BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig2363

Length=690
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009621368.1|  PREDICTED: sucrose nonfermenting 4-like prot...    183   4e-51   Nicotiana tomentosiformis
ref|XP_009621367.1|  PREDICTED: sucrose nonfermenting 4-like prot...    183   8e-51   Nicotiana tomentosiformis
ref|XP_009801936.1|  PREDICTED: sucrose nonfermenting 4-like prot...    180   4e-50   Nicotiana sylvestris
ref|XP_009801935.1|  PREDICTED: sucrose nonfermenting 4-like prot...    180   1e-49   Nicotiana sylvestris
ref|XP_006342753.1|  PREDICTED: sucrose nonfermenting 4-like prot...    169   2e-45   Solanum tuberosum [potatoes]
ref|XP_011090936.1|  PREDICTED: sucrose nonfermenting 4-like protein    169   2e-45   Sesamum indicum [beniseed]
ref|XP_004229201.1|  PREDICTED: sucrose nonfermenting 4-like protein    166   2e-44   Solanum lycopersicum
ref|XP_011071458.1|  PREDICTED: sucrose nonfermenting 4-like protein    164   1e-43   Sesamum indicum [beniseed]
ref|XP_009393223.1|  PREDICTED: sucrose nonfermenting 4-like prot...    144   3e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009393220.1|  PREDICTED: sucrose nonfermenting 4-like prot...    143   3e-36   
emb|CDO98887.1|  unnamed protein product                                139   9e-35   Coffea canephora [robusta coffee]
gb|KDO75160.1|  hypothetical protein CISIN_1g010368mg                   133   1e-32   Citrus sinensis [apfelsine]
ref|XP_009369133.1|  PREDICTED: sucrose nonfermenting 4-like prot...    133   1e-32   Pyrus x bretschneideri [bai li]
gb|KDO75156.1|  hypothetical protein CISIN_1g010368mg                   133   1e-32   Citrus sinensis [apfelsine]
gb|KDO75157.1|  hypothetical protein CISIN_1g010368mg                   133   1e-32   Citrus sinensis [apfelsine]
ref|XP_006419618.1|  hypothetical protein CICLE_v10004799mg             133   1e-32   Citrus clementina [clementine]
gb|KDO75154.1|  hypothetical protein CISIN_1g010368mg                   133   1e-32   Citrus sinensis [apfelsine]
ref|XP_006489115.1|  PREDICTED: sucrose nonfermenting 4-like prot...    133   2e-32   Citrus sinensis [apfelsine]
ref|XP_010659865.1|  PREDICTED: sucrose nonfermenting 4-like prot...    132   2e-32   Vitis vinifera
ref|XP_010269446.1|  PREDICTED: sucrose nonfermenting 4-like prot...    133   2e-32   Nelumbo nucifera [Indian lotus]
ref|XP_010269444.1|  PREDICTED: sucrose nonfermenting 4-like prot...    133   2e-32   Nelumbo nucifera [Indian lotus]
ref|XP_009339832.1|  PREDICTED: sucrose nonfermenting 4-like prot...    132   2e-32   Pyrus x bretschneideri [bai li]
ref|XP_003633645.1|  PREDICTED: sucrose nonfermenting 4-like prot...    132   3e-32   Vitis vinifera
ref|XP_006419619.1|  hypothetical protein CICLE_v10004799mg             132   3e-32   
gb|KDO75159.1|  hypothetical protein CISIN_1g010368mg                   132   3e-32   Citrus sinensis [apfelsine]
gb|KDO56293.1|  hypothetical protein CISIN_1g011558mg                   129   3e-32   Citrus sinensis [apfelsine]
gb|KDO56292.1|  hypothetical protein CISIN_1g011558mg                   129   5e-32   Citrus sinensis [apfelsine]
ref|XP_007222344.1|  hypothetical protein PRUPE_ppa004800mg             131   6e-32   Prunus persica
ref|XP_002274373.1|  PREDICTED: sucrose nonfermenting 4-like prot...    131   8e-32   Vitis vinifera
gb|KDO56289.1|  hypothetical protein CISIN_1g011558mg                   130   9e-32   Citrus sinensis [apfelsine]
ref|XP_008223131.1|  PREDICTED: sucrose nonfermenting 4-like prot...    130   9e-32   Prunus mume [ume]
ref|XP_006433349.1|  hypothetical protein CICLE_v10000984mg             130   1e-31   Citrus clementina [clementine]
ref|XP_004494609.1|  PREDICTED: sucrose nonfermenting 4-like prot...    130   1e-31   Cicer arietinum [garbanzo]
ref|XP_004494610.1|  PREDICTED: sucrose nonfermenting 4-like prot...    130   1e-31   
gb|KDO56290.1|  hypothetical protein CISIN_1g011558mg                   129   1e-31   Citrus sinensis [apfelsine]
ref|XP_011462705.1|  PREDICTED: sucrose nonfermenting 4-like prot...    130   1e-31   Fragaria vesca subsp. vesca
ref|XP_007030947.1|  Sucrose nonfermenting 4                            130   2e-31   
ref|XP_003533466.1|  PREDICTED: sucrose nonfermenting 4-like prot...    129   3e-31   Glycine max [soybeans]
ref|XP_006586934.1|  PREDICTED: sucrose nonfermenting 4-like prot...    129   3e-31   Glycine max [soybeans]
ref|XP_006597748.1|  PREDICTED: sucrose nonfermenting 4-like prot...    129   3e-31   
ref|XP_003546378.1|  PREDICTED: sucrose nonfermenting 4-like prot...    129   3e-31   Glycine max [soybeans]
gb|KHN47756.1|  Sucrose nonfermenting 4-like protein                    129   4e-31   Glycine soja [wild soybean]
ref|XP_006597745.1|  PREDICTED: sucrose nonfermenting 4-like prot...    129   4e-31   Glycine max [soybeans]
ref|XP_009352236.1|  PREDICTED: sucrose nonfermenting 4-like prot...    129   5e-31   Pyrus x bretschneideri [bai li]
ref|XP_010931608.1|  PREDICTED: sucrose nonfermenting 4-like prot...    129   5e-31   Elaeis guineensis
ref|XP_009369131.1|  PREDICTED: sucrose nonfermenting 4-like prot...    129   5e-31   Pyrus x bretschneideri [bai li]
ref|XP_009412087.1|  PREDICTED: sucrose nonfermenting 4-like protein    129   5e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010931609.1|  PREDICTED: sucrose nonfermenting 4-like prot...    128   6e-31   Elaeis guineensis
ref|XP_009369134.1|  PREDICTED: sucrose nonfermenting 4-like prot...    128   6e-31   
ref|XP_009369135.1|  PREDICTED: sucrose nonfermenting 4-like prot...    128   6e-31   
ref|XP_010931610.1|  PREDICTED: sucrose nonfermenting 4-like prot...    128   7e-31   Elaeis guineensis
ref|XP_009381016.1|  PREDICTED: sucrose nonfermenting 4-like protein    128   8e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009339830.1|  PREDICTED: sucrose nonfermenting 4-like prot...    128   8e-31   Pyrus x bretschneideri [bai li]
gb|KHN26574.1|  Sucrose nonfermenting 4-like protein                    128   1e-30   Glycine soja [wild soybean]
gb|EPS59669.1|  hypothetical protein M569_15136                         119   1e-30   Genlisea aurea
ref|XP_002512390.1|  AMP-activated protein kinase, gamma regulato...    127   2e-30   
ref|XP_004508285.1|  PREDICTED: sucrose nonfermenting 4-like prot...    126   3e-30   Cicer arietinum [garbanzo]
ref|XP_008813368.1|  PREDICTED: sucrose nonfermenting 4-like prot...    126   4e-30   Phoenix dactylifera
ref|XP_010097911.1|  hypothetical protein L484_001432                   120   4e-30   
ref|XP_008813370.1|  PREDICTED: sucrose nonfermenting 4-like prot...    126   4e-30   Phoenix dactylifera
ref|XP_010904802.1|  PREDICTED: sucrose nonfermenting 4-like prot...    126   4e-30   
ref|XP_008223130.1|  PREDICTED: sucrose nonfermenting 4-like prot...    126   4e-30   Prunus mume [ume]
gb|KEH15993.1|  sucrose nonfermenting-like protein                      125   4e-30   Medicago truncatula
ref|XP_009384402.1|  PREDICTED: sucrose nonfermenting 4-like prot...    125   5e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009384403.1|  PREDICTED: sucrose nonfermenting 4-like prot...    125   5e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008458476.1|  PREDICTED: sucrose nonfermenting 4-like protein    126   5e-30   Cucumis melo [Oriental melon]
ref|XP_011657174.1|  PREDICTED: sucrose nonfermenting 4-like protein    126   5e-30   Cucumis sativus [cucumbers]
ref|XP_009384400.1|  PREDICTED: sucrose nonfermenting 4-like prot...    125   5e-30   
gb|KEH15992.1|  sucrose nonfermenting-like protein                      125   5e-30   Medicago truncatula
ref|XP_010904800.1|  PREDICTED: sucrose nonfermenting 4-like prot...    125   6e-30   Elaeis guineensis
ref|XP_004296819.1|  PREDICTED: sucrose nonfermenting 4-like prot...    125   6e-30   Fragaria vesca subsp. vesca
gb|KEH32279.1|  sucrose nonfermenting-like protein                      125   6e-30   Medicago truncatula
gb|AES91833.2|  sucrose nonfermenting-like protein                      125   7e-30   Medicago truncatula
gb|KEH32278.1|  sucrose nonfermenting-like protein                      125   8e-30   Medicago truncatula
ref|XP_006344633.1|  PREDICTED: sucrose nonfermenting 4-like prot...    125   1e-29   Solanum tuberosum [potatoes]
ref|XP_002892477.1|  hypothetical protein ARALYDRAFT_470981             125   1e-29   
ref|XP_012069369.1|  PREDICTED: sucrose nonfermenting 4-like protein    125   1e-29   Jatropha curcas
ref|NP_563834.1|  putative activator subunit of SNF1-related prot...    125   1e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006417620.1|  hypothetical protein EUTSA_v10007484mg             125   1e-29   Eutrema salsugineum [saltwater cress]
gb|KHG04900.1|  Sucrose nonfermenting 4-like protein                    125   1e-29   Gossypium arboreum [tree cotton]
gb|ABA12451.1|  AKINbetagammaI                                          124   1e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011087405.1|  PREDICTED: sucrose nonfermenting 4-like protein    124   1e-29   Sesamum indicum [beniseed]
ref|XP_006584037.1|  PREDICTED: sucrose nonfermenting 4-like prot...    124   1e-29   Glycine max [soybeans]
gb|KFK43205.1|  hypothetical protein AALP_AA1G093900                    124   1e-29   Arabis alpina [alpine rockcress]
emb|CDY32146.1|  BnaCnng06550D                                          124   2e-29   Brassica napus [oilseed rape]
ref|XP_002516895.1|  AMP-activated protein kinase, gamma regulato...    124   2e-29   
ref|XP_012089045.1|  PREDICTED: sucrose nonfermenting 4-like prot...    124   2e-29   Jatropha curcas
gb|KHN20226.1|  Sucrose nonfermenting 4-like protein                    124   2e-29   Glycine soja [wild soybean]
ref|XP_010259697.1|  PREDICTED: sucrose nonfermenting 4-like prot...    124   2e-29   Nelumbo nucifera [Indian lotus]
ref|XP_003555605.1|  PREDICTED: sucrose nonfermenting 4-like prot...    124   2e-29   Glycine max [soybeans]
ref|XP_009352235.1|  PREDICTED: sucrose nonfermenting 4-like prot...    124   2e-29   Pyrus x bretschneideri [bai li]
ref|XP_010259698.1|  PREDICTED: sucrose nonfermenting 4-like prot...    124   2e-29   Nelumbo nucifera [Indian lotus]
ref|XP_012089047.1|  PREDICTED: sucrose nonfermenting 4-like prot...    124   2e-29   
ref|XP_007138886.1|  hypothetical protein PHAVU_009G246000g             124   2e-29   Phaseolus vulgaris [French bean]
ref|XP_010458170.1|  PREDICTED: sucrose nonfermenting 4-like protein    124   2e-29   Camelina sativa [gold-of-pleasure]
ref|XP_007154249.1|  hypothetical protein PHAVU_003G103000g             124   3e-29   Phaseolus vulgaris [French bean]
ref|XP_010475723.1|  PREDICTED: sucrose nonfermenting 4-like prot...    124   3e-29   Camelina sativa [gold-of-pleasure]
ref|XP_006307328.1|  hypothetical protein CARUB_v10008946mg             124   3e-29   
ref|XP_010489630.1|  PREDICTED: sucrose nonfermenting 4-like protein    124   3e-29   Camelina sativa [gold-of-pleasure]
ref|XP_006307327.1|  hypothetical protein CARUB_v10008946mg             124   3e-29   
ref|XP_006307326.1|  hypothetical protein CARUB_v10008946mg             123   3e-29   
gb|KJB26425.1|  hypothetical protein B456_004G240500                    123   3e-29   Gossypium raimondii
ref|XP_010475724.1|  PREDICTED: sucrose nonfermenting 4-like prot...    123   3e-29   Camelina sativa [gold-of-pleasure]
ref|XP_012089044.1|  PREDICTED: sucrose nonfermenting 4-like prot...    123   4e-29   Jatropha curcas
gb|KHF98317.1|  Sucrose nonfermenting 4-like protein                    123   4e-29   Gossypium arboreum [tree cotton]
gb|KJB26424.1|  hypothetical protein B456_004G240500                    123   4e-29   Gossypium raimondii
emb|CDY06344.1|  BnaA09g48590D                                          123   5e-29   
ref|XP_003550198.1|  PREDICTED: sucrose nonfermenting 4-like prot...    123   5e-29   Glycine max [soybeans]
ref|XP_003609636.1|  5'-AMP-activated protein kinase subunit gamma      123   6e-29   
gb|KJB45988.1|  hypothetical protein B456_007G342100                    122   6e-29   Gossypium raimondii
ref|XP_009791916.1|  PREDICTED: sucrose nonfermenting 4-like protein    122   6e-29   Nicotiana sylvestris
emb|CDY31116.1|  BnaA08g26660D                                          122   7e-29   Brassica napus [oilseed rape]
gb|AGA95983.1|  sucrose non-fermenting 4                                122   7e-29   Brassica rapa subsp. pekinensis [bai cai]
gb|KJB45989.1|  hypothetical protein B456_007G342100                    122   7e-29   Gossypium raimondii
gb|KJB45263.1|  hypothetical protein B456_007G298100                    122   8e-29   Gossypium raimondii
ref|XP_007144724.1|  hypothetical protein PHAVU_007G179400g             122   8e-29   Phaseolus vulgaris [French bean]
gb|KJB45265.1|  hypothetical protein B456_007G298100                    122   8e-29   Gossypium raimondii
gb|KJB45264.1|  hypothetical protein B456_007G298100                    122   8e-29   Gossypium raimondii
ref|XP_009588179.1|  PREDICTED: sucrose nonfermenting 4-like protein    122   9e-29   Nicotiana tomentosiformis
ref|XP_011627434.1|  PREDICTED: sucrose nonfermenting 4-like prot...    122   1e-28   Amborella trichopoda
ref|XP_006855487.1|  PREDICTED: sucrose nonfermenting 4-like prot...    122   1e-28   Amborella trichopoda
ref|NP_001051949.1|  Os03g0856400                                       121   2e-28   
emb|CDX95016.1|  BnaC05g06550D                                          121   2e-28   
emb|CDP15501.1|  unnamed protein product                                121   2e-28   Coffea canephora [robusta coffee]
ref|XP_010921763.1|  PREDICTED: sucrose nonfermenting 4-like prot...    121   3e-28   Elaeis guineensis
ref|XP_010921766.1|  PREDICTED: sucrose nonfermenting 4-like prot...    120   3e-28   Elaeis guineensis
ref|XP_008789953.1|  PREDICTED: sucrose nonfermenting 4-like protein    121   3e-28   
ref|XP_010921764.1|  PREDICTED: sucrose nonfermenting 4-like prot...    120   3e-28   Elaeis guineensis
ref|XP_010921762.1|  PREDICTED: sucrose nonfermenting 4-like prot...    121   3e-28   Elaeis guineensis
ref|XP_010921768.1|  PREDICTED: sucrose nonfermenting 4-like prot...    120   3e-28   
ref|XP_010921765.1|  PREDICTED: sucrose nonfermenting 4-like prot...    120   3e-28   Elaeis guineensis
ref|XP_009148157.1|  PREDICTED: sucrose nonfermenting 4-like protein    120   3e-28   Brassica rapa
emb|CDX93522.1|  BnaA06g05260D                                          120   4e-28   
gb|KHG04062.1|  Sucrose nonfermenting 4-like protein                    121   4e-28   Gossypium arboreum [tree cotton]
ref|XP_009387023.1|  PREDICTED: sucrose nonfermenting 4-like prot...    120   4e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009387018.1|  PREDICTED: sucrose nonfermenting 4-like prot...    120   4e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008388557.1|  PREDICTED: sucrose nonfermenting 4-like protein    120   5e-28   
ref|XP_004302417.1|  PREDICTED: sucrose nonfermenting 4-like protein    120   5e-28   Fragaria vesca subsp. vesca
ref|XP_006650929.1|  PREDICTED: sucrose nonfermenting 4-like prot...    120   6e-28   Oryza brachyantha
emb|CDY22651.1|  BnaC08g42850D                                          120   6e-28   Brassica napus [oilseed rape]
ref|XP_010674700.1|  PREDICTED: sucrose nonfermenting 4-like protein    119   9e-28   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010938454.1|  PREDICTED: sucrose nonfermenting 4-like protein    119   9e-28   Elaeis guineensis
gb|KDP40000.1|  hypothetical protein JCGZ_01998                         119   1e-27   Jatropha curcas
ref|XP_004230211.1|  PREDICTED: sucrose nonfermenting 4-like protein    119   1e-27   Solanum lycopersicum
gb|AAO61673.1|  AKIN betagamma                                          119   1e-27   Medicago truncatula
ref|XP_003626272.1|  5'-AMP-activated protein kinase subunit beta-1     119   1e-27   Medicago truncatula
ref|NP_001105555.1|  protein kinase AKINbetagamma-2                     118   3e-27   
gb|ACN35851.1|  unknown                                                 118   3e-27   Zea mays [maize]
ref|XP_008648222.1|  PREDICTED: AKINbetagamma-1 protein kinase is...    118   3e-27   
ref|NP_001105005.1|  AKINbetagamma-1 protein kinase                     118   3e-27   
ref|XP_002466066.1|  hypothetical protein SORBIDRAFT_01g000600          118   3e-27   
gb|AFW66924.1|  hypothetical protein ZEAMMB73_799257                    117   3e-27   
