BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig248

Length=713
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006349488.1|  PREDICTED: galactose oxidase-like                  328   6e-106   Solanum tuberosum [potatoes]
ref|XP_004249644.1|  PREDICTED: galactose oxidase                       326   1e-104   Solanum lycopersicum
ref|XP_009602919.1|  PREDICTED: galactose oxidase                       321   3e-103   Nicotiana tomentosiformis
ref|XP_009774166.1|  PREDICTED: galactose oxidase                       319   3e-102   Nicotiana sylvestris
gb|ACV49899.1|  glyoxal oxidase                                         317   9e-102   Vitis vinifera
emb|CDP06561.1|  unnamed protein product                                317   1e-101   Coffea canephora [robusta coffee]
emb|CAN73409.1|  hypothetical protein VITISV_024374                     314   3e-101   Vitis vinifera
gb|ABA42922.1|  glyoxal oxidase                                         315   6e-101   Vitis pseudoreticulata
gb|ACV49897.1|  glyoxal oxidase                                         315   6e-101   Vitis pseudoreticulata
gb|ACV49898.1|  glyoxal oxidase                                         315   7e-101   Vitis vinifera
ref|XP_002274763.1|  PREDICTED: galactose oxidase                       315   1e-100   Vitis vinifera
ref|XP_012087985.1|  PREDICTED: galactose oxidase                       312   1e-99    
ref|XP_003520957.1|  PREDICTED: uncharacterized protein LOC100776515    310   9e-99    Glycine max [soybeans]
ref|XP_007134016.1|  hypothetical protein PHAVU_010G012100g             309   2e-98    Phaseolus vulgaris [French bean]
ref|XP_003516307.1|  PREDICTED: galactose oxidase-like                  309   2e-98    Glycine max [soybeans]
ref|XP_004137754.1|  PREDICTED: galactose oxidase                       306   2e-97    Cucumis sativus [cucumbers]
ref|XP_008442498.1|  PREDICTED: LOW QUALITY PROTEIN: galactose ox...    305   4e-97    Cucumis melo [Oriental melon]
ref|XP_010088559.1|  hypothetical protein L484_016951                   305   5e-97    Morus notabilis
gb|KJB36661.1|  hypothetical protein B456_006G169500                    302   8e-96    Gossypium raimondii
ref|XP_006403636.1|  hypothetical protein EUTSA_v100109140mg            293   1e-95    
ref|XP_010553274.1|  PREDICTED: galactose oxidase                       299   1e-94    Tarenaya hassleriana [spider flower]
ref|XP_010044010.1|  PREDICTED: galactose oxidase                       298   3e-94    Eucalyptus grandis [rose gum]
ref|XP_002322929.1|  glyoxal oxidase-related family protein             296   8e-94    Populus trichocarpa [western balsam poplar]
ref|XP_004305171.1|  PREDICTED: galactose oxidase                       296   1e-93    Fragaria vesca subsp. vesca
ref|XP_007026880.1|  Glyoxal oxidase-related protein                    302   2e-93    
gb|KJB16941.1|  hypothetical protein B456_002G255700                    293   3e-93    Gossypium raimondii
ref|XP_011094925.1|  PREDICTED: galactose oxidase                       295   4e-93    Sesamum indicum [beniseed]
ref|XP_009378883.1|  PREDICTED: uncharacterized protein LOC103967351    291   6e-93    
ref|XP_011006630.1|  PREDICTED: galactose oxidase                       293   1e-92    Populus euphratica
ref|XP_008359690.1|  PREDICTED: LOW QUALITY PROTEIN: galactose ox...    292   6e-92    
ref|XP_010262660.1|  PREDICTED: galactose oxidase                       292   7e-92    Nelumbo nucifera [Indian lotus]
emb|CDY59162.1|  BnaC06g42590D                                          291   1e-91    Brassica napus [oilseed rape]
ref|XP_010515903.1|  PREDICTED: galactose oxidase-like                  291   1e-91    Camelina sativa [gold-of-pleasure]
ref|XP_007208466.1|  hypothetical protein PRUPE_ppa003992mg             291   2e-91    Prunus persica
ref|XP_010674911.1|  PREDICTED: uncharacterized protein LOC104890981    290   2e-91    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006290869.1|  hypothetical protein CARUB_v10016978mg             290   3e-91    Capsella rubella
gb|EPS61181.1|  glyoxal oxidase                                         290   4e-91    Genlisea aurea
gb|KFK34638.1|  hypothetical protein AALP_AA5G172000                    289   7e-91    Arabis alpina [alpine rockcress]
ref|XP_002876232.1|  hypothetical protein ARALYDRAFT_485786             289   8e-91    
ref|XP_010504181.1|  PREDICTED: galactose oxidase-like                  289   8e-91    Camelina sativa [gold-of-pleasure]
gb|EYU41788.1|  hypothetical protein MIMGU_mgv1a004290mg                288   1e-90    Erythranthe guttata [common monkey flower]
ref|XP_009378871.1|  PREDICTED: galactose oxidase                       288   2e-90    
ref|XP_009103886.1|  PREDICTED: galactose oxidase                       288   2e-90    Brassica rapa
emb|CDX67577.1|  BnaA07g16170D                                          288   4e-90    
ref|XP_010427056.1|  PREDICTED: galactose oxidase-like                  287   4e-90    Camelina sativa [gold-of-pleasure]
ref|XP_008240187.1|  PREDICTED: galactose oxidase                       287   5e-90    Prunus mume [ume]
ref|NP_190963.1|  glyoxal oxidase-related protein                       286   2e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006429215.1|  hypothetical protein CICLE_v10011448mg             285   2e-89    Citrus clementina [clementine]
ref|XP_006480899.1|  PREDICTED: galactose oxidase-like                  285   2e-89    Citrus sinensis [apfelsine]
gb|KDO57956.1|  hypothetical protein CISIN_1g044265mg                   284   7e-89    Citrus sinensis [apfelsine]
ref|XP_004507195.1|  PREDICTED: galactose oxidase-like                  272   3e-84    Cicer arietinum [garbanzo]
gb|KEH28959.1|  glyoxal oxidase amino-terminal protein                  267   3e-82    Medicago truncatula
ref|XP_006850437.1|  PREDICTED: galactose oxidase                       266   9e-82    Amborella trichopoda
ref|XP_010905399.1|  PREDICTED: LOW QUALITY PROTEIN: galactose ox...    254   3e-77    
ref|XP_008811510.1|  PREDICTED: galactose oxidase                       251   7e-76    Phoenix dactylifera
ref|XP_002972585.1|  hypothetical protein SELMODRAFT_97196              246   7e-74    Selaginella moellendorffii
ref|XP_002972039.1|  hypothetical protein SELMODRAFT_441651             245   8e-74    Selaginella moellendorffii
ref|XP_009421296.1|  PREDICTED: galactose oxidase                       245   1e-73    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001778975.1|  predicted protein                                  241   3e-72    
ref|XP_001765643.1|  predicted protein                                  238   4e-71    
ref|XP_001771982.1|  predicted protein                                  236   4e-70    
ref|XP_001762124.1|  predicted protein                                  233   4e-69    
emb|CBI30475.3|  unnamed protein product                                225   8e-68    Vitis vinifera
ref|XP_002970610.1|  hypothetical protein SELMODRAFT_93556              221   8e-65    Selaginella moellendorffii
ref|XP_002968445.1|  hypothetical protein SELMODRAFT_89852              219   4e-64    Selaginella moellendorffii
ref|XP_001776127.1|  predicted protein                                  218   2e-63    
ref|XP_001783776.1|  predicted protein                                  211   6e-61    
ref|XP_001757263.1|  predicted protein                                  209   4e-60    
ref|XP_001784508.1|  predicted protein                                  208   1e-59    
ref|XP_001759194.1|  predicted protein                                  207   2e-59    
ref|XP_001774105.1|  predicted protein                                  206   7e-59    
ref|XP_001769885.1|  predicted protein                                  205   1e-58    
ref|XP_001772413.1|  predicted protein                                  204   3e-58    
ref|XP_001777189.1|  predicted protein                                  203   5e-58    
ref|XP_011069751.1|  PREDICTED: galactose oxidase-like                  202   3e-57    Sesamum indicum [beniseed]
ref|XP_011069718.1|  PREDICTED: galactose oxidase-like                  201   4e-57    Sesamum indicum [beniseed]
ref|XP_011069750.1|  PREDICTED: galactose oxidase-like                  201   5e-57    Sesamum indicum [beniseed]
ref|XP_001759192.1|  predicted protein                                  200   1e-56    
ref|XP_010674901.1|  PREDICTED: galactose oxidase                       199   2e-56    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_001774194.1|  predicted protein                                  198   4e-56    
ref|XP_011092656.1|  PREDICTED: galactose oxidase-like                  199   5e-56    Sesamum indicum [beniseed]
ref|XP_002968444.1|  hypothetical protein SELMODRAFT_231119             197   9e-56    
ref|XP_001756237.1|  predicted protein                                  196   3e-55    
ref|XP_010540180.1|  PREDICTED: galactose oxidase-like                  197   3e-55    Tarenaya hassleriana [spider flower]
ref|XP_009364601.1|  PREDICTED: galactose oxidase                       196   4e-55    Pyrus x bretschneideri [bai li]
gb|AEW07659.1|  hypothetical protein 0_8408_01                          184   5e-55    Pinus radiata
ref|XP_006304793.1|  hypothetical protein CARUB_v10012343mg             196   6e-55    Capsella rubella
ref|XP_001758038.1|  predicted protein                                  195   6e-55    
ref|XP_002970607.1|  hypothetical protein SELMODRAFT_411320             195   6e-55    Selaginella moellendorffii
ref|XP_008389005.1|  PREDICTED: galactose oxidase                       195   8e-55    Malus domestica [apple tree]
ref|XP_009149487.1|  PREDICTED: galactose oxidase                       195   8e-55    Brassica rapa
ref|XP_001782509.1|  predicted protein                                  194   1e-54    
ref|XP_009794042.1|  PREDICTED: galactose oxidase-like                  194   2e-54    Nicotiana sylvestris
gb|KJB45029.1|  hypothetical protein B456_007G286100                    194   2e-54    Gossypium raimondii
ref|XP_006416454.1|  hypothetical protein EUTSA_v10007284mg             194   3e-54    Eutrema salsugineum [saltwater cress]
gb|EYU23055.1|  hypothetical protein MIMGU_mgv1a021812mg                193   3e-54    Erythranthe guttata [common monkey flower]
emb|CDY44191.1|  BnaC05g15480D                                          196   4e-54    Brassica napus [oilseed rape]
gb|AFG46408.1|  hypothetical protein 0_8408_01                          182   5e-54    Pinus taeda
gb|KFK44113.1|  hypothetical protein AALP_AA1G217400                    192   6e-54    Arabis alpina [alpine rockcress]
ref|XP_011073112.1|  PREDICTED: galactose oxidase                       192   1e-53    Sesamum indicum [beniseed]
ref|XP_009614398.1|  PREDICTED: galactose oxidase-like                  192   1e-53    Nicotiana tomentosiformis
ref|XP_002994680.1|  hypothetical protein SELMODRAFT_432583             183   1e-53    Selaginella moellendorffii
ref|XP_001751285.1|  predicted protein                                  191   2e-53    
ref|XP_001762682.1|  predicted protein                                  191   2e-53    
ref|XP_006300296.1|  hypothetical protein CARUB_v10021300mg             191   4e-53    Capsella rubella
ref|XP_001763031.1|  predicted protein                                  190   5e-53    
ref|NP_177692.1|  glyoxal oxidase-related protein                       189   1e-52    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010498415.1|  PREDICTED: galactose oxidase                       189   1e-52    Camelina sativa [gold-of-pleasure]
ref|XP_001751488.1|  predicted protein                                  187   4e-52    
ref|XP_010471675.1|  PREDICTED: galactose oxidase-like isoform X1       188   4e-52    
ref|XP_010471676.1|  PREDICTED: galactose oxidase-like isoform X2       188   4e-52    Camelina sativa [gold-of-pleasure]
ref|XP_010536368.1|  PREDICTED: galactose oxidase-like                  188   4e-52    Tarenaya hassleriana [spider flower]
ref|XP_002889034.1|  hypothetical protein ARALYDRAFT_895435             187   5e-52    Arabidopsis lyrata subsp. lyrata
emb|CDY62590.1|  BnaA08g31280D                                          187   8e-52    Brassica napus [oilseed rape]
ref|XP_010428587.1|  PREDICTED: galactose oxidase-like                  187   8e-52    Camelina sativa [gold-of-pleasure]
ref|XP_011083592.1|  PREDICTED: galactose oxidase-like                  187   9e-52    Sesamum indicum [beniseed]
ref|XP_010459669.1|  PREDICTED: galactose oxidase-like                  187   1e-51    Camelina sativa [gold-of-pleasure]
ref|XP_009110252.1|  PREDICTED: galactose oxidase-like                  186   2e-51    Brassica rapa
ref|XP_004494672.1|  PREDICTED: galactose oxidase-like                  186   2e-51    Cicer arietinum [garbanzo]
ref|XP_011074991.1|  PREDICTED: galactose oxidase-like                  186   2e-51    
ref|XP_006390288.1|  hypothetical protein EUTSA_v10018361mg             186   3e-51    Eutrema salsugineum [saltwater cress]
ref|XP_001760507.1|  predicted protein                                  185   3e-51    
ref|XP_010111102.1|  hypothetical protein L484_008478                   186   3e-51    Morus notabilis
ref|XP_007208189.1|  hypothetical protein PRUPE_ppa020922mg             185   3e-51    
ref|XP_008813838.1|  PREDICTED: galactose oxidase-like                  186   3e-51    Phoenix dactylifera
emb|CDY01391.1|  BnaA07g11640D                                          185   4e-51    
ref|NP_173419.1|  glyoxal oxidase-related protein                       185   4e-51    Arabidopsis thaliana [mouse-ear cress]
ref|XP_001774885.1|  predicted protein                                  185   4e-51    
ref|XP_009103376.1|  PREDICTED: galactose oxidase-like                  185   5e-51    Brassica rapa
ref|XP_001762118.1|  predicted protein                                  185   5e-51    
ref|XP_010416451.1|  PREDICTED: galactose oxidase-like isoform X2       184   5e-51    Camelina sativa [gold-of-pleasure]
ref|XP_010652487.1|  PREDICTED: galactose oxidase                       185   5e-51    
gb|AET97563.1|  galactose oxidase                                       185   6e-51    Ziziphus jujuba [Chinese jujube]
emb|CDY01390.1|  BnaA07g11630D                                          184   7e-51    
ref|XP_010536366.1|  PREDICTED: galactose oxidase-like                  185   7e-51    Tarenaya hassleriana [spider flower]
ref|XP_010416450.1|  PREDICTED: galactose oxidase-like isoform X1       184   8e-51    Camelina sativa [gold-of-pleasure]
ref|XP_007030653.1|  Glyoxal oxidase-related protein                    184   9e-51    
ref|XP_009393211.1|  PREDICTED: galactose oxidase-like                  184   1e-50    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX83736.1|  BnaC08g19090D                                          177   1e-50    
emb|CDY13556.1|  BnaC02g23670D                                          184   1e-50    Brassica napus [oilseed rape]
ref|XP_009128116.1|  PREDICTED: galactose oxidase-like                  184   1e-50    Brassica rapa
ref|XP_002893079.1|  hypothetical protein ARALYDRAFT_472215             184   1e-50    
ref|XP_010477216.1|  PREDICTED: galactose oxidase-like                  184   1e-50    Camelina sativa [gold-of-pleasure]
ref|XP_010256224.1|  PREDICTED: galactose oxidase                       184   2e-50    Nelumbo nucifera [Indian lotus]
ref|XP_006849170.2|  PREDICTED: galactose oxidase                       183   2e-50    
ref|XP_009103375.1|  PREDICTED: galactose oxidase-like                  183   2e-50    Brassica rapa
gb|ERN10751.1|  hypothetical protein AMTR_s00027p00175370               183   2e-50    Amborella trichopoda
ref|XP_008218222.1|  PREDICTED: galactose oxidase                       183   2e-50    Prunus mume [ume]
ref|XP_006290310.1|  hypothetical protein CARUB_v10019204mg             183   2e-50    Capsella rubella
ref|XP_004238618.1|  PREDICTED: galactose oxidase-like                  183   3e-50    Solanum lycopersicum
emb|CDP07430.1|  unnamed protein product                                183   3e-50    Coffea canephora [robusta coffee]
gb|KFK37635.1|  hypothetical protein AALP_AA3G008700                    183   3e-50    Arabis alpina [alpine rockcress]
ref|XP_010930930.1|  PREDICTED: uncharacterized protein LOC105051966    183   4e-50    
ref|XP_009607831.1|  PREDICTED: galactose oxidase-like                  182   4e-50    Nicotiana tomentosiformis
gb|KJB59770.1|  hypothetical protein B456_009G270800                    182   5e-50    Gossypium raimondii
ref|XP_009106212.1|  PREDICTED: galactose oxidase isoform X1            182   6e-50    Brassica rapa
ref|XP_009106213.1|  PREDICTED: galactose oxidase isoform X2            182   6e-50    Brassica rapa
emb|CDY39045.1|  BnaA02g17340D                                          182   8e-50    Brassica napus [oilseed rape]
emb|CDY47509.1|  BnaAnng09070D                                          182   8e-50    Brassica napus [oilseed rape]
emb|CDY43429.1|  BnaC07g14960D                                          181   1e-49    Brassica napus [oilseed rape]
ref|XP_010504696.1|  PREDICTED: galactose oxidase-like                  181   1e-49    Camelina sativa [gold-of-pleasure]
ref|XP_009797024.1|  PREDICTED: galactose oxidase-like                  182   1e-49    Nicotiana sylvestris
ref|XP_006342233.1|  PREDICTED: galactose oxidase-like                  181   1e-49    Solanum tuberosum [potatoes]
gb|EYU36763.1|  hypothetical protein MIMGU_mgv1a004035mg                181   1e-49    Erythranthe guttata [common monkey flower]
ref|XP_010105252.1|  hypothetical protein L484_019394                   181   1e-49    Morus notabilis
ref|XP_007017716.1|  Glyoxal oxidase-related protein                    181   1e-49    
ref|XP_002973684.1|  hypothetical protein SELMODRAFT_413959             181   1e-49    Selaginella moellendorffii
emb|CDP08591.1|  unnamed protein product                                181   1e-49    Coffea canephora [robusta coffee]
ref|XP_004289629.1|  PREDICTED: galactose oxidase-like                  181   1e-49    Fragaria vesca subsp. vesca
ref|XP_009774595.1|  PREDICTED: galactose oxidase-like                  181   2e-49    Nicotiana sylvestris
ref|XP_012071982.1|  PREDICTED: galactose oxidase-like                  181   2e-49    Jatropha curcas
ref|XP_004238617.1|  PREDICTED: galactose oxidase-like                  181   2e-49    Solanum lycopersicum
gb|KJB38605.1|  hypothetical protein B456_006G262900                    181   2e-49    Gossypium raimondii
ref|XP_010061250.1|  PREDICTED: galactose oxidase-like                  181   3e-49    Eucalyptus grandis [rose gum]
ref|XP_010516382.1|  PREDICTED: galactose oxidase-like                  180   3e-49    Camelina sativa [gold-of-pleasure]
ref|XP_002876427.1|  hypothetical protein ARALYDRAFT_907231             180   3e-49    Arabidopsis lyrata subsp. lyrata
ref|XP_006383732.1|  hypothetical protein POPTR_0005s25680g             179   3e-49    
ref|XP_009600286.1|  PREDICTED: galactose oxidase-like                  180   3e-49    Nicotiana tomentosiformis
ref|XP_004304717.1|  PREDICTED: galactose oxidase                       180   3e-49    Fragaria vesca subsp. vesca
gb|KJB38606.1|  hypothetical protein B456_006G263000                    180   4e-49    Gossypium raimondii
ref|XP_006342232.1|  PREDICTED: galactose oxidase-like                  180   4e-49    Solanum tuberosum [potatoes]
ref|XP_006392509.1|  hypothetical protein EUTSA_v10023396mg             179   6e-49    Eutrema salsugineum [saltwater cress]
ref|XP_010916153.1|  PREDICTED: galactose oxidase-like                  179   8e-49    Elaeis guineensis
ref|XP_003519774.1|  PREDICTED: galactose oxidase-like                  179   8e-49    Glycine max [soybeans]
ref|XP_010660091.1|  PREDICTED: galactose oxidase                       179   9e-49    Vitis vinifera
ref|XP_006342231.1|  PREDICTED: galactose oxidase-like                  179   9e-49    Solanum tuberosum [potatoes]
ref|XP_006342711.1|  PREDICTED: galactose oxidase-like                  179   1e-48    Solanum tuberosum [potatoes]
ref|XP_003561804.1|  PREDICTED: galactose oxidase-like                  179   1e-48    Brachypodium distachyon [annual false brome]
gb|KJB38607.1|  hypothetical protein B456_006G263100                    179   1e-48    Gossypium raimondii
ref|XP_008775019.1|  PREDICTED: galactose oxidase-like                  178   1e-48    Phoenix dactylifera
ref|XP_006357288.1|  PREDICTED: galactose oxidase-like                  178   2e-48    Solanum tuberosum [potatoes]
ref|XP_011457694.1|  PREDICTED: galactose oxidase-like                  178   2e-48    Fragaria vesca subsp. vesca
emb|CDX73183.1|  BnaC06g36310D                                          178   2e-48    
ref|XP_006857804.1|  PREDICTED: galactose oxidase                       177   2e-48    Amborella trichopoda
ref|XP_009797022.1|  PREDICTED: galactose oxidase-like                  178   2e-48    Nicotiana sylvestris
gb|KFK35620.1|  hypothetical protein AALP_AA4G014800                    178   2e-48    Arabis alpina [alpine rockcress]
ref|XP_004238325.1|  PREDICTED: galactose oxidase-like                  177   2e-48    Solanum lycopersicum
ref|XP_010536365.1|  PREDICTED: galactose oxidase-like                  177   2e-48    
ref|XP_004239377.1|  PREDICTED: galactose oxidase-like                  178   3e-48    Solanum lycopersicum
ref|XP_009791893.1|  PREDICTED: galactose oxidase-like                  177   3e-48    Nicotiana sylvestris
ref|XP_006383733.1|  hypothetical protein POPTR_0005s25690g             178   3e-48    
ref|XP_009779182.1|  PREDICTED: galactose oxidase-like                  178   3e-48    Nicotiana sylvestris
ref|XP_004291826.1|  PREDICTED: galactose oxidase-like                  177   3e-48    Fragaria vesca subsp. vesca
ref|XP_002510488.1|  Galactose oxidase precursor, putative              177   3e-48    
gb|KJB29631.1|  hypothetical protein B456_005G111300                    177   3e-48    Gossypium raimondii
ref|XP_008387970.1|  PREDICTED: galactose oxidase-like                  177   3e-48    
ref|XP_009797023.1|  PREDICTED: galactose oxidase-like                  177   3e-48    Nicotiana sylvestris
ref|XP_008781649.1|  PREDICTED: uncharacterized protein LOC103701389    177   4e-48    
ref|XP_006838081.2|  PREDICTED: galactose oxidase                       177   5e-48    
emb|CDY29385.1|  BnaA06g14110D                                          176   5e-48    Brassica napus [oilseed rape]
emb|CDY44816.1|  BnaCnng11720D                                          177   5e-48    Brassica napus [oilseed rape]
ref|NP_191321.1|  glyoxal oxidase-related protein                       177   5e-48    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003626387.1|  Galactose oxidase                                  177   5e-48    Medicago truncatula
ref|XP_003613586.1|  hypothetical protein MTR_5g038410                  177   5e-48    
ref|XP_009408991.1|  PREDICTED: galactose oxidase-like                  176   7e-48    
ref|XP_011028961.1|  PREDICTED: galactose oxidase-like                  177   7e-48    Populus euphratica
emb|CDY62245.1|  BnaC01g42480D                                          176   7e-48    Brassica napus [oilseed rape]
ref|XP_010105253.1|  hypothetical protein L484_019396                   176   8e-48    Morus notabilis
ref|XP_006849171.2|  PREDICTED: galactose oxidase                       176   8e-48    
gb|ERN00650.1|  hypothetical protein AMTR_s00225p00021580               176   8e-48    Amborella trichopoda
ref|XP_009119411.1|  PREDICTED: galactose oxidase                       176   8e-48    Brassica rapa
gb|ERN10752.1|  hypothetical protein AMTR_s00027p00177380               176   8e-48    Amborella trichopoda
ref|XP_009603236.1|  PREDICTED: galactose oxidase-like                  176   1e-47    Nicotiana tomentosiformis
ref|XP_010271448.1|  PREDICTED: galactose oxidase-like                  176   1e-47    Nelumbo nucifera [Indian lotus]
ref|XP_010263908.1|  PREDICTED: galactose oxidase-like                  176   1e-47    Nelumbo nucifera [Indian lotus]
ref|XP_004291825.1|  PREDICTED: galactose oxidase-like                  176   1e-47    Fragaria vesca subsp. vesca
ref|XP_010532190.1|  PREDICTED: galactose oxidase                       176   2e-47    Tarenaya hassleriana [spider flower]
ref|XP_007225625.1|  hypothetical protein PRUPE_ppa003824mg             175   2e-47    Prunus persica
ref|XP_009619752.1|  PREDICTED: galactose oxidase-like                  176   2e-47    Nicotiana tomentosiformis
ref|XP_004489989.1|  PREDICTED: uncharacterized protein LOC101500908    176   2e-47    Cicer arietinum [garbanzo]
ref|XP_010533609.1|  PREDICTED: galactose oxidase-like                  175   2e-47    Tarenaya hassleriana [spider flower]
ref|XP_010041767.1|  PREDICTED: galactose oxidase                       175   3e-47    Eucalyptus grandis [rose gum]
ref|XP_006344285.1|  PREDICTED: galactose oxidase-like                  175   4e-47    Solanum tuberosum [potatoes]
ref|XP_008221312.1|  PREDICTED: galactose oxidase-like                  174   4e-47    Prunus mume [ume]
ref|XP_004252835.1|  PREDICTED: galactose oxidase-like                  174   5e-47    Solanum lycopersicum
ref|XP_006342230.1|  PREDICTED: galactose oxidase-like                  174   5e-47    Solanum tuberosum [potatoes]
ref|XP_011045139.1|  PREDICTED: galactose oxidase-like                  174   6e-47    Populus euphratica
ref|XP_009388162.1|  PREDICTED: galactose oxidase-like                  174   6e-47    
ref|XP_009335425.1|  PREDICTED: galactose oxidase-like                  174   6e-47    
ref|XP_002280559.1|  PREDICTED: galactose oxidase                       174   6e-47    Vitis vinifera
gb|KHN43222.1|  Galactose oxidase                                       172   8e-47    Glycine soja [wild soybean]
ref|XP_007157402.1|  hypothetical protein PHAVU_002G066900g             173   8e-47    Phaseolus vulgaris [French bean]
ref|XP_007147126.1|  hypothetical protein PHAVU_006G098100g             174   8e-47    Phaseolus vulgaris [French bean]
ref|XP_004238324.1|  PREDICTED: galactose oxidase-like                  173   9e-47    Solanum lycopersicum
emb|CDY45255.1|  BnaA06g09250D                                          170   1e-46    Brassica napus [oilseed rape]
ref|XP_002512263.1|  Galactose oxidase precursor, putative              172   2e-46    
ref|XP_009606830.1|  PREDICTED: galactose oxidase                       172   2e-46    Nicotiana tomentosiformis
gb|EPS72896.1|  hypothetical protein M569_01859                         172   2e-46    Genlisea aurea
ref|XP_002468154.1|  hypothetical protein SORBIDRAFT_01g040550          172   3e-46    Sorghum bicolor [broomcorn]
ref|XP_003553749.1|  PREDICTED: galactose oxidase-like                  172   4e-46    Glycine max [soybeans]
ref|XP_006343542.1|  PREDICTED: galactose oxidase-like                  171   5e-46    Solanum tuberosum [potatoes]
ref|XP_003527766.1|  PREDICTED: galactose oxidase-like                  171   5e-46    Glycine max [soybeans]
ref|XP_009801814.1|  PREDICTED: galactose oxidase                       171   5e-46    Nicotiana sylvestris
ref|XP_007136065.1|  hypothetical protein PHAVU_009G014900g             171   5e-46    Phaseolus vulgaris [French bean]
ref|XP_010271447.1|  PREDICTED: galactose oxidase-like                  171   6e-46    Nelumbo nucifera [Indian lotus]
gb|KJB58134.1|  hypothetical protein B456_009G196400                    171   8e-46    Gossypium raimondii
ref|XP_009407008.1|  PREDICTED: uncharacterized protein LOC103989784    171   8e-46    
ref|XP_010242442.1|  PREDICTED: galactose oxidase                       171   1e-45    Nelumbo nucifera [Indian lotus]
ref|XP_012091952.1|  PREDICTED: galactose oxidase                       171   1e-45    Jatropha curcas
ref|XP_007017718.1|  Glyoxal oxidase-related protein                    170   1e-45    
ref|XP_006848962.1|  PREDICTED: galactose oxidase                       170   2e-45    Amborella trichopoda
ref|XP_003589379.1|  Galactose oxidase                                  170   2e-45    Medicago truncatula
gb|KHN45905.1|  Galactose oxidase                                       169   2e-45    Glycine soja [wild soybean]
ref|XP_003523554.1|  PREDICTED: galactose oxidase-like                  169   2e-45    Glycine max [soybeans]
ref|XP_010061025.1|  PREDICTED: galactose oxidase-like                  170   2e-45    Eucalyptus grandis [rose gum]
emb|CDX81637.1|  BnaC08g39640D                                          169   3e-45    
ref|XP_004147869.1|  PREDICTED: galactose oxidase                       169   3e-45    Cucumis sativus [cucumbers]
ref|XP_010458940.1|  PREDICTED: galactose oxidase-like                  169   3e-45    Camelina sativa [gold-of-pleasure]
gb|KGN60011.1|  hypothetical protein Csa_3G866440                       169   4e-45    Cucumis sativus [cucumbers]
ref|XP_009117902.1|  PREDICTED: galactose oxidase-like                  169   4e-45    Brassica rapa
ref|NP_001049609.1|  Os03g0258900                                       169   4e-45    
emb|CDY53551.1|  BnaA09g57100D                                          169   4e-45    Brassica napus [oilseed rape]
gb|AAG12543.1|AC007797_3  Unknown Protein                               168   5e-45    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010496071.1|  PREDICTED: galactose oxidase-like                  169   5e-45    Camelina sativa [gold-of-pleasure]
ref|XP_004237211.1|  PREDICTED: galactose oxidase-like                  169   6e-45    Solanum lycopersicum
ref|XP_006577272.1|  PREDICTED: galactose oxidase-like                  168   6e-45    Glycine max [soybeans]
ref|XP_010476497.1|  PREDICTED: galactose oxidase-like                  168   7e-45    Camelina sativa [gold-of-pleasure]
ref|XP_006304526.1|  hypothetical protein CARUB_v10011386mg             168   8e-45    Capsella rubella
ref|XP_007017717.1|  Glyoxal oxidase-related protein                    168   9e-45    
ref|XP_010924630.1|  PREDICTED: uncharacterized protein LOC105047413    168   1e-44    
ref|XP_009594288.1|  PREDICTED: uncharacterized protein LOC104090813    168   1e-44    
ref|NP_172895.2|  glyoxal oxidase-related protein                       167   2e-44    
gb|EMT01589.1|  hypothetical protein F775_04099                         167   2e-44    
gb|EAY89314.1|  hypothetical protein OsI_10817                          167   2e-44    
ref|XP_002890054.1|  hypothetical protein ARALYDRAFT_888820             167   3e-44    
ref|XP_008466509.1|  PREDICTED: galactose oxidase-like                  167   3e-44    
ref|XP_010904553.1|  PREDICTED: galactose oxidase-like                  166   4e-44    
ref|XP_001771865.1|  predicted protein                                  165   4e-44    
ref|XP_009782130.1|  PREDICTED: galactose oxidase-like                  166   5e-44    
ref|XP_006417012.1|  hypothetical protein EUTSA_v10007241mg             166   5e-44    
ref|XP_011045140.1|  PREDICTED: galactose oxidase-like                  165   5e-44    
ref|XP_006649773.1|  PREDICTED: galactose oxidase-like                  166   6e-44    
ref|XP_007046239.1|  Glyoxal oxidase-related protein, putative          166   6e-44    
ref|XP_002301997.2|  glyoxal oxidase-related family protein             165   7e-44    
ref|XP_004243010.2|  PREDICTED: galactose oxidase                       165   8e-44    
ref|XP_010670858.1|  PREDICTED: galactose oxidase-like                  165   8e-44    
gb|EYU22441.1|  hypothetical protein MIMGU_mgv1a024085mg                166   9e-44    
ref|XP_006378160.1|  glyoxal oxidase-related family protein             165   1e-43    
ref|XP_007136064.1|  hypothetical protein PHAVU_009G014800g             165   2e-43    
ref|XP_003544396.1|  PREDICTED: uncharacterized protein LOC100791340    164   2e-43    
ref|XP_004500954.1|  PREDICTED: galactose oxidase-like                  164   2e-43    
ref|XP_008444780.1|  PREDICTED: galactose oxidase-like                  164   2e-43    
ref|XP_006387029.1|  hypothetical protein POPTR_2128s00200g             159   3e-43    
ref|XP_010096335.1|  hypothetical protein L484_021082                   164   4e-43    
ref|XP_001767275.1|  predicted protein                                  162   4e-43    
ref|XP_009625411.1|  PREDICTED: LOW QUALITY PROTEIN: galactose ox...    163   4e-43    
tpg|DAA44472.1|  TPA: glyoxal oxidase                                   164   5e-43    
ref|NP_001149941.1|  glyoxal oxidase precursor                          163   5e-43    
ref|XP_011071032.1|  PREDICTED: galactose oxidase-like                  163   6e-43    
ref|XP_010539855.1|  PREDICTED: galactose oxidase-like                  162   9e-43    
ref|XP_010670864.1|  PREDICTED: galactose oxidase-like                  163   9e-43    
ref|XP_002975736.1|  hypothetical protein SELMODRAFT_232564             162   1e-42    
ref|XP_011010793.1|  PREDICTED: galactose oxidase                       162   1e-42    
ref|XP_004499224.1|  PREDICTED: galactose oxidase-like                  162   1e-42    
ref|XP_006828863.1|  PREDICTED: galactose oxidase                       162   1e-42    
gb|EMS60899.1|  hypothetical protein TRIUR3_32646                       161   1e-42    
gb|KFK43688.1|  hypothetical protein AALP_AA1G160100                    162   1e-42    
ref|XP_001767845.1|  predicted protein                                  162   2e-42    
ref|XP_004984953.1|  PREDICTED: galactose oxidase-like                  161   2e-42    
ref|XP_007160695.1|  hypothetical protein PHAVU_001G009200g             161   2e-42    
ref|XP_002520142.1|  conserved hypothetical protein                     161   2e-42    
ref|XP_004486272.1|  PREDICTED: galactose oxidase-like                  161   2e-42    
ref|XP_006438575.1|  hypothetical protein CICLE_v10031195mg             160   3e-42    
ref|XP_004152661.2|  PREDICTED: galactose oxidase-like                  161   3e-42    
ref|XP_006483245.1|  PREDICTED: galactose oxidase-like                  161   4e-42    
ref|XP_008793761.1|  PREDICTED: galactose oxidase-like                  160   4e-42    
gb|KEH36231.1|  glyoxal oxidase amino-terminal protein                  160   4e-42    
gb|KJB14442.1|  hypothetical protein B456_002G125000                    160   4e-42    
ref|XP_009335433.1|  PREDICTED: galactose oxidase-like                  160   5e-42    
ref|XP_006654771.1|  PREDICTED: uncharacterized protein LOC102716970    161   5e-42    
gb|KDO82728.1|  hypothetical protein CISIN_1g048017mg                   160   5e-42    
gb|KJB50703.1|  hypothetical protein B456_008G183000                    160   6e-42    
ref|XP_006471853.1|  PREDICTED: galactose oxidase-like                  160   7e-42    
ref|XP_006433075.1|  hypothetical protein CICLE_v10000768mg             160   7e-42    
ref|XP_009381768.1|  PREDICTED: uncharacterized protein LOC103969853    160   8e-42    
ref|XP_011003791.1|  PREDICTED: galactose oxidase-like                  160   8e-42    
ref|XP_008221409.1|  PREDICTED: galactose oxidase-like                  160   8e-42    
ref|XP_008801460.1|  PREDICTED: galactose oxidase-like                  160   8e-42    
emb|CDM83959.1|  unnamed protein product                                160   9e-42    
ref|XP_006382737.1|  glyoxal oxidase-related family protein             159   1e-41    
ref|XP_008387971.1|  PREDICTED: galactose oxidase-like                  159   2e-41    
ref|XP_009360496.1|  PREDICTED: LOW QUALITY PROTEIN: galactose ox...    159   2e-41    
ref|XP_009337669.1|  PREDICTED: galactose oxidase-like                  158   3e-41    
ref|XP_008221311.1|  PREDICTED: galactose oxidase-like                  158   4e-41    
gb|EAY98991.1|  hypothetical protein OsI_20949                          158   4e-41    
ref|XP_008367509.1|  PREDICTED: uncharacterized protein LOC103431143    158   4e-41    
ref|NP_001056298.1|  Os05g0559000                                       158   5e-41    
ref|XP_006389311.1|  glyoxal oxidase-related family protein             157   5e-41    
emb|CDP00919.1|  unnamed protein product                                149   1e-40    
ref|XP_010100623.1|  hypothetical protein L484_011554                   156   1e-40    
gb|ACG29670.1|  glyoxal oxidase                                         157   1e-40    
ref|XP_008649992.1|  PREDICTED: uncharacterized protein LOC103630723    157   1e-40    
ref|XP_003527665.1|  PREDICTED: galactose oxidase-like                  155   2e-40    
ref|XP_008239597.1|  PREDICTED: uncharacterized protein LOC103338188    155   2e-40    
ref|XP_003569556.2|  PREDICTED: uncharacterized protein LOC100835848    156   3e-40    
gb|KJB37454.1|  hypothetical protein B456_006G205600                    155   3e-40    
ref|XP_002440240.1|  hypothetical protein SORBIDRAFT_09g028310          155   4e-40    
ref|XP_002961909.1|  hypothetical protein SELMODRAFT_77682              155   4e-40    
ref|XP_008466667.1|  PREDICTED: galactose oxidase-like                  155   6e-40    
ref|XP_008221748.1|  PREDICTED: galactose oxidase                       154   7e-40    
gb|KHN04050.1|  Galactose oxidase                                       154   9e-40    
ref|XP_009337676.1|  PREDICTED: galactose oxidase-like                  154   9e-40    
ref|XP_002456130.1|  hypothetical protein SORBIDRAFT_03g031030          154   9e-40    
ref|XP_011087000.1|  PREDICTED: galactose oxidase-like                  154   1e-39    
emb|CDY39313.1|  BnaC05g10660D                                          150   2e-39    
ref|XP_007039386.1|  Glyoxal oxidase-related protein                    153   2e-39    
ref|XP_004298452.1|  PREDICTED: galactose oxidase-like                  153   2e-39    
ref|XP_004147870.1|  PREDICTED: galactose oxidase-like                  153   2e-39    
ref|NP_001170492.1|  hypothetical protein precursor                     153   2e-39    
ref|XP_004963606.1|  PREDICTED: galactose oxidase-like                  153   3e-39    
gb|KGN60010.1|  hypothetical protein Csa_3G865940                       152   3e-39    
ref|XP_010554972.1|  PREDICTED: galactose oxidase                       152   4e-39    
ref|XP_008338258.1|  PREDICTED: galactose oxidase-like                  152   4e-39    
ref|XP_006646198.1|  PREDICTED: uncharacterized protein LOC102719070    152   5e-39    
ref|XP_008367966.1|  PREDICTED: galactose oxidase-like                  151   7e-39    
ref|XP_003567916.1|  PREDICTED: galactose oxidase-like                  152   8e-39    
ref|XP_004301024.2|  PREDICTED: uncharacterized protein LOC101293...    151   1e-38    
gb|KEH24796.1|  glyoxal oxidase amino-terminal protein                  150   1e-38    
ref|XP_010523439.1|  PREDICTED: galactose oxidase-like isoform X1       150   2e-38    
ref|XP_009392205.1|  PREDICTED: galactose oxidase-like                  150   2e-38    
ref|XP_009337677.1|  PREDICTED: galactose oxidase-like                  150   2e-38    
ref|XP_010102932.1|  hypothetical protein L484_018951                   150   3e-38    
ref|XP_008347351.1|  PREDICTED: galactose oxidase-like                  149   3e-38    
ref|XP_002446737.1|  hypothetical protein SORBIDRAFT_06g021520          149   4e-38    
ref|XP_007227672.1|  hypothetical protein PRUPE_ppa026498mg             149   5e-38    
ref|XP_006473606.1|  PREDICTED: galactose oxidase-like                  149   6e-38    
ref|XP_009367892.1|  PREDICTED: uncharacterized protein LOC103957460    149   6e-38    
ref|XP_010688268.1|  PREDICTED: uncharacterized protein LOC104902254    149   6e-38    
ref|XP_008348975.1|  PREDICTED: galactose oxidase-like                  149   7e-38    
ref|XP_010541897.1|  PREDICTED: galactose oxidase-like                  149   8e-38    
ref|XP_010251352.1|  PREDICTED: uncharacterized protein LOC104593293    149   8e-38    
ref|XP_010686035.1|  PREDICTED: uncharacterized protein LOC104900331    149   9e-38    
emb|CDP00283.1|  unnamed protein product                                148   9e-38    
ref|XP_002518913.1|  Galactose oxidase precursor, putative              148   9e-38    
ref|XP_006435123.1|  hypothetical protein CICLE_v10003275mg             148   9e-38    
ref|XP_011464174.1|  PREDICTED: uncharacterized protein LOC101293...    148   1e-37    
gb|KDO84767.1|  hypothetical protein CISIN_1g009420mg                   148   1e-37    
ref|XP_008340335.1|  PREDICTED: uncharacterized protein LOC103403295    150   1e-37    
emb|CDP12684.1|  unnamed protein product                                147   2e-37    
ref|XP_012086609.1|  PREDICTED: galactose oxidase-like                  147   2e-37    
ref|XP_007137990.1|  hypothetical protein PHAVU_009G171700g             147   2e-37    
ref|XP_011464176.1|  PREDICTED: uncharacterized protein LOC101293...    147   2e-37    
ref|XP_010670846.1|  PREDICTED: galactose oxidase-like                  147   2e-37    
ref|XP_010026976.1|  PREDICTED: uncharacterized protein LOC104417381    147   2e-37    
ref|XP_004299160.2|  PREDICTED: uncharacterized protein LOC101293...    147   2e-37    
ref|XP_011464173.1|  PREDICTED: uncharacterized protein LOC101293...    147   2e-37    
ref|XP_010254463.1|  PREDICTED: galactose oxidase                       147   2e-37    
gb|KJB38604.1|  hypothetical protein B456_006G262800                    146   3e-37    
ref|XP_008377179.1|  PREDICTED: galactose oxidase-like                  146   5e-37    
ref|XP_004969528.1|  PREDICTED: uncharacterized protein LOC101774211    147   5e-37    
ref|XP_002272723.2|  PREDICTED: uncharacterized protein LOC100259927    146   5e-37    
emb|CBI34589.3|  unnamed protein product                                146   6e-37    
ref|XP_004292851.1|  PREDICTED: uncharacterized protein LOC101303486    146   7e-37    
gb|KDO76728.1|  hypothetical protein CISIN_1g0433692mg                  145   8e-37    
ref|XP_006477507.1|  PREDICTED: galactose oxidase-like                  145   8e-37    
ref|XP_009367481.1|  PREDICTED: uncharacterized protein LOC103957109    146   8e-37    
ref|XP_008245383.1|  PREDICTED: galactose oxidase-like                  145   9e-37    
ref|XP_006833409.2|  PREDICTED: galactose oxidase                       145   1e-36    
ref|XP_006439219.1|  hypothetical protein CICLE_v10024435mg             145   1e-36    
ref|XP_004309580.1|  PREDICTED: galactose oxidase-like                  145   1e-36    
ref|XP_008377171.1|  PREDICTED: galactose oxidase-like                  145   1e-36    
gb|EMT23870.1|  hypothetical protein F775_01170                         144   2e-36    
gb|KHG09161.1|  galactose oxidase                                       144   2e-36    
ref|XP_010100201.1|  hypothetical protein L484_015346                   145   2e-36    
ref|NP_001043851.1|  Os01g0677000                                       145   2e-36    
ref|XP_007209012.1|  hypothetical protein PRUPE_ppa023406mg             144   2e-36    
gb|EEC71262.1|  hypothetical protein OsI_03252                          145   2e-36    
ref|XP_009336933.1|  PREDICTED: galactose oxidase-like                  145   2e-36    
ref|XP_008350494.1|  PREDICTED: galactose oxidase-like                  144   3e-36    
gb|ERM98687.1|  hypothetical protein AMTR_s00109p00131490               144   3e-36    
ref|XP_009337697.1|  PREDICTED: galactose oxidase-like                  144   3e-36    
ref|XP_009336713.1|  PREDICTED: galactose oxidase-like                  144   4e-36    
ref|XP_007222145.1|  hypothetical protein PRUPE_ppa004709mg             143   4e-36    
emb|CAN83495.1|  hypothetical protein VITISV_026965                     144   4e-36    
gb|KJB51134.1|  hypothetical protein B456_008G202800                    143   5e-36    
ref|XP_008390562.1|  PREDICTED: uncharacterized protein LOC103452799    142   1e-35    
ref|XP_004501852.1|  PREDICTED: uncharacterized protein LOC101503410    145   1e-35    
ref|XP_007209962.1|  hypothetical protein PRUPE_ppa004880mg             142   2e-35    
ref|XP_008362947.1|  PREDICTED: galactose oxidase-like                  142   2e-35    
ref|XP_009352508.1|  PREDICTED: galactose oxidase-like                  143   2e-35    
ref|XP_009336703.1|  PREDICTED: galactose oxidase-like                  142   2e-35    
ref|XP_008350495.1|  PREDICTED: galactose oxidase-like                  141   2e-35    
ref|XP_004298451.2|  PREDICTED: galactose oxidase-like                  141   3e-35    
ref|XP_011026783.1|  PREDICTED: galactose oxidase-like                  141   4e-35    
ref|XP_011009462.1|  PREDICTED: galactose oxidase-like                  140   6e-35    
ref|XP_006351423.1|  PREDICTED: uncharacterized protein LOC102595893    140   8e-35    
ref|XP_008242563.1|  PREDICTED: uncharacterized protein LOC103340881    140   2e-34    
ref|XP_007203106.1|  hypothetical protein PRUPE_ppa023837mg             140   2e-34    
ref|XP_006475694.1|  PREDICTED: galactose oxidase-like                  138   3e-34    
ref|XP_008220102.1|  PREDICTED: uncharacterized protein LOC103320236    138   4e-34    
ref|XP_008367891.1|  PREDICTED: galactose oxidase-like                  139   4e-34    
ref|XP_006381726.1|  hypothetical protein POPTR_0006s16390g             138   6e-34    
ref|XP_010663077.1|  PREDICTED: uncharacterized protein LOC100253501    137   8e-34    
ref|XP_009394071.1|  PREDICTED: uncharacterized protein LOC103979627    137   9e-34    
ref|XP_004242940.2|  PREDICTED: uncharacterized protein LOC101252095    137   1e-33    
ref|XP_007037788.1|  Glyoxal oxidase-related protein                    137   1e-33    
ref|XP_004138264.1|  PREDICTED: uncharacterized protein LOC101204692    136   2e-33    
ref|XP_010656292.1|  PREDICTED: galactose oxidase                       137   2e-33    
ref|XP_004236288.1|  PREDICTED: uncharacterized protein LOC101250105    136   2e-33    
ref|XP_004288880.2|  PREDICTED: uncharacterized protein LOC101300395    137   2e-33    
ref|XP_004978797.1|  PREDICTED: galactose oxidase-like                  136   2e-33    
ref|XP_006451231.1|  hypothetical protein CICLE_v10010756mg             136   3e-33    
ref|XP_008464498.1|  PREDICTED: uncharacterized protein LOC103502362    135   3e-33    
ref|XP_004503455.1|  PREDICTED: uncharacterized protein LOC101501825    135   5e-33    
emb|CDP00282.1|  unnamed protein product                                135   5e-33    
ref|XP_001764698.1|  predicted protein                                  134   5e-33    
emb|CBI28031.3|  unnamed protein product                                137   6e-33    
ref|XP_009766667.1|  PREDICTED: uncharacterized protein LOC104217988    135   8e-33    
ref|XP_006341271.1|  PREDICTED: uncharacterized protein LOC102605018    134   9e-33    
ref|XP_010535981.1|  PREDICTED: galactose oxidase-like                  134   1e-32    
gb|EYU17749.1|  hypothetical protein MIMGU_mgv1a003984mg                134   1e-32    
ref|XP_002324431.2|  hypothetical protein POPTR_0018s09110g             134   2e-32    
ref|XP_009600209.1|  PREDICTED: uncharacterized protein LOC104095723    134   2e-32    
ref|XP_007226541.1|  hypothetical protein PRUPE_ppa024999mg             134   2e-32    
ref|XP_003620657.1|  Galactose oxidase                                  133   2e-32    
ref|XP_004139435.1|  PREDICTED: galactose oxidase-like                  134   3e-32    
gb|KJB27154.1|  hypothetical protein B456_004G281000                    134   3e-32    
ref|NP_001150444.1|  glyoxal oxidase precursor                          132   4e-32    
ref|XP_011048365.1|  PREDICTED: galactose oxidase                       132   5e-32    
ref|XP_008460895.1|  PREDICTED: galactose oxidase                       132   6e-32    
ref|XP_003630749.1|  Galactose oxidase                                  132   7e-32    
gb|EYU38846.1|  hypothetical protein MIMGU_mgv1a027114mg                131   7e-32    
dbj|BAL41451.1|  glyoxal oxidase 2                                      133   7e-32    
gb|KEH35019.1|  glyoxal oxidase amino-terminal protein                  131   7e-32    
gb|KCW83241.1|  hypothetical protein EUGRSUZ_B00180                     131   8e-32    
ref|XP_007152887.1|  hypothetical protein PHAVU_004G168600g             132   1e-31    
ref|XP_002299426.2|  hypothetical protein POPTR_0001s11390g             130   2e-31    
ref|XP_002449081.1|  hypothetical protein SORBIDRAFT_05g004490          130   2e-31    
ref|XP_004513017.1|  PREDICTED: uncharacterized protein LOC101505637    131   2e-31    
ref|XP_010535983.1|  PREDICTED: galactose oxidase-like                  131   2e-31    
gb|KCW65018.1|  hypothetical protein EUGRSUZ_G02553                     130   2e-31    
emb|CDY43432.1|  BnaC07g14990D                                          130   2e-31    
ref|XP_007160315.1|  hypothetical protein PHAVU_002G311300g             130   3e-31    
gb|AEA52292.1|  glyoxal oxidase-related protein                         130   3e-31    
gb|KHN45617.1|  hypothetical protein glysoja_031488                     126   5e-31    
gb|KJB27141.1|  hypothetical protein B456_004G281100                    130   7e-31    
gb|KHN16621.1|  Galactose oxidase                                       129   8e-31    
emb|CDP03295.1|  unnamed protein product                                130   1e-30    
ref|XP_006584818.1|  PREDICTED: uncharacterized protein LOC100808336    129   1e-30    
ref|XP_001754066.1|  predicted protein                                  127   2e-30    



