSLEGGLLLAMFNLAHIAEEYFTSKS  120

Query  874   KVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVDCE  1053
               DV+ELKENHP+FALLL+ + + S  FS+L Y KVPV DL+VGS ILV+AGE+VPVD E
Sbjct  121   MYDVRELKENHPEFALLLETSGDESAHFSNLNYAKVPVHDLEVGSHILVRAGEAVPVDGE  180

Query  1054  VF  1059
             V+
Sbjct  181   VY  182



>ref|XP_011623223.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
isoform X3 [Amborella trichopoda]
Length=661

 Score =   214 bits (546),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 144/179 (80%), Gaps = 1/179 (1%)
 Frame = +1

Query  520   FADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRAFAVIAFPLVGV  699
              A A  W+ LA+FLREHL+LCC S  L + A  CP+ LPKPA+KP+Q      AFPLVGV
Sbjct  1     MARACGWADLADFLREHLQLCCCSMGLLLMAVLCPHALPKPAIKPVQNTLVAFAFPLVGV  60

Query  700   SASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTRCSKV  879
             S++LDA++D+AGG++NIHVLMALA FASVFMGNSLEG LLLAMFNLAHIAEE+FT  +  
Sbjct  61    SSALDAVVDLAGGRVNIHVLMALAAFASVFMGNSLEGALLLAMFNLAHIAEEYFTSRAMN  120

Query  880   DVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVDCEV  1056
             DVKELKE+HPDFAL+L+ + +  P FS L Y+++PV ++ +G++ILV+AGE+VPVD EV
Sbjct  121   DVKELKESHPDFALVLE-SVDVPPHFSSLSYKRIPVHNVDMGAYILVRAGETVPVDGEV  178



>gb|AFW69218.1| hypothetical protein ZEAMMB73_697863 [Zea mays]
Length=768

 Score =   214 bits (546),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 146/183 (80%), Gaps = 0/183 (0%)
 Frame = +1

Query  511   LLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRAFAVIAFPL  690
             +++ A AI W+++A+ LREHL LCC S  L + AAACP+V    +V  LQ A   +AFPL
Sbjct  104   VMRVARAIGWANVADALREHLHLCCISLGLLLIAAACPHVALLNSVSRLQAALIAVAFPL  163

Query  691   VGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTRC  870
             VGVSA+LDAL+++A G+INIHVLMALA FAS+FMGN+LEGGLLLAMFNLAHIAEE+FT  
Sbjct  164   VGVSAALDALVNIADGRINIHVLMALAAFASIFMGNALEGGLLLAMFNLAHIAEEYFTSK  223

Query  871   SKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVDC  1050
             S  DV+ELKENHP+FALLL+ + E S  FS+L Y KVPV DL VGS ILV+AGE+VPVD 
Sbjct  224   SMFDVRELKENHPEFALLLETSGEESVQFSNLSYTKVPVHDLDVGSHILVRAGEAVPVDG  283

Query  1051  EVF  1059
             EV+
Sbjct  284   EVY  286



>ref|XP_008681454.1| PREDICTED: uncharacterized protein LOC100273554 isoform X1 [Zea 
mays]
 gb|AFW69217.1| ATPase cadmium transporter [Zea mays]
Length=823

 Score =   214 bits (546),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 146/183 (80%), Gaps = 0/183 (0%)
 Frame = +1

Query  511   LLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRAFAVIAFPL  690
             +++ A AI W+++A+ LREHL LCC S  L + AAACP+V    +V  LQ A   +AFPL
Sbjct  104   VMRVARAIGWANVADALREHLHLCCISLGLLLIAAACPHVALLNSVSRLQAALIAVAFPL  163

Query  691   VGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTRC  870
             VGVSA+LDAL+++A G+INIHVLMALA FAS+FMGN+LEGGLLLAMFNLAHIAEE+FT  
Sbjct  164   VGVSAALDALVNIADGRINIHVLMALAAFASIFMGNALEGGLLLAMFNLAHIAEEYFTSK  223

Query  871   SKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVDC  1050
             S  DV+ELKENHP+FALLL+ + E S  FS+L Y KVPV DL VGS ILV+AGE+VPVD 
Sbjct  224   SMFDVRELKENHPEFALLLETSGEESVQFSNLSYTKVPVHDLDVGSHILVRAGEAVPVDG  283

Query  1051  EVF  1059
             EV+
Sbjct  284   EVY  286



>dbj|BAK06002.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=828

 Score =   214 bits (544),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 144/183 (79%), Gaps = 0/183 (0%)
 Frame = +1

Query  511   LLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRAFAVIAFPL  690
             +++ A  I W+ +A+ LREHL+LCC S  L + AA CP+V    +V  L  A   IAFPL
Sbjct  110   VMRMARTIGWADVADALREHLQLCCISLGLLLTAAVCPHVPLLNSVGRLPAALIAIAFPL  169

Query  691   VGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTRC  870
             VGVSA+LDAL+D+A GKINIHVLMALA FAS+FMGNSLEGGLLLAMFNLAHIAEE+FT  
Sbjct  170   VGVSAALDALVDIADGKINIHVLMALAAFASIFMGNSLEGGLLLAMFNLAHIAEEYFTSK  229

Query  871   SKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVDC  1050
             S  DV+ELKENHP+FALLL+ + + S  FS+L Y KVPV DL+VGS ILV+AGE+VPVD 
Sbjct  230   SMYDVRELKENHPEFALLLETSGDESAHFSNLNYAKVPVHDLEVGSHILVRAGEAVPVDG  289

Query  1051  EVF  1059
             EV+
Sbjct  290   EVY  292



>emb|CCC14999.1| heavy metal ATPase 1 [Hordeum vulgare subsp. vulgare]
Length=828

 Score =   214 bits (544),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 144/183 (79%), Gaps = 0/183 (0%)
 Frame = +1

Query  511   LLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRAFAVIAFPL  690
             +++ A  I W+ +A+ LREHL+LCC S  L + AA CP+V    +V  L  A   IAFPL
Sbjct  110   VMRMARTIGWADVADALREHLQLCCISLGLLLTAAVCPHVPLLNSVGRLPAALIAIAFPL  169

Query  691   VGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTRC  870
             VGVSA+LDAL+D+A GKINIHVLMALA FAS+FMGNSLEGGLLLAMFNLAHIAEE+FT  
Sbjct  170   VGVSAALDALVDIADGKINIHVLMALAAFASIFMGNSLEGGLLLAMFNLAHIAEEYFTSK  229

Query  871   SKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVDC  1050
             S  DV+ELKENHP+FALLL+ + + S  FS+L Y KVPV DL+VGS ILV+AGE+VPVD 
Sbjct  230   SMYDVRELKENHPEFALLLETSGDESAHFSNLNYAKVPVHDLEVGSHILVRAGEAVPVDG  289

Query  1051  EVF  1059
             EV+
Sbjct  290   EVY  292



>ref|XP_008338386.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
[Malus domestica]
Length=765

 Score =   213 bits (543),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 120/190 (63%), Positives = 150/190 (79%), Gaps = 13/190 (7%)
 Frame = +1

Query  487   QLTKPQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRA  666
             +LT  Q+ L++FA A+RW+ LA+FLREHL+LC  SA+L +AAA CPYV+ K AVKP+Q A
Sbjct  105   ELTGTQKQLVRFAKAVRWTDLADFLREHLQLCFCSASLLLAAAVCPYVMLKLAVKPMQNA  164

Query  667   FAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHI  846
             F +       VSA+LDAL D++GGK+NIHVL ALA FASVFMGN+LEGGLLLAMFNLAHI
Sbjct  165   FIL-------VSAALDALTDLSGGKVNIHVLTALAAFASVFMGNALEGGLLLAMFNLAHI  217

Query  847   AEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQA  1026
             AEE+FT  S +DVK+LKENHPDFAL+LD+N+   P+ SDL  ++VPV +L+VGS+ILV A
Sbjct  218   AEEYFTSRSMIDVKDLKENHPDFALVLDINDGQLPNTSDLANKQVPVHNLQVGSYILVGA  277

Query  1027  GESVPVDCEV  1056
                   DCEV
Sbjct  278   ------DCEV  281



>ref|XP_004966187.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic-like 
[Setaria italica]
Length=828

 Score =   210 bits (534),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 115/183 (63%), Positives = 145/183 (79%), Gaps = 0/183 (0%)
 Frame = +1

Query  511   LLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRAFAVIAFPL  690
             +++ A AI W+ +A+ LRE+L+LCC S  L + AA CP+V    +V  LQ     +AFPL
Sbjct  109   VMRVARAIGWADVASALRENLQLCCISLGLLLIAAVCPHVALLSSVGRLQATLIAVAFPL  168

Query  691   VGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTRC  870
             VGVSA+LDAL+++A G+INIHVLMALA FAS+FMGN+LEGGLLLAMFNLAHIAEE+FT  
Sbjct  169   VGVSAALDALVNIADGRINIHVLMALAAFASIFMGNALEGGLLLAMFNLAHIAEEYFTSK  228

Query  871   SKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVDC  1050
             S  DV+ELKENHP+FALLL+ + E S  FS+L Y +VPV DL+VGS ILV+AGE+VPVD 
Sbjct  229   SMFDVRELKENHPEFALLLETSGEESVQFSNLSYTRVPVHDLEVGSHILVRAGEAVPVDG  288

Query  1051  EVF  1059
             EV+
Sbjct  289   EVY  291



>ref|XP_011623222.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
isoform X2 [Amborella trichopoda]
Length=667

 Score =   204 bits (518),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 107/173 (62%), Positives = 138/173 (80%), Gaps = 1/173 (1%)
 Frame = +1

Query  520   FADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRAFAVIAFPLVGV  699
              A A  W+ LA+FLREHL+LCC S  L + A  CP+ LPKPA+KP+Q      AFPLVGV
Sbjct  1     MARACGWADLADFLREHLQLCCCSMGLLLMAVLCPHALPKPAIKPVQNTLVAFAFPLVGV  60

Query  700   SASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTRCSKV  879
             S++LDA++D+AGG++NIHVLMALA FASVFMGNSLEG LLLAMFNLAHIAEE+FT  +  
Sbjct  61    SSALDAVVDLAGGRVNIHVLMALAAFASVFMGNSLEGALLLAMFNLAHIAEEYFTSRAMN  120

Query  880   DVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESV  1038
             DVKELKE+HPDFAL+L+ + +  P FS L Y+++PV ++ +G++ILV+AGE+ 
Sbjct  121   DVKELKESHPDFALVLE-SVDVPPHFSSLSYKRIPVHNVDMGAYILVRAGEAT  172



>gb|EMT13424.1| Putative cadmium/zinc-transporting ATPase HMA1, chloroplastic 
[Aegilops tauschii]
Length=695

 Score =   201 bits (510),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 120/207 (58%), Positives = 145/207 (70%), Gaps = 25/207 (12%)
 Frame = +1

Query  514   LKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRAFAVIAFPLV  693
             ++ A AI W+ +A+ LREHL+LCC S AL + AA CP+V    +V  L  A   +AFPLV
Sbjct  1     MRMARAIGWADVADALREHLQLCCISLALLLMAAVCPHVPLLNSVGRLPAALIAVAFPLV  60

Query  694   G-------------------------VSASLDALMDVAGGKINIHVLMALAGFASVFMGN  798
             G                         VSA+LDAL+D+A GKINIHVLMALA FAS+FMGN
Sbjct  61    GAAYQVYQQTADQHRNILKIKIENEEVSAALDALVDIADGKINIHVLMALAAFASIFMGN  120

Query  799   SLEGGLLLAMFNLAHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQK  978
             SLEGGLLLAMFNLAHIAEE+FT  S  DV+ELKENHP+FALLL+ + + S  FS+L Y K
Sbjct  121   SLEGGLLLAMFNLAHIAEEYFTSKSMYDVRELKENHPEFALLLETSGDESAHFSNLNYAK  180

Query  979   VPVSDLKVGSFILVQAGESVPVDCEVF  1059
             VPV DL+VGS ILV+AGE+VPVD EV+
Sbjct  181   VPVHDLEVGSHILVRAGEAVPVDGEVY  207



>ref|XP_010271194.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
isoform X2 [Nelumbo nucifera]
Length=793

 Score =   198 bits (503),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 116/194 (60%), Positives = 133/194 (69%), Gaps = 38/194 (20%)
 Frame = +1

Query  478   DDEQLTKPQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPL  657
             +D +L K QE +L+FA  I W  LANFLREHL+LCC S AL +AAA+CPY+LPKP VKPL
Sbjct  101   EDAKLNKSQEAVLRFAKTIGWYDLANFLREHLQLCCCSTALLLAAASCPYLLPKPTVKPL  160

Query  658   QRAFAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNL  837
             Q AF VIAFPLVGVSA+LDAL D+  G++NIHVLMALA FASVFMGNSLEGGLLLAMFNL
Sbjct  161   QNAFIVIAFPLVGVSAALDALTDITAGRVNIHVLMALAAFASVFMGNSLEGGLLLAMFNL  220

Query  838   AHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFIL  1017
             AHI                                      DL Y++VPV DL+VGS+IL
Sbjct  221   AHI--------------------------------------DLSYKRVPVHDLEVGSYIL  242

Query  1018  VQAGESVPVDCEVF  1059
             V+AGESVPVD EV 
Sbjct  243   VRAGESVPVDGEVL  256



>ref|XP_008798716.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
[Phoenix dactylifera]
Length=673

 Score =   189 bits (480),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 107/121 (88%), Gaps = 0/121 (0%)
 Frame = +1

Query  697   VSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTRCSK  876
             VSA+LDA++++AGGK+NIHVLMALA FAS+FMGNSLEG LLLAMFNLAHIAEE+FT  S 
Sbjct  15    VSAALDAVLNLAGGKVNIHVLMALAAFASIFMGNSLEGALLLAMFNLAHIAEEYFTSRSM  74

Query  877   VDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVDCEV  1056
             +DVKELK++HPDFALLL+VN +  P FS L Y K+PV DLKVGSFILV+AGE+VPVD EV
Sbjct  75    IDVKELKDSHPDFALLLEVNGDRPPQFSKLNYTKIPVHDLKVGSFILVRAGEAVPVDGEV  134

Query  1057  F  1059
             F
Sbjct  135   F  135



>ref|XP_008675719.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
[Zea mays]
Length=132

 Score =   174 bits (440),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = +1

Query  682   FPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHF  861
             FP++ VSA+LDAL+++A G+INIHVLMALA FAS+FMGN+LEGGLLLAMFNLAHIAEE+F
Sbjct  8     FPILQVSAALDALVNIADGRINIHVLMALAAFASIFMGNALEGGLLLAMFNLAHIAEEYF  67

Query  862   TRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESV  1038
             T  S  DV+ELKENHP+FALLL+ + E S  FS+L Y KVPV DL+VGS ILV+AGE V
Sbjct  68    TSKSMFDVRELKENHPEFALLLETSGEESVQFSNLSYTKVPVHDLEVGSHILVRAGEMV  126



>dbj|BAK05651.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=386

 Score =   181 bits (459),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = +1

Query  697   VSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTRCSK  876
             VSA+LDAL+D+A G+I+IHVLMALA FASVFMGNSLEGGLLLAMF+LAH AEE+FTR S 
Sbjct  11    VSAALDALVDIADGRIDIHVLMALAAFASVFMGNSLEGGLLLAMFSLAHTAEEYFTRKSM  70

Query  877   VDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVDCEV  1056
             VDV+ELKENHP+FALLL+ + + S  FS+L + KVPV DLKVGS ILV+AGE+VPVD EV
Sbjct  71    VDVRELKENHPEFALLLETSGDGSTRFSNLSHTKVPVHDLKVGSHILVRAGEAVPVDGEV  130

Query  1057  F  1059
             +
Sbjct  131   Y  131



>gb|EMS55611.1| putative cadmium/zinc-transporting ATPase HMA1, chloroplastic 
[Triticum urartu]
Length=715

 Score =   179 bits (454),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = +1

Query  697   VSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTRCSK  876
             VSA+LDAL+D+A G+I+IHVLMALA FASVFMGNSLEGGLLLAMF+LAH AEE+FTR S 
Sbjct  76    VSAALDALVDIADGRIDIHVLMALAAFASVFMGNSLEGGLLLAMFSLAHTAEEYFTRKSM  135

Query  877   VDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVDCEV  1056
             VDV+ELKENHP+FALLL+ + + S  FS+L + KVPV DL VGS ILV+AGE+VPVD EV
Sbjct  136   VDVRELKENHPEFALLLETSGDESTRFSNLSHTKVPVQDLTVGSHILVRAGEAVPVDGEV  195

Query  1057  F  1059
             +
Sbjct  196   Y  196



>ref|XP_006380686.1| hypothetical protein POPTR_0007s104802g, partial [Populus trichocarpa]
 gb|ERP58483.1| hypothetical protein POPTR_0007s104802g, partial [Populus trichocarpa]
Length=225

 Score =   161 bits (407),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = +1

Query  481  DEQLTKPQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQ  660
            D QLT PQ  LLKFA  + W  LAN LREHL+LCC SAALFI AAACPY++PKPAVKPLQ
Sbjct  104  DSQLTGPQRALLKFAKTLGWMDLANLLREHLQLCCCSAALFITAAACPYIIPKPAVKPLQ  163

Query  661  RAFAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLA  840
             A  ++AFPLVGVSASLDAL D+ GGK+NIHVLMALAGFAS+FMGN+LE  +LL MFNLA
Sbjct  164  NALMLVAFPLVGVSASLDALTDIVGGKVNIHVLMALAGFASIFMGNALERRVLLCMFNLA  223

Query  841  HI  846
            HI
Sbjct  224  HI  225



>ref|XP_002986489.1| hypothetical protein SELMODRAFT_182418 [Selaginella moellendorffii]
 gb|EFJ12346.1| hypothetical protein SELMODRAFT_182418 [Selaginella moellendorffii]
Length=807

 Score =   169 bits (428),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 99/187 (53%), Positives = 129/187 (69%), Gaps = 3/187 (2%)
 Frame = +1

Query  502   QEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRAFAVIA  681
             Q  L+  ADA   + +AN  R+ L+LCC S  L   A   P +LP+   + LQ   A++A
Sbjct  99    QRALITVADATGIAAVANSWRDSLQLCCVSIGLVFLAIFSPRLLPR--ARGLQTGLAIVA  156

Query  682   FPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHF  861
             F L GV A LDA MDVAGGK+NIHVLMALA F SVFMGN+LEG LLLAMF+L+H AEE+F
Sbjct  157   FSLTGVPAVLDACMDVAGGKVNIHVLMALAAFGSVFMGNALEGALLLAMFSLSHQAEEYF  216

Query  862   TRCSKVDVKELKENHPDFALLLDVNNESSPSFS-DLRYQKVPVSDLKVGSFILVQAGESV  1038
             T  +  DVK LK+++P+FAL+LD    S    S  + Y +V VS ++VG+ +LV+AGE V
Sbjct  217   TNRALGDVKALKKSNPEFALVLDREVSSHSHLSTTVPYVEVDVSKVEVGALLLVKAGEGV  276

Query  1039  PVDCEVF  1059
             PVDC+V+
Sbjct  277   PVDCQVW  283



>ref|XP_002964908.1| hypothetical protein SELMODRAFT_167322 [Selaginella moellendorffii]
 gb|EFJ33746.1| hypothetical protein SELMODRAFT_167322 [Selaginella moellendorffii]
Length=817

 Score =   169 bits (428),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 99/187 (53%), Positives = 129/187 (69%), Gaps = 3/187 (2%)
 Frame = +1

Query  502   QEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRAFAVIA  681
             Q  L+  ADA   + +AN  R+ L+LCC S  L   A   P +LP+   + LQ   A++A
Sbjct  107   QRALITVADATGIAAVANSWRDSLQLCCVSIGLVFLAIFSPRLLPRA--RGLQTGLAIVA  164

Query  682   FPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHF  861
             F L GV A LDA MDVAGGK+NIHVLMALA F SVFMGN+LEG LLLAMF+L+H AEE+F
Sbjct  165   FSLTGVPAVLDACMDVAGGKVNIHVLMALAAFGSVFMGNALEGALLLAMFSLSHQAEEYF  224

Query  862   TRCSKVDVKELKENHPDFALLLDVNNESSPSFS-DLRYQKVPVSDLKVGSFILVQAGESV  1038
             T  +  DVK LK+++P+FAL+LD    S    S  + Y +V VS ++VG+ +LV+AGE V
Sbjct  225   TNRALGDVKALKKSNPEFALVLDREVSSHSHLSTTVPYVEVDVSKVEVGALLLVKAGEGV  284

Query  1039  PVDCEVF  1059
             PVDC+V+
Sbjct  285   PVDCQVW  291



>gb|ERN05712.1| hypothetical protein AMTR_s00006p00237340 [Amborella trichopoda]
Length=661

 Score =   164 bits (414),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 104/120 (87%), Gaps = 1/120 (1%)
 Frame = +1

Query  697   VSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTRCSK  876
             VS++LDA++D+AGG++NIHVLMALA FASVFMGNSLEG LLLAMFNLAHIAEE+FT  + 
Sbjct  5     VSSALDAVVDLAGGRVNIHVLMALAAFASVFMGNSLEGALLLAMFNLAHIAEEYFTSRAM  64

Query  877   VDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVDCEV  1056
              DVKELKE+HPDFAL+L+ + +  P FS L Y+++PV ++ +G++ILV+AGE+VPVD EV
Sbjct  65    NDVKELKESHPDFALVLE-SVDVPPHFSSLSYKRIPVHNVDMGAYILVRAGETVPVDGEV  123



>ref|XP_010417082.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
isoform X2 [Camelina sativa]
Length=652

 Score =   163 bits (412),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = +1

Query  721   MDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTRCSKVDVKELKE  900
             MD+AGG++NIHVLMALA FASVFMGN+LEGGLLL MFNLAHIAEE FT  S VDVKELKE
Sbjct  1     MDIAGGRVNIHVLMALAAFASVFMGNALEGGLLLVMFNLAHIAEEFFTSRSVVDVKELKE  60

Query  901   NHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVDCEVF  1059
             ++PD AL++DVN+ + P+F D  Y+ V V +++VGS+ILV  GE VPVDC+V+
Sbjct  61    SNPDSALVIDVNDANVPNFFDFSYKSVNVHNVQVGSYILVGTGEVVPVDCQVY  113



>ref|XP_006383535.1| hypothetical protein POPTR_0005s18650g [Populus trichocarpa]
 gb|ERP61332.1| hypothetical protein POPTR_0005s18650g [Populus trichocarpa]
Length=331

 Score =   155 bits (391),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 100/169 (59%), Positives = 113/169 (67%), Gaps = 12/169 (7%)
 Frame = +1

Query  484  EQLTKPQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQR  663
             QLT PQ  LLKFA  I W  LAN  RE+L+LC  SA+L          L       L  
Sbjct  68   SQLTGPQRALLKFAKTIGWMDLANLFRENLQLCFCSASLS---------LYHCRCLLLYD  118

Query  664  AFAVIAFPLVG-VSASLDALMDVAGGKINIHVL-MALAGFASVFMGNSLEGGLLLAMFNL  837
            +   IAF LVG VSASLDAL D+  GK+NIHVL MALA FASVFMGN+LEGGLL AMFNL
Sbjct  119  SETCIAFSLVGQVSASLDALTDITDGKVNIHVLIMALACFASVFMGNTLEGGLLFAMFNL  178

Query  838  AHIAEEHFTRCSKV-DVKELKENHPDFALLLDVNNESSPSFSDLRYQKV  981
            AHIAEE FT  S + DVKELKEN+PD A +LDVN++  P  S L Y+KV
Sbjct  179  AHIAEEFFTNRSVIDDVKELKENYPDSAFVLDVNDDKLPDVSPLSYKKV  227



>ref|XP_001762609.1| predicted protein [Physcomitrella patens]
 gb|EDQ72732.1| predicted protein, partial [Physcomitrella patens]
Length=743

 Score =   156 bits (395),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 90/187 (48%), Positives = 131/187 (70%), Gaps = 3/187 (2%)
 Frame = +1

Query  502   QEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRAFAVIA  681
             Q+++ + ++ +  + +A+  RE+L + C S  L +  AA P VLP+ A    Q    + A
Sbjct  29    QKLIKRTSEVLGVAAIADAWRENLTIVCVSTVLLLLGAALPLVLPQAA--SYQNLLVIPA  86

Query  682   FPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHF  861
              PL GV A LDA +DVAGGK++IHVLMA A  ASV MG++LEGGLLLAMF L+H+AEEHF
Sbjct  87    LPLTGVPAVLDASIDVAGGKVDIHVLMAFAALASVLMGSALEGGLLLAMFGLSHLAEEHF  146

Query  862   TRCSKVDVKELKENHPDFALLL-DVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESV  1038
             T  + VDVK LK+ +P++AL+L D + + +P  + + Y+K+P  D+ VGSF+L++AGE V
Sbjct  147   TEKAMVDVKALKDTNPEYALVLDDFDPKKNPPLTSIPYKKLPAKDVAVGSFLLIKAGEVV  206

Query  1039  PVDCEVF  1059
             PVD +V+
Sbjct  207   PVDGDVY  213



>ref|XP_001780815.1| predicted protein [Physcomitrella patens]
 gb|EDQ54372.1| predicted protein, partial [Physcomitrella patens]
Length=743

 Score =   146 bits (368),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 88/191 (46%), Positives = 126/191 (66%), Gaps = 3/191 (2%)
 Frame = +1

Query  490   LTKPQEVLLKFADAIRWSHLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRAF  669
             L   Q ++ + A+ +  + LA    +++ + C+S AL +  A  P V P+ A    Q   
Sbjct  29    LNAVQRLIKRAAEVLGIAGLAKAWGDNITVVCASTALLLLEAIAPLVFPQAA--SYQNLL  86