ref|XP_003559740.1|  PREDICTED: sucrose nonfermenting 4-like protein    118   3e-27   Brachypodium distachyon [annual false brome]
ref|XP_007205127.1|  hypothetical protein PRUPE_ppa004966mg             117   4e-27   Prunus persica
dbj|BAK02043.1|  predicted protein                                      117   7e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAO51911.1|  SnRK1 beta-gamma subunit                               117   7e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008802115.1|  PREDICTED: sucrose nonfermenting 4-like protein    117   8e-27   
ref|XP_010024670.1|  PREDICTED: sucrose nonfermenting 4-like prot...    116   1e-26   Eucalyptus grandis [rose gum]
ref|XP_010024669.1|  PREDICTED: sucrose nonfermenting 4-like prot...    116   1e-26   Eucalyptus grandis [rose gum]
ref|XP_012089046.1|  PREDICTED: sucrose nonfermenting 4-like prot...    115   2e-26   
ref|XP_008370464.1|  PREDICTED: sucrose nonfermenting 4-like prot...    112   3e-26   
ref|XP_008370463.1|  PREDICTED: sucrose nonfermenting 4-like prot...    112   3e-26   
ref|XP_008246396.1|  PREDICTED: sucrose nonfermenting 4-like protein    115   3e-26   Prunus mume [ume]
ref|XP_003521702.1|  PREDICTED: sucrose nonfermenting 4-like prot...    114   4e-26   Glycine max [soybeans]
ref|XP_007147040.1|  hypothetical protein PHAVU_006G091100g             114   9e-26   Phaseolus vulgaris [French bean]
ref|XP_010528890.1|  PREDICTED: sucrose nonfermenting 4-like prot...    114   9e-26   Tarenaya hassleriana [spider flower]
ref|XP_010549766.1|  PREDICTED: sucrose nonfermenting 4-like prot...    113   1e-25   Tarenaya hassleriana [spider flower]
ref|XP_004980982.1|  PREDICTED: sucrose nonfermenting 4-like prot...    113   1e-25   Setaria italica
ref|XP_003554656.1|  PREDICTED: sucrose nonfermenting 4-like prot...    113   1e-25   Glycine max [soybeans]
ref|XP_010524503.1|  PREDICTED: sucrose nonfermenting 4-like protein    113   2e-25   Tarenaya hassleriana [spider flower]
gb|KHN43289.1|  Sucrose nonfermenting 4-like protein                    113   2e-25   Glycine soja [wild soybean]
ref|XP_008223132.1|  PREDICTED: sucrose nonfermenting 4-like prot...    112   3e-25   Prunus mume [ume]
ref|XP_010098308.1|  Sucrose nonfermenting 4-like protein               111   7e-25   Morus notabilis
ref|XP_010551058.1|  PREDICTED: sucrose nonfermenting 4-like protein    110   1e-24   Tarenaya hassleriana [spider flower]
gb|KJB72644.1|  hypothetical protein B456_011G188600                    106   3e-23   Gossypium raimondii
ref|XP_004293513.1|  PREDICTED: sucrose nonfermenting 4-like protein    107   3e-23   Fragaria vesca subsp. vesca
gb|KJB72643.1|  hypothetical protein B456_011G188600                    106   4e-23   Gossypium raimondii
gb|KHG02417.1|  Sucrose nonfermenting 4-like protein                    107   4e-23   Gossypium arboreum [tree cotton]
gb|KJB72641.1|  hypothetical protein B456_011G188600                    106   4e-23   Gossypium raimondii
gb|KJB72638.1|  hypothetical protein B456_011G188600                    106   4e-23   Gossypium raimondii
gb|KHG20472.1|  Sucrose nonfermenting 4-like protein                    105   8e-23   Gossypium arboreum [tree cotton]
ref|XP_007035544.1|  Sucrose nonfermenting 4                            105   1e-22   
ref|XP_009376652.1|  PREDICTED: sucrose nonfermenting 4-like prot...    105   1e-22   Pyrus x bretschneideri [bai li]
ref|XP_009376653.1|  PREDICTED: sucrose nonfermenting 4-like prot...    105   1e-22   Pyrus x bretschneideri [bai li]
ref|XP_011014797.1|  PREDICTED: sucrose nonfermenting 4-like prot...    103   2e-22   Populus euphratica
ref|XP_011014792.1|  PREDICTED: sucrose nonfermenting 4-like prot...    103   3e-22   Populus euphratica
ref|XP_006380178.1|  hypothetical protein POPTR_0008s22640g             103   4e-22   Populus trichocarpa [western balsam poplar]
ref|XP_011044505.1|  PREDICTED: sucrose nonfermenting 4-like prot...    103   5e-22   Populus euphratica
ref|XP_011044506.1|  PREDICTED: sucrose nonfermenting 4-like prot...    102   6e-22   Populus euphratica
gb|KJB38630.1|  hypothetical protein B456_006G264100                    102   9e-22   Gossypium raimondii
ref|XP_002314455.2|  hypothetical protein POPTR_0010s02420g             102   9e-22   
gb|KHG18811.1|  Sucrose nonfermenting 4-like protein                    102   1e-21   Gossypium arboreum [tree cotton]
gb|KJB28629.1|  hypothetical protein B456_005G059200                    100   4e-21   Gossypium raimondii
gb|KDD72481.1|  hypothetical protein H632_c3290p0                     94.7    7e-21   Helicosporidium sp. ATCC 50920
ref|XP_006382512.1|  kinase family protein                            98.6    3e-20   Populus trichocarpa [western balsam poplar]
ref|XP_001770299.1|  predicted protein                                98.6    3e-20   
ref|XP_004496022.1|  PREDICTED: sucrose nonfermenting 4-like prot...  98.6    3e-20   
gb|KHG30800.1|  Sucrose nonfermenting 4-like protein                  94.7    6e-20   Gossypium arboreum [tree cotton]
ref|XP_002953462.1|  hypothetical protein VOLCADRAFT_63727            95.5    3e-19   Volvox carteri f. nagariensis
ref|XP_011036820.1|  PREDICTED: sucrose nonfermenting 4-like protein  95.5    3e-19   Populus euphratica
ref|XP_002319007.1|  kinase family protein                            95.1    5e-19   
ref|XP_011399865.1|  5'-AMP-activated protein kinase subunit gamma-1  95.5    6e-19   Auxenochlorella protothecoides
gb|EYU45566.1|  hypothetical protein MIMGU_mgv1a006371mg              94.0    8e-19   Erythranthe guttata [common monkey flower]
ref|XP_001703192.1|  hypothetical protein CHLREDRAFT_140612           93.6    2e-18   Chlamydomonas reinhardtii
ref|XP_011023639.1|  PREDICTED: sucrose nonfermenting 4-like protein  93.6    2e-18   Populus euphratica
ref|XP_003058117.1|  carbohydrate-binding module family 48 protein    91.3    1e-17   Micromonas pusilla CCMP1545
ref|XP_002499707.1|  carbohydrate-binding module family 48 protein    90.9    2e-17   Micromonas commoda
ref|XP_002991688.1|  hypothetical protein SELMODRAFT_161836           89.7    4e-17   Selaginella moellendorffii
ref|XP_002991046.1|  hypothetical protein SELMODRAFT_229585           89.7    4e-17   Selaginella moellendorffii
ref|XP_007510428.1|  predicted protein                                88.2    3e-16   Bathycoccus prasinos
ref|XP_009604836.1|  PREDICTED: sucrose nonfermenting 4-like prot...  84.7    1e-15   Nicotiana tomentosiformis
ref|XP_009604835.1|  PREDICTED: sucrose nonfermenting 4-like prot...  85.1    2e-15   Nicotiana tomentosiformis
ref|XP_009604831.1|  PREDICTED: sucrose nonfermenting 4-like prot...  85.1    2e-15   Nicotiana tomentosiformis
ref|XP_003081623.1|  protein kinase, putative (ISS)                   85.1    2e-15   
emb|CEF99376.1|  CBS domain                                           85.1    2e-15   Ostreococcus tauri
gb|AFW58138.1|  hypothetical protein ZEAMMB73_812855                  81.3    3e-15   
ref|XP_003591122.1|  5'-AMP-activated protein kinase subunit beta-1   84.3    3e-15   
gb|AES61373.2|  sucrose nonfermenting-like protein                    84.0    3e-15   Medicago truncatula
ref|XP_008668068.1|  PREDICTED: SNF4 isoform X1                       83.2    6e-15   Zea mays [maize]
ref|XP_008661809.1|  PREDICTED: uncharacterized protein LOC100279...  82.0    1e-14   Zea mays [maize]
ref|XP_008661808.1|  PREDICTED: uncharacterized protein LOC100279...  82.4    1e-14   
ref|XP_010249337.1|  PREDICTED: sucrose nonfermenting 4-like prot...  82.0    2e-14   Nelumbo nucifera [Indian lotus]
ref|XP_010528891.1|  PREDICTED: sucrose nonfermenting 4-like prot...  81.6    2e-14   Tarenaya hassleriana [spider flower]
ref|XP_011073279.1|  PREDICTED: sucrose nonfermenting 4-like protein  81.6    2e-14   Sesamum indicum [beniseed]
ref|XP_009778508.1|  PREDICTED: sucrose nonfermenting 4-like prot...  80.5    3e-14   Nicotiana sylvestris
ref|XP_009778504.1|  PREDICTED: sucrose nonfermenting 4-like prot...  80.9    4e-14   Nicotiana sylvestris
ref|XP_009778507.1|  PREDICTED: sucrose nonfermenting 4-like prot...  80.5    4e-14   Nicotiana sylvestris
ref|XP_009778502.1|  PREDICTED: sucrose nonfermenting 4-like prot...  80.9    4e-14   Nicotiana sylvestris
ref|XP_004975479.1|  PREDICTED: sucrose nonfermenting 4-like prot...  79.3    1e-13   Setaria italica
ref|XP_006341460.1|  PREDICTED: sucrose nonfermenting 4-like prot...  77.8    3e-13   
ref|XP_006341457.1|  PREDICTED: sucrose nonfermenting 4-like prot...  78.2    3e-13   Solanum tuberosum [potatoes]
ref|XP_004235851.1|  PREDICTED: sucrose nonfermenting 4-like prot...  77.8    4e-13   
ref|XP_010249336.1|  PREDICTED: sucrose nonfermenting 4-like prot...  77.8    4e-13   Nelumbo nucifera [Indian lotus]
ref|XP_010942338.1|  PREDICTED: sucrose nonfermenting 4-like prot...  77.4    5e-13   Elaeis guineensis
ref|XP_010942339.1|  PREDICTED: sucrose nonfermenting 4-like prot...  77.4    5e-13   Elaeis guineensis
ref|XP_010921767.1|  PREDICTED: sucrose nonfermenting 4-like prot...  77.0    7e-13   
ref|XP_005650760.1|  hypothetical protein COCSUDRAFT_46541            77.4    1e-12   Coccomyxa subellipsoidea C-169
emb|CCD59754.1|  5-AMP-activated protein kinase , beta subunit,pu...  73.6    3e-12   Schistosoma mansoni
dbj|BAJ98914.1|  predicted protein                                    73.2    3e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011263621.1|  PREDICTED: 5'-AMP-activated protein kinase s...  71.2    4e-12   
ref|XP_001419967.1|  predicted protein                                74.7    5e-12   Ostreococcus lucimarinus CCE9901
gb|EFX67948.1|  putative AMP-activated protein kinase beta non-ca...  72.8    5e-12   Daphnia pulex
ref|XP_008776278.1|  PREDICTED: sucrose nonfermenting 4-like protein  74.3    6e-12   Phoenix dactylifera
emb|CAH66402.1|  OSIGBa0155K12.5                                      73.9    6e-12   Oryza sativa [red rice]
gb|EAY93966.1|  hypothetical protein OsI_15744                        73.9    7e-12   Oryza sativa Indica Group [Indian rice]
emb|CAD40779.1|  OSJNBb0012E08.3                                      73.9    7e-12   Oryza sativa Japonica Group [Japonica rice]
gb|KJB28630.1|  hypothetical protein B456_005G059200                  73.6    8e-12   Gossypium raimondii
gb|EFN63325.1|  5'-AMP-activated protein kinase subunit beta-1        70.9    1e-11   Camponotus floridanus
ref|XP_003579641.1|  PREDICTED: sucrose nonfermenting 4-like protein  73.6    1e-11   Brachypodium distachyon [annual false brome]
ref|XP_011648266.1|  PREDICTED: 5'-AMP-activated protein kinase s...  71.6    1e-11   Pogonomyrmex barbatus
ref|XP_011648265.1|  PREDICTED: 5'-AMP-activated protein kinase s...  71.6    2e-11   Pogonomyrmex barbatus
ref|XP_011141680.1|  PREDICTED: 5'-AMP-activated protein kinase s...  71.6    2e-11   Harpegnathos saltator
ref|XP_003402479.1|  PREDICTED: 5'-AMP-activated protein kinase s...  71.6    2e-11   Bombus terrestris [large earth bumblebee]
ref|XP_011165960.1|  PREDICTED: 5'-AMP-activated protein kinase s...  71.2    2e-11   Solenopsis invicta [imported red fire ant]
ref|XP_011351639.1|  PREDICTED: 5'-AMP-activated protein kinase s...  71.2    2e-11   Ooceraea biroi
ref|XP_011165958.1|  PREDICTED: 5'-AMP-activated protein kinase s...  71.2    2e-11   Solenopsis invicta [imported red fire ant]
ref|XP_011686658.1|  PREDICTED: 5'-AMP-activated protein kinase s...  71.2    2e-11   Wasmannia auropunctata
ref|XP_002059935.1|  GJ15118                                          72.0    2e-11   Drosophila virilis
ref|XP_003689967.1|  PREDICTED: 5'-AMP-activated protein kinase s...  71.2    2e-11   Apis florea [dwarf honeybee]
ref|XP_012134975.1|  PREDICTED: 5'-AMP-activated protein kinase s...  71.2    2e-11   Megachile rotundata
ref|XP_006611839.1|  PREDICTED: 5'-AMP-activated protein kinase s...  71.2    2e-11   Apis dorsata [rock honeybee]
ref|XP_011871899.1|  PREDICTED: 5'-AMP-activated protein kinase s...  71.2    2e-11   Vollenhovia emeryi
ref|XP_012056387.1|  PREDICTED: 5'-AMP-activated protein kinase s...  71.2    2e-11   Atta cephalotes
ref|XP_393160.1|  PREDICTED: 5'-AMP-activated protein kinase subu...  71.2    2e-11   Apis mellifera [bee]
ref|XP_011066455.1|  PREDICTED: 5'-AMP-activated protein kinase s...  71.2    2e-11   Acromyrmex echinatior
gb|EGI57827.1|  5'-AMP-activated protein kinase subunit beta-2        71.2    2e-11   Acromyrmex echinatior
sp|P80387.1|AAKB1_PIG  RecName: Full=5'-AMP-activated protein kin...  68.6    2e-11   Sus scrofa [pigs]
pdb|1Z0M|A  Chain A, The Glycogen-Binding Domain Of The Amp-Activ...  68.2    2e-11   Rattus norvegicus [brown rat]
dbj|GAA50585.1|  5'-AMP-activated protein kinase regulatory beta ...  71.2    3e-11   Clonorchis sinensis [oriental liver fluke]
ref|XP_006267071.1|  PREDICTED: 5'-AMP-activated protein kinase s...  70.5    3e-11   Alligator mississippiensis
ref|XP_006027434.1|  PREDICTED: 5'-AMP-activated protein kinase s...  70.5    3e-11   
ref|XP_011307699.1|  PREDICTED: 5'-AMP-activated protein kinase s...  70.5    4e-11   Fopius arisanus
ref|XP_009174364.1|  hypothetical protein T265_09888                  71.2    4e-11   Opisthorchis viverrini [Southeast Asian liver fluke]
ref|XP_002004495.1|  GI19965                                          70.9    4e-11   Drosophila mojavensis
ref|XP_011501101.1|  PREDICTED: 5'-AMP-activated protein kinase s...  70.1    4e-11   Ceratosolen solmsi marchali
ref|XP_011871897.1|  PREDICTED: 5'-AMP-activated protein kinase s...  70.9    5e-11   Vollenhovia emeryi
ref|XP_011871898.1|  PREDICTED: 5'-AMP-activated protein kinase s...  70.9    6e-11   Vollenhovia emeryi
ref|XP_011501100.1|  PREDICTED: 5'-AMP-activated protein kinase s...  70.1    7e-11   Ceratosolen solmsi marchali
emb|CDO98288.1|  unnamed protein product                              70.9    7e-11   Coffea canephora [robusta coffee]
pdb|1Z0N|A  Chain A, The Glycogen-Binding Domain Of The Amp-Activ...  66.6    7e-11   
dbj|BAM18690.1|  5-AMP-activated protein kinase                       67.8    1e-10   
gb|ABC70455.1|  AMPK-activated protein kinase beta-1 subunit          68.6    1e-10   
ref|XP_007620808.1|  PREDICTED: 5'-AMP-activated protein kinase s...  68.6    1e-10   
ref|XP_007620810.1|  PREDICTED: 5'-AMP-activated protein kinase s...  68.6    1e-10   
ref|XP_005842864.1|  hypothetical protein CHLNCDRAFT_142561           70.5    1e-10   
ref|NP_001157430.1|  5'-AMP-activated protein kinase subunit beta-1   68.9    1e-10   
gb|KGB38003.1|  5'-AMP-activated protein kinase subunit beta-1        69.7    1e-10   
ref|XP_010307414.1|  PREDICTED: 5'-AMP-activated protein kinase s...  68.6    1e-10   
pdb|4QFG|B  Chain B, Structure Of Ampk In Complex With Staurospor...  67.8    1e-10   
ref|XP_003419314.1|  PREDICTED: 5'-AMP-activated protein kinase s...  68.6    1e-10   
ref|XP_009685797.1|  PREDICTED: 5'-AMP-activated protein kinase s...  68.6    2e-10   
ref|XP_010307415.1|  PREDICTED: 5'-AMP-activated protein kinase s...  68.6    2e-10   
dbj|BAE32089.1|  unnamed protein product                              68.6    2e-10   
ref|XP_003495959.1|  PREDICTED: 5'-AMP-activated protein kinase s...  68.6    2e-10   
ref|XP_003932243.1|  PREDICTED: 5'-AMP-activated protein kinase s...  68.6    2e-10   
ref|XP_005612604.1|  PREDICTED: 5'-AMP-activated protein kinase s...  68.6    2e-10   
ref|XP_011819803.1|  PREDICTED: 5'-AMP-activated protein kinase s...  68.6    2e-10   
ref|XP_007643335.1|  PREDICTED: 5'-AMP-activated protein kinase s...  68.6    2e-10   
gb|AAF14222.1|AF108215_1  5'-AMP-activated protein kinase beta su...  68.6    2e-10   
ref|NP_114075.1|  5'-AMP-activated protein kinase subunit beta-1      68.6    2e-10   
ref|NP_114182.1|  5'-AMP-activated protein kinase subunit beta-1      68.6    2e-10   
ref|XP_006249543.1|  PREDICTED: 5'-AMP-activated protein kinase s...  68.6    2e-10   
gb|EWS74006.1|  5'-AMP-activated kinase protein                       68.9    2e-10   
ref|XP_005670719.1|  PREDICTED: 5'-AMP-activated protein kinase s...  68.2    2e-10   
ref|NP_001230550.1|  5'-AMP-activated protein kinase subunit beta-1   68.2    2e-10   
ref|XP_006865516.1|  PREDICTED: 5'-AMP-activated protein kinase s...  68.2    2e-10   
ref|XP_007440099.1|  PREDICTED: 5'-AMP-activated protein kinase s...  68.2    2e-10   
ref|XP_007093604.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.4    2e-10   
ref|XP_002107791.1|  hypothetical protein TRIADDRAFT_16636            66.6    2e-10   