>ref|XP_006349488.1| PREDICTED: galactose oxidase-like [Solanum tuberosum]
Length=538

 Score =   328 bits (841),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 151/192 (79%), Positives = 171/192 (89%), Gaps = 1/192 (1%)
 Frame = +3

Query  141  PARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPV  320
            P+RA LPGTWELLVP+AGIASMHTAVT +NTVVLLDRT+IGPSR RLP HHCRND NDP+
Sbjct  22   PSRADLPGTWELLVPDAGIASMHTAVTHYNTVVLLDRTDIGPSRKRLPPHHCRNDPNDPI  81

Query  321  LKTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPC  500
            LK DCYAHSVLLDL TNS+RPL +LTDTWCSSGQFLPDG+L+ TGGDLDGFRKFRKF PC
Sbjct  82   LKKDCYAHSVLLDLETNSVRPLMILTDTWCSSGQFLPDGTLLHTGGDLDGFRKFRKFTPC  141

Query  501  -NSSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFPF  677
             +SSS+CDW+EL++VQLS+GRWY+TNQILP G +IIVGGR A SVE+FPPR  GAV FPF
Sbjct  142  ESSSSVCDWEELQNVQLSEGRWYSTNQILPTGEIIIVGGRAASSVEYFPPRETGAVEFPF  201

Query  678  LGEVEDRQLDNL  713
            L + ED+Q DNL
Sbjct  202  LTQAEDKQHDNL  213



>ref|XP_004249644.1| PREDICTED: galactose oxidase [Solanum lycopersicum]
Length=568

 Score =   326 bits (835),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 152/192 (79%), Positives = 170/192 (89%), Gaps = 1/192 (1%)
 Frame = +3

Query  141  PARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPV  320
            P+ A LPGTWELLVP+AGIASMHTAVT +NTVVLLDRT+IGPSR RLP HHCRND NDP+
Sbjct  52   PSLADLPGTWELLVPDAGIASMHTAVTHYNTVVLLDRTDIGPSRRRLPPHHCRNDPNDPI  111

Query  321  LKTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPC  500
            LK DCYAHS+LLDL TNS+RPL +LTDTWCSSGQFLPDG+L+ TGGDLDGFRKFRKF PC
Sbjct  112  LKKDCYAHSLLLDLETNSVRPLRILTDTWCSSGQFLPDGTLLHTGGDLDGFRKFRKFTPC  171

Query  501  -NSSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFPF  677
             +SSS+CDW+EL++VQLSQGRWY+TNQILP G +IIVGGR A SVEFFPPR  GAV FPF
Sbjct  172  ESSSSVCDWEELQNVQLSQGRWYSTNQILPTGEIIIVGGRAASSVEFFPPRETGAVEFPF  231

Query  678  LGEVEDRQLDNL  713
            L + EDRQ DNL
Sbjct  232  LTQAEDRQHDNL  243



>ref|XP_009602919.1| PREDICTED: galactose oxidase [Nicotiana tomentosiformis]
Length=536

 Score =   321 bits (823),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 152/198 (77%), Positives = 165/198 (83%), Gaps = 1/198 (1%)
 Frame = +3

Query  123  IHSTVNPARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRN  302
            IH     +RA LPGTWELLV  AGIASMHTAVT FNTVVLLDRT+IGPSR  LP HHCR 
Sbjct  14   IHFVTMSSRADLPGTWELLVAEAGIASMHTAVTHFNTVVLLDRTDIGPSRKLLPPHHCRV  73

Query  303  DKNDPVLKTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKF  482
            D NDP+LK DCYAHSVLLDL TNS+RPL +LTDTWCSSGQFLPDG+L+ TGGDLDGFRKF
Sbjct  74   DPNDPILKKDCYAHSVLLDLQTNSIRPLMILTDTWCSSGQFLPDGTLLHTGGDLDGFRKF  133

Query  483  RKFVPCN-SSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGG  659
            RKF PC  S+SLCDW+EL+D QLSQGRWYATNQILP+G +IIVGGR A SVEFFPPR  G
Sbjct  134  RKFTPCEPSNSLCDWEELQDTQLSQGRWYATNQILPNGEIIIVGGRAANSVEFFPPRKEG  193

Query  660  AVHFPFLGEVEDRQLDNL  713
            A  FPFL + ED Q DNL
Sbjct  194  AFEFPFLTQAEDNQHDNL  211



>ref|XP_009774166.1| PREDICTED: galactose oxidase [Nicotiana sylvestris]
Length=536

 Score =   319 bits (817),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 151/198 (76%), Positives = 165/198 (83%), Gaps = 1/198 (1%)
 Frame = +3

Query  123  IHSTVNPARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRN  302
            IH     +RA LPGTWELLV +AGIASMHTAVT FNTVVLLDRT+IGPSR  LP H CR 
Sbjct  14   IHFVTMSSRADLPGTWELLVADAGIASMHTAVTHFNTVVLLDRTDIGPSRKLLPPHRCRV  73

Query  303  DKNDPVLKTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKF  482
            D NDP+LK DCYAHSVLLDL TNS+RPL +LTDTWCSSGQFLPDG+L+ TGGDLDGFRKF
Sbjct  74   DPNDPILKKDCYAHSVLLDLQTNSIRPLMILTDTWCSSGQFLPDGTLLHTGGDLDGFRKF  133

Query  483  RKFVPCN-SSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGG  659
            RKF PC  S+SLCDW+EL+D QLSQGRWYATNQILP+G +IIVGGR A SVEFFPPR  G
Sbjct  134  RKFTPCEPSTSLCDWEELQDTQLSQGRWYATNQILPNGEIIIVGGRAANSVEFFPPRKEG  193

Query  660  AVHFPFLGEVEDRQLDNL  713
            A  FPFL + ED Q DNL
Sbjct  194  AFEFPFLTQAEDNQHDNL  211



>gb|ACV49899.1| glyoxal oxidase [Vitis vinifera]
Length=523

 Score =   317 bits (812),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 162/190 (85%), Gaps = 0/190 (0%)
 Frame = +3

Query  144  ARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVL  323
            A A LPGTWEL+VPNAGIASMHTAVTR+ TVVLLDRTNIGPSR  LP  HCR D  D VL
Sbjct  9    ALADLPGTWELIVPNAGIASMHTAVTRYGTVVLLDRTNIGPSRKMLPKGHCRYDPKDEVL  68

Query  324  KTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCN  503
            K DCYAHSV+LDL+TN +RPL +LTDTWCSSGQFLPDGSL+QTGGDLDG +K RKFVPC 
Sbjct  69   KRDCYAHSVILDLNTNKIRPLKILTDTWCSSGQFLPDGSLLQTGGDLDGVKKIRKFVPCG  128

Query  504  SSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFPFLG  683
                CDW+EL+DV+L  GRWYATNQILPDGSVIIVGGR A SVE++PPR GGAV FPFL 
Sbjct  129  PHGFCDWEELKDVELETGRWYATNQILPDGSVIIVGGRAANSVEYYPPRKGGAVQFPFLS  188

Query  684  EVEDRQLDNL  713
            +VED+Q+DNL
Sbjct  189  DVEDKQMDNL  198



>emb|CDP06561.1| unnamed protein product [Coffea canephora]
Length=541

 Score =   317 bits (812),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 149/194 (77%), Positives = 166/194 (86%), Gaps = 6/194 (3%)
 Frame = +3

Query  150  AALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKT  329
            A LPG+WELLVP+AGIASMHTAVT  NTV+LLDRTNIGPSR  LP H CR+D NDPVLK 
Sbjct  23   ADLPGSWELLVPDAGIASMHTAVTHTNTVILLDRTNIGPSRKLLPPHRCRHDPNDPVLKV  82

Query  330  DCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPC---  500
            DCYAHS LLDL TNS+RPL +LTDTWCSSGQFLPDG+L+ TGGDLDGF K RKF PC   
Sbjct  83   DCYAHSALLDLTTNSIRPLMILTDTWCSSGQFLPDGTLLSTGGDLDGFTKIRKFTPCTES  142

Query  501  ---NSSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHF  671
               ++SSLCDWQELED+QLSQGRWYATNQILPDGS+II+GGR + SVEF+PPR  GAV+F
Sbjct  143  TPNSASSLCDWQELEDIQLSQGRWYATNQILPDGSIIIIGGRASPSVEFYPPRKTGAVNF  202

Query  672  PFLGEVEDRQLDNL  713
            PFL EVED Q+DNL
Sbjct  203  PFLNEVEDNQMDNL  216



>emb|CAN73409.1| hypothetical protein VITISV_024374 [Vitis vinifera]
Length=467

 Score =   314 bits (805),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 161/190 (85%), Gaps = 0/190 (0%)
 Frame = +3

Query  144  ARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVL  323
            A A LPGTWEL+VPNAGIASMHTAVTR+ TVVLLDRTNIGPSR  LP  HCR D  D VL
Sbjct  9    ALADLPGTWELIVPNAGIASMHTAVTRYGTVVLLDRTNIGPSRKMLPKGHCRYDPKDEVL  68

Query  324  KTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCN  503
            K DCYAHSV+LDL+TN +RPL +LTDTWCSSGQFLPDGSL+QTGGDLDG +K RKFVPC 
Sbjct  69   KRDCYAHSVILDLNTNKIRPLKILTDTWCSSGQFLPDGSLLQTGGDLDGVKKIRKFVPCG  128

Query  504  SSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFPFLG  683
                CDW+EL+DV+L  GRWYATNQILPDGSVIIVGGR A SVE++PPR GGAV  PFL 
Sbjct  129  PHGFCDWEELKDVELETGRWYATNQILPDGSVIIVGGRAANSVEYYPPRKGGAVQLPFLS  188

Query  684  EVEDRQLDNL  713
            +VED+Q+DNL
Sbjct  189  DVEDKQMDNL  198



>gb|ABA42922.1| glyoxal oxidase [Vitis pseudoreticulata]
Length=523

 Score =   315 bits (807),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 161/190 (85%), Gaps = 0/190 (0%)
 Frame = +3

Query  144  ARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVL  323
            A A LPGTWEL+VPNAGIASMHTAVTR+ TVVLLDRTNIGPSR  LP  HCR D  D VL
Sbjct  9    ALADLPGTWELIVPNAGIASMHTAVTRYGTVVLLDRTNIGPSRKMLPKGHCRYDPKDEVL  68

Query  324  KTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCN  503
            K DCYAHSV+LDL+TN +RPL +LTDTWCSSGQFLPDGSL+QTGGDLDG +K RKFVPC 
Sbjct  69   KRDCYAHSVILDLNTNKIRPLKILTDTWCSSGQFLPDGSLLQTGGDLDGVKKIRKFVPCG  128

Query  504  SSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFPFLG  683
                CDW+EL+DV+L  GRWYATNQILPDGSVIIVGGR A SVE++PPR GGAV  PFL 
Sbjct  129  PHGFCDWEELKDVELETGRWYATNQILPDGSVIIVGGRAANSVEYYPPRKGGAVQLPFLS  188

Query  684  EVEDRQLDNL  713
            +VED+Q+DNL
Sbjct  189  DVEDKQMDNL  198



>gb|ACV49897.1| glyoxal oxidase [Vitis pseudoreticulata]
Length=523

 Score =   315 bits (807),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 161/190 (85%), Gaps = 0/190 (0%)
 Frame = +3

Query  144  ARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVL  323
            A A LPGTWEL+VPNAGIASMHTAVTR+ TVVLLDRTNIGPSR  LP  HCR D  D VL
Sbjct  9    ALADLPGTWELIVPNAGIASMHTAVTRYGTVVLLDRTNIGPSRKMLPKGHCRYDPKDEVL  68

Query  324  KTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCN  503
            K DCYAHSV+LDL+TN +RPL +LTDTWCSSGQFLPDGSL+QTGGDLDG +K RKFVPC 
Sbjct  69   KRDCYAHSVILDLNTNKIRPLKILTDTWCSSGQFLPDGSLLQTGGDLDGVKKIRKFVPCG  128

Query  504  SSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFPFLG  683
                CDW+EL+DV+L  GRWYATNQILPDGSVIIVGGR A SVE++PPR GGAV  PFL 
Sbjct  129  PHGFCDWEELKDVELETGRWYATNQILPDGSVIIVGGRAANSVEYYPPRKGGAVQLPFLS  188

Query  684  EVEDRQLDNL  713
            +VED+Q+DNL
Sbjct  189  DVEDKQMDNL  198



>gb|ACV49898.1| glyoxal oxidase [Vitis vinifera]
Length=523

 Score =   315 bits (806),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 161/190 (85%), Gaps = 0/190 (0%)
 Frame = +3

Query  144  ARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVL  323
            A A LPGTWEL+VPNAGIASMHTAVTR+ TVVLLDRTNIGPSR  LP  HCR D  D VL
Sbjct  9    ALADLPGTWELIVPNAGIASMHTAVTRYGTVVLLDRTNIGPSRKMLPKGHCRYDPKDEVL  68

Query  324  KTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCN  503
            K DCYAHSV+LDL+TN +RPL +LTDTWCSSGQFLPDGSL+QTGGDLDG +K RKFVPC 
Sbjct  69   KRDCYAHSVILDLNTNKIRPLKILTDTWCSSGQFLPDGSLLQTGGDLDGVKKIRKFVPCG  128

Query  504  SSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFPFLG  683
                CDW+EL+DV+L  GRWYATNQILPDGSVIIVGGR A SVE++PPR GGAV  PFL 
Sbjct  129  PHGFCDWEELKDVELETGRWYATNQILPDGSVIIVGGRAANSVEYYPPRKGGAVQLPFLS  188

Query  684  EVEDRQLDNL  713
            +VED+Q+DNL
Sbjct  189  DVEDKQMDNL  198



>ref|XP_002274763.1| PREDICTED: galactose oxidase [Vitis vinifera]
Length=542

 Score =   315 bits (806),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 161/190 (85%), Gaps = 0/190 (0%)
 Frame = +3

Query  144  ARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVL  323
            A A LPGTWEL+VPNAGIASMHTAVTR+ TVVLLDRTNIGPSR  LP  HCR D  D VL
Sbjct  28   ALADLPGTWELIVPNAGIASMHTAVTRYGTVVLLDRTNIGPSRKMLPKGHCRYDPKDEVL  87

Query  324  KTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCN  503
            K DCYAHSV+LDL+TN +RPL +LTDTWCSSGQFLPDGSL+QTGGDLDG +K RKFVPC 
Sbjct  88   KRDCYAHSVILDLNTNKIRPLKILTDTWCSSGQFLPDGSLLQTGGDLDGVKKIRKFVPCG  147

Query  504  SSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFPFLG  683
                CDW+EL+DV+L  GRWYATNQILPDGSVIIVGGR A SVE++PPR GGAV  PFL 
Sbjct  148  PHGFCDWEELKDVELETGRWYATNQILPDGSVIIVGGRAANSVEYYPPRKGGAVQLPFLS  207

Query  684  EVEDRQLDNL  713
            +VED+Q+DNL
Sbjct  208  DVEDKQMDNL  217



>ref|XP_012087985.1| PREDICTED: galactose oxidase [Jatropha curcas]
 gb|KDP24540.1| hypothetical protein JCGZ_25104 [Jatropha curcas]
Length=537

 Score =   312 bits (800),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 148/195 (76%), Positives = 165/195 (85%), Gaps = 1/195 (1%)
 Frame = +3

Query  129  STVNPARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDK  308
            S++    A LPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSR  LP  HCR DK
Sbjct  18   SSIISTLAQLPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRKMLPKGHCRFDK  77

Query  309  NDPVLKTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRK  488
            ND +LK DCYAHSVLLDL T  +RPL +LTDTWCSSGQFLPDG+L+ TGGDLDGF K RK
Sbjct  78   NDAILKRDCYAHSVLLDLQTKQIRPLMILTDTWCSSGQFLPDGTLLHTGGDLDGFTKIRK  137

Query  489  FVPCNSSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVH  668
            F PC+ + LCDW EL+DV+LS GRWYATNQ+LPDGSVIIVGGR A +VE++PPR  GAV 
Sbjct  138  FEPCDPNGLCDWVELDDVKLSDGRWYATNQVLPDGSVIIVGGRGANTVEYYPPR-NGAVS  196

Query  669  FPFLGEVEDRQLDNL  713
            FPFL +VEDRQ+DNL
Sbjct  197  FPFLSDVEDRQMDNL  211



>ref|XP_003520957.1| PREDICTED: uncharacterized protein LOC100776515 [Glycine max]
Length=539

 Score =   310 bits (793),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 147/196 (75%), Positives = 166/196 (85%), Gaps = 6/196 (3%)
 Frame = +3

Query  144  ARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVL  323
            ARA LPGTWELLVP+AGIASMHTAVTRFNTVVLLDRTNIGPSR  LP  HCR+DKND VL
Sbjct  18   ARADLPGTWELLVPDAGIASMHTAVTRFNTVVLLDRTNIGPSRKLLPKGHCRSDKNDAVL  77

Query  324  KTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCN  503
            K DCYAHSV LDL TN +RPL +LTDTWCSSGQFLPDG+L+QTGGDLDG +K RKF PC+
Sbjct  78   KLDCYAHSVHLDLATNQIRPLKILTDTWCSSGQFLPDGTLLQTGGDLDGLKKIRKFSPCD  137

Query  504  SS------SLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAV  665
             S      S CDW+EL+D++L++GRWYATNQILPDGSVII+GGR + +VEFFPP+  GAV
Sbjct  138  VSSSSSLHSPCDWEELDDIELAEGRWYATNQILPDGSVIIIGGRGSNTVEFFPPKRNGAV  197

Query  666  HFPFLGEVEDRQLDNL  713
             FPFL E ED Q+DNL
Sbjct  198  SFPFLSETEDTQMDNL  213



>ref|XP_007134016.1| hypothetical protein PHAVU_010G012100g [Phaseolus vulgaris]
 gb|ESW06010.1| hypothetical protein PHAVU_010G012100g [Phaseolus vulgaris]
Length=534

 Score =   309 bits (791),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = +3

Query  144  ARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVL  323
            ARA LPG+WE+LV +AG+ASMHTAVTRFNTVVLLDRTNIGPSR  LP  HCR D+ND +L
Sbjct  21   ARADLPGSWEILVSDAGVASMHTAVTRFNTVVLLDRTNIGPSRKLLPKGHCRYDRNDALL  80

Query  324  KTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCN  503
            K DCYAHSV LDL TN +RPL +LTDTWCSSGQFLPDG+L+QTGGDLDG +K R F PC+
Sbjct  81   KRDCYAHSVHLDLQTNQVRPLKILTDTWCSSGQFLPDGTLLQTGGDLDGLKKIRLFSPCD  140

Query  504  SSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFPFLG  683
            ++ LCDW+EL+DV+L++GRWYATNQILPDGSVII+GGR + +VEFFPPR  GAV FPFL 
Sbjct  141  ATGLCDWKELDDVELAEGRWYATNQILPDGSVIIIGGRGSNTVEFFPPRKHGAVSFPFLA  200

Query  684  EVEDRQLDNL  713
            E ED Q+DNL
Sbjct  201  ETEDTQMDNL  210



>ref|XP_003516307.1| PREDICTED: galactose oxidase-like [Glycine max]
Length=547

 Score =   309 bits (791),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 163/190 (86%), Gaps = 1/190 (1%)
 Frame = +3

Query  144  ARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVL  323
            ARA LPGTWELLVP+AGIASMHTAVTRFNTVVLLDRTNIGPSR  LP  HCR+DKND VL
Sbjct  33   ARADLPGTWELLVPDAGIASMHTAVTRFNTVVLLDRTNIGPSRKLLPKGHCRSDKNDAVL  92

Query  324  KTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCN  503
            K DCYAHSV LDL TN +RPL +LTDTWCSSGQFLPDG+L+QTGGDLDG +K RKF PC+
Sbjct  93   KLDCYAHSVHLDLATNQIRPLKILTDTWCSSGQFLPDGTLLQTGGDLDGLKKIRKFSPCD  152

Query  504  SSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFPFLG  683
             +S CDW+EL DV L++GRWYATNQILPDGSVII+GGR + +VEFFPP+   AV FPFL 
Sbjct  153  DAS-CDWEELNDVVLAEGRWYATNQILPDGSVIIIGGRGSNTVEFFPPKQNVAVSFPFLS  211

Query  684  EVEDRQLDNL  713
            E ED Q+DNL
Sbjct  212  ETEDTQMDNL  221



>ref|XP_004137754.1| PREDICTED: galactose oxidase [Cucumis sativus]
 gb|KGN58827.1| hypothetical protein Csa_3G733320 [Cucumis sativus]
Length=535

 Score =   306 bits (784),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 142/189 (75%), Positives = 161/189 (85%), Gaps = 0/189 (0%)
 Frame = +3

Query  147  RAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLK  326
            RA LPGTWELL+PNAGIASMHTAVTRFNTVVLLDRTNIGP+R  L   HCRND+ D +LK
Sbjct  22   RADLPGTWELLIPNAGIASMHTAVTRFNTVVLLDRTNIGPTRKMLRKGHCRNDRYDAILK  81

Query  327  TDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNS  506
             DCYAHSVLLDL TN +RPLT+LTDTWCSSGQFLPDG+L+ TGGD+DG RKFRKF PC  
Sbjct  82   HDCYAHSVLLDLQTNQIRPLTILTDTWCSSGQFLPDGTLLHTGGDIDGLRKFRKFQPCEP  141

Query  507  SSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFPFLGE  686
            +  CDW EL + +L+ GRWYATNQILPDGSVIIVGGR A +VE++PPR  GAV+FPFL +
Sbjct  142  NGACDWIELSEPELADGRWYATNQILPDGSVIIVGGRGANTVEYYPPRKNGAVNFPFLRD  201

Query  687  VEDRQLDNL  713
            VED Q+DNL
Sbjct  202  VEDGQMDNL  210



>ref|XP_008442498.1| PREDICTED: LOW QUALITY PROTEIN: galactose oxidase [Cucumis melo]
Length=537

 Score =   305 bits (782),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 142/189 (75%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = +3

Query  147  RAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLK  326
            RA LPGTWELL+PNAGIASMHTAVTRFNTVVLLDRTNIGP+R  L   HCRND+ D VLK
Sbjct  24   RADLPGTWELLIPNAGIASMHTAVTRFNTVVLLDRTNIGPTRKMLRKGHCRNDRYDAVLK  83

Query  327  TDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNS  506
             DCYAHSV+LDL TN +RPLT+LTDTWCSSGQFLPDG+L+ TGGD+DG RKFRKF PC  
Sbjct  84   HDCYAHSVVLDLQTNQIRPLTILTDTWCSSGQFLPDGTLLHTGGDIDGLRKFRKFQPCEP  143

Query  507  SSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFPFLGE  686
            +  CDW EL + +L+ GRWYATNQILPDGSVIIVGGR A +VE++PPR  GAV FPFL +
Sbjct  144  NGACDWIELSEPELADGRWYATNQILPDGSVIIVGGRGANTVEYYPPRKNGAVXFPFLRD  203

Query  687  VEDRQLDNL  713
            VED Q+DNL
Sbjct  204  VEDGQMDNL  212



>ref|XP_010088559.1| hypothetical protein L484_016951 [Morus notabilis]
 gb|EXB36700.1| hypothetical protein L484_016951 [Morus notabilis]
Length=538

 Score =   305 bits (781),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 158/190 (83%), Gaps = 0/190 (0%)
 Frame = +3

Query  144  ARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVL  323
            ARA LPGTWE+LV NAGIASMHTAVTRFNTVVLLDRTNIGPSR  L   HCR+D+ND VL
Sbjct  24   ARAQLPGTWEILVENAGIASMHTAVTRFNTVVLLDRTNIGPSRKLLRKGHCRSDRNDAVL  83

Query  324  KTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCN  503
            K DCYAHSVLLDL TN +RPL +LTDTWCSSGQFLP+G+L+QTGGDLDGF K RKF PC 
Sbjct  84   KHDCYAHSVLLDLATNQIRPLMILTDTWCSSGQFLPNGTLLQTGGDLDGFNKIRKFDPCE  143

Query  504  SSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFPFLG  683
             +  CDW EL+DV L  GRWYATNQILPDGSVIIVGGR A +VE+FPPR  GAV  PFL 
Sbjct  144  PNGSCDWVELDDVALIDGRWYATNQILPDGSVIIVGGRAANTVEYFPPRKNGAVSIPFLA  203

Query  684  EVEDRQLDNL  713
            E ED Q+DNL
Sbjct  204  EAEDNQMDNL  213



>gb|KJB36661.1| hypothetical protein B456_006G169500 [Gossypium raimondii]
Length=538

 Score =   302 bits (774),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 158/191 (83%), Gaps = 2/191 (1%)
 Frame = +3

Query  147  RAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLK  326
            RA LPGTWELLVPNAG+ASMHTAVTRFNTVVLLDRTNIGPSR  LP  HCR D ND VLK
Sbjct  24   RAQLPGTWELLVPNAGVASMHTAVTRFNTVVLLDRTNIGPSRKMLPKGHCRIDSNDVVLK  83

Query  327  TDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNS  506
             DC+AHSV+LDL TN +RPL +LTDTWCSSGQFLPDG+L+QTGGDLDGF+K RKF PC  
Sbjct  84   KDCFAHSVVLDLQTNQIRPLMILTDTWCSSGQFLPDGTLVQTGGDLDGFKKIRKFEPCEP  143

Query  507  SSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXG--GAVHFPFL  680
               CDW EL+DV+L+ GRWYATNQILPDG+VIIVGGR   +VE++PPR    GA+   FL
Sbjct  144  GEFCDWVELKDVELANGRWYATNQILPDGTVIIVGGRGTNTVEYYPPRKNKKGAIELKFL  203

Query  681  GEVEDRQLDNL  713
             +VED Q+DNL
Sbjct  204  ADVEDNQMDNL  214



>ref|XP_006403636.1| hypothetical protein EUTSA_v100109140mg, partial [Eutrema salsugineum]
 gb|ESQ45089.1| hypothetical protein EUTSA_v100109140mg, partial [Eutrema salsugineum]
Length=281

 Score =   293 bits (750),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 155/190 (82%), Gaps = 0/190 (0%)
 Frame = +3

Query  144  ARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVL  323
            ARA LPGTWEL+V +AGIASMHTAVTRFNTVVLLDRTNIGPSR  L  H CR D  D VL
Sbjct  33   ARADLPGTWELIVQDAGIASMHTAVTRFNTVVLLDRTNIGPSRKALGQHRCRKDPKDAVL  92

Query  324  KTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCN  503
            K DCYAHSVL DL TN +RPL + TDTWCSSGQFL DGSL+QTGGD DGF+K R+F PC+
Sbjct  93   KRDCYAHSVLFDLGTNQIRPLMIQTDTWCSSGQFLSDGSLLQTGGDRDGFKKIRRFEPCD  152

Query  504  SSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFPFLG  683
             +  CDW EL+D +L  GRWYATNQILPDGSVIIVGGR   +VE++PPR  GAV FPFL 
Sbjct  153  PNEKCDWVELQDTELRTGRWYATNQILPDGSVIIVGGRGTNTVEYYPPRENGAVPFPFLA  212

Query  684  EVEDRQLDNL  713
            +VED+Q+DNL
Sbjct  213  DVEDKQMDNL  222



>ref|XP_010553274.1| PREDICTED: galactose oxidase [Tarenaya hassleriana]
Length=537

 Score =   299 bits (766),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 156/190 (82%), Gaps = 0/190 (0%)
 Frame = +3

Query  144  ARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVL  323
            ARA LPGTWELLVP+AGIASMHTAVTRFNTVVLLDRTNIGPSR  L    CR D++DP+L
Sbjct  22   ARADLPGTWELLVPDAGIASMHTAVTRFNTVVLLDRTNIGPSRKFLGHKRCRRDQSDPIL  81

Query  324  KTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCN  503
            K DCYAHSV  DL TN +RPL + TDTWCSSGQFLPDGSL+QTGGDLDGFRK R+F PC 
Sbjct  82   KLDCYAHSVQFDLGTNRIRPLMIQTDTWCSSGQFLPDGSLLQTGGDLDGFRKIRRFDPCE  141

Query  504  SSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFPFLG  683
             +  CDW EL D +L  GRWYATNQILPDGSVIIVGGR   +VE++PPR  GAV FPFL 
Sbjct  142  PTGSCDWVELSDTELVAGRWYATNQILPDGSVIIVGGRGTSTVEYYPPRKNGAVPFPFLA  201

Query  684  EVEDRQLDNL  713
            +VED Q+DNL
Sbjct  202  DVEDTQMDNL  211



>ref|XP_010044010.1| PREDICTED: galactose oxidase [Eucalyptus grandis]
 gb|KCW86022.1| hypothetical protein EUGRSUZ_B02726 [Eucalyptus grandis]
Length=546

 Score =   298 bits (764),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 140/192 (73%), Positives = 161/192 (84%), Gaps = 2/192 (1%)
 Frame = +3

Query  144  ARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRL--PAHHCRNDKNDP  317
            ARA LPGTWELLV +AGIASMHTAVTRFNTVVLLDRTNIGPSR+RL  P   CR +  D 
Sbjct  30   ARAGLPGTWELLVADAGIASMHTAVTRFNTVVLLDRTNIGPSRLRLRLPHGGCRRNPRDA  89

Query  318  VLKTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVP  497
            VLK DCYAHS +LDL TN +RPLT+LTDTWCSSGQFLPDGSL+QTGGDLDG RK R+F P
Sbjct  90   VLKRDCYAHSAVLDLATNRIRPLTILTDTWCSSGQFLPDGSLLQTGGDLDGVRKIRRFEP  149

Query  498  CNSSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFPF  677
            C+++  CDW EL+ V+L+ GRWY TNQILPDGSVI+VGGR A +VE++PPR GGAV FPF
Sbjct  150  CDAAGGCDWVELDHVELADGRWYGTNQILPDGSVIVVGGRAANTVEYYPPREGGAVFFPF  209

Query  678  LGEVEDRQLDNL  713
            L +  D+Q+DNL
Sbjct  210  LADAGDKQMDNL  221



>ref|XP_002322929.1| glyoxal oxidase-related family protein [Populus trichocarpa]
 gb|EEF04690.1| glyoxal oxidase-related family protein [Populus trichocarpa]
Length=528

 Score =   296 bits (759),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 162/190 (85%), Gaps = 1/190 (1%)
 Frame = +3

Query  144  ARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVL  323
            +RA LPGTW+LLVPNAGI+SMHTAVTRFNTVVLLDRTN GPSR  L   HCR D +D VL
Sbjct  15   SRAELPGTWDLLVPNAGISSMHTAVTRFNTVVLLDRTNTGPSRKMLRKGHCRLDPHDAVL  74

Query  324  KTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCN  503
            K DCYAHSVL DL TN +RPL +LTDTWCSSGQFL DG+L+QTGGDLDGF+K RKF PC+
Sbjct  75   KRDCYAHSVLFDLQTNQIRPLMILTDTWCSSGQFLHDGTLLQTGGDLDGFKKIRKFDPCD  134

Query  504  SSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFPFLG  683
             +  CDW EL+DV+LS+GRWYA+NQILPDGSVII+GGR A +VE++PPR  GAV FPFL 
Sbjct  135  INGSCDWVELDDVELSEGRWYASNQILPDGSVIIIGGRGANTVEYYPPR-NGAVLFPFLA  193

Query  684  EVEDRQLDNL  713
            +VED+Q+DNL
Sbjct  194  DVEDKQMDNL  203



>ref|XP_004305171.1| PREDICTED: galactose oxidase [Fragaria vesca subsp. vesca]
Length=535

 Score =   296 bits (758),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 142/197 (72%), Positives = 160/197 (81%), Gaps = 1/197 (1%)
 Frame = +3

Query  123  IHSTVNPARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRN  302
            +HS     RA LPGTW+LLV NAGIASMHTAVTRFNTVVLLDRTNIGPSR  L   HCRN
Sbjct  15   LHSVAISTRADLPGTWDLLVANAGIASMHTAVTRFNTVVLLDRTNIGPSRKMLSRGHCRN  74

Query  303  DKNDPVLKTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKF  482
            D ND VLK DCYAHSV  D +TN +RPL +LTDTWCSSGQFLPDG+L+QTGGDLDG RK 
Sbjct  75   DPNDAVLKHDCYAHSVQFDPNTNQIRPLMILTDTWCSSGQFLPDGTLLQTGGDLDGVRKI  134

Query  483  RKFVPCNSSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGA  662
            RKF PC+++  CDW EL+DV+L+ GRWYATNQILPDGSVIIVGGR A +VE++PPR  G 
Sbjct  135  RKFHPCDAAGSCDWVELDDVELTDGRWYATNQILPDGSVIIVGGRGANTVEYYPPR-NGV  193

Query  663  VHFPFLGEVEDRQLDNL  713
            V   FL +VED Q+DNL
Sbjct  194  VELKFLADVEDTQMDNL  210



>ref|XP_007026880.1| Glyoxal oxidase-related protein [Theobroma cacao]
 gb|EOY07382.1| Glyoxal oxidase-related protein [Theobroma cacao]
Length=783

 Score =   302 bits (774),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/197 (71%), Positives = 158/197 (80%), Gaps = 0/197 (0%)
 Frame = +3

Query  123  IHSTVNPARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRN  302
            I +T+   RA LPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSR  LP  HCR 
Sbjct  260  IFTTLVAVRAQLPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRKMLPKGHCRI  319

Query  303  DKNDPVLKTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKF  482
            D  D +LK DCYAHSV+ D  TN +RPL +LTDTWCSSGQFLPDG+L+QTGGDLDGF+K 
Sbjct  320  DPTDVILKKDCYAHSVVFDPQTNHIRPLMILTDTWCSSGQFLPDGTLLQTGGDLDGFKKI  379

Query  483  RKFVPCNSSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGA  662
            RKF PC  +  CDW EL DV+L  GRWYATNQILPDG+VIIVGGR   +VE+ PPR  GA
Sbjct  380  RKFEPCEPTGFCDWVELRDVELVNGRWYATNQILPDGTVIIVGGRGTNTVEYVPPRKNGA  439

Query  663  VHFPFLGEVEDRQLDNL  713
            +   FL +VED+Q+DNL
Sbjct  440  IELKFLADVEDKQMDNL  456



>gb|KJB16941.1| hypothetical protein B456_002G255700 [Gossypium raimondii]
Length=473

 Score =   293 bits (751),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 139/199 (70%), Positives = 158/199 (79%), Gaps = 2/199 (1%)
 Frame = +3

Query  123  IHSTVNPARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRN  302
            I  T++   A LPG+WELLV NAG+ASMHTAVTRFNTVVLLDRTNIGPSR  LP  HCR 
Sbjct  13   IFITLSTVHAQLPGSWELLVSNAGVASMHTAVTRFNTVVLLDRTNIGPSRKMLPKGHCRY  72

Query  303  DKNDPVLKTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKF  482
            D++D VLK DCYAHSV+ DL TN +RPL +LTDTWCSSGQFLPDG+L+QTGGDLDGF+K 
Sbjct  73   DRHDDVLKKDCYAHSVVFDLQTNEIRPLMILTDTWCSSGQFLPDGTLLQTGGDLDGFKKI  132

Query  483  RKFVPCNSSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRX--G  656
            RKF PC     CDW EL+DV+L  GRWYATNQILPDG+VIIVGGR   +VE++PP     
Sbjct  133  RKFEPCEPDRFCDWVELKDVELINGRWYATNQILPDGTVIIVGGRGTNTVEYYPPTKTQN  192

Query  657  GAVHFPFLGEVEDRQLDNL  713
            GAV   FL EVED Q+DNL
Sbjct  193  GAVELKFLAEVEDNQMDNL  211



>ref|XP_011094925.1| PREDICTED: galactose oxidase [Sesamum indicum]
Length=533

 Score =   295 bits (755),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 144/195 (74%), Positives = 162/195 (83%), Gaps = 4/195 (2%)
 Frame = +3

Query  138  NPARAA--LPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKN  311
            N A AA  LPG WELLVP+AGIASMHTAVTRFNTVVLLDRT+IGPSR  LP   C  +  
Sbjct  15   NAATAADLLPGVWELLVPDAGIASMHTAVTRFNTVVLLDRTHIGPSRKLLPKDRCLVNPA  74

Query  312  DPVLKTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKF  491
            +P  K DC AHSVLLDL TN++RPLT+LTDTWCSSGQFLPDGSLIQTGGDLDGF+K RKF
Sbjct  75   NPHRK-DCTAHSVLLDLQTNNIRPLTILTDTWCSSGQFLPDGSLIQTGGDLDGFKKIRKF  133

Query  492  VPCNSSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXG-GAVH  668
             PC   S CDW+EL+D++L QGRWYATNQILPDGS+II+GG++A SVEFFPPR   GA +
Sbjct  134  TPCEPGSFCDWEELQDLELYQGRWYATNQILPDGSIIIIGGKSANSVEFFPPRKEIGAAN  193

Query  669  FPFLGEVEDRQLDNL  713
            FPFL EVED Q+DNL
Sbjct  194  FPFLSEVEDNQMDNL  208



>ref|XP_009378883.1| PREDICTED: uncharacterized protein LOC103967351 [Pyrus x bretschneideri]
Length=423

 Score =   291 bits (745),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 155/190 (82%), Gaps = 1/190 (1%)
 Frame = +3

Query  144  ARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVL  323
            ARA LPGTWELLV NAG+ASMHTAVTRFNTVVLLDRT+IGPSR  L   HCRND  D VL
Sbjct  22   ARADLPGTWELLVENAGVASMHTAVTRFNTVVLLDRTSIGPSRKMLRRGHCRNDPYDAVL  81

Query  324  KTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCN  503
            K DCYAHSVL DL T  +RPL + TDTWCSSGQFLPDG+L+QTGGDLDG +K RKFVPC 
Sbjct  82   KRDCYAHSVLFDLQTKQIRPLMIQTDTWCSSGQFLPDGTLLQTGGDLDGVKKIRKFVPCE  141

Query  504  SSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFPFLG  683
            ++  CDW EL DV+L+ GRWYATNQILPDGSV IVGGR A +VE++PPR  GAV   FL 
Sbjct  142  ATGSCDWVELADVELANGRWYATNQILPDGSVAIVGGRAANTVEYYPPRK-GAVALNFLA  200

Query  684  EVEDRQLDNL  713
            +VED Q+DNL
Sbjct  201  DVEDNQMDNL  210



>ref|XP_011006630.1| PREDICTED: galactose oxidase [Populus euphratica]
Length=528

 Score =   293 bits (751),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 160/190 (84%), Gaps = 1/190 (1%)
 Frame = +3

Query  144  ARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVL  323
            + A LPGTW+LLV NAGI+SMHTAVTRFNTVVLLDRTNIGPSR  L   HCR D  D VL
Sbjct  15   SHAELPGTWDLLVSNAGISSMHTAVTRFNTVVLLDRTNIGPSRKMLRKGHCRVDPYDAVL  74

Query  324  KTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCN  503
            K DCYAHSVL DL TN +RPL +LTDTWCSSGQFL DG+L+QTGGDLDGF+K RKF PC+
Sbjct  75   KRDCYAHSVLFDLQTNQIRPLMILTDTWCSSGQFLHDGTLLQTGGDLDGFKKIRKFDPCD  134

Query  504  SSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFPFLG  683
             +  CDW EL+DV+LS+GRWYA+NQILPDGSVIIVGGR A +VE++PPR  GAV FPFL 
Sbjct  135  INGSCDWVELDDVELSEGRWYASNQILPDGSVIIVGGRGANTVEYYPPRD-GAVLFPFLA  193

Query  684  EVEDRQLDNL  713
            +VED+Q+DNL
Sbjct  194  DVEDKQMDNL  203



>ref|XP_008359690.1| PREDICTED: LOW QUALITY PROTEIN: galactose oxidase [Malus domestica]
Length=535

 Score =   292 bits (747),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 155/190 (82%), Gaps = 1/190 (1%)
 Frame = +3

Query  144  ARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVL  323
            ARA LPGTWELLV NAG+ASMHTAVTRFNTVVLLDRTNIGPSR  L   HCRND  D VL
Sbjct  22   ARADLPGTWELLVQNAGLASMHTAVTRFNTVVLLDRTNIGPSRKMLRRGHCRNDPYDAVL  81

Query  324  KTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCN  503
            K DCYAHSVL DL T  +RPL + TDTWCSSGQFLPDG+L+QTGGDLDG +K RKFVPC 
Sbjct  82   KLDCYAHSVLFDLQTKQIRPLMIQTDTWCSSGQFLPDGTLLQTGGDLDGVKKIRKFVPCE  141

Query  504  SSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFPFLG  683
            ++  CDW EL DV+L+ GRWYATNQILPDGSV IVGGR A +VE++PPR  GAV   FL 
Sbjct  142  ATGSCDWVELADVELANGRWYATNQILPDGSVAIVGGRAANTVEYYPPRK-GAVALNFLA  200

Query  684  EVEDRQLDNL  713
            +VED Q+DNL
Sbjct  201  DVEDNQMDNL  210



>ref|XP_010262660.1| PREDICTED: galactose oxidase [Nelumbo nucifera]
Length=536

 Score =   292 bits (747),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 152/188 (81%), Gaps = 0/188 (0%)
 Frame = +3

Query  150  AALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKT  329
              LPGTWELLVPN GIASMHTAVT + TVVLLDRTNIGPSR  L   HCR D  D VLK 
Sbjct  24   GGLPGTWELLVPNVGIASMHTAVTHYGTVVLLDRTNIGPSRRMLRKGHCRFDLKDRVLKH  83

Query  330  DCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSS  509
            DCYAHSVL D  TN +RPL +LTDTWCSSGQFLPDG+L+QTGGDLDG +K RKF PC   
Sbjct  84   DCYAHSVLFDPATNQIRPLMILTDTWCSSGQFLPDGTLLQTGGDLDGLKKIRKFAPCEPD  143

Query  510  SLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFPFLGEV  689
             LCDW+EL+DV+L+ GRWY+TNQILPDGS+IIVGGR A SVEF+PP+  GAV  PFL +V
Sbjct  144  KLCDWEELDDVELAAGRWYSTNQILPDGSIIIVGGRAASSVEFYPPKKHGAVVLPFLADV  203