Query  670   AVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIA  849
                A PL+GV A LDA++DVAGG +NIHVL+A A  ASVFMGN+LEGGLLLAMF+L+H A
Sbjct  87    VYSAIPLIGVPALLDAIIDVAGGNVNIHVLIAFAALASVFMGNALEGGLLLAMFSLSHQA  146

Query  850   EEHFTRCSKVDVKELKENHPDFALLLDVNNESS-PSFSDLRYQKVPVSDLKVGSFILVQA  1026
             E +FT  +  DVK LK+ +P+ AL+LD  ++S  P  S +  ++V V D+ VGS++LV+A
Sbjct  147   EHYFTEEAMGDVKTLKDRNPESALVLDEFDQSKPPPLSSVPSKEVAVKDVAVGSYVLVKA  206

Query  1027  GESVPVDCEVF  1059
             GE VPVD +V+
Sbjct  207   GEVVPVDGDVY  217



>ref|XP_007153577.1| hypothetical protein PHAVU_003G047300g [Phaseolus vulgaris]
 gb|ESW25571.1| hypothetical protein PHAVU_003G047300g [Phaseolus vulgaris]
Length=86

 Score = 99.4 bits (246),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 47/78 (60%), Positives = 62/78 (79%), Gaps = 2/78 (3%)
 Frame = +1

Query  766  LAGFASVFMGNSLEGGLLLAMF--NLAHIAEEHFTRCSKVDVKELKENHPDFALLLDVNN  939
            +  FAS+FMGNSLEGGLLL++F  +LAHIAEEHFT  S VDV+ELKEN+PDFA +LD  +
Sbjct  1    MTAFASIFMGNSLEGGLLLSIFGNSLAHIAEEHFTSRSIVDVRELKENNPDFAFVLDTKD  60

Query  940  ESSPSFSDLRYQKVPVSD  993
            +  P+  DL Y+++P+ D
Sbjct  61   DKLPNTFDLAYKRIPMHD  78



>ref|XP_007514984.1| cadmium-translocating P-type ATPase [Bathycoccus prasinos]
 emb|CCO15224.1| cadmium-translocating P-type ATPase [Bathycoccus prasinos]
Length=1193

 Score = 83.6 bits (205),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 46/140 (33%), Positives = 77/140 (55%), Gaps = 1/140 (1%)
 Frame = +1

Query  628   VLPKPAVKPLQRAFAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLE  807
             ++P      L  +   + +   G    +D L +VA G IN+HVL  LA F +V +G + E
Sbjct  217   IVPGATAAWLSTSATALVYLFAGTPEFVDVLYEVARGNINVHVLTTLAVFGTVLLGCAFE  276

Query  808   GGLLLAMFNLAHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPV  987
             G LLL +F  AH  E+  T+ ++ D+K L +  P FA ++D++  +       + +K+  
Sbjct  277   GALLLVLFASAHYVEDRLTQHARGDLKALWKTVPPFANVVDIDGATGDPIEGSQ-RKMRA  335

Query  988   SDLKVGSFILVQAGESVPVD  1047
             S++ VGS+  V+AG  VP+D
Sbjct  336   SEVPVGSYCYVKAGTQVPLD  355



>ref|XP_003060286.1| p-type ATPase superfamily [Micromonas pusilla CCMP1545]
 gb|EEH55055.1| p-type ATPase superfamily [Micromonas pusilla CCMP1545]
Length=1343

 Score = 81.6 bits (200),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 48/132 (36%), Positives = 74/132 (56%), Gaps = 3/132 (2%)
 Frame = +1

Query  655   LQRAFAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFN  834
             ++ A   + + L G S  +D   ++A G +NIHVL  LA   +V +G +LEGGLLL +F 
Sbjct  246   VETAATALVYVLSGTSEFVDVTYELAVGNVNIHVLTTLAVLGTVLLGCALEGGLLLVLFA  305

Query  835   LAHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNE-SSPSFSDLRYQKVPVSDLKVGSF  1011
              A   E   TR ++ D+KEL    P  A  +++N + S P  +  R   V   D+ VG+ 
Sbjct  306   TATFVETRLTRHARGDLKELWATVPGEATTIELNADGSGPDVNSSR--TVNARDVTVGTN  363

Query  1012  ILVQAGESVPVD  1047
             + V+AG+ VP+D
Sbjct  364   VFVKAGQQVPLD  375



>ref|XP_002505330.1| cation-transporting p-type ATPase [Micromonas sp. RCC299]
 gb|ACO66588.1| cation-transporting p-type ATPase [Micromonas sp. RCC299]
Length=1395

 Score = 80.5 bits (197),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 44/131 (34%), Positives = 72/131 (55%), Gaps = 2/131 (2%)
 Frame = +1

Query  655   LQRAFAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFN  834
             ++ A  V  + L G S  +D   ++A G +NIHVL  LA   +V +G ++EG +LL +F 
Sbjct  250   IETAATVAVYALAGTSEFVDVSYELAVGNVNIHVLTTLAVAGTVLLGCAIEGAMLLVLFA  309

Query  835   LAHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFI  1014
              AH  E   T  ++ D++ L    P  A ++++  + SP     R   VP  D+ VG+ +
Sbjct  310   SAHFVETRLTGHARGDLRMLWATVPGEATIVELREDGSPDADSERL--VPARDVGVGANV  367

Query  1015  LVQAGESVPVD  1047
              V+AG+ VP+D
Sbjct  368   FVRAGQQVPLD  378



>ref|WP_020355591.1| MULTISPECIES: cadmium-translocating P-type ATPase [Chlamydia]
 gb|EPP36113.1| cadmium-translocating P-type ATPase [Chlamydia psittaci 10_743_SC13]
 gb|EPP38522.1| cadmium-translocating P-type ATPase [Chlamydia psittaci 10_881_SC42]
 gb|AHK63531.1| putative cadmium/zinc-transporting ATPase HMA1, chloroplastic 
[Chlamydia avium 10DC88]
Length=657

 Score = 76.6 bits (187),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 69/131 (53%), Gaps = 9/131 (7%)
 Frame = +1

Query  667   FAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHI  846
             F +  F L G  A + +L D+A   INI +LM  A F S+F+G +LEG LLL +F ++  
Sbjct  72    FIIFTFFLAGTPALITSLDDIAKKTINIDILMTSAAFGSIFIGGALEGALLLVLFAISES  131

Query  847   AEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQA  1026
              E+  +  +K  +  LK   P  A ++                KVPV+ ++VG  I +++
Sbjct  132   LEQMVSGKAKSTLSSLKHLAPTIAWVVREGGN---------LHKVPVNQVQVGDIICIKS  182

Query  1027  GESVPVDCEVF  1059
             GE VP+D ++ 
Sbjct  183   GEIVPLDGQII  193



>ref|WP_011006853.1| HAD family hydrolase [Chlamydophila caviae]
 gb|AAP05639.1| cadmium-translocating P-type ATPase [Chlamydophila caviae GPIC]
Length=657

 Score = 76.6 bits (187),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 69/131 (53%), Gaps = 9/131 (7%)
 Frame = +1

Query  667   FAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHI  846
             F V  F L G  A + +L D+    +NI +LM  A F S+F+G +LEG LLL +F ++  
Sbjct  72    FVVFTFFLAGTPALIKSLDDIRNKTVNIDILMTSAAFGSIFIGGALEGSLLLVLFAISEA  131

Query  847   AEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQA  1026
               +  +  +K  +  LK   P  A ++          +D   +K PVS ++VG  I V++
Sbjct  132   LGQMVSGKAKSTLASLKHLAPTIAWIVG---------TDGNLEKKPVSQVQVGDIIRVKS  182

Query  1027  GESVPVDCEVF  1059
             GE VP+D E+ 
Sbjct  183   GEIVPLDGEII  193



>emb|CEG01764.1| Cation-transporting P-type ATPase, subfamily IB [Ostreococcus 
tauri]
Length=920

 Score = 76.6 bits (187),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 77/128 (60%), Gaps = 2/128 (2%)
 Frame = +1

Query  673   VIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAE  852
             ++ + L G    +D   ++A G +NIHVL  LA F +V +G ++EG LLL +F LAH+ E
Sbjct  16    IMVYALAGTPEFVDVTYELALGNVNIHVLTTLAVFGTVLLGCAMEGALLLVLFALAHMVE  75

Query  853   EHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGE  1032
             +  T  ++ D+K L    P  A ++ +N + +P  + +   +VP +++ VGS I V+AG+
Sbjct  76    DRLTLHARGDLKALWSTVPTTANVVKLNADGTPDLASV--TEVPAAEVDVGSLIFVKAGQ  133

Query  1033  SVPVDCEV  1056
              VP+D  V
Sbjct  134   QVPLDGTV  141



>ref|WP_014946276.1| HAD family hydrolase [Chlamydia psittaci]
 gb|AFS27407.1| cadmium-translocating P-type ATPase [Chlamydia psittaci CP3]
Length=657

 Score = 75.5 bits (184),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 69/131 (53%), Gaps = 9/131 (7%)
 Frame = +1

Query  667   FAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHI  846
             F V  F L G  A + +L DV    +NI +LM  A F S+F+G +LEG LLL +F ++  
Sbjct  72    FVVFTFFLAGTPALIKSLDDVRNKTVNIDILMTSAAFGSIFIGGALEGSLLLVLFAISEA  131

Query  847   AEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQA  1026
               +  +  +K  +  LK   P  A ++           D   +K+PV+ ++VG  I V++
Sbjct  132   LGQMVSGKAKGTLASLKHLAPTIAWVVQ---------EDGNLEKIPVNHVEVGKIIRVKS  182

Query  1027  GESVPVDCEVF  1059
             GE VP+D E+ 
Sbjct  183   GEIVPLDGEII  193



>ref|WP_014947277.1| HAD family hydrolase [Chlamydia psittaci]
 gb|AFS21736.1| cadmium-translocating P-type ATPase [Chlamydia psittaci MN]
 emb|CCO02377.1| putative cation transport related membrane protein [Chlamydia 
psittaci 01DC12]
 gb|EPJ25522.1| cadmium-translocating P-type ATPase [Chlamydia psittaci 09DC77]
 gb|EPJ26719.1| cadmium-translocating P-type ATPase [Chlamydia psittaci 09DC80]
 gb|EPJ30633.1| cadmium-translocating P-type ATPase [Chlamydia psittaci 09DC78]
 gb|EPL02046.1| cadmium-translocating P-type ATPase [Chlamydia psittaci 09DC79]
Length=657

 Score = 75.5 bits (184),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 69/131 (53%), Gaps = 9/131 (7%)
 Frame = +1

Query  667   FAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHI  846
             F V  F L G  A + +L DV    +NI +LM  A F S+F+G +LEG LLL +F ++  
Sbjct  72    FVVFTFFLAGTPALIKSLDDVRNKTVNIDILMTSAAFGSIFIGGALEGSLLLVLFAISEA  131

Query  847   AEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQA  1026
               +  +  +K  +  LK   P  A ++           D   +K+PV+ ++VG  I V++
Sbjct  132   LGQMVSGKAKGTLASLKHLAPTIAWVVQ---------EDGNLEKIPVNHVEVGKIIRVKS  182

Query  1027  GESVPVDCEVF  1059
             GE VP+D E+ 
Sbjct  183   GEIVPLDGEII  193



>ref|XP_001421458.1| P-ATPase family transporter: cadmium ion, partial [Ostreococcus 
lucimarinus CCE9901]
 gb|ABO99751.1| P-ATPase family transporter: cadmium ion, partial [Ostreococcus 
lucimarinus CCE9901]
Length=632

 Score = 75.1 bits (183),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 78/134 (58%), Gaps = 2/134 (1%)
 Frame = +1

Query  655   LQRAFAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFN  834
             + R   ++ + L G    +D   ++A G +NIHVL  LA F +V +G ++EG LLL +F 
Sbjct  5     VSRVCTILVYVLAGTPEFVDVTYELAVGNVNIHVLTTLAVFGTVLLGCAMEGALLLVLFA  64

Query  835   LAHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFI  1014
             LAH  E+  T  ++ D+K L    P  A ++ +  + +P  + LR  ++P +D+ VG+ I
Sbjct  65    LAHFVEDRLTLHARGDLKALWGTVPTTADVVQLLADGTPDLTTLR--EMPAADVDVGTMI  122

Query  1015  LVQAGESVPVDCEV  1056
              V+AG+ VP+D  V
Sbjct  123   FVKAGQQVPLDGMV  136



>ref|XP_001421427.1| P-ATPase family transporter: cadmium/zinc ion; heavy metal translocating 
P-type ATPase family-like protein [Ostreococcus 
lucimarinus CCE9901]
 gb|ABO99720.1| P-ATPase family transporter: cadmium/zinc ion; heavy metal translocating 
P-type ATPase family-like protein [Ostreococcus 
lucimarinus CCE9901]
Length=997

 Score = 75.1 bits (183),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 78/134 (58%), Gaps = 2/134 (1%)
 Frame = +1

Query  655   LQRAFAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFN  834
             + R   ++ + L G    +D   ++A G +NIHVL  LA F +V +G ++EG LLL +F 
Sbjct  89    VSRVCTILVYVLAGTPEFVDVTYELAVGNVNIHVLTTLAVFGTVLLGCAMEGALLLVLFA  148

Query  835   LAHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFI  1014
             LAH  E+  T  ++ D+K L    P  A ++ +  + +P  + LR  ++P +D+ VG+ I
Sbjct  149   LAHFVEDRLTLHARGDLKALWGTVPTTADVVQLLADGTPDLTTLR--EMPAADVDVGTMI  206

Query  1015  LVQAGESVPVDCEV  1056
              V+AG+ VP+D  V
Sbjct  207   FVKAGQQVPLDGMV  220



>ref|WP_006343557.1| HAD family hydrolase [Chlamydia psittaci]
 ref|YP_004064822.1| putative cation transport related membrane protein [Chlamydia 
psittaci RD1]
 emb|CBY17391.1| putative cation transport related membrane protein [Chlamydia 
psittaci RD1]
 gb|ADZ18138.1| cadmium-translocating P-type ATPase [Chlamydia psittaci 6BC]
 gb|EGF84773.1| cadmium-translocating P-type ATPase [Chlamydia psittaci Cal10]
 gb|AEG85922.1| cadmium-translocating P-type ATPase [Chlamydia psittaci C19/98]
 gb|AEG86897.1| cadmium-translocating P-type ATPase [Chlamydia psittaci 01DC11]
 gb|AEG87875.1| cadmium-translocating P-type ATPase [Chlamydia psittaci 02DC15]
 gb|AEG88848.1| cadmium-translocating P-type ATPase [Chlamydia psittaci 08DC60]
 gb|AFS19977.1| cadmium-translocating P-type ATPase [Chlamydia psittaci 84/55]
 gb|AFS21029.1| cadmium-translocating P-type ATPase [Chlamydia psittaci GR9]
 gb|AFS23161.1| cadmium-translocating P-type ATPase [Chlamydia psittaci VS225]
 gb|AFS23914.1| cadmium-translocating P-type ATPase [Chlamydia psittaci WS/RT/E30]
 gb|AFS25936.1| cadmium-translocating P-type ATPase [Chlamydia psittaci WC]
 gb|AGE75475.1| putative cation transport related membrane protein [Chlamydia 
psittaci Mat116]
 gb|EPJ13310.1| cadmium-translocating P-type ATPase [Chlamydia psittaci 02DC15]
 gb|EPJ14406.1| cadmium-translocating P-type ATPase [Chlamydia psittaci 02DC16]
 gb|EPJ16134.1| cadmium-translocating P-type ATPase [Chlamydia psittaci 02DC18]
 gb|EPJ17305.1| cadmium-translocating P-type ATPase [Chlamydia psittaci 02DC22]
 gb|EPJ17983.1| cadmium-translocating P-type ATPase [Chlamydia psittaci 01DC11]
 gb|EPJ19275.1| cadmium-translocating P-type ATPase [Chlamydia psittaci 03DC29]
 gb|EPJ20669.1| cadmium-translocating P-type ATPase [Chlamydia psittaci 02DC21]
 gb|EPJ22555.1| cadmium-translocating P-type ATPase [Chlamydia psittaci 04DC42]
 gb|EPJ23443.1| cadmium-translocating P-type ATPase [Chlamydia psittaci 08DC60]
 gb|EPJ28342.1| cadmium-translocating P-type ATPase [Chlamydia psittaci 99DC5]
 gb|EPJ28506.1| cadmium-translocating P-type ATPase [Chlamydia psittaci C19/98]
 gb|EPJ31324.1| cadmium-translocating P-type ATPase [Chlamydia psittaci 03DC35]
 gb|EPJ98255.1| cadmium-translocating P-type ATPase [Chlamydia psittaci 02DC24]
 gb|EPJ99999.1| cadmium-translocating P-type ATPase [Chlamydia psittaci 02DC14]
 gb|EPP28743.1| cadmium-translocating P-type ATPase [Chlamydia psittaci 08-2626_L3]
 gb|EPP31092.1| cadmium-translocating P-type ATPase [Chlamydia psittaci C1/97]
 gb|EPP34097.1| cadmium-translocating P-type ATPase [Chlamydia psittaci C6/98]
Length=657

 Score = 74.7 bits (182),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 69/131 (53%), Gaps = 9/131 (7%)
 Frame = +1

Query  667   FAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHI  846
             F V  F L G  A + +L D+    +NI +LM  A F S+F+G +LEG LLL +F ++  
Sbjct  72    FVVFTFFLAGTPALIKSLDDIRNKTVNIDILMTSAAFGSIFIGGALEGSLLLVLFAISEA  131

Query  847   AEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQA  1026
               +  +  +K  +  LK   P  A ++           D   +K+PV+ ++VG  I V++
Sbjct  132   LGQMVSGKAKGTLASLKHLAPTIAWVVR---------EDGNLEKIPVNHVEVGKIIRVKS  182

Query  1027  GESVPVDCEVF  1059
             GE VP+D E+ 
Sbjct  183   GEIVPLDGEII  193



>gb|AEB55908.1| cadmium-translocating P-type ATPase [Chlamydia psittaci 6BC]
Length=628

 Score = 74.7 bits (182),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 69/131 (53%), Gaps = 9/131 (7%)
 Frame = +1

Query  667   FAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHI  846
             F V  F L G  A + +L D+    +NI +LM  A F S+F+G +LEG LLL +F ++  
Sbjct  43    FVVFTFFLAGTPALIKSLDDIRNKTVNIDILMTSAAFGSIFIGGALEGSLLLVLFAISEA  102

Query  847   AEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQA  1026
               +  +  +K  +  LK   P  A ++           D   +K+PV+ ++VG  I V++
Sbjct  103   LGQMVSGKAKGTLASLKHLAPTIAWVVR---------EDGNLEKIPVNHVEVGKIIRVKS  153

Query  1027  GESVPVDCEVF  1059
             GE VP+D E+ 
Sbjct  154   GEIVPLDGEII  164



>ref|WP_014946930.1| HAD family hydrolase [Chlamydia psittaci]
 gb|AFS28462.1| cadmium-translocating P-type ATPase [Chlamydia psittaci NJ1]
Length=657

 Score = 74.7 bits (182),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 69/131 (53%), Gaps = 9/131 (7%)
 Frame = +1

Query  667   FAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHI  846
             F V  F L G  A + +L D+    +NI +LM  A F S+F+G +LEG LLL +F ++  
Sbjct  72    FVVFTFFLAGTPALIKSLDDIRNKTVNIDILMTSAAFGSIFIGGALEGSLLLVLFAISEA  131

Query  847   AEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQA  1026
               +  +  +K  +  LK   P  A ++           D   +K+PV+ ++VG  I V++
Sbjct  132   LGQMVSGKAKGTLASLKHLAPTIAWVVR---------EDGNLEKIPVNHVEVGKIIRVKS  182

Query  1027  GESVPVDCEVF  1059
             GE VP+D E+ 
Sbjct  183   GEIVPLDGEII  193



>ref|WP_014945350.1| HAD family hydrolase [Chlamydia psittaci]
 gb|AFS25111.1| cadmium-translocating P-type ATPase [Chlamydia psittaci M56]
Length=657

 Score = 74.7 bits (182),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 69/131 (53%), Gaps = 9/131 (7%)
 Frame = +1

Query  667   FAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHI  846
             F V  F L G  A + +L D+    +NI +LM  A F S+F+G +LEG LLL +F ++  
Sbjct  72    FVVFTFFLAGTPALIKSLDDIRNKTVNIDILMTSAAFGSIFIGGALEGSLLLVLFAISEA  131

Query  847   AEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQA  1026
               +  +  +K  +  LK   P  A ++           D   +K+PV+ ++VG  I V++
Sbjct  132   LGQMVSGKAKGTLASLKHLAPTIAWVVR---------EDGNLEKIPVNHVEVGKIIRVKS  182

Query  1027  GESVPVDCEVF  1059
             GE VP+D E+ 
Sbjct  183   GEIVPLDGEII  193



>ref|XP_005645930.1| heavy metal translocatin [Coccomyxa subellipsoidea C-169]
 gb|EIE21386.1| heavy metal translocatin [Coccomyxa subellipsoidea C-169]
Length=812

 Score = 74.7 bits (182),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 67/118 (57%), Gaps = 3/118 (3%)
 Frame = +1

Query  694   GVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTRCS  873
             GV   ++    VA G++  HVLM L+   +V +G + EG  LL +F+ +H  E + TR +
Sbjct  94    GVPGMVEVCEHVAAGEVTPHVLMMLSALGTVILGKAFEGAWLLVLFSASHAIEHNVTRRA  153

Query  874   KVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVD  1047
             +  +  L+E+ P  A  L    + SP+  +   QK+  SD+++G  I V+AGE VPVD
Sbjct  154   QGSMASLQES-PQSAWRLATAPDGSPAPGE--PQKIDRSDVRLGDLIFVKAGEQVPVD  208



>ref|XP_005845243.1| hypothetical protein CHLNCDRAFT_136900 [Chlorella variabilis]
 gb|EFN53141.1| hypothetical protein CHLNCDRAFT_136900 [Chlorella variabilis]
Length=806

 Score = 74.7 bits (182),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 71/126 (56%), Gaps = 2/126 (2%)
 Frame = +1

Query  682   FPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHF  861
             + L G+ A++D   D+  G ++ HVLM LA   ++  G++LEG LLL +F  +H+ E   
Sbjct  43    YLLAGLPAAVDLSYDLTAGHVDTHVLMNLAVLGTLVTGHALEGALLLVLFQTSHVVEHLL  102

Query  862   TRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVP  1041
             T  ++ ++  L +  P  A+L+ +  +  P  +  R  +V  +D+ VG  +LV+ GE VP
Sbjct  103   TDRAQGNLAALYDAMPKEAVLVGMGPDGRPDLASAR--RVLAADVAVGDCMLVKPGEQVP  160

Query  1042  VDCEVF  1059
             +D  V 
Sbjct  161   LDGAVI  166



>gb|EPJ19566.1| cadmium-translocating P-type ATPase [Chlamydia psittaci 02DC23]
Length=587

 Score = 74.3 bits (181),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 69/131 (53%), Gaps = 9/131 (7%)
 Frame = +1

Query  667   FAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHI  846
             F V  F L G  A + +L D+    +NI +LM  A F S+F+G +LEG LLL +F ++  
Sbjct  2     FVVFTFFLAGTPALIKSLDDIRNKTVNIDILMTSAAFGSIFIGGALEGSLLLVLFAISEA  61

Query  847   AEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQA  1026
               +  +  +K  +  LK   P  A ++           D   +K+PV+ ++VG  I V++
Sbjct  62    LGQMVSGKAKGTLASLKHLAPTIAWVVR---------EDGNLEKIPVNHVEVGKIIRVKS  112

Query  1027  GESVPVDCEVF  1059
             GE VP+D E+ 
Sbjct  113   GEIVPLDGEII  123



>ref|WP_010232691.1| HAD family hydrolase [Chlamydia muridarum]
Length=659

 Score = 74.3 bits (181),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 70/137 (51%), Gaps = 9/137 (7%)
 Frame = +1

Query  649   KPLQRAFAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAM  828
             +PL     ++ F L G  A + +  D+    +NI +LM  A F S+F+G +LEG LLL +
Sbjct  66    QPLSSLLLILTFFLAGTPALVKSFEDILNKTVNIDILMTSAAFGSIFIGGALEGALLLVL  125

Query  829   FNLAHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGS  1008
             F ++       +  +K  +  LK   P  A ++ +         D   QKV V ++KVG 
Sbjct  126   FAISESLGAMVSGKAKSTLASLKHLAPTVAWVVQL---------DGSLQKVLVQNVKVGE  176

Query  1009  FILVQAGESVPVDCEVF  1059
              I V++GE VP+D E+ 
Sbjct  177   IIRVKSGEVVPLDGEII  193



>ref|WP_035407486.1| HAD family hydrolase [Chlamydia suis]
 gb|ESN89048.1| cadmium-translocating P-type ATPase [Chlamydia suis MD56]
Length=659

 Score = 74.3 bits (181),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 70/137 (51%), Gaps = 9/137 (7%)
 Frame = +1

Query  649   KPLQRAFAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAM  828
             +PL     ++ F L G  A + +  D+    +NI +LM  A F S+F+G +LEG LLL +
Sbjct  66    QPLSSLLLILTFFLAGTPALVKSFEDILNKTVNIDILMTSAAFGSIFIGGALEGALLLVL  125

Query  829   FNLAHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGS  1008
             F ++       +  +K  +  LK   P  A ++ +         D   QKV V ++KVG 
Sbjct  126   FAISESLGAMVSGKAKSTLASLKHLAPTVAWVVQL---------DGSLQKVLVQNVKVGE  176