ref|XP_010718766.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.4    3e-10   
ref|XP_006192760.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.4    3e-10   
ref|XP_005288764.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.8    3e-10   
ref|XP_011566160.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.4    3e-10   
ref|XP_011566161.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.4    3e-10   
gb|KDR14603.1|  5'-AMP-activated protein kinase subunit beta-1        67.8    3e-10   
dbj|BAG62754.1|  unnamed protein product                              67.0    3e-10   
ref|XP_011762213.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.4    3e-10   
ref|XP_007115489.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.4    4e-10   
ref|XP_010602376.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.4    4e-10   
ref|XP_007528697.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.4    4e-10   
gb|AAX27372.2|  SJCHGC06409 protein                                   68.2    4e-10   
ref|XP_010223382.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.4    4e-10   
ref|XP_008822639.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.4    4e-10   
ref|XP_006204862.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.4    4e-10   
gb|EHJ76458.1|  AMP-activated protein kinase beta subunit             67.8    4e-10   
ref|XP_007115490.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.4    4e-10   
ref|XP_543421.2|  PREDICTED: 5'-AMP-activated protein kinase subu...  67.4    4e-10   
ref|XP_006739484.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.4    4e-10   
ref|XP_004429982.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.4    4e-10   
ref|XP_003478394.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.4    4e-10   
ref|XP_010967864.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.4    4e-10   
ref|XP_004753403.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.4    4e-10   
ref|XP_004888215.1|  PREDICTED: LOW QUALITY PROTEIN: 5'-AMP-activ...  67.4    4e-10   
ref|XP_004597846.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.4    4e-10   
ref|XP_005026699.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.4    4e-10   
ref|XP_005572435.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.0    4e-10   
gb|AAC98897.1|  5'-AMP-activated protein kinase beta-1                67.0    4e-10   
ref|XP_006890478.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.4    4e-10   
ref|XP_007464928.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.4    4e-10   
gb|KFP23743.1|  5'-AMP-activated protein kinase subunit beta-1        66.6    4e-10   
ref|XP_004276795.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.4    4e-10   
ref|XP_004611129.1|  PREDICTED: 5'-AMP-activated protein kinase s...  66.6    4e-10   
ref|XP_010366577.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.0    4e-10   
ref|XP_007189550.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.4    4e-10   
ref|XP_009947961.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.4    4e-10   
ref|XP_004691050.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.4    4e-10   
ref|NP_001035001.1|  5'-AMP-activated protein kinase subunit beta-1   67.4    4e-10   
dbj|BAG35397.1|  unnamed protein product                              67.4    4e-10   
emb|CAA12024.1|  AMP-activated protein kinase, beta 1 subunit         67.4    4e-10   
pdb|4CFE|B  Chain B, Structure Of Full Length Human Ampk In Compl...  67.4    4e-10   
ref|XP_007189551.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.0    4e-10   
ref|XP_003789975.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.4    4e-10   
emb|CAA73146.1|  5'-AMP-activated protein kinase beta-1               67.4    4e-10   
ref|XP_003280008.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.4    4e-10   
gb|ELR55203.1|  5'-AMP-activated protein kinase subunit beta-1        67.4    4e-10   
ref|XP_006908665.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.4    4e-10   
gb|EFB19633.1|  hypothetical protein PANDA_008368                     67.0    5e-10   
ref|XP_011354156.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.4    5e-10   
ref|XP_001846099.1|  AMPK-beta subunit                                67.4    5e-10   
gb|KJB72637.1|  hypothetical protein B456_011G188600                  68.6    5e-10   
ref|NP_001126231.1|  5'-AMP-activated protein kinase subunit beta-1   67.4    5e-10   
ref|XP_007936402.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.4    5e-10   
gb|AAD09237.1|  AMP-activated protein kinase beta subunit             67.4    5e-10   
ref|NP_001103403.1|  AMP-activated protein kinase beta subunit        67.4    5e-10   
ref|NP_006244.2|  5'-AMP-activated protein kinase subunit beta-1      67.0    5e-10   
ref|XP_002919718.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.0    5e-10   
ref|XP_010366576.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.0    5e-10   
ref|XP_008575072.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.0    5e-10   
ref|NP_001019729.1|  5'-AMP-activated protein kinase subunit beta-1   67.0    5e-10   
ref|XP_005691509.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.0    5e-10   
ref|XP_004636297.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.0    5e-10   
gb|AAB71326.1|  AMP-activated protein kinase beta; 95% similar to...  67.4    5e-10   
ref|XP_004017423.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.0    5e-10   
ref|XP_002199491.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.0    5e-10   
ref|XP_009947959.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.4    5e-10   
ref|XP_010207396.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.0    5e-10   
gb|ELW63854.1|  5'-AMP-activated protein kinase subunit beta-1        66.6    5e-10   
ref|XP_002719846.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.0    5e-10   
ref|XP_007115488.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.0    5e-10   
ref|XP_006151614.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.0    5e-10   
gb|KFQ34570.1|  5'-AMP-activated protein kinase subunit beta-1        66.2    5e-10   
ref|XP_010181605.1|  PREDICTED: 5'-AMP-activated protein kinase s...  66.2    5e-10   
ref|XP_005524473.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.0    6e-10   
ref|XP_005421533.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.0    6e-10   
ref|XP_008140991.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.0    6e-10   
ref|XP_005493512.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.0    6e-10   
ref|XP_006096619.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.0    6e-10   
ref|XP_004709618.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.0    6e-10   
ref|XP_005524474.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.0    6e-10   
ref|XP_009504274.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.0    6e-10   
ref|XP_005421534.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.0    6e-10   
ref|XP_011551610.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.0    6e-10   
ref|XP_009504275.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.0    6e-10   
ref|XP_011551609.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.0    6e-10   
ref|XP_005863872.1|  PREDICTED: 5'-AMP-activated protein kinase s...  66.6    6e-10   
ref|XP_004664081.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.4    6e-10   
ref|XP_004464736.1|  PREDICTED: 5'-AMP-activated protein kinase s...  66.6    7e-10   
ref|XP_011762214.1|  PREDICTED: 5'-AMP-activated protein kinase s...  66.2    7e-10   
ref|XP_010003139.1|  PREDICTED: 5'-AMP-activated protein kinase s...  66.6    7e-10   
ref|XP_009564874.1|  PREDICTED: 5'-AMP-activated protein kinase s...  66.6    7e-10   
ref|XP_008501044.1|  PREDICTED: 5'-AMP-activated protein kinase s...  66.6    7e-10   
ref|XP_009564865.1|  PREDICTED: 5'-AMP-activated protein kinase s...  66.6    7e-10   
ref|XP_001604284.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.0    7e-10   
ref|XP_009462002.1|  PREDICTED: 5'-AMP-activated protein kinase s...  66.6    7e-10   
ref|XP_010003138.1|  PREDICTED: 5'-AMP-activated protein kinase s...  66.6    7e-10   
ref|XP_008501043.1|  PREDICTED: 5'-AMP-activated protein kinase s...  66.6    7e-10   
ref|XP_010285128.1|  PREDICTED: 5'-AMP-activated protein kinase s...  66.6    7e-10   
ref|XP_010075264.1|  PREDICTED: 5'-AMP-activated protein kinase s...  66.6    7e-10   
ref|XP_009886902.1|  PREDICTED: 5'-AMP-activated protein kinase s...  66.6    7e-10   
ref|XP_009907947.1|  PREDICTED: 5'-AMP-activated protein kinase s...  66.6    7e-10   
ref|XP_009968116.1|  PREDICTED: 5'-AMP-activated protein kinase s...  66.6    7e-10   
ref|XP_010018201.1|  PREDICTED: 5'-AMP-activated protein kinase s...  66.6    7e-10   
ref|XP_010119776.1|  PREDICTED: 5'-AMP-activated protein kinase s...  66.6    7e-10   
ref|XP_009484216.1|  PREDICTED: 5'-AMP-activated protein kinase s...  66.6    7e-10   
ref|XP_009462001.1|  PREDICTED: 5'-AMP-activated protein kinase s...  66.6    7e-10   
gb|KFQ86232.1|  5'-AMP-activated protein kinase subunit beta-1        66.6    7e-10   
ref|XP_009920278.1|  PREDICTED: 5'-AMP-activated protein kinase s...  66.6    7e-10   
ref|XP_005233274.1|  PREDICTED: 5'-AMP-activated protein kinase s...  66.6    7e-10   
ref|XP_009985761.1|  PREDICTED: 5'-AMP-activated protein kinase s...  66.6    7e-10   
ref|XP_010119774.1|  PREDICTED: 5'-AMP-activated protein kinase s...  66.6    8e-10   
ref|XP_009641133.1|  PREDICTED: 5'-AMP-activated protein kinase s...  66.6    8e-10   
ref|XP_009329096.1|  PREDICTED: 5'-AMP-activated protein kinase s...  66.6    8e-10   
ref|XP_005147877.1|  PREDICTED: 5'-AMP-activated protein kinase s...  66.6    8e-10   
gb|KFW71954.1|  5'-AMP-activated protein kinase subunit beta-1        66.6    8e-10   
ref|XP_010075263.1|  PREDICTED: 5'-AMP-activated protein kinase s...  66.6    8e-10   
ref|XP_011450447.1|  PREDICTED: 5'-AMP-activated protein kinase s...  66.6    8e-10   
gb|AAX20151.1|  AMPK-beta subunit                                     67.0    8e-10   
ref|XP_009820087.1|  PREDICTED: 5'-AMP-activated protein kinase s...  66.6    8e-10   
ref|XP_001654986.1|  AAEL002216-PB                                    67.0    8e-10   
ref|XP_010018200.1|  PREDICTED: 5'-AMP-activated protein kinase s...  66.6    8e-10   
ref|XP_009886901.1|  PREDICTED: 5'-AMP-activated protein kinase s...  66.6    8e-10   
ref|XP_009968115.1|  PREDICTED: 5'-AMP-activated protein kinase s...  66.6    8e-10   
ref|XP_005147878.1|  PREDICTED: 5'-AMP-activated protein kinase s...  66.6    8e-10   
ref|XP_009484215.1|  PREDICTED: 5'-AMP-activated protein kinase s...  66.6    8e-10   
ref|XP_001654987.1|  AAEL002216-PA                                    66.6    8e-10   
ref|XP_008933322.1|  PREDICTED: 5'-AMP-activated protein kinase s...  66.6    8e-10   
ref|XP_005233275.1|  PREDICTED: 5'-AMP-activated protein kinase s...  66.6    8e-10   
ref|XP_010173179.1|  PREDICTED: 5'-AMP-activated protein kinase s...  66.6    8e-10   
ref|XP_009866586.1|  PREDICTED: 5'-AMP-activated protein kinase s...  66.6    8e-10   
ref|XP_009580035.1|  PREDICTED: 5'-AMP-activated protein kinase s...  66.6    8e-10   
ref|XP_010285126.1|  PREDICTED: 5'-AMP-activated protein kinase s...  66.6    8e-10   
ref|XP_010173178.1|  PREDICTED: 5'-AMP-activated protein kinase s...  66.6    8e-10   
ref|XP_009866578.1|  PREDICTED: 5'-AMP-activated protein kinase s...  66.6    8e-10   
ref|XP_010133291.1|  PREDICTED: 5'-AMP-activated protein kinase s...  66.6    8e-10   
ref|XP_010133290.1|  PREDICTED: 5'-AMP-activated protein kinase s...  66.6    8e-10   
ref|XP_009907946.1|  PREDICTED: 5'-AMP-activated protein kinase s...  66.6    8e-10   
ref|XP_009935035.1|  PREDICTED: 5'-AMP-activated protein kinase s...  66.6    8e-10   
ref|XP_009985753.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.0    8e-10   
ref|XP_009580034.1|  PREDICTED: 5'-AMP-activated protein kinase s...  67.0    9e-10   
ref|XP_009920279.1|  PREDICTED: 5'-AMP-activated protein kinase s...  66.2    9e-10   
ref|XP_009285792.1|  PREDICTED: 5'-AMP-activated protein kinase s...  66.6    9e-10   
ref|XP_005513189.1|  PREDICTED: 5'-AMP-activated protein kinase s...  66.6    1e-09   
ref|XP_010396353.1|  PREDICTED: 5'-AMP-activated protein kinase s...  66.2    1e-09   
ref|XP_005513188.1|  PREDICTED: 5'-AMP-activated protein kinase s...  66.6    1e-09   
ref|XP_008639860.1|  PREDICTED: 5'-AMP-activated protein kinase s...  66.2    1e-09   
emb|CDS32620.1|  AMPK beta subunit                                    67.0    1e-09   
ref|XP_008639859.1|  PREDICTED: 5'-AMP-activated protein kinase s...  66.2    1e-09   
gb|EFA86476.1|  putative glycoside hydrolase                          67.0    1e-09   
ref|XP_004333402.1|  AMP-activated protein kinase, putative           65.9    1e-09   
ref|XP_009080076.1|  PREDICTED: 5'-AMP-activated protein kinase s...  66.2    1e-09   
gb|EPY74958.1|  5-AMP-activated protein kinase subunit beta-1         67.4    1e-09   
ref|XP_009080077.1|  PREDICTED: 5'-AMP-activated protein kinase s...  66.2    1e-09   
ref|XP_003226038.1|  PREDICTED: 5'-AMP-activated protein kinase s...  65.9    1e-09   
ref|XP_004464735.1|  PREDICTED: 5'-AMP-activated protein kinase s...  66.2    1e-09   
dbj|BAN20433.1|  5-AMP-activated protein kinase, beta subunit         65.9    1e-09   
ref|XP_004334197.1|  AMPactivated protein kinase, putative            67.0    1e-09   
gb|AER10554.1|  AMP-activated protein kinase beta subunit             66.2    2e-09   
ref|XP_008924024.1|  PREDICTED: 5'-AMP-activated protein kinase s...  65.9    2e-09   
ref|XP_008924023.1|  PREDICTED: 5'-AMP-activated protein kinase s...  65.9    2e-09   
gb|EPQ06218.1|  5'-AMP-activated protein kinase subunit beta-1        66.6    2e-09   
ref|XP_004464734.1|  PREDICTED: 5'-AMP-activated protein kinase s...  65.9    2e-09   
gb|KFB38717.1|  hypothetical protein ZHAS_00006119                    65.9    2e-09   
gb|AER10555.1|  AMP-activated protein kinase beta subunit             65.9    2e-09   
ref|XP_001986668.1|  GH21488                                          66.2    2e-09   
ref|XP_008067492.1|  PREDICTED: 5'-AMP-activated protein kinase s...  65.5    2e-09   
ref|XP_317273.3|  AGAP008195-PA                                       65.5    2e-09   
ref|XP_005054922.1|  PREDICTED: 5'-AMP-activated protein kinase s...  65.1    3e-09   
ref|NP_001085572.1|  protein kinase, AMP-activated, beta 1 non-ca...  65.1    3e-09   
ref|XP_002018281.1|  GL16847                                          65.9    3e-09   
ref|XP_001361124.1|  GA20794                                          65.9    3e-09   
dbj|GAM25701.1|  hypothetical protein SAMD00019534_088760             65.9    3e-09   
ref|XP_009090555.1|  PREDICTED: 5'-AMP-activated protein kinase s...  64.7    4e-09   
ref|XP_009090554.1|  PREDICTED: 5'-AMP-activated protein kinase s...  64.7    4e-09   
ref|XP_009604833.1|  PREDICTED: sucrose nonfermenting 4-like prot...  65.9    4e-09   
gb|ETN60216.1|  5-amp-activated protein kinase, beta subunit          65.1    4e-09   
ref|XP_006005533.1|  PREDICTED: 5'-AMP-activated protein kinase s...  64.7    4e-09   
gb|ETN61937.1|  5-amp-activated protein kinase, beta subunit          65.1    4e-09   
ref|XP_009833767.1|  hypothetical protein, variant                    64.7    4e-09   
ref|XP_005054920.1|  PREDICTED: 5'-AMP-activated protein kinase s...  64.7    4e-09   
ref|XP_005987277.1|  PREDICTED: 5'-AMP-activated protein kinase s...  64.7    4e-09   
ref|XP_008868724.1|  hypothetical protein H310_05711                  64.7    4e-09   
gb|ETE60360.1|  5'-AMP-activated protein kinase subunit beta-1        62.8    5e-09   
ref|XP_002932123.1|  PREDICTED: 5'-AMP-activated protein kinase s...  64.3    5e-09   
emb|CDI99725.1|  AMPK beta subunit                                    65.1    5e-09   
emb|CDS18956.1|  AMPK beta subunit                                    65.1    5e-09   
ref|XP_009833768.1|  hypothetical protein H257_09292                  64.7    5e-09   
ref|XP_002932122.1|  PREDICTED: 5'-AMP-activated protein kinase s...  64.3    5e-09   
ref|XP_008611134.1|  hypothetical protein SDRG_07095                  64.3    6e-09   
ref|XP_001642216.1|  hypothetical protein Kpol_195p2                  64.7    7e-09   
ref|XP_004910662.1|  PREDICTED: 5'-AMP-activated protein kinase s...  63.9    8e-09   