Query  690  EDRQLDNL  713
            ED Q+DNL
Sbjct  204  EDNQMDNL  211



>emb|CDY59162.1| BnaC06g42590D [Brassica napus]
Length=540

 Score =   291 bits (746),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 154/189 (81%), Gaps = 0/189 (0%)
 Frame = +3

Query  147  RAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLK  326
            RA LPGTWEL+V +AGIASMHTAVTRFNTVVLLDRTNIGPSR  L  H CR D ND VLK
Sbjct  25   RADLPGTWELIVQDAGIASMHTAVTRFNTVVLLDRTNIGPSRKALGKHRCRKDPNDAVLK  84

Query  327  TDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNS  506
             DCYAHSVL DL TN +RPL + TDTWCSSGQFL DGSL+QTGGD DGF+K RKF PC+ 
Sbjct  85   RDCYAHSVLFDLGTNQIRPLMIQTDTWCSSGQFLSDGSLLQTGGDRDGFKKIRKFEPCDP  144

Query  507  SSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFPFLGE  686
            +  CDW EL+D +L  GRWYA+NQILPDGSVIIVGGR   +VE++PPR  GAV F FL +
Sbjct  145  NETCDWVELQDTELITGRWYASNQILPDGSVIIVGGRGTNTVEYYPPRENGAVPFQFLAD  204

Query  687  VEDRQLDNL  713
            VED+Q+DNL
Sbjct  205  VEDKQMDNL  213



>ref|XP_010515903.1| PREDICTED: galactose oxidase-like [Camelina sativa]
Length=544

 Score =   291 bits (746),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 154/190 (81%), Gaps = 0/190 (0%)
 Frame = +3

Query  144  ARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVL  323
            ARA LPGTWEL+V +AGIASMHTAVTRFNTV+LLDRTNIGPSR  L  H CR D ND  L
Sbjct  28   ARADLPGTWELIVQDAGIASMHTAVTRFNTVILLDRTNIGPSRKALNRHRCRRDPNDAAL  87

Query  324  KTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCN  503
            K DCYAHSVL DL TN +RPL + TDTWCSSGQFL DGSL+QTGGD DGF+K RKF PC+
Sbjct  88   KHDCYAHSVLFDLATNQIRPLMIQTDTWCSSGQFLSDGSLLQTGGDKDGFKKIRKFEPCD  147

Query  504  SSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFPFLG  683
             +  CDW EL+D +L  GRWYATNQILPDGSVIIVGGR   +VE++PPR  GAV F FL 
Sbjct  148  PNETCDWVELQDTELITGRWYATNQILPDGSVIIVGGRGTNTVEYYPPRENGAVPFQFLA  207

Query  684  EVEDRQLDNL  713
            +VED+Q+DNL
Sbjct  208  DVEDKQMDNL  217



>ref|XP_007208466.1| hypothetical protein PRUPE_ppa003992mg [Prunus persica]
 gb|EMJ09665.1| hypothetical protein PRUPE_ppa003992mg [Prunus persica]
Length=536

 Score =   291 bits (745),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 156/190 (82%), Gaps = 1/190 (1%)
 Frame = +3

Query  144  ARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVL  323
            ARA LPGTWELLV NAG++SMHTAVTRFNTVVLLDRTNIGPSR  L   HCR+D  D VL
Sbjct  23   ARADLPGTWELLVENAGVSSMHTAVTRFNTVVLLDRTNIGPSRKMLRKGHCRSDPKDAVL  82

Query  324  KTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCN  503
            K DCYAHSVL D  TN +RPL + TDTWCSSGQFLPDGSL+QTGGDLDGF+K RKF PC 
Sbjct  83   KHDCYAHSVLFDPKTNQIRPLMINTDTWCSSGQFLPDGSLLQTGGDLDGFKKIRKFDPCE  142

Query  504  SSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFPFLG  683
             +  CDW EL DV+LS+GRWY+TNQILPDGSVIIVGGR A +VE++PPR  GAV   FL 
Sbjct  143  LNGSCDWVELADVELSEGRWYSTNQILPDGSVIIVGGRAANTVEYYPPRT-GAVSLNFLA  201

Query  684  EVEDRQLDNL  713
            +VED Q+DNL
Sbjct  202  DVEDTQMDNL  211



>ref|XP_010674911.1| PREDICTED: uncharacterized protein LOC104890981 [Beta vulgaris 
subsp. vulgaris]
Length=536

 Score =   290 bits (743),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 153/190 (81%), Gaps = 0/190 (0%)
 Frame = +3

Query  144  ARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVL  323
            +RA LPGTWELLV + GIASMHTAVT F TVVLLDRTNIGP+R+ LP HHCR D ND VL
Sbjct  22   SRAELPGTWELLVADVGIASMHTAVTHFGTVVLLDRTNIGPTRLLLPKHHCRTDPNDAVL  81

Query  324  KTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCN  503
            K DCYAHS L D  TN +RPL + TDTWCSSGQFL DG+L+QTGGD DG++K RKF PC 
Sbjct  82   KHDCYAHSALFDPITNKIRPLIIQTDTWCSSGQFLSDGTLLQTGGDQDGWKKIRKFKPCE  141

Query  504  SSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFPFLG  683
            ++  CDW+EL DV L  GRWY+TNQILP+G VIIVGG+ A SVEF+PPR  GAV FPFL 
Sbjct  142  TTEFCDWEELNDVVLDHGRWYSTNQILPNGDVIIVGGKVAFSVEFYPPRQNGAVLFPFLA  201

Query  684  EVEDRQLDNL  713
            +VEDRQ DNL
Sbjct  202  DVEDRQGDNL  211



>ref|XP_006290869.1| hypothetical protein CARUB_v10016978mg [Capsella rubella]
 gb|EOA23767.1| hypothetical protein CARUB_v10016978mg [Capsella rubella]
Length=538

 Score =   290 bits (743),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 154/190 (81%), Gaps = 0/190 (0%)
 Frame = +3

Query  144  ARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVL  323
            ARA LPGTW+L+V +AGIASMHTAVTRFNTV+LLDRTNIGPSR  L  H CR D ND  L
Sbjct  22   ARADLPGTWQLIVQDAGIASMHTAVTRFNTVILLDRTNIGPSRKALDRHRCRRDPNDAAL  81

Query  324  KTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCN  503
            K DCYAHSVL DL TN +RPL + TDTWCSSGQFL DGSL+QTGGD DGFRK R+F PC+
Sbjct  82   KHDCYAHSVLFDLATNQIRPLMIQTDTWCSSGQFLSDGSLLQTGGDKDGFRKIRRFEPCD  141

Query  504  SSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFPFLG  683
             +  CDW EL+D +L  GRWYATNQILPDGSVIIVGGR   +VE++PPR  GAV F FL 
Sbjct  142  PNETCDWVELQDTELITGRWYATNQILPDGSVIIVGGRGTNTVEYYPPRENGAVPFQFLA  201

Query  684  EVEDRQLDNL  713
            +VED+Q+DNL
Sbjct  202  DVEDKQMDNL  211



>gb|EPS61181.1| glyoxal oxidase, partial [Genlisea aurea]
Length=526

 Score =   290 bits (742),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 140/195 (72%), Positives = 161/195 (83%), Gaps = 2/195 (1%)
 Frame = +3

Query  132  TVNPARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKN  311
            TV    AALPG WE+LV +AGIASMHTAVTRFNT VLLDRT+IGPS I LP   C  +  
Sbjct  9    TVAGVGAALPGEWEILVVDAGIASMHTAVTRFNTAVLLDRTHIGPSNISLPNKGCLVNPA  68

Query  312  DPVLKTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKF  491
            +P  K DC AHSV+LDL +N++RPL + TDTWCSSGQFLPDGSLIQTGGDLDGF+KFR+F
Sbjct  69   NPRRK-DCTAHSVVLDLRSNTVRPLKISTDTWCSSGQFLPDGSLIQTGGDLDGFKKFRRF  127

Query  492  VPCNSSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPR-XGGAVH  668
             PC+S SLCDW+ELE+V+L QGRWYATNQILPDGS+IIVGG+++ SVEFFPPR   GAV 
Sbjct  128  TPCDSGSLCDWEELENVELFQGRWYATNQILPDGSIIIVGGKSSYSVEFFPPRTAAGAVK  187

Query  669  FPFLGEVEDRQLDNL  713
            FPFL E ED Q+DNL
Sbjct  188  FPFLSEAEDNQMDNL  202



>gb|KFK34638.1| hypothetical protein AALP_AA5G172000 [Arabis alpina]
Length=541

 Score =   289 bits (740),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 136/189 (72%), Positives = 152/189 (80%), Gaps = 0/189 (0%)
 Frame = +3

Query  147  RAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLK  326
            RA LPGTWEL+V +AGIASMHTAVTRFNTV+LLDRTN GPSR  L  H CR D ND VLK
Sbjct  26   RADLPGTWELIVQDAGIASMHTAVTRFNTVILLDRTNTGPSRKSLGQHRCRKDPNDVVLK  85

Query  327  TDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNS  506
             DCYAHSVL DL TN +RPL + TDTWCSSGQFL DGSL+QTGGD DGF+K RKF PC  
Sbjct  86   HDCYAHSVLFDLGTNQIRPLMIQTDTWCSSGQFLSDGSLLQTGGDRDGFKKIRKFEPCEP  145

Query  507  SSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFPFLGE  686
            +  CDW EL+D +L  GRWYATNQILPDGSVIIVGGR   +VE++PPR  GAV F FL +
Sbjct  146  NETCDWVELQDTELITGRWYATNQILPDGSVIIVGGRGTNTVEYYPPRQNGAVPFQFLAD  205

Query  687  VEDRQLDNL  713
            VED+Q+DNL
Sbjct  206  VEDKQMDNL  214



>ref|XP_002876232.1| hypothetical protein ARALYDRAFT_485786 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52491.1| hypothetical protein ARALYDRAFT_485786 [Arabidopsis lyrata subsp. 
lyrata]
Length=542

 Score =   289 bits (740),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 153/190 (81%), Gaps = 0/190 (0%)
 Frame = +3

Query  144  ARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVL  323
            ARA LPGTWEL+V +AGIASMHTAVTRFNTV+LLDRTNIGPSR  L  H CR D  D  L
Sbjct  25   ARADLPGTWELIVQDAGIASMHTAVTRFNTVILLDRTNIGPSRKALDRHRCRRDPKDAAL  84

Query  324  KTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCN  503
            K DCYAHSVL DL TN +RPL + TDTWCSSGQFL DGSL+QTGGD DGF+K RKF PC+
Sbjct  85   KHDCYAHSVLFDLGTNQIRPLMIQTDTWCSSGQFLSDGSLLQTGGDKDGFKKIRKFEPCD  144

Query  504  SSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFPFLG  683
             +  CDW EL+D +L  GRWYATNQILPDGSVIIVGGR   +VE++PPR  GAV F FL 
Sbjct  145  PNETCDWVELQDTELITGRWYATNQILPDGSVIIVGGRGTNTVEYYPPRQNGAVPFQFLA  204

Query  684  EVEDRQLDNL  713
            +VED+Q+DNL
Sbjct  205  DVEDKQMDNL  214



>ref|XP_010504181.1| PREDICTED: galactose oxidase-like [Camelina sativa]
Length=543

 Score =   289 bits (740),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 153/190 (81%), Gaps = 0/190 (0%)
 Frame = +3

Query  144  ARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVL  323
            ARA LPGTWEL+V +AGIASMHTAVTRFNTV+LLDRTNIGPSR  L  H CR D ND  L
Sbjct  27   ARADLPGTWELIVQDAGIASMHTAVTRFNTVILLDRTNIGPSRKALDRHRCRRDPNDAAL  86

Query  324  KTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCN  503
            K DCYAHSVL DL TN +RPL + TDTWCSSGQFL DGSL+QTGGD DG +K RKF PC+
Sbjct  87   KHDCYAHSVLFDLATNQIRPLMIQTDTWCSSGQFLSDGSLLQTGGDKDGLKKIRKFEPCD  146

Query  504  SSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFPFLG  683
             +  CDW EL+D +L  GRWYATNQILPDGSVIIVGGR   +VE++PPR  GAV F FL 
Sbjct  147  PNETCDWVELQDTELITGRWYATNQILPDGSVIIVGGRGTNTVEYYPPRENGAVPFQFLA  206

Query  684  EVEDRQLDNL  713
            +VED+Q+DNL
Sbjct  207  DVEDKQMDNL  216



>gb|EYU41788.1| hypothetical protein MIMGU_mgv1a004290mg [Erythranthe guttata]
Length=534

 Score =   288 bits (738),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 134/191 (70%), Positives = 161/191 (84%), Gaps = 2/191 (1%)
 Frame = +3

Query  144  ARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVL  323
            A A LPG WELL+P+AGIASMHTAVTRFNTVVLLDRT+IGPSR  LP + C+ +  DP  
Sbjct  19   AVADLPGAWELLIPDAGIASMHTAVTRFNTVVLLDRTHIGPSRKLLPGNLCQVNPADPPT  78

Query  324  KTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCN  503
            K DC AHSVLLDL TN++RPL+++TDTWCSSGQFLPDGSLIQTGGD+DGF+K RKF PC 
Sbjct  79   K-DCTAHSVLLDLQTNTIRPLSIVTDTWCSSGQFLPDGSLIQTGGDMDGFKKIRKFTPCE  137

Query  504  SSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXG-GAVHFPFL  680
              SLCDW+EL++ +L QGRWYATNQILPDGS+II+GG+++ +VEF+PP+   GA +FPFL
Sbjct  138  PGSLCDWEELQETELYQGRWYATNQILPDGSIIIIGGKSSNTVEFYPPKTEIGAANFPFL  197

Query  681  GEVEDRQLDNL  713
             EV D Q+DNL
Sbjct  198  IEVRDNQMDNL  208



>ref|XP_009378871.1| PREDICTED: galactose oxidase [Pyrus x bretschneideri]
Length=537

 Score =   288 bits (738),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 154/190 (81%), Gaps = 1/190 (1%)
 Frame = +3

Query  144  ARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVL  323
            ARA LPGTWELLV NAG+ASMHTAVTRFNTVVLLDRT+IGPSR  L   HCRND  D VL
Sbjct  22   ARADLPGTWELLVQNAGVASMHTAVTRFNTVVLLDRTSIGPSRKMLRRGHCRNDPYDAVL  81

Query  324  KTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCN  503
            K DCYAHSVL DL T  +RPL + TDTWCSSGQFLPDG+L+QTGGDLDG +K RKFVPC 
Sbjct  82   KRDCYAHSVLFDLQTKQIRPLMIQTDTWCSSGQFLPDGTLLQTGGDLDGVKKIRKFVPCE  141

Query  504  SSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFPFLG  683
            ++  CDW EL DV+L+ GRWYATNQILPDGSV IVGGR   +VE++PPR  GAV   FL 
Sbjct  142  ATGSCDWVELADVELANGRWYATNQILPDGSVAIVGGRAPNTVEYYPPRK-GAVALNFLA  200

Query  684  EVEDRQLDNL  713
            +VED Q+DNL
Sbjct  201  DVEDNQMDNL  210



>ref|XP_009103886.1| PREDICTED: galactose oxidase [Brassica rapa]
Length=542

 Score =   288 bits (737),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 153/188 (81%), Gaps = 0/188 (0%)
 Frame = +3

Query  150  AALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKT  329
            A LPGTWEL+V +AGIASMHTAVTRFNTVVLLDRTNIGPSR  L  H CR D ND VLK 
Sbjct  28   ADLPGTWELIVQDAGIASMHTAVTRFNTVVLLDRTNIGPSRKALGRHRCRKDPNDVVLKR  87

Query  330  DCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSS  509
            DCYAHSVL DL TN +RPL + TDTWCSSGQFL DGSL+QTGGD DGF+K RKF PC+ +
Sbjct  88   DCYAHSVLFDLGTNQIRPLMIQTDTWCSSGQFLSDGSLLQTGGDRDGFKKIRKFEPCDPN  147

Query  510  SLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFPFLGEV  689
              CDW EL+D +L  GRWYA+NQILPDGSVIIVGGR   +VE++PPR  GAV F FL +V
Sbjct  148  ETCDWVELQDTELITGRWYASNQILPDGSVIIVGGRGTNTVEYYPPRQNGAVPFQFLADV  207

Query  690  EDRQLDNL  713
            ED+Q+DNL
Sbjct  208  EDKQMDNL  215



>emb|CDX67577.1| BnaA07g16170D [Brassica napus]
Length=542

 Score =   288 bits (736),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 134/189 (71%), Positives = 155/189 (82%), Gaps = 0/189 (0%)
 Frame = +3

Query  147  RAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLK  326
            RA LPGTWEL+V +AGIASMHTAVTRFNTVVLLDRTNIGPS+  L  H CR D ND VLK
Sbjct  27   RADLPGTWELIVQDAGIASMHTAVTRFNTVVLLDRTNIGPSKKALGRHRCRKDPNDVVLK  86

Query  327  TDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNS  506
             DCYAHSVL DL TN +RPL + TDTWCSSGQFL DGSL+QTGGD DGF+K R+F PC+ 
Sbjct  87   RDCYAHSVLFDLGTNQIRPLMIQTDTWCSSGQFLSDGSLLQTGGDRDGFKKIRRFEPCDP  146

Query  507  SSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFPFLGE  686
            +  CDW EL+D +L+ GRWYA++QILPDGSVIIVGGR   +VE++PPR  GAV F FL +
Sbjct  147  NETCDWVELQDTELTTGRWYASDQILPDGSVIIVGGRGTNTVEYYPPRENGAVPFQFLAD  206

Query  687  VEDRQLDNL  713
            VED+Q+DNL
Sbjct  207  VEDKQMDNL  215



>ref|XP_010427056.1| PREDICTED: galactose oxidase-like [Camelina sativa]
Length=544

 Score =   287 bits (735),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 152/190 (80%), Gaps = 0/190 (0%)
 Frame = +3

Query  144  ARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVL  323
            AR  LPGTWEL V +AGIASMHTAVTRFNTV+LLDRTNIGPSR  L  H CR D ND  L
Sbjct  28   ARGDLPGTWELTVQDAGIASMHTAVTRFNTVILLDRTNIGPSRKALDRHRCRRDPNDAAL  87

Query  324  KTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCN  503
            K DCYAHSVL DL TN +RPL + TDTWCSSGQFL DGSL+QTGGD DGF+K R+F PC+
Sbjct  88   KHDCYAHSVLFDLATNQIRPLMIQTDTWCSSGQFLSDGSLLQTGGDKDGFKKIRRFEPCD  147

Query  504  SSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFPFLG  683
             +  CDW EL+D +L  GRWYATNQILPDGSVIIVGGR   +VE++PPR  GAV F FL 
Sbjct  148  PNETCDWVELQDTELITGRWYATNQILPDGSVIIVGGRGTNTVEYYPPRENGAVPFQFLA  207

Query  684  EVEDRQLDNL  713
            +VED+Q+DNL
Sbjct  208  DVEDKQMDNL  217



>ref|XP_008240187.1| PREDICTED: galactose oxidase [Prunus mume]
Length=536

 Score =   287 bits (734),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 153/190 (81%), Gaps = 1/190 (1%)
 Frame = +3

Query  144  ARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVL  323
            ARA LPGTWELL  NAG++SMHTAVTRFNTVVLLDRTNIGPSR  L    CR+D ND VL
Sbjct  23   ARADLPGTWELLAENAGVSSMHTAVTRFNTVVLLDRTNIGPSRKMLRKGRCRSDPNDAVL  82

Query  324  KTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCN  503
            K DCYAHSVL D  TN +RPL + TDTWCSSGQFLPDGSL+QTGGDLDGF+K RKF PC 
Sbjct  83   KHDCYAHSVLFDPETNQIRPLMINTDTWCSSGQFLPDGSLLQTGGDLDGFKKIRKFDPCE  142

Query  504  SSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFPFLG  683
             +  CDW EL DV+LS GRWYATNQILPDGSVIIVGGR A +VE++PPR  G V   FL 
Sbjct  143  LNGSCDWVELADVELSAGRWYATNQILPDGSVIIVGGRAANTVEYYPPRT-GVVSLNFLA  201

Query  684  EVEDRQLDNL  713
            +VED Q+DNL
Sbjct  202  DVEDTQMDNL  211



>ref|NP_190963.1| glyoxal oxidase-related protein [Arabidopsis thaliana]
 emb|CAB88357.1| putative protein [Arabidopsis thaliana]
 gb|AAL06866.1| AT3g53950/F5K20_250 [Arabidopsis thaliana]
 dbj|BAC41808.1| unknown protein [Arabidopsis thaliana]
 gb|AAO11608.1| At3g53950/F5K20_250 [Arabidopsis thaliana]
 gb|AEE79163.1| glyoxal oxidase-related protein [Arabidopsis thaliana]
Length=545

 Score =   286 bits (731),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 133/189 (70%), Positives = 152/189 (80%), Gaps = 0/189 (0%)
 Frame = +3

Query  147  RAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLK  326
            RA LPG+WEL+V +AGIASMHTAVTRFNTV+LLDRTNIGPSR  L  H CR D  D  LK
Sbjct  29   RADLPGSWELIVQDAGIASMHTAVTRFNTVILLDRTNIGPSRKALDRHRCRRDPKDAALK  88

Query  327  TDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNS  506
             DCYAHSVL DL TN +RPL + TDTWCSSGQFL DGSL+QTGGD DGF+K RKF PC+ 
Sbjct  89   RDCYAHSVLFDLGTNQIRPLMIQTDTWCSSGQFLSDGSLLQTGGDKDGFKKIRKFEPCDP  148

Query  507  SSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFPFLGE  686
            +  CDW EL+D +L  GRWYA+NQILPDGSVIIVGGR   +VE++PPR  GAV F FL +
Sbjct  149  NETCDWVELQDTELITGRWYASNQILPDGSVIIVGGRGTNTVEYYPPRENGAVPFQFLAD  208

Query  687  VEDRQLDNL  713
            VED+Q+DNL
Sbjct  209  VEDKQMDNL  217



>ref|XP_006429215.1| hypothetical protein CICLE_v10011448mg [Citrus clementina]
 gb|ESR42455.1| hypothetical protein CICLE_v10011448mg [Citrus clementina]
Length=535

 Score =   285 bits (730),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 132/195 (68%), Positives = 160/195 (82%), Gaps = 1/195 (1%)
 Frame = +3

Query  129  STVNPARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDK  308
            S++   RA LPGTWEL++ +AGI+SMHTAVTRFNTVVLLDRTNIGPSR  L    CR D+
Sbjct  17   SSIISTRADLPGTWELVLADAGISSMHTAVTRFNTVVLLDRTNIGPSRKMLGRGRCRLDR  76

Query  309  NDPVLKTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRK  488
            ND  LK DCYAHS +LDL TN +RPL +LTDTWCSSGQ L DG+++QTGGDLDG++K RK
Sbjct  77   NDRALKRDCYAHSAILDLQTNQIRPLMILTDTWCSSGQILADGTVLQTGGDLDGYKKIRK  136

Query  489  FVPCNSSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVH  668
            F PC ++ LCDW EL+DV+L  GRWY T+QILPDGSVII+GG+ A +VE++PPR  GAV 
Sbjct  137  FSPCEATGLCDWVELDDVELVNGRWYGTDQILPDGSVIILGGKGANTVEYYPPR-NGAVS  195

Query  669  FPFLGEVEDRQLDNL  713
            FPFL +VED+Q+DNL
Sbjct  196  FPFLADVEDKQMDNL  210



>ref|XP_006480899.1| PREDICTED: galactose oxidase-like [Citrus sinensis]
Length=535

 Score =   285 bits (730),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 132/195 (68%), Positives = 160/195 (82%), Gaps = 1/195 (1%)
 Frame = +3

Query  129  STVNPARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDK  308
            S++   RA LPGTWEL++ +AGI+SMHTAVTRFNTVVLLDRTNIGPSR  L    CR D+
Sbjct  17   SSIISTRADLPGTWELVLADAGISSMHTAVTRFNTVVLLDRTNIGPSRKMLGRGRCRLDR  76

Query  309  NDPVLKTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRK  488
            ND  LK DCYAHS +LDL TN +RPL +LTDTWCSSGQ L DG+++QTGGDLDG++K RK
Sbjct  77   NDRALKRDCYAHSAILDLQTNQIRPLMILTDTWCSSGQILADGTVLQTGGDLDGYKKIRK  136

Query  489  FVPCNSSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVH  668
            F PC ++ LCDW EL+DV+L  GRWY T+QILPDGSVII+GG+ A +VE++PPR  GAV 
Sbjct  137  FSPCEATGLCDWVELDDVELVNGRWYGTDQILPDGSVIILGGKGANTVEYYPPR-NGAVS  195

Query  669  FPFLGEVEDRQLDNL  713
            FPFL +VED+Q+DNL
Sbjct  196  FPFLADVEDKQMDNL  210



>gb|KDO57956.1| hypothetical protein CISIN_1g044265mg, partial [Citrus sinensis]
Length=517

 Score =   284 bits (726),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 131/189 (69%), Positives = 157/189 (83%), Gaps = 1/189 (1%)
 Frame = +3

Query  147  RAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLK  326
            RA LPGTWEL++ +AGI+SMHTAVTRFNTVVLLDRTNIGPSR  L    CR D+ND  LK
Sbjct  5    RADLPGTWELVLADAGISSMHTAVTRFNTVVLLDRTNIGPSRKMLGRGRCRLDRNDRALK  64

Query  327  TDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNS  506
             DCYAHS +LDL TN +RPL +LTDTWCSSGQ L DG+++QTGGDLDG++K RKF PC +
Sbjct  65   RDCYAHSAILDLQTNQIRPLMILTDTWCSSGQILADGTVLQTGGDLDGYKKIRKFSPCEA  124

Query  507  SSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFPFLGE  686
            + LCDW EL+DV+L  GRWY T+QILPDGSVII+GG+ A +VE++PPR  GAV FPFL +
Sbjct  125  NGLCDWVELDDVELVNGRWYGTDQILPDGSVIILGGKGANTVEYYPPR-NGAVSFPFLAD  183

Query  687  VEDRQLDNL  713
            VED+Q+DNL
Sbjct  184  VEDKQMDNL  192



>ref|XP_004507195.1| PREDICTED: galactose oxidase-like [Cicer arietinum]
Length=536

 Score =   272 bits (695),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 137/191 (72%), Positives = 158/191 (83%), Gaps = 1/191 (1%)
 Frame = +3

Query  144  ARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVL  323
            ARA LPGTWELL+PNAGIASMHTAVTRFNTV+LLDRTNIGPSR  LP ++CR  KN  V 
Sbjct  22   ARADLPGTWELLIPNAGIASMHTAVTRFNTVILLDRTNIGPSRKLLPKNNCRLYKNHAVS  81

Query  324  KTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCN  503
            K DCYAHS+L D  TN LRPL +LTDTWCSSGQFLP+G+L+QTGGDLDGF+K RKF PC+
Sbjct  82   KLDCYAHSILFDPKTNQLRPLKILTDTWCSSGQFLPNGTLLQTGGDLDGFKKLRKFNPCD  141

Query  504  SSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVH-FPFL  680
             +  CDW+EL DV+LS+GRWYATNQILPDGS+II+GGR + +VEF+P R    V  FPFL
Sbjct  142  VNGSCDWEELNDVELSEGRWYATNQILPDGSIIIIGGRGSNTVEFYPKRKNDVVFSFPFL  201

Query  681  GEVEDRQLDNL  713
             E ED Q+DNL
Sbjct  202  SETEDTQMDNL  212



>gb|KEH28959.1| glyoxal oxidase amino-terminal protein [Medicago truncatula]
Length=532

 Score =   267 bits (682),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 153/191 (80%), Gaps = 4/191 (2%)
 Frame = +3

Query  141  PARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPV  320
            P RA LPGTWELLV NAGIASMHT VTRFNTV+LLDRTNIGP+R  LP +HCR  K  P 
Sbjct  21   PTRATLPGTWELLVQNAGIASMHTTVTRFNTVILLDRTNIGPTRKLLPKNHCRFTKTKP-  79

Query  321  LKTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPC  500
               DCYAHSVL D   N LRPL +LTDTWCSSG FLP+GSL+QTGGDLDGF+K R F PC
Sbjct  80   ---DCYAHSVLFDPIKNQLRPLKILTDTWCSSGSFLPNGSLLQTGGDLDGFKKIRIFNPC  136

Query  501  NSSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFPFL  680
            +S+  CDW+EL DV+LS+GRWYATNQILPDGS+II+GGR + +VEF+P R  G V FPFL
Sbjct  137  DSTGSCDWEELNDVELSEGRWYATNQILPDGSIIIIGGRGSNTVEFYPKRENGVVLFPFL  196

Query  681  GEVEDRQLDNL  713
             E ED Q+DNL
Sbjct  197  QETEDTQMDNL  207



>ref|XP_006850437.1| PREDICTED: galactose oxidase [Amborella trichopoda]
 gb|ERN12018.1| hypothetical protein AMTR_s00165p00057230 [Amborella trichopoda]
Length=544

 Score =   266 bits (679),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 123/197 (62%), Positives = 147/197 (75%), Gaps = 0/197 (0%)
 Frame = +3

Query  123  IHSTVNPARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRN  302
            I S +  +   LPG WELL+ NAGI+SMHTAVTRF TVVLLDRTNIGP++++LP  +CR 
Sbjct  12   ISSFIFTSNGDLPGKWELLLQNAGISSMHTAVTRFGTVVLLDRTNIGPTKLKLPRGNCRY  71

Query  303  DKNDPVLKTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKF  482
            D  D  LK DCYAHS + D  +N +RPL +LTDTWCSSG FLP+G+L+QTGGDLDG RK 
Sbjct  72   DPRDATLKLDCYAHSAIFDPASNQIRPLKILTDTWCSSGGFLPNGTLLQTGGDLDGNRKV  131

Query  483  RKFVPCNSSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGA  662
            R F PC+S S CDW E+ D  L+ GRWY+TNQILP+G VIIVGGR   +VEF+PP  G  
Sbjct  132  RLFEPCSSGSYCDWMEIPDYDLAVGRWYSTNQILPEGHVIIVGGRGTHTVEFYPPNMGTI  191

Query  663  VHFPFLGEVEDRQLDNL  713
               PFL E ED Q+DNL
Sbjct  192  TELPFLLEAEDAQMDNL  208



>ref|XP_010905399.1| PREDICTED: LOW QUALITY PROTEIN: galactose oxidase [Elaeis guineensis]
Length=553

 Score =   254 bits (649),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 128/192 (67%), Positives = 143/192 (74%), Gaps = 4/192 (2%)
 Frame = +3

Query  147  RAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLK  326
            RA LPGTWE+LV +AGIASMHTAVTRF TVVLLDRT+IGPSR+ LP  HCR D  D  L 
Sbjct  29   RAQLPGTWEVLVEDAGIASMHTAVTRFGTVVLLDRTDIGPSRLPLPKGHCRRDPTDRALP  88

Query  327  T-DCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPC-  500
              DC AHS LLD  T  LRPL++LTDTWCSSGQFLPDG+L+Q+GGDLDGFRK R   PC 
Sbjct  89   VGDCTAHSALLDPATRRLRPLSILTDTWCSSGQFLPDGTLLQSGGDLDGFRKLRTISPCS  148

Query  501  -NSSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFPF  677
             +  S CDW EL    L+ GRWYATNQILPDGSV++VGGR A SVEF+PP       FPF
Sbjct  149  LDDRSPCDWLELPSPLLAAGRWYATNQILPDGSVVVVGGRAAPSVEFYPPDR-PLRPFPF  207

Query  678  LGEVEDRQLDNL  713
            L    D Q+DNL
Sbjct  208  LAAASDPQMDNL  219



>ref|XP_008811510.1| PREDICTED: galactose oxidase [Phoenix dactylifera]
Length=557

 Score =   251 bits (640),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 141/191 (74%), Gaps = 4/191 (2%)
 Frame = +3

Query  150  AALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKT  329
            A LPGTWE+LV +AGIASMHTAVTRF TVVLLDRT+IGPSR+ LP  HCR D  D  L  
Sbjct  34   AQLPGTWEVLVEDAGIASMHTAVTRFGTVVLLDRTDIGPSRLPLPKSHCRRDPTDRALPG  93

Query  330  -DCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPC--  500
             DC AHS LLD  T  LRPL++LTDTWCSSGQFLPDG+L+QTGGDLDG RK R   PC  
Sbjct  94   GDCTAHSALLDPATRRLRPLSILTDTWCSSGQFLPDGTLLQTGGDLDGLRKLRTISPCSL  153

Query  501  NSSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFPFL  680
            +  S CDW EL    L+ GRWYATNQILPDGSV+IVGGR A SVEF+PP       FPFL
Sbjct  154  DDRSPCDWLELPSPLLAAGRWYATNQILPDGSVVIVGGRAAPSVEFYPPDR-PLRPFPFL  212

Query  681  GEVEDRQLDNL  713
                D Q+DNL
Sbjct  213  AAASDPQMDNL  223



>ref|XP_002972585.1| hypothetical protein SELMODRAFT_97196 [Selaginella moellendorffii]
 gb|EFJ26671.1| hypothetical protein SELMODRAFT_97196 [Selaginella moellendorffii]
Length=551

 Score =   246 bits (627),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 116/193 (60%), Positives = 140/193 (73%), Gaps = 1/193 (1%)
 Frame = +3

Query  138  NPARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDP  317
            NP ++ LPGTW+LLVPNAGIASMHTAVT + TV+LLDRT+IG S+I L  + CR D  D 
Sbjct  32   NPTKSQLPGTWQLLVPNAGIASMHTAVTHYGTVLLLDRTDIGASKISLTDNRCRRDSADK  91

Query  318  VLKTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVP  497
             L+TDC AHSV++D+ T ++RPLT+LTDTWCSS QF  +G+L+ TGGD DG RK R FVP
Sbjct  92   SLQTDCSAHSVIIDVATAAVRPLTILTDTWCSSAQFTANGTLLHTGGDFDGNRKLRYFVP  151

Query  498  CNSSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGA-VHFP  674
            C     CDW E  D  L  GRWYATNQ+LPDG  I+VGGR + ++EF PP  G   V FP
Sbjct  152  CPEPGACDWVESSDQSLKAGRWYATNQLLPDGRTIVVGGRDSFTLEFVPPSPGDELVTFP  211

Query  675  FLGEVEDRQLDNL  713
            FL    D Q+DNL
Sbjct  212  FLSSTRDMQMDNL  224



>ref|XP_002972039.1| hypothetical protein SELMODRAFT_441651 [Selaginella moellendorffii]
 gb|EFJ26956.1| hypothetical protein SELMODRAFT_441651 [Selaginella moellendorffii]
Length=550

 Score =   245 bits (626),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 116/193 (60%), Positives = 140/193 (73%), Gaps = 1/193 (1%)
 Frame = +3

Query  138  NPARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDP  317
            NP ++ LPGTW+LLVPNAGIASMHTAVT + TV+LLDRT+IG S+I L  + CR D  D 
Sbjct  31   NPTKSQLPGTWQLLVPNAGIASMHTAVTHYGTVLLLDRTDIGASKISLTDNRCRRDAADK  90

Query  318  VLKTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVP  497
             L+TDC AHSV++D+ T ++RPLT+LTDTWCSS QF  +G+L+ TGGD DG RK R FVP
Sbjct  91   SLQTDCSAHSVIIDVATAAVRPLTILTDTWCSSAQFTANGTLLHTGGDFDGNRKLRYFVP  150

Query  498  CNSSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGA-VHFP  674
            C     CDW E  D  L  GRWYATNQ+LPDG  I+VGGR + ++EF PP  G   V FP
Sbjct  151  CPEPGACDWVESSDQSLKAGRWYATNQLLPDGRTIVVGGRDSFTLEFVPPSPGDELVTFP  210

Query  675  FLGEVEDRQLDNL  713
            FL    D Q+DNL
Sbjct  211  FLSSTRDMQMDNL  223



>ref|XP_009421296.1| PREDICTED: galactose oxidase [Musa acuminata subsp. malaccensis]
Length=559

 Score =   245 bits (626),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 141/189 (75%), Gaps = 4/189 (2%)
 Frame = +3

Query  156  LPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLK---  326
            LPGTWE+++ +A IASMHTAVTRF TVVLLDRT IG SR+RLP   CR D  D +L    
Sbjct  38   LPGTWEVVLEDARIASMHTAVTRFGTVVLLDRTGIGASRLRLPRSRCRIDPGDSLLPPGG  97

Query  327  TDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNS  506
             DC AHS LLD  +  LRPL+VLTDTWCSSGQFLP+G+L+Q+GGDLDG RK R F PC  
Sbjct  98   KDCSAHSALLDPSSRRLRPLSVLTDTWCSSGQFLPNGTLLQSGGDLDGLRKLRAFSPCPL  157

Query  507  SSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFPFLGE  686
            +  CDW EL+   L+ GRWYATNQILPDGSV+IVGGR A SVEF+PP      +FPFL  
Sbjct  158  AGSCDWLELDSPLLADGRWYATNQILPDGSVVIVGGRAAPSVEFYPPSR-PLRNFPFLAT  216

Query  687  VEDRQLDNL  713
             ED Q+DNL
Sbjct  217  AEDAQMDNL  225



>ref|XP_001778975.1| predicted protein [Physcomitrella patens]
 gb|EDQ56230.1| predicted protein [Physcomitrella patens]
Length=534

 Score =   241 bits (615),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 112/184 (61%), Positives = 137/184 (74%), Gaps = 1/184 (1%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            GTWELL+ NAGIASMHTA+TRF T+V+LDRTNIG S+I LP   CR   ND VL++DC A
Sbjct  24   GTWELLMENAGIASMHTALTRFGTLVMLDRTNIGASQINLPDGKCR-ASNDLVLQSDCSA  82

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HSV+ D  T ++RPL ++TD WCSSGQF+PDG+L+QTGGD DG RK R FVPC  S  CD
Sbjct  83   HSVVFDPATKTVRPLFLMTDPWCSSGQFMPDGTLMQTGGDFDGLRKIRTFVPCEPSGTCD  142

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFPFLGEVEDRQ  701
            W E    +L  GRWY+TNQ+LPDG  I++GGR+A ++EF PP   G ++FPFL    D Q
Sbjct  143  WVESTTQELQSGRWYSTNQLLPDGRQIVIGGRSAFNLEFIPPNANGPLYFPFLNATNDDQ  202

Query  702  LDNL  713
             DNL
Sbjct  203  NDNL  206



>ref|XP_001765643.1| predicted protein [Physcomitrella patens]
 gb|EDQ69482.1| predicted protein [Physcomitrella patens]
Length=535

 Score =   238 bits (607),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 137/184 (74%), Gaps = 1/184 (1%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            GTWELL+ NAGIA MH A+TRF TVV++DRT+IG S+I LPA  CR D +D VLK DC A
Sbjct  24   GTWELLLENAGIACMHAALTRFGTVVMIDRTDIGASQIGLPAGVCR-DSDDLVLKHDCTA  82

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HSV+ D  T ++RPL + TD WCSSGQF+PDGSL+QTGGD DG RK R FVPC +S +CD
Sbjct  83   HSVVFDPVTKTVRPLFLQTDPWCSSGQFMPDGSLMQTGGDFDGVRKIRTFVPCEASGICD  142

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFPFLGEVEDRQ  701
            W E    +L  GRWY+TNQ+LPDG  II+GGR+A ++EF PP   G ++FPFL    D Q
Sbjct  143  WVESTTQELQSGRWYSTNQLLPDGRQIIIGGRSAFNLEFIPPNANGPLYFPFLNATNDDQ  202

Query  702  LDNL  713
             DNL
Sbjct  203  NDNL  206



>ref|XP_001771982.1| predicted protein [Physcomitrella patens]
 gb|EDQ63243.1| predicted protein [Physcomitrella patens]
Length=550

 Score =   236 bits (601),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 112/184 (61%), Positives = 135/184 (73%), Gaps = 1/184 (1%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            GTWE+LV N+GIASMH AVTR+ TVVLLDRTN G + I LP   CR D +D VLK DC A
Sbjct  38   GTWEILVNNSGIASMHAAVTRYGTVVLLDRTNTGATEIALPGGACR-DSDDLVLKHDCTA  96

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HSVL D  TN++RPL++LTDTWCSSGQFL DG+L+QTGGD +G RK R F PC ++  CD
Sbjct  97   HSVLFDPGTNTVRPLSILTDTWCSSGQFLSDGTLMQTGGDFEGIRKVRTFAPCPATGTCD  156

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFPFLGEVEDRQ  701
            W E  +V L   RWYATNQ+LPDG  II+GGR+A ++E+ PP   G ++F FL    D Q
Sbjct  157  WVESVEVVLEAPRWYATNQLLPDGRQIIIGGRSAYNIEYIPPAANGLLYFDFLNTTNDAQ  216

Query  702  LDNL  713
             DNL
Sbjct  217  NDNL  220



>ref|XP_001762124.1| predicted protein [Physcomitrella patens]
 gb|EDQ72916.1| predicted protein [Physcomitrella patens]
Length=529

 Score =   233 bits (593),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 137/187 (73%), Gaps = 4/187 (2%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            GTWELLV NAGIA+MH AVTRF TVVLLDRTN G S+I LP   CR D ND VLK DC A
Sbjct  15   GTWELLVDNAGIAAMHAAVTRFGTVVLLDRTNTGASQIALPDGVCR-DSNDMVLKHDCTA  73

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HSVL D  TNS+RPLT+ TDTWCSSGQF+PDG+L+QTGGD +G RK R F PC ++  CD
Sbjct  74   HSVLFDPSTNSVRPLTIQTDTWCSSGQFMPDGTLMQTGGDFEGVRKVRTFTPCPATETCD  133

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPP---RXGGAVHFPFLGEVE  692
            W E  ++ L+  RWYATNQ+LPDG  II+GGR+A ++E+ PP       A++F FL    
Sbjct  134  WVESTELILASPRWYATNQLLPDGHQIIIGGRSAFNLEYMPPSAASSAAALYFDFLNATN  193

Query  693  DRQLDNL  713
            D Q DNL
Sbjct  194  DAQNDNL  200



>emb|CBI30475.3| unnamed protein product [Vitis vinifera]
Length=382

 Score =   225 bits (574),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = +3

Query  156  LPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDC  335
            LPGTWEL+VPNAGIASMHTAVTR+ TVVLLDRTNIGPSR  LP  HCR D  D VLK DC
Sbjct  38   LPGTWELIVPNAGIASMHTAVTRYGTVVLLDRTNIGPSRKMLPKGHCRYDPKDEVLKRDC  97

Query  336  YAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSL  515
            YAHSV+LDL+TN +RPL +LTDTWCSSGQFLPDGSL+QTGGDLDG +K RKFVPC     
Sbjct  98   YAHSVILDLNTNKIRPLKILTDTWCSSGQFLPDGSLLQTGGDLDGVKKIRKFVPCGPHGF  157

Query  516  CDWQELEDVQLSQGR  560
            CDW+EL+DV+L  GR
Sbjct  158  CDWEELKDVELETGR  172



>ref|XP_002970610.1| hypothetical protein SELMODRAFT_93556 [Selaginella moellendorffii]
 gb|EFJ28740.1| hypothetical protein SELMODRAFT_93556 [Selaginella moellendorffii]
Length=535

 Score =   221 bits (564),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 102/187 (55%), Positives = 129/187 (69%), Gaps = 0/187 (0%)
 Frame = +3

Query  153  ALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTD  332
            A PG ++++  NAG+ASMHT VT F+  + LDRTNIGPS+I L A  CR++ +D  LK D
Sbjct  25   AQPGRFDVIAQNAGVASMHTVVTHFSNAIFLDRTNIGPSQINLAAGGCRDNPDDRTLKHD  84

Query  333  CYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSS  512
            C AHSV+ D  + + R L++ +DTWCSSGQFLP+G+L+QTGGD DGF K R   PC +  
Sbjct  85   CTAHSVMFDYFSGASRALSIYSDTWCSSGQFLPNGTLLQTGGDFDGFFKVRYMTPCPNGG  144

Query  513  LCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFPFLGEVE  692
             CDWQE +   L  GRWYA+NQ+LPDG VI+VGGR+A S EF P R  G    PFL E  
Sbjct  145  TCDWQESKTEFLHSGRWYASNQLLPDGRVIVVGGRSAFSYEFIPDRGAGQFELPFLKETN  204

Query  693  DRQLDNL  713
            D   +NL
Sbjct  205  DPTFNNL  211



>ref|XP_002968445.1| hypothetical protein SELMODRAFT_89852 [Selaginella moellendorffii]
 gb|EFJ30699.1| hypothetical protein SELMODRAFT_89852 [Selaginella moellendorffii]
Length=535

 Score =   219 bits (559),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 101/187 (54%), Positives = 128/187 (68%), Gaps = 0/187 (0%)
 Frame = +3

Query  153  ALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTD  332
            A PG ++++  NAG+ASMHT VT F+  + LDRTNIGPS+I L    CR++ +D  LK D
Sbjct  25   AQPGRFDVIAQNAGVASMHTVVTHFSNAIFLDRTNIGPSQINLAGGGCRDNPDDRTLKHD  84

Query  333  CYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSS  512
            C AHSV+ D  + + R L++ +DTWCSSGQFLP+G+L+QTGGD DGF K R   PC +  
Sbjct  85   CTAHSVMFDYFSGASRALSIYSDTWCSSGQFLPNGTLLQTGGDFDGFFKVRYMTPCPNGG  144

Query  513  LCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFPFLGEVE  692
             CDWQE +   L  GRWYA+NQ+LPDG VI+VGGR+A S EF P R  G    PFL E  
Sbjct  145  TCDWQESKTEFLHSGRWYASNQLLPDGRVIVVGGRSAFSYEFIPDRGAGQFELPFLKETN  204

Query  693  DRQLDNL  713
            D   +NL
Sbjct  205  DPTFNNL  211



>ref|XP_001776127.1| predicted protein [Physcomitrella patens]
 gb|EDQ59038.1| predicted protein [Physcomitrella patens]
Length=551

 Score =   218 bits (555),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 130/173 (75%), Gaps = 1/173 (1%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            G+W+ LVP+AGI+SMHTA+TR++TVVLLDRTNIGPSR+ LP   CR    + + KTDCYA
Sbjct  34   GSWKTLVPDAGISSMHTAITRYDTVVLLDRTNIGPSRLLLPNGRCRTQPLERISKTDCYA  93

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HS + D + N++RPL + TDTWCSSGQF+ DG+L+QTGGD +G +K R+ VPC ++  CD
Sbjct  94   HSAMFDSNLNTVRPLYIFTDTWCSSGQFIWDGTLVQTGGDFEGTKKIRRLVPCQATGTCD  153

Query  522  WQELEDVQLSQGRWYATNQILPDG-SVIIVGGRTAQSVEFFPPRXGGAVHFPF  677
            W E    +L+ GRWY++NQ+LPDG ++I+VGGR A + EF P R  G   FP 
Sbjct  154  WVESTTEELTVGRWYSSNQLLPDGKTMIVVGGRNAPTYEFVPKRSPGEGVFPL  206