Query  1009  FILVQAGESVPVDCEVF  1059
              I V++GE VP+D E+ 
Sbjct  177   IIRVKSGEVVPLDGEII  193



>ref|WP_006344470.1| HAD family hydrolase [Chlamydophila abortus]
 gb|EGK69598.1| putative cation transport related membrane protein [Chlamydophila 
abortus LLG]
Length=657

 Score = 73.9 bits (180),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 70/137 (51%), Gaps = 9/137 (7%)
 Frame = +1

Query  646   VKPLQRAFAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLA  825
             V  +   F V  F L G  A + +L D+    +NI +LM  A F S+F+G +LEG LLL 
Sbjct  65    VTEISNLFVVFTFFLAGTPALIKSLDDIRNKTVNIDILMTSAAFGSIFIGGALEGSLLLV  124

Query  826   MFNLAHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVG  1005
             +F ++    +  +  +K  +  LK   P  A ++           D   +K+PV  ++VG
Sbjct  125   LFAISEALGQMVSGKAKGTLASLKHLAPTIAWVVQ---------EDGNLEKIPVRLVEVG  175

Query  1006  SFILVQAGESVPVDCEV  1056
               I V++GE VP+D E+
Sbjct  176   HIIRVKSGEIVPLDGEI  192



>ref|WP_011097388.1| HAD family hydrolase [Chlamydophila abortus]
 emb|CAH64307.1| putative cation transport related membrane protein [Chlamydophila 
abortus S26/3]
 emb|CED80911.1| putative cation transport related membrane protein [Chlamydophila 
abortus]
Length=657

 Score = 73.9 bits (180),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 70/137 (51%), Gaps = 9/137 (7%)
 Frame = +1

Query  646   VKPLQRAFAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLA  825
             V  +   F V  F L G  A + +L D+    +NI +LM  A F S+F+G +LEG LLL 
Sbjct  65    VTEISNLFVVFTFFLAGTPALIKSLDDIRNKTVNIDILMTSAAFGSIFIGGALEGSLLLV  124

Query  826   MFNLAHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVG  1005
             +F ++    +  +  +K  +  LK   P  A ++           D   +K+PV  ++VG
Sbjct  125   LFAISEALGQMVSGKAKGTLASLKHLAPTIAWVVQ---------EDGNLEKIPVRLVEVG  175

Query  1006  SFILVQAGESVPVDCEV  1056
               I V++GE VP+D E+
Sbjct  176   HIIRVKSGEIVPLDGEI  192



>ref|WP_010229366.1| HAD family hydrolase [Chlamydia muridarum]
 gb|AAF38980.1| cation-transporting ATPase, E1-E2 family [Chlamydia muridarum 
str. Nigg]
 gb|AHH22499.1| HAD family hydrolase [Chlamydia muridarum str. Nigg3 CMUT3-5]
 gb|AHH23423.1| HAD family hydrolase [Chlamydia muridarum str. Nigg CM972]
 gb|KDU80374.1| cadmium-translocating P-type ATPase [Chlamydia muridarum]
 gb|KDU81094.1| cadmium-translocating P-type ATPase [Chlamydia muridarum]
 gb|KDU82161.1| cadmium-translocating P-type ATPase [Chlamydia muridarum]
 gb|KDU83046.1| cadmium-translocating P-type ATPase [Chlamydia muridarum]
 gb|KDU84152.1| cadmium-translocating P-type ATPase [Chlamydia muridarum]
 gb|AID37650.1| HAD family hydrolase [Chlamydia muridarum str. Nigg 2 MCR]
 gb|AIT90337.1| HAD family hydrolase [Chlamydia muridarum]
 gb|AIT91225.1| HAD family hydrolase [Chlamydia muridarum]
 gb|AIW23099.1| HAD family hydrolase [Chlamydia muridarum]
 gb|AJR10203.1| HAD family hydrolase [Chlamydia muridarum]
Length=659

 Score = 73.6 bits (179),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 69/137 (50%), Gaps = 9/137 (7%)
 Frame = +1

Query  649   KPLQRAFAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAM  828
             +PL     ++ F L G  A + +  D+    +NI +LM  A F S+F+G +LEG LLL +
Sbjct  66    QPLSSLLLILTFFLAGTPALVKSFEDILNKTVNIDILMTSAAFGSIFIGGALEGALLLVL  125

Query  829   FNLAHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGS  1008
             F ++       +  +K  +  LK   P  A ++           D   QK+ V ++KVG 
Sbjct  126   FAISESLGSMVSGKAKSTLASLKHLAPTVAWVVQ---------QDGSLQKILVQNVKVGE  176

Query  1009  FILVQAGESVPVDCEVF  1059
              I V++GE VP+D E+ 
Sbjct  177   VIRVKSGEVVPLDGEII  193



>ref|WP_011457672.1| HAD family hydrolase [Chlamydophila felis]
 dbj|BAE80887.1| cadmium/zinc cation transporting ATPase [Chlamydophila felis 
Fe/C-56]
Length=657

 Score = 72.8 bits (177),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 68/131 (52%), Gaps = 9/131 (7%)
 Frame = +1

Query  667   FAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHI  846
             F +  F L G  A + +L D+    +NI +LM  A F S+F+G +LEG LLL +F ++  
Sbjct  72    FVIFTFFLAGTPALIKSLDDIRNKTVNIDILMTSAAFGSIFIGGALEGSLLLVLFAISEA  131

Query  847   AEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQA  1026
               +  +  +K  +  LK   P  A ++           D   +K P++ + VG+ I V++
Sbjct  132   LGQMVSGKAKSTLASLKHLAPTIAWVVG---------EDGNLEKTPINQVLVGNIIRVKS  182

Query  1027  GESVPVDCEVF  1059
             GE VP+D E+ 
Sbjct  183   GEIVPLDGEII  193



>ref|WP_014518218.1| HAD family hydrolase [Chlamydia pneumoniae]
 gb|ACZ32753.1| cadmium-translocating P-type ATPase [Chlamydophila pneumoniae 
LPCoLN]
Length=658

 Score = 72.4 bits (176),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/137 (31%), Positives = 71/137 (52%), Gaps = 9/137 (7%)
 Frame = +1

Query  649   KPLQRAFAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAM  828
             K L   F V  F L G  A + +L ++    +NI +LM  A F S+F+G +LEG LLL +
Sbjct  66    KNLSNLFVVFTFFLAGTPALIKSLDNICQKVVNIDILMTSAAFGSIFIGGALEGALLLVL  125

Query  829   FNLAHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGS  1008
             F ++    +  +  +K  +  LK+  P    L+           D   QKV ++ ++VG+
Sbjct  126   FAISEALGQMVSGKAKSTLVSLKQLAPTTGWLV---------LEDGNLQKVAINKIEVGN  176

Query  1009  FILVQAGESVPVDCEVF  1059
              + +++GE VP+D E+ 
Sbjct  177   ILRIKSGEVVPLDGEIL  193



>ref|WP_010883503.1| HAD family hydrolase [Chlamydia pneumoniae]
 ref|NP_225063.1| metal transport P-type ATPase [Chlamydophila pneumoniae CWL029]
 gb|AAD19006.1| Metal Transport P-type ATPase [Chlamydophila pneumoniae CWL029]
 dbj|BAA99076.1| metal transport P-type ATPase [Chlamydophila pneumoniae J138]
 gb|AAP98826.1| copper-transporting ATPase [Chlamydophila pneumoniae TW-183]
Length=658

 Score = 72.4 bits (176),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/137 (31%), Positives = 71/137 (52%), Gaps = 9/137 (7%)
 Frame = +1

Query  649   KPLQRAFAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAM  828
             K L   F V  F L G  A + +L ++    +NI +LM  A F S+F+G +LEG LLL +
Sbjct  66    KNLSNLFVVFTFFLAGTPALIKSLDNICQKVVNIDILMTSAAFGSIFIGGALEGALLLVL  125

Query  829   FNLAHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGS  1008
             F ++    +  +  +K  +  LK+  P    L+           D   QKV ++ ++VG+
Sbjct  126   FAISEALGQMVSGKAKSTLVSLKQLAPTTGWLV---------LEDGNLQKVAINKIEVGN  176

Query  1009  FILVQAGESVPVDCEVF  1059
              + +++GE VP+D E+ 
Sbjct  177   ILRIKSGEVVPLDGEIL  193



>gb|ETR79629.1| Lead, cadmium, zinc and mercury transporting ATPase [Chlamydia 
pneumoniae B21]
Length=654

 Score = 72.4 bits (176),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/137 (31%), Positives = 71/137 (52%), Gaps = 9/137 (7%)
 Frame = +1

Query  649   KPLQRAFAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAM  828
             K L   F V  F L G  A + +L ++    +NI +LM  A F S+F+G +LEG LLL +
Sbjct  62    KNLSNLFVVFTFFLAGTPALIKSLDNICQKVVNIDILMTSAAFGSIFIGGALEGALLLVL  121

Query  829   FNLAHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGS  1008
             F ++    +  +  +K  +  LK+  P    L+           D   QKV ++ ++VG+
Sbjct  122   FAISEALGQMVSGKAKSTLVSLKQLAPTTGWLV---------LEDGNLQKVAINKIEVGN  172

Query  1009  FILVQAGESVPVDCEVF  1059
              + +++GE VP+D E+ 
Sbjct  173   ILRIKSGEVVPLDGEIL  189



>ref|WP_010892244.1| HAD family hydrolase [Chlamydia pneumoniae]
 ref|NP_445538.1| cation transporter E1-E2 family ATPase [Chlamydophila pneumoniae 
AR39]
 gb|AAF38779.1| cation-transporting ATPase, E1-E2 family [Chlamydophila pneumoniae 
AR39]
Length=683

 Score = 72.4 bits (176),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/137 (31%), Positives = 71/137 (52%), Gaps = 9/137 (7%)
 Frame = +1

Query  649   KPLQRAFAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAM  828
             K L   F V  F L G  A + +L ++    +NI +LM  A F S+F+G +LEG LLL +
Sbjct  91    KNLSNLFVVFTFFLAGTPALIKSLDNICQKVVNIDILMTSAAFGSIFIGGALEGALLLVL  150

Query  829   FNLAHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGS  1008
             F ++    +  +  +K  +  LK+  P    L+           D   QKV ++ ++VG+
Sbjct  151   FAISEALGQMVSGKAKSTLVSLKQLAPTTGWLV---------LEDGNLQKVAINKIEVGN  201

Query  1009  FILVQAGESVPVDCEVF  1059
              + +++GE VP+D E+ 
Sbjct  202   ILRIKSGEVVPLDGEIL  218



>ref|WP_006341401.1| ATPase [Parachlamydia acanthamoebae]
 gb|EFB41409.1| hypothetical protein pah_c045o133 [Parachlamydia acanthamoebae 
str. Hall's coccus]
 emb|CCB85553.1| putative cadmium/zinc-transporting ATPase HMA1,chloroplastic 
[Parachlamydia acanthamoebae UV-7]
 gb|KIA78719.1| putative cadmium/zinc-transporting ATPase HMA1 [Parachlamydia 
acanthamoebae]
Length=670

 Score = 70.5 bits (171),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 44/138 (32%), Positives = 77/138 (56%), Gaps = 9/138 (7%)
 Frame = +1

Query  646   VKPLQRAFAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLA  825
             ++P+     V  + L G+ A +++L D+    INI +LM LA F+S+ +G+ +EGGLLL 
Sbjct  69    LQPISHILLVSVYFLAGIPALIESLEDLVDLDINIDILMTLAAFSSILIGSGMEGGLLLV  128

Query  826   MFNLAHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVG  1005
             +F L+   E+  T  +K  +  L +  P  A ++      +P  + +      V ++ VG
Sbjct  129   LFALSGSMEDAVTTKAKGAMSSLYKLSPTLACVV------TPKGTLIERS---VKEILVG  179

Query  1006  SFILVQAGESVPVDCEVF  1059
             + ILV+AG+ VP+D +V 
Sbjct  180   TRILVKAGQIVPLDGKVI  197



>ref|WP_039383686.1| ATPase [Neochlamydia sp. TUME1]
 gb|KIC76897.1| putative cadmium/zinc-transporting ATPase HMA1 [Neochlamydia 
sp. TUME1]
Length=662

 Score = 70.1 bits (170),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 72/129 (56%), Gaps = 9/129 (7%)
 Frame = +1

Query  673   VIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAE  852
             VI + L G+ A +++  D+A   INI +LM LA F+SV +G+ +EGGLLL +F L+   E
Sbjct  71    VIVYFLAGIPALIESFEDLANLDINIDILMTLAAFSSVLIGSGMEGGLLLVLFALSGAME  130

Query  853   EHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGE  1032
             +  T  +K  +  L +  P  A ++           D    +  +++++VG  ILV++G+
Sbjct  131   QAVTEKAKSAISALHKLSPTKASIVQ---------PDGTLLERAINEIQVGENILVKSGQ  181

Query  1033  SVPVDCEVF  1059
              VP+D  V 
Sbjct  182   VVPLDGVVI  190



>ref|WP_044882722.1| ATPase [Neochlamydia sp. EPS4]
Length=662

 Score = 70.1 bits (170),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 72/129 (56%), Gaps = 9/129 (7%)
 Frame = +1

Query  673   VIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAE  852
             VI + L G+ A +++  D+A   INI +LM LA F+SV +G+ +EGGLLL +F L+   E
Sbjct  71    VIVYFLAGIPALIESFEDLANLDINIDILMTLAAFSSVLIGSEMEGGLLLVLFALSGAME  130

Query  853   EHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGE  1032
             +  T  +K  +  L +  P  A ++           D    +  +++++VG  ILV++G+
Sbjct  131   QAVTEKAKSAISALHKLSPTKASIVQ---------PDGTLLERAINEIQVGENILVKSGQ  181

Query  1033  SVPVDCEVF  1059
              VP+D  V 
Sbjct  182   VVPLDGVVL  190



>gb|KIC72628.1| putative cadmium/zinc-transporting ATPase HMA1, chloroplastic 
[Neochlamydia sp. EPS4]
Length=665

 Score = 69.7 bits (169),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 72/129 (56%), Gaps = 9/129 (7%)
 Frame = +1

Query  673   VIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAE  852
             VI + L G+ A +++  D+A   INI +LM LA F+SV +G+ +EGGLLL +F L+   E
Sbjct  74    VIVYFLAGIPALIESFEDLANLDINIDILMTLAAFSSVLIGSEMEGGLLLVLFALSGAME  133

Query  853   EHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGE  1032
             +  T  +K  +  L +  P  A ++           D    +  +++++VG  ILV++G+
Sbjct  134   QAVTEKAKSAISALHKLSPTKASIVQ---------PDGTLLERAINEIQVGENILVKSGQ  184

Query  1033  SVPVDCEVF  1059
              VP+D  V 
Sbjct  185   VVPLDGVVL  193



>ref|WP_042240439.1| ATPase [Neochlamydia sp. S13]
Length=662

 Score = 69.7 bits (169),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 72/128 (56%), Gaps = 9/128 (7%)
 Frame = +1

Query  673   VIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAE  852
             VI + L G+ A +++  D+A   INI +LM LA F+SV +G+ +EGGLLL +F L+   E
Sbjct  71    VIVYFLAGIPALIESFEDLANLDINIDILMTLAAFSSVLIGSGMEGGLLLVLFALSGAME  130

Query  853   EHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGE  1032
             +  T  +K  +  L +  P  A ++           D    +  +++++VG  ILV++G+
Sbjct  131   QAVTEKAKSAISALHKLSPTKASIVQ---------PDGTLLERAINEIQVGENILVKSGQ  181

Query  1033  SVPVDCEV  1056
              VP+D  V
Sbjct  182   VVPLDGVV  189



>ref|WP_020370598.1| MULTISPECIES: cadmium-translocating P-type ATPase [Chlamydia]
 gb|EPP34870.1| cadmium-translocating P-type ATPase [Chlamydia psittaci 10_1398_11]
 gb|EQM62268.1| cadmium-translocating P-type ATPase [Chlamydia ibidis 10-1398/6]
Length=657

 Score = 69.3 bits (168),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 67/132 (51%), Gaps = 11/132 (8%)
 Frame = +1

Query  655   LQRAFAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFN  834
             + R F V+ F L G  A + +L D+    INI +LM  A F S+F+  +LEG LLL +F 
Sbjct  68    ISRLFIVLTFFLAGTPAVIKSLDDIRNKTINIDILMTSAAFGSIFIDGALEGALLLVLFT  127

Query  835   LAHIAEEHFTRCSKVDVKELKENHPDFA-LLLDVNNESSPSFSDLRYQKVPVSDLKVGSF  1011
              +       +  ++  +  LK   P  A ++LD  N           +K P+S ++VG  
Sbjct  128   FSEALGLMVSGKARSTLVSLKNLTPTMAWIVLDNGN----------LKKTPISQVQVGDV  177

Query  1012  ILVQAGESVPVD  1047
             I  ++GE VP+D
Sbjct  178   IRTKSGEIVPLD  189



>ref|WP_012727986.1| HAD family hydrolase [Chlamydia trachomatis]
 emb|CAX11186.1| cation transporting ATPase [Chlamydia trachomatis B/Jali20/OT]
Length=659

 Score = 68.6 bits (166),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 66/129 (51%), Gaps = 9/129 (7%)
 Frame = +1

Query  673   VIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAE  852
             ++ F L G  A + +  D+    +NI +LM  A F S+F+G +LEG LLL +F ++    
Sbjct  74    ILTFFLAGTPALIKSFEDILDRTVNIDILMTSAAFGSIFIGGALEGALLLVLFAISESLG  133

Query  853   EHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGE  1032
                +  +K  +  LK   P  A ++           D   QKV V ++KVG  I V++GE
Sbjct  134   AMVSGKAKSTLASLKHLAPTVAWVVQ---------QDGSLQKVLVQNVKVGEIIRVKSGE  184

Query  1033  SVPVDCEVF  1059
              VP+D ++ 
Sbjct  185   VVPLDGKII  193



>ref|WP_009872104.1| HAD family hydrolase [Chlamydia trachomatis]
 ref|NP_220246.1| metal transport ATPase [Chlamydia trachomatis D/UW-3/CX]
 gb|AAC68322.1| Metal Transport P-type ATPase [Chlamydia trachomatis D/UW-3/CX]
 gb|AAX51005.1| lead, cadmium, zinc and mercury transporting ATPase [Chlamydia 
trachomatis A/HAR-13]
 emb|CAX10293.1| cation transporting ATPase [Chlamydia trachomatis B/TZ1A828/OT]
 gb|ADH19372.1| cation transporting ATPase [Chlamydia trachomatis G/11222]
 gb|ADI51404.1| Lead, cadmium, zinc and mercury transporting ATPase [Chlamydia 
trachomatis D-EC]
 gb|ADI52416.1| Lead, cadmium, zinc and mercury transporting ATPase [Chlamydia 
trachomatis D-LC]
 gb|AEJ77039.1| cadmium-translocating P-type ATPase [Chlamydia trachomatis L2c]
 gb|AEP35617.1| Lead, cadmium, zinc and mercury transporting ATPase [Chlamydia 
trachomatis A2497]
 emb|CAX09399.1| cation transporting ATPase [Chlamydia trachomatis A2497]
 emb|CCP49922.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
A/7249]
 emb|CCP49024.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
A/5291]
 emb|CCP48125.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
A/363]
 emb|CCP50906.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
K/SotonK1]
 emb|CCP53815.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
D/SotonD5]
 emb|CCP54706.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
D/SotonD6]
 emb|CCP58306.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
G/SotonG1]
 emb|CCP59200.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
Ia/SotonIa1]
 emb|CCP60094.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
Ia/SotonIa3]
 gb|AGS00685.1| cation transporting ATPase [Chlamydia trachomatis RC-J(s)/122]
 gb|AGS02556.1| cation transporting ATPase [Chlamydia trachomatis J/6276tet1]
 gb|AGT70257.1| HAD family hydrolase [Chlamydia trachomatis]
 gb|AGT71181.1| HAD family hydrolase [Chlamydia trachomatis]
 gb|AGT73023.1| HAD family hydrolase [Chlamydia trachomatis]
 gb|AHC17589.1| HAD family hydrolase [Chlamydia trachomatis C/TW-3]
Length=659

 Score = 68.6 bits (166),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 66/129 (51%), Gaps = 9/129 (7%)
 Frame = +1

Query  673   VIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAE  852
             ++ F L G  A + +  D+    +NI +LM  A F S+F+G +LEG LLL +F ++    
Sbjct  74    ILTFFLAGTPALIKSFEDILDRTVNIDILMTSAAFGSIFIGGALEGALLLVLFAISESLG  133

Query  853   EHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGE  1032
                +  +K  +  LK   P  A ++           D   QKV V ++KVG  I V++GE
Sbjct  134   AMVSGKAKSTLASLKHLAPTVAWVVQ---------QDGSLQKVLVQNVKVGEIIRVKSGE  184

Query  1033  SVPVDCEVF  1059
              VP+D ++ 
Sbjct  185   VVPLDGKII  193



>ref|WP_014541063.1| HAD family hydrolase [Chlamydia trachomatis]
 gb|ADH18447.1| cation transporting ATPase [Chlamydia trachomatis G/9768]
 gb|ADH20294.1| cation transporting ATPase [Chlamydia trachomatis G/11074]
 gb|ADH97392.1| cation transporting ATPase [Chlamydia trachomatis G/9301]
Length=659

 Score = 68.6 bits (166),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 66/129 (51%), Gaps = 9/129 (7%)
 Frame = +1

Query  673   VIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAE  852
             ++ F L G  A + +  D+    +NI +LM  A F S+F+G +LEG LLL +F ++    
Sbjct  74    ILTFFLAGTPALIKSFEDILDRTVNIDILMTSAAFGSIFIGGALEGALLLVLFAISESLG  133

Query  853   EHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGE  1032
                +  +K  +  LK   P  A ++           D   QKV V ++KVG  I V++GE
Sbjct  134   AMVSGKAKSTLASLKHLAPTVAWVVQ---------QDGSLQKVLVQNVKVGEIIRVKSGE  184

Query  1033  SVPVDCEVF  1059
              VP+D ++ 
Sbjct  185   VVPLDGKII  193



>ref|WP_009872881.1| HAD family hydrolase [Chlamydia trachomatis]
 ref|YP_008635241.1| cation transporting ATPase [Chlamydia trachomatis E/C599]
 ref|YP_008655897.1| cation transporting ATPase [Chlamydia trachomatis F/SWFPminus]
 emb|CBJ15252.1| cation transporting ATPase [Chlamydia trachomatis Sweden2]
 gb|ADH17524.1| cation transporting ATPase [Chlamydia trachomatis E/150]
 gb|ADH21216.1| cation transporting ATPase [Chlamydia trachomatis E/11023]
 emb|CCE14790.1| cation transporting ATPase [Chlamydia trachomatis F/SW5]
 emb|CCE13901.1| cation transporting ATPase [Chlamydia trachomatis F/SW4]
 emb|CCE13012.1| cation transporting ATPase [Chlamydia trachomatis E/SW3]
 emb|CCP52923.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
D/SotonD1]
 emb|CCP55596.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
E/SotonE4]
 emb|CCP56496.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
E/SotonE8]
 emb|CCP57413.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
F/SotonF3]
 emb|CCP60989.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
E/Bour]
 emb|CCP28526.1| cation transporting ATPase [Chlamydia trachomatis IU824]
 emb|CCP29427.1| cation transporting ATPase [Chlamydia trachomatis IU888]
 gb|AGR99739.1| cation transporting ATPase [Chlamydia trachomatis RC-F(s)/342]
 gb|AGT64698.1| HAD family hydrolase [Chlamydia trachomatis]
 gb|AGT65627.1| HAD family hydrolase [Chlamydia trachomatis]
 gb|AGT66553.1| HAD family hydrolase [Chlamydia trachomatis]
 gb|AGT67482.1| HAD family hydrolase [Chlamydia trachomatis F/11-96]
 gb|AGT68404.1| HAD family hydrolase [Chlamydia trachomatis]
 gb|AGT69335.1| HAD family hydrolase [Chlamydia trachomatis]
 gb|AGT72096.1| HAD family hydrolase [Chlamydia trachomatis]
 emb|CDG43629.1| cation transporting ATPase [Chlamydia trachomatis E/C599]
 emb|CDG42740.1| cation transporting ATPase [Chlamydia trachomatis F/SWFPminus]
Length=659

 Score = 68.6 bits (166),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 66/129 (51%), Gaps = 9/129 (7%)
 Frame = +1

Query  673   VIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAE  852
             ++ F L G  A + +  D+    +NI +LM  A F S+F+G +LEG LLL +F ++    
Sbjct  74    ILTFFLAGTPALIKSFEDILDRTVNIDILMTSAAFGSIFIGGALEGALLLVLFAISESLG  133

Query  853   EHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGE  1032
                +  +K  +  LK   P  A ++           D   QKV V ++KVG  I V++GE
Sbjct  134   AMVSGKAKSTLASLKHLAPTVAWVVQ---------QDGSLQKVLVQNVKVGEIIRVKSGE  184

Query  1033  SVPVDCEVF  1059
              VP+D ++ 
Sbjct  185   VVPLDGKII  193



>gb|EYE60727.1| cadmium-translocating P-type ATPase [Bacteroides fragilis str. 
S6L5]
Length=628

 Score = 68.6 bits (166),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 72/132 (55%), Gaps = 11/132 (8%)
 Frame = +1

Query  667   FAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHI  846
             F ++ F L G  A + +L D++   +NI +LM  A F S+F+G +LEG LLL +F ++  
Sbjct  43    FIILTFFLAGTPALIKSLDDISKKIVNIDILMTSAAFGSIFIGGALEGALLLVLFAISES  102