>ref|XP_009621368.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Nicotiana 
tomentosiformis]
Length=441

 Score =   183 bits (464),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 78/89 (88%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +3

Query  423  MYPAGMDYARESSTVLITTRFVWPYGGRTVCLSGTFTGWSQWPMTPVEGCPSVFQTICSL  602
            MYPAGMDYAR+S T LI TRFVWPYGGR+VCLSGTFTGWSQWPMTPVEGCP+VFQTICS+
Sbjct  1    MYPAGMDYARDSGTALIPTRFVWPYGGRSVCLSGTFTGWSQWPMTPVEGCPTVFQTICSI  60

Query  603  PPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            PPGYHQYKF+VDGEWRHDENQPF +G+YG
Sbjct  61   PPGYHQYKFIVDGEWRHDENQPFVSGSYG  89



>ref|XP_009621367.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Nicotiana 
tomentosiformis]
Length=486

 Score =   183 bits (464),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 78/89 (88%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +3

Query  423  MYPAGMDYARESSTVLITTRFVWPYGGRTVCLSGTFTGWSQWPMTPVEGCPSVFQTICSL  602
            MYPAGMDYAR+S T LI TRFVWPYGGR+VCLSGTFTGWSQWPMTPVEGCP+VFQTICS+
Sbjct  1    MYPAGMDYARDSGTALIPTRFVWPYGGRSVCLSGTFTGWSQWPMTPVEGCPTVFQTICSI  60

Query  603  PPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            PPGYHQYKF+VDGEWRHDENQPF +G+YG
Sbjct  61   PPGYHQYKFIVDGEWRHDENQPFVSGSYG  89



>ref|XP_009801936.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Nicotiana 
sylvestris]
Length=441

 Score =   180 bits (457),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 77/89 (87%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +3

Query  423  MYPAGMDYARESSTVLITTRFVWPYGGRTVCLSGTFTGWSQWPMTPVEGCPSVFQTICSL  602
            MYPAGMDYAR+S T LI TRFVWPYGG +VCLSGTFTGWSQWPMTPVEGCP+VFQT+CS+
Sbjct  1    MYPAGMDYARDSGTALIPTRFVWPYGGTSVCLSGTFTGWSQWPMTPVEGCPTVFQTLCSI  60

Query  603  PPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            PPGYHQYKF+VDGEWRHDENQPF TG+YG
Sbjct  61   PPGYHQYKFIVDGEWRHDENQPFVTGSYG  89



>ref|XP_009801935.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Nicotiana 
sylvestris]
Length=486

 Score =   180 bits (457),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 77/89 (87%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +3

Query  423  MYPAGMDYARESSTVLITTRFVWPYGGRTVCLSGTFTGWSQWPMTPVEGCPSVFQTICSL  602
            MYPAGMDYAR+S T LI TRFVWPYGG +VCLSGTFTGWSQWPMTPVEGCP+VFQT+CS+
Sbjct  1    MYPAGMDYARDSGTALIPTRFVWPYGGTSVCLSGTFTGWSQWPMTPVEGCPTVFQTLCSI  60

Query  603  PPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            PPGYHQYKF+VDGEWRHDENQPF TG+YG
Sbjct  61   PPGYHQYKFIVDGEWRHDENQPFVTGSYG  89



>ref|XP_006342753.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006342754.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 
X2 [Solanum tuberosum]
Length=486

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +3

Query  423  MYPAGMDYARESSTVLITTRFVWPYGGRTVCLSGTFTGWSQWPMTPVEGCPSVFQTICSL  602
            MYP+ MDYAR+  T LI TRFVWPYGGR+V LSGTFTGWSQWPM PVEGCP+VFQT+CS+
Sbjct  1    MYPSAMDYARDGGTALIPTRFVWPYGGRSVYLSGTFTGWSQWPMAPVEGCPTVFQTVCSV  60

Query  603  PPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            PPGYHQYKF+VDGEWRHDENQPF +G+ G
Sbjct  61   PPGYHQYKFIVDGEWRHDENQPFVSGSLG  89



>ref|XP_011090936.1| PREDICTED: sucrose nonfermenting 4-like protein [Sesamum indicum]
Length=490

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/89 (82%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +3

Query  423  MYPAGMDYARESSTVLITTRFVWPYGGRTVCLSGTFTGWSQWPMTPVEGCPSVFQTICSL  602
            MYP GMDY+RES  VLI TRFVWPYGGR V +SG+FTGW+QWPMTPVEGCP+VFQTICSL
Sbjct  1    MYPLGMDYSRESGMVLIPTRFVWPYGGRVVYISGSFTGWTQWPMTPVEGCPTVFQTICSL  60

Query  603  PPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            PPGYHQYKFVVDGEWRHDE+QPF + N G
Sbjct  61   PPGYHQYKFVVDGEWRHDEHQPFISSNIG  89



>ref|XP_004229201.1| PREDICTED: sucrose nonfermenting 4-like protein [Solanum lycopersicum]
 ref|XP_010321096.1| PREDICTED: sucrose nonfermenting 4-like protein [Solanum lycopersicum]
Length=487

 Score =   166 bits (420),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 72/90 (80%), Positives = 80/90 (89%), Gaps = 1/90 (1%)
 Frame = +3

Query  423  MYPAGMDYARESSTVLITTRFVWPYGGRTVCLSGTFTGWSQWPMTPVEGCPSVFQTICSL  602
            MYP+ MDYAR+  T LI TRFVWPYGGR+V LSGTFTGWSQWPM PVEGCP+VFQT+CS+
Sbjct  1    MYPSAMDYARDGGTALIPTRFVWPYGGRSVYLSGTFTGWSQWPMAPVEGCPTVFQTVCSV  60

Query  603  PPGYHQYKFVVDGEWRHDENQPFAT-GNYG  689
            PPGYHQYKF+VDGEWRHDENQPF + GN G
Sbjct  61   PPGYHQYKFIVDGEWRHDENQPFVSGGNLG  90



>ref|XP_011071458.1| PREDICTED: sucrose nonfermenting 4-like protein [Sesamum indicum]
Length=490

 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +3

Query  423  MYPAGMDYARESSTVLITTRFVWPYGGRTVCLSGTFTGWSQWPMTPVEGCPSVFQTICSL  602
            MYP GMDY RES  VLI TRFVWPYGGR+V +SG+FTGW+QWPMTPVEGCP+VFQTICSL
Sbjct  1    MYPLGMDYLRESGLVLIPTRFVWPYGGRSVYISGSFTGWTQWPMTPVEGCPTVFQTICSL  60

Query  603  PPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            PPGYHQYKFVVDGEWR+DE++PF + N G
Sbjct  61   PPGYHQYKFVVDGEWRYDEHRPFISSNIG  89



>ref|XP_009393223.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=489

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 75/90 (83%), Gaps = 1/90 (1%)
 Frame = +3

Query  423  MYPAGMDYARESSTVLITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPSVFQTICS  599
            M+  G +++ + +TVL+ TRFVWPYGGR V LSG+FTGWS+  PM+PVEGCP+VFQ ICS
Sbjct  1    MFSRGTEFSHDPATVLVPTRFVWPYGGRRVFLSGSFTGWSEHLPMSPVEGCPTVFQVICS  60

Query  600  LPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            L PG HQYKF VDGEWRHDE QPFATGNYG
Sbjct  61   LTPGLHQYKFYVDGEWRHDERQPFATGNYG  90



>ref|XP_009393220.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009393221.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009393222.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=490

 Score =   143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 75/90 (83%), Gaps = 1/90 (1%)
 Frame = +3

Query  423  MYPAGMDYARESSTVLITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPSVFQTICS  599
            M+  G +++ + +TVL+ TRFVWPYGGR V LSG+FTGWS+  PM+PVEGCP+VFQ ICS
Sbjct  1    MFSRGTEFSHDPATVLVPTRFVWPYGGRRVFLSGSFTGWSEHLPMSPVEGCPTVFQVICS  60

Query  600  LPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            L PG HQYKF VDGEWRHDE QPFATGNYG
Sbjct  61   LTPGLHQYKFYVDGEWRHDERQPFATGNYG  90



>emb|CDO98887.1| unnamed protein product [Coffea canephora]
Length=471

 Score =   139 bits (350),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 72/84 (86%), Gaps = 3/84 (4%)
 Frame = +3

Query  438  MDYARESSTVLITTRFVWPYGGRTVCLSGTFTGWSQWPMTPVEGCPSVFQTICSLPPGYH  617
            MDY+RE     + TRFVWPYGGR+V + G+FTGW+Q PMTPVEGCP+VFQT+C+LPPG+H
Sbjct  1    MDYSREPG---MPTRFVWPYGGRSVYICGSFTGWAQHPMTPVEGCPTVFQTVCNLPPGFH  57

Query  618  QYKFVVDGEWRHDENQPFATGNYG  689
            QYKFVVDGEWRHDE+QP  + NYG
Sbjct  58   QYKFVVDGEWRHDEHQPHVSSNYG  81



>gb|KDO75160.1| hypothetical protein CISIN_1g010368mg [Citrus sinensis]
Length=435

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 73/94 (78%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARESS----TVLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQ  587
            M+  GMD ARE +    TVLI  RFVWPYGGR+V LSG+F  WS+  PM+PVEGCP+VFQ
Sbjct  6    MFNPGMDAAREPASVPDTVLIPMRFVWPYGGRSVFLSGSFNRWSELLPMSPVEGCPTVFQ  65

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             I S+PPGYHQYKF VDGEWRHDE+QPF +  YG
Sbjct  66   IIWSIPPGYHQYKFCVDGEWRHDEHQPFISSEYG  99



>ref|XP_009369133.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Pyrus 
x bretschneideri]
Length=492

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 72/94 (77%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARES----STVLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQ  587
            M+   MD AR+     STVLI  RFVWPYGGR+V LSG+F  WS+  PMTPVEGCP+VFQ
Sbjct  1    MFATNMDLARDVGGAPSTVLIPMRFVWPYGGRSVFLSGSFARWSELIPMTPVEGCPTVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             I S+ PGYHQYKF VDGEWRHDE+QPF +G YG
Sbjct  61   AIYSVTPGYHQYKFFVDGEWRHDEHQPFVSGEYG  94



>gb|KDO75156.1| hypothetical protein CISIN_1g010368mg [Citrus sinensis]
Length=500

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 73/94 (78%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARESS----TVLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQ  587
            M+  GMD ARE +    TVLI  RFVWPYGGR+V LSG+F  WS+  PM+PVEGCP+VFQ
Sbjct  6    MFNPGMDAAREPASVPDTVLIPMRFVWPYGGRSVFLSGSFNRWSELLPMSPVEGCPTVFQ  65

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             I S+PPGYHQYKF VDGEWRHDE+QPF +  YG
Sbjct  66   IIWSIPPGYHQYKFCVDGEWRHDEHQPFISSEYG  99



>gb|KDO75157.1| hypothetical protein CISIN_1g010368mg [Citrus sinensis]
Length=512

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 73/94 (78%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARESS----TVLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQ  587
            M+  GMD ARE +    TVLI  RFVWPYGGR+V LSG+F  WS+  PM+PVEGCP+VFQ
Sbjct  6    MFNPGMDAAREPASVPDTVLIPMRFVWPYGGRSVFLSGSFNRWSELLPMSPVEGCPTVFQ  65

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             I S+PPGYHQYKF VDGEWRHDE+QPF +  YG
Sbjct  66   IIWSIPPGYHQYKFCVDGEWRHDEHQPFISSEYG  99



>ref|XP_006419618.1| hypothetical protein CICLE_v10004799mg [Citrus clementina]
 gb|ESR32858.1| hypothetical protein CICLE_v10004799mg [Citrus clementina]
 gb|KDO75155.1| hypothetical protein CISIN_1g010368mg [Citrus sinensis]
Length=495

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 73/94 (78%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARESS----TVLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQ  587
            M+  GMD ARE +    TVLI  RFVWPYGGR+V LSG+F  WS+  PM+PVEGCP+VFQ
Sbjct  6    MFNPGMDAAREPASVPDTVLIPMRFVWPYGGRSVFLSGSFNRWSELLPMSPVEGCPTVFQ  65

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             I S+PPGYHQYKF VDGEWRHDE+QPF +  YG
Sbjct  66   IIWSIPPGYHQYKFCVDGEWRHDEHQPFISSEYG  99



>gb|KDO75154.1| hypothetical protein CISIN_1g010368mg [Citrus sinensis]
Length=471

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 73/94 (78%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARESS----TVLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQ  587
            M+  GMD ARE +    TVLI  RFVWPYGGR+V LSG+F  WS+  PM+PVEGCP+VFQ
Sbjct  6    MFNPGMDAAREPASVPDTVLIPMRFVWPYGGRSVFLSGSFNRWSELLPMSPVEGCPTVFQ  65

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             I S+PPGYHQYKF VDGEWRHDE+QPF +  YG
Sbjct  66   IIWSIPPGYHQYKFCVDGEWRHDEHQPFISSEYG  99



>ref|XP_006489115.1| PREDICTED: sucrose nonfermenting 4-like protein-like [Citrus 
sinensis]
Length=495

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 73/94 (78%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARESS----TVLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQ  587
            M+  GMD ARE +    TVLI  RFVWPYGGR+V LSG+F  WS+  PM+PVEGCP+VFQ
Sbjct  6    MFNPGMDAAREPASVPDTVLIPMRFVWPYGGRSVFLSGSFNRWSELLPMSPVEGCPTVFQ  65

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             I S+PPGYHQYKF VDGEWRHDE+QPF +  YG
Sbjct  66   IIWSIPPGYHQYKFCVDGEWRHDEHQPFISSEYG  99



>ref|XP_010659865.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Vitis 
vinifera]
Length=452

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 74/94 (79%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARESS----TVLITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPSVFQ  587
            M+ +G +   E+S    TVLI TRFVWPYGGR V LSG+FT WS+  PM+P+EGCP+VFQ
Sbjct  1    MFVSGAESGHENSAIPGTVLIPTRFVWPYGGRRVLLSGSFTRWSEHIPMSPIEGCPTVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             I SL PGYHQYKF VDGEWRHDE+QPF +GNYG
Sbjct  61   VIWSLAPGYHQYKFFVDGEWRHDEHQPFVSGNYG  94



>ref|XP_010269446.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Nelumbo 
nucifera]
Length=486

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 74/98 (76%), Gaps = 5/98 (5%)
 Frame = +3

Query  411  LWE*MYPAGMDYARESS----TVLITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCP  575
            + E MY +G D   E+S    TVL+  RFVWPYGGR V LSG+FT WS+  PM+PVEGCP
Sbjct  1    MIEEMYSSGTDSMPETSGVAGTVLVPMRFVWPYGGRRVFLSGSFTRWSEHLPMSPVEGCP  60