>ref|XP_001783776.1| predicted protein [Physcomitrella patens]
 gb|EDQ51428.1| predicted protein [Physcomitrella patens]
Length=525

 Score =   211 bits (537),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 126/187 (67%), Gaps = 4/187 (2%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            GTWELL+ NAGIASMHTAVT +NTV+ LDRTNIG S I LP   CR + ++  LK DC A
Sbjct  14   GTWELLLDNAGIASMHTAVTHYNTVIFLDRTNIGRSEIDLPNGECRENDDELALKKDCTA  73

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HSV+ D  +NS+R L V TD WCSSGQF  DG+++QTGGD +G +K R  VPC     CD
Sbjct  74   HSVMFDPSSNSVRALWVQTDPWCSSGQFQGDGTMVQTGGDFEGIKKIRTLVPCGRDDECD  133

Query  522  WQELEDVQLSQGRWYATNQILPDGSV-IIVGGRTAQSVEFFPP--RXGGAVHFPFLGEVE  692
            W E E  +LS+GRWYATNQILPDG   I++GGR A + EF P   R  G  +   L +  
Sbjct  134  WVE-ERTELSEGRWYATNQILPDGKTQIVIGGRDAYTYEFVPKRNRNEGVFYLKLLEDTN  192

Query  693  DRQLDNL  713
              Q DN+
Sbjct  193  SAQGDNM  199



>ref|XP_001757263.1| predicted protein [Physcomitrella patens]
 gb|EDQ77748.1| predicted protein [Physcomitrella patens]
Length=540

 Score =   209 bits (532),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 102/187 (55%), Positives = 129/187 (69%), Gaps = 3/187 (2%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            GTW++LV NAGIASMHTA+T ++T +LLDRTNIG S+I LP   CR++  + VLK DC A
Sbjct  29   GTWQILVGNAGIASMHTAITHYDTAILLDRTNIGASQIPLPNGQCRDNSQELVLKHDCTA  88

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HSV+LD  TNS+R L V TDTWCSSGQF+ DG+++QTGGD +G  K R+  PC ++  C+
Sbjct  89   HSVMLDTKTNSVRALWVQTDTWCSSGQFISDGTMVQTGGDYEGLYKIRRLTPCAANENCN  148

Query  522  WQELEDVQLSQGRWYATNQILPDGS-VIIVGGRTAQSVEFFPPRXG--GAVHFPFLGEVE  692
            W E     L+  RWYA+NQ+LPDGS  I+VGGR A S EF P R    GA     L +  
Sbjct  149  WVESTTEALTDPRWYASNQLLPDGSRQIVVGGRNAFSYEFVPKRRTGEGAFALQLLRDTN  208

Query  693  DRQLDNL  713
              Q DN+
Sbjct  209  TNQGDNM  215



>ref|XP_001784508.1| predicted protein [Physcomitrella patens]
 gb|EDQ50675.1| predicted protein [Physcomitrella patens]
Length=558

 Score =   208 bits (530),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 123/189 (65%), Gaps = 2/189 (1%)
 Frame = +3

Query  153  ALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTD  332
            A  G W +L  NAGIASMHTAV  +++V+ LDRTNIG S I     +CRN+  D VLK D
Sbjct  34   AYNGKWRVLTANAGIASMHTAVNFYDSVIFLDRTNIGLSEINFTNGYCRNNPQDRVLKHD  93

Query  333  CYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSS  512
            C AHSV+LD  +  +RPLT++TDTWCSSGQF  +G+L+QTGGD DG RK R   PC    
Sbjct  94   CSAHSVMLDPVSGKVRPLTIITDTWCSSGQFFANGTLVQTGGDFDGMRKVRLLDPCGPDG  153

Query  513  LCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXG--GAVHFPFLGE  686
             CDW E +   L   RWY+TNQ+LPDG  I+VGG  + S EF P R    G+    FL E
Sbjct  154  GCDWMESDTENLKDKRWYSTNQLLPDGRQIVVGGIESYSYEFVPKRKSREGSYELNFLNE  213

Query  687  VEDRQLDNL  713
             +D Q DNL
Sbjct  214  TKDAQNDNL  222



>ref|XP_001759194.1| predicted protein [Physcomitrella patens]
 gb|EDQ75878.1| predicted protein [Physcomitrella patens]
Length=537

 Score =   207 bits (528),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 123/175 (70%), Gaps = 2/175 (1%)
 Frame = +3

Query  150  AALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKT  329
            A+ PG+W++L  NAGIASMH+AVTRF+T VLLDRTNIGPS I+LP   CRN   + V KT
Sbjct  25   ASQPGSWKVLQKNAGIASMHSAVTRFDTCVLLDRTNIGPSGIKLPGGRCRNQPKERVSKT  84

Query  330  DCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSS  509
            DCYAHSV+L+    ++R L + TDTWCSSGQF+ +G L+QTGGD +G +K R   PC + 
Sbjct  85   DCYAHSVMLNPANGAVRALYIYTDTWCSSGQFMGNGVLVQTGGDFEGNKKIRTLSPCGAG  144

Query  510  SLCDWQELEDVQLSQGRWYATNQILPDG-SVIIVGGRTAQSVEFFPPRXGGAVHF  671
              CDW E  D +LS+GRWYA+N ILP G   I+VGGR   + EF P R  G   F
Sbjct  145  GNCDWVE-TDRELSKGRWYASNHILPGGVRQIVVGGRNEPTYEFVPKRKAGETVF  198



>ref|XP_001774105.1| predicted protein [Physcomitrella patens]
 gb|EDQ61019.1| predicted protein [Physcomitrella patens]
Length=530

 Score =   206 bits (523),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 118/174 (68%), Gaps = 2/174 (1%)
 Frame = +3

Query  153  ALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTD  332
            A  G+W LL  NAGI+SMHTAVT  NTV++LDRTNIGPS I+LP   CR    + + KTD
Sbjct  25   AAQGSWALLNKNAGISSMHTAVTHMNTVIMLDRTNIGPSAIKLPNGRCRQQAAERISKTD  84

Query  333  CYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSS  512
            CYAHSV+ +   N +RPL V TDTWCSSGQF  +G ++QTGGD +G RK R   PC +  
Sbjct  85   CYAHSVMFNPANNQVRPLYVYTDTWCSSGQFFDNGRMVQTGGDFEGNRKIRTLQPCGAGG  144

Query  513  LCDWQELEDVQLSQGRWYATNQILPDG-SVIIVGGRTAQSVEFFPPRXGGAVHF  671
             CDW EL +  L+ GRWYA+NQ+LP G   IIVGGR   S EF+P R  G   F
Sbjct  145  NCDWVELGE-NLATGRWYASNQLLPSGIRQIIVGGRNTPSYEFYPKRKAGEGFF  197



>ref|XP_001769885.1| predicted protein [Physcomitrella patens]
 gb|EDQ65245.1| predicted protein [Physcomitrella patens]
Length=530

 Score =   205 bits (521),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 118/174 (68%), Gaps = 2/174 (1%)
 Frame = +3

Query  153  ALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTD  332
            A  G+W LL  NAGI+SMHTAVT  NTV++LDRTNIGPS I+LP   CR    + + KTD
Sbjct  25   AAQGSWALLNKNAGISSMHTAVTHMNTVIMLDRTNIGPSAIKLPDGRCRKQPAERISKTD  84

Query  333  CYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSS  512
            CYAHSV+ +   N +RPL V TDTWCSSGQF  +G ++QTGGD +G RK R   PC +  
Sbjct  85   CYAHSVMFNPANNQVRPLYVYTDTWCSSGQFFDNGRMVQTGGDFEGNRKIRTLQPCGAGG  144

Query  513  LCDWQELEDVQLSQGRWYATNQILPDG-SVIIVGGRTAQSVEFFPPRXGGAVHF  671
             CDW EL +  L+ GRWYA+NQ+LP G   IIVGGR   S EF+P R  G   F
Sbjct  145  NCDWVELGE-NLATGRWYASNQLLPSGIRQIIVGGRNTPSYEFYPKRKAGEGFF  197



>ref|XP_001772413.1| predicted protein [Physcomitrella patens]
 gb|EDQ62884.1| predicted protein [Physcomitrella patens]
Length=531

 Score =   204 bits (519),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 97/184 (53%), Positives = 125/184 (68%), Gaps = 2/184 (1%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            G WE +V NAGI++MH+AV     VVLLDRTN+GPS+++L   +CR++  D  LK DC A
Sbjct  31   GYWETVVNNAGISTMHSAVAHDGNVVLLDRTNVGPSQLKLAPDNCRDNLADRSLKHDCTA  90

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HS L   ++N +RPL V+TDTWCSSGQF   G L+QTGGD DG +K R F PC   + CD
Sbjct  91   HSALFSPNSNKVRPLKVITDTWCSSGQFDGSGKLVQTGGDADGVKKIRHFTPCGKGA-CD  149

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFPFLGEVEDRQ  701
            W EL    L +GRWYA+NQILPDG+ I+VGGR   ++E+ P    G  + P L +  D Q
Sbjct  150  WVELNG-GLQEGRWYASNQILPDGTQIVVGGRGVATLEYVPANGRGTYYLPLLSKSNDAQ  208

Query  702  LDNL  713
            +DNL
Sbjct  209  MDNL  212



>ref|XP_001777189.1| predicted protein [Physcomitrella patens]
 gb|EDQ57969.1| predicted protein [Physcomitrella patens]
Length=530

 Score =   203 bits (517),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 117/174 (67%), Gaps = 2/174 (1%)
 Frame = +3

Query  153  ALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTD  332
            A  G+W LL  NAGI+SMHTAVT  NTV++LDRTN GPS I+LP   CR    + + KTD
Sbjct  25   AAQGSWALLNKNAGISSMHTAVTHMNTVIMLDRTNTGPSAIKLPNGRCRKQPAERISKTD  84

Query  333  CYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSS  512
            CYAHSV+ +   N +RPL V TDTWCSSGQF  +G ++QTGGD +G RK R   PC +  
Sbjct  85   CYAHSVMFNPANNQVRPLYVYTDTWCSSGQFFDNGRMVQTGGDFEGNRKIRTLQPCGAGG  144

Query  513  LCDWQELEDVQLSQGRWYATNQILPDG-SVIIVGGRTAQSVEFFPPRXGGAVHF  671
             CDW EL +  L+ GRWYA+NQ+LP G   IIVGGR   S EF+P R  G   F
Sbjct  145  NCDWVELGE-NLATGRWYASNQLLPSGIRQIIVGGRNTPSYEFYPKRKAGEGFF  197



>ref|XP_011069751.1| PREDICTED: galactose oxidase-like [Sesamum indicum]
Length=560

 Score =   202 bits (513),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 99/185 (54%), Positives = 126/185 (68%), Gaps = 4/185 (2%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            G W LL+ + G+++MH  +   + VV+ DRT+ GPS I LP +HCRND ND +LK DC A
Sbjct  36   GKWNLLLSDIGVSAMHMQLLNTDRVVIFDRTDFGPSNISLPNNHCRNDPNDLMLKVDCTA  95

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HSV  D+ +NS+RPL VLTD WCSSG  +PDGSL+QTGG  DG R  R + PC  +S CD
Sbjct  96   HSVEYDVASNSIRPLNVLTDVWCSSGSVMPDGSLMQTGGFNDGDRNVRVYKPCGDNS-CD  154

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGG--AVHFPFLGEVED  695
            WQE + V L Q RWYATN ILPDG  IIVGGR   S EF+P + G   + + PFL +  D
Sbjct  155  WQEFDAV-LRQRRWYATNHILPDGRQIIVGGRGQFSYEFYPKKAGADQSYNLPFLSQTND  213

Query  696  RQLDN  710
             +++N
Sbjct  214  PRIEN  218



>ref|XP_011069718.1| PREDICTED: galactose oxidase-like [Sesamum indicum]
Length=562

 Score =   201 bits (512),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 99/185 (54%), Positives = 124/185 (67%), Gaps = 4/185 (2%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            G W LL+ N G+++MH  +   + V++ DRT+ GPS I LP + CRND ND  LK DC A
Sbjct  38   GKWNLLLSNIGVSAMHMQLLNTDRVIIFDRTDFGPSNISLPNNQCRNDPNDLTLKVDCTA  97

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HSV  D+ +NS+RPL VLTD WCSSG  +PDGSL+QTGG  DG R  R + PC+  S CD
Sbjct  98   HSVEYDVASNSIRPLNVLTDVWCSSGSAMPDGSLMQTGGFNDGDRNVRVYKPCSDDS-CD  156

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGG--AVHFPFLGEVED  695
            WQE  DV L Q RWYATN ILPDG  IIVGGR   S EF+P + G   + + PFL +  D
Sbjct  157  WQEF-DVALRQRRWYATNHILPDGRQIIVGGRGQFSYEFYPKKAGADQSYNLPFLSQTND  215

Query  696  RQLDN  710
             +++N
Sbjct  216  PRIEN  220



>ref|XP_011069750.1| PREDICTED: galactose oxidase-like [Sesamum indicum]
Length=562

 Score =   201 bits (512),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 99/185 (54%), Positives = 124/185 (67%), Gaps = 4/185 (2%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            G W LL+ N G+++MH  +   + V++ DRT+ GPS I LP + CRND ND  LK DC A
Sbjct  38   GKWNLLLSNIGVSAMHMQLLNTDRVIIFDRTDFGPSNISLPNNQCRNDPNDLTLKVDCTA  97

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HSV  D+ +NS+RPL VLTD WCSSG  +PDGSL+QTGG  DG R  R + PC+  S CD
Sbjct  98   HSVEYDVASNSIRPLNVLTDVWCSSGSAMPDGSLMQTGGFNDGDRNVRVYKPCSDDS-CD  156

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGG--AVHFPFLGEVED  695
            WQE  DV L Q RWYATN ILPDG  IIVGGR   S EF+P + G   + + PFL +  D
Sbjct  157  WQEF-DVALRQRRWYATNHILPDGRQIIVGGRGQFSYEFYPKKAGADQSYNLPFLSQTND  215

Query  696  RQLDN  710
             +++N
Sbjct  216  PRIEN  220



>ref|XP_001759192.1| predicted protein [Physcomitrella patens]
 gb|EDQ75876.1| predicted protein [Physcomitrella patens]
Length=533

 Score =   200 bits (508),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 122/176 (69%), Gaps = 4/176 (2%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            GTW++L  NAG+++MHTAVTRF+T ++LDRTNIGPS+IRLP   CR    +   K DCYA
Sbjct  30   GTWQMLQRNAGVSAMHTAVTRFDTAIMLDRTNIGPSQIRLPGKRCRKQPLERFSKIDCYA  89

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HSV+ +    ++RPL V TDTWCSSGQF+ +G ++QTGGD +G +K R   PC++   CD
Sbjct  90   HSVMFNPANGAVRPLYVQTDTWCSSGQFMSNGVMVQTGGDFEGNKKIRTLAPCSARGTCD  149

Query  522  WQELEDVQLSQGRWYATNQILPDGS-VIIVGGRTAQSVEFFPPRXG--GAVHFPFL  680
            W E    +L++GRWYA+N ILP G+  I+VGGR   S EF P R    GA + P L
Sbjct  150  WVETAQ-ELTRGRWYASNHILPGGNRQIVVGGRNEPSYEFVPKRRAGEGAFNLPLL  204



>ref|XP_010674901.1| PREDICTED: galactose oxidase [Beta vulgaris subsp. vulgaris]
Length=549

 Score =   199 bits (507),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 102/191 (53%), Positives = 123/191 (64%), Gaps = 8/191 (4%)
 Frame = +3

Query  159  PGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCY  338
            PG W++L  N GI++MH  + + N V++ DRT+ GPS + LP   CRND +D VLK DC 
Sbjct  30   PGEWQVLQENIGISAMHMQLMQNNKVIMFDRTDFGPSNLSLPFGRCRNDSSDIVLKIDCT  89

Query  339  AHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLC  518
            AHSV+ D+ TN+ RPLTV TDTWCSSG  LPDGSL+QTGG  DG R  RKF PC   + C
Sbjct  90   AHSVVYDIATNTFRPLTVNTDTWCSSGSLLPDGSLVQTGGYNDGDRVVRKFTPCKDDN-C  148

Query  519  DWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFP------PRXGGAVHFPFL  680
            DW E  +  LS  RWYATNQILPDG VII+GGR   + EFFP      P         FL
Sbjct  149  DWIEYPNY-LSDRRWYATNQILPDGRVIIIGGRRVFTYEFFPSNSNSFPTSTSTFWLNFL  207

Query  681  GEVEDRQLDNL  713
             E  D + +NL
Sbjct  208  LETHDDEENNL  218



>ref|XP_001774194.1| predicted protein [Physcomitrella patens]
 gb|EDQ60970.1| predicted protein [Physcomitrella patens]
Length=533

 Score =   198 bits (504),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 94/179 (53%), Positives = 123/179 (69%), Gaps = 2/179 (1%)
 Frame = +3

Query  138  NPARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDP  317
            +P   A  G+W+LL  NAGI+SMH+AVTRFNTV+ LDRTNIGPS+I+LP   CR    + 
Sbjct  22   SPLFVAGQGSWQLLQNNAGISSMHSAVTRFNTVIFLDRTNIGPSQIKLPDGRCRQQPAER  81

Query  318  VLKTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVP  497
            + K+DCYAHSV+ +    ++R L + TDTWCSSGQF+ DG ++QTGGD +G +K R   P
Sbjct  82   ISKSDCYAHSVMFNPANGAVRALFIFTDTWCSSGQFMWDGQMVQTGGDFEGNKKIRTLTP  141

Query  498  CNSSSLCDWQELEDVQLSQGRWYATNQILPDGS-VIIVGGRTAQSVEFFPPRXGGAVHF  671
            C +S  CDW E    +LS+GRWY+TN ILP G+  I++GGR   + EF P R  G   F
Sbjct  142  CPASGNCDWTE-TGTELSRGRWYSTNHILPGGNRQIVMGGRNEPTYEFVPKRTAGEGVF  199



>ref|XP_011092656.1| PREDICTED: galactose oxidase-like [Sesamum indicum]
Length=562

 Score =   199 bits (505),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 123/185 (66%), Gaps = 4/185 (2%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            G W L++ N G+++MH  +   + VV+ DRT+ GPS I LP + CRND ND  LK DC A
Sbjct  38   GKWNLVLSNIGVSAMHMQLLNTDRVVIFDRTDFGPSNISLPNNQCRNDPNDLTLKVDCTA  97

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HSV  D+ +NS+RPL VLTD WCSSG  +PDGSL+QTGG  DG R  R + PC+  S CD
Sbjct  98   HSVEYDVASNSIRPLNVLTDVWCSSGSAMPDGSLMQTGGFNDGDRNVRVYKPCSDDS-CD  156

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGG--AVHFPFLGEVED  695
            WQE  DV L Q RWYATN ILPDG  IIVGGR     EF+P + G   + + PFL +  D
Sbjct  157  WQEF-DVALRQRRWYATNHILPDGRQIIVGGRGQFGYEFYPKKTGADQSYNLPFLSQTND  215

Query  696  RQLDN  710
             +++N
Sbjct  216  PRIEN  220



>ref|XP_002968444.1| hypothetical protein SELMODRAFT_231119 [Selaginella moellendorffii]
 gb|EFJ30698.1| hypothetical protein SELMODRAFT_231119 [Selaginella moellendorffii]
Length=520

 Score =   197 bits (501),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 98/197 (50%), Positives = 131/197 (66%), Gaps = 6/197 (3%)
 Frame = +3

Query  123  IHSTVNPARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRN  302
            + ST+ P++   PG + +++ NAGI+SMHTAVT +  V+ LDRTNIGPS I L   +CR+
Sbjct  6    MESTMMPSQQ--PGRFNIVLQNAGISSMHTAVTHYGNVIFLDRTNIGPSAINL-VGNCRD  62

Query  303  DKNDPVLKTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKF  482
            +  D +   DC AHSV+ D  +N++RP+ + +DTWCSSGQFLP+G+L+QTGG  DG    
Sbjct  63   NPADMMTTHDCTAHSVIYDPSSNTVRPVFIYSDTWCSSGQFLPNGTLMQTGGSADGGSII  122

Query  483  RKFVPCNSSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGA  662
            R F PC+S S C+W E     L   RWYA+NQILPDG +I+VGGR   + EF P   GG 
Sbjct  123  RYFTPCSSGSWCNWME-SSTNLQSSRWYASNQILPDGRIIVVGGRGVYNYEFQP--TGGQ  179

Query  663  VHFPFLGEVEDRQLDNL  713
             +  FL +  D Q DNL
Sbjct  180  FYLQFLKDTADFQDDNL  196



>ref|XP_001756237.1| predicted protein [Physcomitrella patens]
 gb|EDQ79103.1| predicted protein [Physcomitrella patens]
Length=535

 Score =   196 bits (499),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 95/184 (52%), Positives = 118/184 (64%), Gaps = 1/184 (1%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            G WE++  NAGIA+MH AVT F  V+LLDRTN+G S++ L    CR ++ D   K DC A
Sbjct  33   GYWEIVKDNAGIATMHAAVTSFGNVILLDRTNVGDSQLPLNNGRCRQNEADRANKNDCTA  92

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HS +    +N++RPL V TDTWCSSGQF  DG ++QTGGD +G  K R++ PC     CD
Sbjct  93   HSAVFSPGSNNIRPLFVFTDTWCSSGQFNGDGKMVQTGGDAEGVAKIREYQPCGDDGGCD  152

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFPFLGEVEDRQ  701
            W EL D  L  GRWYA+NQ LPDG+ I+VGGR A +VE+ P    G    P L E    Q
Sbjct  153  WVEL-DTSLQIGRWYASNQQLPDGTQIVVGGRNAFTVEYVPANGRGQTTLPLLQETNSAQ  211

Query  702  LDNL  713
             DNL
Sbjct  212  NDNL  215



>ref|XP_010540180.1| PREDICTED: galactose oxidase-like [Tarenaya hassleriana]
Length=565

 Score =   197 bits (500),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 100/194 (52%), Positives = 133/194 (69%), Gaps = 3/194 (2%)
 Frame = +3

Query  132  TVNPARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKN  311
            T + A AA  G W+LL+ + GI++MH  + R + V++ DRT+ GPS I LP  +CR++ N
Sbjct  27   TCHVATAAGGGRWQLLLRSVGISAMHMQLLRNDRVIMFDRTDFGPSNISLPGGNCRSNPN  86

Query  312  DPVLKTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKF  491
            D V K DC AHSV  D+ +N +RPLTV ++TWCSSG  +PDG+L+QTGGDLDG R+ R F
Sbjct  87   DRVSKVDCTAHSVEFDVISNGIRPLTVQSNTWCSSGSVMPDGTLVQTGGDLDGERRARLF  146

Query  492  VPCNSSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVH-  668
             PC S+  CDW+ELE+  L+  RWYA+N ILPDGS IIVGGR   + EF+P      V+ 
Sbjct  147  SPCFSND-CDWKELEN-GLALRRWYASNHILPDGSQIIVGGRGQFNFEFYPKTKDPNVYN  204

Query  669  FPFLGEVEDRQLDN  710
             PFL +  DR  +N
Sbjct  205  LPFLAQTNDRGSEN  218



>ref|XP_009364601.1| PREDICTED: galactose oxidase [Pyrus x bretschneideri]
Length=556

 Score =   196 bits (499),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 104/196 (53%), Positives = 127/196 (65%), Gaps = 7/196 (4%)
 Frame = +3

Query  141  PARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPV  320
            P  ++  G W LL  + GI++MH  + R N V++ DRT+ GPS I LP   CR D ND V
Sbjct  29   PPYSSNQGQWRLLHSSVGISAMHMQLLRTNKVIMFDRTDYGPSNISLPRGQCRRDPNDTV  88

Query  321  LKTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPC  500
            LK DC AHS+L DL +N+ RPLTV TDTWCSSG  LPDG+L+QTGG  DG R  R F PC
Sbjct  89   LKVDCTAHSILYDLGSNTFRPLTVHTDTWCSSGSVLPDGTLVQTGGYNDGDRVVRTFSPC  148

Query  501  NSSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFP---PRXGG--AV  665
            N+ + CDW EL +  L Q RWYATNQILPDG VIIVGGR   + EF+P      GG   +
Sbjct  149  NNDN-CDWLELPN-YLIQRRWYATNQILPDGRVIIVGGRQQFNYEFYPRSSQNQGGPRTI  206

Query  666  HFPFLGEVEDRQLDNL  713
               FL +  D+  +NL
Sbjct  207  WLEFLRQTTDQDENNL  222



>gb|AEW07659.1| hypothetical protein 0_8408_01, partial [Pinus radiata]
 gb|AFG46415.1| hypothetical protein 0_8408_01, partial [Pinus taeda]
Length=140

 Score =   184 bits (468),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 100/127 (79%), Gaps = 0/127 (0%)
 Frame = +3

Query  144  ARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVL  323
            A A LPGTWELL  N GIASMHTAVTR+ TVVLLDRT+IG S+I LP  +CR+D ND  L
Sbjct  13   ADAQLPGTWELLAENGGIASMHTAVTRYGTVVLLDRTDIGESKISLPPGNCRDDPNDQAL  72

Query  324  KTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCN  503
            + DC AHSVLL+  TN +RPL +LTDTWCSSGQFLPDG+L+QTGG +DG +K RKF PC 
Sbjct  73   QHDCSAHSVLLNPATNGIRPLKILTDTWCSSGQFLPDGTLLQTGGAMDGNKKIRKFAPCP  132

Query  504  SSSLCDW  524
               LCDW
Sbjct  133  PEELCDW  139



>ref|XP_006304793.1| hypothetical protein CARUB_v10012343mg [Capsella rubella]
 gb|EOA37691.1| hypothetical protein CARUB_v10012343mg [Capsella rubella]
Length=549

 Score =   196 bits (497),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 125/188 (66%), Gaps = 3/188 (2%)
 Frame = +3

Query  150  AALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKT  329
            +A  G+W +L+PN GI++MH  +   + VV+ DRTN GPS I LP  +CRN+ ND V K 
Sbjct  27   SAAGGSWNVLLPNVGISAMHMQLLHNDRVVMFDRTNFGPSNISLPNGNCRNNPNDAVSKI  86

Query  330  DCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSS  509
            DC AHS+  D+  N++RPLTV ++TWCSSG   PDG LIQTGGD DG  K R F PCN +
Sbjct  87   DCTAHSIEYDVAMNTVRPLTVQSNTWCSSGSVRPDGVLIQTGGDRDGALKARTFTPCNDN  146

Query  510  SLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXG-GAVHFPFLGE  686
              CDW E+++  LS+ RWY++NQ+LPDG  I++GG+   + EFFP       V  PFL E
Sbjct  147  K-CDWVEIDN-GLSKRRWYSSNQLLPDGKQIVIGGQGQFNYEFFPKTTSPNVVDLPFLAE  204

Query  687  VEDRQLDN  710
              DR  +N
Sbjct  205  TNDRGQEN  212



>ref|XP_001758038.1| predicted protein [Physcomitrella patens]
 gb|EDQ77280.1| predicted protein [Physcomitrella patens]
Length=513

 Score =   195 bits (495),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 98/190 (52%), Positives = 122/190 (64%), Gaps = 3/190 (2%)
 Frame = +3

Query  147  RAALPGTW-ELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVL  323
            R  + G W E +V NAGI++MH AVT   +V+LLDRTNIG S++ LP   CR++  D   
Sbjct  6    RLGVKGDWYETVVENAGISTMHAAVTNTGSVILLDRTNIGDSQLSLPNGVCRDNPEDRAN  65

Query  324  KTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCN  503
              DC AHS L   + N +RPL V TDTWCSSGQF  +G ++QTGGD DG  K R F PCN
Sbjct  66   THDCTAHSALFTPNGNVIRPLFVYTDTWCSSGQFDANGQMVQTGGDADGLMKIRTFAPCN  125

Query  504  SSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFPFLG  683
              + CDW E +  QL  GRWYATNQILPDGS I+VGGR+  ++E+ P    G  +   L 
Sbjct  126  DGN-CDWVE-QGAQLQNGRWYATNQILPDGSQIVVGGRSVFTIEYVPANGRGTYYLDLLE  183

Query  684  EVEDRQLDNL  713
            +  D Q DNL
Sbjct  184  KTNDAQQDNL  193



>ref|XP_002970607.1| hypothetical protein SELMODRAFT_411320 [Selaginella moellendorffii]
 gb|EFJ28737.1| hypothetical protein SELMODRAFT_411320 [Selaginella moellendorffii]
Length=529

 Score =   195 bits (496),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 96/188 (51%), Positives = 125/188 (66%), Gaps = 4/188 (2%)
 Frame = +3

Query  150  AALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKT  329
            A  PG + +++ NAGI+SMHTAVT +  V+ LDRTNIGPS I L   +CR++  D +   
Sbjct  22   AQQPGRFNIVLQNAGISSMHTAVTHYGNVIFLDRTNIGPSAINL-VGNCRDNPADMMTTH  80

Query  330  DCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSS  509
            DC AHSV+ D  +N++RP+ + +DTWCSSGQFLP+G+L+QTGG  DG    R F PC+S 
Sbjct  81   DCTAHSVIYDPSSNTVRPVFIYSDTWCSSGQFLPNGTLMQTGGSSDGGSIIRYFTPCSSG  140

Query  510  SLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFPFLGEV  689
            S C+W E     L   RWYA+NQILPDG +I+VGGR   + EF P   GG  +  FL + 
Sbjct  141  SWCNWME-SSTNLQSSRWYASNQILPDGRIIVVGGRGVYNYEFQP--TGGQFYLQFLKDT  197

Query  690  EDRQLDNL  713
             D Q DNL
Sbjct  198  ADFQDDNL  205



>ref|XP_008389005.1| PREDICTED: galactose oxidase [Malus domestica]
Length=556

 Score =   195 bits (496),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 124/189 (66%), Gaps = 7/189 (4%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            G W LL  + GI++MH  + R N V++ DRT+ GPS I LP   CR D ND VLK DC A
Sbjct  36   GQWHLLHSSVGISAMHMQLLRTNKVIMFDRTDYGPSNISLPRGQCRRDPNDTVLKVDCTA  95

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HS+L DL +N+ RPLTV TDTWCSSG  LPDG+L+QTGG  DG R  R F PCN+ + CD
Sbjct  96   HSILYDLGSNTFRPLTVHTDTWCSSGSILPDGTLVQTGGYNDGDRVVRTFSPCNNDN-CD  154

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFP---PRXGG--AVHFPFLGE  686
            W EL +  L Q RWYATNQILPDG VIIVGGR   + EF+P      GG   +   FL +
Sbjct  155  WLELPN-YLIQRRWYATNQILPDGRVIIVGGRRQFNYEFYPRSSQNQGGPHTIWLEFLRQ  213

Query  687  VEDRQLDNL  713
              D+  +NL
Sbjct  214  TTDQDENNL  222



>ref|XP_009149487.1| PREDICTED: galactose oxidase [Brassica rapa]
Length=549

 Score =   195 bits (496),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 124/187 (66%), Gaps = 3/187 (2%)
 Frame = +3

Query  153  ALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTD  332
            A  G W+LL+PN GI++MH  + R + VV+ DRTN GPS I LP  +CRN+  DPV K D
Sbjct  28   AAGGRWKLLLPNVGISAMHMQLLRNDRVVMFDRTNFGPSNISLPNGNCRNNPQDPVSKID  87

Query  333  CYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSS  512
            C AHS+  D+ +N++RPLTV ++TWCSSG   PDG L+QTGGD DG  K R F PCN+  
Sbjct  88   CTAHSIEYDVASNTIRPLTVQSNTWCSSGSVRPDGVLVQTGGDRDGELKARIFTPCNNKK  147

Query  513  LCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXG-GAVHFPFLGEV  689
             CDW E+ +  L++ RWY++N ILPDG  I++GG+   + EFFP       +  PFL E 
Sbjct  148  -CDWIEINN-GLTKRRWYSSNHILPDGKQIVIGGQGQFNYEFFPKTTSPNVIALPFLAET  205

Query  690  EDRQLDN  710
             DR  +N
Sbjct  206  NDRGEEN  212



>ref|XP_001782509.1| predicted protein [Physcomitrella patens]
 gb|EDQ52661.1| predicted protein [Physcomitrella patens]
Length=518

 Score =   194 bits (494),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 94/185 (51%), Positives = 124/185 (67%), Gaps = 4/185 (2%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            G+W++L  NAGIA MH A T +NT+++LDRTN GPS+IRL    CRN   + +LK DC+A
Sbjct  12   GSWQILNRNAGIACMHAAATHYNTLIMLDRTNTGPSQIRLAGGKCRNQPLERILKNDCWA  71

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HSV+++  + ++RPLTV TDTWCSSGQF  +G ++QTGGD +G RK R   PC     CD
Sbjct  72   HSVMMNPVSGAVRPLTVQTDTWCSSGQFFDNGMMVQTGGDFEGLRKIRTLKPCPPEGNCD  131

Query  522  WQELEDVQLSQGRWYATNQILPDGS-VIIVGGRTAQSVEFFPPRXGGAVHFPFLGEVEDR  698
            W EL +  L++GRWYA+NQ+L  G+  IIVGGR   + EF+P R  G   +     V D 
Sbjct  132  WMELAE-PLAKGRWYASNQLLQTGTRQIIVGGRNEPTYEFYPKRRAGEGAYYL--SVLDG  188

Query  699  QLDNL  713
              DNL
Sbjct  189  CCDNL  193



>ref|XP_009794042.1| PREDICTED: galactose oxidase-like [Nicotiana sylvestris]
Length=553

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 96/189 (51%), Positives = 122/189 (65%), Gaps = 3/189 (2%)
 Frame = +3

Query  150  AALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKT  329
            +A  G W LL+PN GI++MH  +   + VV+ DRT+ G S I LP   CRND ND  L+ 
Sbjct  30   SAAGGKWNLLMPNIGISAMHMQLLNNDKVVIFDRTDFGHSNISLPYGKCRNDPNDTTLQI  89

Query  330  DCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSS  509
            DC AHSV  +  TNS+RPL V TD WCSSG   PDGSL+QTGG  DG +  R F PCN +
Sbjct  90   DCTAHSVEYNTVTNSIRPLMVQTDVWCSSGAVFPDGSLVQTGGFNDGEKVVRVFKPCNGN  149

Query  510  SLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGG--AVHFPFLG  683
            + CDWQE++   L+Q RWYATN ILPDG  I++GGR A + EF+P       A   PFL 
Sbjct  150  NTCDWQEIQG-GLAQRRWYATNHILPDGRQIVIGGRRAFNYEFYPKPASAYKAYSLPFLV  208

Query  684  EVEDRQLDN  710
            +  D +++N
Sbjct  209  QTNDLKIEN  217



>gb|KJB45029.1| hypothetical protein B456_007G286100 [Gossypium raimondii]
Length=547

 Score =   194 bits (493),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/196 (47%), Positives = 123/196 (63%), Gaps = 1/196 (1%)
 Frame = +3

Query  123  IHSTVNPARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRN  302
            + S   P+ +   G W+LL  + GI++MH  +   N V++ DRT+ GPS + LP   CR 
Sbjct  18   VASQALPSYSGRNGEWQLLHESVGISAMHMQLLHNNKVIIFDRTDFGPSNLSLPNGICRV  77

Query  303  DKNDPVLKTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKF  482
            D +D +L+TDC AHS+L D+ TN  RPL + TDTWCSSG  LP+G+L+QTGG  DG R  
Sbjct  78   DSSDTMLQTDCTAHSILYDIVTNGFRPLMIQTDTWCSSGAVLPNGTLVQTGGYNDGERNI  137

Query  483  RKFVPCNSSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGA  662
            R F PC+    C+W E     L Q RWYA+NQ+LPDG +IIVGGR   + EF+P    G 
Sbjct  138  RSFTPCSDDEYCNWIEFPQ-SLIQRRWYASNQVLPDGRIIIVGGRRQFNYEFYPSSWNGV  196

Query  663  VHFPFLGEVEDRQLDN  710
            +   FL E  D+ L+N
Sbjct  197  IFLDFLMETNDQGLEN  212



>ref|XP_006416454.1| hypothetical protein EUTSA_v10007284mg [Eutrema salsugineum]
 gb|ESQ34807.1| hypothetical protein EUTSA_v10007284mg [Eutrema salsugineum]
Length=547

 Score =   194 bits (492),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 122/187 (65%), Gaps = 3/187 (2%)
 Frame = +3

Query  153  ALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTD  332
            A  G W LL+PN GI++MH  + R + VV+ DRTN GPS I LP  +CRN+ ND V K D
Sbjct  27   AAGGKWNLLLPNVGISAMHMQLLRNDRVVMFDRTNFGPSNISLPNGNCRNNPNDAVSKID  86

Query  333  CYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSS  512
            C AHS+  D+ +N++RPLTV ++TWCSSG   PDG L+QTGGD DG  K R F PCN+  
Sbjct  87   CTAHSIEYDVASNTVRPLTVQSNTWCSSGSVRPDGVLVQTGGDRDGELKARTFTPCNNDR  146

Query  513  LCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXG-GAVHFPFLGEV  689
             CDW E+ +  L++ RWY++N ILPDG  IIVGG    + EF+P       +  PFL E 
Sbjct  147  -CDWAEINN-GLARRRWYSSNHILPDGKQIIVGGTRQFNYEFYPKTTSPNVIALPFLAET  204

Query  690  EDRQLDN  710
             DR  +N
Sbjct  205  NDRGQEN  211



>gb|EYU23055.1| hypothetical protein MIMGU_mgv1a021812mg, partial [Erythranthe 
guttata]
Length=517

 Score =   193 bits (490),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 97/188 (52%), Positives = 123/188 (65%), Gaps = 3/188 (2%)
 Frame = +3

Query  153  ALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTD  332
            +L G W LL  + GI++MH  + + N +V+ DRT+ GPS + LP   CR+D ND VL  D
Sbjct  1    SLQGEWRLLHESIGISAMHMQLLKNNKLVIFDRTDFGPSNLSLPDGRCRSDPNDEVLVRD  60

Query  333  CYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSS  512
            C AHS++ D+ +NS RPLT+LTDTWCSSG  LPDG+L+QTGG  DG    R   PC   +
Sbjct  61   CTAHSIMYDIGSNSFRPLTILTDTWCSSGTVLPDGTLVQTGGFNDGDHVTRTLAPCARKN  120

Query  513  LCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXG-GAVHFPFLGEV  689
             CDW E  D  LS+ RWYATNQILPDG +IIVGGR   + EF+P   G G++   FL E 
Sbjct  121  -CDWNEFPD-SLSRRRWYATNQILPDGRIIIVGGRAQFNYEFYPRNYGDGSIRLRFLKEA  178

Query  690  EDRQLDNL  713
             D   +NL
Sbjct  179  RDGSENNL  186



>emb|CDY44191.1| BnaC05g15480D [Brassica napus]
Length=777

 Score =   196 bits (497),  Expect = 4e-54, Method: Composition-based stats.
 Identities = 92/187 (49%), Positives = 121/187 (65%), Gaps = 3/187 (2%)
 Frame = +3

Query  153  ALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTD  332
            A  G W LL+PN GI++MH  + R + VV+ DRTN GPS I LP  +CRN+  DP+ K D
Sbjct  27   AAGGKWNLLLPNVGISAMHMQLLRNDRVVMFDRTNFGPSNISLPNGNCRNNPQDPISKID  86

Query  333  CYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSS  512
            C AHS+  D+ +N++RPLTV ++TWCSSG   PDG L+QTGGD DG  K R F PC    
Sbjct  87   CTAHSIEYDVASNTIRPLTVQSNTWCSSGSVRPDGVLVQTGGDRDGELKARIFSPCKDKR  146

Query  513  LCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXG-GAVHFPFLGEV  689
             CDW E+ +  L++ RWY++N ILPDG  I++GG+   + EFFP       +  PFL E 
Sbjct  147  -CDWIEINN-GLTKRRWYSSNHILPDGKQIVIGGQGQFNYEFFPKTTSPNVIALPFLAET  204

Query  690  EDRQLDN  710
             DR  +N
Sbjct  205  NDRGEEN  211



>gb|AFG46408.1| hypothetical protein 0_8408_01, partial [Pinus taeda]
 gb|AFG46409.1| hypothetical protein 0_8408_01, partial [Pinus taeda]
 gb|AFG46410.1| hypothetical protein 0_8408_01, partial [Pinus taeda]
 gb|AFG46411.1| hypothetical protein 0_8408_01, partial [Pinus taeda]
 gb|AFG46412.1| hypothetical protein 0_8408_01, partial [Pinus taeda]
 gb|AFG46413.1| hypothetical protein 0_8408_01, partial [Pinus taeda]
 gb|AFG46414.1| hypothetical protein 0_8408_01, partial [Pinus taeda]
 gb|AFG46416.1| hypothetical protein 0_8408_01, partial [Pinus taeda]
 gb|AFG46417.1| hypothetical protein 0_8408_01, partial [Pinus taeda]
 gb|AFG46418.1| hypothetical protein 0_8408_01, partial [Pinus taeda]
 gb|AFG46419.1| hypothetical protein 0_8408_01, partial [Pinus taeda]
 gb|AFG46420.1| hypothetical protein 0_8408_01, partial [Pinus taeda]
 gb|AFG46421.1| hypothetical protein 0_8408_01, partial [Pinus taeda]
 gb|AFG46422.1| hypothetical protein 0_8408_01, partial [Pinus taeda]
Length=140

 Score =   182 bits (461),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = +3

Query  144  ARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVL  323
            A A LPGTWELL  N GIASMHTAVT + TVVLLDRT+IG S+I LP  +CR+D ND  L
Sbjct  13   ADAQLPGTWELLAENGGIASMHTAVTHYGTVVLLDRTDIGESKISLPPGNCRDDPNDQAL  72

Query  324  KTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCN  503
            + DC AHSVLL+  TN +RPL +LTDTWCSSGQFLPDG+L+QTGG +DG +K RKF PC 
Sbjct  73   QHDCSAHSVLLNPATNGIRPLKILTDTWCSSGQFLPDGTLLQTGGAMDGNKKIRKFAPCP  132

Query  504  SSSLCDW  524
               LCDW
Sbjct  133  PEELCDW  139



>gb|KFK44113.1| hypothetical protein AALP_AA1G217400 [Arabis alpina]
Length=508

 Score =   192 bits (488),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 96/188 (51%), Positives = 122/188 (65%), Gaps = 3/188 (2%)
 Frame = +3

Query  150  AALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKT  329
            +A  G W LL+PN GIA+MH  + R + VV+ DRTN GPS I LP  +CR+  ND V K 
Sbjct  27   SAAGGKWNLLLPNVGIAAMHMQLLRNDRVVMFDRTNFGPSNISLPNGNCRDSPNDIVTKL  86

Query  330  DCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSS  509
            DC AHS+  D+ +N++RPLTV ++TWCSSG   PDG L+QTGGD DG  K R F PCN++
Sbjct  87   DCTAHSIEYDVASNTVRPLTVQSNTWCSSGSVRPDGVLVQTGGDRDGELKARTFSPCNNN  146

Query  510  SLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXG-GAVHFPFLGE  686
              CDW E  +  L+  RWYA+N ILPDG  I+VGG+   + EF+P       V  PFL E
Sbjct  147  R-CDWVEFSN-GLATRRWYASNHILPDGKQIVVGGQGKFNYEFYPKTTSQNVVALPFLAE  204

Query  687  VEDRQLDN  710
              DR  +N
Sbjct  205  TNDRGEEN  212



>ref|XP_011073112.1| PREDICTED: galactose oxidase [Sesamum indicum]
Length=549

 Score =   192 bits (488),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 101/194 (52%), Positives = 121/194 (62%), Gaps = 5/194 (3%)
 Frame = +3

Query  141  PARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPV  320
            PA A + G W LL  + GI++MH  + + N VV+ DRT+ GPS I L    CR D ND V
Sbjct  28   PAYAHIEGEWHLLHRSIGISAMHMQLLKNNKVVIFDRTDFGPSNISLSGRRCRFDPNDRV  87

Query  321  LKTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPC  500
            LK DC AHS+L D+ TN  R LTV TDTWCSSG  LPDG+L+QTGG  DG    R  VPC
Sbjct  88   LKKDCTAHSILYDIRTNGFRTLTVQTDTWCSSGALLPDGTLVQTGGYNDGDHVIRILVPC  147

Query  501  NSSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFP---PRXGGAVHF  671
            N  + CDW E     LS+ RWYA+NQILPDG VIIVGGR   + EF+P   P    +   
Sbjct  148  NGGN-CDWVEFPR-SLSRRRWYASNQILPDGRVIIVGGRAQFNYEFYPGHSPSSSKSFRL  205

Query  672  PFLGEVEDRQLDNL  713
             FL E +D   +NL
Sbjct  206  NFLRETKDGHENNL  219



>ref|XP_009614398.1| PREDICTED: galactose oxidase-like [Nicotiana tomentosiformis]
Length=553

 Score =   192 bits (488),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/189 (50%), Positives = 122/189 (65%), Gaps = 3/189 (2%)
 Frame = +3

Query  150  AALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKT  329
            +A  G W +L+ N GI++MH  +   + VV+ DRT+ G S I LP   CRND ND  L+ 
Sbjct  30   SAAGGKWNILMSNIGISAMHMQLLNNDKVVIFDRTDFGHSNISLPDGKCRNDPNDTTLQI  89

Query  330  DCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSS  509
            DC AHSV  ++ TNS+RPL V TD WCSSG   PDGSL+QTGG  DG +  R F PCN +
Sbjct  90   DCTAHSVEYNIVTNSIRPLMVQTDVWCSSGSVFPDGSLVQTGGFNDGEKVVRVFKPCNGN  149

Query  510  SLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGG--AVHFPFLG  683
            + CDWQE++   L+Q RWYATN ILPDG  II+GGR A + EF+P       A   PFL 
Sbjct  150  NTCDWQEIQG-GLAQRRWYATNHILPDGRQIIIGGRRAFNYEFYPKPASAYKAYSLPFLV  208

Query  684  EVEDRQLDN  710
            +  D +++N
Sbjct  209  QTNDPKIEN  217



>ref|XP_002994680.1| hypothetical protein SELMODRAFT_432583 [Selaginella moellendorffii]
 gb|EFJ04255.1| hypothetical protein SELMODRAFT_432583 [Selaginella moellendorffii]
Length=202

 Score =   183 bits (464),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 114/165 (69%), Gaps = 2/165 (1%)
 Frame = +3

Query  150  AALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKT  329
            A  PG + +++ NAGI+SMHTAVT +  V+ LDRTNIGPS I L   +CR++  D +   
Sbjct  22   AQQPGRFNIVLQNAGISSMHTAVTHYGNVIFLDRTNIGPSAINL-VGNCRDNPADMMTTH  80