Query  847   AEEHFTRCSKVDVKELKENHPDFA-LLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQ  1023
               +  +  +K  +  LK   P  A ++L+  N           +K+ V+ ++VG  I ++
Sbjct  103   LGQMVSGKAKSTLVSLKHLAPKIAWVVLEGGN----------LKKISVNQVQVGDIIRIK  152

Query  1024  AGESVPVDCEVF  1059
             +GE VP+D ++ 
Sbjct  153   SGEVVPLDGQII  164



>ref|WP_034734702.1| HAD family hydrolase [Bacteroides fragilis]
Length=657

 Score = 68.6 bits (166),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 72/132 (55%), Gaps = 11/132 (8%)
 Frame = +1

Query  667   FAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHI  846
             F ++ F L G  A + +L D++   +NI +LM  A F S+F+G +LEG LLL +F ++  
Sbjct  72    FIILTFFLAGTPALIKSLDDISKKIVNIDILMTSAAFGSIFIGGALEGALLLVLFAISES  131

Query  847   AEEHFTRCSKVDVKELKENHPDFA-LLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQ  1023
               +  +  +K  +  LK   P  A ++L+  N           +K+ V+ ++VG  I ++
Sbjct  132   LGQMVSGKAKSTLVSLKHLAPKIAWVVLEGGN----------LKKISVNQVQVGDIIRIK  181

Query  1024  AGESVPVDCEVF  1059
             +GE VP+D ++ 
Sbjct  182   SGEVVPLDGQII  193



>ref|WP_021828664.1| cadmium-translocating P-type ATPase [Chlamydia gallinacea]
 gb|ERL53642.1| cadmium-translocating P-type ATPase [Chlamydia gallinacea 08-1274/3]
Length=657

 Score = 68.2 bits (165),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 72/132 (55%), Gaps = 11/132 (8%)
 Frame = +1

Query  667   FAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHI  846
             F ++ F L G  A + +L D++   +NI +LM  A F S+F+G +LEG LLL +F ++  
Sbjct  72    FIILTFFLAGTPALIKSLDDISKKIVNIDILMTSAAFGSIFIGGALEGALLLVLFAISES  131

Query  847   AEEHFTRCSKVDVKELKENHPDFA-LLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQ  1023
               +  +  +K  +  LK   P  A ++L+  N           +K+ V+ ++VG  I ++
Sbjct  132   LGQMVSGKAKSTLVSLKHLAPKIAWVVLEGGN----------LKKISVNQVQVGDIIRIK  181

Query  1024  AGESVPVDCEVF  1059
             +GE VP+D ++ 
Sbjct  182   SGEVVPLDGQII  193



>ref|WP_024010970.1| cadmium-translocating P-type ATPase [Chlamydia pecorum]
 gb|ETF40778.1| cadmium-translocating P-type ATPase [Chlamydia pecorum IPTaLE]
Length=657

 Score = 68.2 bits (165),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/131 (30%), Positives = 66/131 (50%), Gaps = 9/131 (7%)
 Frame = +1

Query  667   FAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHI  846
             F V+ F   G  A + +L ++    INI +LM  A F S+F+G +LEG LLL +F ++  
Sbjct  72    FTVLTFFFAGTPALIKSLENIYHKTINIDILMTSAAFGSIFIGGALEGALLLVLFAISEA  131

Query  847   AEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQA  1026
               +  +  +K  +  LK+  P    +L  N            Q+ P+  + VG  + +++
Sbjct  132   LGQMVSGKAKSSLASLKQLAPTTGWVLLENGH---------LQQKPIDKICVGDILRIKS  182

Query  1027  GESVPVDCEVF  1059
             GE VP+D E+ 
Sbjct  183   GEVVPLDGEII  193



>ref|WP_012263550.1| HAD family hydrolase [Chlamydia trachomatis]
 emb|CAP06494.1| cation transporting ATPase [Chlamydia trachomatis L2b/UCH-1/proctitis]
 emb|CCP52026.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
L2b/8200/07]
 emb|CCP61879.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
L2b/795]
 emb|CCP62774.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
L1/440/LN]
 emb|CCP64553.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
L1/115]
 emb|CCP65442.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
L1/224]
 emb|CCP67221.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
L3/404/LN]
 emb|CCP68109.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
L2b/UCH-2]
 emb|CCP69000.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
L2b/Canada2]
 emb|CCP69891.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
L2b/LST]
 emb|CCP70781.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
L2b/Ams1]
 emb|CCP71671.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
L2b/CV204]
 emb|CCP90836.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
L2b/Ams2]
 emb|CCP91726.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
L2b/Ams3]
 emb|CCP92618.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
L2b/Canada1]
 emb|CCP93511.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
L2b/Ams4]
 emb|CCP94402.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
L2b/Ams5]
Length=659

 Score = 68.2 bits (165),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 66/129 (51%), Gaps = 9/129 (7%)
 Frame = +1

Query  673   VIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAE  852
             ++ F L G  A + +  D+    +NI +LM  A F S+F+G +LEG LLL +F ++    
Sbjct  74    ILTFFLAGTPALIKSFEDILDRTVNIDILMTSAAFGSIFIGGALEGALLLVLFAISESLG  133

Query  853   EHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGE  1032
                +  +K  +  LK   P  A ++           D   QKV V ++K+G  I V++GE
Sbjct  134   AMVSGKAKSTLASLKHLAPTVAWVVQ---------QDGSLQKVLVQNVKIGEIIRVKSGE  184

Query  1033  SVPVDCEVF  1059
              VP+D ++ 
Sbjct  185   VVPLDGKII  193



>ref|WP_021756909.1| cadmium-translocating P-type ATPase [Chlamydia pecorum]
 gb|AGW38326.1| cadmium-translocating P-type ATPase [Chlamydia pecorum PV3056/3]
Length=657

 Score = 68.2 bits (165),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/131 (30%), Positives = 66/131 (50%), Gaps = 9/131 (7%)
 Frame = +1

Query  667   FAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHI  846
             F V+ F   G  A + +L ++    INI +LM  A F S+F+G +LEG LLL +F ++  
Sbjct  72    FTVLTFFFAGTPALIKSLENIYHKTINIDILMTSAAFGSIFIGGALEGALLLVLFAISEA  131

Query  847   AEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQA  1026
               +  +  +K  +  LK+  P    +L  N            Q+ P+  + VG  + +++
Sbjct  132   LGQMVSGKAKSSLASLKQLAPTTGWVLLENGH---------LQQKPIDKICVGDILRIKS  182

Query  1027  GESVPVDCEVF  1059
             GE VP+D E+ 
Sbjct  183   GEVVPLDGEII  193



>ref|WP_009873330.1| HAD family hydrolase [Chlamydia trachomatis]
 ref|YP_001654187.1| cation transporting ATPase [Chlamydia trachomatis 434/Bu]
 emb|CAP03540.1| cation transporting ATPase [Chlamydia trachomatis 434/Bu]
 emb|CCP66333.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
L2/25667R]
 gb|AGJ65124.1| HAD family hydrolase [Chlamydia trachomatis L2/434/Bu(f)]
 gb|AGJ64184.1| HAD family hydrolase [Chlamydia trachomatis L2/434/Bu(i)]
 gb|AGR94172.1| cation transporting ATPase [Chlamydia trachomatis RC-F/69]
 gb|AGR95097.1| cation transporting ATPase [Chlamydia trachomatis RC-L2(s)/46]
 gb|AGR96022.1| cation transporting ATPase [Chlamydia trachomatis RC-F(s)/852]
 gb|AGR96976.1| cation transporting ATPase [Chlamydia trachomatis RC-J/943]
 gb|AGR97897.1| cation transporting ATPase [Chlamydia trachomatis RC-J/953]
 gb|AGR98817.1| cation transporting ATPase [Chlamydia trachomatis RC-L2(s)/3]
 gb|AGS01628.1| cation transporting ATPase [Chlamydia trachomatis RC-J/966]
 gb|AGS03509.1| cation transporting ATPase [Chlamydia trachomatis RC-J/971]
 gb|AGS04437.1| cation transporting ATPase [Chlamydia trachomatis RC-L2/55]
Length=659

 Score = 68.2 bits (165),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 66/129 (51%), Gaps = 9/129 (7%)
 Frame = +1

Query  673   VIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAE  852
             ++ F L G  A + +  D+    +NI +LM  A F S+F+G +LEG LLL +F ++    
Sbjct  74    ILTFFLAGTPALIKSFEDILDRTVNIDILMTSAAFGSIFIGGALEGALLLVLFAISESLG  133

Query  853   EHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGE  1032
                +  +K  +  LK   P  A ++           D   QKV V ++K+G  I V++GE
Sbjct  134   AMVSGKAKSTLASLKHLAPTVAWVVQ---------QDGSLQKVLVQNVKIGEIIRVKSGE  184

Query  1033  SVPVDCEVF  1059
              VP+D ++ 
Sbjct  185   VVPLDGKII  193



>ref|WP_015506573.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis]
 emb|CCP63663.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
L1/1322/p2]
Length=659

 Score = 68.2 bits (165),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 66/129 (51%), Gaps = 9/129 (7%)
 Frame = +1

Query  673   VIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAE  852
             ++ F L G  A + +  D+    +NI +LM  A F S+F+G +LEG LLL +F ++    
Sbjct  74    ILTFFLAGTPALIKSFEDILDRTVNIDILMTSAAFGSIFIGGALEGALLLVLFAISESLG  133

Query  853   EHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGE  1032
                +  +K  +  LK   P  A ++           D   QKV V ++K+G  I V++GE
Sbjct  134   AMVSGKAKSTLASLKHLAPTVAWVVQ---------QDGSLQKVLVQNVKIGEIIRVKSGE  184

Query  1033  SVPVDCEVF  1059
              VP+D ++ 
Sbjct  185   VVPLDGKII  193



>ref|WP_021757537.1| cadmium-translocating P-type ATPase [Chlamydia pecorum]
 gb|AGW39251.1| cadmium-translocating P-type ATPase [Chlamydia pecorum W73]
 gb|AGW40176.1| cadmium-translocating P-type ATPase [Chlamydia pecorum P787]
 gb|ETF38547.1| cadmium-translocating P-type ATPase [Chlamydia pecorum VR629]
 gb|ETF39052.1| cadmium-translocating P-type ATPase [Chlamydia pecorum DBDeUG]
 gb|ETF39728.1| cadmium-translocating P-type ATPase [Chlamydia pecorum MC/MarsBar]
Length=657

 Score = 68.2 bits (165),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/131 (30%), Positives = 66/131 (50%), Gaps = 9/131 (7%)
 Frame = +1

Query  667   FAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHI  846
             F V+ F   G  A + +L ++    INI +LM  A F S+F+G +LEG LLL +F ++  
Sbjct  72    FTVLTFFFAGTPALIKSLENIYHKTINIDILMTSAAFGSIFIGGALEGALLLVLFAISEA  131

Query  847   AEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQA  1026
               +  +  +K  +  LK+  P    +L  N            Q+ P+  + VG  + +++
Sbjct  132   LGQMVSGKAKSSLASLKQLAPTTGWVLLENGH---------LQQKPIDKICVGDILRIKS  182

Query  1027  GESVPVDCEVF  1059
             GE VP+D E+ 
Sbjct  183   GEVVPLDGEII  193



>gb|AEB41191.1| cadmium-translocating P-type ATPase [Chlamydophila pecorum E58]
Length=628

 Score = 67.8 bits (164),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/131 (30%), Positives = 66/131 (50%), Gaps = 9/131 (7%)
 Frame = +1

Query  667   FAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHI  846
             F V+ F   G  A + +L ++    INI +LM  A F S+F+G +LEG LLL +F ++  
Sbjct  43    FTVLTFFFAGTPALIKSLENIYHKTINIDILMTSAAFGSIFIGGALEGALLLVLFAISEA  102

Query  847   AEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQA  1026
               +  +  +K  +  LK+  P    +L  N            Q+ P+  + VG  + +++
Sbjct  103   LGQMVSGKAKSSLASLKQLAPTTGWVLLENGH---------LQQKPIDKICVGDILRIKS  153

Query  1027  GESVPVDCEVF  1059
             GE VP+D E+ 
Sbjct  154   GEVVPLDGEII  164



>gb|ADI38979.1| heavy metal translocating ATPase, P-type [Waddlia chondrophila 
WSU 86-1044]
 emb|CCB92100.1| putative cadmium/zinc-transporting ATPase HMA1,chloroplastic 
[Waddlia chondrophila 2032/99]
Length=663

 Score = 67.8 bits (164),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 71/136 (52%), Gaps = 9/136 (7%)
 Frame = +1

Query  640   PAVKPLQRAFAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLL  819
             PA  P      +  + L G+ + ++AL D+A  ++NI +LM LA F+S+F+G+ +EGGLL
Sbjct  63    PAWVPFSHLTLIGVYFLAGIPSLIEALEDLANFEVNIDILMTLAAFSSIFIGSGMEGGLL  122

Query  820   LAMFNLAHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLK  999
             L +F L+   E+     +   +  L +  P  A ++           D    +  + ++ 
Sbjct  123   LVLFALSGSMEDAVRSKATSAINSLHKLSPTTAFVVQ---------EDGTAVEKSIKEIA  173

Query  1000  VGSFILVQAGESVPVD  1047
             VG  I V+AG+ VP+D
Sbjct  174   VGCLIRVKAGQIVPLD  189



>ref|WP_041941913.1| ATPase [Waddlia chondrophila]
Length=655

 Score = 67.8 bits (164),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 71/136 (52%), Gaps = 9/136 (7%)
 Frame = +1

Query  640   PAVKPLQRAFAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLL  819
             PA  P      +  + L G+ + ++AL D+A  ++NI +LM LA F+S+F+G+ +EGGLL
Sbjct  55    PAWVPFSHLTLIGVYFLAGIPSLIEALEDLANFEVNIDILMTLAAFSSIFIGSGMEGGLL  114

Query  820   LAMFNLAHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLK  999
             L +F L+   E+     +   +  L +  P  A ++           D    +  + ++ 
Sbjct  115   LVLFALSGSMEDAVRSKATSAINSLHKLSPTTAFVVQ---------EDGTAVEKSIKEIA  165

Query  1000  VGSFILVQAGESVPVD  1047
             VG  I V+AG+ VP+D
Sbjct  166   VGCLIRVKAGQIVPLD  181



>ref|XP_005705513.1| metal transporting P-type ATPase [Galdieria sulphuraria]
 gb|EME28993.1| metal transporting P-type ATPase [Galdieria sulphuraria]
Length=854

 Score = 67.8 bits (164),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 43/135 (32%), Positives = 69/135 (51%), Gaps = 9/135 (7%)
 Frame = +1

Query  649   KPLQRAFAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAM  828
             K  +       F + G+ A  D ++ +    INI VLM  A  AS F+G+  EG LL+ +
Sbjct  188   KSFETLLVGTCFAICGLPALDDTVISLKARDINIDVLMTAAALASFFLGSIFEGTLLVLL  247

Query  829   FNLAHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNE--SSPSFSDLRYQKVPVSDLKV  1002
             +  +HIAE    + +   +  L+++ P  AL +   ++   SP       ++V VS +K 
Sbjct  248   YTSSHIAERKVQQFATKRLDSLRDHIPQTALCVGTRDKLYDSP-------REVSVSQVKP  300

Query  1003  GSFILVQAGESVPVD  1047
             G +ILV+AGE  P D
Sbjct  301   GDWILVRAGEIAPCD  315



>ref|WP_042103685.1| ATPase [Parachlamydiaceae bacterium HS-T3]
Length=668

 Score = 67.4 bits (163),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 70/140 (50%), Gaps = 9/140 (6%)
 Frame = +1

Query  640   PAVKPLQRAFAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLL  819
             P   P   A  V  +   G+ + ++++ D+   +INI VLM LA F SV +G+ +EG LL
Sbjct  65    PTFLPYSHALLVFVYFFAGIPSLIESIEDLLDFQINIDVLMTLAAFGSVIIGSPMEGALL  124

Query  820   LAMFNLAHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLK  999
             L +F+L+   EE  T  +K  +  L +  P  A ++     +             + ++ 
Sbjct  125   LVLFSLSAAMEEAVTASAKKTISHLHKLSPTRACVITSTGHTIDR---------AIKEIS  175

Query  1000  VGSFILVQAGESVPVDCEVF  1059
              G+ IL++AGE VP+D  V 
Sbjct  176   KGTKILIKAGELVPLDGVVI  195



>ref|WP_013942882.1| ATPase [Simkania negevensis]
 emb|CCB88415.1| putative cadmium/zinc-transporting ATPase HMA1,chloroplastic 
[Simkania negevensis Z]
Length=648

 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 63/118 (53%), Gaps = 9/118 (8%)
 Frame = +1

Query  694   GVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTRCS  873
             G  A  + + D+   +INI VLM LA F S  +G+ +EGGLLL +F  +   EE  +R +
Sbjct  71    GTPALQNTIEDIKNLEINIDVLMTLAAFLSFLIGSQMEGGLLLVLFAFSGAMEETVSRKA  130

Query  874   KVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVD  1047
             K  +  L E  P  A +L              +QK  V ++ VG+ +LV+AGE VP+D
Sbjct  131   KGALLNLNELSPTMATVLGEKGT--------LFQK-SVREITVGTRLLVRAGEIVPLD  179



>ref|WP_036097748.1| ATPase [Listeria floridensis]
Length=649

 Score = 65.9 bits (159),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 66/126 (52%), Gaps = 10/126 (8%)
 Frame = +1

Query  673   VIAFPLVGVSASLDALMD-VAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIA  849
             V AF + G   + D + D +   K+N+ +LM LA   +  +G  LEG +L+ +F+L+   
Sbjct  40    VAAFIIGGFEQARDGIRDTIKTKKLNVELLMVLAATGASIIGYWLEGAVLIFIFSLSGAL  99

Query  850   EEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAG  1029
             E + T  S+ ++ +L    P+ A LL  N E          Q+  V DLK G  +LV+ G
Sbjct  100   ETYTTNKSRREITKLMSFQPETAFLLLENGE---------LQETAVDDLKTGQLLLVRPG  150

Query  1030  ESVPVD  1047
             E +P+D
Sbjct  151   ERIPID  156



>gb|EUJ30302.1| cadmium-translocating P-type ATPase [Listeria floridensis FSL 
S10-1187]
Length=650

 Score = 65.9 bits (159),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 66/126 (52%), Gaps = 10/126 (8%)
 Frame = +1

Query  673   VIAFPLVGVSASLDALMD-VAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIA  849
             V AF + G   + D + D +   K+N+ +LM LA   +  +G  LEG +L+ +F+L+   
Sbjct  41    VAAFIIGGFEQARDGIRDTIKTKKLNVELLMVLAATGASIIGYWLEGAVLIFIFSLSGAL  100

Query  850   EEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAG  1029
             E + T  S+ ++ +L    P+ A LL  N E          Q+  V DLK G  +LV+ G
Sbjct  101   ETYTTNKSRREITKLMSFQPETAFLLLENGE---------LQETAVDDLKTGQLLLVRPG  151

Query  1030  ESVPVD  1047
             E +P+D
Sbjct  152   ERIPID  157



>ref|XP_011400702.1| putative cadmium/zinc-transporting ATPase HMA1, chloroplastic 
[Auxenochlorella protothecoides]
 gb|KFM27715.1| putative cadmium/zinc-transporting ATPase HMA1, chloroplastic 
[Auxenochlorella protothecoides]
Length=588

 Score = 64.7 bits (156),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 63/112 (56%), Gaps = 3/112 (3%)
 Frame = +1

Query  727   VAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTRCSKVDVKELKENH  906
             +A G+++ HVL +LA   +   G++ EG LLL MF  +H+ E   T  ++  + +L    
Sbjct  58    LAAGEVDTHVLTSLAAAGTALTGHAAEGALLLTMFQTSHMLEHQLTARARGRLADLFAGL  117

Query  907   PDFALLLDVN-NESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVDCEVF  1059
             PD A +++V+  +++P     R+  V V++L+ G  +LV  G  VPVD  V 
Sbjct  118   PDAAEVVEVDLADAAPRLHTRRH--VAVANLRPGDHVLVLPGAQVPVDGRVV  167



>emb|CEG25651.1| cadmium-transporting ATPase [Bacillus sp. B-jedd]
Length=638

 Score = 64.3 bits (155),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 43/145 (30%), Positives = 72/145 (50%), Gaps = 11/145 (8%)
 Frame = +1

Query  625   YVLPKPAVKPLQRAFAVIAFPLVGVSASLDAL-MDVAGGKINIHVLMALAGFASVFMGNS  801
             ++L K  ++P   A  + AF + G + + + +   +   ++N+ +LM LA   S  +G  
Sbjct  41    WLLGKNGLEPASIAAYLAAFVIGGFAKAKEGIEATIEDKELNVEMLMVLAAIGSAIIGYW  100

Query  802   LEGGLLLAMFNLAHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKV  981
              EG +L+ +F ++   E +    S  ++  L E  P+ ALLL    E          Q+V
Sbjct  101   AEGAILIFIFAVSGALETYTMNKSHKEISSLMELQPEEALLLTAGGE----------QRV  150

Query  982   PVSDLKVGSFILVQAGESVPVDCEV  1056
             PVS L VG  ILV+ GE +P D  +
Sbjct  151   PVSQLAVGDAILVKPGERIPADGRI  175



>ref|WP_042349864.1| ATPase [Bacillus sp. G2(2012b)]
Length=636

 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/146 (29%), Positives = 77/146 (53%), Gaps = 10/146 (7%)
 Frame = +1

Query  625   YVLPKPAVKPLQRAFAVIAFPLVGVSASLDALMD-VAGGKINIHVLMALAGFASVFMGNS  801
             ++L K  +        ++AF + G + + + ++D +   ++N+ +LM LA   S  +G  
Sbjct  35    WILSKNDMVTFSVIAYLLAFVIGGYAKAKEGILDTIETKRLNVEILMILAAIGSAIIGYW  94

Query  802   LEGGLLLAMFNLAHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKV  981
              EG +L+ +F+L+   E +    S  ++  L +  P+ ALL+D  +E + S        V
Sbjct  95    AEGSILIFIFSLSGALETYTMNKSHKEISALMDLQPEEALLID--SEGNESL-------V  145

Query  982   PVSDLKVGSFILVQAGESVPVDCEVF  1059
              V+DLK+G  IL++AGE VP D  + 
Sbjct  146   AVADLKLGDHILIKAGERVPSDGSII  171



>ref|WP_010761167.1| heavy metal translocating P-type ATPase [Enterococcus haemoperoxidus]
 gb|EOH99805.1| heavy metal translocating P-type ATPase [Enterococcus haemoperoxidus 
ATCC BAA-382]
 gb|EOT62453.1| cadmium-translocating P-type ATPase [Enterococcus haemoperoxidus 
ATCC BAA-382]
Length=637

 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 66/126 (52%), Gaps = 10/126 (8%)
 Frame = +1

Query  673   VIAFPLVGVSASLDALMDVAGGK-INIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIA  849
             ++A    G   + D L++    K +N+ +LMALA   +  +GN  EG +L  +F L+   
Sbjct  39    ILAIFFGGFKQTKDGLIETLENKHLNVDLLMALAAVGACIIGNWFEGAMLTFIFCLSGAL  98

Query  850   EEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAG  1029
             EE+ T  SK ++  L    P+ ALLL   NE   +       +  V++L++G  ILV  G
Sbjct  99    EEYTTNKSKNEIASLMNMQPETALLL---NEQGKTI------ETAVNELQIGDLILVPKG  149

Query  1030  ESVPVD  1047
              SVP+D
Sbjct  150   ASVPID  155



>ref|WP_036081150.1| ATPase [Listeria cornellensis]
 gb|EUJ26739.1| hypothetical protein PCORN_14539 [Listeria cornellensis FSL F6-969]
Length=614

 Score = 63.5 bits (153),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 69/126 (55%), Gaps = 10/126 (8%)
 Frame = +1

Query  673   VIAFPLVGVSASLDALMD-VAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIA  849
             ++AF + G + + + + + +   K+N+ +LM +A   +  +G  LEG +L+ +F+L+   
Sbjct  38    LVAFVIGGFAKAKEGITNTIRTKKLNVELLMVIAAIGASIIGYWLEGAILIFIFSLSGAL  97

Query  850   EEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAG  1029
             E +    SK D+  L E  P  A LL  +N ++         +VPV +L  G FIL++ G
Sbjct  98    ETYTMNKSKRDISNLLEIQPMTASLLQTDNSTT---------EVPVEELLEGQFILIRPG  148

Query  1030  ESVPVD  1047
             E VP+D
Sbjct  149   EIVPLD  154



>ref|WP_040980550.1| metal ABC transporter ATPase [Oceanobacillus sp. S5]
Length=646

 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 57/105 (54%), Gaps = 9/105 (9%)
 Frame = +1

Query  745   NIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTRCSKVDVKELKENHPDFALL  924
             N H+LM LA   +  +G   EG LL+ +F+ AH  E++    SK ++ +L E +P  A L
Sbjct  84    NSHILMGLAALGASILGEFWEGALLILIFSGAHFLEDYAEGRSKREITKLLEMNPTTARL  143

Query  925   LDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVDCEVF  1059
             +D N  ++          V VSDLK+G  + V  G+ VP+D ++ 
Sbjct  144   IDNNGNTT---------MVEVSDLKIGDRLQVLNGDQVPIDGKII  179



>ref|WP_007542749.1| ATPase [Listeria fleischmannii]
 gb|EIA21610.1| cadmium-translocating P-type ATPase [Listeria fleischmannii subsp. 
coloradonensis]
Length=649

 Score = 62.8 bits (151),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 58/106 (55%), Gaps = 9/106 (8%)
 Frame = +1