Query  576  SVFQTICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            +VFQ IC+L PGYHQYKF VDGEWRHDE QP  TG+YG
Sbjct  61   TVFQAICNLTPGYHQYKFFVDGEWRHDERQPVETGSYG  98



>ref|XP_010269444.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Nelumbo 
nucifera]
 ref|XP_010269445.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Nelumbo 
nucifera]
Length=495

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 74/98 (76%), Gaps = 5/98 (5%)
 Frame = +3

Query  411  LWE*MYPAGMDYARESS----TVLITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCP  575
            + E MY +G D   E+S    TVL+  RFVWPYGGR V LSG+FT WS+  PM+PVEGCP
Sbjct  1    MIEEMYSSGTDSMPETSGVAGTVLVPMRFVWPYGGRRVFLSGSFTRWSEHLPMSPVEGCP  60

Query  576  SVFQTICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            +VFQ IC+L PGYHQYKF VDGEWRHDE QP  TG+YG
Sbjct  61   TVFQAICNLTPGYHQYKFFVDGEWRHDERQPVETGSYG  98



>ref|XP_009339832.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Pyrus 
x bretschneideri]
Length=492

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 72/94 (77%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARES----STVLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQ  587
            M+   MD AR+     STVLI  RFVWPYGGR+V LSG+F  WS+  PMTPVEGCP+VFQ
Sbjct  1    MFATNMDSARDVGGAPSTVLIPMRFVWPYGGRSVFLSGSFARWSELIPMTPVEGCPTVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             I S+ PGYHQYKF VDGEWRHDE+QPF +G YG
Sbjct  61   AIYSVTPGYHQYKFFVDGEWRHDEHQPFVSGEYG  94



>ref|XP_003633645.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Vitis 
vinifera]
 emb|CBI36807.3| unnamed protein product [Vitis vinifera]
Length=482

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 74/94 (79%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARESS----TVLITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPSVFQ  587
            M+ +G +   E+S    TVLI TRFVWPYGGR V LSG+FT WS+  PM+P+EGCP+VFQ
Sbjct  1    MFVSGAESGHENSAIPGTVLIPTRFVWPYGGRRVLLSGSFTRWSEHIPMSPIEGCPTVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             I SL PGYHQYKF VDGEWRHDE+QPF +GNYG
Sbjct  61   VIWSLAPGYHQYKFFVDGEWRHDEHQPFVSGNYG  94



>ref|XP_006419619.1| hypothetical protein CICLE_v10004799mg [Citrus clementina]
 gb|ESR32859.1| hypothetical protein CICLE_v10004799mg [Citrus clementina]
Length=505

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 73/94 (78%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARESS----TVLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQ  587
            M+  GMD ARE +    TVLI  RFVWPYGGR+V LSG+F  WS+  PM+PVEGCP+VFQ
Sbjct  6    MFNPGMDAAREPASVPDTVLIPMRFVWPYGGRSVFLSGSFNRWSELLPMSPVEGCPTVFQ  65

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             I S+PPGYHQYKF VDGEWRHDE+QPF +  YG
Sbjct  66   IIWSIPPGYHQYKFCVDGEWRHDEHQPFISSEYG  99



>gb|KDO75159.1| hypothetical protein CISIN_1g010368mg [Citrus sinensis]
Length=505

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 73/94 (78%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARESS----TVLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQ  587
            M+  GMD ARE +    TVLI  RFVWPYGGR+V LSG+F  WS+  PM+PVEGCP+VFQ
Sbjct  6    MFNPGMDAAREPASVPDTVLIPMRFVWPYGGRSVFLSGSFNRWSELLPMSPVEGCPTVFQ  65

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             I S+PPGYHQYKF VDGEWRHDE+QPF +  YG
Sbjct  66   IIWSIPPGYHQYKFCVDGEWRHDEHQPFISSEYG  99



>gb|KDO56293.1| hypothetical protein CISIN_1g011558mg [Citrus sinensis]
Length=271

 Score =   129 bits (323),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 72/94 (77%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARESS----TVLITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPSVFQ  587
            MY +G++   E+S    ++L+  RF+WP GGR V LSG+FT WS+  PM+P EGCP+VFQ
Sbjct  1    MYNSGLNTGHENSGVVGSILVPVRFIWPNGGRRVSLSGSFTRWSEPMPMSPSEGCPAVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             IC LPPG+HQYKF VDGEWRHDENQP  +GNYG
Sbjct  61   IICRLPPGHHQYKFYVDGEWRHDENQPHVSGNYG  94



>gb|KDO56292.1| hypothetical protein CISIN_1g011558mg [Citrus sinensis]
Length=323

 Score =   129 bits (325),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 72/94 (77%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARESS----TVLITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPSVFQ  587
            MY +G++   E+S    ++L+  RF+WP GGR V LSG+FT WS+  PM+P EGCP+VFQ
Sbjct  1    MYNSGLNTGHENSGVVGSILVPVRFIWPNGGRRVSLSGSFTRWSEPMPMSPSEGCPAVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             IC LPPG+HQYKF VDGEWRHDENQP  +GNYG
Sbjct  61   IICRLPPGHHQYKFYVDGEWRHDENQPHVSGNYG  94



>ref|XP_007222344.1| hypothetical protein PRUPE_ppa004800mg [Prunus persica]
 gb|EMJ23543.1| hypothetical protein PRUPE_ppa004800mg [Prunus persica]
Length=491

 Score =   131 bits (329),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 72/94 (77%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARES----STVLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQ  587
            M+   MD AR+     STVLI  RFVWPYGGR+V LSG+F  WS+  PMTPVEGCP+VFQ
Sbjct  1    MFATNMDSARDVGGAPSTVLIPMRFVWPYGGRSVFLSGSFARWSELIPMTPVEGCPTVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             I S+ PGYHQYKF VDGEWRHDE+QP+ +G YG
Sbjct  61   AIYSVTPGYHQYKFFVDGEWRHDEHQPYVSGEYG  94



>ref|XP_002274373.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Vitis 
vinifera]
 emb|CBI26085.3| unnamed protein product [Vitis vinifera]
Length=491

 Score =   131 bits (329),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 71/94 (76%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARE----SSTVLITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPSVFQ  587
            M   GMD ARE    + TVLI   FVW YGGR+V LSG+FTGW+  + M+PVEGCP+VFQ
Sbjct  1    MLSPGMDSAREGGGVAGTVLIPMNFVWSYGGRSVYLSGSFTGWTNLYQMSPVEGCPTVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             ICSL PGYHQYKF VDGEWRHDENQPF +  YG
Sbjct  61   VICSLTPGYHQYKFFVDGEWRHDENQPFISCTYG  94



>gb|KDO56289.1| hypothetical protein CISIN_1g011558mg [Citrus sinensis]
Length=426

 Score =   130 bits (327),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 72/94 (77%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARESS----TVLITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPSVFQ  587
            MY +G++   E+S    ++L+  RF+WP GGR V LSG+FT WS+  PM+P EGCP+VFQ
Sbjct  1    MYNSGLNTGHENSGVVGSILVPVRFIWPNGGRRVSLSGSFTRWSEPMPMSPSEGCPAVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             IC LPPG+HQYKF VDGEWRHDENQP  +GNYG
Sbjct  61   IICRLPPGHHQYKFYVDGEWRHDENQPHVSGNYG  94



>ref|XP_008223131.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Prunus 
mume]
Length=491

 Score =   130 bits (328),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 72/94 (77%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARES----STVLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQ  587
            M+   MD AR+     STVLI  RFVWPYGGR+V LSG+F  WS+  PMTPVEGCP+VFQ
Sbjct  1    MFATNMDSARDVGGAPSTVLIPMRFVWPYGGRSVFLSGSFARWSELIPMTPVEGCPTVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             I S+ PGYHQYKF VDGEWRHDE+QP+ +G YG
Sbjct  61   AIYSVMPGYHQYKFFVDGEWRHDEHQPYVSGEYG  94



>ref|XP_006433349.1| hypothetical protein CICLE_v10000984mg [Citrus clementina]
 ref|XP_006472034.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 
X1 [Citrus sinensis]
 gb|ESR46589.1| hypothetical protein CICLE_v10000984mg [Citrus clementina]
 gb|KDO56288.1| hypothetical protein CISIN_1g011558mg [Citrus sinensis]
Length=483

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 72/94 (77%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARESS----TVLITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPSVFQ  587
            MY +G++   E+S    ++L+  RF+WP GGR V LSG+FT WS+  PM+P EGCP+VFQ
Sbjct  1    MYNSGLNTGHENSGVVGSILVPVRFIWPNGGRRVSLSGSFTRWSEPMPMSPSEGCPAVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             IC LPPG+HQYKF VDGEWRHDENQP  +GNYG
Sbjct  61   IICRLPPGHHQYKFYVDGEWRHDENQPHVSGNYG  94



>ref|XP_004494609.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 
X1 [Cicer arietinum]
Length=486

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 64/76 (84%), Gaps = 1/76 (1%)
 Frame = +3

Query  465  VLITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPSVFQTICSLPPGYHQYKFVVDG  641
            +LI  RFVWPYGGR V LSG+FT WS+  PM+P+EGCPSVFQ ICSL PGYHQYKF VDG
Sbjct  20   ILIPKRFVWPYGGRRVFLSGSFTRWSEHIPMSPMEGCPSVFQVICSLMPGYHQYKFNVDG  79

Query  642  EWRHDENQPFATGNYG  689
            EWRHDE QPF +GNYG
Sbjct  80   EWRHDEQQPFVSGNYG  95



>ref|XP_004494610.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 
X2 [Cicer arietinum]
Length=484

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 64/76 (84%), Gaps = 1/76 (1%)
 Frame = +3

Query  465  VLITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPSVFQTICSLPPGYHQYKFVVDG  641
            +LI  RFVWPYGGR V LSG+FT WS+  PM+P+EGCPSVFQ ICSL PGYHQYKF VDG
Sbjct  20   ILIPKRFVWPYGGRRVFLSGSFTRWSEHIPMSPMEGCPSVFQVICSLMPGYHQYKFNVDG  79

Query  642  EWRHDENQPFATGNYG  689
            EWRHDE QPF +GNYG
Sbjct  80   EWRHDEQQPFVSGNYG  95



>gb|KDO56290.1| hypothetical protein CISIN_1g011558mg [Citrus sinensis]
 gb|KDO56291.1| hypothetical protein CISIN_1g011558mg [Citrus sinensis]
Length=384

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 72/94 (77%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARESS----TVLITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPSVFQ  587
            MY +G++   E+S    ++L+  RF+WP GGR V LSG+FT WS+  PM+P EGCP+VFQ
Sbjct  1    MYNSGLNTGHENSGVVGSILVPVRFIWPNGGRRVSLSGSFTRWSEPMPMSPSEGCPAVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             IC LPPG+HQYKF VDGEWRHDENQP  +GNYG
Sbjct  61   IICRLPPGHHQYKFYVDGEWRHDENQPHVSGNYG  94



>ref|XP_011462705.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Fragaria 
vesca subsp. vesca]
 ref|XP_011462706.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Fragaria 
vesca subsp. vesca]
Length=490

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 71/94 (76%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARE----SSTVLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQ  587
            M+   MD AR+     STVLI  RFVWPYGGR+V LSG+F  WS+  PMTPVEGCP+VFQ
Sbjct  1    MFATNMDAARDIGGAQSTVLIPMRFVWPYGGRSVFLSGSFARWSELVPMTPVEGCPTVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             I S+ PG HQYKF VDGEWRHDE+QP+A G YG
Sbjct  61   AIYSVTPGIHQYKFFVDGEWRHDEHQPYANGEYG  94



>ref|XP_007030947.1| Sucrose nonfermenting 4 [Theobroma cacao]
 gb|EOY11449.1| Sucrose nonfermenting 4 [Theobroma cacao]
Length=479

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 73/94 (78%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARESSTV----LITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPSVFQ  587
            M+ +G +  +E+S V    LI  RFVWPYGGR V LSG+FT WS+  PM+P+EGCP+VFQ
Sbjct  1    MFASGPETGQENSGVSGPLLIPMRFVWPYGGRRVFLSGSFTRWSEHIPMSPMEGCPTVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             ICSL PGYHQ+KF VDGEWRHDE+QPF  GNYG
Sbjct  61   VICSLSPGYHQFKFYVDGEWRHDEHQPFVNGNYG  94



>ref|XP_003533466.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 
X1 [Glycine max]
Length=492

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 73/95 (77%), Gaps = 6/95 (6%)
 Frame = +3

Query  423  MYPAGMDYARESS-----TVLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVF  584
            M+   MD AR+++     TVLI  RFVWPYGGR+V LSG+FT W +  PM+PVEGCP+VF
Sbjct  1    MFGQSMDSARDAAGGVAGTVLIPMRFVWPYGGRSVFLSGSFTRWLELLPMSPVEGCPTVF  60

Query  585  QTICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            Q I +LPPGYHQYKF VDGEWRHDE+QP+  G YG
Sbjct  61   QVIYNLPPGYHQYKFFVDGEWRHDEHQPYVPGEYG  95



>ref|XP_006586934.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 
X2 [Glycine max]
 ref|XP_006586935.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 
X3 [Glycine max]
 ref|XP_006586936.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 
X4 [Glycine max]
Length=493

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 73/95 (77%), Gaps = 6/95 (6%)
 Frame = +3

Query  423  MYPAGMDYARESS-----TVLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVF  584
            M+   MD AR+++     TVLI  RFVWPYGGR+V LSG+FT W +  PM+PVEGCP+VF
Sbjct  1    MFGQSMDSARDAAGGVAGTVLIPMRFVWPYGGRSVFLSGSFTRWLELLPMSPVEGCPTVF  60

Query  585  QTICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            Q I +LPPGYHQYKF VDGEWRHDE+QP+  G YG
Sbjct  61   QVIYNLPPGYHQYKFFVDGEWRHDEHQPYVPGEYG  95



>ref|XP_006597748.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 
X5 [Glycine max]
Length=409

 Score =   129 bits (323),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 72/94 (77%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARESS----TVLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQ  587
            M+   MD AR +     TVLI  RFVWPYGGR+V LSG+FT W +  PM+PVEGCP+VFQ
Sbjct  1    MFGQSMDSARNAGGVAGTVLIPMRFVWPYGGRSVFLSGSFTRWLELLPMSPVEGCPTVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             I +LPPGYHQYKF VDGEWRHDE+QP+  G+YG
Sbjct  61   VIYNLPPGYHQYKFFVDGEWRHDEHQPYVPGDYG  94



>ref|XP_003546378.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 
X1 [Glycine max]
Length=491

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 72/94 (77%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARESS----TVLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQ  587
            M+   MD AR +     TVLI  RFVWPYGGR+V LSG+FT W +  PM+PVEGCP+VFQ
Sbjct  1    MFGQSMDSARNAGGVAGTVLIPMRFVWPYGGRSVFLSGSFTRWLELLPMSPVEGCPTVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             I +LPPGYHQYKF VDGEWRHDE+QP+  G+YG
Sbjct  61   VIYNLPPGYHQYKFFVDGEWRHDEHQPYVPGDYG  94



>gb|KHN47756.1| Sucrose nonfermenting 4-like protein [Glycine soja]
Length=491

 Score =   129 bits (324),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 72/94 (77%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARESS----TVLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQ  587
            M+   MD AR +     TVLI  RFVWPYGGR+V LSG+FT W +  PM+PVEGCP+VFQ
Sbjct  1    MFGQSMDSARNAGGVAGTVLIPMRFVWPYGGRSVFLSGSFTRWLELLPMSPVEGCPTVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             I +LPPGYHQYKF VDGEWRHDE+QP+  G+YG
Sbjct  61   VIYNLPPGYHQYKFFVDGEWRHDEHQPYVPGDYG  94



>ref|XP_006597745.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 
X2 [Glycine max]
 ref|XP_006597746.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 
X3 [Glycine max]
 ref|XP_006597747.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 
X4 [Glycine max]
Length=492

 Score =   129 bits (324),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 72/94 (77%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARESS----TVLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQ  587
            M+   MD AR +     TVLI  RFVWPYGGR+V LSG+FT W +  PM+PVEGCP+VFQ
Sbjct  1    MFGQSMDSARNAGGVAGTVLIPMRFVWPYGGRSVFLSGSFTRWLELLPMSPVEGCPTVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             I +LPPGYHQYKF VDGEWRHDE+QP+  G+YG
Sbjct  61   VIYNLPPGYHQYKFFVDGEWRHDEHQPYVPGDYG  94



>ref|XP_009352236.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Pyrus 
x bretschneideri]
Length=491

 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 71/94 (76%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARES----STVLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQ  587
            M+   MD AR+     STVLI  RFVWPYGGR+V  SG+F  WS+  PMTPVEGCP+VFQ
Sbjct  1    MFATNMDSARDVVGVPSTVLIPMRFVWPYGGRSVFFSGSFVRWSELIPMTPVEGCPTVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             + S+ PGYHQYKF VDGEWRHDE+QP+ +G YG
Sbjct  61   AVYSVTPGYHQYKFFVDGEWRHDEHQPYVSGEYG  94



>ref|XP_010931608.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Elaeis 
guineensis]
Length=493