Query  330  DCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSS  509
            DC AHSV+ D  +N++RP+ + +DTWCSSGQFLP+G+L+QTGG  DG    R F PC+S 
Sbjct  81   DCTAHSVIYDPSSNTVRPVFIYSDTWCSSGQFLPNGTLMQTGGSADGGSIIRYFTPCSSG  140

Query  510  SLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFP  644
            S C+W E     L   RWYA+NQILPDG +I+VGGR   + EF P
Sbjct  141  SWCNWME-SSTNLQSSRWYASNQILPDGRIIVVGGRGVYNYEFQP  184



>ref|XP_001751285.1| predicted protein [Physcomitrella patens]
 gb|EDQ83602.1| predicted protein, partial [Physcomitrella patens]
Length=513

 Score =   191 bits (485),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 115/175 (66%), Gaps = 0/175 (0%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            G  +LL+ ++GIASMHT V    TV+ LDRTN+GPS IRL   +CRN  ++ V   DC+A
Sbjct  1    GAEQLLMNDSGIASMHTVVLHTGTVLFLDRTNVGPSHIRLADGNCRNSTSEMVSPYDCFA  60

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HSV      N++RPLT+ TDTWCSSG  + DG+L+QTGGD DG  K R F PC S + CD
Sbjct  61   HSVEFTPGPNTVRPLTIQTDTWCSSGAVVADGTLVQTGGDFDGSNKIRYFKPCASGANCD  120

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFPFLGE  686
            W E     L   RWYATNQ+L DGS+++VGG+   + EF P R  G V  PFL E
Sbjct  121  WAEDSTTTLQTRRWYATNQVLADGSILVVGGQNVFTYEFVPGRPAGQVALPFLQE  175



>ref|XP_001762682.1| predicted protein [Physcomitrella patens]
 gb|EDQ72481.1| predicted protein [Physcomitrella patens]
Length=520

 Score =   191 bits (485),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/173 (52%), Positives = 117/173 (68%), Gaps = 1/173 (1%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            G+W+ L  + GI+SMHTAVTRF+T +LLDRTN+G S + LP   CR    + +   DCYA
Sbjct  9    GSWQTLKDDVGISSMHTAVTRFDTAILLDRTNVGLSTLLLPNGRCRVQPLERMSNPDCYA  68

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HSV+ D + N++R L V TDTWCSSGQF  DGSL+QTGGD +G +K R+ VPC +   CD
Sbjct  69   HSVMYDPNANTVRALYVFTDTWCSSGQFFADGSLVQTGGDFEGAKKIRRLVPCQADETCD  128

Query  522  WQELEDVQLSQGRWYATNQILPDG-SVIIVGGRTAQSVEFFPPRXGGAVHFPF  677
            W E    +L+  RWYAT+ +LPDG S+II+GGR   + EF P R  G   +P 
Sbjct  129  WVESTTEELAVARWYATSHLLPDGKSMIIMGGRNNPTYEFVPKRFPGEGVYPL  181



>ref|XP_006300296.1| hypothetical protein CARUB_v10021300mg [Capsella rubella]
 gb|EOA33194.1| hypothetical protein CARUB_v10021300mg [Capsella rubella]
Length=547

 Score =   191 bits (484),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 96/184 (52%), Positives = 123/184 (67%), Gaps = 3/184 (2%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            G+W+LL+ N GI++MH+ +   + V++ DRTN GPS I LP   CRN  ND V KTDC A
Sbjct  35   GSWKLLLSNVGISAMHSQLLHNDRVIMYDRTNFGPSNISLPNGACRNSPNDIVSKTDCTA  94

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HSV  D+  NS+RPLTV ++TWCSSG   PDG+L+QTGGD DG RK R F PC+  S CD
Sbjct  95   HSVEYDVALNSIRPLTVQSNTWCSSGGVTPDGTLLQTGGDRDGERKTRLFAPCDDGS-CD  153

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVH-FPFLGEVEDR  698
            W E+ D  L+  RWYA+N +LPDG  IIVGG+   + EFFP      ++  PFL +  DR
Sbjct  154  WTEI-DKGLNARRWYASNHVLPDGRQIIVGGQGQFNFEFFPKTNAPNLYSLPFLSQTNDR  212

Query  699  QLDN  710
              +N
Sbjct  213  GEEN  216



>ref|XP_001763031.1| predicted protein [Physcomitrella patens]
 gb|EDQ72236.1| predicted protein [Physcomitrella patens]
Length=537

 Score =   190 bits (483),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 93/185 (50%), Positives = 119/185 (64%), Gaps = 3/185 (2%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            G+WE +V NAGI++MH AVT +  V+LLDRTNIG S++ LPA  CR++  D     DC A
Sbjct  33   GSWETVVDNAGISTMHAAVTHYGNVILLDRTNIGDSQLPLPAGVCRDNPADRANTHDCTA  92

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HS +    +N++RPL + TDTWCSSG F  DG++IQTGGD DG  K R F PC  +  CD
Sbjct  93   HSAIYSPGSNAIRPLFIFTDTWCSSGAFDGDGNMIQTGGDSDGISKIRTFAPCGDNGGCD  152

Query  522  WQE-LEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFPFLGEVEDR  698
            W E   D+QL  GRWYA+NQ LPDG+  ++GGR A +VE+ P    G      L +    
Sbjct  153  WVETTTDLQL--GRWYASNQQLPDGTQAVIGGRNAFTVEYVPANGRGQTELQLLIDTNSA  210

Query  699  QLDNL  713
            Q DNL
Sbjct  211  QYDNL  215



>ref|NP_177692.1| glyoxal oxidase-related protein [Arabidopsis thaliana]
 gb|AAF87115.1|AC006434_11 F10A5.18 [Arabidopsis thaliana]
 gb|AEE35738.1| glyoxal oxidase-related protein [Arabidopsis thaliana]
Length=547

 Score =   189 bits (481),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 96/179 (54%), Positives = 120/179 (67%), Gaps = 3/179 (2%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            GTWELL+PN GI++MH+ +   + V++ DRTN GPS I LP   CR+   D V KTDC A
Sbjct  35   GTWELLLPNVGISAMHSQLLHNDRVIMYDRTNFGPSNISLPNGACRSSPGDAVSKTDCTA  94

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HSV  D+  N +RPLTV ++TWCSSG   PDG+L+QTGGDLDG RK R   PC+ +S CD
Sbjct  95   HSVEYDVALNRIRPLTVQSNTWCSSGGVTPDGTLLQTGGDLDGERKVRLMDPCDDNS-CD  153

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVH-FPFLGEVED  695
            W E+++  L+  RWYATN ILPDG  II+GGR   + EFFP       +  PFL E  D
Sbjct  154  WIEVDN-GLAARRWYATNHILPDGRQIIIGGRGQFNYEFFPKTNAPNFYSIPFLSETND  211



>ref|XP_010498415.1| PREDICTED: galactose oxidase [Camelina sativa]
Length=549

 Score =   189 bits (481),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/188 (48%), Positives = 124/188 (66%), Gaps = 3/188 (2%)
 Frame = +3

Query  150  AALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKT  329
            +A  G+W +L+PN GI++MH  + R + VV+ DRTN GPS I LP  +CR++ ND V + 
Sbjct  27   SAAGGSWNVLLPNVGISAMHMQLLRNDRVVMFDRTNFGPSNISLPNGNCRDNPNDAVSRI  86

Query  330  DCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSS  509
            DC AHS+  D+  N++RPLTV ++TWCSSG   PDG L+QTGGD DG  K R F PCN+ 
Sbjct  87   DCTAHSIEYDVAMNTVRPLTVQSNTWCSSGSVTPDGVLVQTGGDRDGALKARTFSPCNND  146

Query  510  SLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXG-GAVHFPFLGE  686
              CDW E+++  L + RWY++N +LPDG  I++GG+   + EFFP       V  PFL E
Sbjct  147  Q-CDWVEIDNGLLKR-RWYSSNHLLPDGKQIVIGGQGQFNYEFFPKTTSPNVVALPFLAE  204

Query  687  VEDRQLDN  710
              DR  +N
Sbjct  205  TNDRGQEN  212



>ref|XP_001751488.1| predicted protein [Physcomitrella patens]
 gb|EDQ83805.1| predicted protein [Physcomitrella patens]
Length=506

 Score =   187 bits (475),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 118/184 (64%), Gaps = 2/184 (1%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            G WE +V NAGIA+MH AVT +  VVLLDRTN+GPS++ L    CR++  D     DC A
Sbjct  6    GYWETVVNNAGIATMHAAVTHYGNVVLLDRTNVGPSQLNLAPGVCRDNPQDRASTHDCTA  65

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HS L    +N +RPL V TDTWCSSGQF   G L+QTGGD DG  K R F PC     CD
Sbjct  66   HSALFTPGSNDIRPLFVYTDTWCSSGQFDGSGKLVQTGGDADGLMKIRNFSPCGGGG-CD  124

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFPFLGEVEDRQ  701
            W EL D  L QGRWYA+NQILPDG+ I+VGGR   +VE+ P    G    P L +  D Q
Sbjct  125  WVEL-DGGLQQGRWYASNQILPDGTQIVVGGRGVGTVEYVPANGRGTYDVPLLYKSNDAQ  183

Query  702  LDNL  713
            +DNL
Sbjct  184  MDNL  187



>ref|XP_010471675.1| PREDICTED: galactose oxidase-like isoform X1 [Camelina sativa]
Length=548

 Score =   188 bits (477),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 93/184 (51%), Positives = 121/184 (66%), Gaps = 3/184 (2%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            GTW LL+PN GI++MH+ +   + V++ DRTN GPS I LP   CR   ND V KTDC A
Sbjct  35   GTWRLLLPNVGISAMHSQLLHNDRVIMYDRTNFGPSNISLPNGACRKSPNDAVSKTDCTA  94

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HSV  ++  NS+RPLTV ++TWCSSG   PDG+L+QTGG  DG RK R F PC+  S CD
Sbjct  95   HSVEYNVALNSIRPLTVQSNTWCSSGGVTPDGTLLQTGGSRDGERKTRLFAPCDDDS-CD  153

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVH-FPFLGEVEDR  698
            W E+++  L+  RWYA+N +LPDG  II+GGR   + EFFP      ++  PFL +  D 
Sbjct  154  WTEVDN-GLAASRWYASNHVLPDGRQIIIGGRDQFNYEFFPKTNAPNLYELPFLAQTTDP  212

Query  699  QLDN  710
              +N
Sbjct  213  GQEN  216



>ref|XP_010471676.1| PREDICTED: galactose oxidase-like isoform X2 [Camelina sativa]
Length=548

 Score =   188 bits (477),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 93/184 (51%), Positives = 121/184 (66%), Gaps = 3/184 (2%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            GTW LL+PN GI++MH+ +   + V++ DRTN GPS I LP   CR   ND V KTDC A
Sbjct  35   GTWRLLLPNVGISAMHSQLLHNDRVIMYDRTNFGPSNISLPNGACRKSPNDAVSKTDCTA  94

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HSV  ++  NS+RPLTV ++TWCSSG   PDG+L+QTGG  DG RK R F PC+  S CD
Sbjct  95   HSVEYNVALNSIRPLTVQSNTWCSSGGVTPDGTLLQTGGSRDGERKTRLFAPCDDDS-CD  153

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVH-FPFLGEVEDR  698
            W E+++  L+  RWYA+N +LPDG  II+GGR   + EFFP      ++  PFL +  D 
Sbjct  154  WTEVDN-GLAASRWYASNHVLPDGRQIIIGGRDQFNYEFFPKTNAPNLYELPFLAQTTDP  212

Query  699  QLDN  710
              +N
Sbjct  213  GQEN  216



>ref|XP_010536368.1| PREDICTED: galactose oxidase-like [Tarenaya hassleriana]
Length=557

 Score =   188 bits (477),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 122/184 (66%), Gaps = 3/184 (2%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            G+W+LL  N GI++MH  +   + V+  DRT+ GPS I LP+  CRN++ND V K DC A
Sbjct  38   GSWQLLQLNVGISAMHMQLLHNDRVITFDRTDFGPSNISLPSGKCRNNQNDRVSKLDCTA  97

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HSV  D+  N +RPLTV ++TWCSSG   PDG+L+QTGGDLDG R+ R F PC ++  CD
Sbjct  98   HSVEYDVLGNGIRPLTVQSNTWCSSGSVTPDGTLVQTGGDLDGERRARLFFPCKTNK-CD  156

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVH-FPFLGEVEDR  698
            W E+ D  L+  RWYA+N ILPDG  IIVGGR   + EF+P      V+  PFL +  DR
Sbjct  157  WSEI-DNGLALRRWYASNHILPDGRQIIVGGRGQFNFEFYPKTKDPNVYNLPFLAQTNDR  215

Query  699  QLDN  710
              +N
Sbjct  216  GSEN  219



>ref|XP_002889034.1| hypothetical protein ARALYDRAFT_895435 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65293.1| hypothetical protein ARALYDRAFT_895435 [Arabidopsis lyrata subsp. 
lyrata]
Length=547

 Score =   187 bits (476),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 94/185 (51%), Positives = 121/185 (65%), Gaps = 3/185 (2%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            GTWELL+PN GI++MH+ +   + V++ DRTN GPS I LP   CR+   D V   DC A
Sbjct  35   GTWELLLPNVGISAMHSQLLHNDRVIMYDRTNFGPSNISLPNGACRSSPGDAVSNIDCTA  94

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HSV  D+  N +RPLTV ++TWCSSG   PDG+L QTGGD DG RK R F PC+  ++CD
Sbjct  95   HSVEYDVALNRIRPLTVQSNTWCSSGGVTPDGTLQQTGGDKDGERKVRLFAPCD-DNICD  153

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVH-FPFLGEVEDR  698
            W E+++  L+  RWYATN +LPDG  II+GGR   + EFFP      ++  PFL E  D 
Sbjct  154  WTEVDN-GLAARRWYATNHVLPDGRQIIIGGRGQFNFEFFPKTNAPNLYSLPFLSETNDP  212

Query  699  QLDNL  713
              +NL
Sbjct  213  DENNL  217



>emb|CDY62590.1| BnaA08g31280D [Brassica napus]
Length=547

 Score =   187 bits (475),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 91/187 (49%), Positives = 122/187 (65%), Gaps = 3/187 (2%)
 Frame = +3

Query  153  ALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTD  332
            A  G W LL+ N GI++MH  + R + VV+ DRTN GPS I LP  +CRN+  D V K D
Sbjct  27   AAGGKWTLLLSNVGISAMHMQLLRNDRVVMFDRTNFGPSNISLPNGNCRNNPQDAVSKID  86

Query  333  CYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSS  512
            C AHS+  D+ +N++RPLTV ++TWCSSG   PDG L+QTGGD DG  K R F PCN++ 
Sbjct  87   CTAHSIEYDVASNTVRPLTVQSNTWCSSGSVRPDGVLVQTGGDRDGELKARIFSPCNNNK  146

Query  513  LCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXG-GAVHFPFLGEV  689
             CDW E+ +  L++ RWY++N ILPDG  I++GG+   + EF+P       +  PFL E 
Sbjct  147  -CDWVEINN-GLTKRRWYSSNHILPDGKQIVIGGQGQFNYEFYPKTTSPNVIALPFLAET  204

Query  690  EDRQLDN  710
             DR  +N
Sbjct  205  NDRGQEN  211



>ref|XP_010428587.1| PREDICTED: galactose oxidase-like [Camelina sativa]
Length=548

 Score =   187 bits (475),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 92/184 (50%), Positives = 122/184 (66%), Gaps = 3/184 (2%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            GTW+LL+PN GI++MH+ +   + V++ DRTN GPS I LP   CR   ND V KTDC A
Sbjct  35   GTWKLLLPNVGISAMHSQLLHNDRVIMYDRTNFGPSNISLPHGACRQSPNDAVSKTDCTA  94

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HS+  ++  NS+RPLTV ++TWCSSG   PDG+L+QTGG  DG RK R F PC+  S CD
Sbjct  95   HSIEYNVALNSIRPLTVQSNTWCSSGGVTPDGTLLQTGGSRDGERKTRLFAPCDDDS-CD  153

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVH-FPFLGEVEDR  698
            W E+++  L+  RWYA+N +LPDG  II+GGR   + EFFP      ++  PFL +  D 
Sbjct  154  WTEVDN-GLATARWYASNHVLPDGRQIIIGGRDQFNYEFFPKTNAPNLYALPFLTQTTDP  212

Query  699  QLDN  710
              +N
Sbjct  213  GQEN  216



>ref|XP_011083592.1| PREDICTED: galactose oxidase-like [Sesamum indicum]
Length=550

 Score =   187 bits (475),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 123/188 (65%), Gaps = 4/188 (2%)
 Frame = +3

Query  153  ALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTD  332
            A  G W+LL+ N GI++MH  +   + VV+ DRT+ GPS I LP   CR D ND VL  D
Sbjct  32   AADGRWDLLLSNIGISAMHMQLLHTDRVVMFDRTDFGPSNISLPDGKCRRDPNDTVLPVD  91

Query  333  CYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSS  512
            C AHSV  D+ +NS+RPL VLTD WCSSG  +PDG+L+QTGG  DG    R + PC +S+
Sbjct  92   CTAHSVEYDVASNSIRPLMVLTDVWCSSGAVMPDGTLVQTGGFNDGDHAIRIYEPCRNST  151

Query  513  LCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXG--GAVHFPFLGE  686
             CDW+E+    L+Q RWYATN ILPDG  I+VGGR   + EF+P      G+ + PFL +
Sbjct  152  -CDWREISR-GLTQRRWYATNHILPDGRQIVVGGRRQFNYEFYPKTSSADGSYNLPFLVQ  209

Query  687  VEDRQLDN  710
              D +++N
Sbjct  210  TNDPRIEN  217



>ref|XP_010459669.1| PREDICTED: galactose oxidase-like [Camelina sativa]
Length=550

 Score =   187 bits (474),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/189 (49%), Positives = 125/189 (66%), Gaps = 4/189 (2%)
 Frame = +3

Query  150  AALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKT  329
            +A  G+W +L+PN GI++MH  + R + VV+ DRTN GPS I LP  +CR++ ND V + 
Sbjct  27   SAAGGSWNVLLPNVGISAMHMQLLRNDRVVMFDRTNFGPSNISLPNGNCRDNPNDAVSRM  86

Query  330  DCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSS  509
            DC AHS+  D+  N++RPLTV ++TWCSSG   PDG L+QTGGD DG  K R F PCN+ 
Sbjct  87   DCTAHSIEYDVAMNTVRPLTVQSNTWCSSGSVRPDGVLVQTGGDRDGALKARTFSPCNND  146

Query  510  SLCDWQELEDVQLSQGRWYATNQILPDGS-VIIVGGRTAQSVEFFPPRXG-GAVHFPFLG  683
              CDW E+++  LS+ RWY++N +LPDG   I++GG+   + EFFP       V  PFL 
Sbjct  147  Q-CDWVEIDN-GLSKRRWYSSNHLLPDGKQQIVIGGQGQFNYEFFPKTTNPNVVALPFLA  204

Query  684  EVEDRQLDN  710
            E  DR  +N
Sbjct  205  ETNDRGQEN  213



>ref|XP_009110252.1| PREDICTED: galactose oxidase-like [Brassica rapa]
Length=547

 Score =   186 bits (472),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/187 (48%), Positives = 122/187 (65%), Gaps = 3/187 (2%)
 Frame = +3

Query  153  ALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTD  332
            A  G W LL+ N GI++MH  + R + VV+ DRTN GPS I LP  +CRN+  D V K D
Sbjct  27   AAGGKWTLLLSNVGISAMHMQLLRNDRVVMFDRTNFGPSNISLPNGNCRNNPQDAVSKID  86

Query  333  CYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSS  512
            C AHS+  D+ +N++RPLTV ++TWCSSG   PDG L+QTGGD DG  K R F PCN++ 
Sbjct  87   CTAHSIEYDVASNTVRPLTVQSNTWCSSGSVRPDGVLVQTGGDRDGELKARIFSPCNNNR  146

Query  513  LCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXG-GAVHFPFLGEV  689
             CDW E+ +  +++ RWY++N ILPDG  I++GG+   + EF+P       +  PFL E 
Sbjct  147  -CDWVEINNA-VAKRRWYSSNHILPDGKQIVIGGQGQFNYEFYPKTTSPNVIALPFLAET  204

Query  690  EDRQLDN  710
             DR  +N
Sbjct  205  NDRGQEN  211



>ref|XP_004494672.1| PREDICTED: galactose oxidase-like [Cicer arietinum]
Length=559

 Score =   186 bits (473),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 118/190 (62%), Gaps = 8/190 (4%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            G W LL P  GI++MH  +T  + +++ DRT+ GPS + L    CR D  D  LKTDC A
Sbjct  38   GQWNLLQPTIGISAMHMQLTHNDKIIIFDRTDFGPSNLPLSNGECRMDPYDTALKTDCTA  97

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HSVL D++TN+ R LT+ TDTWCSSG  LP+G+LIQTGG  DG R+ R F PC   + CD
Sbjct  98   HSVLYDIYTNTFRSLTIQTDTWCSSGSVLPNGTLIQTGGFNDGERRIRMFTPCFHEN-CD  156

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRX------GGAVHFPFLG  683
            W E     L + RWYATNQILPD  VII+GGR   + EFFP           ++H PFL 
Sbjct  157  WIEFPS-YLIERRWYATNQILPDNRVIIIGGRKQFNYEFFPKTITSSESSPSSIHLPFLQ  215

Query  684  EVEDRQLDNL  713
            E  D   +NL
Sbjct  216  ETNDPNENNL  225



>ref|XP_011074991.1| PREDICTED: galactose oxidase-like [Sesamum indicum]
Length=544

 Score =   186 bits (472),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 93/188 (49%), Positives = 124/188 (66%), Gaps = 4/188 (2%)
 Frame = +3

Query  153  ALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTD  332
            A  G W+ L+ N GI++MH  +   + VV+ DRT+ G S I LPA +CRND +D  L  D
Sbjct  24   AASGRWDFLLSNIGISAMHMQLLYTDRVVIFDRTDFGVSNISLPAGNCRNDPSDTALVND  83

Query  333  CYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSS  512
            C AHSV  D+ TNS+RPL VLTDTWCSSG  +PDG+L+QTGG  DG    R + PC ++S
Sbjct  84   CTAHSVEYDVATNSIRPLMVLTDTWCSSGAVMPDGTLVQTGGYNDGDHAVRLYKPCTNNS  143

Query  513  LCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFP--FLGE  686
             CDW+E+ +  L+Q RWYATN ILPDG  I++GGR   + EF+P    G   +   FL E
Sbjct  144  -CDWREI-NPGLTQRRWYATNHILPDGRAIVIGGRRQHNYEFYPKTSPGDTSYKLDFLVE  201

Query  687  VEDRQLDN  710
             +D +++N
Sbjct  202  TKDPKIEN  209



>ref|XP_006390288.1| hypothetical protein EUTSA_v10018361mg [Eutrema salsugineum]
 gb|ESQ27574.1| hypothetical protein EUTSA_v10018361mg [Eutrema salsugineum]
Length=552

 Score =   186 bits (472),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 93/184 (51%), Positives = 122/184 (66%), Gaps = 3/184 (2%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            GTW+LL+ N GI++MH+ +   + V++ DRTN GPS I LP   C +  ND V K DC A
Sbjct  35   GTWQLLLSNVGISAMHSQLLINDRVIIFDRTNFGPSNISLPNGACHDSPNDAVSKQDCTA  94

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HS+  D+  N +RPLTV ++TWCSSG  LPDG+L+QTGGD DG RK R F PC  +S CD
Sbjct  95   HSIEYDVALNRIRPLTVQSNTWCSSGGVLPDGTLLQTGGDKDGERKARLFSPCQDNS-CD  153

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVH-FPFLGEVEDR  698
            W E+++  L+  RWYA+N ILPDG  II+GGR   + EFFP      ++  PFL +  DR
Sbjct  154  WTEVDN-GLAARRWYASNHILPDGRQIIIGGRGQFNFEFFPKTNAPNLYSLPFLSQTNDR  212

Query  699  QLDN  710
              +N
Sbjct  213  GDEN  216



>ref|XP_001760507.1| predicted protein [Physcomitrella patens]
 gb|EDQ74582.1| predicted protein [Physcomitrella patens]
Length=506

 Score =   185 bits (469),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 118/182 (65%), Gaps = 4/182 (2%)
 Frame = +3

Query  168  WELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYAHS  347
            +E +V NAGIASMHTAVT    V+LLDRTNIG S++ LP   CR++  D     DC AHS
Sbjct  9    YETVVENAGIASMHTAVTHTGAVILLDRTNIGDSQLPLPNGVCRDNPADRANTHDCTAHS  68

Query  348  VLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCDWQ  527
             L   + N ++PL V TDTWCSSGQF  +G+++QTGGD DG  K R    C   + CDW 
Sbjct  69   ALYTPNGNGIKPLFVYTDTWCSSGQFDANGNMVQTGGDADGLMKIRTL--CGDGN-CDWV  125

Query  528  ELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFPFLGEVEDRQLD  707
            E +D QL  GRWYATNQILPDG+ I+VGGR+  +VE+ P    G  +   L +  D Q D
Sbjct  126  E-QDTQLQNGRWYATNQILPDGTQIVVGGRSVFTVEYVPANGRGTYYLDLLEQTSDAQQD  184

Query  708  NL  713
            NL
Sbjct  185  NL  186



>ref|XP_010111102.1| hypothetical protein L484_008478 [Morus notabilis]
 gb|EXC30148.1| hypothetical protein L484_008478 [Morus notabilis]
Length=544

 Score =   186 bits (471),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 93/188 (49%), Positives = 121/188 (64%), Gaps = 3/188 (2%)
 Frame = +3

Query  150  AALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKT  329
            AA  G W+LL  + GI +MH  +   + VV+ DRT+ G S++ LP   CRND+ D  LK 
Sbjct  23   AAAGGRWQLLQKSIGITAMHMQLLNNDRVVIFDRTDFGRSQLSLPDGKCRNDRFDTALKV  82

Query  330  DCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSS  509
            DC AHS   D+ +N+ R LTV TD WCSSG  + DG+LIQTGG  DG R+ R F PC+  
Sbjct  83   DCTAHSAEYDVTSNTFRALTVQTDVWCSSGAVIADGTLIQTGGYNDGERRVRVFKPCDGR  142

Query  510  SLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVH-FPFLGE  686
            + CDWQE+ D+ LS  RWYATN ILPDG  II+GGR   + E++P      VH  PFL E
Sbjct  143  T-CDWQEI-DLGLSAKRWYATNHILPDGRQIIIGGRRQFNYEYYPKDTDKNVHNLPFLSE  200

Query  687  VEDRQLDN  710
              D++++N
Sbjct  201  TNDKRIEN  208



>ref|XP_007208189.1| hypothetical protein PRUPE_ppa020922mg, partial [Prunus persica]
 gb|EMJ09388.1| hypothetical protein PRUPE_ppa020922mg, partial [Prunus persica]
Length=528

 Score =   185 bits (470),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 109/161 (68%), Gaps = 2/161 (1%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            G W LL  + GI++MH  + R N V++ DRT+ GPS I LP   CR+D ND +LK DC A
Sbjct  10   GQWHLLHSSIGISAMHMQLLRTNMVIMFDRTDYGPSNISLPGRQCRHDPNDTLLKVDCTA  69

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HS+L D+ TN+LRPL V TDTWCSSG   PDG+L+QTGG  DG    R F PC   + CD
Sbjct  70   HSILYDIGTNTLRPLNVQTDTWCSSGAVFPDGTLVQTGGYNDGDHVVRTFTPCTGDN-CD  128

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFP  644
            W E  +  L Q RWYA+NQILPDG +IIVGGR   + EF+P
Sbjct  129  WLEFPN-YLVQRRWYASNQILPDGRIIIVGGRRQFNYEFYP  168



>ref|XP_008813838.1| PREDICTED: galactose oxidase-like [Phoenix dactylifera]
Length=548

 Score =   186 bits (471),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 96/199 (48%), Positives = 123/199 (62%), Gaps = 8/199 (4%)
 Frame = +3

Query  126  HSTVNPARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRND  305
            HS    A     G W+LL  + G+++MH  +   + V++ DRT+ GPS + LP   CR+D
Sbjct  21   HSAAEAASGG--GRWDLLQRSIGVSAMHMQLLHNDRVIIFDRTDFGPSNLSLPDGKCRHD  78

Query  306  KNDPVLKTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFR  485
             ++ VLK DC AHS   D+ TN+ RPLT+ TDTWCSSG   PDG LIQTGG  DG R  R
Sbjct  79   HHERVLKIDCTAHSAEYDVVTNTFRPLTIHTDTWCSSGSVDPDGRLIQTGGSFDGERAIR  138

Query  486  KFVPCNSSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFP---PRXG  656
             F PC + S CDW+E+E   L+  RWYATNQILPDG  II+GGR   S EF+P   P   
Sbjct  139  TFFPC-TDSRCDWKEVE--ALAVPRWYATNQILPDGRAIIIGGRLQFSYEFYPKSNPSTA  195

Query  657  GAVHFPFLGEVEDRQLDNL  713
            G  +  FL +  D + +NL
Sbjct  196  GITNLEFLLQTRDVEENNL  214



>emb|CDY01391.1| BnaA07g11640D [Brassica napus]
Length=556

 Score =   185 bits (470),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 90/187 (48%), Positives = 120/187 (64%), Gaps = 3/187 (2%)
 Frame = +3

Query  153  ALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTD  332
            A  G W+LL+ N GI++MH  +   + VV+ DRTN GPS I LP  +CR +  DPV K D
Sbjct  27   AAGGKWDLLLSNVGISAMHMQLLSNDRVVMFDRTNFGPSNISLPNGNCRRNPQDPVSKMD  86

Query  333  CYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSS  512
            C AHS+  D+ +N +RPLTV ++TWCSSG   PDG L+QTGGD DG  K R F PC+ + 
Sbjct  87   CTAHSIEYDVASNKVRPLTVQSNTWCSSGSVRPDGVLVQTGGDRDGELKARTFSPCDDNQ  146

Query  513  LCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXG-GAVHFPFLGEV  689
             CDW E+ +  L++ RWY++N ILPDG  I++GGR   + EFFP       +  PFL E 
Sbjct  147  -CDWVEINN-GLAKRRWYSSNHILPDGKQIVIGGRGQFNYEFFPKTTSPNVIALPFLAET  204

Query  690  EDRQLDN  710
             D+  +N
Sbjct  205  SDKGEEN  211



>ref|NP_173419.1| glyoxal oxidase-related protein [Arabidopsis thaliana]
 gb|AAL24259.1| At1g19900/F6F9_4 [Arabidopsis thaliana]
 gb|AEE29911.1| glyoxal oxidase-related protein [Arabidopsis thaliana]
Length=548

 Score =   185 bits (470),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 91/188 (48%), Positives = 121/188 (64%), Gaps = 3/188 (2%)
 Frame = +3

Query  150  AALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKT  329
            +A  G W+ + PN GI++MH  +   + VV+ DRTN GPS I LP  +CR++  D V K 
Sbjct  27   SAARGLWKYIAPNVGISAMHMQLLHNDRVVMYDRTNFGPSNISLPNGNCRDNPQDAVSKI  86

Query  330  DCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSS  509
            DC AHS+  D+ TN++RPLTV ++TWCSSG   PDG L+QTGGD DG  K R F PCN++
Sbjct  87   DCTAHSIEYDVATNTIRPLTVQSNTWCSSGSVRPDGVLVQTGGDRDGELKTRTFSPCNNN  146

Query  510  SLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXG-GAVHFPFLGE  686
              CDW E+ +  L + RWYA+N ILPDG  I++GG+   + EFFP       V  PFL E
Sbjct  147  Q-CDWVEMNN-GLKKRRWYASNHILPDGKQIVMGGQGQFNYEFFPKTTNPNVVALPFLAE  204

Query  687  VEDRQLDN  710
              D+  +N
Sbjct  205  THDQGQEN  212



>ref|XP_001774885.1| predicted protein [Physcomitrella patens]
 gb|EDQ60297.1| predicted protein [Physcomitrella patens]
Length=534

 Score =   185 bits (469),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 90/184 (49%), Positives = 112/184 (61%), Gaps = 1/184 (1%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            G WE++  NAGIA+MH AVT +  V+LLDRTNIG S++ L    CR ++ D   K DC A
Sbjct  31   GYWEIVKENAGIATMHAAVTHYGNVILLDRTNIGDSQLPLDNGRCRQNEVDRANKYDCTA  90

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HS +    +N +RPL + TDTWCSSGQF   G ++QTGGD +G  K R F PC     CD
Sbjct  91   HSAIFSPGSNEIRPLFIFTDTWCSSGQFDGSGKMVQTGGDAEGVAKIRNFQPCGDGGGCD  150

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFPFLGEVEDRQ  701
            W E  D  L  GRWYA+NQ LPDG+  +VGGR A ++E+ P    G      L E    Q
Sbjct  151  WVE-TDSSLQIGRWYASNQQLPDGTQAVVGGRNAFTIEYVPANGRGQTTLALLQETNSPQ  209

Query  702  LDNL  713
             DNL
Sbjct  210  NDNL  213



>ref|XP_009103376.1| PREDICTED: galactose oxidase-like [Brassica rapa]
Length=556

 Score =   185 bits (470),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 90/187 (48%), Positives = 120/187 (64%), Gaps = 3/187 (2%)
 Frame = +3

Query  153  ALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTD  332
            A  G W+LL+ N GI++MH  +   + VV+ DRTN GPS I LP  +CR +  DPV K D
Sbjct  27   AAGGKWDLLLSNVGISAMHMQLLSNDRVVMFDRTNFGPSNISLPNGNCRRNPQDPVSKMD  86

Query  333  CYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSS  512
            C AHS+  D+ +N +RPLTV ++TWCSSG   PDG L+QTGGD DG  K R F PC+ + 
Sbjct  87   CTAHSIEYDVASNKVRPLTVQSNTWCSSGSVRPDGVLVQTGGDRDGELKARTFSPCDDNQ  146

Query  513  LCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXG-GAVHFPFLGEV  689
             CDW E+ +  L++ RWY++N ILPDG  I++GGR   + EFFP       +  PFL E 
Sbjct  147  -CDWVEINN-GLAKRRWYSSNHILPDGKQIVIGGRGQFNYEFFPKTTSPNVIALPFLAET  204

Query  690  EDRQLDN  710
             D+  +N
Sbjct  205  SDKGEEN  211



>ref|XP_001762118.1| predicted protein [Physcomitrella patens]
 gb|EDQ73222.1| predicted protein [Physcomitrella patens]
Length=529

 Score =   185 bits (469),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 99/184 (54%), Positives = 119/184 (65%), Gaps = 2/184 (1%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            G WE +V NAGIA+MH+AV+    VVLLDRTN+GPS++ L    CR++  D   K DC A
Sbjct  29   GYWETVVDNAGIATMHSAVSHDGNVVLLDRTNVGPSQLNLAPGVCRDNPQDRATKHDCTA  88

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HS L    +N +RPL V TDTWCSSGQF   G L+QTGGD DG  K R F PC     CD
Sbjct  89   HSALFSPGSNKIRPLFVYTDTWCSSGQFDGSGKLVQTGGDADGLMKIRHFSPCGGGD-CD  147

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFPFLGEVEDRQ  701
            W EL D  L +GRWYA+NQILPDG+ I+VGGR   +VE+ P    G    P L +  D Q
Sbjct  148  WVEL-DGGLQEGRWYASNQILPDGTQIVVGGRGVGTVEYVPANGRGTYDLPLLYKSNDAQ  206

Query  702  LDNL  713
            +DNL
Sbjct  207  MDNL  210



>ref|XP_010416451.1| PREDICTED: galactose oxidase-like isoform X2 [Camelina sativa]
Length=516

 Score =   184 bits (468),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 91/184 (49%), Positives = 121/184 (66%), Gaps = 3/184 (2%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            GTW+LL+PN GI++MH+ +   + V++ DRTN GPS I LP   CR   ND + KTDC A
Sbjct  35   GTWKLLLPNVGISAMHSQLLHNDRVIMYDRTNFGPSNISLPHGACRQSPNDAISKTDCTA  94

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HSV  ++  NS+RPLTV ++TWCSSG   PDG+L+QTGG  DG  K R F PC+  S CD
Sbjct  95   HSVEYNVALNSIRPLTVQSNTWCSSGGVTPDGTLLQTGGSRDGELKTRLFAPCDDDS-CD  153

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVH-FPFLGEVEDR  698
            W E+++  L+  RWYA+N +LPDG  II+GGR   + EFFP      ++  PFL +  D 
Sbjct  154  WTEVDN-GLAAARWYASNHVLPDGRQIIIGGRDQFNYEFFPKTNAPNLYALPFLTQTTDP  212

Query  699  QLDN  710
              +N
Sbjct  213  GQEN  216



>ref|XP_010652487.1| PREDICTED: galactose oxidase [Vitis vinifera]
Length=563

 Score =   185 bits (470),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 120/188 (64%), Gaps = 7/188 (4%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            G+W LL  + GI++MH  +   N +++ DRT+ G S + LP  HCR+D ND  LK DC A
Sbjct  37   GSWFLLHSSIGISAMHMQILHNNKIIIFDRTDFGASNLSLPDGHCRSDPNDMALKVDCTA  96

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HS+L D+  NS+RPL + TDTWCSSG  + DG+LIQTGG  DG R  R F PCN    CD
Sbjct  97   HSLLYDVLLNSIRPLMLQTDTWCSSGSVIADGTLIQTGGYNDGERVARTFTPCNDDQ-CD  155

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFP-----FLGE  686
            W+EL +  LS  RWYA+NQILPDG +I+VGGR A S EFFP     +   P     FL +
Sbjct  156  WKELPEY-LSVRRWYASNQILPDGRIIVVGGRNAFSYEFFPKNTLNSTSQPNYYLKFLKD  214

Query  687  VEDRQLDN  710
              D + +N
Sbjct  215  TRDPKEEN  222



>gb|AET97563.1| galactose oxidase [Ziziphus jujuba]
Length=545

 Score =   185 bits (469),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 93/185 (50%), Positives = 117/185 (63%), Gaps = 6/185 (3%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            G W+LL  + GI++MH  +   + VV+ DRT+ GPS + LPA  CRND ND VL  DC A
Sbjct  29   GQWQLLQKSIGISAMHMQLLNNDRVVIFDRTDFGPSNLSLPAGKCRNDPNDTVLTVDCTA  88

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HS   D+ TN+ RPLTV TD WCSSG   PDG LIQTGG  DG R+ R + PC     CD
Sbjct  89   HSAEYDVATNTFRPLTVQTDVWCSSGCVTPDGRLIQTGGYNDGERRVRIYKPCTG---CD  145

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGA--VHFPFLGEVED  695
            WQE+E + L+  RWYATN ILPDG  II+GGR   + EF+P     +     PFL +  D
Sbjct  146  WQEIE-LGLAARRWYATNHILPDGRQIIIGGRRQFNYEFYPKTASASNVYSLPFLVQTND  204

Query  696  RQLDN  710
             +++N
Sbjct  205  PKIEN  209



>emb|CDY01390.1| BnaA07g11630D [Brassica napus]
Length=509

 Score =   184 bits (467),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 91/187 (49%), Positives = 119/187 (64%), Gaps = 3/187 (2%)
 Frame = +3

Query  153  ALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTD  332
            A  G W+LL+ N GI++MH  +   + VV+ DRTN GPS I LP  +CRN+  D V K D
Sbjct  27   AAGGKWDLLLSNVGISAMHMQLLPNDRVVMFDRTNFGPSNISLPNGNCRNNPQDAVSKID  86

Query  333  CYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSS  512
            C AHS+   + +N++RPLTV ++TWCSSG   PDG L+QTGGD DG  K R F PC S  
Sbjct  87   CTAHSIEYKVESNTIRPLTVQSNTWCSSGSLRPDGVLVQTGGDRDGELKARTFTPC-SDE  145

Query  513  LCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXG-GAVHFPFLGEV  689
             CDW E+ +  L++ RWY++N ILPDG  II+GG+   + EFFP       +  PFL E 
Sbjct  146  ECDWVEINN-GLARRRWYSSNHILPDGKQIIIGGQRQFNYEFFPKTTSPNVIDLPFLAET  204

Query  690  EDRQLDN  710
             DR  +N
Sbjct  205  NDRGEEN  211



>ref|XP_010536366.1| PREDICTED: galactose oxidase-like [Tarenaya hassleriana]
Length=551

 Score =   185 bits (469),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 94/191 (49%), Positives = 122/191 (64%), Gaps = 4/191 (2%)
 Frame = +3

Query  144  ARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVL  323
            A AA  G W+LL  + GI++MH  + R + VV+ DRT+ GPS I LPA  C +  +DPV 
Sbjct  26   ASAAGGGRWQLLQSSIGISAMHMQLLRNDRVVIFDRTDFGPSNISLPAGKCIDSPDDPVS  85

Query  324  KTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCN  503
            K DC AHSV  D+ +N  R LTV +DTWCSSG  +P+G+L+QTGGD DG R+ R F PC 
Sbjct  86   KVDCTAHSVEYDVTSNRFRTLTVQSDTWCSSGSVIPNGTLVQTGGDKDGERRVRLFSPCG  145

Query  504  SSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPP--RXGGAVHFPF  677
            S+  CDW E++D  L+  RWYATN ILPDG  II+GGR   + E++P           PF
Sbjct  146  SNG-CDWSEIDD-GLAVRRWYATNHILPDGRQIIIGGRRQWNFEYYPKTAEAPNVYSLPF  203

Query  678  LGEVEDRQLDN  710
            L +  DR  +N
Sbjct  204  LVQTNDRGSEN  214



>ref|XP_010416450.1| PREDICTED: galactose oxidase-like isoform X1 [Camelina sativa]
Length=548

 Score =   184 bits (468),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 91/184 (49%), Positives = 121/184 (66%), Gaps = 3/184 (2%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            GTW+LL+PN GI++MH+ +   + V++ DRTN GPS I LP   CR   ND + KTDC A
Sbjct  35   GTWKLLLPNVGISAMHSQLLHNDRVIMYDRTNFGPSNISLPHGACRQSPNDAISKTDCTA  94

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HSV  ++  NS+RPLTV ++TWCSSG   PDG+L+QTGG  DG  K R F PC+  S CD
Sbjct  95   HSVEYNVALNSIRPLTVQSNTWCSSGGVTPDGTLLQTGGSRDGELKTRLFAPCDDDS-CD  153

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVH-FPFLGEVEDR  698
            W E+++  L+  RWYA+N +LPDG  II+GGR   + EFFP      ++  PFL +  D 
Sbjct  154  WTEVDN-GLAAARWYASNHVLPDGRQIIIGGRDQFNYEFFPKTNAPNLYALPFLTQTTDP  212

Query  699  QLDN  710
              +N
Sbjct  213  GQEN  216



>ref|XP_007030653.1| Glyoxal oxidase-related protein [Theobroma cacao]
 gb|EOY11155.1| Glyoxal oxidase-related protein [Theobroma cacao]
Length=558

 Score =   184 bits (468),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 123/201 (61%), Gaps = 13/201 (6%)
 Frame = +3

Query  135  VNPARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKND  314
            +NPA     G W+LL  + GI++MH  +   N V++ DRT+ GPS + LP+  CR D +D
Sbjct  25   LNPAGRQ--GAWQLLHASVGISAMHMQLLHNNKVIIFDRTDFGPSNLSLPSGLCRIDPSD  82

Query  315  PVLKTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFV  494
             VL+TDC AHS+L D+ TN+ RPL V TDTWCSSG  LP+G+L+QTGG  DG R  R F 
Sbjct  83   IVLQTDCTAHSILYDISTNAFRPLMVQTDTWCSSGAVLPNGTLVQTGGYNDGDRNIRTFT  142

Query  495  PCNSSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGA----  662
            PC +   CDW E     L Q RWYA+NQILPDG +IIVGGR   + EF+P    G     
Sbjct  143  PC-TDEYCDWIEFPQ-SLLQRRWYASNQILPDGRIIIVGGRRQFNYEFYPQNIEGKSSSS  200

Query  663  -----VHFPFLGEVEDRQLDN  710
                     FL E  D Q++N
Sbjct  201  STDHIFGLNFLRETNDYQMEN  221



>ref|XP_009393211.1| PREDICTED: galactose oxidase-like [Musa acuminata subsp. malaccensis]
Length=542

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 93/193 (48%), Positives = 120/193 (62%), Gaps = 5/193 (3%)
 Frame = +3

Query  144  ARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVL  323
            A A+  G WELL P+ G+++MH  +   + V++ DRT+ GPS + LP   CRND  D  L
Sbjct  17   ATASGGGQWELLQPSIGVSAMHMQLLSNDRVIVFDRTDFGPSNLSLPGGRCRNDPRDWTL  76

Query  324  KTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCN  503
              DC AH+   D+ +N++RPLTVLTD WCSSG   PDG LIQTGG  DG R  R   PC+
Sbjct  77   TVDCTAHAAEYDVPSNAVRPLTVLTDPWCSSGTVSPDGRLIQTGGANDGERAVRYLDPCH  136

Query  504  SSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFP---PRXGGAVHFP  674
               LCDW+E +   L+  RWYATN +LPDG  ++VGGR+  + EF P       GAV  P
Sbjct  137  -DRLCDWEE-DAAGLAAPRWYATNHVLPDGRAVVVGGRSQHNYEFVPKLGAADAGAVSLP  194

Query  675  FLGEVEDRQLDNL  713
            FL E  D + +NL
Sbjct  195  FLRETRDAEYNNL  207



>emb|CDX83736.1| BnaC08g19090D [Brassica napus]
Length=243

 Score =   177 bits (448),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 112/166 (67%), Gaps = 2/166 (1%)
 Frame = +3

Query  153  ALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTD  332
            A  G W LL+ N GI++MH  + R + VV+ DRTN GPS I LP  +CRN+  D V K D
Sbjct  27   AAGGKWTLLLSNVGISAMHMQLLRNDRVVMFDRTNFGPSNISLPNGNCRNNPQDAVSKID  86

Query  333  CYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSS  512
            C AHS+  D+ +N++RPLTV  +TWCSSG   PDG L+QTGGD DG  K R F PCN+  
Sbjct  87   CTAHSIEYDVASNTVRPLTVQFNTWCSSGSVRPDGVLVQTGGDRDGGLKARVFSPCNNKR  146

Query  513  LCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPR  650
             CDW E+ +  L++ RWY++N ILPDG  I++GG+   + EF+P R
Sbjct  147  -CDWVEINN-GLTKRRWYSSNHILPDGKQIVIGGQGQFNYEFYPKR  190