Query  739   KINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTRCSKVDVKELKENHPDFA  918
             K+N+ +LM LA   +  +G   EG +L+ +F+L+   E + T  S+ ++ +L    P+ A
Sbjct  63    KLNVELLMVLAATGASIIGYWFEGAILIFIFSLSGSLETYTTNKSRREITKLMALKPETA  122

Query  919   LLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVDCEV  1056
              L     E           +V VSDLK+G  ILV+ GESVP+D ++
Sbjct  123   FLQGEKGE---------LTEVSVSDLKIGDLILVRPGESVPIDGQI  159



>gb|EPP35803.1| E1-E2 ATPase family protein, partial [Chlamydia psittaci 84-8471/1]
Length=112

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 61/120 (51%), Gaps = 9/120 (8%)
 Frame = +1

Query  667   FAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHI  846
             F V  F L G  A + +L D+    +NI +LM  A F S+F+G +LEG LLL +F ++  
Sbjct  2     FVVFTFFLAGTPALIKSLDDIRNKTVNIDILMTSAAFGSIFIGGALEGSLLLVLFAISEA  61

Query  847   AEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQA  1026
               +  +  +K  +  LK   P  A ++           D   +K+PV+ ++VG  I V++
Sbjct  62    LGQMVSGKAKGTLASLKHLAPTIAWVVR---------EDGNLEKIPVNHVEVGKIIRVKS  112



>ref|XP_001697106.1| heavy metal transporting ATPase [Chlamydomonas reinhardtii]
 gb|EDP00361.1| heavy metal transporting ATPase [Chlamydomonas reinhardtii]
Length=1189

 Score = 62.8 bits (151),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 48/166 (29%), Positives = 78/166 (47%), Gaps = 29/166 (17%)
 Frame = +1

Query  643   AVKPLQRAFAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLL  822
             A   LQ A     + L G+  ++ ++   AGG ++ HVLM+LA  A++++G   EG LLL
Sbjct  46    AAGGLQAACLAGTYCLSGLPQAVSSVALAAGGGLDTHVLMSLAVLATLYLGMVQEGALLL  105

Query  823   AMFNLAHIAEEHFTRCSKVDVKELKENHPDFALLL-------------DVN---------  936
              +F ++H  EE FT  ++  ++ L    P+ A L+              +N         
Sbjct  106   LLFQISHFLEERFTSRAQGSMERLWAAMPERATLVALEPVPAGASAAAGINGSSTGSTGG  165

Query  937   -----NESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVDCEVF  1059
                  +   P  S  R  +V    + VG  +LV+AGE +P+D EV 
Sbjct  166   SGTGSSSGGPDLSSCR--EVLADSVAVGQLVLVRAGEQLPLDGEVV  209



>gb|ERE43186.1| hypothetical protein N036_37020, partial [Enterococcus gallinarum 
EGD-AAK12]
Length=424

 Score = 61.6 bits (148),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 58/104 (56%), Gaps = 10/104 (10%)
 Frame = +1

Query  745   NIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTRCSKVDVKELKENHPDFALL  924
             N+ +LM +A   ++F+G+  EG LL+ +F+L+H  EE+ T  SK +++ L    P  A  
Sbjct  68    NVDLLMIIASIGAMFIGDFREGSLLIFIFSLSHALEEYATNKSKKEIESLINIQPKLAKK  127

Query  925   LDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVDCEV  1056
             L +N           Y +V V +L VG  I V  GESVP+D ++
Sbjct  128   L-ING---------SYTEVSVDNLYVGDIISVLKGESVPIDGKI  161



>ref|WP_017473159.1| metal ABC transporter ATPase [Amphibacillus jilinensis]
Length=643

 Score = 62.0 bits (149),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 56/105 (53%), Gaps = 9/105 (9%)
 Frame = +1

Query  745   NIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTRCSKVDVKELKENHPDFALL  924
             N H+LM LA   +  +G   EG LL+ +F+ AH  EE+    SK ++ +L E HP  A  
Sbjct  86    NSHILMGLAALGASLIGEFWEGALLILIFSGAHFLEEYAEGRSKREITKLVEMHPTTARR  145

Query  925   LDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVDCEVF  1059
             +  N ++         +K+ V +LKVG  + V+ G+ VP+D  + 
Sbjct  146   ITSNGKT---------EKINVEELKVGDHLQVRNGDQVPIDGVIL  181



>ref|WP_036086498.1| ATPase [Listeria booriae]
Length=610

 Score = 61.6 bits (148),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 59/106 (56%), Gaps = 9/106 (8%)
 Frame = +1

Query  739   KINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTRCSKVDVKELKENHPDFA  918
             K+N+ +LM LA   +  +G  LEG +L+ +F+L+   E + T  SK ++  L E  P  A
Sbjct  60    KLNVELLMILAAIGASIIGYWLEGAVLIFIFSLSGALETYTTNKSKREITNLLEIQPVTA  119

Query  919   LLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVDCEV  1056
              L   +N           ++VPV  L++G  +LV+ G+++P+D E+
Sbjct  120   FLRRADN---------TVEEVPVESLRLGDSLLVRPGDTIPIDGEI  156



>ref|WP_016837892.1| hypothetical protein [Ureibacillus thermosphaericus]
Length=634

 Score = 61.6 bits (148),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 40/130 (31%), Positives = 67/130 (52%), Gaps = 10/130 (8%)
 Frame = +1

Query  673   VIAFPLVGVSASLDALMD-VAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIA  849
             +IAF + G + + + ++D +    +N+ +LM LA   S+ +G   EG +L+ +F L+   
Sbjct  51    IIAFIIGGYAKAKEGILDTIENRTLNVELLMILAAIGSMIIGYWTEGAILIFIFALSGAL  110

Query  850   EEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAG  1029
             E +    S  ++  L    P+ A L+  N E           KVPVS LKVG  +L++ G
Sbjct  111   ETYAMNRSHREISSLMNLQPEEAWLVRGNFEP---------MKVPVSSLKVGDHLLIKPG  161

Query  1030  ESVPVDCEVF  1059
             E +P D E+ 
Sbjct  162   ERIPADGEII  171



>ref|WP_007473773.1| cadmium-translocating P-type ATPase [Listeria fleischmannii]
 gb|EMG28368.1| cadmium-translocating P-type ATPase [Listeria fleischmannii LU2006-1]
Length=649

 Score = 61.6 bits (148),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 58/106 (55%), Gaps = 9/106 (8%)
 Frame = +1

Query  739   KINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTRCSKVDVKELKENHPDFA  918
             K+N+ +LM LA   +  +G   EG +L+ +F+L+   E + T  S+ ++ +L    P+ A
Sbjct  63    KLNVELLMVLAATGASIIGYWFEGAILIFIFSLSGSLETYTTNKSRREITKLMALKPETA  122

Query  919   LLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVDCEV  1056
              L     E           +V VSDL++G  ILV+ GESVP+D ++
Sbjct  123   FLQGEKGE---------LTEVSVSDLRIGDLILVRPGESVPIDGQI  159



>gb|KIY94537.1| Cd2+/Zn2+-exporting ATPase [Monoraphidium neglectum]
Length=318

 Score = 60.8 bits (146),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 71/123 (58%), Gaps = 1/123 (1%)
 Frame = +1

Query  688   LVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTR  867
             L GV    + L+ +   +++ HVLM+L+   +++MG + EG LLL +F ++H+ E+  T 
Sbjct  117   LSGVPQLAETLVAIVRSRVDTHVLMSLSVVGTLYMGMAAEGALLLLLFRVSHLLEDKLTE  176

Query  868   CSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVD  1047
              +  ++  L ++ P  A L++V+ +     +     +VP S + +G  +LV+ GE+VP+D
Sbjct  177   RASGNLGRLFDSVPSRATLVEVDEDGGAPRA-ASATEVPASSVALGQHVLVRPGEAVPLD  235

Query  1048  CEV  1056
               +
Sbjct  236   GSI  238



>ref|WP_027320967.1| ATPase [Bacillus sp. URHB0009]
Length=638

 Score = 61.2 bits (147),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 43/145 (30%), Positives = 71/145 (49%), Gaps = 11/145 (8%)
 Frame = +1

Query  625   YVLPKPAVKPLQRAFAVIAFPLVGVSASLDALMDVAGGK-INIHVLMALAGFASVFMGNS  801
             Y+L K   +       ++AF + G + + + + +    K +N+ +LM LA   S  +G  
Sbjct  42    YLLDKGDYRAESIIAYLLAFVIGGFAKAKEGIEETIENKELNVEMLMVLAAIGSAIIGYW  101

Query  802   LEGGLLLAMFNLAHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKV  981
              EG +L+ +F L+   E +    S  ++  L E  P+ ALL+    E          + V
Sbjct  102   TEGAILIFIFALSGALETYTMNKSNKEISSLMELEPEEALLISGGEE----------RLV  151

Query  982   PVSDLKVGSFILVQAGESVPVDCEV  1056
             PV+DLKVG  ILV+ GE +P D  +
Sbjct  152   PVADLKVGDIILVKPGERIPSDGRI  176



>gb|EOL43279.1| heavy metal translocating P-type ATPase [Enterococcus caccae 
ATCC BAA-1240]
 gb|EOT68321.1| cadmium-translocating P-type ATPase [Enterococcus caccae ATCC 
BAA-1240]
Length=656

 Score = 61.2 bits (147),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 72/142 (51%), Gaps = 11/142 (8%)
 Frame = +1

Query  625   YVLPKPAVKPLQRAFAVIAFPLVGVSASLDALMDVAGGK-INIHVLMALAGFASVFMGNS  801
             +VL K  V+    +FA   F L G   + + L D    + +N+ +LMALA   +  +GN 
Sbjct  24    FVLEKLNVRFYPISFAAAIF-LGGFKQTKEGLFDTIENRHLNVDLLMALAAIGACLIGNW  82

Query  802   LEGGLLLAMFNLAHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKV  981
              EG +L  +F L+   EE+ T  SK ++  L    P+ A LL  + +++         +V
Sbjct  83    FEGAMLTFIFCLSGALEEYTTNKSKKEISSLMNMQPETAFLLHDSGKTT---------EV  133

Query  982   PVSDLKVGSFILVQAGESVPVD  1047
              V+ L++G  +LV  G  +P+D
Sbjct  134   AVTQLQIGDLLLVPKGARIPID  155



>ref|WP_034860433.1| ATPase, partial [Enterococcus caccae]
Length=621

 Score = 61.2 bits (147),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 72/142 (51%), Gaps = 11/142 (8%)
 Frame = +1

Query  625   YVLPKPAVKPLQRAFAVIAFPLVGVSASLDALMDVAGGK-INIHVLMALAGFASVFMGNS  801
             +VL K  V+    +FA   F L G   + + L D    + +N+ +LMALA   +  +GN 
Sbjct  24    FVLEKLNVRFYPISFAAAIF-LGGFKQTKEGLFDTIENRHLNVDLLMALAAIGACLIGNW  82

Query  802   LEGGLLLAMFNLAHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKV  981
              EG +L  +F L+   EE+ T  SK ++  L    P+ A LL  + +++         +V
Sbjct  83    FEGAMLTFIFCLSGALEEYTTNKSKKEISSLMNMQPETAFLLHDSGKTT---------EV  133

Query  982   PVSDLKVGSFILVQAGESVPVD  1047
              V+ L++G  +LV  G  +P+D
Sbjct  134   AVTQLQIGDLLLVPKGARIPID  155



>ref|WP_028393088.1| ATPase [Bacillus sp. FJAT-14515]
Length=639

 Score = 61.2 bits (147),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 69/127 (54%), Gaps = 11/127 (9%)
 Frame = +1

Query  679   AFPLVGVSASLDALMD-VAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEE  855
             AF + G + + + + D +A  ++N+ +LM LA   S  +G   EG +L+ +F L+  A E
Sbjct  60    AFVIGGYAKAKEGIEDTIADKELNVEMLMILAAIGSAIIGYWTEGAILIFIFALSG-ALE  118

Query  856   HFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGES  1035
              +T         + ++H + + L+D+  E +   +D    KV VS L+VG  IL++ GE 
Sbjct  119   TYT---------MNKSHKEISALMDLQPEEALRITDGIETKVAVSQLRVGDLILIKPGER  169

Query  1036  VPVDCEV  1056
             VP D ++
Sbjct  170   VPSDGKI  176



>ref|WP_027347512.1| ATPase [Helcococcus sueciensis]
Length=610

 Score = 60.8 bits (146),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 42/137 (31%), Positives = 68/137 (50%), Gaps = 10/137 (7%)
 Frame = +1

Query  640   PAVKPLQRAFAVIAFPLVGVSASLDALMDVAGGKI-NIHVLMALAGFASVFMGNSLEGGL  816
             P+ K L      IA   +G  A+ +A++D    K  N+ +LM LA   ++ +  + EG L
Sbjct  29    PSNKNLSTYIFYIAILFLGYYATKNAVVDTIKNKSPNVDLLMILAALGAIVIDYASEGAL  88

Query  817   LLAMFNLAHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDL  996
             LL +F  A + E++ T  S   +KEL +  PD         ++    SD  Y+ V   +L
Sbjct  89    LLIIFAGAEVLEDYVTGKSSNAIKELMQQLPD---------KAKRVTSDGNYEIVSTDEL  139

Query  997   KVGSFILVQAGESVPVD  1047
             K+G  +LV  G  +P+D
Sbjct  140   KIGDKVLVSKGNQLPID  156



>ref|WP_034564885.1| ATPase, partial [Carnobacterium gallinarum]
Length=223

 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 36/126 (29%), Positives = 67/126 (53%), Gaps = 10/126 (8%)
 Frame = +1

Query  673   VIAFPLVGVSASLDALMDVAGGK-INIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIA  849
             +++F + G   + + ++D    K +N+ +LM LA   +  +G  +EG LL+ +F+L+   
Sbjct  40    LLSFTIGGFKQAKEGIIDTYQNKHLNVDILMVLAAIGASIIGYWMEGALLIFIFSLSGSL  99

Query  850   EEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAG  1029
             EE+ T  S   +  L +  P+ AL +  N E+         Q+V ++ LK+G  + V  G
Sbjct  100   EEYATNKSTEAISSLMQMQPETALRILENGET---------QEVSLTSLKIGDILFVPKG  150

Query  1030  ESVPVD  1047
              S+P+D
Sbjct  151   ASIPID  156



>ref|WP_035508554.1| MULTISPECIES: ATPase [Halobacillus]
 emb|CDQ27541.1| Zinc-transporting ATPase [Halobacillus trueperi]
 emb|CDQ20468.1| Zinc-transporting ATPase [Halobacillus dabanensis]
 emb|CDQ24063.1| Zinc-transporting ATPase [Halobacillus karajensis]
Length=639

 Score = 60.8 bits (146),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 69/136 (51%), Gaps = 11/136 (8%)
 Frame = +1

Query  652   PLQRAFAVIAFPLVGVSASLDALMDVAGGK-INIHVLMALAGFASVFMGNSLEGGLLLAM  828
             PL  +  V AF + G + + + L +    K +N+ +LM LA   S  +G   EG +L+ +
Sbjct  53    PLYVSLFVSAFLVGGFAKAKEGLEETLKEKSLNVELLMILAAIGSASIGYWTEGAILIFI  112

Query  829   FNLAHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGS  1008
             F+L+   E +    S  ++  L    P+ ALL+          +D+ Y+ VPV  L +G+
Sbjct  113   FSLSGALETYTMNKSHKEISSLMNMQPEEALLI----------TDVGYEWVPVKKLHIGN  162

Query  1009  FILVQAGESVPVDCEV  1056
              IL++ GE VP D  +
Sbjct  163   RILIKPGERVPADGTI  178



>ref|WP_024336013.1| hypothetical protein [Desulfotignum balticum]
Length=619

 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/140 (28%), Positives = 75/140 (54%), Gaps = 13/140 (9%)
 Frame = +1

Query  628   VLPKPAVKPLQRAFAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLE  807
             VLP+ ++  L   F V++  + G+   ++A+  VAG ++N+  L+++A  A V  GN LE
Sbjct  43    VLPEISLTNL---FLVVSILINGLPIVMEAIRGVAGKRVNVDELVSIAVVACVLTGNFLE  99

Query  808   GGLLLAMFNLAHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPV  987
               ++ A+     + EE  +  ++  +++L E  PD A++     E          + VPV
Sbjct  100   AAVVSAIMKAGAMVEEAVSDSARHAIRKLVELTPDTAVVRRRGQE----------ETVPV  149

Query  988   SDLKVGSFILVQAGESVPVD  1047
             S ++ G  ++V+ G+ +PVD
Sbjct  150   SGIRSGDLLVVRQGQVIPVD  169



>ref|WP_042957256.1| metal ABC transporter ATPase [Enterococcus faecium]
Length=643

 Score = 60.8 bits (146),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 55/105 (52%), Gaps = 9/105 (9%)
 Frame = +1

Query  745   NIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTRCSKVDVKELKENHPDFALL  924
             N H+LM LA   +  MGN  EG LL+ +F+ AH  E++    SK ++ +L E +P  A L
Sbjct  91    NSHILMGLAAIGASLMGNFWEGTLLILIFSGAHFLEDYAEGRSKREITKLLEMNPTTARL  150

Query  925   LDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVDCEVF  1059
             +           D   + V VS+LKVG  + V  G+ VP+D  + 
Sbjct  151   I---------LPDGSTKNVDVSELKVGDQLQVLNGDQVPIDGVIL  186



>ref|WP_002320192.1| metal ABC transporter ATPase [Enterococcus faecium]
 gb|EFF61531.1| cadmium-exporting ATPase [Enterococcus faecium PC4.1]
 gb|ELB16815.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0025]
Length=643

 Score = 60.8 bits (146),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 55/105 (52%), Gaps = 9/105 (9%)
 Frame = +1

Query  745   NIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTRCSKVDVKELKENHPDFALL  924
             N H+LM LA   +  MGN  EG LL+ +F+ AH  E++    SK ++ +L E +P  A L
Sbjct  91    NSHILMGLAAIGASLMGNFWEGTLLILIFSGAHFLEDYAEGRSKREITKLLEMNPTTARL  150

Query  925   LDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVDCEVF  1059
             +           D   + V VS+LKVG  + V  G+ VP+D  + 
Sbjct  151   I---------LPDGSTKNVDVSELKVGDQLQVLNGDQVPIDGVIL  186



>ref|WP_027109173.1| metal ABC transporter ATPase [Lacticigenium naphtae]
Length=647

 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 55/105 (52%), Gaps = 9/105 (9%)
 Frame = +1

Query  745   NIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTRCSKVDVKELKENHPDFALL  924
             N H+LM LA   +  MGN  EG LL+ +F+ AH  E++    SK ++ +L E +P  A L
Sbjct  89    NSHILMGLAAIGASLMGNFWEGTLLILIFSGAHFLEDYAEGRSKREITKLLEMNPTTARL  148

Query  925   LDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVDCEVF  1059
             +           D   + V VS+LKVG  + V  G+ VP+D  + 
Sbjct  149   I---------LPDGSTKNVDVSELKVGDQLQVLNGDQVPIDGVIL  184



>ref|WP_035019975.1| metal ABC transporter ATPase [Carnobacterium sp. WN1374]
Length=643

 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 55/105 (52%), Gaps = 9/105 (9%)
 Frame = +1

Query  745   NIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTRCSKVDVKELKENHPDFALL  924
             N H+LM LA   +  MGN  EG LL+ +F+ AH  E++    SK ++ +L E +P  A L
Sbjct  91    NSHILMGLAAIGASLMGNFWEGTLLILIFSGAHFLEDYAEGRSKREITKLLEMNPTTARL  150

Query  925   LDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVDCEVF  1059
             +           D   + V VS+LKVG  + V  G+ VP+D  + 
Sbjct  151   I---------LPDGSTKNVDVSELKVGDQLQVLNGDQVPIDGVIL  186



>ref|WP_002340522.1| heavy metal translocating P-type ATPase [Enterococcus faecium]
 gb|ELB28148.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0036]
 gb|EOG22840.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0180]
Length=643

 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 55/105 (52%), Gaps = 9/105 (9%)
 Frame = +1

Query  745   NIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTRCSKVDVKELKENHPDFALL  924
             N H+LM LA   +  MGN  EG LL+ +F+ AH  E++    SK ++ +L E +P  A L
Sbjct  91    NSHILMGLAAIGASLMGNFWEGTLLILIFSGAHFLEDYAEGRSKREITKLLEMNPTTARL  150

Query  925   LDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVDCEVF  1059
             +           D   + V VS+LKVG  + V  G+ VP+D  + 
Sbjct  151   I---------LPDGSTKNVDVSELKVGDQLQVLNGDQVPIDGVIL  186



>ref|WP_034536052.1| metal ABC transporter ATPase [Carnobacterium inhibens]
Length=641

 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 55/105 (52%), Gaps = 9/105 (9%)
 Frame = +1

Query  745   NIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTRCSKVDVKELKENHPDFALL  924
             N H+LM LA   +  MGN  EG LL+ +F+ AH  E++    SK ++ +L E +P  A L
Sbjct  89    NSHILMGLAAIGASLMGNFWEGTLLILIFSGAHFLEDYAEGRSKREITKLLEMNPTTARL  148

Query  925   LDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVDCEVF  1059
             +           D   + V VS+LKVG  + V  G+ VP+D  + 
Sbjct  149   I---------LPDGSTKNVDVSELKVGDQLQVLNGDQVPIDGVIL  184



>ref|WP_016629416.1| cadmium-exporting ATPase [Enterococcus faecium]
 gb|EPI17981.1| cadmium-exporting ATPase [Enterococcus faecium SD1C-2]
Length=641

 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 54/101 (53%), Gaps = 9/101 (9%)
 Frame = +1

Query  745   NIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTRCSKVDVKELKENHPDFALL  924
             N H+LM LA   +  MGN  EG LL+ +F+ AH  E++    SK ++ +L E +P  A L
Sbjct  89    NSHILMGLAAIGASLMGNFWEGTLLILIFSGAHFLEDYAEGRSKREITKLLEMNPTTARL  148

Query  925   LDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVD  1047
             +           D   + V VS+LKVG  + V  G+ VP+D
Sbjct  149   I---------LPDGSTKNVDVSELKVGDQLQVLNGDQVPID  180



>ref|WP_002342449.1| heavy metal translocating P-type ATPase [Enterococcus faecium]
 gb|ELB33382.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0033]
Length=641

 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 55/105 (52%), Gaps = 9/105 (9%)
 Frame = +1

Query  745   NIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTRCSKVDVKELKENHPDFALL  924
             N H+LM LA   +  MGN  EG LL+ +F+ AH  E++    SK ++ +L E +P  A L
Sbjct  89    NSHILMGLAAIGASLMGNFWEGTLLILIFSGAHFLEDYAEGRSKREITKLLEMNPTTARL  148

Query  925   LDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVDCEVF  1059
             +           D   + V VS+LKVG  + V  G+ VP+D  + 
Sbjct  149   I---------LPDGSTKNVDVSELKVGDQLQVLNGDQVPIDGVIL  184



>gb|EJY50509.1| cadmium-exporting ATPase [Enterococcus faecium 506]
 gb|EPI22604.1| cadmium-exporting ATPase [Enterococcus faecium OC2A-1]
Length=664

 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 54/101 (53%), Gaps = 9/101 (9%)
 Frame = +1

Query  745   NIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTRCSKVDVKELKENHPDFALL  924
             N H+LM LA   +  MGN  EG LL+ +F+ AH  E++    SK ++ +L E +P  A L
Sbjct  112   NSHILMGLAAIGASLMGNFWEGTLLILIFSGAHFLEDYAEGRSKREITKLLEMNPTTARL  171

Query  925   LDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVD  1047
             +           D   + V VS+LKVG  + V  G+ VP+D
Sbjct  172   I---------LPDGSTKNVDVSELKVGDQLQVLNGDQVPID  203



>gb|EJX69301.1| cadmium-exporting ATPase [Enterococcus faecium P1190]
 gb|EJX76889.1| cadmium-exporting ATPase [Enterococcus faecium P1139]
 gb|EJX85948.1| cadmium-exporting ATPase [Enterococcus faecium P1123]
 gb|EJY51834.1| cadmium-exporting ATPase [Enterococcus faecium 503]
Length=664

 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 54/101 (53%), Gaps = 9/101 (9%)
 Frame = +1

Query  745   NIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTRCSKVDVKELKENHPDFALL  924
             N H+LM LA   +  MGN  EG LL+ +F+ AH  E++    SK ++ +L E +P  A L
Sbjct  112   NSHILMGLAAIGASLMGNFWEGTLLILIFSGAHFLEDYAEGRSKREITKLLEMNPTTARL  171

Query  925   LDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVD  1047
             +           D   + V VS+LKVG  + V  G+ VP+D
Sbjct  172   I---------LPDGSTKNVDVSELKVGDQLQVLNGDQVPID  203



>ref|WP_002333371.1| heavy metal translocating P-type ATPase [Enterococcus faecium]
 gb|ELA88410.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0009]
 gb|ELB22869.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0039]
 gb|ELB49192.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0038]
 gb|ELB58557.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0052]
 gb|KEI51779.1| metal ABC transporter ATPase [Enterococcus faecium UC8733]
Length=641

 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 54/101 (53%), Gaps = 9/101 (9%)
 Frame = +1

Query  745   NIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTRCSKVDVKELKENHPDFALL  924
             N H+LM LA   +  MGN  EG LL+ +F+ AH  E++    SK ++ +L E +P  A L
Sbjct  89    NSHILMGLAAIGASLMGNFWEGTLLILIFSGAHFLEDYAEGRSKREITKLLEMNPTTARL  148

Query  925   LDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVD  1047
             +           D   + V VS+LKVG  + V  G+ VP+D
Sbjct  149   I---------LPDGSTKNVDVSELKVGDQLQVLNGDQVPID  180