 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 73/94 (78%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARESS----TVLITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPSVFQ  587
            M+ +G+D  +E S     +L+ TRFVWPYGG+ V ++G+FT WS+  PM+ VEGCP+VFQ
Sbjct  1    MFSSGIDSQQEPSGLAGAMLVPTRFVWPYGGKRVFVTGSFTRWSEHLPMSAVEGCPTVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             ICSL PG+HQYKF VDGEWRHDE QPF TGNYG
Sbjct  61   AICSLTPGFHQYKFYVDGEWRHDEQQPFVTGNYG  94



>ref|XP_009369131.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Pyrus 
x bretschneideri]
Length=493

 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 72/95 (76%), Gaps = 6/95 (6%)
 Frame = +3

Query  423  MYPAGMDYARES----STVLITTRFVWPYGGRTVCLSGTFTG-WSQW-PMTPVEGCPSVF  584
            M+   MD AR+     STVLI  RFVWPYGGR+V LSG+F   WS+  PMTPVEGCP+VF
Sbjct  1    MFATNMDLARDVGGAPSTVLIPMRFVWPYGGRSVFLSGSFARRWSELIPMTPVEGCPTVF  60

Query  585  QTICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            Q I S+ PGYHQYKF VDGEWRHDE+QPF +G YG
Sbjct  61   QAIYSVTPGYHQYKFFVDGEWRHDEHQPFVSGEYG  95



>ref|XP_009412087.1| PREDICTED: sucrose nonfermenting 4-like protein [Musa acuminata 
subsp. malaccensis]
Length=493

 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 72/94 (77%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARE----SSTVLITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPSVFQ  587
            M+ +G ++ +E    S + L+ TRFVWPYGGR V L+G+FT WS+  PM+PVEGCP+VFQ
Sbjct  1    MFSSGTEFLQEVAGVSGSALVPTRFVWPYGGRRVFLTGSFTRWSEHLPMSPVEGCPTVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             ICSL PG HQYKF VDGEWRHDE QPF TGN G
Sbjct  61   AICSLTPGLHQYKFFVDGEWRHDECQPFVTGNDG  94



>ref|XP_010931609.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Elaeis 
guineensis]
Length=484

 Score =   128 bits (322),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 73/94 (78%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARESS----TVLITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPSVFQ  587
            M+ +G+D  +E S     +L+ TRFVWPYGG+ V ++G+FT WS+  PM+ VEGCP+VFQ
Sbjct  1    MFSSGIDSQQEPSGLAGAMLVPTRFVWPYGGKRVFVTGSFTRWSEHLPMSAVEGCPTVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             ICSL PG+HQYKF VDGEWRHDE QPF TGNYG
Sbjct  61   AICSLTPGFHQYKFYVDGEWRHDEQQPFVTGNYG  94



>ref|XP_009369134.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X3 [Pyrus 
x bretschneideri]
Length=467

 Score =   128 bits (322),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 72/95 (76%), Gaps = 6/95 (6%)
 Frame = +3

Query  423  MYPAGMDYARES----STVLITTRFVWPYGGRTVCLSGTFTG-WSQW-PMTPVEGCPSVF  584
            M+   MD AR+     STVLI  RFVWPYGGR+V LSG+F   WS+  PMTPVEGCP+VF
Sbjct  1    MFATNMDLARDVGGAPSTVLIPMRFVWPYGGRSVFLSGSFARRWSELIPMTPVEGCPTVF  60

Query  585  QTICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            Q I S+ PGYHQYKF VDGEWRHDE+QPF +G YG
Sbjct  61   QAIYSVTPGYHQYKFFVDGEWRHDEHQPFVSGEYG  95



>ref|XP_009369135.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X4 [Pyrus 
x bretschneideri]
Length=465

 Score =   128 bits (322),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 72/95 (76%), Gaps = 6/95 (6%)
 Frame = +3

Query  423  MYPAGMDYARES----STVLITTRFVWPYGGRTVCLSGTFTG-WSQW-PMTPVEGCPSVF  584
            M+   MD AR+     STVLI  RFVWPYGGR+V LSG+F   WS+  PMTPVEGCP+VF
Sbjct  1    MFATNMDLARDVGGAPSTVLIPMRFVWPYGGRSVFLSGSFARRWSELIPMTPVEGCPTVF  60

Query  585  QTICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            Q I S+ PGYHQYKF VDGEWRHDE+QPF +G YG
Sbjct  61   QAIYSVTPGYHQYKFFVDGEWRHDEHQPFVSGEYG  95



>ref|XP_010931610.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X3 [Elaeis 
guineensis]
Length=428

 Score =   128 bits (321),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 73/94 (78%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARESS----TVLITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPSVFQ  587
            M+ +G+D  +E S     +L+ TRFVWPYGG+ V ++G+FT WS+  PM+ VEGCP+VFQ
Sbjct  1    MFSSGIDSQQEPSGLAGAMLVPTRFVWPYGGKRVFVTGSFTRWSEHLPMSAVEGCPTVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             ICSL PG+HQYKF VDGEWRHDE QPF TGNYG
Sbjct  61   AICSLTPGFHQYKFYVDGEWRHDEQQPFVTGNYG  94



>ref|XP_009381016.1| PREDICTED: sucrose nonfermenting 4-like protein [Musa acuminata 
subsp. malaccensis]
Length=493

 Score =   128 bits (322),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 73/94 (78%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARESSTV----LITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQ  587
            M+  G + ++E++ V    L+ TRFVWPYGGR V L+G+FT WS++ PM+PVEGCP VFQ
Sbjct  1    MFAPGTEVSQEAAGVAGAMLVPTRFVWPYGGRRVFLTGSFTRWSEYLPMSPVEGCPRVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             ICSL PG HQYKF VDGEW+HDE+QP  TGNYG
Sbjct  61   VICSLAPGLHQYKFYVDGEWKHDESQPSVTGNYG  94



>ref|XP_009339830.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009339831.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Pyrus 
x bretschneideri]
Length=493

 Score =   128 bits (321),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 72/95 (76%), Gaps = 6/95 (6%)
 Frame = +3

Query  423  MYPAGMDYARES----STVLITTRFVWPYGGRTVCLSGTFTG-WSQW-PMTPVEGCPSVF  584
            M+   MD AR+     STVLI  RFVWPYGGR+V LSG+F   WS+  PMTPVEGCP+VF
Sbjct  1    MFATNMDSARDVGGAPSTVLIPMRFVWPYGGRSVFLSGSFARRWSELIPMTPVEGCPTVF  60

Query  585  QTICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            Q I S+ PGYHQYKF VDGEWRHDE+QPF +G YG
Sbjct  61   QAIYSVTPGYHQYKFFVDGEWRHDEHQPFVSGEYG  95



>gb|KHN26574.1| Sucrose nonfermenting 4-like protein [Glycine soja]
Length=558

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 71/90 (79%), Gaps = 6/90 (7%)
 Frame = +3

Query  438  MDYARESS-----TVLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQTICS  599
            MD AR+++     TVLI  RFVWPYGGR+V LSG+FT W +  PM+PVEGCP+VFQ I +
Sbjct  1    MDSARDAAGGVAGTVLIPMRFVWPYGGRSVFLSGSFTRWLELLPMSPVEGCPTVFQVIYN  60

Query  600  LPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            LPPGYHQYKF VDGEWRHDE+QP+  G YG
Sbjct  61   LPPGYHQYKFFVDGEWRHDEHQPYVPGEYG  90



>gb|EPS59669.1| hypothetical protein M569_15136, partial [Genlisea aurea]
Length=66

 Score =   119 bits (297),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/66 (83%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = +3

Query  423  MYPAGMDYARESSTVLITTRFVWPYGGRTVCLSGTFTGWSQWPMTPVEGCPSVFQTICSL  602
            MYP GMDY RES  VLI TRFVWPYGGR V +SG+FTGW+QWPMTPVEGCP+VFQTICSL
Sbjct  1    MYPLGMDYPRESGIVLIPTRFVWPYGGRAVYISGSFTGWTQWPMTPVEGCPTVFQTICSL  60

Query  603  PPGYHQ  620
            PPGYHQ
Sbjct  61   PPGYHQ  66



>ref|XP_002512390.1| AMP-activated protein kinase, gamma regulatory subunit, putative 
[Ricinus communis]
 gb|EEF49842.1| AMP-activated protein kinase, gamma regulatory subunit, putative 
[Ricinus communis]
Length=540

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 71/90 (79%), Gaps = 2/90 (2%)
 Frame = +3

Query  423  MYPAGMDYARESSTVLITTRFVWPYGGRTVCLSGTFTGWS-QWPMTPVEGCPSVFQTICS  599
            M+ +G D    S+ VL   RFVWPYGGR+V LSGTFTGW+   PM+PVEGCP+VFQ ICS
Sbjct  1    MFGSGQDTGHGSTGVL-PLRFVWPYGGRSVFLSGTFTGWTDHIPMSPVEGCPTVFQVICS  59

Query  600  LPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            L PGYHQYKF VDGEWR+DE+QP  +GNYG
Sbjct  60   LTPGYHQYKFFVDGEWRYDEHQPSVSGNYG  89



>ref|XP_004508285.1| PREDICTED: sucrose nonfermenting 4-like protein-like [Cicer arietinum]
Length=476

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 72/95 (76%), Gaps = 6/95 (6%)
 Frame = +3

Query  423  MYPAGMDYARESS-----TVLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVF  584
            M+   MD AR++      TVLI  RFVWPYGGR+V LSG+FT WS+   M+PVEGCP+VF
Sbjct  1    MFTPRMDSARDAGGVAAGTVLIPMRFVWPYGGRSVYLSGSFTRWSELLQMSPVEGCPTVF  60

Query  585  QTICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            Q I SL PGYHQYKF VDGEWRHDE+QP+ +G YG
Sbjct  61   QVIHSLAPGYHQYKFFVDGEWRHDEHQPYISGEYG  95



>ref|XP_008813368.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Phoenix 
dactylifera]
 ref|XP_008813369.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Phoenix 
dactylifera]
Length=493

 Score =   126 bits (317),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 72/94 (77%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARESS----TVLITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPSVFQ  587
            M+ +GMD  +E S      L+ TRFVWPYGG+ V L+G+FT WS+  PM+PVEGCP+VFQ
Sbjct  1    MFSSGMDPPQEPSGLAGITLVPTRFVWPYGGKRVFLTGSFTRWSEHLPMSPVEGCPTVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             ICSL PG H+YKF VDGEWRHDE QP ATG+YG
Sbjct  61   AICSLTPGLHEYKFYVDGEWRHDERQPCATGSYG  94



>ref|XP_010097911.1| hypothetical protein L484_001432 [Morus notabilis]
 ref|XP_010104932.1| hypothetical protein L484_006674 [Morus notabilis]
 gb|EXB72999.1| hypothetical protein L484_001432 [Morus notabilis]
 gb|EXC02380.1| hypothetical protein L484_006674 [Morus notabilis]
Length=158

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 70/92 (76%), Gaps = 6/92 (7%)
 Frame = +3

Query  432  AGMDYARESS-----TVLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQTI  593
            +G +   ESS     ++LI TRFVWPYGGR V LSG+FT WS+  PM+PVEGCP+VFQ +
Sbjct  5    SGAESGHESSGGHAGSILIPTRFVWPYGGRRVFLSGSFTRWSEHIPMSPVEGCPTVFQVV  64

Query  594  CSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             +L PGYHQYKF VDGEWRHDE Q F +GNYG
Sbjct  65   WNLSPGYHQYKFYVDGEWRHDEQQQFVSGNYG  96



>ref|XP_008813370.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Phoenix 
dactylifera]
Length=484

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 72/94 (77%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARESS----TVLITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPSVFQ  587
            M+ +GMD  +E S      L+ TRFVWPYGG+ V L+G+FT WS+  PM+PVEGCP+VFQ
Sbjct  1    MFSSGMDPPQEPSGLAGITLVPTRFVWPYGGKRVFLTGSFTRWSEHLPMSPVEGCPTVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             ICSL PG H+YKF VDGEWRHDE QP ATG+YG
Sbjct  61   AICSLTPGLHEYKFYVDGEWRHDERQPCATGSYG  94



>ref|XP_010904802.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Elaeis 
guineensis]
Length=463

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 71/94 (76%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARESS----TVLITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPSVFQ  587
            M  +GMD  +E S    +VL+ TRFVWPYGG+ V L+G+FT WS+  PM+PVEGCP+VFQ
Sbjct  1    MLSSGMDPPQEPSGLAGSVLVPTRFVWPYGGKRVFLTGSFTRWSEHLPMSPVEGCPTVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             ICSL PG H+YKF VDGEWRHDE QP  TG YG
Sbjct  61   AICSLTPGVHEYKFYVDGEWRHDEQQPSVTGRYG  94



>ref|XP_008223130.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Prunus 
mume]
Length=492

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 72/95 (76%), Gaps = 6/95 (6%)
 Frame = +3

Query  423  MYPAGMDYARES----STVLITTRFVWPYGGRTVCLSGTFTG-WSQW-PMTPVEGCPSVF  584
            M+   MD AR+     STVLI  RFVWPYGGR+V LSG+F   WS+  PMTPVEGCP+VF
Sbjct  1    MFATNMDSARDVGGAPSTVLIPMRFVWPYGGRSVFLSGSFARRWSELIPMTPVEGCPTVF  60

Query  585  QTICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            Q I S+ PGYHQYKF VDGEWRHDE+QP+ +G YG
Sbjct  61   QAIYSVMPGYHQYKFFVDGEWRHDEHQPYVSGEYG  95



>gb|KEH15993.1| sucrose nonfermenting-like protein [Medicago truncatula]
Length=393

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 68/89 (76%), Gaps = 5/89 (6%)
 Frame = +3

Query  438  MDYARESS----TVLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQTICSL  602
            MD+ R+      TVLI  RFVWPYGG +V LSG+FT WS+  PM+PVEGCP+VFQ I  L
Sbjct  1    MDHVRDVGSVVGTVLIPMRFVWPYGGSSVFLSGSFTRWSELLPMSPVEGCPTVFQVIYRL  60

Query  603  PPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            PPGYHQYKF VDGEWRHDE+QP+  G YG
Sbjct  61   PPGYHQYKFFVDGEWRHDEHQPYVHGQYG  89



>ref|XP_009384402.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=435

 Score =   125 bits (315),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 68/94 (72%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARESSTV----LITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPSVFQ  587
            M+P+G D  + ++ V    LI TRFVWPYGGR V L G+FT W++  PMT VEGCPSVFQ
Sbjct  1    MFPSGTDRTQVTAAVSCGVLIPTRFVWPYGGRRVYLLGSFTRWTEHLPMTRVEGCPSVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             IC L PG HQYKF VDGEWRHDE QP   GNYG
Sbjct  61   AICRLTPGVHQYKFFVDGEWRHDERQPHMVGNYG  94



>ref|XP_009384403.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=416

 Score =   125 bits (315),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 68/94 (72%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARESSTV----LITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPSVFQ  587
            M+P+G D  + ++ V    LI TRFVWPYGGR V L G+FT W++  PMT VEGCPSVFQ
Sbjct  1    MFPSGTDRTQVTAAVSCGVLIPTRFVWPYGGRRVYLLGSFTRWTEHLPMTRVEGCPSVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             IC L PG HQYKF VDGEWRHDE QP   GNYG
Sbjct  61   AICRLTPGVHQYKFFVDGEWRHDERQPHMVGNYG  94



>ref|XP_008458476.1| PREDICTED: sucrose nonfermenting 4-like protein [Cucumis melo]
Length=491

 Score =   126 bits (316),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 71/94 (76%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARESS----TVLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQ  587
            M+ + MD  R+++    T+LI  RFVWPYGGR+V LSG+FT WS+  PMTP+EGCP+VFQ
Sbjct  1    MFASSMDTVRDTARTAGTLLIPMRFVWPYGGRSVFLSGSFTRWSELVPMTPMEGCPTVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             I SL PGYHQYKF VDGEWRHDE Q   +G YG
Sbjct  61   AIYSLTPGYHQYKFFVDGEWRHDEQQTCVSGEYG  94



>ref|XP_011657174.1| PREDICTED: sucrose nonfermenting 4-like protein [Cucumis sativus]
 gb|KGN47196.1| hypothetical protein Csa_6G198240 [Cucumis sativus]
Length=491

 Score =   126 bits (316),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 71/94 (76%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARESS----TVLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQ  587
            M+ + MD  R+++    T+LI  RFVWPYGGR+V LSG+FT WS+  PMTP+EGCP+VFQ
Sbjct  1    MFASSMDTVRDTARTAGTLLIPMRFVWPYGGRSVFLSGSFTRWSELVPMTPMEGCPTVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             I SL PGYHQYKF VDGEWRHDE Q   +G YG
Sbjct  61   AIYSLTPGYHQYKFFVDGEWRHDEQQTCVSGEYG  94



>ref|XP_009384400.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009384401.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=485

 Score =   125 bits (315),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 68/94 (72%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARESSTV----LITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPSVFQ  587
            M+P+G D  + ++ V    LI TRFVWPYGGR V L G+FT W++  PMT VEGCPSVFQ
Sbjct  1    MFPSGTDRTQVTAAVSCGVLIPTRFVWPYGGRRVYLLGSFTRWTEHLPMTRVEGCPSVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             IC L PG HQYKF VDGEWRHDE QP   GNYG
Sbjct  61   AICRLTPGVHQYKFFVDGEWRHDERQPHMVGNYG  94



>gb|KEH15992.1| sucrose nonfermenting-like protein [Medicago truncatula]
Length=485

 Score =   125 bits (315),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 68/89 (76%), Gaps = 5/89 (6%)
 Frame = +3