>emb|CDY13556.1| BnaC02g23670D [Brassica napus]
Length=554

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 90/184 (49%), Positives = 124/184 (67%), Gaps = 3/184 (2%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            GTW+LL+   GI++MH+ +   + V++ DR+N GPS+I LP+  CR+  ND V K DC A
Sbjct  35   GTWKLLLNEVGISAMHSQLLINDRVIMYDRSNFGPSKISLPSGACRDSPNDVVSKRDCSA  94

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HS+  D+  NS+RPLT+ ++TWCSSG   P+G+L+QTGGD +G RK R F PC+  S CD
Sbjct  95   HSIEYDVAFNSIRPLTIESNTWCSSGGVTPEGALLQTGGDKEGERKARMFYPCDDES-CD  153

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVH-FPFLGEVEDR  698
            W E+++  L+  RWYATN +LPDG  IIVGGR   + EFFP     +++  PFL E  D 
Sbjct  154  WTEVDNA-LNVRRWYATNHVLPDGRQIIVGGRNQFNFEFFPKTKAPSLYKLPFLSETYDV  212

Query  699  QLDN  710
              +N
Sbjct  213  GQEN  216



>ref|XP_009128116.1| PREDICTED: galactose oxidase-like [Brassica rapa]
Length=555

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 124/184 (67%), Gaps = 3/184 (2%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            GTW+LL+ + GI++MH+ +   + V++ DR+N GPS+I LP+  CR+  ND V K DC A
Sbjct  36   GTWKLLLNDVGISAMHSQLLINDRVIMYDRSNFGPSKISLPSGACRDSPNDVVSKRDCTA  95

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HS+  D+  NS+RPLT+ ++TWCSSG   P+G+L+QTGGD +G RK R F PC+  S CD
Sbjct  96   HSIEYDVAFNSIRPLTIESNTWCSSGGVTPEGALLQTGGDKEGERKARMFYPCDDES-CD  154

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVH-FPFLGEVEDR  698
            W E+++  L   RWYATN +LPDG  II+GGR   + EFFP     +++  PFL E  D 
Sbjct  155  WTEVDNA-LYVRRWYATNHVLPDGRQIIIGGRNQFNFEFFPKTKAPSLYKLPFLSETYDA  213

Query  699  QLDN  710
              +N
Sbjct  214  GQEN  217



>ref|XP_002893079.1| hypothetical protein ARALYDRAFT_472215 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69338.1| hypothetical protein ARALYDRAFT_472215 [Arabidopsis lyrata subsp. 
lyrata]
Length=549

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 90/188 (48%), Positives = 122/188 (65%), Gaps = 3/188 (2%)
 Frame = +3

Query  150  AALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKT  329
            +A  G W+ + PN GI++MH  +   + VV+ DRTN GPS I LP  +CR++ ND V K 
Sbjct  27   SAARGLWKYIAPNVGISAMHMQLLHNDRVVMYDRTNFGPSNISLPNGNCRDNPNDIVSKR  86

Query  330  DCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSS  509
            DC AHS+  D+  N++RPLTV ++TWCSSG   PDG L+QTGGD DG  K R F PC+++
Sbjct  87   DCTAHSIEYDVAMNTVRPLTVQSNTWCSSGSVRPDGVLVQTGGDRDGELKARTFSPCDNN  146

Query  510  SLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXG-GAVHFPFLGE  686
              CDW E+ +  L++ RWYA+N ILPDG  I++GG+   + EFFP       V  PFL E
Sbjct  147  Q-CDWVEINN-GLTKRRWYASNHILPDGKQIVIGGQAQFNYEFFPKTTNPNVVALPFLAE  204

Query  687  VEDRQLDN  710
              D+  +N
Sbjct  205  THDQGQEN  212



>ref|XP_010477216.1| PREDICTED: galactose oxidase-like [Camelina sativa]
Length=550

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 90/189 (48%), Positives = 125/189 (66%), Gaps = 4/189 (2%)
 Frame = +3

Query  150  AALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKT  329
            +A  G+W +L+PN GI++MH  + R + VV+ DRTN GPS I LP  +CR++ ND + +T
Sbjct  27   SAAGGSWNVLLPNVGISAMHMQLLRNDRVVMFDRTNFGPSNISLPNGNCRDNPNDAISRT  86

Query  330  DCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSS  509
            DC AHS+  D+  N++RPLTV ++TWCSSG   PDG L+QTGGD DG  K R F PCN+ 
Sbjct  87   DCTAHSIEYDVAMNTVRPLTVQSNTWCSSGSVRPDGVLVQTGGDRDGELKARTFSPCNND  146

Query  510  SLCDWQELEDVQLSQGRWYATNQILPDGS-VIIVGGRTAQSVEFFPPRXG-GAVHFPFLG  683
              CDW E+++  L + RWY++N +LPDG   I++GG+   + EF+P       V  PFL 
Sbjct  147  Q-CDWVEIDN-GLWKRRWYSSNHLLPDGKQQIVIGGQGQFNYEFYPKTTNPNVVALPFLA  204

Query  684  EVEDRQLDN  710
            E  DR  +N
Sbjct  205  ETNDRGQEN  213



>ref|XP_010256224.1| PREDICTED: galactose oxidase [Nelumbo nucifera]
Length=554

 Score =   184 bits (466),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 98/184 (53%), Positives = 117/184 (64%), Gaps = 5/184 (3%)
 Frame = +3

Query  168  WELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYAHS  347
            W LL  N G+++MH  +   N VV+ DRT+ GPS + LP   CR D ND  LK DC AHS
Sbjct  38   WRLLHTNIGLSAMHMQLLHNNKVVMFDRTDFGPSNLSLPPGRCRFDPNDTALKIDCTAHS  97

Query  348  VLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCDWQ  527
            +L D+ TN++RPL V TDTWCSSG  LPDG+L+QTGG  DG R  R+  PCN+   CDW 
Sbjct  98   LLYDVATNTIRPLMVQTDTWCSSGALLPDGTLLQTGGYNDGDRAIRQLTPCNNDE-CDWI  156

Query  528  ELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHF--PFLGEVEDRQ  701
            E     LS  RWYATNQILPDG VII+GGR   S EF+ PR   +  F   FL E  D  
Sbjct  157  E-SPGYLSAKRWYATNQILPDGRVIILGGRREFSYEFY-PRGSSSNSFWLNFLRETRDND  214

Query  702  LDNL  713
             +NL
Sbjct  215  ENNL  218



>ref|XP_006849170.2| PREDICTED: galactose oxidase [Amborella trichopoda]
Length=546

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 97/193 (50%), Positives = 122/193 (63%), Gaps = 7/193 (4%)
 Frame = +3

Query  144  ARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVL  323
            A A+  G W+LL  + GI++MH A+   N V++ DRT+ GPS + LP   CR D++D  L
Sbjct  21   ALASGGGQWKLLKRSIGISAMHMALLPNNRVIMFDRTDFGPSNVSLPNGRCRKDRHDRAL  80

Query  324  KTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCN  503
            +TDC+AHSV L+  T+ +RPLT+LTDTWCSSG   PDG LIQTGG  DG R  R F PC 
Sbjct  81   QTDCWAHSVELNWVTHGVRPLTILTDTWCSSGALAPDGHLIQTGGSNDGERVVRTFSPCA  140

Query  504  SSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFP---PRXGGAVHFP  674
            +   CDW EL D  L+  RWYA+NQILPDG +I+VGGR   + EF P   P         
Sbjct  141  T---CDWAELPD-GLAMPRWYASNQILPDGRIIVVGGRGQFNYEFVPKTDPSEHSMYPLE  196

Query  675  FLGEVEDRQLDNL  713
            FL E  D   +NL
Sbjct  197  FLSETRDDCENNL  209



>ref|XP_009103375.1| PREDICTED: galactose oxidase-like [Brassica rapa]
Length=556

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 91/187 (49%), Positives = 118/187 (63%), Gaps = 3/187 (2%)
 Frame = +3

Query  153  ALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTD  332
            A  G W+LL+ N GI++MH  +   + VV+ DRTN GPS I LP  +CRN+  D V K D
Sbjct  27   AAGGKWDLLLSNVGISAMHMQLLPNDRVVMFDRTNFGPSNISLPNGNCRNNPQDAVSKID  86

Query  333  CYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSS  512
            C AHS+   + +N++RPLTV ++TWCSSG   PDG L+QTGGD DG  K R F PC S  
Sbjct  87   CTAHSIEYKVESNTIRPLTVQSNTWCSSGSLRPDGVLVQTGGDRDGELKARTFTPC-SDE  145

Query  513  LCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXG-GAVHFPFLGEV  689
             CDW E+    L++ RWY++N ILPDG  II+GG+   + EFFP       +  PFL E 
Sbjct  146  ECDWVEINK-GLARRRWYSSNHILPDGKQIIIGGQRQFNYEFFPKTTSPNVIDLPFLAET  204

Query  690  EDRQLDN  710
             DR  +N
Sbjct  205  NDRGEEN  211



>gb|ERN10751.1| hypothetical protein AMTR_s00027p00175370 [Amborella trichopoda]
Length=560

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 97/193 (50%), Positives = 122/193 (63%), Gaps = 7/193 (4%)
 Frame = +3

Query  144  ARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVL  323
            A A+  G W+LL  + GI++MH A+   N V++ DRT+ GPS + LP   CR D++D  L
Sbjct  35   ALASGGGQWKLLKRSIGISAMHMALLPNNRVIMFDRTDFGPSNVSLPNGRCRKDRHDRAL  94

Query  324  KTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCN  503
            +TDC+AHSV L+  T+ +RPLT+LTDTWCSSG   PDG LIQTGG  DG R  R F PC 
Sbjct  95   QTDCWAHSVELNWVTHGVRPLTILTDTWCSSGALAPDGHLIQTGGSNDGERVVRTFSPCA  154

Query  504  SSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFP---PRXGGAVHFP  674
            +   CDW EL D  L+  RWYA+NQILPDG +I+VGGR   + EF P   P         
Sbjct  155  T---CDWAELPD-GLAMPRWYASNQILPDGRIIVVGGRGQFNYEFVPKTDPSEHSMYPLE  210

Query  675  FLGEVEDRQLDNL  713
            FL E  D   +NL
Sbjct  211  FLSETRDDCENNL  223



>ref|XP_008218222.1| PREDICTED: galactose oxidase [Prunus mume]
Length=553

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 109/161 (68%), Gaps = 2/161 (1%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            G W LL  + GI++MH  + R N V++ DRT+ G S I LP   CR+D ND +LK DC A
Sbjct  35   GQWHLLHSSIGISAMHMQLLRTNMVIMFDRTDYGRSNISLPRRQCRHDPNDTLLKVDCTA  94

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HS+L D+ TN+LRPLTV TDTWCSSG   PDG+L+QTGG  DG    R F PC   + CD
Sbjct  95   HSILYDIGTNTLRPLTVQTDTWCSSGAVFPDGTLVQTGGYNDGDHVVRTFTPCTGDN-CD  153

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFP  644
            W E  +  L Q RWYA+NQILPDG +IIVGGR   + EF+P
Sbjct  154  WLEFPN-YLVQRRWYASNQILPDGRIIIVGGRRQFNYEFYP  193



>ref|XP_006290310.1| hypothetical protein CARUB_v10019204mg [Capsella rubella]
 gb|EOA23208.1| hypothetical protein CARUB_v10019204mg [Capsella rubella]
Length=547

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 92/183 (50%), Positives = 114/183 (62%), Gaps = 3/183 (2%)
 Frame = +3

Query  168  WELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYAHS  347
            WE+L+P+ GI++MH  +     V++ DRT+ G S + LP   CR D  D  +K DC AHS
Sbjct  38   WEMLLPSIGISAMHMQLLHNGMVIMFDRTDFGTSNVSLPGGVCRYDPTDTAVKFDCSAHS  97

Query  348  VLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCDWQ  527
            VL D+ +N+ RPL V TDTWCSSG  LP+G+L+QTGG  DG R  R F PC  S  CDW 
Sbjct  98   VLYDVVSNTFRPLQVQTDTWCSSGAVLPNGTLVQTGGYNDGERAARTFTPCGYSETCDWI  157

Query  528  ELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFP--PRXGGAVHFPFLGEVEDRQ  701
            E     LSQ RWYATNQILPDG +I+VGGR   + EFFP       +  F FL E  D  
Sbjct  158  EFPQ-YLSQRRWYATNQILPDGRIIVVGGRRQFNFEFFPRHSSRSRSSRFEFLRETSDGS  216

Query  702  LDN  710
             +N
Sbjct  217  NEN  219



>ref|XP_004238618.1| PREDICTED: galactose oxidase-like [Solanum lycopersicum]
Length=553

 Score =   183 bits (464),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 97/196 (49%), Positives = 122/196 (62%), Gaps = 5/196 (3%)
 Frame = +3

Query  138  NPARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDP  317
            N A AA  G W+LL+ N GI+SMH  +   + V++ DRT+ G S I LP   CRN+ ND 
Sbjct  26   NSAYAAAGGKWDLLMSNIGISSMHMQLLNNDRVIMYDRTDFGASNISLPNGKCRNNTNDL  85

Query  318  VLKTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVP  497
             LK DC AHSV  D+ TNS+RPL V TD WCSSG    DG+L+QTGG  DG +  R   P
Sbjct  86   ALKIDCTAHSVEYDVSTNSIRPLMVQTDVWCSSGSATSDGTLVQTGGFNDGEKVVRVLKP  145

Query  498  CN-SSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPP--RXGGAVH  668
            CN + S CDW+E+E   L Q RWYATN +LPDG  II+GGR A + EF+P         +
Sbjct  146  CNGNKSRCDWREIESA-LIQSRWYATNHVLPDGRQIIIGGREAFNYEFYPKTLSTNNIFN  204

Query  669  FPFLGEVED-RQLDNL  713
              FL +  D R+ +NL
Sbjct  205  LTFLQQTNDPREENNL  220



>emb|CDP07430.1| unnamed protein product [Coffea canephora]
Length=561

 Score =   183 bits (464),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 96/197 (49%), Positives = 119/197 (60%), Gaps = 3/197 (2%)
 Frame = +3

Query  126  HSTVNPARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRND  305
            H  +  A A   G W LL  + GIASMH  +   + VV+ DRT+ GPS I L +  CR D
Sbjct  29   HRKLAEAAATTGGQWALLQSSIGIASMHMQLLNNDKVVIYDRTDFGPSNISLASGKCRYD  88

Query  306  KNDPVLKTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFR  485
              + VLK DC AHSV  D+ TNS RPLTVLTD WCSSG  +PDG+ +QTGG  DG    R
Sbjct  89   PQEQVLKVDCTAHSVEYDVATNSFRPLTVLTDVWCSSGSLMPDGTFVQTGGFNDGDHVVR  148

Query  486  KFVPCNSSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGG--  659
             + PC+S S CDWQE+ +  L Q RWYATN ILPD S II+GGR   + EF+P       
Sbjct  149  LYKPCSSGSNCDWQEINN-GLIQRRWYATNHILPDSSQIIIGGRRQFNYEFYPKTAATNQ  207

Query  660  AVHFPFLGEVEDRQLDN  710
              +  FL +  D  ++N
Sbjct  208  VFNLRFLVQTNDPVVEN  224



>gb|KFK37635.1| hypothetical protein AALP_AA3G008700 [Arabis alpina]
Length=548

 Score =   183 bits (464),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 123/184 (67%), Gaps = 3/184 (2%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            GTW+LL+PN GI++MH+ +   + V++ DR+N GPS I LP   C N  ND V K DC A
Sbjct  31   GTWKLLLPNVGISAMHSQLLHNDHVIMYDRSNFGPSNISLPNGTCLNSPNDIVSKRDCTA  90

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HS+  D+ +N +RPLTV ++TWCSSG   PDG+L+QTGGD +G RK R F PC+ ++ CD
Sbjct  91   HSIEYDVASNQIRPLTVRSNTWCSSGGLTPDGTLLQTGGDKEGERKARLFSPCDDNT-CD  149

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAV-HFPFLGEVEDR  698
            W E+++  L+  RWYA+N +LPDG  II+GGR   S EF+P      +   PFL + +D 
Sbjct  150  WSEVDN-GLATRRWYASNHVLPDGRQIIIGGRAQFSYEFYPKTNAPYLFSLPFLTQTDDP  208

Query  699  QLDN  710
              +N
Sbjct  209  HDEN  212



>ref|XP_010930930.1| PREDICTED: uncharacterized protein LOC105051966 [Elaeis guineensis]
Length=569

 Score =   183 bits (464),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 98/186 (53%), Positives = 122/186 (66%), Gaps = 6/186 (3%)
 Frame = +3

Query  168  WELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYAHS  347
            W+LL  + GI++MH  +   N VV+ DRT+ GPS I LPA  CR+D  D VL  DC AHS
Sbjct  49   WQLLHASIGISAMHMQLLPGNKVVMFDRTDFGPSNISLPAGRCRSDPADLVLPLDCTAHS  108

Query  348  VLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCDWQ  527
            VLLDL + +LRPLT+L+DTWCSSG  LP+GSL+Q+GG  DG    R F   +S    DWQ
Sbjct  109  VLLDLPSTALRPLTILSDTWCSSGALLPNGSLLQSGGFNDGDHSIRLFDSVSSDPTADWQ  168

Query  528  ELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRX----GGAVH-FPFLGEVE  692
            EL    L+  RWYA++Q+LPDG V+IVGGR   S EFFP +     GGA+  FPFL E  
Sbjct  169  ELPS-YLTVRRWYASDQLLPDGRVLIVGGRRQFSYEFFPRQESAGGGGAIFPFPFLEETR  227

Query  693  DRQLDN  710
            D   +N
Sbjct  228  DGNSEN  233



>ref|XP_009607831.1| PREDICTED: galactose oxidase-like [Nicotiana tomentosiformis]
Length=558

 Score =   182 bits (463),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 96/195 (49%), Positives = 118/195 (61%), Gaps = 5/195 (3%)
 Frame = +3

Query  138  NPARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDP  317
            N A AA+ GTWELL+ + GI++MH  +   + VV+ DRT+ G S I LP   CRN+ ND 
Sbjct  29   NSANAAVGGTWELLMSDIGISAMHMQLLNNDRVVMFDRTDFGASNIALPNGKCRNNSNDL  88

Query  318  VLKTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVP  497
             L  DC AHSV  D+ TNS+RPL V T+ WCSSG    DGSL+QTGG  DG    R F P
Sbjct  89   ALIVDCTAHSVEFDITTNSVRPLMVQTNVWCSSGSATSDGSLVQTGGFNDGVNVVRVFKP  148

Query  498  C--NSSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFP--PRXGGAV  665
            C     S CDWQE+ +  L Q RWYATN +LPDG  II+GGR A + EF+P         
Sbjct  149  CITGKRSTCDWQEMGN-GLIQSRWYATNHMLPDGRQIIIGGRAAFNYEFYPKTASTNNVF  207

Query  666  HFPFLGEVEDRQLDN  710
              PFL +  D   +N
Sbjct  208  SLPFLEQTNDPMEEN  222



>gb|KJB59770.1| hypothetical protein B456_009G270800 [Gossypium raimondii]
Length=547

 Score =   182 bits (462),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 91/188 (48%), Positives = 119/188 (63%), Gaps = 5/188 (3%)
 Frame = +3

Query  150  AALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKT  329
            AA  G W+LL  + G+++MH  + R + VV+ DRT+ GPS++ LP   CRND +D  LK 
Sbjct  28   AAADGRWQLLQKSIGVSAMHMQLLRNDRVVVFDRTDFGPSKLPLPNGKCRNDPSDTALKV  87

Query  330  DCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSS  509
            DC AHSV  D+ TN+ RPL V TD WCSSG  +P+G+L+QTGG  DG R+ R F PC   
Sbjct  88   DCTAHSVEYDVLTNTFRPLMVQTDVWCSSGAIMPNGNLVQTGGFNDGERRVRTFSPC---  144

Query  510  SLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPR-XGGAVHFPFLGE  686
            S CDWQE  +  L+  RWYA+N ILPDG  I+VGGR   + EF P          PFL +
Sbjct  145  STCDWQETPN-GLAAKRWYASNHILPDGRQIVVGGRRQFNYEFVPKTITANTFSLPFLSQ  203

Query  687  VEDRQLDN  710
              +R ++N
Sbjct  204  TSERGVEN  211



>ref|XP_009106212.1| PREDICTED: galactose oxidase isoform X1 [Brassica rapa]
Length=560

 Score =   182 bits (462),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 91/184 (49%), Positives = 120/184 (65%), Gaps = 3/184 (2%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            GTW+LL+ N GI++MH+ +   + V++ DR+N GPS+I LP   CR+  ND V K DC A
Sbjct  37   GTWKLLLNNVGISAMHSQLLINDRVIMYDRSNFGPSKISLPNGTCRDSPNDSVSKRDCTA  96

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HS+  D+  N +RPLTV ++TWCSSG   PDG+L+QTGGD DG RK R F PC+  S CD
Sbjct  97   HSIEYDVALNRIRPLTVQSNTWCSSGGVTPDGTLLQTGGDKDGERKARLFYPCDDES-CD  155

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVH-FPFLGEVEDR  698
            W E+++  L+  RWYA+N +LPDG  IIVGGR   + EFFP       +   FL E  D 
Sbjct  156  WSEIDNA-LNVKRWYASNHVLPDGRQIIVGGRDEFNFEFFPKTNAPNTYSLRFLSETNDL  214

Query  699  QLDN  710
              +N
Sbjct  215  DQEN  218



>ref|XP_009106213.1| PREDICTED: galactose oxidase isoform X2 [Brassica rapa]
Length=554

 Score =   182 bits (462),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 91/184 (49%), Positives = 120/184 (65%), Gaps = 3/184 (2%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            GTW+LL+ N GI++MH+ +   + V++ DR+N GPS+I LP   CR+  ND V K DC A
Sbjct  37   GTWKLLLNNVGISAMHSQLLINDRVIMYDRSNFGPSKISLPNGTCRDSPNDSVSKRDCTA  96

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HS+  D+  N +RPLTV ++TWCSSG   PDG+L+QTGGD DG RK R F PC+  S CD
Sbjct  97   HSIEYDVALNRIRPLTVQSNTWCSSGGVTPDGTLLQTGGDKDGERKARLFYPCDDES-CD  155

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVH-FPFLGEVEDR  698
            W E+++  L+  RWYA+N +LPDG  IIVGGR   + EFFP       +   FL E  D 
Sbjct  156  WSEIDNA-LNVKRWYASNHVLPDGRQIIVGGRDEFNFEFFPKTNAPNTYSLRFLSETNDL  214

Query  699  QLDN  710
              +N
Sbjct  215  DQEN  218



>emb|CDY39045.1| BnaA02g17340D [Brassica napus]
Length=555

 Score =   182 bits (461),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 122/184 (66%), Gaps = 3/184 (2%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            GTW LL+ + GI++MH+ +   + V++ DR+N GPS+I LP+  CR   ND V K DC A
Sbjct  36   GTWRLLLNDVGISAMHSQLLINDRVIMYDRSNFGPSKISLPSGACRVSPNDVVSKRDCTA  95

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HS+  D+  NS+RPLT+ ++TWCSSG   P+G+L+QTGGD +G RK R F PC+  S CD
Sbjct  96   HSIEYDVAFNSIRPLTIESNTWCSSGGVTPEGALLQTGGDKEGERKARMFYPCDDES-CD  154

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVH-FPFLGEVEDR  698
            W E+++  L   RWYATN +LPDG  II+GGR   + EFFP     +++  PFL E  D 
Sbjct  155  WTEVDNA-LYVRRWYATNHVLPDGRQIIIGGRNQFNFEFFPKTKAPSLYKLPFLSETYDA  213

Query  699  QLDN  710
              +N
Sbjct  214  GQEN  217



>emb|CDY47509.1| BnaAnng09070D [Brassica napus]
Length=554

 Score =   182 bits (461),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 91/184 (49%), Positives = 120/184 (65%), Gaps = 3/184 (2%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            GTW+LL+ N GI++MH+ +   + V++ DR+N GPS+I LP   CR+  ND V K DC A
Sbjct  37   GTWKLLLNNVGISAMHSQLLINDRVIMYDRSNFGPSKISLPNGTCRDSPNDSVSKRDCTA  96

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HS+  D+  N +RPLTV ++TWCSSG   PDG+L+QTGGD DG RK R F PC+  S CD
Sbjct  97   HSIEYDVALNRIRPLTVQSNTWCSSGGVTPDGTLLQTGGDKDGERKARLFYPCDDDS-CD  155

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVH-FPFLGEVEDR  698
            W E+++  L+  RWYA+N +LPDG  IIVGGR   + EFFP       +   FL E  D 
Sbjct  156  WSEIDNA-LNVKRWYASNHVLPDGRQIIVGGRDEFNFEFFPKTNAPNTYSLRFLSETNDL  214

Query  699  QLDN  710
              +N
Sbjct  215  DQEN  218



>emb|CDY43429.1| BnaC07g14960D [Brassica napus]
Length=509

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/187 (48%), Positives = 120/187 (64%), Gaps = 3/187 (2%)
 Frame = +3

Query  153  ALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTD  332
            A  G W+LL+ N GI++MH  +   + VV+ DRTN GPS I LP  +CRN+  D V K D
Sbjct  27   AAGGKWDLLLSNVGISAMHMQLLPNDRVVMFDRTNFGPSNISLPNGNCRNNPQDAVSKID  86

Query  333  CYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSS  512
            C AHS+  ++ +N++RPLTV ++TWCSSG    DG L+QTGGD DG  K R F PC+ + 
Sbjct  87   CTAHSIEYNVESNTIRPLTVQSNTWCSSGSLRSDGVLVQTGGDRDGELKARTFSPCDDNE  146

Query  513  LCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXG-GAVHFPFLGEV  689
             CDW E+ +  L++ RWY++N ILPDG  II+GG+   + EFFP       +  PFL E 
Sbjct  147  -CDWVEINN-GLARRRWYSSNHILPDGKQIIIGGQRQFNYEFFPKTTSPNVIDLPFLAET  204

Query  690  EDRQLDN  710
             DR  +N
Sbjct  205  NDRGEEN  211



>ref|XP_010504696.1| PREDICTED: galactose oxidase-like [Camelina sativa]
Length=547

 Score =   181 bits (460),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 92/183 (50%), Positives = 113/183 (62%), Gaps = 3/183 (2%)
 Frame = +3

Query  168  WELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYAHS  347
            WE+L+P+ GI++MH  +     V++ DRT+ G S + LP   CR D  D  +K DC AHS
Sbjct  38   WEMLLPSIGISAMHMQLLHNGMVIMFDRTDFGISNVSLPGGICRYDPTDTAVKFDCTAHS  97

Query  348  VLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCDWQ  527
            VL D+ +NS RPL V TDTWCSSG  LP+G+L+QTGG  DG R  R F PC  S  CDW 
Sbjct  98   VLYDVVSNSYRPLQVQTDTWCSSGAVLPNGTLVQTGGYNDGERAARMFTPCGYSETCDWM  157

Query  528  ELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPR--XGGAVHFPFLGEVEDRQ  701
            E     LSQ RWYATNQILPDG +I+VGGR   + E FP       +  F FL E  D  
Sbjct  158  EFPQ-YLSQRRWYATNQILPDGRIIVVGGRRQFNYEIFPRHNSRSRSSRFEFLRETSDGS  216

Query  702  LDN  710
             +N
Sbjct  217  NEN  219



>ref|XP_009797024.1| PREDICTED: galactose oxidase-like [Nicotiana sylvestris]
Length=558

 Score =   182 bits (461),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 96/195 (49%), Positives = 118/195 (61%), Gaps = 5/195 (3%)
 Frame = +3

Query  138  NPARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDP  317
            N A AA+ GTWELL+ + GI++MH  +   + VV+ DRT+ G S I LP   CRN+ ND 
Sbjct  29   NSANAAVGGTWELLMSDIGISAMHMQLLNNDRVVMFDRTDFGASNIALPNGKCRNNSNDL  88

Query  318  VLKTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVP  497
             L  DC AHSV  D+ TNS+RPL V T+ WCSSG    DGSL+QTGG  DG    R F P
Sbjct  89   ALIVDCTAHSVEFDVTTNSVRPLMVQTNVWCSSGSATSDGSLVQTGGFNDGINVVRVFKP  148

Query  498  C--NSSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFP--PRXGGAV  665
            C     S CDWQE+ +  L Q RWYATN +LPDG  II+GGR A + EF+P         
Sbjct  149  CITGKRSTCDWQEMGN-GLIQSRWYATNHMLPDGRQIIIGGRAAFNYEFYPKTASTNNVF  207

Query  666  HFPFLGEVEDRQLDN  710
              PFL +  D   +N
Sbjct  208  SLPFLEQTNDPMEEN  222



>ref|XP_006342233.1| PREDICTED: galactose oxidase-like [Solanum tuberosum]
Length=553

 Score =   181 bits (460),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 98/196 (50%), Positives = 121/196 (62%), Gaps = 5/196 (3%)
 Frame = +3

Query  138  NPARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDP  317
            N A AA  G W+LL+ N GI+SMH  +   + VV+ DRT+ G S I LP   CRN+ ND 
Sbjct  26   NSAYAAGGGRWDLLMSNIGISSMHMQLLNNDRVVMYDRTDFGASNISLPNGKCRNNTNDL  85

Query  318  VLKTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVP  497
             LK DC AHSV  D+ TNS+RPL V TD WCSSG    DG+L+QTGG  DG    R   P
Sbjct  86   TLKVDCTAHSVEYDVSTNSVRPLMVQTDVWCSSGSATSDGTLVQTGGFNDGENVVRVLKP  145

Query  498  CN-SSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPP--RXGGAVH  668
            CN + S CDW+E+E   L Q RWYATN +LPDG  II+GGR A + EF+P         +
Sbjct  146  CNGNKSTCDWKEIEGA-LIQSRWYATNHVLPDGRQIIIGGREAFNYEFYPKTLSTNNIFN  204

Query  669  FPFLGEVED-RQLDNL  713
              FL +  D R+ +NL
Sbjct  205  LTFLQQTNDLREENNL  220



>gb|EYU36763.1| hypothetical protein MIMGU_mgv1a004035mg [Erythranthe guttata]
Length=548

 Score =   181 bits (460),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 95/193 (49%), Positives = 120/193 (62%), Gaps = 5/193 (3%)
 Frame = +3

Query  141  PARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPV  320
            P  +A  G W++L+ N G+++MH  +   + VV+ DRT+ G S I LPA  CRND ND  
Sbjct  24   PRASAAGGKWDVLLSNIGVSAMHIQLLNNDRVVIFDRTDFGSSNISLPAGKCRNDPNDTY  83

Query  321  LKTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPC  500
               DC AHSV  D+ +N++RPLTV TDTWCSSG   PDGSL+QTGG  DG    R F PC
Sbjct  84   STVDCTAHSVEYDVVSNTVRPLTVQTDTWCSSGAVAPDGSLVQTGGYNDGDHAVRTFRPC  143

Query  501  NSSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFP---PRXGGAVHF  671
            N SS CDWQE+    L + RWYATN ILPDG  II+GGR     EF+P   P    + + 
Sbjct  144  NDSS-CDWQEINP-GLIKRRWYATNHILPDGKQIIIGGRRQFGFEFYPKTSPADYKSYNL  201

Query  672  PFLGEVEDRQLDN  710
             FL +  D  ++N
Sbjct  202  SFLVQTYDPLIEN  214



>ref|XP_010105252.1| hypothetical protein L484_019394 [Morus notabilis]
 gb|EXC04187.1| hypothetical protein L484_019394 [Morus notabilis]
Length=544

 Score =   181 bits (460),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 92/188 (49%), Positives = 119/188 (63%), Gaps = 3/188 (2%)
 Frame = +3

Query  150  AALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKT  329
            AA  G W+LL  + GI +MH  +   + VV+ DRT+ G S++ LP   CRND+ D  LK 
Sbjct  23   AAAGGRWQLLQKSIGIPAMHMQLLNNDRVVIFDRTDFGRSQLSLPDGKCRNDRFDTALKV  82

Query  330  DCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSS  509
            DC AHS   D+ +N+ R LTV TD WCSSG  + DG+LIQTGG  DG R+ R F PC+  
Sbjct  83   DCTAHSAEYDVTSNTFRALTVQTDVWCSSGAVMADGTLIQTGGYNDGERRVRVFKPCDGR  142

Query  510  SLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVH-FPFLGE  686
            + CDWQE+ D+ LS  RWYATN ILP G  II+GGR   + E++P      VH  PFL E
Sbjct  143  T-CDWQEI-DLGLSAKRWYATNHILPGGRQIIIGGRRQFNYEYYPKDTDKNVHNLPFLSE  200

Query  687  VEDRQLDN  710
              D+ ++N
Sbjct  201  TNDKGIEN  208



>ref|XP_007017716.1| Glyoxal oxidase-related protein [Theobroma cacao]
 gb|EOY14941.1| Glyoxal oxidase-related protein [Theobroma cacao]
Length=546

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 92/188 (49%), Positives = 116/188 (62%), Gaps = 5/188 (3%)
 Frame = +3

Query  150  AALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKT  329
            +A  G W+LL  + G+++MH  + R + VV+ DRT+ G S + LP   CR D ND  LK 
Sbjct  27   SAADGRWQLLQKSIGVSAMHMQLLRNDRVVMFDRTDFGKSNLPLPNGKCRTDPNDTALKV  86

Query  330  DCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSS  509
            DC AHSV  D+ TN  R L V TD WCSSG  +PDG+L+QTGG  DG R+ R F PC   
Sbjct  87   DCTAHSVEYDVLTNKFRALMVQTDVWCSSGAIMPDGNLVQTGGFNDGERRVRVFSPC---  143

Query  510  SLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGG-AVHFPFLGE  686
            S CDWQE+ +  L+  RWYATN ILPDG  I+VGGR   + EF P        + PFL E
Sbjct  144  STCDWQEIPN-GLAAKRWYATNHILPDGRQIVVGGRRQFNYEFVPKNVAANTFNLPFLSE  202

Query  687  VEDRQLDN  710
              DR ++N
Sbjct  203  TNDRGVEN  210



>ref|XP_002973684.1| hypothetical protein SELMODRAFT_413959 [Selaginella moellendorffii]
 gb|EFJ25344.1| hypothetical protein SELMODRAFT_413959 [Selaginella moellendorffii]
Length=537

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 94/183 (51%), Positives = 117/183 (64%), Gaps = 5/183 (3%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            G+WELLV N+G+++MH  V+  N V++ DRT+ GPS IRLP   CRND +D  LK DC+A
Sbjct  29   GSWELLVENSGVSAMHMLVSHTNKVLIFDRTDYGPSAIRLPHGRCRNDSSDLALKIDCWA  88

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HSV L + T ++RPL VLTDTWCSSG F  DG+  QTGG  DG R  R +  C     C+
Sbjct  89   HSVELQIPTRNIRPLEVLTDTWCSSGAFRADGTFTQTGGWNDGARVVRHYNFCED---CN  145

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFPFLGEVEDRQ  701
            W E +   L + RWYA+NQILPD  VI+VGGR A S EF  P  G     PFL    D +
Sbjct  146  WTE-QPGGLQRPRWYASNQILPDNRVIVVGGRVAFSYEFV-PGDGHLYSLPFLRSTSDER  203

Query  702  LDN  710
             +N
Sbjct  204  SEN  206



>emb|CDP08591.1| unnamed protein product [Coffea canephora]
Length=548

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 114/187 (61%), Gaps = 2/187 (1%)
 Frame = +3

Query  153  ALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTD  332
            A+ G W LL    GI++MH  +   N V++ DRT+ G S I LP   CR D +D  LKTD
Sbjct  34   AIQGEWRLLQECIGISAMHMQLLHNNRVIMFDRTDFGNSNISLPGGRCRRDPHDVALKTD  93

Query  333  CYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSS  512
            C AHSVL D+ TN+ RPL V TDTWCSSG  L DG+L+QTGG  DG    RKF PC    
Sbjct  94   CTAHSVLYDIGTNNFRPLMVQTDTWCSSGAVLEDGTLVQTGGYNDGDHAVRKFSPCGGED  153

Query  513  LCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFPFLGEVE  692
             CDW E  +  L + RWYATNQILPDG +IIVGGR   + EF+      +    FL E +
Sbjct  154  -CDWVEFPNA-LMRRRWYATNQILPDGRIIIVGGRGQFNYEFYSQPATVSYDLEFLKETK  211

Query  693  DRQLDNL  713
            D   +NL
Sbjct  212  DEGENNL  218



>ref|XP_004289629.1| PREDICTED: galactose oxidase-like [Fragaria vesca subsp. vesca]
Length=547

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 92/193 (48%), Positives = 122/193 (63%), Gaps = 6/193 (3%)
 Frame = +3

Query  123  IHSTVNPARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRN  302
            I + ++ +  A  G WELL  N GI++MH  +   + VV+ DRT+ G S + LP   CRN
Sbjct  17   IATFLSSSTHAAVGKWELLTKNVGISAMHMQLLHNDRVVMFDRTDFGASNLSLPNGVCRN  76

Query  303  DKNDPVLKTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKF  482
            + ND  LK DC AHS   D+ +N++RPL V TDTWCSSG   P+GSL+QTGG  DG +  
Sbjct  77   NPNDTTLKVDCTAHSAEYDVASNTVRPLFVFTDTWCSSGAVNPNGSLVQTGGYNDGEKMV  136

Query  483  RKFVPCNSSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGG-  659
            R F PC   + CDW+E+ +V L+  RWYAT+ ILPDG  II+GGR   S EF+P   G  
Sbjct  137  RVFTPC---ATCDWEEIGNV-LANWRWYATDHILPDGRQIIIGGRGQFSYEFYPKSEGSM  192

Query  660  -AVHFPFLGEVED  695
             +++ PFL E  D
Sbjct  193  TSLNLPFLQETSD  205



>ref|XP_009774595.1| PREDICTED: galactose oxidase-like [Nicotiana sylvestris]
Length=554

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 120/191 (63%), Gaps = 5/191 (3%)
 Frame = +3

Query  153  ALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTD  332
            A+ G W+LL+ N GI++MH  +   + V++ DRT+ G S I LP   CRN+ ND  LK D
Sbjct  31   AVGGNWDLLISNIGISAMHMQLLNNDRVIMYDRTDFGASNISLPDGKCRNNPNDLALKLD  90

Query  333  CYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCN-SS  509
            C AHSV  D+ TNS+RPL V TD WCSSG    DGSL+QTGG  DG    R F PCN + 
Sbjct  91   CTAHSVEYDVSTNSVRPLMVQTDVWCSSGSATSDGSLVQTGGFNDGENVVRVFRPCNGNG  150

Query  510  SLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFP--PRXGGAVHFPFLG  683
            S CDW+E+    L Q RWYATN ILPDG  II+GGR A + EF+P         + PFL 
Sbjct  151  STCDWKEIGG-GLIQSRWYATNHILPDGRQIIIGGREAFNYEFYPKTASTNSVFNLPFLQ  209

Query  684  EVED-RQLDNL  713
            +  D R+ +NL
Sbjct  210  QTNDPREENNL  220



>ref|XP_012071982.1| PREDICTED: galactose oxidase-like [Jatropha curcas]
 gb|KDP38596.1| hypothetical protein JCGZ_04521 [Jatropha curcas]
Length=550

 Score =   181 bits (458),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 92/189 (49%), Positives = 121/189 (64%), Gaps = 3/189 (2%)
 Frame = +3

Query  147  RAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLK  326
             AA  G W+LL  + GI +MH  +   + VV+ DRT+ G S + LP   CR+D N+ V+K
Sbjct  28   EAAGGGRWQLLQKSIGITAMHMQLLNNDRVVIFDRTDFGISNLSLPEGQCRDDPNELVIK  87

Query  327  TDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNS  506
            TDC AHS   D  TN  RPL VLT+ WCSSG   PDG LIQTGG  DG R+ R F PC+S
Sbjct  88   TDCTAHSAEYDALTNKFRPLRVLTNVWCSSGAVTPDGRLIQTGGFNDGERQVRVFSPCSS  147

Query  507  SSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVH-FPFLG  683
            ++ CDWQE+ +  L   RWYATN ILP+G+ +I+GGR   S EF+P      ++  PFL 
Sbjct  148  TN-CDWQEVGN-GLKARRWYATNHILPEGNQVIIGGRRQFSYEFYPKTGAADLYSLPFLV  205

Query  684  EVEDRQLDN  710
            + +DR ++N
Sbjct  206  QTDDRNIEN  214



>ref|XP_004238617.1| PREDICTED: galactose oxidase-like [Solanum lycopersicum]
Length=557

 Score =   181 bits (458),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 98/197 (50%), Positives = 122/197 (62%), Gaps = 6/197 (3%)
 Frame = +3

Query  138  NPARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDP  317
            N A AA  G W+LL+ N GI++MH  +   + VV+ DRT+ G S I LP   CRN+ ND 
Sbjct  28   NLAYAAAGGKWDLLMSNIGISAMHMQLLNDDRVVIYDRTDFGMSNISLPDGKCRNNNNDL  87

Query  318  VLKTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVP  497
             LK DC AHSV  D+ TNS+RPL + T+ WCSSG    DGSL+QTGG  DG    R + P
Sbjct  88   ALKVDCTAHSVEYDVSTNSVRPLMIQTNVWCSSGSATSDGSLVQTGGSNDGKFVIRVYRP  147

Query  498  C--NSSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFP--PRXGGAV  665
            C     S CDW E+E+  L Q RWY+TN ILPDGS II+GGR A + EFFP         
Sbjct  148  CIIGKKSNCDWLEIEN-GLIQSRWYSTNHILPDGSQIIIGGRDAFNYEFFPKTASTNNVF  206

Query  666  HFPFLGEVED-RQLDNL  713
            + PFL +  D R+ +NL
Sbjct  207  NLPFLQQTNDPREENNL  223



>gb|KJB38605.1| hypothetical protein B456_006G262900 [Gossypium raimondii]
Length=548

 Score =   181 bits (458),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/187 (48%), Positives = 116/187 (62%), Gaps = 5/187 (3%)
 Frame = +3

Query  153  ALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTD  332
            A  G+W+LL  + GI++MH  + R + V++ DRT+ GPS + LP   CRND  D  L+ D
Sbjct  29   AADGSWQLLQKSVGISAMHMQLLRNDRVIMFDRTDFGPSNLLLPNGKCRNDPTDTALQVD  88

Query  333  CYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSS  512
            C AHSV  D+  N  R LTV TD WCSSG  +PDG+L QTGG  DG R+ R F PC +  
Sbjct  89   CTAHSVEYDVFANKFRALTVQTDVWCSSGAIMPDGNLFQTGGFNDGERRVRVFSPCRT--  146

Query  513  LCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPR-XGGAVHFPFLGEV  689
             CDW E+ +  L+  RWYA+N ILPDG  IIVGGR   + EF P       ++ PFL E 
Sbjct  147  -CDWNEIPN-GLTAKRWYASNHILPDGRQIIVGGRGQFNYEFIPKNIVSNKINLPFLSET  204

Query  690  EDRQLDN  710
             D+ ++N
Sbjct  205  NDKGIEN  211



>ref|XP_010061250.1| PREDICTED: galactose oxidase-like [Eucalyptus grandis]
 gb|KCW68173.1| hypothetical protein EUGRSUZ_F01844 [Eucalyptus grandis]
Length=551

 Score =   181 bits (458),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 92/184 (50%), Positives = 116/184 (63%), Gaps = 5/184 (3%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            G W+LL  + G+++MH  +   + VV+ DRT+ G S + LP   CRND  D  LK DC A
Sbjct  35   GRWQLLQRSIGVSAMHMQLLHNDVVVIFDRTDFGKSNLSLPNGKCRNDPRDTALKIDCTA  94

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HS+  D+ +NS RPL V TD WCSSG  +PDG LIQTGG  DG R+ R F PC   S CD
Sbjct  95   HSIEYDVASNSFRPLMVQTDVWCSSGSVMPDGRLIQTGGFNDGERRIRIFNPC---SGCD  151

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVH-FPFLGEVEDR  698
            WQE+E+  LS  RWYATN ILP+G  IIVGGR   + EF+P      V+  PFL +  D 
Sbjct  152  WQEVEN-GLSARRWYATNHILPNGLQIIVGGRGQFNYEFYPKTGAPKVYNLPFLAQTNDA  210

Query  699  QLDN  710
             ++N
Sbjct  211  NIEN  214



>ref|XP_010516382.1| PREDICTED: galactose oxidase-like [Camelina sativa]
Length=546

 Score =   180 bits (457),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 91/183 (50%), Positives = 113/183 (62%), Gaps = 3/183 (2%)
 Frame = +3

Query  168  WELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYAHS  347
            WE+L+P+ GI++MH  +     V++ DRT+ G S + LP   CR D  D  +K DC AHS
Sbjct  37   WEMLLPSIGISAMHMQLLHNGMVIMFDRTDFGISNVSLPGGICRYDPTDTAVKFDCSAHS  96

Query  348  VLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCDWQ  527
            VL D+ +N+ RPL V TDTWCSSG  LP+G+L+QTGG  DG R  R F PC  S  CDW 
Sbjct  97   VLYDVVSNTYRPLQVQTDTWCSSGAVLPNGTLVQTGGYNDGERAARMFTPCGYSETCDWM  156

Query  528  ELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFP--PRXGGAVHFPFLGEVEDRQ  701
            E     LSQ RWYATNQILPDG +I+VGGR   + E FP       +  F FL E  D  
Sbjct  157  EFPQ-YLSQRRWYATNQILPDGRIIVVGGRRQFNYEIFPRHSSRSRSSRFEFLRETSDGS  215

Query  702  LDN  710
             +N
Sbjct  216  DEN  218



>ref|XP_002876427.1| hypothetical protein ARALYDRAFT_907231 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52686.1| hypothetical protein ARALYDRAFT_907231 [Arabidopsis lyrata subsp. 
lyrata]
Length=547

 Score =   180 bits (457),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 91/183 (50%), Positives = 113/183 (62%), Gaps = 3/183 (2%)
 Frame = +3

Query  168  WELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYAHS  347
            WE+L+P+ GI++MH  +     VV+ DRT+ G S + LP   CR D  D  +K DC AHS
Sbjct  37   WEMLLPSIGISAMHMQLLHNGMVVMFDRTDFGTSNVSLPGGICRYDPTDTAVKFDCSAHS  96

Query  348  VLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCDWQ  527
            VL D+ +N+ RPL V TDTWCSSG  LP+G+L+QTGG  DG R  R F PC  S  CDW 
Sbjct  97   VLYDVVSNTYRPLNVQTDTWCSSGAVLPNGTLVQTGGYNDGERAARMFTPCGYSETCDWI  156

Query  528  ELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPR--XGGAVHFPFLGEVEDRQ  701
            E     LSQ RWYATNQI+PDG +I+VGGR   + E FP       +  F FL E  D  
Sbjct  157  EFPQ-YLSQRRWYATNQIIPDGRIIVVGGRRQFNYELFPRHDSRSRSSRFEFLRETSDGS  215