>ref|WP_007209263.1| metal ABC transporter ATPase [Enterococcus italicus]
 gb|EFU72951.1| cadmium-exporting ATPase [Enterococcus italicus DSM 15952]
Length=641

 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 55/105 (52%), Gaps = 9/105 (9%)
 Frame = +1

Query  745   NIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTRCSKVDVKELKENHPDFALL  924
             N H+LM LA   +  MGN  EG LL+ +F+ AH  E++    SK ++ +L E +P  A L
Sbjct  89    NSHILMGLAAIGASLMGNFWEGTLLILIFSGAHFLEDYAEGRSKREITKLLEMNPTTARL  148

Query  925   LDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVDCEVF  1059
             +           D   + V VS+LKVG  + V  G+ VP+D  + 
Sbjct  149   I---------LPDGSTKNVDVSELKVGDQLQVLNGDQVPIDGVIL  184



>ref|WP_003680028.1| metal ABC transporter ATPase [Lactobacillus coryniformis]
 gb|EJN55111.1| Putative cadmium-exporting ATPase [Lactobacillus coryniformis 
subsp. coryniformis CECT 5711]
Length=639

 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 55/105 (52%), Gaps = 9/105 (9%)
 Frame = +1

Query  745   NIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTRCSKVDVKELKENHPDFALL  924
             N H+LM LA   +  MGN  EG LL+ +F+ AH  E++    SK ++ +L E +P  A L
Sbjct  87    NSHILMGLAAIGASLMGNFWEGTLLILIFSGAHFLEDYAEGRSKREITKLLEMNPTTARL  146

Query  925   LDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVDCEVF  1059
             +           D   + V VS+LKVG  + V  G+ VP+D  + 
Sbjct  147   I---------LPDGSTKNVDVSELKVGDQLQVLNGDQVPIDGVIL  182



>ref|WP_042350547.1| ATPase [Bacillus sp. G2(2012b)]
Length=631

 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 91/174 (52%), Gaps = 14/174 (8%)
 Frame = +1

Query  544   HLANFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRAFAVIAFPLVGVSASLDALM  723
             ++ N L EH+EL  +  +  +  +   ++L K   +       ++AF + G + + + + 
Sbjct  5     NIWNKLHEHIELIAALVSGVLILS--GWLLSKNNFETTSIVTYLLAFIIGGYAKAKEGIT  62

Query  724   D-VAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTRCSKVDVKELKE  900
             + +   K+N+ +LM LA   S  +G   EG +L+ +F+L+  A E +T         + +
Sbjct  63    ETIEDKKLNVEILMILAAVGSAIIGYWTEGAILIFIFSLSG-ALETYT---------MNK  112

Query  901   NHPDFALLLDVNNESSPSFSDLRYQK-VPVSDLKVGSFILVQAGESVPVDCEVF  1059
             +H + + L+D+  E +   + L  ++ + VSDLK+G  IL++AGE VP D  + 
Sbjct  113   SHKEISALMDLQPEEAMLINHLGEERIIAVSDLKIGDHILIKAGERVPSDGMII  166



>ref|WP_025868775.1| ATPase [Enterococcus sp. TR]
Length=637

 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/142 (30%), Positives = 73/142 (51%), Gaps = 11/142 (8%)
 Frame = +1

Query  625   YVLPKPAVKPLQRAFAVIAFPLVGVSASLDALMDVAGGK-INIHVLMALAGFASVFMGNS  801
             ++L K  V     +F ++A    G   + + L+D    K +N+ +LMALA   +  +GN 
Sbjct  24    FILEKTGVFFYPISF-ILAILFGGFKQTKEGLLDTFENKHLNVDLLMALAAIGACIIGNW  82

Query  802   LEGGLLLAMFNLAHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKV  981
              EG +L  +F L+   EE+ T  SK ++  L    P+ A LLD   +++         +V
Sbjct  83    FEGAMLTFIFCLSGALEEYTTNKSKKEISSLMNLQPETAFLLDELGKTT---------EV  133

Query  982   PVSDLKVGSFILVQAGESVPVD  1047
              V++L++G  +LV  G  +P+D
Sbjct  134   AVTELQIGDNLLVPKGARIPID  155



>ref|WP_002330461.1| heavy metal translocating P-type ATPase [Enterococcus faecium]
 gb|ELA71530.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0017]
Length=645

 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 54/101 (53%), Gaps = 9/101 (9%)
 Frame = +1

Query  745   NIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTRCSKVDVKELKENHPDFALL  924
             N H+LM LA   +  MGN  EG LL+ +F+ AH  E++    SK ++ +L E +P  A L
Sbjct  87    NSHILMGLAAIGASLMGNFWEGTLLILIFSGAHFLEDYAEGRSKREITKLLEMNPTTARL  146

Query  925   LDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVD  1047
             +           D   + V VS+LKVG  + V  G+ VP+D
Sbjct  147   IQ---------PDGSTKNVDVSELKVGDQLQVLNGDQVPID  178



>ref|WP_002316687.1| MULTISPECIES: metal ABC transporter ATPase [Lactobacillales]
 gb|AAS18264.1| P-type ATPase cation exporter [Enterococcus faecium]
 gb|EEI61759.1| cadmium-exporting ATPase [Enterococcus faecium TX1330]
 gb|ELB31491.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0042]
 gb|EOK14221.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0371]
 gb|EOM44181.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0174]
 gb|EPI16242.1| cadmium-exporting ATPase [Enterococcus faecium SD2A-2]
Length=645

 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 54/101 (53%), Gaps = 9/101 (9%)
 Frame = +1

Query  745   NIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTRCSKVDVKELKENHPDFALL  924
             N H+LM LA   +  MGN  EG LL+ +F+ AH  E++    SK ++ +L E +P  A L
Sbjct  87    NSHILMGLAAIGASLMGNFWEGTLLILIFSGAHFLEDYAEGRSKREITKLLEMNPTTARL  146

Query  925   LDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVD  1047
             +           D   + V VS+LKVG  + V  G+ VP+D
Sbjct  147   IQ---------PDGSTKNVDVSELKVGDQLQVLNGDQVPID  178



>ref|WP_044981713.1| zinc ABC transporter ATPase [Treponema denticola]
Length=643

 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/130 (27%), Positives = 70/130 (54%), Gaps = 10/130 (8%)
 Frame = +1

Query  673   VIAFPLVGVSASLDALMDVAGGKI-NIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIA  849
             VIA+ + G    L ++ ++  G++ + + LM++A   +  +G+  EG  ++  +NL  + 
Sbjct  42    VIAWLIAGYKVLLTSVKNILKGQVFDENFLMSVATIGAFILGDWTEGAAVMLFYNLGEVV  101

Query  850   EEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAG  1029
             +      S+  + +L +  PDFA L D         SD + + V  + +K+GS +LV+AG
Sbjct  102   QHSAVEKSRRSIIDLMDLRPDFARLYD---------SDSKEKLVDPASVKIGSLVLVKAG  152

Query  1030  ESVPVDCEVF  1059
             E +P+D  ++
Sbjct  153   EKIPLDGVIY  162



>ref|WP_044981792.1| zinc ABC transporter ATPase [Treponema denticola]
Length=643

 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/130 (27%), Positives = 70/130 (54%), Gaps = 10/130 (8%)
 Frame = +1

Query  673   VIAFPLVGVSASLDALMDVAGGKI-NIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIA  849
             VIA+ + G    L ++ ++  G++ + + LM++A   +  +G+  EG  ++  +NL  + 
Sbjct  42    VIAWLIAGYKVLLTSVKNILKGQVFDENFLMSVATIGAFILGDWTEGAAVMLFYNLGEVV  101

Query  850   EEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAG  1029
             +      S+  + +L +  PDFA L D         SD + + V  + +K+GS +LV+AG
Sbjct  102   QHSAVEKSRRSIIDLMDLRPDFARLYD---------SDSKEKLVDPASVKIGSLVLVKAG  152

Query  1030  ESVPVDCEVF  1059
             E +P+D  ++
Sbjct  153   EKIPLDGVIY  162



>ref|WP_038125441.1| zinc ABC transporter ATPase [Treponema denticola]
Length=643

 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/130 (27%), Positives = 70/130 (54%), Gaps = 10/130 (8%)
 Frame = +1

Query  673   VIAFPLVGVSASLDALMDVAGGKI-NIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIA  849
             VIA+ + G    L ++ ++  G++ + + LM++A   +  +G+  EG  ++  +NL  + 
Sbjct  42    VIAWLIAGYKVLLTSVKNILKGQVFDENFLMSVATIGAFILGDWTEGAAVMLFYNLGEVV  101

Query  850   EEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAG  1029
             +      S+  + +L +  PDFA L D         SD + + V  + +K+GS +LV+AG
Sbjct  102   QHSAVEKSRRSIIDLMDLRPDFARLYD---------SDSKEKLVDPASVKIGSLVLVKAG  152

Query  1030  ESVPVDCEVF  1059
             E +P+D  ++
Sbjct  153   EKIPLDGVIY  162



>ref|WP_010956962.1| zinc ABC transporter ATPase [Treponema denticola]
 ref|NP_971990.1| cadmium-translocating P-type ATPase [Treponema denticola ATCC 
35405]
 gb|AAS11901.1| cadmium-translocating P-type ATPase [Treponema denticola ATCC 
35405]
Length=643

 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/130 (27%), Positives = 70/130 (54%), Gaps = 10/130 (8%)
 Frame = +1

Query  673   VIAFPLVGVSASLDALMDVAGGKI-NIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIA  849
             VIA+ + G    L ++ ++  G++ + + LM++A   +  +G+  EG  ++  +NL  + 
Sbjct  42    VIAWLIAGYKVLLTSVKNILKGQVFDENFLMSVATIGAFILGDWTEGAAVMLFYNLGEVV  101

Query  850   EEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAG  1029
             +      S+  + +L +  PDFA L D         SD + + V  + +K+GS +LV+AG
Sbjct  102   QHSAVEKSRRSIIDLMDLRPDFARLYD---------SDSKEKLVDPASVKIGSLVLVKAG  152

Query  1030  ESVPVDCEVF  1059
             E +P+D  ++
Sbjct  153   EKIPLDGVIY  162



>ref|WP_036086878.1| metal ABC transporter ATPase [Leuconostoc pseudomesenteroides]
 gb|KDA47129.1| Lead, cadmium, zinc and mercury transporting ATPase/Copper-translocating 
P-type ATPase [Leuconostoc pseudomesenteroides 1159]
Length=645

 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 54/101 (53%), Gaps = 9/101 (9%)
 Frame = +1

Query  745   NIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTRCSKVDVKELKENHPDFALL  924
             N H+LM LA   +  MGN  EG LL+ +F+ AH  E++    SK ++ +L E +P  A L
Sbjct  87    NSHILMGLAAIGASLMGNFWEGTLLILIFSGAHFLEDYAEGRSKREITKLLEMNPTTARL  146

Query  925   LDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVD  1047
             +           D   + V VS+LKVG  + V  G+ VP+D
Sbjct  147   IQ---------PDGSTKNVDVSELKVGDQLQVLNGDQVPID  178



>ref|WP_044956710.1| zinc ABC transporter ATPase [Treponema denticola]
Length=643

 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/130 (27%), Positives = 70/130 (54%), Gaps = 10/130 (8%)
 Frame = +1

Query  673   VIAFPLVGVSASLDALMDVAGGKI-NIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIA  849
             VIA+ + G    L ++ ++  G++ + + LM++A   +  +G+  EG  ++  +NL  + 
Sbjct  42    VIAWLIAGYKVLLTSVKNILKGQVFDENFLMSVATIGAFILGDWTEGAAVMLFYNLGEVV  101

Query  850   EEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAG  1029
             +      S+  + +L +  PDFA L D         SD + + V  + +K+GS +LV+AG
Sbjct  102   QHSAVEKSRRSIIDLMDLRPDFARLYD---------SDSKEKLVDPASVKIGSLVLVKAG  152

Query  1030  ESVPVDCEVF  1059
             E +P+D  ++
Sbjct  153   EKIPLDGVIY  162



>ref|WP_044909868.1| zinc ABC transporter ATPase [Treponema denticola]
Length=643

 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/130 (27%), Positives = 70/130 (54%), Gaps = 10/130 (8%)
 Frame = +1

Query  673   VIAFPLVGVSASLDALMDVAGGKI-NIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIA  849
             VIA+ + G    L ++ ++  G++ + + LM++A   +  +G+  EG  ++  +NL  + 
Sbjct  42    VIAWLIAGYKVLLTSVKNILKGQVFDENFLMSVATIGAFILGDWTEGAAVMLFYNLGEVV  101

Query  850   EEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAG  1029
             +      S+  + +L +  PDFA L D         SD + + V  + +K+GS +LV+AG
Sbjct  102   QHSAVEKSRRSIIDLMDLRPDFARLYD---------SDSKEKLVDPASVKIGSLVLVKAG  152

Query  1030  ESVPVDCEVF  1059
             E +P+D  ++
Sbjct  153   EKIPLDGVIY  162



>ref|WP_041101592.1| ATPase [Bacillus badius]
 gb|KIL72230.1| Lead, cadmium, zinc and mercury transporting ATPase [Bacillus 
badius]
 gb|KIL76994.1| Lead, cadmium, zinc and mercury transporting ATPase [Bacillus 
badius]
Length=638

 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 74/146 (51%), Gaps = 11/146 (8%)
 Frame = +1

Query  625   YVLPKPAVKPLQRAFAVIAFPLVGVSASLDALMD-VAGGKINIHVLMALAGFASVFMGNS  801
             ++L K ++     A  ++AF + G + + + + + +A  ++N+ +LM  A   S  +G  
Sbjct  42    WLLDKNSIHSAAVASYLLAFIIGGFAKAKEGIEETIADKELNVEMLMIFAAVGSAIIGYW  101

Query  802   LEGGLLLAMFNLAHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKV  981
              EG +L+ +F L+   E +    S+ ++  L E  P+ A L+           D   +KV
Sbjct  102   TEGAILIFIFALSGALETYTMNKSQKEISSLMEIQPEEAWLI----------RDGAEEKV  151

Query  982   PVSDLKVGSFILVQAGESVPVDCEVF  1059
              VS+L VG  ILV+ GE +P D  +F
Sbjct  152   HVSELAVGDLILVKPGERIPADGVIF  177



>ref|WP_025516432.1| ATPase P [Bordetella trematum]
Length=796

 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 64/130 (49%), Gaps = 9/130 (7%)
 Frame = +1

Query  667   FAVIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHI  846
             FA+ A    G+       + V  G +NI+ LM++A   +VF+G   E  +++A+FN+A +
Sbjct  207   FALGAIAACGLGTYRKGWIAVRNGNLNINALMSIAVTGAVFIGQWPEAAMVMALFNVAEL  266

Query  847   AEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQA  1026
              E      ++  V+ L +  P  AL  D N E         + +VP + L+VG  + V+ 
Sbjct  267   IEARALDRARNAVRGLMDLAPQTALRQDANGE---------WIEVPAAQLRVGDSVRVRP  317

Query  1027  GESVPVDCEV  1056
             GE +  D  +
Sbjct  318   GERIAADGAI  327



>ref|WP_038133943.1| zinc ABC transporter ATPase [Treponema denticola]
Length=643

 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/130 (27%), Positives = 70/130 (54%), Gaps = 10/130 (8%)
 Frame = +1

Query  673   VIAFPLVGVSASLDALMDVAGGKI-NIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIA  849
             VIA+ + G    L ++ ++  G++ + + LM++A   +  +G+  EG  ++  +NL  + 
Sbjct  42    VIAWLIAGYKVLLTSVKNILKGQVFDENFLMSVATIGAFILGDWTEGAAVMLFYNLGEVV  101

Query  850   EEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAG  1029
             +      S+  + +L +  PDFA L D         SD + + V  + +K+GS +LV+AG
Sbjct  102   QHSAVEKSRRSIIDLMDLRPDFARLYD---------SDSKEKLVDPASVKIGSLVLVKAG  152

Query  1030  ESVPVDCEVF  1059
             E +P+D  ++
Sbjct  153   EKIPLDGVIY  162



>ref|WP_002668757.1| zinc ABC transporter ATPase [Treponema denticola]
 gb|EGC77130.1| cadmium-translocating P-type ATPase [Treponema denticola F0402]
Length=643

 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/130 (27%), Positives = 70/130 (54%), Gaps = 10/130 (8%)
 Frame = +1

Query  673   VIAFPLVGVSASLDALMDVAGGKI-NIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIA  849
             VIA+ + G    L ++ ++  G++ + + LM++A   +  +G+  EG  ++  +NL  + 
Sbjct  42    VIAWLIAGYKVLLTSVKNILKGQVFDENFLMSVATIGAFILGDWTEGAAVMLFYNLGEVV  101

Query  850   EEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAG  1029
             +      S+  + +L +  PDFA L D         SD + + V  + +K+GS +LV+AG
Sbjct  102   QHSAVEKSRRSIIDLMDLRPDFARLYD---------SDSKEKLVDPASVKIGSLVLVKAG  152

Query  1030  ESVPVDCEVF  1059
             E +P+D  ++
Sbjct  153   EKIPLDGVIY  162



>ref|WP_009498466.1| ATPase [Sporosarcina newyorkensis]
 gb|EGQ26156.1| P-ATPase superfamily P-type ATPase cadmium transporter [Sporosarcina 
newyorkensis 2681]
Length=634

 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 70/146 (48%), Gaps = 10/146 (7%)
 Frame = +1

Query  625   YVLPKPAVKPLQRAFAVIAFPLVGVSASLDALMDVAGGK-INIHVLMALAGFASVFMGNS  801
             ++L K   +       ++AF + G + + + + +    K +N+ +LM  A   S  +G  
Sbjct  35    WLLSKNGTEAFSITLYILAFLIGGYAKAKEGIEETIKNKELNVEMLMVFAAIGSGIIGYW  94

Query  802   LEGGLLLAMFNLAHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKV  981
              EG +L+ +F ++   E +    S  ++  L E  P+ A L+           D   QKV
Sbjct  95    AEGAILIFIFAISGALETYTLNKSHKEISSLMEMQPEEAWLIT---------EDGSEQKV  145

Query  982   PVSDLKVGSFILVQAGESVPVDCEVF  1059
             P + L +G+ +LV+ GE +PVD +V 
Sbjct  146   PTASLSLGAVLLVKPGERIPVDGQVL  171



>ref|WP_002694306.1| heavy metal translocating P-type ATPase, partial [Treponema denticola]
 gb|EMD56539.1| heavy metal translocating P-type ATPase, partial [Treponema denticola 
US-Trep]
Length=707

 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/130 (27%), Positives = 70/130 (54%), Gaps = 10/130 (8%)
 Frame = +1

Query  673   VIAFPLVGVSASLDALMDVAGGKI-NIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIA  849
             VIA+ + G    L ++ ++  G++ + + LM++A   +  +G+  EG  ++  +NL  + 
Sbjct  106   VIAWLIAGYKVLLTSVKNILKGQVFDENFLMSVATIGAFILGDWTEGAAVMLFYNLGEVV  165

Query  850   EEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAG  1029
             +      S+  + +L +  PDFA L D         SD + + V  + +K+GS +LV+AG
Sbjct  166   QHSAVEKSRRSIIDLMDLRPDFARLYD---------SDSKEKLVDPASVKIGSLVLVKAG  216

Query  1030  ESVPVDCEVF  1059
             E +P+D  ++
Sbjct  217   EKIPLDGVIY  226



>ref|WP_044979779.1| zinc ABC transporter ATPase [Treponema putidum]
 gb|AIN94318.1| zinc ABC transporter ATPase [Treponema putidum]
Length=643

 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/130 (27%), Positives = 70/130 (54%), Gaps = 10/130 (8%)
 Frame = +1

Query  673   VIAFPLVGVSASLDALMDVAGGKI-NIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIA  849
             VIA+ + G    L ++ ++  G++ + + LM++A   +  +G+  EG  ++  +NL  + 
Sbjct  42    VIAWLVAGYKVLLTSVKNILKGRVFDENFLMSVATIGAFILGDWTEGAAVMLFYNLGEVV  101

Query  850   EEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAG  1029
             +      S+  + +L +  PDFA L D         SD + + V  + +K+GS +LV+AG
Sbjct  102   QHSAVEKSRRSIIDLMDLRPDFARLYD---------SDSKEKLVDPASVKIGSLVLVKAG  152

Query  1030  ESVPVDCEVF  1059
             E +P+D  ++
Sbjct  153   EKIPLDGIIY  162



>ref|WP_002677948.1| heavy metal translocating P-type ATPase, partial [Treponema denticola]
 gb|EMB43176.1| heavy metal translocating P-type ATPase, partial [Treponema denticola 
ASLM]
Length=725

 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/130 (27%), Positives = 70/130 (54%), Gaps = 10/130 (8%)
 Frame = +1

Query  673   VIAFPLVGVSASLDALMDVAGGKI-NIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIA  849
             VIA+ + G    L ++ ++  G++ + + LM++A   +  +G+  EG  ++  +NL  + 
Sbjct  124   VIAWLIAGYKVLLTSVKNILKGQVFDENFLMSVATIGAFILGDWTEGAAVMLFYNLGEVV  183

Query  850   EEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAG  1029
             +      S+  + +L +  PDFA L D         SD + + V  + +K+GS +LV+AG
Sbjct  184   QHSAVEKSRRSIIDLMDLRPDFARLYD---------SDSKEKLVDPASVKIGSLVLVKAG  234

Query  1030  ESVPVDCEVF  1059
             E +P+D  ++
Sbjct  235   EKIPLDGVIY  244



>ref|WP_034679548.1| ATPase [Bacillus megaterium]
Length=627

 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 65/129 (50%), Gaps = 11/129 (9%)
 Frame = +1

Query  673   VIAFPLVGVSASLDALMDVAGGK-INIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIA  849
             +IAF + G + + + + +    K +N+ +LM LA   S  +G   EG +L+ +F L+   
Sbjct  50    LIAFTIGGYAKAKEGITETLHNKELNVEMLMILAAIGSAAIGYWTEGAVLIFIFALSGAL  109

Query  850   EEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAG  1029
             E +    S  ++  L E  P+ ALL+           D R + VPVS L V   I V+AG
Sbjct  110   ETYTMNKSHKEIASLMELQPEEALLI----------KDDRREVVPVSSLHVDDLIYVRAG  159

Query  1030  ESVPVDCEV  1056
             E +PVD  +
Sbjct  160   ERIPVDGTI  168



>ref|WP_037562329.1| ATPase [Sporosarcina ureae]
Length=622

 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/146 (27%), Positives = 68/146 (47%), Gaps = 10/146 (7%)
 Frame = +1

Query  625   YVLPKPAVKPLQRAFAVIAFPLVGVSASLDALMDVAGGK-INIHVLMALAGFASVFMGNS  801
             ++L K   +       +IAF + G + + + + +    K +N+ +LM  A   S  +G  
Sbjct  23    WILGKNGTESFSITLYIIAFLIGGYAKAKEGIEETIKNKELNVEMLMIFAAIGSGIIGYW  82

Query  802   LEGGLLLAMFNLAHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKV  981
              EG +L+ +F ++   E +    S  ++  L E  P+ A LL           D   +KV
Sbjct  83    AEGAILIFIFAISGALETYTLNKSHNEISSLMELQPEEAWLL---------LEDGSEKKV  133

Query  982   PVSDLKVGSFILVQAGESVPVDCEVF  1059
                 L +GS +LV+ GE +PVD E+ 
Sbjct  134   STDSLSIGSILLVKPGERIPVDGEIL  159



>gb|EKU93181.1| heavy metal translocating P-type ATPase [Alloiococcus otitis 
ATCC 51267]
Length=641

 Score = 59.7 bits (143),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 54/103 (52%), Gaps = 9/103 (9%)
 Frame = +1

Query  739   KINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTRCSKVDVKELKENHPDFA  918
             K N H+LM LAG  ++ +G  LE  LL+ +F  AH  E++    SK ++ +L E  P  A
Sbjct  80    KPNSHILMGLAGLGAILLGEELEAALLILIFAGAHFLEDYAEGKSKKEISKLVELTPKLA  139

Query  919   LLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVD  1047
               LD   E      DL    VPV  ++V   + VQ G+ VP+D
Sbjct  140   RRLDGLGE-----IDL----VPVDQVQVKDLVQVQKGDQVPLD  173



>ref|WP_040292691.1| metal ABC transporter ATPase [Alloiococcus otitis]
Length=646

 Score = 59.3 bits (142),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 54/103 (52%), Gaps = 9/103 (9%)
 Frame = +1

Query  739   KINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTRCSKVDVKELKENHPDFA  918
             K N H+LM LAG  ++ +G  LE  LL+ +F  AH  E++    SK ++ +L E  P  A
Sbjct  85    KPNSHILMGLAGLGAILLGEELEAALLILIFAGAHFLEDYAEGKSKKEISKLVELTPKLA  144

Query  919   LLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVD  1047
               LD   E      DL    VPV  ++V   + VQ G+ VP+D
Sbjct  145   RRLDGLGE-----IDL----VPVDQVQVKDLVQVQKGDQVPLD  178



>ref|WP_002671414.1| heavy metal translocating P-type ATPase [Treponema denticola]
 gb|EMB46223.1| heavy metal translocating P-type ATPase [Treponema denticola 
AL-2]
Length=800

 Score = 59.7 bits (143),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/130 (27%), Positives = 70/130 (54%), Gaps = 10/130 (8%)
 Frame = +1

Query  673   VIAFPLVGVSASLDALMDVAGGKI-NIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIA  849
             VIA+ + G    L ++ ++  G++ + + LM++A   +  +G+  EG  ++  +NL  + 
Sbjct  199   VIAWLIAGYKVLLTSVKNILKGQVFDENFLMSVATIGAFILGDWTEGAAVMLFYNLGEVV  258