Query  438  MDYARESS----TVLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQTICSL  602
            MD+ R+      TVLI  RFVWPYGG +V LSG+FT WS+  PM+PVEGCP+VFQ I  L
Sbjct  1    MDHVRDVGSVVGTVLIPMRFVWPYGGSSVFLSGSFTRWSELLPMSPVEGCPTVFQVIYRL  60

Query  603  PPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            PPGYHQYKF VDGEWRHDE+QP+  G YG
Sbjct  61   PPGYHQYKFFVDGEWRHDEHQPYVHGQYG  89



>ref|XP_010904800.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Elaeis 
guineensis]
 ref|XP_010904801.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Elaeis 
guineensis]
Length=493

 Score =   125 bits (315),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 71/94 (76%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARESS----TVLITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPSVFQ  587
            M  +GMD  +E S    +VL+ TRFVWPYGG+ V L+G+FT WS+  PM+PVEGCP+VFQ
Sbjct  1    MLSSGMDPPQEPSGLAGSVLVPTRFVWPYGGKRVFLTGSFTRWSEHLPMSPVEGCPTVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             ICSL PG H+YKF VDGEWRHDE QP  TG YG
Sbjct  61   AICSLTPGVHEYKFYVDGEWRHDEQQPSVTGRYG  94



>ref|XP_004296819.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011462704.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Fragaria 
vesca subsp. vesca]
Length=491

 Score =   125 bits (315),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 71/95 (75%), Gaps = 6/95 (6%)
 Frame = +3

Query  423  MYPAGMDYARE----SSTVLITTRFVWPYGGRTVCLSGTFTG-WSQW-PMTPVEGCPSVF  584
            M+   MD AR+     STVLI  RFVWPYGGR+V LSG+F   WS+  PMTPVEGCP+VF
Sbjct  1    MFATNMDAARDIGGAQSTVLIPMRFVWPYGGRSVFLSGSFARRWSELVPMTPVEGCPTVF  60

Query  585  QTICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            Q I S+ PG HQYKF VDGEWRHDE+QP+A G YG
Sbjct  61   QAIYSVTPGIHQYKFFVDGEWRHDEHQPYANGEYG  95



>gb|KEH32279.1| sucrose nonfermenting-like protein [Medicago truncatula]
Length=415

 Score =   125 bits (314),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 71/96 (74%), Gaps = 7/96 (7%)
 Frame = +3

Query  423  MYPAGMDYARE------SSTVLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSV  581
            M+   MD AR+      + TVLI  RFVWPYGGRTV LSG+FT WS+   M+PVEGCP+V
Sbjct  1    MFSPSMDSARDVGGVVAAGTVLIPVRFVWPYGGRTVYLSGSFTRWSELLQMSPVEGCPTV  60

Query  582  FQTICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            FQ I +L PGYHQYKF VDGEWRHDE+ P  TG+YG
Sbjct  61   FQVIHNLAPGYHQYKFFVDGEWRHDEHTPHITGDYG  96



>gb|AES91833.2| sucrose nonfermenting-like protein [Medicago truncatula]
Length=481

 Score =   125 bits (314),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 71/96 (74%), Gaps = 7/96 (7%)
 Frame = +3

Query  423  MYPAGMDYARE------SSTVLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSV  581
            M+   MD AR+      + TVLI  RFVWPYGGRTV LSG+FT WS+   M+PVEGCP+V
Sbjct  1    MFSPSMDSARDVGGVVAAGTVLIPVRFVWPYGGRTVYLSGSFTRWSELLQMSPVEGCPTV  60

Query  582  FQTICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            FQ I +L PGYHQYKF VDGEWRHDE+ P  TG+YG
Sbjct  61   FQVIHNLAPGYHQYKFFVDGEWRHDEHTPHITGDYG  96



>gb|KEH32278.1| sucrose nonfermenting-like protein [Medicago truncatula]
Length=459

 Score =   125 bits (314),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 71/96 (74%), Gaps = 7/96 (7%)
 Frame = +3

Query  423  MYPAGMDYARE------SSTVLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSV  581
            M+   MD AR+      + TVLI  RFVWPYGGRTV LSG+FT WS+   M+PVEGCP+V
Sbjct  1    MFSPSMDSARDVGGVVAAGTVLIPVRFVWPYGGRTVYLSGSFTRWSELLQMSPVEGCPTV  60

Query  582  FQTICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            FQ I +L PGYHQYKF VDGEWRHDE+ P  TG+YG
Sbjct  61   FQVIHNLAPGYHQYKFFVDGEWRHDEHTPHITGDYG  96



>ref|XP_006344633.1| PREDICTED: sucrose nonfermenting 4-like protein-like [Solanum 
tuberosum]
Length=483

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = +3

Query  432  AGMDYARESSTVLITTRFVWPYGGRTVCLSGTFTGW-SQWPMTPVEGCPSVFQTICSLPP  608
            +G ++   + TVL+ TRFVWPYGGR V LSG+FT W     M+P+EGCP+VFQ +C+L P
Sbjct  8    SGQNHTGVAGTVLMPTRFVWPYGGRRVLLSGSFTRWQDHITMSPMEGCPTVFQVVCNLTP  67

Query  609  GYHQYKFVVDGEWRHDENQPFATGNYG  689
            GYHQYKF VDGEWRHDE QP  +GNYG
Sbjct  68   GYHQYKFFVDGEWRHDERQPVVSGNYG  94



>ref|XP_002892477.1| hypothetical protein ARALYDRAFT_470981 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68736.1| hypothetical protein ARALYDRAFT_470981 [Arabidopsis lyrata subsp. 
lyrata]
Length=479

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 73/94 (78%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARESST----VLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQ  587
            M+ + +D +R +S     +L  TRFVWPYGGR V LSG+FT W++  PM+P+EGCP+VFQ
Sbjct  1    MFGSTLDSSRGNSAASGQLLTPTRFVWPYGGRRVFLSGSFTRWTEHVPMSPLEGCPTVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             IC+L PGYHQYKF VDGEWRHDE+QPF +GN G
Sbjct  61   VICNLTPGYHQYKFFVDGEWRHDEHQPFVSGNGG  94



>ref|XP_012069369.1| PREDICTED: sucrose nonfermenting 4-like protein [Jatropha curcas]
Length=488

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 73/96 (76%), Gaps = 9/96 (9%)
 Frame = +3

Query  423  MYPAGMDYARESS------TVLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSV  581
            M+ +GMD ARE+       TVL+  RFVWP+GGR+V LSG+F  W++  PM+P+EGCP+V
Sbjct  1    MFASGMDSAREAGGAGVAGTVLM--RFVWPHGGRSVFLSGSFDRWTRLVPMSPMEGCPTV  58

Query  582  FQTICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            FQ ICS+ PGYHQYKF+VDGEWRHDE QP  T  YG
Sbjct  59   FQAICSITPGYHQYKFLVDGEWRHDERQPCLTSEYG  94



>ref|NP_563834.1| putative activator subunit of SNF1-related protein kinase [Arabidopsis 
thaliana]
 sp|Q944A6.1|SNF4_ARATH RecName: Full=Sucrose nonfermenting 4-like protein; Short=SNF4; 
AltName: Full=CBS domain-containing protein CBSCBS3; AltName: 
Full=SNF1-related protein kinase regulatory subunit betagamma; 
Short=AKIN subunit betagamma; Short=AKINbetagamma [Arabidopsis 
thaliana]
 gb|AAL27498.1|AF439826_1 At1g09020/F7G19_11 [Arabidopsis thaliana]
 gb|AAN18191.1| At1g09020/F7G19_11 [Arabidopsis thaliana]
 gb|ABA12450.1| AKINbetagamma [Arabidopsis thaliana]
 gb|AEE28383.1| sucrose nonfermenting 4-like protein [Arabidopsis thaliana]
Length=487

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 73/94 (78%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARESST----VLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQ  587
            M+ + +D +R +S     +L  TRFVWPYGGR V LSG+FT W++  PM+P+EGCP+VFQ
Sbjct  1    MFGSTLDSSRGNSAASGQLLTPTRFVWPYGGRRVFLSGSFTRWTEHVPMSPLEGCPTVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             IC+L PGYHQYKF VDGEWRHDE+QPF +GN G
Sbjct  61   VICNLTPGYHQYKFFVDGEWRHDEHQPFVSGNGG  94



>ref|XP_006417620.1| hypothetical protein EUTSA_v10007484mg [Eutrema salsugineum]
 ref|XP_006417621.1| hypothetical protein EUTSA_v10007484mg [Eutrema salsugineum]
 dbj|BAJ33729.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ35973.1| hypothetical protein EUTSA_v10007484mg [Eutrema salsugineum]
 gb|ESQ35974.1| hypothetical protein EUTSA_v10007484mg [Eutrema salsugineum]
Length=487

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 73/94 (78%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARESST----VLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQ  587
            M+ + +D +R +S     +L  TRFVWPYGGR V LSG+FT W++  PM+P+EGCP+VFQ
Sbjct  1    MFGSTLDSSRGNSAASGQLLTPTRFVWPYGGRRVFLSGSFTRWTEHVPMSPLEGCPTVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             IC+L PGYHQYKF VDGEWRHDE+QPF +GN G
Sbjct  61   VICNLTPGYHQYKFFVDGEWRHDEHQPFVSGNGG  94



>gb|KHG04900.1| Sucrose nonfermenting 4-like protein [Gossypium arboreum]
Length=479

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 69/94 (73%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARE----SSTVLITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPSVFQ  587
            M+ +G +   E    S  +L+  RF+WPYGG  V L+G+FT WS+  PM+P+EGCP+VFQ
Sbjct  1    MFASGSETGHENRGVSRPLLVPMRFIWPYGGSRVFLTGSFTRWSEHIPMSPMEGCPTVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             ICSL PGYHQ+KF VDGEWRHDE QPF  GNYG
Sbjct  61   VICSLSPGYHQFKFFVDGEWRHDERQPFVNGNYG  94



>gb|ABA12451.1| AKINbetagammaI [Arabidopsis thaliana]
Length=394

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 73/94 (78%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARESST----VLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQ  587
            M+ + +D +R +S     +L  TRFVWPYGGR V LSG+FT W++  PM+P+EGCP+VFQ
Sbjct  1    MFGSTLDSSRGNSAASGQLLTPTRFVWPYGGRRVFLSGSFTRWTEHVPMSPLEGCPTVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             IC+L PGYHQYKF VDGEWRHDE+QPF +GN G
Sbjct  61   VICNLTPGYHQYKFFVDGEWRHDEHQPFVSGNGG  94



>ref|XP_011087405.1| PREDICTED: sucrose nonfermenting 4-like protein [Sesamum indicum]
Length=478

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 64/77 (83%), Gaps = 1/77 (1%)
 Frame = +3

Query  462  TVLITTRFVWPYGGRTVCLSGTFTGW-SQWPMTPVEGCPSVFQTICSLPPGYHQYKFVVD  638
            TV++ TRFVWPYGGR V LSGTFT W    PM+P+EGCP+VFQ I +L PGYHQYKF VD
Sbjct  14   TVMVPTRFVWPYGGRRVLLSGTFTRWQDHIPMSPMEGCPTVFQVIYNLTPGYHQYKFFVD  73

Query  639  GEWRHDENQPFATGNYG  689
            GEW+HDE+QPF +GNYG
Sbjct  74   GEWKHDEHQPFVSGNYG  90



>ref|XP_006584037.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 
X1 [Glycine max]
 ref|XP_006584038.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 
X2 [Glycine max]
 gb|KHN02987.1| Sucrose nonfermenting 4-like protein [Glycine soja]
Length=482

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 72/94 (77%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARESS----TVLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQ  587
            M+   MD AR++S    TVLI  RFVWPYGGR+V LSG+FT WS+   M+PVEGCP+VFQ
Sbjct  1    MFSPSMDSARDASGVAGTVLIPMRFVWPYGGRSVYLSGSFTRWSELLQMSPVEGCPTVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             I SL PG+HQYKF VDGEWRHD++QP  +G YG
Sbjct  61   VIHSLIPGHHQYKFFVDGEWRHDDHQPCVSGEYG  94



>gb|KFK43205.1| hypothetical protein AALP_AA1G093900 [Arabis alpina]
Length=487

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 73/94 (78%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARESST----VLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQ  587
            M+ + +D +R +S     +L  TRFVWPYGGR V LSG+FT W++  PM+P+EGCP+VFQ
Sbjct  1    MFGSTLDSSRGNSAASGQLLTPTRFVWPYGGRRVFLSGSFTRWTEHVPMSPLEGCPTVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             IC+L PGYHQYKF VDGEWRHDE+QPF +GN G
Sbjct  61   VICNLTPGYHQYKFFVDGEWRHDEHQPFVSGNGG  94



>emb|CDY32146.1| BnaCnng06550D [Brassica napus]
Length=482

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 72/94 (77%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARESST----VLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQ  587
            M+ + +D +R +S     V+  TRFVWPYGGR V LSG+FT W++  PM+P+EGC +VFQ
Sbjct  1    MFSSTLDNSRGNSAAAGQVVTPTRFVWPYGGRRVYLSGSFTRWTEHVPMSPIEGCATVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             IC+L PGYHQYKF VDGEWRHDE+QPF TGN G
Sbjct  61   VICNLTPGYHQYKFFVDGEWRHDEHQPFVTGNGG  94



>ref|XP_002516895.1| AMP-activated protein kinase, gamma regulatory subunit, putative 
[Ricinus communis]
 gb|EEF45509.1| AMP-activated protein kinase, gamma regulatory subunit, putative 
[Ricinus communis]
Length=485

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 70/93 (75%), Gaps = 4/93 (4%)
 Frame = +3

Query  423  MYPAGMDYARESSTVL---ITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQT  590
            M+  GMD  RES  V    +  RFVWP+GGR+V LSG+F  W++  PM+P+EGCP+VFQ 
Sbjct  1    MFAQGMDCGRESGGVTAGTVLMRFVWPHGGRSVFLSGSFDRWTRLVPMSPMEGCPTVFQA  60

Query  591  ICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            ICS+ PGYHQYKF+VDGEWRHDE QP +T  YG
Sbjct  61   ICSITPGYHQYKFLVDGEWRHDERQPCSTSEYG  93



>ref|XP_012089045.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Jatropha 
curcas]
 gb|KDP23504.1| hypothetical protein JCGZ_23337 [Jatropha curcas]
Length=472

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 72/90 (80%), Gaps = 2/90 (2%)
 Frame = +3

Query  423  MYPAGMDYARESSTVLITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPSVFQTICS  599
            M+ +G   A +++ V +  RFVWPYGGR+V LSG+FTGW++  PM+PVEGCP+VFQ +CS
Sbjct  1    MFSSGPVTAHDNTGV-VPMRFVWPYGGRSVFLSGSFTGWTEHIPMSPVEGCPTVFQVVCS  59

Query  600  LPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            L PGYHQYKF VDGEWRHDE+Q   +GNYG
Sbjct  60   LTPGYHQYKFFVDGEWRHDEHQQSVSGNYG  89



>gb|KHN20226.1| Sucrose nonfermenting 4-like protein [Glycine soja]
Length=480

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 65/76 (86%), Gaps = 1/76 (1%)
 Frame = +3

Query  465  VLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQTICSLPPGYHQYKFVVDG  641
            VLI  RFVWP+GGR V L+G+FT WS + PM+P+EGCP+VFQ ICSLPPGYHQYKF VDG
Sbjct  17   VLIPKRFVWPHGGRRVFLTGSFTRWSAFIPMSPMEGCPTVFQVICSLPPGYHQYKFNVDG  76

Query  642  EWRHDENQPFATGNYG  689
            EWRHDE+QPF +G+ G
Sbjct  77   EWRHDEHQPFVSGDCG  92



>ref|XP_010259697.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Nelumbo 
nucifera]
Length=494

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 70/94 (74%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARESS----TVLITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPSVFQ  587
            MY +G D   E+S    T L+  RFVWPYGGR V LSG+FT WS+   M+PVEGCP+VFQ
Sbjct  1    MYSSGTDSVPEASGVAGTTLVPMRFVWPYGGRRVFLSGSFTRWSEHLLMSPVEGCPTVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             ICSL PG+HQYKF+VD EWRHDE+QP+  G YG
Sbjct  61   AICSLTPGHHQYKFLVDEEWRHDEHQPYINGIYG  94



>ref|XP_003555605.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 
X1 [Glycine max]
 ref|XP_006606520.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 
X2 [Glycine max]
Length=486

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 65/76 (86%), Gaps = 1/76 (1%)
 Frame = +3

Query  465  VLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQTICSLPPGYHQYKFVVDG  641
            VLI  RFVWP+GGR V L+G+FT WS + PM+P+EGCP+VFQ ICSLPPGYHQYKF VDG
Sbjct  23   VLIPKRFVWPHGGRRVFLTGSFTRWSAFIPMSPMEGCPTVFQVICSLPPGYHQYKFNVDG  82

Query  642  EWRHDENQPFATGNYG  689
            EWRHDE+QPF +G+ G
Sbjct  83   EWRHDEHQPFVSGDCG  98



>ref|XP_009352235.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Pyrus 
x bretschneideri]
Length=492

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 71/95 (75%), Gaps = 6/95 (6%)
 Frame = +3

Query  423  MYPAGMDYARES----STVLITTRFVWPYGGRTVCLSGTFTG-WSQW-PMTPVEGCPSVF  584
            M+   MD AR+     STVLI  RFVWPYGGR+V  SG+F   WS+  PMTPVEGCP+VF
Sbjct  1    MFATNMDSARDVVGVPSTVLIPMRFVWPYGGRSVFFSGSFVRRWSELIPMTPVEGCPTVF  60