Query  702  LDN  710
             +N
Sbjct  216  NEN  218



>ref|XP_006383732.1| hypothetical protein POPTR_0005s25680g [Populus trichocarpa]
 gb|ERP61529.1| hypothetical protein POPTR_0005s25680g [Populus trichocarpa]
Length=487

 Score =   179 bits (454),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 93/184 (51%), Positives = 112/184 (61%), Gaps = 4/184 (2%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            G W+LL  N GI +MH  +   + VV+ DRT+ G S + LP   CR+D ++ V+K DC A
Sbjct  31   GRWQLLQKNIGIVAMHMQLLNNDRVVIYDRTDFGRSNLSLPGGKCRDDSSEIVIKHDCTA  90

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HSV  D+  N  RPL V TD WCSSG  +PDGSLIQTGG  DG RK R F PCN    CD
Sbjct  91   HSVEYDVLANKFRPLMVQTDVWCSSGAVVPDGSLIQTGGFSDGERKVRTFYPCNGD--CD  148

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVH-FPFLGEVEDR  698
            W E  D  L   RWYATN ILPDG  II+GGR   + EF+P      V+  PFL +  DR
Sbjct  149  WVETGD-GLKAKRWYATNHILPDGKQIIIGGRRQFNYEFYPKTSSPDVYSLPFLLQTNDR  207

Query  699  QLDN  710
              +N
Sbjct  208  GSEN  211



>ref|XP_009600286.1| PREDICTED: galactose oxidase-like [Nicotiana tomentosiformis]
Length=554

 Score =   180 bits (457),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 118/191 (62%), Gaps = 5/191 (3%)
 Frame = +3

Query  153  ALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTD  332
            A  G W+LL+ N GI++MH  +   + V++ DRT+ G S I LP   CRN+ ND  LK D
Sbjct  31   AAGGNWDLLISNIGISAMHMQLLNNDRVIIYDRTDFGASNISLPDGKCRNNSNDLALKLD  90

Query  333  CYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCN-SS  509
            C AHSV  D+ TNS+RPL V TD WCSSG    DGSL+QTGG  DG    R F PCN + 
Sbjct  91   CTAHSVEYDVSTNSVRPLMVQTDVWCSSGSATSDGSLVQTGGFNDGENVVRVFRPCNGNG  150

Query  510  SLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFP--PRXGGAVHFPFLG  683
            S CDW+E+    L Q RWYATN ILPDG  II+GGR A + EF+P           PFL 
Sbjct  151  STCDWKEIGG-GLIQSRWYATNHILPDGRQIIIGGREAFNYEFYPKTASTNNVFSLPFLQ  209

Query  684  EVED-RQLDNL  713
            +  D R+ +NL
Sbjct  210  QTNDPREENNL  220



>ref|XP_004304717.1| PREDICTED: galactose oxidase [Fragaria vesca subsp. vesca]
Length=546

 Score =   180 bits (456),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 115/184 (63%), Gaps = 3/184 (2%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            G W LL  + GI++MH  +   N V++ DRT+ G S I LP   CR D ND  L+ DC A
Sbjct  32   GQWRLLQSSIGISAMHMQLLHNNKVIMFDRTDFGASNISLPGGKCREDPNDTALQRDCTA  91

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HSVL D+  N+ RPLT+ TD WCSSG  LPDG+L+QTGG  DG R  R F PCN    CD
Sbjct  92   HSVLYDIGQNTFRPLTIQTDPWCSSGAVLPDGTLLQTGGYNDGDRSLRTFSPCNDEK-CD  150

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFP-PRXGGAVHFPFLGEVEDR  698
            W E  +  L++ RWYA+NQILPDG +IIVGGR   + EF+P       +    L +  D+
Sbjct  151  WNEEPNYLLTR-RWYASNQILPDGRIIIVGGRRQYNYEFYPRGSSSSTIWLEHLRQTRDQ  209

Query  699  QLDN  710
            +++N
Sbjct  210  RIEN  213



>gb|KJB38606.1| hypothetical protein B456_006G263000 [Gossypium raimondii]
Length=549

 Score =   180 bits (456),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 89/188 (47%), Positives = 117/188 (62%), Gaps = 5/188 (3%)
 Frame = +3

Query  150  AALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKT  329
            +A  G+W+LL  + GI++MH  + R + V++ DRT+ GPS + LP   CRND  D  L+ 
Sbjct  29   SAADGSWQLLQKSIGISAMHMQLLRNDRVIMFDRTDFGPSNLPLPTGKCRNDPTDTALQV  88

Query  330  DCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSS  509
            DC AHSV  D+  N  R LTV TD WCSSG  +PDG+L QTGG  DG R+ R F PC + 
Sbjct  89   DCTAHSVEYDVFANKFRALTVQTDVWCSSGAIMPDGNLFQTGGFNDGERRVRVFSPCRT-  147

Query  510  SLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPR-XGGAVHFPFLGE  686
              CDW E+ +  L+  RWYA+N ILPDG  IIVGGR   + EF P       ++ PFL E
Sbjct  148  --CDWNEIPN-GLTAKRWYASNHILPDGRQIIVGGRGQFNYEFIPKNIVTTKINLPFLSE  204

Query  687  VEDRQLDN  710
              D+ ++N
Sbjct  205  TNDKGIEN  212



>ref|XP_006342232.1| PREDICTED: galactose oxidase-like [Solanum tuberosum]
Length=553

 Score =   180 bits (456),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 122/196 (62%), Gaps = 8/196 (4%)
 Frame = +3

Query  135  VNPARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKND  314
            +N A AA  G W+LL+PN GI++MH  +   + V++ DRT+ G S I LP   CRN+  +
Sbjct  27   LNLANAA-GGKWDLLMPNIGISAMHMQLLNNDRVIMYDRTDFGASNIPLPDGKCRNNPKE  85

Query  315  PVLKTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFV  494
              LK DC AHSV  D+ TNS+RPL V TD WCSSG    DGSL+QTGG  DG    R F 
Sbjct  86   LALKVDCTAHSVEYDVSTNSIRPLMVQTDVWCSSGSATSDGSLVQTGGFNDGKLMVRTFN  145

Query  495  PCNSSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFP--PRXGGAVH  668
            PCN+   CDWQE+ D  L Q RWY+TN ILPDGS II+GGR A + EFFP          
Sbjct  146  PCNT---CDWQEMGD-GLVQSRWYSTNHILPDGSQIIIGGRDAFNYEFFPKTASTNNVFS  201

Query  669  FPFLGEVE-DRQLDNL  713
             PFL +    R+ +NL
Sbjct  202  LPFLQQTNVPREENNL  217



>ref|XP_006392509.1| hypothetical protein EUTSA_v10023396mg [Eutrema salsugineum]
 gb|ESQ29795.1| hypothetical protein EUTSA_v10023396mg [Eutrema salsugineum]
Length=548

 Score =   179 bits (455),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 94/185 (51%), Positives = 115/185 (62%), Gaps = 6/185 (3%)
 Frame = +3

Query  168  WELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYAHS  347
            WELLVPN GI++MH  +     V++ DRT+ G S + LP   CR D +D  +K DC AHS
Sbjct  34   WELLVPNIGISAMHMQLLHNGMVIMFDRTDFGVSNLSLPGGICRFDPSDTAVKFDCSAHS  93

Query  348  VLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCDWQ  527
            VL D+ +N+ R L V TDTWCSSG  LP+G+L+QTGG  DG R  R F PC     CDW 
Sbjct  94   VLYDVVSNTYRALKVQTDTWCSSGSVLPNGTLVQTGGYNDGERATRMFSPCGYGETCDWI  153

Query  528  ELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPP----RXGGAVHFPFLGEVED  695
            E     L+Q RWYATNQILPDG +I+VGGR   + EFFP     R  G+  F FL E  D
Sbjct  154  EFPQ-YLAQRRWYATNQILPDGRIIVVGGRRQFNFEFFPRPDHHRYRGS-RFDFLRETTD  211

Query  696  RQLDN  710
               +N
Sbjct  212  GSNEN  216



>ref|XP_010916153.1| PREDICTED: galactose oxidase-like [Elaeis guineensis]
Length=541

 Score =   179 bits (454),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 95/185 (51%), Positives = 114/185 (62%), Gaps = 5/185 (3%)
 Frame = +3

Query  168  WELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYAHS  347
            W+LL  + G+++MH  +   + V++ DRT+ G S + LP   CRND N+ VLK DC AHS
Sbjct  29   WDLLQRSIGVSAMHMQLLHNDRVIIFDRTDFGRSNLSLPDGKCRNDPNEKVLKIDCTAHS  88

Query  348  VLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCDWQ  527
               DL TN+ RPL +LTD+WCSSG   PDG LIQTGG  DG R  R FVPCN  S CDW 
Sbjct  89   AEYDLATNTFRPLMILTDSWCSSGTVAPDGRLIQTGGWNDGDRAVRTFVPCNDGS-CDWS  147

Query  528  ELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFP---PRXGGAVHFPFLGEVEDR  698
            E +   L+  RWYATNQILPDG  IIVGGR   + EF P   P        PFL   +D 
Sbjct  148  E-DPQGLAARRWYATNQILPDGRAIIVGGRKQFNFEFHPKPNPSDLTTFPLPFLQATKDD  206

Query  699  QLDNL  713
              DNL
Sbjct  207  VEDNL  211



>ref|XP_003519774.1| PREDICTED: galactose oxidase-like [Glycine max]
Length=560

 Score =   179 bits (454),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 108/173 (62%), Gaps = 0/173 (0%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            G W  L  + GI++MH  V   N VV+ DRT+ GPS I L  H CR +  D  LK DC A
Sbjct  33   GHWVQLQRSIGISAMHMQVMYDNKVVIFDRTDFGPSNISLSGHRCRFNPRDLALKLDCTA  92

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HSVL DL T++ RPLT+ +D WCSSG     G+L+QTGG  DG+ K R F PC S + CD
Sbjct  93   HSVLYDLATDTFRPLTLRSDAWCSSGALTASGTLLQTGGFNDGYTKLRSFTPCPSHNTCD  152

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFPFL  680
            W E  +  LS  RWYA+NQILP+G VI+VGGR + + EF P     A  F FL
Sbjct  153  WLEHNNHNLSTSRWYASNQILPNGKVIVVGGRNSFTYEFVPKNQNDASSFWFL  205



>ref|XP_010660091.1| PREDICTED: galactose oxidase [Vitis vinifera]
Length=544

 Score =   179 bits (453),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 95/186 (51%), Positives = 117/186 (63%), Gaps = 4/186 (2%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            G W LL  + GI++MH  +   N VV+ DRT+ GPS + LP H CR+D  D  L+TDC A
Sbjct  31   GEWHLLHASIGISAMHMQLLWNNKVVIFDRTDFGPSNLSLPPHLCRHDPRDHALQTDCTA  90

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HS+L  + TN+ RPL V TDTWCSSG  LP+G+L QTGG  DG    R F PC+  S CD
Sbjct  91   HSLLYCVDTNTFRPLKVQTDTWCSSGSVLPNGTLTQTGGFNDGDHVLRMFTPCDDYS-CD  149

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFP--FLGEVED  695
            W E     LSQ RWYA+NQILPDG +IIVGGR   + EF+P    G+  +   FL E  D
Sbjct  150  WVEFPG-YLSQRRWYASNQILPDGRIIIVGGRRQFNYEFYPRSSRGSNLYTLDFLRETRD  208

Query  696  RQLDNL  713
               +NL
Sbjct  209  AHENNL  214



>ref|XP_006342231.1| PREDICTED: galactose oxidase-like [Solanum tuberosum]
Length=556

 Score =   179 bits (454),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 96/197 (49%), Positives = 120/197 (61%), Gaps = 6/197 (3%)
 Frame = +3

Query  138  NPARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDP  317
            N A AA  G W+LL+ N GI++MH  +   + VV+ DRT+ G S I LP   CRN+ ND 
Sbjct  27   NLAYAAAGGKWDLLMSNIGISAMHMQLLNDDRVVMYDRTDFGMSNISLPNGKCRNNNNDL  86

Query  318  VLKTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVP  497
             LK DC AHS+  D+ TNS+RPL + T+ WCSSG    DGSL+QTGG  DG    R + P
Sbjct  87   ALKVDCTAHSIEYDVSTNSVRPLMIQTNVWCSSGSATSDGSLVQTGGSNDGKFVIRVYKP  146

Query  498  C--NSSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFP--PRXGGAV  665
            C     S CDWQE+ +  L Q RWY+TN ILPDG  II+GGR A + EF P  P      
Sbjct  147  CITGKRSNCDWQEMGN-GLIQSRWYSTNHILPDGRQIIIGGRDAFNYEFHPKIPSTNNVF  205

Query  666  HFPFLGEVED-RQLDNL  713
              PFL +  D R+ +NL
Sbjct  206  SLPFLQQTNDPREENNL  222



>ref|XP_006342711.1| PREDICTED: galactose oxidase-like [Solanum tuberosum]
Length=568

 Score =   179 bits (454),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/183 (49%), Positives = 117/183 (64%), Gaps = 6/183 (3%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            G+W LL+ N GI++MH  +   + VV+ DRT+ G S I LP   CR D+ND  LK DC A
Sbjct  45   GSWNLLLSNIGISAMHMQLLNNDRVVMFDRTDFGMSNISLPDGKCRYDQNDTTLKVDCTA  104

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSS---  512
            HS+  D+ +NS+RPL V TD WCSSG   PDGSL+QTGG  DG +  R F PC++++   
Sbjct  105  HSIEYDIASNSIRPLMVQTDVWCSSGSVFPDGSLVQTGGFNDGEKVVRVFKPCSNATTNG  164

Query  513  LCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGG--AVHFPFLGE  686
             CDW+E++   L Q RWY+TN ILPDG  II+GGR A + EF+P       +   PFL +
Sbjct  165  TCDWEEIQG-GLVQRRWYSTNHILPDGRQIIIGGRRAFNYEFYPKSASANNSYSLPFLVK  223

Query  687  VED  695
              D
Sbjct  224  TND  226



>ref|XP_003561804.1| PREDICTED: galactose oxidase-like [Brachypodium distachyon]
Length=569

 Score =   179 bits (454),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/185 (47%), Positives = 118/185 (64%), Gaps = 5/185 (3%)
 Frame = +3

Query  168  WELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYAHS  347
            W++L  + G+++MH  + R + V++ DRT+ GPS + LP   CR + ++ VL  DC AHS
Sbjct  35   WDILQHSIGVSAMHMQLLRNDRVIIFDRTDFGPSNLSLPDGRCRRNPHERVLPVDCTAHS  94

Query  348  VLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCDWQ  527
               D+ TN+ RPL+V TDTWCSSG   PDG+L+QTGG  DG+R  R   PC   + CDW 
Sbjct  95   AEYDVRTNAFRPLSVFTDTWCSSGTVSPDGTLVQTGGWNDGYRNARTMAPCVDGT-CDWN  153

Query  528  ELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRX---GGAVHFPFLGEVEDR  698
            E +D  L+  RWYATNQILPDG   IVGGR   S EF+P +      A+  PFL + +D 
Sbjct  154  ETQDA-LAANRWYATNQILPDGRAFIVGGRRQFSYEFYPKQADHPSDAIALPFLVQTKDP  212

Query  699  QLDNL  713
            + +NL
Sbjct  213  EENNL  217



>gb|KJB38607.1| hypothetical protein B456_006G263100 [Gossypium raimondii]
Length=549

 Score =   179 bits (453),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/188 (46%), Positives = 117/188 (62%), Gaps = 5/188 (3%)
 Frame = +3

Query  150  AALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKT  329
            +A+ G+W++L  + GI++MH  + R + V++ DRT+ GPS + LP   CRND  D  L+ 
Sbjct  29   SAVDGSWQILQKSIGISAMHMQLLRNDRVIMFDRTDFGPSNLSLPNGKCRNDPTDTALQV  88

Query  330  DCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSS  509
            DC AHSV  D+  N  RPLTV TD WCSSG  +PDG+L QTGG  DG R  R F PC + 
Sbjct  89   DCTAHSVEYDVFANKFRPLTVQTDVWCSSGAIMPDGNLFQTGGFNDGERWVRVFSPCRT-  147

Query  510  SLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPR-XGGAVHFPFLGE  686
              CDW E+ +  L+  RWYA+N ILPD   II+GGR   + EF P       ++ PFL E
Sbjct  148  --CDWNEIPN-GLTAKRWYASNHILPDERQIIIGGRGQFNYEFIPKNIVANKINLPFLSE  204

Query  687  VEDRQLDN  710
              D+ ++N
Sbjct  205  TNDKGIEN  212



>ref|XP_008775019.1| PREDICTED: galactose oxidase-like [Phoenix dactylifera]
Length=544

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 117/191 (61%), Gaps = 5/191 (3%)
 Frame = +3

Query  150  AALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKT  329
            AA  G W+LL  + G+++MH  +   + VV+ DRT+ G S + LP   CRND N+ V+K 
Sbjct  24   AAGGGRWDLLHRSIGVSAMHMQLLHNDRVVIFDRTDFGLSNLSLPNGKCRNDPNEKVIKI  83

Query  330  DCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSS  509
            DC AHS   D+ TN+ RPL +LTD+WCSSG   PDG LIQTGG  DG R  R FVPC+  
Sbjct  84   DCTAHSAEYDVATNTFRPLMILTDSWCSSGAVAPDGRLIQTGGWNDGDRAVRTFVPCDDG  143

Query  510  SLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFP---PRXGGAVHFPFL  680
            S CDW E+    L+  RWYATNQILPDG  IIVGGR   + EF P   P        PFL
Sbjct  144  S-CDWSEVPQ-GLAARRWYATNQILPDGRAIIVGGRRQFNYEFHPKPNPSDLTTFPLPFL  201

Query  681  GEVEDRQLDNL  713
               +D   DNL
Sbjct  202  QNTKDDVEDNL  212



>ref|XP_006357288.1| PREDICTED: galactose oxidase-like [Solanum tuberosum]
Length=570

 Score =   178 bits (452),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 90/185 (49%), Positives = 113/185 (61%), Gaps = 5/185 (3%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            G W LL  + GI++MH  +   N VV+ DRT+ G S + LP   CR   ND  +K DC A
Sbjct  54   GKWILLHKSIGISAMHMQLLHNNKVVIFDRTDFGSSNLSLPRGKCR--YNDEAIKVDCTA  111

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HS+L ++ TN+ RPL V TD WCSSG    +G+LIQTGG  DG RK R F PCN    CD
Sbjct  112  HSILYNVATNTYRPLMVQTDVWCSSGAVNSNGTLIQTGGYHDGERKIRLFSPCNDEETCD  171

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGG--AVHFPFLGEVED  695
            W EL+   L+  RWY+T+ ILPDG ++I+GGR A S EFFP         H PFL E  D
Sbjct  172  WTELQQ-NLTVKRWYSTDHILPDGRIMIIGGRNAYSYEFFPQNSNTNYVFHLPFLKETTD  230

Query  696  RQLDN  710
             + +N
Sbjct  231  PKEEN  235



>ref|XP_011457694.1| PREDICTED: galactose oxidase-like [Fragaria vesca subsp. vesca]
Length=547

 Score =   178 bits (452),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/183 (49%), Positives = 116/183 (63%), Gaps = 6/183 (3%)
 Frame = +3

Query  153  ALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTD  332
            A  G WELL+ N GI++MH  +   + VV+ DRTN GPS + LP   CR + ND  LK D
Sbjct  27   AADGKWELLLKNVGISAMHMQLLHNDRVVMFDRTNFGPSNLSLPNGVCRKNPNDTALKVD  86

Query  333  CYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSS  512
            C AHS   D+ +N++RPL V TDTWCSSG   P GSL+QTGG  +G ++ R F PC   +
Sbjct  87   CTAHSAEYDVASNAVRPLFVFTDTWCSSGAVNPSGSLVQTGGSNEGEKRVRVFNPC---A  143

Query  513  LCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGG--AVHFPFLGE  686
             CDW+E+++  L   RWYAT+ ILPDG  II+GGR   + EF+P   G   A++  FL E
Sbjct  144  TCDWKEIQN-GLVNRRWYATDHILPDGRQIIIGGRGEFNYEFYPKSAGSMTALNLQFLQE  202

Query  687  VED  695
              D
Sbjct  203  TSD  205



>emb|CDX73183.1| BnaC06g36310D [Brassica napus]
Length=552

 Score =   178 bits (452),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 90/184 (49%), Positives = 119/184 (65%), Gaps = 3/184 (2%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            GTW+LL+ N GI++MH+ +   + V++ DR+N GPS+I LP   CR+  ND V K DC A
Sbjct  35   GTWKLLLNNVGISAMHSQLLINDRVIMYDRSNFGPSKISLPNGTCRDSPNDSVSKRDCTA  94

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HS+  D+  N +RPLTV ++TWCSSG   PDG+L+QTGGD DG RK R F PC+  S C 
Sbjct  95   HSIEYDVALNRVRPLTVQSNTWCSSGGVTPDGTLLQTGGDKDGERKARLFYPCDDDS-CV  153

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVH-FPFLGEVEDR  698
            W E+++  L+  RWYA+N +LPDG  IIVGGR   + EFFP       +   FL E  D 
Sbjct  154  WSEIDNA-LNVKRWYASNHVLPDGRQIIVGGRDEFNFEFFPKTNAPNTYSLRFLSETNDL  212

Query  699  QLDN  710
              +N
Sbjct  213  DQEN  216



>ref|XP_006857804.1| PREDICTED: galactose oxidase [Amborella trichopoda]
 gb|ERN19271.1| hypothetical protein AMTR_s00061p00216590 [Amborella trichopoda]
Length=528

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 93/187 (50%), Positives = 119/187 (64%), Gaps = 5/187 (3%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            G W+LLV +AG+++MH   TR  TVV+ D T  G S++ L    C +   D  L  DC+A
Sbjct  4    GHWDLLVSDAGVSAMHMTTTRLGTVVMFDGTYFGTSKLPLGHSRCHDRATDVALPRDCWA  63

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HS+  D   NS+RPLT+LTDT CSSG FLP+G+LIQTGG  DG +  R F PC  S+ CD
Sbjct  64   HSIEYDPAANSVRPLTILTDTLCSSGAFLPNGTLIQTGGFQDGEKGLRLFHPCLGSA-CD  122

Query  522  WQELED--VQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXG--GAVHFPFLGEV  689
            W E+     QLS+ RWY+TNQ+LPD  VI+VGG TA + EF P   G  G+   PFL E 
Sbjct  123  WNEVSSPPSQLSEKRWYSTNQVLPDHRVIVVGGTTAFTYEFVPKPSGSEGSFRLPFLIET  182

Query  690  EDRQLDN  710
             D  ++N
Sbjct  183  NDPIVEN  189



>ref|XP_009797022.1| PREDICTED: galactose oxidase-like [Nicotiana sylvestris]
Length=551

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 119/190 (63%), Gaps = 7/190 (4%)
 Frame = +3

Query  153  ALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTD  332
            A  G W+LL+ N GI++MH  +   + V++ DRT+ GPS I LP   CRN+ ND  LK D
Sbjct  31   AAGGKWQLLMSNIGISAMHIQLLNNDRVIMYDRTDFGPSNISLPDGKCRNNPNDLALKVD  90

Query  333  CYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSS  512
            C AHSV  D+ TNS+RPL V TD WCSSG    DGSL+QTGG  DG    R   PC   S
Sbjct  91   CTAHSVEYDVSTNSVRPLMVQTDVWCSSGSVNSDGSLVQTGGFNDGEHMVRVVKPC---S  147

Query  513  LCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHF--PFLGE  686
             CDWQE+ +  L Q RWY+TN ILPDG  II+GGR A + EF+P     +  F  PFL +
Sbjct  148  TCDWQEMGN-NLIQSRWYSTNHILPDGRQIIIGGRKAFNYEFYPKTASTSNVFSLPFLQQ  206

Query  687  VED-RQLDNL  713
              + R+ +NL
Sbjct  207  TNNPREENNL  216



>gb|KFK35620.1| hypothetical protein AALP_AA4G014800 [Arabis alpina]
Length=549

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 90/183 (49%), Positives = 113/183 (62%), Gaps = 3/183 (2%)
 Frame = +3

Query  168  WELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYAHS  347
            WE+L P+ GI++MH  +     V++ DRT+ G S I L    CR D +D  +K DC AHS
Sbjct  35   WEVLQPSIGISAMHMQLLHNGMVIMFDRTDFGNSNISLAGGMCRYDPSDTAVKFDCSAHS  94

Query  348  VLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCDWQ  527
            VL D+ +N+ RPL V TDTWCSSG  LP+G+L+QTGG  DG R  R F PC  S  CDW 
Sbjct  95   VLYDVASNTYRPLKVQTDTWCSSGSVLPNGTLVQTGGYNDGDRAARMFTPCGFSETCDWI  154

Query  528  ELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVH--FPFLGEVEDRQ  701
            E     L+Q RWYATNQILPDG +I+VGGR   + E FP     ++   F FL E  D  
Sbjct  155  EFPQ-YLTQRRWYATNQILPDGRIIVVGGRRQFNFEIFPRADYRSIESRFEFLRETTDGS  213

Query  702  LDN  710
             +N
Sbjct  214  NEN  216



>ref|XP_004238325.1| PREDICTED: galactose oxidase-like [Solanum lycopersicum]
Length=547

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 98/196 (50%), Positives = 122/196 (62%), Gaps = 8/196 (4%)
 Frame = +3

Query  135  VNPARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKND  314
            +N A AA  G W+LL+ N GI++MH  +   + V++ DRT+ G S I LP   CRN+  +
Sbjct  23   LNLANAA-GGKWDLLMSNIGISAMHMQLLNNDRVIMYDRTDFGASNISLPDGKCRNNPKE  81

Query  315  PVLKTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFV  494
              LK DC AHSV  D+ TNS+RPL V T+ WCSSG    DGSL+QTGG  DG    R F 
Sbjct  82   LALKIDCTAHSVEYDVSTNSIRPLMVQTNVWCSSGSATSDGSLVQTGGFNDGKLMVRTFN  141

Query  495  PCNSSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFP--PRXGGAVH  668
            PCN+   CDWQE+ D  L Q RWY+TN ILPDGS II+GGR A + EFFP         +
Sbjct  142  PCNT---CDWQEMGD-GLGQSRWYSTNHILPDGSQIIIGGRDAFNYEFFPQTASTSNVFN  197

Query  669  FPFLGEVE-DRQLDNL  713
             PFL E    R+ +NL
Sbjct  198  LPFLRETNVPREENNL  213



>ref|XP_010536365.1| PREDICTED: galactose oxidase-like [Tarenaya hassleriana]
Length=539

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 96/194 (49%), Positives = 120/194 (62%), Gaps = 3/194 (2%)
 Frame = +3

Query  132  TVNPARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKN  311
            T + A  A  G WELL  NAGI++MH  + R + VV+ DRTN GPS I LP   CRN+ N
Sbjct  3    TCHVAYVAGDGRWELLRGNAGISAMHIQLLRNDRVVMFDRTNWGPSNISLPDGKCRNNPN  62

Query  312  DPVLKTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKF  491
            D V K DC AHSV  D+  N +RPLTV+++ +CSSG   PDG+L+QTGGD DG R  R F
Sbjct  63   DRVSKMDCTAHSVEYDVVANRVRPLTVMSNPFCSSGSVRPDGTLVQTGGDEDGDRMVRLF  122

Query  492  VPCNSSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVH-  668
              C     CDW E++   L+  RWYA++ ILPDG  +IVGGR   + EFFP      V+ 
Sbjct  123  SACEMDG-CDWTEIKS-GLAVRRWYASDHILPDGRQVIVGGREQFNFEFFPKTKDPKVYS  180

Query  669  FPFLGEVEDRQLDN  710
             PFL E  D   +N
Sbjct  181  LPFLSETNDNGSEN  194



>ref|XP_004239377.1| PREDICTED: galactose oxidase-like [Solanum lycopersicum]
Length=567

 Score =   178 bits (451),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 91/185 (49%), Positives = 114/185 (62%), Gaps = 5/185 (3%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            G W LL  + GI++MH  +   N VV+ DRT+ G S + LP   CR   ND  +K DC A
Sbjct  51   GKWILLHKSIGISAMHMQLLHNNKVVIFDRTDFGSSNLSLPHDKCR--YNDEAIKVDCTA  108

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HS+L ++ TN+ RPLTV TD WCSSG   P+G+LIQTGG   G RK R F PC     CD
Sbjct  109  HSILYNVATNTYRPLTVQTDVWCSSGAVNPNGTLIQTGGYHAGERKIRLFSPCFDEETCD  168

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAV--HFPFLGEVED  695
            W EL+   L+  RWY+T+ ILPDG ++I+GGR A S EFFP      V  H PFL E  D
Sbjct  169  WTELQQ-NLTVKRWYSTDHILPDGRIMIIGGRNAYSYEFFPQSSETDVVFHLPFLKETTD  227

Query  696  RQLDN  710
             + +N
Sbjct  228  PKEEN  232



>ref|XP_009791893.1| PREDICTED: galactose oxidase-like [Nicotiana sylvestris]
Length=545

 Score =   177 bits (450),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 116/190 (61%), Gaps = 7/190 (4%)
 Frame = +3

Query  153  ALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTD  332
            A  G W+LL  N GI++MH  +   + V++ DRT+ G S I LP   CRN+ ND  LK D
Sbjct  26   AAGGKWQLLKSNIGISAMHMQLLNNDRVIMYDRTDFGASNISLPNGRCRNNPNDLALKVD  85

Query  333  CYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSS  512
            C AHSV  D+ TNS+RPL V TD WCSSG    DGSL+QTGG  DG R  R   PCN+  
Sbjct  86   CTAHSVEYDVSTNSVRPLMVQTDVWCSSGSVNADGSLVQTGGFNDGERMVRVVKPCNT--  143

Query  513  LCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPP--RXGGAVHFPFLGE  686
             CDWQE+    L Q RWY+TN ILPDG  II+GGR A + EF+P           PFL +
Sbjct  144  -CDWQEMGS-NLIQSRWYSTNHILPDGRQIIIGGRKAFNYEFYPKTASTNNVFSLPFLQQ  201

Query  687  VED-RQLDNL  713
              + R+ +NL
Sbjct  202  TNNPREENNL  211



>ref|XP_006383733.1| hypothetical protein POPTR_0005s25690g [Populus trichocarpa]
 gb|ERP61530.1| hypothetical protein POPTR_0005s25690g [Populus trichocarpa]
Length=557

 Score =   178 bits (451),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 96/188 (51%), Positives = 113/188 (60%), Gaps = 4/188 (2%)
 Frame = +3

Query  150  AALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKT  329
            AA  G W+LL  N GI +MH  +   + VV+ DRT+ G S I LP   CRND  + V+K 
Sbjct  29   AAGRGRWQLLQKNIGIVAMHMQLLNNDRVVIYDRTDYGKSNISLPHGKCRNDSWELVIKY  88

Query  330  DCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSS  509
            DC AHSV  D+  N  RPL V T+ WCSSG  +PDGSLIQTGG  DG RK R F PCN  
Sbjct  89   DCTAHSVEYDVLANKFRPLMVQTNVWCSSGAVVPDGSLIQTGGFNDGQRKVRTFYPCNGD  148

Query  510  SLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVH-FPFLGE  686
              CDW E  D  L   RWYATN ILPDG  II+GGR   + EF+P      V+  PFL +
Sbjct  149  --CDWVETGD-GLKARRWYATNHILPDGKQIIIGGRRQFNYEFYPKTSSPDVYSLPFLLQ  205

Query  687  VEDRQLDN  710
              DR  +N
Sbjct  206  TNDRGSEN  213



>ref|XP_009779182.1| PREDICTED: galactose oxidase-like [Nicotiana sylvestris]
Length=596

 Score =   178 bits (452),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 91/185 (49%), Positives = 115/185 (62%), Gaps = 5/185 (3%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            G W LL  + G+++MH  +   N VV+ DRT+ G S + LP   CR   ND  ++ DC A
Sbjct  80   GKWILLQKSIGVSAMHMQLLHNNKVVIFDRTDFGASNLSLPQGQCR--YNDEAIRVDCTA  137

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HS+L D+ TN+ RPL V TD WCSSG   P+G+LIQTGG   G RK R F PCN+   CD
Sbjct  138  HSILYDVATNTYRPLMVTTDVWCSSGAVNPNGTLIQTGGYHAGERKIRLFSPCNNDEHCD  197

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFP--PRXGGAVHFPFLGEVED  695
            W EL    L+  RWY+++ ILPDG VIIVGGR A S EFFP   +  G  + PFL E  D
Sbjct  198  WTELPQ-NLTVKRWYSSDHILPDGRVIIVGGRRAFSYEFFPQNSQNNGIFYLPFLKETTD  256

Query  696  RQLDN  710
             + +N
Sbjct  257  PKEEN  261



>ref|XP_004291826.1| PREDICTED: galactose oxidase-like [Fragaria vesca subsp. vesca]
Length=554

 Score =   177 bits (450),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 88/183 (48%), Positives = 115/183 (63%), Gaps = 6/183 (3%)
 Frame = +3

Query  153  ALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTD  332
            A  G W+LL+PN GI++MH  + + + VV+ DRT+ G S + LP   CRN+ ND  LK D
Sbjct  34   AAGGKWQLLLPNVGISAMHMQLLKNDRVVMFDRTDFGKSNLSLPNGVCRNNPNDTALKVD  93

Query  333  CYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSS  512
            C AHS   D+  N +RPL V +D WCSSG   P G+L+QTGG  DG ++ R + PC   +
Sbjct  94   CTAHSAEYDVAGNKIRPLFVYSDVWCSSGSVNPSGTLVQTGGFNDGEKRVRTYDPC---A  150

Query  513  LCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGG--AVHFPFLGE  686
             CDW+E+E+  L+  RWYATN ILPDG  II+GGR   + EF+P   G   A   PFL E
Sbjct  151  TCDWKEIENA-LTNRRWYATNHILPDGRQIIIGGRRQFNYEFYPKSEGSMNAHSLPFLVE  209

Query  687  VED  695
              D
Sbjct  210  TSD  212



>ref|XP_002510488.1| Galactose oxidase precursor, putative [Ricinus communis]
 gb|EEF52675.1| Galactose oxidase precursor, putative [Ricinus communis]
Length=547

 Score =   177 bits (450),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 115/187 (61%), Gaps = 5/187 (3%)
 Frame = +3

Query  153  ALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTD  332
            A  G W+LL  N GI +MH  +   + VV+ DRT+ G S + LP   CR D  + VLKTD
Sbjct  28   AAGGRWQLLQENIGITAMHMQLLNNDRVVIFDRTDFGLSNLSLPNGKCRKDPTELVLKTD  87

Query  333  CYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSS  512
            C AHSV  D+ +N +R L V T+ WCSSG  +PDGSLIQTGG  DG RK R F PC+S  
Sbjct  88   CTAHSVEYDVLSNQIRALMVQTNVWCSSGAVMPDGSLIQTGGFNDGERKVRTFDPCSS--  145

Query  513  LCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVH-FPFLGEV  689
             CDW EL D  L   RWYATN ILPDG  II+GGR   + EF+P      V+   FL E 
Sbjct  146  -CDWVELGD-GLKARRWYATNHILPDGKQIIIGGRRQFNYEFYPKSAAPDVYSLRFLVET  203

Query  690  EDRQLDN  710
             DR ++N
Sbjct  204  NDRNIEN  210



>gb|KJB29631.1| hypothetical protein B456_005G111300 [Gossypium raimondii]
Length=548

 Score =   177 bits (450),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 93/188 (49%), Positives = 114/188 (61%), Gaps = 5/188 (3%)
 Frame = +3

Query  150  AALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKT  329
            AA  G W+LL  + GI++MH  +   + VV  DRT+ GPS + LP   CR D ND  LK 
Sbjct  29   AAAGGRWQLLQKSIGISAMHMQLLSNDRVVAFDRTDFGPSNLPLPKGKCRFDLNDTALKQ  88

Query  330  DCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSS  509
            DC AHS+  D+ +N  RPL V TD WCSSG   P+G L+QTGG  DG RK R F PC+S 
Sbjct  89   DCTAHSIEYDVLSNKFRPLMVQTDVWCSSGAVTPNGDLVQTGGFNDGERKVRVFSPCSS-  147

Query  510  SLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGG-AVHFPFLGE  686
              CDWQE  +  L+  RWY+TN ILPDG  IIVGGR   + EF P          PFL E
Sbjct  148  --CDWQESNN-GLAARRWYSTNHILPDGRQIIVGGRKQFNYEFVPKNIAANTFDLPFLFE  204

Query  687  VEDRQLDN  710
              DR+++N
Sbjct  205  TNDREVEN  212



>ref|XP_008387970.1| PREDICTED: galactose oxidase-like [Malus domestica]
Length=547

 Score =   177 bits (450),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 93/188 (49%), Positives = 113/188 (60%), Gaps = 6/188 (3%)
 Frame = +3

Query  153  ALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTD  332
            A  G W LL  N GI +MH  +   + VV+ DRT+ G S + LP   CR D ND  LK D
Sbjct  28   AAGGKWVLLQQNIGITAMHLQLLHNDRVVIYDRTDFGMSNLSLPDGKCREDPNDTALKID  87

Query  333  CYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSS  512
            C AHSV  D+ TNS RPL V TD WCSSG   PDG LIQTGG  DG RK R + PCN   
Sbjct  88   CTAHSVEYDVPTNSFRPLMVQTDVWCSSGSISPDGRLIQTGGFNDGERKVRIYEPCNG--  145

Query  513  LCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGA--VHFPFLGE  686
             CDW+E ++  L+  RWYATN ILPDG  II+GGR   + EF+P     +     PFL +
Sbjct  146  -CDWKEYDN-GLAARRWYATNHILPDGRQIIIGGRRQFNYEFYPKSASSSNVYSLPFLVQ  203

Query  687  VEDRQLDN  710
              D +++N
Sbjct  204  TNDAKIEN  211



>ref|XP_009797023.1| PREDICTED: galactose oxidase-like [Nicotiana sylvestris]
Length=551

 Score =   177 bits (450),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 117/190 (62%), Gaps = 7/190 (4%)
 Frame = +3

Query  153  ALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTD  332
            A  G W+LL+ N GI++MH  +   + V++ DRT+ GPS I LP   CRN+ ND  LK D
Sbjct  31   AAGGKWQLLMSNIGISAMHIQLLNNDRVIMYDRTDFGPSNISLPDGKCRNNPNDLALKVD  90

Query  333  CYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSS  512
            C AHSV  D+ TNS+RPL V TD WCSSG    DGSL+QTGG  DG    R   PC   S
Sbjct  91   CTAHSVEYDVSTNSVRPLMVQTDVWCSSGSVNSDGSLVQTGGFNDGEHMVRVVKPC---S  147

Query  513  LCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPP--RXGGAVHFPFLGE  686
             CDWQE+ +  L Q RWY+TN ILPDG  II+GGR A + EF+P           PFL +
Sbjct  148  TCDWQEMGN-NLIQSRWYSTNHILPDGRQIIIGGRKAFNYEFYPKTASTNNVFSLPFLQQ  206

Query  687  VED-RQLDNL  713
              + R+ +NL
Sbjct  207  TNNPREENNL  216



>ref|XP_008781649.1| PREDICTED: uncharacterized protein LOC103701389 [Phoenix dactylifera]
Length=576

 Score =   177 bits (450),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 93/191 (49%), Positives = 118/191 (62%), Gaps = 9/191 (5%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            G W+LL  + GI++MH  +   + VV+ DRT+ GPS I LP   CR+D  D  L  DC A
Sbjct  46   GEWQLLHASIGISAMHMQLLPGDKVVMFDRTDFGPSNISLPGGRCRSDPADLALPIDCTA  105

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HSVLLDL + +LRPLT+L+DTWCSSG  LP+G+L+Q+GG  DG    R F   +   L D
Sbjct  106  HSVLLDLPSAALRPLTLLSDTWCSSGALLPNGTLLQSGGFNDGDHSIRLFDSVSGDPLAD  165

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRX--------GGAVHFPF  677
            WQEL    L+  RWYA++Q+LPDG V+IVGGR   S EFFP +         G    FPF
Sbjct  166  WQELPS-YLAVRRWYASDQLLPDGRVLIVGGRRQFSYEFFPSQESAAGSGGHGALFPFPF  224

Query  678  LGEVEDRQLDN  710
            L E  D   +N
Sbjct  225  LEETRDANAEN  235



>ref|XP_006838081.2| PREDICTED: galactose oxidase [Amborella trichopoda]
Length=527

 Score =   177 bits (448),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 93/186 (50%), Positives = 114/186 (61%), Gaps = 6/186 (3%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            G+WELL  NAGI++MH A+     VV+ DRT+ G S + LPA  CR+D N+  L  DC A
Sbjct  9    GSWELLQENAGISAMHMALLSNGKVVMFDRTDFGKSNLSLPAGRCRSDPNELALTLDCTA  68

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HS   D   NS+RPL V TD WCSSG   PDG LIQTGG  DG    R F PC++   CD
Sbjct  69   HSAEYDPVANSVRPLFVQTDVWCSSGAIAPDGRLIQTGGFNDGDHVVRVFQPCDN---CD  125

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVH--FPFLGEVED  695
            W+E     L+  RWYATNQILPDG +I++GGR   + EF+P     A    F FL E +D
Sbjct  126  WEEFPS-GLAARRWYATNQILPDGRIIVIGGRRQYNYEFYPKSEMTAATFLFRFLAETKD  184

Query  696  RQLDNL  713
               +NL
Sbjct  185  ANENNL  190



>emb|CDY29385.1| BnaA06g14110D [Brassica napus]
Length=505

 Score =   176 bits (447),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 112/170 (66%), Gaps = 3/170 (2%)
 Frame = +3

Query  204  MHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYAHSVLLDLHTNSLRP  383
            MH  + R + VV+ DRTN GPS I LP  +CRN+  DPV K DC AHS+  D+ +N++RP
Sbjct  1    MHMQLLRNDRVVMFDRTNFGPSNISLPNGNCRNNPQDPVSKIDCTAHSIEYDVASNTIRP  60

Query  384  LTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCDWQELEDVQLSQGRW  563
            LTV ++TWCSSG   PDG L+QTGGD DG  K R F PCN+   CDW E+ +  L++ RW
Sbjct  61   LTVQSNTWCSSGSVRPDGVLVQTGGDRDGELKARIFTPCNNKK-CDWIEINN-GLTKRRW  118

Query  564  YATNQILPDGSVIIVGGRTAQSVEFFPPRXG-GAVHFPFLGEVEDRQLDN  710
            Y++N ILPDG+ I++GG+   + EFFP       +  PFL E  DR  +N
Sbjct  119  YSSNHILPDGTQIVIGGQGQFNYEFFPKTTSPNVIALPFLAETNDRGEEN  168



>emb|CDY44816.1| BnaCnng11720D [Brassica napus]
Length=552

 Score =   177 bits (448),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 91/184 (49%), Positives = 114/184 (62%), Gaps = 4/184 (2%)
 Frame = +3

Query  168  WELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYAHS  347
            WE+L+P+ GI++MH  +     V++ DRT+ G S + LP   CR D +D  +K DC AHS
Sbjct  38   WEVLLPSIGISAMHMQLLHNGMVIMFDRTDFGISNLSLPGGMCRFDPSDTAVKFDCSAHS  97

Query  348  VLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCDWQ  527
            VL D+ +N+ R L V TDTWCSSG  LP+G+L+QTGG  DG R  R F PC  S  CDW 
Sbjct  98   VLYDIVSNTYRALKVQTDTWCSSGSVLPNGTLVQTGGYNDGERAARMFTPCGYSETCDWI  157

Query  528  ELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFP-PRXGG--AVHFPFLGEVEDR  698
            E     L+Q RWYATNQILPDG +I+VGGR   + E FP P   G     F FL E  D 
Sbjct  158  EFPQ-YLAQRRWYATNQILPDGRIIVVGGRRQFNFEIFPRPDSHGYRGSRFDFLRETTDG  216

Query  699  QLDN  710
              +N
Sbjct  217  SSEN  220



>ref|NP_191321.1| glyoxal oxidase-related protein [Arabidopsis thaliana]
 emb|CAB41193.1| putative protein [Arabidopsis thaliana]
 gb|AEE79679.1| glyoxal oxidase-related protein [Arabidopsis thaliana]
Length=547

 Score =   177 bits (448),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 104/159 (65%), Gaps = 1/159 (1%)
 Frame = +3

Query  168  WELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYAHS  347
            WE+L+P+ GI++MH  +     V++ DRT+ G S + LP   CR D  D   K DC AHS
Sbjct  37   WEMLLPSIGISAMHMQLLHNGMVIMFDRTDFGTSNVSLPGGICRYDPTDTAEKFDCSAHS  96

Query  348  VLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCDWQ  527
            VL D+ +N+ RPL V TDTWCSSG  LP+G+L+QTGG  DG R  R F PC  S  CDW 
Sbjct  97   VLYDVVSNTYRPLNVQTDTWCSSGAVLPNGTLVQTGGYNDGERAARMFSPCGYSDTCDWI  156

Query  528  ELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFP  644
            E     LSQ RWYATNQILPDG +I+VGGR   + E FP
Sbjct  157  EFPQ-YLSQRRWYATNQILPDGRIIVVGGRRQFNYELFP  194



>ref|XP_003626387.1| Galactose oxidase [Medicago truncatula]
 gb|AES82605.1| glyoxal oxidase amino-terminal protein [Medicago truncatula]
Length=570

 Score =   177 bits (449),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 91/191 (48%), Positives = 116/191 (61%), Gaps = 9/191 (5%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            G WEL+ P  GI++MH  ++  N +++ DRT+ GPS + L    CR D  D  LK DC A
Sbjct  49   GEWELIQPTIGISAMHMQLSHNNKIIIFDRTDFGPSNLPLSNGRCRMDPFDTALKIDCTA  108

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HSVL D+ TN+ R LTV TDTWCSSG  L +G+L+QTGG  DG R+ R F PC + + CD
Sbjct  109  HSVLYDIATNTFRSLTVQTDTWCSSGSVLSNGTLVQTGGFNDGERRIRMFTPCFNEN-CD  167

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPP-------RXGGAVHFPFL  680
            W E     LS+ RWYATNQILPD  +II+GGR   + EF P            ++H  FL
Sbjct  168  WIEFPS-YLSERRWYATNQILPDNRIIIIGGRRQFNYEFIPKTTTSSSSSSSSSIHLSFL  226

Query  681  GEVEDRQLDNL  713
             E  D   +NL
Sbjct  227  QETNDPSENNL  237



>ref|XP_003613586.1| hypothetical protein MTR_5g038410 [Medicago truncatula]
 gb|AES96544.1| glyoxal oxidase amino-terminal protein [Medicago truncatula]
Length=536

 Score =   177 bits (448),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 86/166 (52%), Positives = 109/166 (66%), Gaps = 3/166 (2%)
 Frame = +3