Query  850   EEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAG  1029
             +      S+  + +L +  PDFA L D         SD + + V  + +K+GS +LV+AG
Sbjct  259   QHSAVEKSRRSIIDLMDLRPDFARLYD---------SDSKEKLVDPASVKIGSLVLVKAG  309

Query  1030  ESVPVDCEVF  1059
             E +P+D  ++
Sbjct  310   EKIPLDGVIY  319



>gb|EMB39506.1| heavy metal translocating P-type ATPase [Treponema denticola 
ATCC 33520]
Length=791

 Score = 59.7 bits (143),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/130 (27%), Positives = 70/130 (54%), Gaps = 10/130 (8%)
 Frame = +1

Query  673   VIAFPLVGVSASLDALMDVAGGKI-NIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIA  849
             VIA+ + G    L ++ ++  G++ + + LM++A   +  +G+  EG  ++  +NL  + 
Sbjct  190   VIAWLIAGYKVLLTSVKNILKGQVFDENFLMSVATIGAFILGDWTEGAAVMLFYNLGEVV  249

Query  850   EEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAG  1029
             +      S+  + +L +  PDFA L D         SD + + V  + +K+GS +LV+AG
Sbjct  250   QHSAVEKSRRSIIDLMDLRPDFARLYD---------SDSKEKLVDPASVKIGSLVLVKAG  300

Query  1030  ESVPVDCEVF  1059
             E +P+D  ++
Sbjct  301   EKIPLDGVIY  310



>ref|WP_002682710.1| heavy metal translocating P-type ATPase [Treponema denticola]
 gb|EMB35980.1| heavy metal translocating P-type ATPase [Treponema denticola 
H-22]
Length=779

 Score = 59.7 bits (143),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/130 (27%), Positives = 70/130 (54%), Gaps = 10/130 (8%)
 Frame = +1

Query  673   VIAFPLVGVSASLDALMDVAGGKI-NIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIA  849
             VIA+ + G    L ++ ++  G++ + + LM++A   +  +G+  EG  ++  +NL  + 
Sbjct  178   VIAWLIAGYKVLLTSVKNILKGQVFDENFLMSVATIGAFILGDWTEGAAVMLFYNLGEVV  237

Query  850   EEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAG  1029
             +      S+  + +L +  PDFA L D         SD + + V  + +K+GS +LV+AG
Sbjct  238   QHSAVEKSRRSIIDLMDLRPDFARLYD---------SDSKEKLVDPASVKIGSLVLVKAG  288

Query  1030  ESVPVDCEVF  1059
             E +P+D  ++
Sbjct  289   EKIPLDGVIY  298



>ref|WP_002678967.1| heavy metal translocating P-type ATPase [Treponema denticola]
 gb|EMB37091.1| heavy metal translocating P-type ATPase [Treponema denticola 
ATCC 33521]
 gb|EMB41436.1| heavy metal translocating P-type ATPase [Treponema denticola 
ATCC 35404]
Length=780

 Score = 59.7 bits (143),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/130 (27%), Positives = 70/130 (54%), Gaps = 10/130 (8%)
 Frame = +1

Query  673   VIAFPLVGVSASLDALMDVAGGKI-NIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIA  849
             VIA+ + G    L ++ ++  G++ + + LM++A   +  +G+  EG  ++  +NL  + 
Sbjct  179   VIAWLIAGYKVLLTSVKNILKGQVFDENFLMSVATIGAFILGDWTEGAAVMLFYNLGEVV  238

Query  850   EEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAG  1029
             +      S+  + +L +  PDFA L D         SD + + V  + +K+GS +LV+AG
Sbjct  239   QHSAVEKSRRSIIDLMDLRPDFARLYD---------SDSKEKLVDPASVKIGSLVLVKAG  289

Query  1030  ESVPVDCEVF  1059
             E +P+D  ++
Sbjct  290   EKIPLDGVIY  299



>ref|WP_002693626.1| heavy metal translocating P-type ATPase [Treponema denticola]
 gb|EMB19764.1| heavy metal translocating P-type ATPase [Treponema denticola 
OTK]
Length=768

 Score = 59.3 bits (142),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/130 (27%), Positives = 70/130 (54%), Gaps = 10/130 (8%)
 Frame = +1

Query  673   VIAFPLVGVSASLDALMDVAGGKI-NIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIA  849
             VIA+ + G    L ++ ++  G++ + + LM++A   +  +G+  EG  ++  +NL  + 
Sbjct  167   VIAWLIAGYKVLLTSVKNILKGQVFDENFLMSVATIGAFILGDWTEGAAVMLFYNLGEVV  226

Query  850   EEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAG  1029
             +      S+  + +L +  PDFA L D         SD + + V  + +K+GS +LV+AG
Sbjct  227   QHSAVEKSRRSIIDLMDLRPDFARLYD---------SDSKEKLVDPASVKIGSLVLVKAG  277

Query  1030  ESVPVDCEVF  1059
             E +P+D  ++
Sbjct  278   EKIPLDGVIY  287



>gb|EMB28453.1| heavy metal translocating P-type ATPase [Treponema denticola 
MYR-T]
 gb|EMB29195.1| heavy metal translocating P-type ATPase [Treponema denticola 
H1-T]
Length=786

 Score = 59.3 bits (142),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/130 (27%), Positives = 70/130 (54%), Gaps = 10/130 (8%)
 Frame = +1

Query  673   VIAFPLVGVSASLDALMDVAGGKI-NIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIA  849
             VIA+ + G    L ++ ++  G++ + + LM++A   +  +G+  EG  ++  +NL  + 
Sbjct  185   VIAWLIAGYKVLLTSVKNILKGQVFDENFLMSVATIGAFILGDWTEGAAVMLFYNLGEVV  244

Query  850   EEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAG  1029
             +      S+  + +L +  PDFA L D         SD + + V  + +K+GS +LV+AG
Sbjct  245   QHSAVEKSRRSIIDLMDLRPDFARLYD---------SDSKEKLVDPASVKIGSLVLVKAG  295

Query  1030  ESVPVDCEVF  1059
             E +P+D  ++
Sbjct  296   EKIPLDGVIY  305



>dbj|BAL52802.1| heavy metal translocating P-type ATPase [uncultured prokaryote]
Length=800

 Score = 59.3 bits (142),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 62/129 (48%), Gaps = 10/129 (8%)
 Frame = +1

Query  673   VIAFPLVGVSASLDALMDVAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAE  852
             VIA+   G   +LD L  +   ++++++LM +A   +  +G   EGG LL +F+L++  +
Sbjct  200   VIAYLAGGYYGALDGLQTLRARQLDVNLLMIMAAIGAAVVGEMAEGGTLLFLFSLSNTLQ  259

Query  853   EHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGE  1032
                   S+  V+ L    PD A  L    E          Q VPV +L  G  +LV+ GE
Sbjct  260   SFALMRSRRAVRALMALQPDLATRLTDQGE----------QIVPVEELLPGERVLVRPGE  309

Query  1033  SVPVDCEVF  1059
              +P D  V 
Sbjct  310   RIPTDGIVL  318



>ref|WP_005980210.1| cadmium transporter [Fusobacterium ulcerans]
 gb|EFS26939.1| heavy metal translocating P-type ATPase [Fusobacterium ulcerans 
ATCC 49185]
Length=786

 Score = 59.3 bits (142),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/132 (27%), Positives = 70/132 (53%), Gaps = 10/132 (8%)
 Frame = +1

Query  655   LQRAFAVIAFPLVGVSASLDALMDVAGGK-INIHVLMALAGFASVFMGNSLEGGLLLAMF  831
             L+ A +++A+ ++G    L++  ++  G  ++ + LM +A F + ++G + E   ++  +
Sbjct  204   LKLAVSIVAYIILGGDVVLNSFKNITKGNFLDENFLMTIATFGAFYLGETTEAVGVMLFY  263

Query  832   NLAHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSF  1011
              +    +E   R S+  +++L +  PD+A + D N E           KV    LK+G  
Sbjct  264   KIGEYFQESAVRNSRKSIEKLLDIRPDYANIRDNNGE---------VIKVSPKKLKIGDI  314

Query  1012  ILVQAGESVPVD  1047
             I+V++GE VPVD
Sbjct  315   IIVKSGEKVPVD  326



>ref|WP_036197655.1| ATPase [Lysinibacillus sinduriensis]
 gb|KGR77787.1| ATPase [Lysinibacillus sinduriensis BLB-1 = JCM 15800]
Length=632

 Score = 59.3 bits (142),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 65/128 (51%), Gaps = 10/128 (8%)
 Frame = +1

Query  679   AFPLVGVSASLDALMDVAGGK-INIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEE  855
             AF + G + + + ++D    K +N+ VLM LA   SV +G   EG +L+ +F L+   E 
Sbjct  53    AFVIGGYAKAKEGILDTVQNKQLNVEVLMILAATGSVIIGYWTEGAILIFIFALSGALET  112

Query  856   HFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGES  1035
             +    S  ++  L +  P+ A L+         F  +   KV VS LKVG  +L++ GE 
Sbjct  113   YAMNKSHREISSLMDLQPEEAWLV------RGGFEPI---KVAVSSLKVGDHVLIKPGER  163

Query  1036  VPVDCEVF  1059
             +P D  +F
Sbjct  164   IPTDGRIF  171



>ref|WP_041071254.1| ATPase [Bacillus sp. OxB-1]
Length=644

 Score = 58.9 bits (141),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 70/146 (48%), Gaps = 10/146 (7%)
 Frame = +1

Query  625   YVLPKPAVKPLQRAFAVIAFPLVGVSASLDALMDVAGGK-INIHVLMALAGFASVFMGNS  801
             +++ K  V+    A  +IAF + G + + + + +    K +N+ +LM  A   S  +G  
Sbjct  45    WMIGKNGVESGSVALYIIAFLIGGFAKAKEGIEETVKNKELNVEMLMVFAAIGSAIIGYW  104

Query  802   LEGGLLLAMFNLAHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKV  981
              EG +L+ +F L+   E +    S  ++  L E  P+ A L+           D    KV
Sbjct  105   AEGAILIFIFALSGALETYTLNKSHKEISALMELQPEEAWLVQ---------EDGSEVKV  155

Query  982   PVSDLKVGSFILVQAGESVPVDCEVF  1059
             P S L +GS + V+ GE +PVD ++ 
Sbjct  156   PTSSLSLGSILAVRPGERIPVDGKIL  181



>ref|WP_026800065.1| ATPase [Pontibacillus halophilus]
 gb|KGX92985.1| ATPase [Pontibacillus halophilus JSM 076056 = DSM 19796]
Length=646

 Score = 58.9 bits (141),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 67/126 (53%), Gaps = 11/126 (9%)
 Frame = +1

Query  673   VIAFPLVGVSASLDALMD-VAGGKINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIA  849
             V AF + G + + + + + +A  ++N+ +LM  A   S  +G   EG +L+ +F L+   
Sbjct  67    VAAFIIGGFAKAKEGIEETIADRELNVEMLMIFAAIGSASIGYWTEGAILIFIFALSGAL  126

Query  850   EEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAG  1029
             E +    S+ ++  L +  P+ ALLL  + E          Q V VSDL +G+ ILV+AG
Sbjct  127   ETYTNNKSQREISSLMDLQPEEALLLTNDGE----------QLVHVSDLTIGNKILVKAG  176

Query  1030  ESVPVD  1047
             E VP D
Sbjct  177   ERVPAD  182



>gb|ADC50439.1| cadmium-transporting ATPase [Bacillus pseudofirmus OF4]
Length=656

 Score = 58.9 bits (141),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 87/169 (51%), Gaps = 13/169 (8%)
 Frame = +1

Query  553   NFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRAFAVIAFPLVGVSASLDALMDVA  732
              F+ EHLEL  +  +  I      ++L +     L  A  + A+ + G   + + + D  
Sbjct  32    KFVEEHLELTLALISGSIIIM--AWLLQRYEYPALSVALFLSAYVIGGYFKAREGIEDAL  89

Query  733   GGK-INIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTRCSKVDVKELKENHP  909
               K +N+ +LM  A   S F+G  +EG +L+ +F+L+  A E +T         + ++H 
Sbjct  90    SNKTLNVELLMIFAAIGSAFIGYWVEGAILIFIFSLSG-ALETYT---------MNKSHR  139

Query  910   DFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVDCEV  1056
             + + L+D+  E++    + + +KV V  L +G+F+L++ GE +P D ++
Sbjct  140   EISSLMDLRPETATVLVNGKERKVGVDHLVIGNFVLIKPGERIPADGKI  188



>ref|WP_000359042.1| hypothetical protein [Streptococcus agalactiae]
 gb|EPT97206.1| hypothetical protein SAG0109_00565 [Streptococcus agalactiae 
BSU108]
Length=626

 Score = 58.9 bits (141),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 55/101 (54%), Gaps = 9/101 (9%)
 Frame = +1

Query  745   NIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTRCSKVDVKELKENHPDFALL  924
             N H+LM LA   ++++G+ +E  LL+ +F+ AH  EE+    SK D+ E+ E +P  A  
Sbjct  70    NTHILMTLAALGAIYLGDLIEAALLIFIFSGAHFLEEYVEGKSKRDIIEILELNPREARK  129

Query  925   LDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVD  1047
             ++ N E            +PV  +++G  +LV  G+ +P D
Sbjct  130   MNDNGE---------VNIIPVQQIRLGDDLLVLNGDQIPTD  161



>ref|WP_041822606.1| ATPase [Bacillus pseudofirmus]
Length=642

 Score = 58.9 bits (141),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 87/169 (51%), Gaps = 13/169 (8%)
 Frame = +1

Query  553   NFLREHLElccssaalfiaaaacPYVLPKPAVKPLQRAFAVIAFPLVGVSASLDALMDVA  732
              F+ EHLEL  +  +  I      ++L +     L  A  + A+ + G   + + + D  
Sbjct  18    KFVEEHLELTLALISGSIIIM--AWLLQRYEYPALSVALFLSAYVIGGYFKAREGIEDAL  75

Query  733   GGK-INIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTRCSKVDVKELKENHP  909
               K +N+ +LM  A   S F+G  +EG +L+ +F+L+  A E +T         + ++H 
Sbjct  76    SNKTLNVELLMIFAAIGSAFIGYWVEGAILIFIFSLSG-ALETYT---------MNKSHR  125

Query  910   DFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVDCEV  1056
             + + L+D+  E++    + + +KV V  L +G+F+L++ GE +P D ++
Sbjct  126   EISSLMDLRPETATVLVNGKERKVGVDHLVIGNFVLIKPGERIPADGKI  174



>dbj|BAQ08727.1| cadmium-transporting atpase [Bacillus sp. OxB-1]
Length=635

 Score = 58.9 bits (141),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 70/146 (48%), Gaps = 10/146 (7%)
 Frame = +1

Query  625   YVLPKPAVKPLQRAFAVIAFPLVGVSASLDALMDVAGGK-INIHVLMALAGFASVFMGNS  801
             +++ K  V+    A  +IAF + G + + + + +    K +N+ +LM  A   S  +G  
Sbjct  36    WMIGKNGVESGSVALYIIAFLIGGFAKAKEGIEETVKNKELNVEMLMVFAAIGSAIIGYW  95

Query  802   LEGGLLLAMFNLAHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKV  981
              EG +L+ +F L+   E +    S  ++  L E  P+ A L+           D    KV
Sbjct  96    AEGAILIFIFALSGALETYTLNKSHKEISALMELQPEEAWLVQ---------EDGSEVKV  146

Query  982   PVSDLKVGSFILVQAGESVPVDCEVF  1059
             P S L +GS + V+ GE +PVD ++ 
Sbjct  147   PTSSLSLGSILAVRPGERIPVDGKIL  172



>gb|EHR70978.1| heavy metal translocating P-type ATPase [Burkholderiales bacterium 
JOSHI_001]
Length=635

 Score = 58.9 bits (141),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/107 (31%), Positives = 54/107 (50%), Gaps = 10/107 (9%)
 Frame = +1

Query  739   KINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTRCSKVDVKELKENHPDFA  918
             KI   + + +A   ++  G ++ G +L+ +  +A    E  T  ++  +K L  + P  A
Sbjct  76    KIGTEIFVTIATLVAMLGGETVAGAVLMVIILIAEFIAELNTDRARASIKSLIGSVPQVA  135

Query  919   LLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVDCEVF  1059
             L+ D   E S          VPV++L+VG  +LV+AGE VPVD  V 
Sbjct  136   LVRDAAGERS----------VPVAELRVGDVVLVRAGEKVPVDGSVL  172



>gb|EUJ42440.1| hypothetical protein PRIP_16482 [Listeria riparia FSL S10-1204]
Length=507

 Score = 58.5 bits (140),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 57/106 (54%), Gaps = 9/106 (8%)
 Frame = +1

Query  739   KINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTRCSKVDVKELKENHPDFA  918
             K+N+ +LM LA   +  +G  LEG +L+ +F+L+   E + T  SK ++  L E  P  A
Sbjct  60    KLNVELLMILAAIGASIIGYWLEGAILIFIFSLSGALETYTTNKSKREITNLLEIQPVTA  119

Query  919   LLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVDCEV  1056
              L   +N           ++V V  L+ G  +LV+ G+++P+D E+
Sbjct  120   FLRHADN---------TVEEVSVESLQPGDLLLVRPGDTIPIDGEI  156



>ref|WP_044901964.1| zinc ABC transporter ATPase [Treponema denticola]
Length=643

 Score = 58.9 bits (141),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/130 (27%), Positives = 69/130 (53%), Gaps = 10/130 (8%)
 Frame = +1

Query  673   VIAFPLVGVSASLDALMDVAGGKI-NIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIA  849
             VIA+   G    L ++ ++  G++ + + LM++A   +  +G+  EG  ++  +NL  + 
Sbjct  42    VIAWLTAGYKVLLTSVKNILKGQVFDENFLMSVATIGAFILGDWTEGAAVMLFYNLGEVV  101

Query  850   EEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAG  1029
             +      S+  + +L +  PDFA L D         SD + + V  + +K+GS +LV+AG
Sbjct  102   QHSAVEKSRRSIIDLMDLRPDFARLYD---------SDSKEKLVDPASVKIGSLVLVKAG  152

Query  1030  ESVPVDCEVF  1059
             E +P+D  ++
Sbjct  153   EKIPLDGVIY  162



>ref|WP_022553426.1| MULTISPECIES: Cd2+/Zn2+-exporting ATPase [Bacillus]
 emb|CDH96179.1| Cd2+/Zn2+-exporting ATPase [Bacillus amyloliquefaciens subsp. 
plantarum NAU-B3]
 gb|AIU81511.1| Zinc-transporting ATPase [Bacillus methylotrophicus]
Length=637

 Score = 58.9 bits (141),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 39/135 (29%), Positives = 68/135 (50%), Gaps = 11/135 (8%)
 Frame = +1

Query  646   VKPLQRAFAVIAFPLVGVSASLDALMDVAGGK-INIHVLMALAGFASVFMGNSLEGGLLL  822
              K L     ++AF + G + + + + D    K +N+ +LM  A   S  +G   EG +L+
Sbjct  49    TKGLSVTLYILAFLIGGFAKAKEGIEDTIETKALNVELLMIFAAVGSALIGYWAEGAVLI  108

Query  823   AMFNLAHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKV  1002
              +F+L+   E +    S  D+  L +  P+ A LL          +D R ++VPV++LK+
Sbjct  109   FIFSLSGALETYTMNKSSRDLTSLMKLEPEEATLL----------ADGREKRVPVAELKI  158

Query  1003  GSFILVQAGESVPVD  1047
             G  I+++ GE V  D
Sbjct  159   GDMIVIKPGERVAAD  173



>ref|WP_002339352.1| heavy metal translocating P-type ATPase [Enterococcus faecium]
 gb|ELB25749.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0039]
 gb|ELB63341.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0052]
Length=642

 Score = 58.9 bits (141),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 67/136 (49%), Gaps = 13/136 (10%)
 Frame = +1

Query  643   AVKPLQRAFAVIAFPLVGVSASLDALMDVAGGK-INIHVLMALAGFASVFMGNSLEGGLL  819
              + PL   F + A  + G   + + L ++   + +N+ +LMALA   +  +GN  EG +L
Sbjct  30    TITPL---FYISAIIIGGYKQTSEGLKELWNDRTLNVDLLMALAAIGACLIGNYFEGAML  86

Query  820   LAMFNLAHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLK  999
               +F L+   EE+ T  S+ ++  L    P  A LL  N +          Q+V VS LK
Sbjct  87    TFIFCLSGALEEYTTNKSQKEITTLMNLQPQKAQLLKENGQ---------MQEVDVSQLK  137

Query  1000  VGSFILVQAGESVPVD  1047
             V + + V  G +VP+D
Sbjct  138   VDNLVFVAKGAAVPID  153



>ref|WP_044957998.1| zinc ABC transporter ATPase [Treponema denticola]
Length=643

 Score = 58.9 bits (141),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/130 (27%), Positives = 69/130 (53%), Gaps = 10/130 (8%)
 Frame = +1

Query  673   VIAFPLVGVSASLDALMDVAGGKI-NIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIA  849
             VIA+   G    L ++ ++  G++ + + LM++A   +  +G+  EG  ++  +NL  + 
Sbjct  42    VIAWLTAGYKVLLTSVKNILKGQVFDENFLMSVATIGAFILGDWTEGAAVMLFYNLGEVV  101

Query  850   EEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAG  1029
             +      S+  + +L +  PDFA L D         SD + + V  + +K+GS +LV+AG
Sbjct  102   QHSAVEKSRRSIIDLMDLRPDFARLYD---------SDSKEKLVDPASVKIGSLVLVKAG  152

Query  1030  ESVPVDCEVF  1059
             E +P+D  ++
Sbjct  153   EKIPLDGVIY  162



>ref|WP_008695532.1| cadmium transporter [Fusobacterium ulcerans]
 gb|EHO84411.1| heavy metal translocating P-type ATPase [Fusobacterium ulcerans 
12-1B]
Length=786

 Score = 58.9 bits (141),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/132 (26%), Positives = 70/132 (53%), Gaps = 10/132 (8%)
 Frame = +1

Query  655   LQRAFAVIAFPLVGVSASLDALMDVAGGK-INIHVLMALAGFASVFMGNSLEGGLLLAMF  831
             L+ A +++A+ ++G    L++  ++  G  ++ + LM +A F + ++G + E   ++  +
Sbjct  204   LKLAVSIVAYIILGGDVVLNSFKNITKGNFLDENFLMTIATFGAFYLGETTEAVGVMLFY  263

Query  832   NLAHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSF  1011
              +    +E   R S+  +++L +  PD+A + D N E           KV    LK+G  
Sbjct  264   KIGEYFQESAVRNSRKSIEKLLDIRPDYANIRDNNGE---------VIKVSPKKLKIGDI  314

Query  1012  ILVQAGESVPVD  1047
             I++++GE VPVD
Sbjct  315   IIIKSGEKVPVD  326



>ref|WP_011983511.1| ATPase [Bacillus cytotoxicus]
 gb|ABS20753.1| heavy metal translocating P-type ATPase [Bacillus cytotoxicus 
NVH 391-98]
Length=641

 Score = 58.9 bits (141),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 74/142 (52%), Gaps = 11/142 (8%)
 Frame = +1

Query  625   YVLPKPAVKPLQRAFAVIAFPLVGVSASLDALMD-VAGGKINIHVLMALAGFASVFMGNS  801
             ++  K  +  +   F ++A+ + G + + + + D +A  ++N+ +LM  A   +  +G  
Sbjct  43    WLFTKNEMATVGVTFYILAYIIGGYAKAKEGIEDTIAEKELNVEMLMLFAAIGAAIIGYW  102

Query  802   LEGGLLLAMFNLAHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKV  981
              EG +L+ +F L+  A E +T         L ++H + + LLD+  E +   S+   +++
Sbjct  103   TEGAILIFIFALSG-ALESYT---------LNKSHKEISALLDLQPEEALRISNGNEERI  152

Query  982   PVSDLKVGSFILVQAGESVPVD  1047
             PV  L+V   IL++ GE VP D
Sbjct  153   PVEQLQVNDTILIKPGERVPAD  174



>ref|WP_003560548.1| metal ABC transporter ATPase [Lactobacillus buchneri]
 gb|EEI18607.1| cadmium-exporting ATPase [Lactobacillus buchneri ATCC 11577]
Length=636

 Score = 58.9 bits (141),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 58/105 (55%), Gaps = 9/105 (9%)
 Frame = +1

Query  745   NIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTRCSKVDVKELKENHPDFALL  924
             NIH+LM+L    ++ +G+  E  LL+ +F  AH  EE     S+ ++K L E  P  A  
Sbjct  70    NIHLLMSLGAVGAILIGSYEEAALLVLIFAGAHFLEEFAEGKSRREIKALLEMTPVKAKR  129

Query  925   LDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVDCEVF  1059
             +D + ++S         ++ V+D+K+G  I VQ G+ VP+D ++ 
Sbjct  130   IDDDGKAS---------EISVNDVKIGDRIQVQNGDQVPIDGQII  165



>ref|WP_003554122.1| metal ABC transporter ATPase [Lactobacillus brevis]
 gb|EEI70128.1| cadmium-exporting ATPase [Lactobacillus brevis subsp. gravesensis 
ATCC 27305]
Length=647

 Score = 58.9 bits (141),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 56/105 (53%), Gaps = 9/105 (9%)
 Frame = +1