Query  204  MHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYAHSVLLDLHTNSLRP  383
            MH  V + N V++ DRT+ GPS I L  + CR + +D  LK DC AHS+L D+ TN+LRP
Sbjct  1    MHMQVMKDNKVIIFDRTDFGPSNISLSNNRCRYNPHDMALKLDCTAHSILYDITTNTLRP  60

Query  384  LTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCDWQELEDVQLSQGRW  563
            LT+ TD WCSSG   P G+LIQTGG  DG+ K R F PC  ++ CDW+EL+   LS  RW
Sbjct  61   LTLQTDAWCSSGAVSPTGTLIQTGGFNDGYTKLRTFTPCPHNNTCDWEELQQ-NLSSSRW  119

Query  564  YATNQILPDGSVIIVGGRTAQSVEFFPPRXGGA--VHFPFLGEVED  695
            YA+NQILP+G +I+VGGR++ S EF P R   A   H  FL    D
Sbjct  120  YASNQILPNGRIIVVGGRSSFSYEFVPKRLNDASFYHLRFLQLTRD  165



>ref|XP_009408991.1| PREDICTED: galactose oxidase-like [Musa acuminata subsp. malaccensis]
Length=540

 Score =   176 bits (447),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 92/191 (48%), Positives = 115/191 (60%), Gaps = 5/191 (3%)
 Frame = +3

Query  150  AALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKT  329
            AA  G W+LL  + G+++MH  +   + VV+ DRT+ GPS + LP   CRND ND  L  
Sbjct  27   AAGGGEWKLLQHSIGVSAMHMQLLHNDRVVVFDRTDFGPSNLSLPDGRCRNDPNDKALPV  86

Query  330  DCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSS  509
            DC AHS   D+  N+ RPL VLTDTWCSSG   PDG+L+QTGG  DG R  R F PC+  
Sbjct  87   DCTAHSAEYDVVANAFRPLMVLTDTWCSSGSVAPDGTLVQTGGFNDGERAARTFRPCDDG  146

Query  510  SLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFP---PRXGGAVHFPFL  680
            S CDW E     L+  RWYATNQ+LPDG  ++VGGR   + EF+P   P     +   FL
Sbjct  147  S-CDWVETAQA-LAVRRWYATNQVLPDGRAVVVGGRRQFNYEFYPKPDPSDMSTIALRFL  204

Query  681  GEVEDRQLDNL  713
             +  D   DNL
Sbjct  205  QDTRDDVEDNL  215



>ref|XP_011028961.1| PREDICTED: galactose oxidase-like [Populus euphratica]
Length=598

 Score =   177 bits (449),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 96/196 (49%), Positives = 120/196 (61%), Gaps = 5/196 (3%)
 Frame = +3

Query  126  HSTVNPARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRND  305
            H TV    AA  G W+LL  + GI +MH  +   + VV+ DRT+ G S + LP   CRND
Sbjct  69   HRTV--TYAAGGGQWQLLQNSIGITAMHMQLLSNDRVVIYDRTDFGRSNLSLPDGKCRND  126

Query  306  KNDPVLKTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFR  485
             ++ V+K DC AHSV  D+  N  RPL V +D WCSSG  +PDGSLIQTGG  DG RK R
Sbjct  127  SSELVIKYDCSAHSVEYDVLANRFRPLMVQSDVWCSSGAVVPDGSLIQTGGFNDGERKVR  186

Query  486  KFVPCNSSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAV  665
             F PCN +  CDW+E+ D  L   RWYAT+ ILPDG  II+GGR   + EF+P      V
Sbjct  187  IFSPCNGAD-CDWEEVGD-GLKAKRWYATSHILPDGRQIIIGGRRQFNYEFYPKSSAPNV  244

Query  666  H-FPFLGEVEDRQLDN  710
            +   FL E  DR ++N
Sbjct  245  YSLRFLMETNDRGIEN  260



>emb|CDY62245.1| BnaC01g42480D [Brassica napus]
Length=552

 Score =   176 bits (447),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 91/185 (49%), Positives = 115/185 (62%), Gaps = 6/185 (3%)
 Frame = +3

Query  168  WELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYAHS  347
            WE+L+P+ GI++MH  +     V++ DRT+ G S + LP   CR D +D  +K DC AHS
Sbjct  38   WEVLLPSVGISAMHMQLLHNGMVIMFDRTDFGISNLSLPGGMCRFDPSDTAVKFDCSAHS  97

Query  348  VLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCDWQ  527
            VL D+ +N+ R L V TDTWCSSG  LP+G+L+QTGG  DG R  R F PC  S  CDW 
Sbjct  98   VLYDVVSNTYRALKVQTDTWCSSGSVLPNGTLVQTGGYNDGERAARMFTPCGYSETCDWI  157

Query  528  ELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPP----RXGGAVHFPFLGEVED  695
            E     L+Q RWYATNQILPDG +I+VGGR   + E FP     R  G+  F FL E  D
Sbjct  158  EFPQ-YLAQRRWYATNQILPDGRIIVVGGRRQFNFEIFPRPDSHRYRGS-RFDFLRETTD  215

Query  696  RQLDN  710
               +N
Sbjct  216  GSSEN  220



>ref|XP_010105253.1| hypothetical protein L484_019396 [Morus notabilis]
 gb|EXC04188.1| hypothetical protein L484_019396 [Morus notabilis]
Length=548

 Score =   176 bits (447),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 117/186 (63%), Gaps = 5/186 (3%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            G W+ L  + G+++MH  +   + VV+ DRT+ G S + LP   CRND ND  LK DC A
Sbjct  28   GRWQTLQTSIGVSAMHMQLLNTDRVVIFDRTDFGKSNLSLPDGKCRNDPNDTALKIDCTA  87

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HSV  D+ +N+ RPL V TD WCSSG   PDG+L+QTGG  DG R+ R F PC S+  CD
Sbjct  88   HSVEYDVVSNTFRPLMVQTDVWCSSGALTPDGTLVQTGGFNDGERRVRIFKPC-STGGCD  146

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVH---FPFLGEVE  692
            W E+E   L+  RWYAT+ ILPDG VI++GGR   + EF+P     A +    PFL +  
Sbjct  147  WLEIE-FGLAARRWYATDHILPDGQVIVIGGRRQFNYEFYPKTTSSAKNPYSLPFLVQTN  205

Query  693  DRQLDN  710
            D +++N
Sbjct  206  DAKIEN  211



>ref|XP_006849171.2| PREDICTED: galactose oxidase [Amborella trichopoda]
Length=544

 Score =   176 bits (447),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 93/187 (50%), Positives = 117/187 (63%), Gaps = 7/187 (4%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            G W+L+  + GI++MH A+   + V++ DRT+ GPS + LP   CR D +D  L+TDC+A
Sbjct  27   GEWKLMKRSIGISAMHMALLPNDRVIIFDRTDFGPSNVSLPKGRCRKDPHDQALQTDCWA  86

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HSV LDL T+++R LT+ TDTWCSSG   PDG LIQTGG  DG R  R F PC+    CD
Sbjct  87   HSVELDLVTHAVRSLTLQTDTWCSSGALAPDGHLIQTGGFNDGERVVRTFSPCSD---CD  143

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFP---PRXGGAVHFPFLGEVE  692
            W E  D  L+  RWYA+NQILPDG +I+VGGR   S EF P   P         FL E  
Sbjct  144  WAETPD-GLAVRRWYASNQILPDGRIIVVGGRKEFSYEFVPKTDPSEQCTYPLDFLSETR  202

Query  693  DRQLDNL  713
            D   +NL
Sbjct  203  DECENNL  209



>gb|ERN00650.1| hypothetical protein AMTR_s00225p00021580 [Amborella trichopoda]
Length=546

 Score =   176 bits (447),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 93/186 (50%), Positives = 114/186 (61%), Gaps = 6/186 (3%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            G+WELL  NAGI++MH A+     VV+ DRT+ G S + LPA  CR+D N+  L  DC A
Sbjct  28   GSWELLQENAGISAMHMALLSNGKVVMFDRTDFGKSNLSLPAGRCRSDPNELALTLDCTA  87

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HS   D   NS+RPL V TD WCSSG   PDG LIQTGG  DG    R F PC++   CD
Sbjct  88   HSAEYDPVANSVRPLFVQTDVWCSSGAIAPDGRLIQTGGFNDGDHVVRVFQPCDN---CD  144

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVH--FPFLGEVED  695
            W+E     L+  RWYATNQILPDG +I++GGR   + EF+P     A    F FL E +D
Sbjct  145  WEEFPS-GLAARRWYATNQILPDGRIIVIGGRRQYNYEFYPKSEMTAATFLFRFLAETKD  203

Query  696  RQLDNL  713
               +NL
Sbjct  204  ANENNL  209



>ref|XP_009119411.1| PREDICTED: galactose oxidase [Brassica rapa]
Length=552

 Score =   176 bits (447),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 91/184 (49%), Positives = 114/184 (62%), Gaps = 4/184 (2%)
 Frame = +3

Query  168  WELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYAHS  347
            WE+L+P+ GI++MH  +     V++ DRT+ G S + LP   CR D +D  +K DC AHS
Sbjct  38   WEVLLPSIGISAMHMQLLHNGMVIMFDRTDFGISNLSLPGGMCRFDPSDTAVKFDCSAHS  97

Query  348  VLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCDWQ  527
            VL D+ +N+ R L V TDTWCSSG  LP+G+L+QTGG  DG R  R F PC  S  CDW 
Sbjct  98   VLYDVVSNTYRALKVQTDTWCSSGSVLPNGTLVQTGGYNDGERAARMFTPCGYSETCDWI  157

Query  528  ELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFP-PRXGG--AVHFPFLGEVEDR  698
            E     L+Q RWYATNQILPDG +I+VGGR   + E FP P   G     F FL E  D 
Sbjct  158  EFPQ-YLAQRRWYATNQILPDGRIIVVGGRRQFNFEIFPRPDSHGYRGSRFDFLRETTDG  216

Query  699  QLDN  710
              +N
Sbjct  217  SSEN  220



>gb|ERN10752.1| hypothetical protein AMTR_s00027p00177380 [Amborella trichopoda]
Length=557

 Score =   176 bits (447),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 93/187 (50%), Positives = 117/187 (63%), Gaps = 7/187 (4%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            G W+L+  + GI++MH A+   + V++ DRT+ GPS + LP   CR D +D  L+TDC+A
Sbjct  40   GEWKLMKRSIGISAMHMALLPNDRVIIFDRTDFGPSNVSLPKGRCRKDPHDQALQTDCWA  99

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HSV LDL T+++R LT+ TDTWCSSG   PDG LIQTGG  DG R  R F PC+    CD
Sbjct  100  HSVELDLVTHAVRSLTLQTDTWCSSGALAPDGHLIQTGGFNDGERVVRTFSPCSD---CD  156

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFP---PRXGGAVHFPFLGEVE  692
            W E  D  L+  RWYA+NQILPDG +I+VGGR   S EF P   P         FL E  
Sbjct  157  WAETPD-GLAVRRWYASNQILPDGRIIVVGGRKEFSYEFVPKTDPSEQCTYPLDFLSETR  215

Query  693  DRQLDNL  713
            D   +NL
Sbjct  216  DECENNL  222



>ref|XP_009603236.1| PREDICTED: galactose oxidase-like [Nicotiana tomentosiformis]
Length=564

 Score =   176 bits (447),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 93/187 (50%), Positives = 116/187 (62%), Gaps = 7/187 (4%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            G W+LL+ N GI++MH  +   + V++ DRT+ G S I LP   CRN+ ND  LK DC A
Sbjct  47   GKWQLLMSNIGISAMHIQLLNNDRVIMYDRTDFGASNISLPNGKCRNNPNDLALKVDCTA  106

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HSV  D+ TNS+RPL V TD WCSSG    DGSL+QTGG  DG R  R   PC   S CD
Sbjct  107  HSVEYDVSTNSVRPLMVQTDVWCSSGSVNSDGSLVQTGGFNDGERMVRVVKPC---STCD  163

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPP--RXGGAVHFPFLGEVED  695
            WQE+    L Q RWY+TN ILPDG  II+GGR A + EF+P         + PFL +  +
Sbjct  164  WQEMGS-NLIQSRWYSTNHILPDGRQIIIGGRKAFNYEFYPKTASTNNVFNLPFLQQTNN  222

Query  696  -RQLDNL  713
             R+ +NL
Sbjct  223  PREENNL  229



>ref|XP_010271448.1| PREDICTED: galactose oxidase-like [Nelumbo nucifera]
Length=549

 Score =   176 bits (446),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 93/189 (49%), Positives = 113/189 (60%), Gaps = 6/189 (3%)
 Frame = +3

Query  150  AALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKT  329
            AA  G+WELL  + GI++MH  +   + VV+ DRT+ G S + LP   CR D +D VL  
Sbjct  29   AAGRGSWELLQKSIGISAMHMQLLYNDRVVIFDRTDFGKSELALPQGKCRTDPSDTVLTV  88

Query  330  DCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSS  509
            DC AHS   D+ TNS RPL V TD WCSSG   PDG LIQTGG  DG R  R F PCN  
Sbjct  89   DCTAHSAEYDVSTNSFRPLMVQTDVWCSSGVVAPDGRLIQTGGFNDGERSVRMFTPCNG-  147

Query  510  SLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFP--PRXGGAVHFPFLG  683
              CDW+E     L++ RWYATN ILPDG  I++GGR   + EF+P  P        PFL 
Sbjct  148  --CDWEENRSGLLAR-RWYATNHILPDGRSIVIGGRREFNYEFYPKSPSTNKLFSLPFLW  204

Query  684  EVEDRQLDN  710
            E  D  ++N
Sbjct  205  ETNDPGIEN  213



>ref|XP_010263908.1| PREDICTED: galactose oxidase-like [Nelumbo nucifera]
Length=550

 Score =   176 bits (446),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 91/185 (49%), Positives = 114/185 (62%), Gaps = 6/185 (3%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            G W+LL  + GI++MH  +   + VV+ DRT+ G S++ LP   CRND ND VL  DC A
Sbjct  34   GKWDLLQQSIGISAMHMQLLNNDRVVIFDRTDFGESKLPLPDGKCRNDPNDTVLTVDCTA  93

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HS   D+ + S+RPL VLTD WCSSG   PDG LIQTGG  DG    R F PCN    CD
Sbjct  94   HSAEYDVLSKSIRPLMVLTDVWCSSGAVSPDGRLIQTGGFNDGDHAVRIFTPCNG---CD  150

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHF--PFLGEVED  695
            WQE     L++ RWYATN ILPDG  II+GGR   + EF+P      + F  PFL +  D
Sbjct  151  WQENSSGLLAR-RWYATNHILPDGRSIIIGGRRQFNYEFYPKSSSTNILFSLPFLSQTND  209

Query  696  RQLDN  710
             +++N
Sbjct  210  PKIEN  214



>ref|XP_004291825.1| PREDICTED: galactose oxidase-like [Fragaria vesca subsp. vesca]
Length=554

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 87/184 (47%), Positives = 118/184 (64%), Gaps = 8/184 (4%)
 Frame = +3

Query  153  ALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTD  332
            A  G W+LL+PN GI++MH  + + + VV+ DRT+ G S + LP   CRN+ ND  LK D
Sbjct  34   AAGGKWQLLLPNVGISAMHMQLLKNDRVVMFDRTDFGKSNLPLPNGRCRNNPNDTALKVD  93

Query  333  CYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSS  512
            C AHS   D+  N +RPL V +D WCSSG   P G+L+QTGG  DG ++ R + PC   +
Sbjct  94   CTAHSAEYDVAGNKIRPLFVYSDVWCSSGSVNPSGTLVQTGGFNDGEKRVRTYDPC---A  150

Query  513  LCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVH---FPFLG  683
             CDW+E+E+  L+  RWYATN  LPDG  II+GGR   + EF+ P+ GG+++    PFL 
Sbjct  151  TCDWKEIENA-LTNRRWYATNHELPDGRQIIIGGRREFNYEFY-PKSGGSMNAHSLPFLV  208

Query  684  EVED  695
            E  D
Sbjct  209  ETSD  212



>ref|XP_010532190.1| PREDICTED: galactose oxidase [Tarenaya hassleriana]
Length=555

 Score =   176 bits (445),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 89/183 (49%), Positives = 110/183 (60%), Gaps = 3/183 (2%)
 Frame = +3

Query  168  WELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYAHS  347
            W+LL  N GI++MH  +   + V++ DRT+ G S I LP   CR D  D  +K DC AHS
Sbjct  40   WQLLQSNIGISAMHMQLLHNDMVIMFDRTDFGTSNISLPGGLCRYDPYDTAVKFDCTAHS  99

Query  348  VLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCDWQ  527
            V+ D+ +N+ RPL V TDTWCSSG  LP+G+L+QTGG  DG R  R F PC     CDW 
Sbjct  100  VIYDVVSNTYRPLKVQTDTWCSSGSVLPNGTLVQTGGYNDGERVMRMFTPCGYGETCDWI  159

Query  528  ELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGG--AVHFPFLGEVEDRQ  701
            E     L+  RWYATNQILPDG +I+VGGR   + EFFP          F FL E  D  
Sbjct  160  EFPRY-LANRRWYATNQILPDGRIIVVGGRRQFNFEFFPRVQSNIRGFRFDFLRETSDGS  218

Query  702  LDN  710
             +N
Sbjct  219  NEN  221



>ref|XP_007225625.1| hypothetical protein PRUPE_ppa003824mg [Prunus persica]
 gb|EMJ26824.1| hypothetical protein PRUPE_ppa003824mg [Prunus persica]
Length=546

 Score =   175 bits (444),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 114/188 (61%), Gaps = 6/188 (3%)
 Frame = +3

Query  153  ALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTD  332
            A  G W LL  N GI++MH  +   + VVL DRT+ G S + LP   CRND ND VLK D
Sbjct  27   AAGGKWLLLQQNIGISAMHMQLLHNDRVVLFDRTDFGKSNLSLPEGQCRNDPNDTVLKVD  86

Query  333  CYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSS  512
            C AHS   D  TNS RPL V TD WCSSG    DGSLIQTGG  DG R+ R F  C    
Sbjct  87   CTAHSAEYDAPTNSFRPLMVQTDVWCSSGSVAQDGSLIQTGGFNDGERRVRIFQSCTG--  144

Query  513  LCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGA-VH-FPFLGE  686
             CDW+E ++  L+  RWYATN ILPDG  II+GGR   + EF+P     + VH  PFL +
Sbjct  145  -CDWKEYDN-GLAARRWYATNHILPDGRQIIIGGRRQFNYEFYPKSESSSNVHSLPFLVQ  202

Query  687  VEDRQLDN  710
              D +++N
Sbjct  203  TNDPKVEN  210



>ref|XP_009619752.1| PREDICTED: galactose oxidase-like [Nicotiana tomentosiformis]
Length=598

 Score =   176 bits (446),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 91/185 (49%), Positives = 114/185 (62%), Gaps = 5/185 (3%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            G W LL  + G+++MH  +   N VV+ DRT+ G S + LP   CR   ND  ++ DC A
Sbjct  82   GKWILLQKSIGVSAMHMQLLHNNKVVIFDRTDFGASNLSLPQGQCR--YNDEAIRVDCTA  139

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HS+L D+ TN+ RPL V TD WCSSG   P+G+LIQTGG   G RK R F PC +   CD
Sbjct  140  HSILYDVATNTYRPLMVHTDVWCSSGAVNPNGTLIQTGGYHAGERKIRLFSPCINDEHCD  199

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFP--PRXGGAVHFPFLGEVED  695
            W EL    L+  RWYA++ ILPDG VIIVGGR A S EFFP   +  G  + PFL E  D
Sbjct  200  WTELPQ-NLTVKRWYASDHILPDGRVIIVGGRRAFSYEFFPQNSQNNGIFYLPFLKETTD  258

Query  696  RQLDN  710
             + +N
Sbjct  259  PKEEN  263



>ref|XP_004489989.1| PREDICTED: uncharacterized protein LOC101500908 [Cicer arietinum]
Length=599

 Score =   176 bits (445),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 109/163 (67%), Gaps = 1/163 (1%)
 Frame = +3

Query  156  LPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDC  335
            L G W  L  + GI++MH  V + N V++ DRT+ GPS I L   HCR +  D  LK DC
Sbjct  70   LLGHWVQLQTSIGISAMHMQVMKDNKVIIFDRTDFGPSNISLSNGHCRYNPRDISLKLDC  129

Query  336  YAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSL  515
             AHS+L D+ +N+LRPLT+ TD WCSSG    +G+LIQTGG  DG+ K R F PC  ++ 
Sbjct  130  TAHSILYDISSNTLRPLTLQTDAWCSSGALNVNGTLIQTGGFNDGYNKLRTFTPCPQTNN  189

Query  516  CDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFP  644
            CDW EL    L+  RWYA+NQILP+G +I+VGGR++ S EF P
Sbjct  190  CDWNELPQ-NLTSSRWYASNQILPNGRIIVVGGRSSFSYEFVP  231



>ref|XP_010533609.1| PREDICTED: galactose oxidase-like [Tarenaya hassleriana]
Length=559

 Score =   175 bits (444),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/184 (48%), Positives = 115/184 (63%), Gaps = 2/184 (1%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            G W+LL  + GI++MHT + R + VV+ D T+ GPS I L    CR+  ND   K DC A
Sbjct  38   GRWQLLRRSIGISAMHTQLLRNDRVVMFDLTDFGPSNISLSGGKCRHSPNDGASKVDCTA  97

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HSV  D+ +N +RPLT+ ++TWCSSG   PDG+LIQTGG  DG R+ R F PC  +  CD
Sbjct  98   HSVEYDVVSNRVRPLTIRSNTWCSSGSVAPDGTLIQTGGFGDGERRVRMFSPCRKNKYCD  157

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVH-FPFLGEVEDR  698
            W+E+E+  L   RWYA+N +L DG  IIVGGR   S EF+P      V+  PFL +  D 
Sbjct  158  WKEIEN-GLVVRRWYASNHVLSDGRQIIVGGRGQFSFEFYPKTKDPNVYSLPFLAQTNDL  216

Query  699  QLDN  710
              +N
Sbjct  217  GTEN  220



>ref|XP_010041767.1| PREDICTED: galactose oxidase [Eucalyptus grandis]
 gb|KCW84906.1| hypothetical protein EUGRSUZ_B01735 [Eucalyptus grandis]
Length=551

 Score =   175 bits (443),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 103/201 (51%), Positives = 120/201 (60%), Gaps = 8/201 (4%)
 Frame = +3

Query  129  STVNPARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDK  308
            S + P      G W LL P+ GI++MH  + R N VV+ DRT+ GPS I LP   CR D 
Sbjct  23   SEILPFHNGREGEWRLLRPSIGISAMHMQLLRNNKVVVFDRTDFGPSNISLPGGRCRYDS  82

Query  309  NDPVLKTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRK  488
            ND  LK DC AHSVL D+ TNS RPL V TDTWCSSG   P GSL+QTGG  DG    R 
Sbjct  83   NDTALKVDCTAHSVLYDVETNSFRPLMVQTDTWCSSGAVSPGGSLVQTGGFNDGDHAVRI  142

Query  489  FVPCNSSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPR------  650
            F PCN+ S CDW E     LS+ RWYATNQILPDG +II+GGR   + EF+P        
Sbjct  143  FTPCNADS-CDWVEYPGY-LSRRRWYATNQILPDGRIIIIGGRREFNYEFYPKNEDPYSA  200

Query  651  XGGAVHFPFLGEVEDRQLDNL  713
              G+    FL E  D   +NL
Sbjct  201  SSGSFWLQFLLETRDESENNL  221



>ref|XP_006344285.1| PREDICTED: galactose oxidase-like [Solanum tuberosum]
Length=574

 Score =   175 bits (443),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 94/186 (51%), Positives = 112/186 (60%), Gaps = 6/186 (3%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            G W LL  + G+++MH  +   N V++ DRT+ G S + LP   CR D  D VL  DC A
Sbjct  56   GEWVLLHESIGVSAMHMQLLYNNKVIIFDRTDFGASNLSLPQGKCRFD--DEVLDVDCSA  113

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HSVL D+ +N+ RPL V TD WCSSG    DG+LIQTGG   G RK R F PC+    CD
Sbjct  114  HSVLYDILSNTYRPLMVQTDVWCSSGALNSDGTLIQTGGYHAGDRKIRLFSPCDGDVDCD  173

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRX---GGAVHFPFLGEVE  692
            W EL    L+  RWYA++ ILPDG VIIVGGR A S EFFP      GG  H PFL E  
Sbjct  174  WTELPQ-NLTVQRWYASDHILPDGRVIIVGGRKAFSYEFFPKTMDDNGGVFHLPFLVETT  232

Query  693  DRQLDN  710
            D   +N
Sbjct  233  DPMEEN  238



>ref|XP_008221312.1| PREDICTED: galactose oxidase-like [Prunus mume]
Length=546

 Score =   174 bits (442),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 115/188 (61%), Gaps = 6/188 (3%)
 Frame = +3

Query  153  ALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTD  332
            A  G W LL  N GI++MH  +   + VVL DRT+ G S + LP   CRND ND VLK D
Sbjct  27   AAGGKWLLLQQNIGISAMHMQLLHNDRVVLFDRTDFGKSNLSLPKGKCRNDPNDTVLKVD  86

Query  333  CYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSS  512
            C AHS   D+ TNS RPL V TD WCSSG    DGSLIQTGG  DG R+ R F  C    
Sbjct  87   CTAHSAEYDVPTNSFRPLMVQTDVWCSSGSVAQDGSLIQTGGFNDGERRVRIFQSCTG--  144

Query  513  LCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGA-VH-FPFLGE  686
             CDW+E ++  L+  RWYATN ILP+G  II+GGR   + EF+P     + VH  PFL +
Sbjct  145  -CDWKEYDN-GLAARRWYATNHILPEGRQIIIGGRRQFNYEFYPKSESSSNVHSLPFLVQ  202

Query  687  VEDRQLDN  710
              D +++N
Sbjct  203  TNDPKVEN  210



>ref|XP_004252835.1| PREDICTED: galactose oxidase-like [Solanum lycopersicum]
Length=570

 Score =   174 bits (442),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 88/183 (48%), Positives = 117/183 (64%), Gaps = 6/183 (3%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            G+W +L+ + GI++MH  +   + VV+ DRT+ G S I LP   CR D+ND  LK DC A
Sbjct  47   GSWNVLLSDIGISAMHMQLLNNDRVVMFDRTDFGMSNISLPDGKCRYDQNDTTLKVDCTA  106

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSS---S  512
            HSV  ++ +NS+RPL V TD WCSSG   PDGSL+QTGG  DG +  R + PC++S   S
Sbjct  107  HSVEYNVASNSIRPLMVQTDVWCSSGSVFPDGSLVQTGGFNDGDKVVRVYKPCSNSTTNS  166

Query  513  LCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGG--AVHFPFLGE  686
             CDW+E++   L Q RWY+TN ILPDG  II+GGR A + EF+P       +   PFL +
Sbjct  167  TCDWEEIQG-GLIQRRWYSTNHILPDGRQIIIGGRRAFNYEFYPKSASANNSYSLPFLVK  225

Query  687  VED  695
              D
Sbjct  226  TND  228



>ref|XP_006342230.1| PREDICTED: galactose oxidase-like [Solanum tuberosum]
Length=553

 Score =   174 bits (441),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 106/164 (65%), Gaps = 4/164 (2%)
 Frame = +3

Query  153  ALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTD  332
            A  G W+LL+ N GI++MH  +   + V++ DRT+ G S I LP   CRN+  D  LK D
Sbjct  32   AAGGKWDLLMSNIGISAMHMQLLNNDRVIMYDRTDFGASNISLPNGKCRNNPKDLALKVD  91

Query  333  CYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSS  512
            C AHSV  D+ TNS+RPL V TD WCSSG    DG+L+QTGG  DG    R F PC   S
Sbjct  92   CTAHSVEYDVSTNSIRPLMVQTDVWCSSGSATSDGTLVQTGGFNDGRNMVRTFKPC---S  148

Query  513  LCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFP  644
             CDWQE+    L QGRWY+ NQILPDG  II+GGR A + EF+P
Sbjct  149  TCDWQEI-GTGLIQGRWYSANQILPDGRQIIIGGRDAFNYEFYP  191



>ref|XP_011045139.1| PREDICTED: galactose oxidase-like [Populus euphratica]
Length=549

 Score =   174 bits (441),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 92/188 (49%), Positives = 113/188 (60%), Gaps = 4/188 (2%)
 Frame = +3

Query  150  AALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKT  329
            AA  G W+LL  + GI +MH  +   + VV+ DRT+ G S + LP   CR+D ++ V+K 
Sbjct  27   AAGGGRWQLLQKSIGIVAMHMQLLNNDHVVIYDRTDFGRSNLSLPGGKCRDDSSEIVVKH  86

Query  330  DCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSS  509
            DC AHSV  D+  N  RPL V TD WCSSG   PDGSLIQTGG  DG RK R F PC   
Sbjct  87   DCTAHSVDYDVLANKFRPLMVQTDVWCSSGAVFPDGSLIQTGGFSDGERKVRTFYPCKGD  146

Query  510  SLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVH-FPFLGE  686
              CDW E  +  L   RWYATN ILPDG  II+GGR   + EF+P      V+  PFL +
Sbjct  147  --CDWVETGN-GLKAKRWYATNHILPDGKQIIIGGRRQFNYEFYPKTSSPNVYSLPFLLQ  203

Query  687  VEDRQLDN  710
              DR ++N
Sbjct  204  TNDRGIEN  211



>ref|XP_009388162.1| PREDICTED: galactose oxidase-like [Musa acuminata subsp. malaccensis]
Length=544

 Score =   174 bits (441),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 91/198 (46%), Positives = 119/198 (60%), Gaps = 6/198 (3%)
 Frame = +3

Query  132  TVNPARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKN  311
            TV  A AA  G W LL  + G+++MH  +   + VV+ DRT+ GPS + LP   CRND +
Sbjct  17   TVVAATAAGGGQWALLQRSIGVSAMHMQLLHNDRVVVFDRTDFGPSNLSLPVGKCRNDPD  76

Query  312  DPVLKTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKF  491
            +  L+ DC AHSV  D+  N+ RPL +LTD WCSSG   PDG+L+QTGG  DG R  R F
Sbjct  77   EKALRVDCTAHSVEYDVAANTFRPLMLLTDAWCSSGTVAPDGTLVQTGGFNDGERASRTF  136

Query  492  VPCNSSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGA---  662
             PC+    C+W E+    L+  RWYATNQILPDG  I+VGGR   + EF+P     +   
Sbjct  137  RPCDDCR-CNWVEVPQA-LAVRRWYATNQILPDGRAIVVGGRRQFNYEFYPKSPDASDLR  194

Query  663  -VHFPFLGEVEDRQLDNL  713
             +  PFL +  D   +NL
Sbjct  195  TIALPFLRDTRDAVENNL  212



>ref|XP_009335425.1| PREDICTED: galactose oxidase-like [Pyrus x bretschneideri]
Length=547

 Score =   174 bits (441),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 91/188 (48%), Positives = 111/188 (59%), Gaps = 6/188 (3%)
 Frame = +3

Query  153  ALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTD  332
            A  G W LL  N GI +MH  +   + VV+ DRT+ G S + LP   CR D ND  LK D
Sbjct  28   AATGKWVLLQQNIGITAMHMQLLHNDRVVIYDRTDFGMSNLSLPDGKCREDPNDTALKID  87

Query  333  CYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSS  512
            C AHSV  D+ TNS RPL V TD WCSSG   PDG LIQTGG  DG RK R + PC    
Sbjct  88   CTAHSVEYDVPTNSFRPLMVQTDVWCSSGSISPDGRLIQTGGFNDGERKVRIYQPCTG--  145

Query  513  LCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGA--VHFPFLGE  686
             CDW+E ++    + RWYATN ILPDG  II+GGR   + EF+P     +     PFL +
Sbjct  146  -CDWKEYDNGXXXR-RWYATNHILPDGRQIIIGGRRQFNYEFYPKSASSSNVYSLPFLVQ  203

Query  687  VEDRQLDN  710
              D +++N
Sbjct  204  TNDAKIEN  211



>ref|XP_002280559.1| PREDICTED: galactose oxidase [Vitis vinifera]
Length=553

 Score =   174 bits (441),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 91/188 (48%), Positives = 115/188 (61%), Gaps = 6/188 (3%)
 Frame = +3

Query  153  ALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTD  332
            A  G W+LL+ N GI +MH  +   + VV+ DRT+ G S + LP   CRND ND VL  D
Sbjct  35   AAGGEWQLLLKNIGITAMHMQLLHNDRVVIFDRTDFGKSNLSLPDGKCRNDPNDTVLPID  94

Query  333  CYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSS  512
            C AHSV  D+ TNS+R L V TD WCSSG  + +G+LIQTGG  DG R  R F PC+S  
Sbjct  95   CTAHSVEYDVATNSIRALMVQTDVWCSSGAVMANGNLIQTGGFNDGDRVVRIFKPCSS--  152

Query  513  LCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGG--AVHFPFLGE  686
             CDW+E+    L+  RWYATN ILPD   I++GGR   + EF+P       A   PFL +
Sbjct  153  -CDWEEVP-FGLAARRWYATNHILPDDRQIVIGGRRQFNYEFYPKTGAASNAYSLPFLAQ  210

Query  687  VEDRQLDN  710
              DR ++N
Sbjct  211  TNDRGIEN  218



>gb|KHN43222.1| Galactose oxidase [Glycine soja]
Length=457

 Score =   172 bits (436),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 92/189 (49%), Positives = 116/189 (61%), Gaps = 7/189 (4%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            G W L+ P+ GI++MH  +   + +++ DRT+ G S + L    CR D ND  LK DC A
Sbjct  28   GQWNLVQPSVGISAMHMQLLHNDKIIMFDRTDFGHSYLPLSNGRCRMDPNDIALKVDCSA  87

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HSVL D+ TN+LRPL + TDTWCSSG  LP+G+LIQTGG  DG R  R F PC   + CD
Sbjct  88   HSVLYDVPTNTLRPLMIQTDTWCSSGSVLPNGTLIQTGGYNDGERSIRMFTPCFDET-CD  146

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFF-----PPRXGGAVHFPFLGE  686
            W E   + LSQ RWYATNQILPD  VI+VGGR   + EF      P     ++   FL +
Sbjct  147  WVEFPGL-LSQRRWYATNQILPDARVIVVGGRRQFNYEFLPKTPSPNSSPSSIPLNFLQQ  205

Query  687  VEDRQLDNL  713
              DR  +NL
Sbjct  206  TSDRSENNL  214



>ref|XP_007157402.1| hypothetical protein PHAVU_002G066900g [Phaseolus vulgaris]
 gb|ESW29396.1| hypothetical protein PHAVU_002G066900g [Phaseolus vulgaris]
Length=515

 Score =   173 bits (439),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 85/167 (51%), Positives = 105/167 (63%), Gaps = 3/167 (2%)
 Frame = +3

Query  204  MHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYAHSVLLDLHTNSLRP  383
            MH  V   N V++ DRT+ GPS I L  H CR +  D  LK DC AHSVL DL  N+LRP
Sbjct  1    MHMQVMYDNKVLIFDRTDFGPSNISLSHHRCRFNPRDLALKLDCTAHSVLYDLSHNTLRP  60

Query  384  LTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCDWQELEDVQLSQGRW  563
            LT+ TD WCSSG  +PDGSL+QTGG  DG+   R F PC   + CDW+E+ +  LS  RW
Sbjct  61   LTLRTDAWCSSGALVPDGSLLQTGGFNDGYTTLRSFTPCPQHNTCDWREIRNHNLSNSRW  120

Query  564  YATNQILPDGSVIIVGGRTAQSVEFFPPR--XGGAVHF-PFLGEVED  695
            Y++NQILP G +IIVGGR + + EF P       + H+ PFL    D
Sbjct  121  YSSNQILPSGKIIIVGGRNSFTYEFVPKNDVPSSSFHYLPFLKLTRD  167



>ref|XP_007147126.1| hypothetical protein PHAVU_006G098100g [Phaseolus vulgaris]
 gb|ESW19120.1| hypothetical protein PHAVU_006G098100g [Phaseolus vulgaris]
Length=552

 Score =   174 bits (440),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 95/196 (48%), Positives = 116/196 (59%), Gaps = 7/196 (4%)
 Frame = +3

Query  141  PARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPV  320
            P+R A  G W+LL P+ GI+ MH  +   + V++ DRT+ G S + L    CR D  D  
Sbjct  27   PSRFANQGQWQLLHPSIGISPMHMQLLHNDKVIMFDRTDFGHSYLPLSNGRCRMDPFDIA  86

Query  321  LKTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPC  500
            LK DC AHS L D+ TN+LRPL + TDTWCSSG  LP+G+LIQTGG  DG R  R F PC
Sbjct  87   LKLDCSAHSALYDVATNTLRPLMIQTDTWCSSGAVLPNGTLIQTGGYNDGERNIRMFTPC  146

Query  501  NSSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXG-----GAV  665
               + CDW E   + LSQ RWYATNQILPD  VI+VGGR   + EF P          +V
Sbjct  147  FDET-CDWVEFPRL-LSQRRWYATNQILPDARVIVVGGRRQFNYEFLPKTANPNSYPSSV  204

Query  666  HFPFLGEVEDRQLDNL  713
               FL    D   +NL
Sbjct  205  PLNFLQRTSDTSENNL  220



>ref|XP_004238324.1| PREDICTED: galactose oxidase-like [Solanum lycopersicum]
Length=545

 Score =   173 bits (439),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 93/194 (48%), Positives = 118/194 (61%), Gaps = 7/194 (4%)
 Frame = +3

Query  135  VNPARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKND  314
            +N A AA  G W+LL+ N GI++MH  +   + V++ DRT+ G S I LP   CRN+  D
Sbjct  22   LNLANAA-GGKWDLLMSNIGISAMHMQLLNNDRVIIYDRTDFGASNISLPNGKCRNNPKD  80

Query  315  PVLKTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFV  494
              LK DC AHSV  D+ TNS+RPL V TD WCSSG    DG+L+QTGG  DG    R F 
Sbjct  81   LALKIDCTAHSVEYDVSTNSVRPLMVQTDVWCSSGSATADGTLVQTGGFNDGRNMVRTFK  140

Query  495  PCNSSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPP--RXGGAVH  668
            PC   S CDWQE+ +  L Q RWY+TN ILPDGS II+GGR   + EFFP         +
Sbjct  141  PC---STCDWQEIGN-GLIQSRWYSTNHILPDGSQIIIGGRDTFNYEFFPKTASTNKVFN  196

Query  669  FPFLGEVEDRQLDN  710
             PF+ +    + +N
Sbjct  197  LPFIQQTNVPKEEN  210



>emb|CDY45255.1| BnaA06g09250D [Brassica napus]
Length=385

 Score =   170 bits (431),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 91/184 (49%), Positives = 113/184 (61%), Gaps = 8/184 (4%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            G W+LL P+ GI++MH  +   N VV+ DRT+ GPS + LP+  CRN         DC A
Sbjct  39   GRWDLLQPSIGISAMHMQLLHNNKVVIFDRTDYGPSNLSLPSQTCRN-----ATVFDCSA  93

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HS+L D+ +N+ RPLT+ +DTWCSSG     GSLIQTGG   G R  R F PC   S CD
Sbjct  94   HSLLYDVASNTFRPLTLQSDTWCSSGSLNASGSLIQTGGYGVGERAVRIFTPCEGVS-CD  152

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAV-HFPFLGEVEDR  698
            W E     LS  RWY+TNQILPDG +IIVGGR A + EF+P   G +V +  FL E  D 
Sbjct  153  WVE-NRAYLSSRRWYSTNQILPDGRIIIVGGRRAFTYEFYPKNPGKSVFYLRFLAETRDP  211

Query  699  QLDN  710
              +N
Sbjct  212  NEEN  215



>ref|XP_002512263.1| Galactose oxidase precursor, putative [Ricinus communis]
 gb|EEF49715.1| Galactose oxidase precursor, putative [Ricinus communis]
Length=533

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/190 (46%), Positives = 110/190 (58%), Gaps = 3/190 (2%)
 Frame = +3

Query  141  PARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPV  320
            P+     G W  L  N GI +MH  +   N V++ DRT+ G S + LP   CR+D  D  
Sbjct  27   PSYPGRQGEWNQLQSNIGITAMHMQLLHDNKVIIYDRTDFGRSNVSLPHRRCRHDSRDQA  86

Query  321  LKTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPC  500
            L+ DC AH++L DL TNS RPLT+ TD WCSS   +P+G+LIQTGG  DG    R F  C
Sbjct  87   LEVDCTAHTILYDLDTNSFRPLTIQTDVWCSSASVIPNGTLIQTGGYNDGDHVMRSFTSC  146

Query  501  NSSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRXGGAVHFPFL  680
             +   CDW E  D  L + RWYA+NQILPDG +IIVGGR A + EF+ P         FL
Sbjct  147  LNDD-CDWIEFRDY-LRERRWYASNQILPDGRIIIVGGRRAYTYEFY-PSVSRTFWLSFL  203

Query  681  GEVEDRQLDN  710
             E  D   +N
Sbjct  204  RETRDGNSEN  213



>ref|XP_009606830.1| PREDICTED: galactose oxidase [Nicotiana tomentosiformis]
Length=556

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/191 (45%), Positives = 115/191 (60%), Gaps = 4/191 (2%)
 Frame = +3

Query  144  ARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVL  323
            +R+ + G W LL  + G+++MH  + R N VV+ DRT+ G S + LP   CR D +D V+
Sbjct  28   SRSGIEGEWRLLHESIGVSAMHMQLLRNNKVVIFDRTDFGRSNLSLPGGRCRYDSHDLVI  87

Query  324  KTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCN  503
            + DC AHSVL D+ +N+ RPL V TDTWCSSG  LPDG+L+QTGG  DG    R   PC 
Sbjct  88   REDCSAHSVLYDVGSNTFRPLMVQTDTWCSSGAVLPDGTLVQTGGYNDGDHIIRTLAPCT  147

Query  504  SSSLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFP--PRXGGAVHFPF  677
              + CDW E     L Q RWY+T+ ILPD  +I++GGR   + EF+P  P    A    F
Sbjct  148  GEN-CDWVEFPRT-LIQRRWYSTDHILPDARIIVIGGRNQHNYEFYPKNPSSFSAFWLQF  205

Query  678  LGEVEDRQLDN  710
            L +  D   +N
Sbjct  206  LSDTRDGDNEN  216



>gb|EPS72896.1| hypothetical protein M569_01859, partial [Genlisea aurea]
Length=516

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 93/185 (50%), Positives = 115/185 (62%), Gaps = 3/185 (2%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            G W LL  + GI++MH  +   + VV+ DRT+ GPS + LP   CR D ++ V K DC A
Sbjct  4    GEWRLLQRSIGISAMHMQLLNDDRVVVFDRTDFGPSNLSLPNGRCRYDSHEMVSKKDCTA  63

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HSVL D+ +N+ R LTV TD WCSSG  LP+G+L+Q GG  DG +  R   PC S   CD
Sbjct  64   HSVLYDVSSNTFRALTVQTDPWCSSGAVLPNGTLLQIGGFNDGAQTVRMQSPC-SGGDCD  122

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFPPRX-GGAVHFPFLGEVEDR  698
            W E   V LS+ RWYAT QILPDG VI+VGGR   S EF+P R   G+  F FL E  D 
Sbjct  123  WVEFPRV-LSRRRWYATAQILPDGDVIVVGGRREYSYEFWPRRSDSGSFEFDFLRETSDD  181

Query  699  QLDNL  713
              +NL
Sbjct  182  SENNL  186



>ref|XP_002468154.1| hypothetical protein SORBIDRAFT_01g040550 [Sorghum bicolor]
 gb|EER95152.1| hypothetical protein SORBIDRAFT_01g040550 [Sorghum bicolor]
Length=585

 Score =   172 bits (437),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 90/200 (45%), Positives = 118/200 (59%), Gaps = 8/200 (4%)
 Frame = +3

Query  135  VNPARAALPGTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKND  314
            + PA  A  G W+LL  + G+++MH  +   + V++ DRT+ G S + LP  HCR +  +
Sbjct  37   IAPASGAGGGRWDLLQRSIGVSAMHMQLLHNDRVIIFDRTDFGSSNLSLPDGHCRVNPRE  96

Query  315  PVL-KTDCYAHSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKF  491
             VL + DC AHS   D+  N+ RPL+V TDTWCSS    PDG+L+QTGG  DGFR  R  
Sbjct  97   RVLPRGDCTAHSAEYDVAANAFRPLSVFTDTWCSSATVAPDGTLVQTGGWNDGFRNARTM  156

Query  492  VPCNSS---SLCDWQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFFP---PRX  653
              C  +     CDW E +DV L+  RWYATNQILPDG   IVGGR   + EF+P   P  
Sbjct  157  PACGGTGDDKSCDWSEKQDV-LAANRWYATNQILPDGRAFIVGGRRQFNYEFYPKAGPSD  215

Query  654  GGAVHFPFLGEVEDRQLDNL  713
               V  PFL   +D + +NL
Sbjct  216  TSVVQMPFLARTKDPEENNL  235



>ref|XP_003553749.1| PREDICTED: galactose oxidase-like [Glycine max]
Length=552

 Score =   172 bits (435),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 92/189 (49%), Positives = 116/189 (61%), Gaps = 7/189 (4%)
 Frame = +3

Query  162  GTWELLVPNAGIASMHTAVTRFNTVVLLDRTNIGPSRIRLPAHHCRNDKNDPVLKTDCYA  341
            G W L+ P+ GI++MH  +   + +++ DRT+ G S + L    CR D ND  LK DC A
Sbjct  34   GQWNLVQPSVGISAMHMQLLHNDKIIMFDRTDFGHSYLPLSNGRCRMDPNDIALKVDCSA  93

Query  342  HSVLLDLHTNSLRPLTVLTDTWCSSGQFLPDGSLIQTGGDLDGFRKFRKFVPCNSSSLCD  521
            HSVL D+ TN+LRPL + TDTWCSSG  LP+G+LIQTGG  DG R  R F PC   + CD
Sbjct  94   HSVLYDVPTNTLRPLMIQTDTWCSSGSVLPNGTLIQTGGYNDGERSIRMFTPCFDET-CD  152

Query  522  WQELEDVQLSQGRWYATNQILPDGSVIIVGGRTAQSVEFF-----PPRXGGAVHFPFLGE  686
            W E   + LSQ RWYATNQILPD  VI+VGGR   + EF      P     ++   FL +
Sbjct  153  WVEFPGL-LSQRRWYATNQILPDARVIVVGGRRQFNYEFLPKTPSPNSSPSSIPLNFLQQ  211

Query  687  VEDRQLDNL  713
              DR  +NL
Sbjct  212  TSDRSENNL  220



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1281324548632