Query  745   NIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTRCSKVDVKELKENHPDFALL  924
             NIH+LM+L    ++ +G+  E  LL+ +F  AH  EE     S+ ++K L E  P  A  
Sbjct  70    NIHLLMSLGAVGAILIGSYEEAALLVLIFAGAHFLEEFAEGKSRREIKALLEMTPVKAKR  129

Query  925   LDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVDCEVF  1059
             +D          D +  ++ V+D+K+G  I VQ G+ VP+D ++ 
Sbjct  130   ID---------DDGKASEISVNDVKIGDRIQVQNGDEVPIDGQII  165



>ref|WP_034551081.1| metal ABC transporter ATPase [Carnobacterium funditum]
Length=633

 Score = 58.5 bits (140),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 55/105 (52%), Gaps = 9/105 (9%)
 Frame = +1

Query  745   NIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTRCSKVDVKELKENHPDFALL  924
             N H+LM LA   +  +G+  EG LL+ +F+ AH  E++    SK ++ +L E +P  A L
Sbjct  81    NSHILMGLAAIGASLIGSFWEGTLLILIFSGAHFLEDYAEGRSKREMTKLMEMNPTTAKL  140

Query  925   LDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVDCEVF  1059
             +           D + + V V DLKVG  + V  G+ VP+D  + 
Sbjct  141   I---------MPDGKTETVAVEDLKVGDQLQVLNGDQVPIDGTIL  176



>ref|WP_002289122.1| MULTISPECIES: ATPase [Enterococcus]
 ref|YP_006375858.1| P-ATPase superfamily P-type ATPase zinc (Zn2+) transporter [Enterococcus 
faecium DO]
 gb|EAN09113.1| Heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase:Heavy 
metal translocating P-type ATPase [Enterococcus faecium DO]
 gb|EEV41118.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
1,230,933]
 gb|EEV44069.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
1,231,502]
 gb|EEV47731.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
1,231,501]
 gb|EEV52655.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
1,231,410]
 gb|EEV55377.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
1,231,408]
 gb|EEW63253.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
C68]
 gb|EEW65803.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
TC 6]
 gb|EFD09799.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
D344SRF]
 gb|EFF19793.1| cadmium-translocating P-type ATPase [Enterococcus faecium E1071]
 gb|EFF22907.1| cadmium-translocating P-type ATPase [Enterococcus faecium E1636]
 gb|EFF27698.1| cadmium-translocating P-type ATPase [Enterococcus faecium E1679]
 gb|EFF28312.1| cadmium-translocating P-type ATPase [Enterococcus faecium U0317]
 gb|EFF33646.1| cadmium-translocating P-type ATPase [Enterococcus faecium E1162]
 gb|EFR68164.1| cadmium-exporting ATPase [Enterococcus faecium TX0133a01]
 gb|EFR71554.1| cadmium-exporting ATPase [Enterococcus faecium TX0133B]
 gb|EFR74850.1| cadmium-exporting ATPase [Enterococcus faecium TX0133A]
 gb|EFR78564.1| cadmium-exporting ATPase [Enterococcus faecium TX0133C]
 gb|EFS07662.1| cadmium-exporting ATPase [Enterococcus faecium TX0133a04]
 gb|EFS08568.1| cadmium-exporting ATPase [Enterococcus faecium TX0082]
 gb|EHM33038.1| cadmium-translocating P-type ATPase [Enterococcus faecium E4452]
 gb|EHM35396.1| cadmium-translocating P-type ATPase [Enterococcus faecium E4453]
 gb|AFC63153.1| cadmium-translocating P-type ATPase [Enterococcus faecium Aus0004]
 gb|AFK58876.1| P-ATPase superfamily P-type ATPase zinc (Zn2+) transporter [Enterococcus 
faecium DO]
 gb|EJX37770.1| cadmium-exporting ATPase [Enterococcus faecium V689]
 gb|EJX38220.1| cadmium-exporting ATPase [Enterococcus faecium S447]
 gb|EJX39428.1| cadmium-exporting ATPase [Enterococcus faecium R501]
 gb|EJX47300.1| cadmium-exporting ATPase [Enterococcus faecium R496]
 gb|EJX47380.1| cadmium-exporting ATPase [Enterococcus faecium R497]
 gb|EJX50014.1| cadmium-exporting ATPase [Enterococcus faecium R499]
 gb|EJX59422.1| cadmium-exporting ATPase [Enterococcus faecium R494]
 gb|EJX62021.1| cadmium-exporting ATPase [Enterococcus faecium R446]
 gb|EJX63534.1| cadmium-exporting ATPase [Enterococcus faecium P1190]
 gb|EJX67773.1| cadmium-exporting ATPase [Enterococcus faecium P1986]
 gb|EJX68422.1| cadmium-exporting ATPase [Enterococcus faecium P1140]
 gb|EJX73976.1| cadmium-exporting ATPase [Enterococcus faecium P1137]
 gb|EJX75183.1| cadmium-exporting ATPase [Enterococcus faecium P1139]
 gb|EJX78062.1| cadmium-exporting ATPase [Enterococcus faecium ERV99]
 gb|EJX82406.1| cadmium-exporting ATPase [Enterococcus faecium P1123]
 gb|EJX83612.1| cadmium-exporting ATPase [Enterococcus faecium ERV69]
 gb|EJX90190.1| cadmium-exporting ATPase [Enterococcus faecium ERV26]
 gb|EJX90250.1| cadmium-exporting ATPase [Enterococcus faecium ERV38]
 gb|EJX91404.1| cadmium-exporting ATPase [Enterococcus faecium ERV168]
 gb|EJX93466.1| cadmium-exporting ATPase [Enterococcus faecium ERV165]
 gb|EJX98491.1| cadmium-exporting ATPase [Enterococcus faecium ERV161]
 gb|EJX99609.1| cadmium-exporting ATPase [Enterococcus faecium ERV102]
 gb|EJY06177.1| cadmium-exporting ATPase [Enterococcus faecium E422]
 gb|EJY08447.1| cadmium-exporting ATPase [Enterococcus faecium E417]
 gb|EJY08919.1| cadmium-exporting ATPase [Enterococcus faecium ERV1]
 gb|EJY14266.1| cadmium-exporting ATPase [Enterococcus faecium C621]
 gb|EJY19053.1| cadmium-exporting ATPase [Enterococcus faecium C1904]
 gb|EJY21820.1| cadmium-exporting ATPase [Enterococcus faecium C497]
 gb|EJY23000.1| cadmium-exporting ATPase [Enterococcus faecium 515]
 gb|EJY26362.1| cadmium-exporting ATPase [Enterococcus faecium 513]
 gb|EJY33185.1| cadmium-exporting ATPase [Enterococcus faecium 514]
 gb|EJY35724.1| cadmium-exporting ATPase [Enterococcus faecium 510]
 gb|EJY38977.1| cadmium-exporting ATPase [Enterococcus faecium 511]
 gb|EJY40773.1| cadmium-exporting ATPase [Enterococcus faecium 509]
 gb|EJY51228.1| cadmium-exporting ATPase [Enterococcus faecium 503]
 gb|EKA00448.1| cadmium-translocating P-type ATPase [Enterococcus sp. GMD4E]
 gb|EKA03722.1| cadmium-translocating P-type ATPase [Enterococcus sp. GMD3E]
 gb|EKA08358.1| cadmium-translocating P-type ATPase [Enterococcus sp. GMD2E]
 gb|EKQ77152.1| P-ATPase superfamily P-type ATPase zinc (Zn2+) transporter [Enterococcus 
sp. GMD5E]
 gb|EKU87065.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
FB129-CNAB4]
 gb|ELA50070.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0005]
 gb|ELA53637.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0012]
 gb|ELA60119.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0013]
 gb|ELA60652.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0022]
 gb|ELA65328.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0019]
 gb|ELA77037.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0011]
 gb|ELA79429.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0002]
 gb|ELA88084.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0016]
 gb|ELA89201.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0009]
 gb|ELA93125.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0020]
 gb|ELA96256.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0018]
 gb|ELA98266.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0001]
 gb|ELA99747.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0007]
 gb|ELB13556.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0032]
 gb|ELB15748.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0031]
 gb|ELB19878.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0025]
 gb|ELB22644.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0035]
 gb|ELB26037.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0040]
 gb|ELB32558.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0036]
 gb|ELB40969.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0024]
 gb|ELB43737.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0044]
 gb|ELB46705.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0043]
 gb|ELB50402.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0034]
 gb|ELB55944.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0030]
 gb|ELB65270.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0048]
 gb|ELB68064.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0054]
 gb|ELB71534.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0051]
 gb|ELB73344.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0050]
 gb|ELB77630.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0046]
 gb|ELB79688.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0057]
 gb|ELB82828.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0049]
 gb|ELB83430.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0045]
 gb|AGE30368.1| Lead, cadmium, zinc and mercury transporting ATPase Copper-translocating 
P-type ATPase [Enterococcus faecium NRRL B-2354]
 gb|EOD84887.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0041]
 gb|EOD85637.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0006]
 gb|EOF55282.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0131]
 gb|EOF79315.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0136]
 gb|EOF90011.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0161]
 gb|EOF90728.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0162]
 gb|EOF92272.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0166]
 gb|EOF95591.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0168]
 gb|EOF97159.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0167]
 gb|EOF98486.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0169]
 gb|EOG03699.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0171]
 gb|EOG05467.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0170]
 gb|EOG06098.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0175]
 gb|EOG09123.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0176]
 gb|EOG14874.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0177]
 gb|EOG18093.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0178]
 gb|EOG19822.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0179]
 gb|EOG25436.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0180]
 gb|EOG27328.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0181]
 gb|EOG28962.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0182]
 gb|EOG35491.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0183]
 gb|EOH51580.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0257]
 gb|EOH53257.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0264]
 gb|EOH62837.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0265]
 gb|EOH68330.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
ATCC 8459]
 gb|EOI38288.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0267]
 gb|EOI41318.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0313]
 gb|EOI45134.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0315]
 gb|EOI51197.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0317]
 gb|EOI54677.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0322]
 gb|EOI60591.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0314]
 gb|EOI62508.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0316]
 gb|EOI62931.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0318]
 gb|EOI68935.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0319]
 gb|EOI72138.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0321]
 gb|EOI73883.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0323]
 gb|EOI83047.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0312]
 gb|EOK16624.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0371]
 gb|EOK87771.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0149]
 gb|EOK90777.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0150]
 gb|EOK98193.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0152]
 gb|EOL07217.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0159]
 gb|EOL08014.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0158]
 gb|EOL08902.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0160]
 gb|EOL70270.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0305]
 gb|EOL72675.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0320]
 gb|EOM03228.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0258]
 gb|EOM05544.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0260]
 gb|EOM12200.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0261]
 gb|EOM14445.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0262]
 gb|EOM19593.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0193]
 gb|EOM22292.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0192]
 gb|EOM33327.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0254]
 gb|EOM34419.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0255]
 gb|EOM38670.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0172]
 gb|EOM39745.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0173]
 gb|EOM43169.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0256]
 gb|EOM45996.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0174]
 gb|EOM66714.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0163]
 gb|EOM68103.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0164]
 gb|EOM68684.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0165]
 gb|EOT37179.1| cadmium-translocating P-type ATPase [Enterococcus faecium EnGen0376]
 gb|EOT54649.1| cadmium-translocating P-type ATPase [Enterococcus faecium EnGen0375]
 gb|EOT89048.1| cadmium-translocating P-type ATPase [Enterococcus faecium EnGen0375]
 gb|EOT95212.1| cadmium-translocating P-type ATPase [Enterococcus faecium EnGen0376]
 gb|EOT97332.1| cadmium-translocating P-type ATPase [Enterococcus faecium EnGen0377]
 gb|EOU02124.1| cadmium-translocating P-type ATPase [Enterococcus faecium EnGen0377]
 gb|EOU02988.1| cadmium-translocating P-type ATPase [Enterococcus faecium ATCC 
8459]
 gb|EPI08112.1| cadmium-exporting ATPase [Enterococcus faecium SD3B-2]
 gb|EPI14770.1| cadmium-exporting ATPase [Enterococcus faecium SD1C-2]
 gb|EPI18858.1| cadmium-exporting ATPase [Enterococcus faecium OC2A-1]
 gb|EPI25216.1| cadmium-exporting ATPase [Enterococcus faecium LA4B-2]
 gb|AGS75232.1| cadmium-translocating P-type ATPase [Enterococcus faecium Aus0085]
 gb|EQI97024.1| cadmium-translocating P-type ATPase [Clostridium difficile Y384]
 gb|ERK33051.1| ATPase [Enterococcus faecium CRL1879]
 gb|ERT31936.1| cadmium-translocating P-type ATPase [Enterococcus faecium BM4538]
 gb|ERT34566.1| cadmium-translocating P-type ATPase [Enterococcus faecium NEF1]
 gb|ERT51122.1| cadmium-translocating P-type ATPase [Enterococcus faecium 10/96A]
 gb|EZP91483.1| ATPase [Enterococcus faecium VRE1044]
 gb|EZP92894.1| ATPase [Enterococcus faecium VSE1036]
 gb|EZP96106.1| ATPase [Enterococcus faecium VRE1261]
 gb|EZP99392.1| ATPase [Enterococcus faecium VRE0576]
 gb|KEI58300.1| ATPase [Enterococcus faecium UC10237]
 gb|KEI59903.1| ATPase [Enterococcus faecium UC7251]
 gb|KFO16978.1| ATPase [Enterococcus faecium UC7267]
 gb|KGK73920.1| ATPase [Enterococcus faecium]
 gb|KGK76879.1| ATPase [Enterococcus faecium]
 gb|KGQ78772.1| ATPase [Enterococcus faecium]
 gb|KGQ79543.1| ATPase [Enterococcus faecium]
Length=642

 Score = 58.5 bits (140),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 67/136 (49%), Gaps = 13/136 (10%)
 Frame = +1

Query  643   AVKPLQRAFAVIAFPLVGVSASLDALMDVAGGK-INIHVLMALAGFASVFMGNSLEGGLL  819
              + PL   F + A  + G   + + L ++   + +N+ +LMALA   +  +GN  EG +L
Sbjct  30    TITPL---FYISAIIIGGYKQTSEGLKELWNDRTLNVDLLMALAAIGACLIGNYFEGAML  86

Query  820   LAMFNLAHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLK  999
               +F L+   EE+ T  S+ ++  L    P  A LL  N +          Q+V VS LK
Sbjct  87    TFIFCLSGALEEYTTNKSQKEITALMNLQPQKAQLLKENGQ---------MQEVDVSQLK  137

Query  1000  VGSFILVQAGESVPVD  1047
             V + + V  G +VP+D
Sbjct  138   VDNLVFVAKGAAVPID  153



>ref|WP_010724018.1| heavy metal translocating P-type ATPase [Enterococcus faecium]
 gb|EOH45738.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0191]
 gb|KEI53316.1| ATPase [Enterococcus faecium UC8733]
Length=642

 Score = 58.5 bits (140),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 67/136 (49%), Gaps = 13/136 (10%)
 Frame = +1

Query  643   AVKPLQRAFAVIAFPLVGVSASLDALMDVAGGK-INIHVLMALAGFASVFMGNSLEGGLL  819
              + PL   F + A  + G   + + L ++   + +N+ +LMALA   +  +GN  EG +L
Sbjct  30    TITPL---FYISAIIIGGYKQTSEGLKELWNDRTLNVDLLMALAAIGACLIGNYFEGAML  86

Query  820   LAMFNLAHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLK  999
               +F L+   EE+ T  S+ ++  L    P  A LL  N +          Q+V VS LK
Sbjct  87    TFIFCLSGALEEYTTNKSQKEITALMNLQPQKAQLLKENGQ---------MQEVDVSQLK  137

Query  1000  VGSFILVQAGESVPVD  1047
             V + + V  G +VP+D
Sbjct  138   VDNLVFVAKGAAVPID  153



>ref|WP_002325689.1| heavy metal translocating P-type ATPase [Enterococcus faecium]
 gb|ELA56125.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0010]
 gb|EOG37190.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0184]
Length=642

 Score = 58.5 bits (140),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 67/136 (49%), Gaps = 13/136 (10%)
 Frame = +1

Query  643   AVKPLQRAFAVIAFPLVGVSASLDALMDVAGGK-INIHVLMALAGFASVFMGNSLEGGLL  819
              + PL   F + A  + G   + + L ++   + +N+ +LMALA   +  +GN  EG +L
Sbjct  30    TITPL---FYISAIIIGGYKQTSEGLKELWNDRTLNVDLLMALAAIGACLIGNYFEGAML  86

Query  820   LAMFNLAHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLK  999
               +F L+   EE+ T  S+ ++  L    P  A LL  N +          Q+V VS LK
Sbjct  87    TFIFCLSGALEEYTTNKSQKEITALMNLQPQKAQLLKENGQ---------MQEVDVSQLK  137

Query  1000  VGSFILVQAGESVPVD  1047
             V + + V  G +VP+D
Sbjct  138   VDNLVFVAKGAAVPID  153



>ref|WP_002336973.1| heavy metal translocating P-type ATPase [Enterococcus faecium]
 gb|ELB10656.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0027]
Length=642

 Score = 58.5 bits (140),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 67/136 (49%), Gaps = 13/136 (10%)
 Frame = +1

Query  643   AVKPLQRAFAVIAFPLVGVSASLDALMDVAGGK-INIHVLMALAGFASVFMGNSLEGGLL  819
              + PL   F + A  + G   + + L ++   + +N+ +LMALA   +  +GN  EG +L
Sbjct  30    TITPL---FYISAIIIGGYKQTSEGLKELWNDRTLNVDLLMALAAIGACLIGNYFEGAML  86

Query  820   LAMFNLAHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLK  999
               +F L+   EE+ T  S+ ++  L    P  A LL  N +          Q+V VS LK
Sbjct  87    TFIFCLSGALEEYTTNKSQKEITALMNLQPQKAQLLKENGQ---------MQEVDVSQLK  137

Query  1000  VGSFILVQAGESVPVD  1047
             V + + V  G +VP+D
Sbjct  138   VDNLVFVAKGAAVPID  153



>ref|WP_010721499.1| heavy metal translocating P-type ATPase [Enterococcus faecium]
 gb|EOK68944.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0129]
Length=642

 Score = 58.5 bits (140),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 67/136 (49%), Gaps = 13/136 (10%)
 Frame = +1

Query  643   AVKPLQRAFAVIAFPLVGVSASLDALMDVAGGK-INIHVLMALAGFASVFMGNSLEGGLL  819
              + PL   F + A  + G   + + L ++   + +N+ +LMALA   +  +GN  EG +L
Sbjct  30    TITPL---FYISAIIIGGYKQTSEGLKELWNDRTLNVDLLMALAAIGACLIGNYFEGAML  86

Query  820   LAMFNLAHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLK  999
               +F L+   EE+ T  S+ ++  L    P  A LL  N +          Q+V VS LK
Sbjct  87    TFIFCLSGALEEYTTNKSQKEITALMNLQPQKAQLLKENGQ---------MQEVDVSQLK  137

Query  1000  VGSFILVQAGESVPVD  1047
             V + + V  G +VP+D
Sbjct  138   VDNLVFVAKGAAVPID  153



>ref|WP_002331817.1| heavy metal translocating P-type ATPase [Enterococcus faecium]
 gb|ELA81655.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0004]
Length=642

 Score = 58.5 bits (140),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 67/136 (49%), Gaps = 13/136 (10%)
 Frame = +1

Query  643   AVKPLQRAFAVIAFPLVGVSASLDALMDVAGGK-INIHVLMALAGFASVFMGNSLEGGLL  819
              + PL   F + A  + G   + + L ++   + +N+ +LMALA   +  +GN  EG +L
Sbjct  30    TITPL---FYISAIIIGGYKQTSEGLKELWNDRTLNVDLLMALAAIGACLIGNYFEGAML  86

Query  820   LAMFNLAHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLK  999
               +F L+   EE+ T  S+ ++  L    P  A LL  N +          Q+V VS LK
Sbjct  87    TFIFCLSGALEEYTTNKSQKEITALMNLQPQKAQLLKENGQ---------MQEVDVSQLK  137

Query  1000  VGSFILVQAGESVPVD  1047
             V + + V  G +VP+D
Sbjct  138   VDNLVFVAKGAAVPID  153



>ref|WP_002330209.1| heavy metal translocating P-type ATPase [Enterococcus faecium]
 gb|ELA73046.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0017]
Length=642

 Score = 58.5 bits (140),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 67/136 (49%), Gaps = 13/136 (10%)
 Frame = +1

Query  643   AVKPLQRAFAVIAFPLVGVSASLDALMDVAGGK-INIHVLMALAGFASVFMGNSLEGGLL  819
              + PL   F + A  + G   + + L ++   + +N+ +LMALA   +  +GN  EG +L
Sbjct  30    TITPL---FYISAIIIGGYKQTSEGLKELWNDRTLNVDLLMALAAIGACLIGNYFEGAML  86

Query  820   LAMFNLAHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLK  999
               +F L+   EE+ T  S+ ++  L    P  A LL  N +          Q+V VS LK
Sbjct  87    TFIFCLSGALEEYTTNKSQKEITALMNLQPQKAQLLKENGQ---------MQEVDVSQLK  137

Query  1000  VGSFILVQAGESVPVD  1047
             V + + V  G +VP+D
Sbjct  138   VDNLVFVAKGAAVPID  153



>ref|WP_010829689.1| heavy metal translocating P-type ATPase [Enterococcus faecium]
 gb|EOK12065.1| heavy metal translocating P-type ATPase [Enterococcus faecium 
EnGen0372]
Length=642

 Score = 58.5 bits (140),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 67/136 (49%), Gaps = 13/136 (10%)
 Frame = +1

Query  643   AVKPLQRAFAVIAFPLVGVSASLDALMDVAGGK-INIHVLMALAGFASVFMGNSLEGGLL  819
              + PL   F + A  + G   + + L ++   + +N+ +LMALA   +  +GN  EG +L
Sbjct  30    TITPL---FYISAIIIGGYKQTSEGLKELWNDRTLNVDLLMALAAIGACLIGNYFEGAML  86

Query  820   LAMFNLAHIAEEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLK  999
               +F L+   EE+ T  S+ ++  L    P  A LL  N +          Q+V VS LK
Sbjct  87    TFIFCLSGALEEYTTNKSQKEITALMNLQPQKAQLLKENGQ---------MQEVDVSQLK  137

Query  1000  VGSFILVQAGESVPVD  1047
             V + + V  G +VP+D
Sbjct  138   VDNLVFVAKGAAVPID  153



>ref|WP_043286157.1| exopolyphosphatase [Burkholderiales bacterium JOSHI_001]
Length=615

 Score = 58.5 bits (140),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/107 (31%), Positives = 54/107 (50%), Gaps = 10/107 (9%)
 Frame = +1

Query  739   KINIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIAEEHFTRCSKVDVKELKENHPDFA  918
             KI   + + +A   ++  G ++ G +L+ +  +A    E  T  ++  +K L  + P  A
Sbjct  56    KIGTEIFVTIATLVAMLGGETVAGAVLMVIILIAEFIAELNTDRARASIKSLIGSVPQVA  115

Query  919   LLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAGESVPVDCEVF  1059
             L+ D   E S          VPV++L+VG  +LV+AGE VPVD  V 
Sbjct  116   LVRDAAGERS----------VPVAELRVGDVVLVRAGEKVPVDGSVL  152



>gb|EPF36091.1| heavy metal translocating P-type ATPase, partial [Treponema denticola 
SP32]
Length=684

 Score = 58.5 bits (140),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 35/130 (27%), Positives = 69/130 (53%), Gaps = 10/130 (8%)
 Frame = +1

Query  673   VIAFPLVGVSASLDALMDVAGGKI-NIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIA  849
             VIA+   G    L ++ ++  G++ + + LM++A   +  +G+  EG  ++  +NL  + 
Sbjct  83    VIAWLTAGYKVLLTSVKNILKGQVFDENFLMSVATIGAFILGDWTEGAAVMLFYNLGEVV  142

Query  850   EEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAG  1029
             +      S+  + +L +  PDFA L D         SD + + V  + +K+GS +LV+AG
Sbjct  143   QHSAVEKSRRSIIDLMDLRPDFARLYD---------SDSKEKLVDPASVKIGSLVLVKAG  193

Query  1030  ESVPVDCEVF  1059
             E +P+D  ++
Sbjct  194   EKIPLDGVIY  203



>ref|WP_010699290.1| heavy metal translocating P-type ATPase [Treponema denticola]
 gb|EMB21386.1| heavy metal translocating P-type ATPase [Treponema denticola 
SP37]
 gb|EPF32910.1| heavy metal translocating P-type ATPase [Treponema denticola 
SP44]
 gb|EPF40387.1| heavy metal translocating P-type ATPase [Treponema denticola 
SP23]
Length=761

 Score = 58.5 bits (140),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 35/130 (27%), Positives = 69/130 (53%), Gaps = 10/130 (8%)
 Frame = +1

Query  673   VIAFPLVGVSASLDALMDVAGGKI-NIHVLMALAGFASVFMGNSLEGGLLLAMFNLAHIA  849
             VIA+   G    L ++ ++  G++ + + LM++A   +  +G+  EG  ++  +NL  + 
Sbjct  160   VIAWLTAGYKVLLTSVKNILKGQVFDENFLMSVATIGAFILGDWTEGAAVMLFYNLGEVV  219

Query  850   EEHFTRCSKVDVKELKENHPDFALLLDVNNESSPSFSDLRYQKVPVSDLKVGSFILVQAG  1029
             +      S+  + +L +  PDFA L D         SD + + V  + +K+GS +LV+AG
Sbjct  220   QHSAVEKSRRSIIDLMDLRPDFARLYD---------SDSKEKLVDPASVKIGSLVLVKAG  270

Query  1030  ESVPVDCEVF  1059
             E +P+D  ++
Sbjct  271   EKIPLDGVIY  280



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2734198738640