Query  585  QTICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            Q + S+ PGYHQYKF VDGEWRHDE+QP+ +G YG
Sbjct  61   QAVYSVTPGYHQYKFFVDGEWRHDEHQPYVSGEYG  95



>ref|XP_010259698.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Nelumbo 
nucifera]
Length=485

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 70/94 (74%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARESS----TVLITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPSVFQ  587
            MY +G D   E+S    T L+  RFVWPYGGR V LSG+FT WS+   M+PVEGCP+VFQ
Sbjct  1    MYSSGTDSVPEASGVAGTTLVPMRFVWPYGGRRVFLSGSFTRWSEHLLMSPVEGCPTVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             ICSL PG+HQYKF+VD EWRHDE+QP+  G YG
Sbjct  61   AICSLTPGHHQYKFLVDEEWRHDEHQPYINGIYG  94



>ref|XP_012089047.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X4 [Jatropha 
curcas]
Length=463

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 72/90 (80%), Gaps = 2/90 (2%)
 Frame = +3

Query  423  MYPAGMDYARESSTVLITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPSVFQTICS  599
            M+ +G   A +++ V +  RFVWPYGGR+V LSG+FTGW++  PM+PVEGCP+VFQ +CS
Sbjct  1    MFSSGPVTAHDNTGV-VPMRFVWPYGGRSVFLSGSFTGWTEHIPMSPVEGCPTVFQVVCS  59

Query  600  LPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            L PGYHQYKF VDGEWRHDE+Q   +GNYG
Sbjct  60   LTPGYHQYKFFVDGEWRHDEHQQSVSGNYG  89



>ref|XP_007138886.1| hypothetical protein PHAVU_009G246000g [Phaseolus vulgaris]
 gb|ESW10880.1| hypothetical protein PHAVU_009G246000g [Phaseolus vulgaris]
Length=457

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 69/89 (78%), Gaps = 5/89 (6%)
 Frame = +3

Query  438  MDYARESS----TVLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQTICSL  602
            MD +R++     TVLI  RFVWPYGGR+V L G+FT WS+  PM+PVEGCP+VFQ I +L
Sbjct  1    MDSSRDAGVVAGTVLIPMRFVWPYGGRSVFLCGSFTRWSELLPMSPVEGCPTVFQVIYNL  60

Query  603  PPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            PPGYHQYKF VDGEWRHDE+Q +  G YG
Sbjct  61   PPGYHQYKFFVDGEWRHDEHQAYVPGEYG  89



>ref|XP_010458170.1| PREDICTED: sucrose nonfermenting 4-like protein [Camelina sativa]
Length=487

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 73/94 (78%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARESST----VLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQ  587
            M+ + +D +R +S     +L  TRFVWPYGGR V LSG+FT W++  P++P+EGCP+VFQ
Sbjct  1    MFGSTLDSSRGNSAASGQLLTPTRFVWPYGGRRVFLSGSFTRWTEHVPLSPLEGCPTVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             IC+L PGYHQYKF VDGEWRHDE+QPF +GN G
Sbjct  61   VICNLTPGYHQYKFFVDGEWRHDEHQPFVSGNGG  94



>ref|XP_007154249.1| hypothetical protein PHAVU_003G103000g [Phaseolus vulgaris]
 ref|XP_007154250.1| hypothetical protein PHAVU_003G103000g [Phaseolus vulgaris]
 ref|XP_007154251.1| hypothetical protein PHAVU_003G103000g [Phaseolus vulgaris]
 ref|XP_007154252.1| hypothetical protein PHAVU_003G103000g [Phaseolus vulgaris]
 gb|ESW26243.1| hypothetical protein PHAVU_003G103000g [Phaseolus vulgaris]
 gb|ESW26244.1| hypothetical protein PHAVU_003G103000g [Phaseolus vulgaris]
 gb|ESW26245.1| hypothetical protein PHAVU_003G103000g [Phaseolus vulgaris]
 gb|ESW26246.1| hypothetical protein PHAVU_003G103000g [Phaseolus vulgaris]
Length=480

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 70/94 (74%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARESS----TVLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQ  587
            M+   MD AR++      VLI  RFVWPYGGR+V LSG+FT WS+   M+PVEGCP+VFQ
Sbjct  1    MFSPSMDSARDAGGVAGAVLIPMRFVWPYGGRSVYLSGSFTRWSELLQMSPVEGCPTVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             I SL PGYHQYKF VDGEWRHDE+QP  +G YG
Sbjct  61   VIHSLAPGYHQYKFYVDGEWRHDEHQPCLSGEYG  94



>ref|XP_010475723.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Camelina 
sativa]
Length=487

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 73/94 (78%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARESST----VLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQ  587
            M+ + +D +R +S     +L  TRFVWPYGGR V LSG+FT W++  P++P+EGCP+VFQ
Sbjct  1    MFGSTLDSSRGNSAASGQLLTPTRFVWPYGGRRVFLSGSFTRWTEHVPLSPLEGCPTVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             IC+L PGYHQYKF VDGEWRHDE+QPF +GN G
Sbjct  61   VICNLTPGYHQYKFFVDGEWRHDEHQPFVSGNGG  94



>ref|XP_006307328.1| hypothetical protein CARUB_v10008946mg [Capsella rubella]
 gb|EOA40226.1| hypothetical protein CARUB_v10008946mg [Capsella rubella]
Length=495

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 73/94 (78%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARESST----VLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQ  587
            M+ + +D +R +S     +L  TRFVWPYGGR V LSG+FT W++  P++P+EGCP+VFQ
Sbjct  1    MFGSTLDSSRGNSAASGQLLTPTRFVWPYGGRRVFLSGSFTRWTEHVPLSPLEGCPTVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             IC+L PGYHQYKF VDGEWRHDE+QPF +GN G
Sbjct  61   VICNLTPGYHQYKFFVDGEWRHDEHQPFVSGNGG  94



>ref|XP_010489630.1| PREDICTED: sucrose nonfermenting 4-like protein [Camelina sativa]
Length=487

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 73/94 (78%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARESST----VLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQ  587
            M+ + +D +R +S     +L  TRFVWPYGGR V LSG+FT W++  P++P+EGCP+VFQ
Sbjct  1    MFGSTLDSSRGNSAASGQLLTPTRFVWPYGGRRVFLSGSFTRWTEHVPLSPLEGCPTVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             IC+L PGYHQYKF VDGEWRHDE+QPF +GN G
Sbjct  61   VICNLTPGYHQYKFFVDGEWRHDEHQPFVSGNGG  94



>ref|XP_006307327.1| hypothetical protein CARUB_v10008946mg [Capsella rubella]
 gb|EOA40225.1| hypothetical protein CARUB_v10008946mg [Capsella rubella]
Length=484

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 73/94 (78%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARESST----VLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQ  587
            M+ + +D +R +S     +L  TRFVWPYGGR V LSG+FT W++  P++P+EGCP+VFQ
Sbjct  1    MFGSTLDSSRGNSAASGQLLTPTRFVWPYGGRRVFLSGSFTRWTEHVPLSPLEGCPTVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             IC+L PGYHQYKF VDGEWRHDE+QPF +GN G
Sbjct  61   VICNLTPGYHQYKFFVDGEWRHDEHQPFVSGNGG  94



>ref|XP_006307326.1| hypothetical protein CARUB_v10008946mg [Capsella rubella]
 gb|EOA40224.1| hypothetical protein CARUB_v10008946mg [Capsella rubella]
Length=394

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 73/94 (78%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARESST----VLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQ  587
            M+ + +D +R +S     +L  TRFVWPYGGR V LSG+FT W++  P++P+EGCP+VFQ
Sbjct  1    MFGSTLDSSRGNSAASGQLLTPTRFVWPYGGRRVFLSGSFTRWTEHVPLSPLEGCPTVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             IC+L PGYHQYKF VDGEWRHDE+QPF +GN G
Sbjct  61   VICNLTPGYHQYKFFVDGEWRHDEHQPFVSGNGG  94



>gb|KJB26425.1| hypothetical protein B456_004G240500 [Gossypium raimondii]
Length=449

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 62/79 (78%), Gaps = 1/79 (1%)
 Frame = +3

Query  456  SSTVLITTRFVWPYGGRTVCLSGTFTGW-SQWPMTPVEGCPSVFQTICSLPPGYHQYKFV  632
            S  +LI  RFVWPYGGR V LSG+FT W    PM+P+EGCP+VFQ ICSL PGYHQ+KF 
Sbjct  16   SGPLLIPMRFVWPYGGRRVFLSGSFTRWLEHIPMSPMEGCPTVFQVICSLSPGYHQFKFF  75

Query  633  VDGEWRHDENQPFATGNYG  689
            VDGEWRHDE+QPF   NYG
Sbjct  76   VDGEWRHDEHQPFVNDNYG  94



>ref|XP_010475724.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Camelina 
sativa]
Length=463

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 73/94 (78%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARESST----VLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQ  587
            M+ + +D +R +S     +L  TRFVWPYGGR V LSG+FT W++  P++P+EGCP+VFQ
Sbjct  1    MFGSTLDSSRGNSAASGQLLTPTRFVWPYGGRRVFLSGSFTRWTEHVPLSPLEGCPTVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             IC+L PGYHQYKF VDGEWRHDE+QPF +GN G
Sbjct  61   VICNLTPGYHQYKFFVDGEWRHDEHQPFVSGNGG  94



>ref|XP_012089044.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Jatropha 
curcas]
Length=512

 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 72/90 (80%), Gaps = 2/90 (2%)
 Frame = +3

Query  423  MYPAGMDYARESSTVLITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPSVFQTICS  599
            M+ +G   A +++ V +  RFVWPYGGR+V LSG+FTGW++  PM+PVEGCP+VFQ +CS
Sbjct  1    MFSSGPVTAHDNTGV-VPMRFVWPYGGRSVFLSGSFTGWTEHIPMSPVEGCPTVFQVVCS  59

Query  600  LPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            L PGYHQYKF VDGEWRHDE+Q   +GNYG
Sbjct  60   LTPGYHQYKFFVDGEWRHDEHQQSVSGNYG  89



>gb|KHF98317.1| Sucrose nonfermenting 4-like protein [Gossypium arboreum]
Length=479

 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 62/79 (78%), Gaps = 1/79 (1%)
 Frame = +3

Query  456  SSTVLITTRFVWPYGGRTVCLSGTFTGW-SQWPMTPVEGCPSVFQTICSLPPGYHQYKFV  632
            S  +LI  RFVWPYGGR V LSG+FT W    PM+P+EGCP+VFQ ICSL PGYHQ+KF 
Sbjct  16   SGPLLIPMRFVWPYGGRRVFLSGSFTRWLEHIPMSPMEGCPTVFQVICSLSPGYHQFKFF  75

Query  633  VDGEWRHDENQPFATGNYG  689
            VDGEWRHDE+QPF   NYG
Sbjct  76   VDGEWRHDEHQPFVNDNYG  94



>gb|KJB26424.1| hypothetical protein B456_004G240500 [Gossypium raimondii]
Length=479

 Score =   123 bits (308),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 62/79 (78%), Gaps = 1/79 (1%)
 Frame = +3

Query  456  SSTVLITTRFVWPYGGRTVCLSGTFTGW-SQWPMTPVEGCPSVFQTICSLPPGYHQYKFV  632
            S  +LI  RFVWPYGGR V LSG+FT W    PM+P+EGCP+VFQ ICSL PGYHQ+KF 
Sbjct  16   SGPLLIPMRFVWPYGGRRVFLSGSFTRWLEHIPMSPMEGCPTVFQVICSLSPGYHQFKFF  75

Query  633  VDGEWRHDENQPFATGNYG  689
            VDGEWRHDE+QPF   NYG
Sbjct  76   VDGEWRHDEHQPFVNDNYG  94



>emb|CDY06344.1| BnaA09g48590D [Brassica napus]
Length=482

 Score =   123 bits (308),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 65/79 (82%), Gaps = 1/79 (1%)
 Frame = +3

Query  456  SSTVLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQTICSLPPGYHQYKFV  632
            S+ ++  TRFVWPYGGR V LSG+FT W++  PM+P+EGCPSVFQ IC+L PGYHQYKF 
Sbjct  16   SAQLVTPTRFVWPYGGRRVFLSGSFTRWTEHVPMSPLEGCPSVFQVICNLTPGYHQYKFY  75

Query  633  VDGEWRHDENQPFATGNYG  689
            VDGEWRHDE+QPF  GN G
Sbjct  76   VDGEWRHDEHQPFVNGNGG  94



>ref|XP_003550198.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 
X1 [Glycine max]
 ref|XP_006600341.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 
X2 [Glycine max]
 ref|XP_006600342.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 
X3 [Glycine max]
 gb|KHN03377.1| Sucrose nonfermenting 4-like protein [Glycine soja]
Length=482

 Score =   123 bits (308),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 71/94 (76%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARESS----TVLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQ  587
            M+   MD AR++S    TVLI  RFVWPYGGR+V LSG+FT WS+   M+PVEGCP+VFQ
Sbjct  1    MFSPSMDSARDASGVAGTVLIPMRFVWPYGGRSVYLSGSFTRWSELLQMSPVEGCPTVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             I SL PG+HQYKF VDGEWRHD+ QP  +G YG
Sbjct  61   VIHSLVPGHHQYKFFVDGEWRHDDLQPCESGEYG  94



>ref|XP_003609636.1| 5'-AMP-activated protein kinase subunit gamma [Medicago truncatula]
Length=489

 Score =   123 bits (308),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 69/91 (76%), Gaps = 7/91 (8%)
 Frame = +3

Query  438  MDYARE------SSTVLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQTIC  596
            MD AR+      + TVLI  RFVWPYGGRTV LSG+FT WS+   M+PVEGCP+VFQ I 
Sbjct  1    MDSARDVGGVVAAGTVLIPVRFVWPYGGRTVYLSGSFTRWSELLQMSPVEGCPTVFQVIH  60

Query  597  SLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            +L PGYHQYKF VDGEWRHDE+ P  TG+YG
Sbjct  61   NLAPGYHQYKFFVDGEWRHDEHTPHITGDYG  91



>gb|KJB45988.1| hypothetical protein B456_007G342100 [Gossypium raimondii]
Length=479

 Score =   122 bits (307),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 64/79 (81%), Gaps = 1/79 (1%)
 Frame = +3

Query  456  SSTVLITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPSVFQTICSLPPGYHQYKFV  632
            S ++LI  RFVWPYGG  V +SG+FT WS+  PM+P+EGCP+VFQ ICSL PGYHQ+KF 
Sbjct  16   SRSLLIPMRFVWPYGGSRVFISGSFTRWSEHIPMSPMEGCPTVFQVICSLSPGYHQFKFF  75

Query  633  VDGEWRHDENQPFATGNYG  689
            VD EWRHDE+QPF  G+YG
Sbjct  76   VDNEWRHDEHQPFVIGDYG  94



>ref|XP_009791916.1| PREDICTED: sucrose nonfermenting 4-like protein [Nicotiana sylvestris]
Length=484

 Score =   122 bits (307),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 68/95 (72%), Gaps = 6/95 (6%)
 Frame = +3

Query  423  MYPAGMDYARESS-----TVLITTRFVWPYGGRTVCLSGTFTGW-SQWPMTPVEGCPSVF  584
            M+ +G D  +  S     TVLI TRFVWPYGGR V LSG+FT W     M+P+EGCP+VF
Sbjct  1    MFGSGSDSGQNHSGVGAGTVLIPTRFVWPYGGRRVLLSGSFTRWQDHITMSPMEGCPTVF  60

Query  585  QTICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            Q +C+L PGYHQYKF VD EWRHDE Q F +GNYG
Sbjct  61   QVVCNLTPGYHQYKFCVDEEWRHDERQQFVSGNYG  95



>emb|CDY31116.1| BnaA08g26660D [Brassica napus]
Length=482

 Score =   122 bits (307),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 71/94 (76%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARESST----VLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQ  587
            M+ + +D +R +S     V+  TRFVWPYGGR V LSG+FT W++  PM+P+EGC +VFQ
Sbjct  1    MFSSTLDNSRGNSAAAGQVVTPTRFVWPYGGRRVYLSGSFTRWTEHVPMSPIEGCATVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             IC+L PGYHQYKF VDGEWRHDE+QPF T N G
Sbjct  61   VICNLTPGYHQYKFFVDGEWRHDEHQPFVTANGG  94



>gb|AGA95983.1| sucrose non-fermenting 4 [Brassica rapa subsp. pekinensis]
Length=482

 Score =   122 bits (307),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 71/94 (76%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARESST----VLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQ  587
            M+ + +D +R +S     V+  TRFVWPYGGR V LSG+FT W++  PM+P+EGC +VFQ
Sbjct  1    MFSSTLDNSRGNSAAAGQVVTPTRFVWPYGGRRVYLSGSFTRWTEHVPMSPIEGCATVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             IC+L PGYHQYKF VDGEWRHDE+QPF T N G
Sbjct  61   VICNLTPGYHQYKFFVDGEWRHDEHQPFVTANGG  94



>gb|KJB45989.1| hypothetical protein B456_007G342100 [Gossypium raimondii]
Length=464

 Score =   122 bits (306),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 64/79 (81%), Gaps = 1/79 (1%)
 Frame = +3

Query  456  SSTVLITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPSVFQTICSLPPGYHQYKFV  632
            S ++LI  RFVWPYGG  V +SG+FT WS+  PM+P+EGCP+VFQ ICSL PGYHQ+KF 
Sbjct  16   SRSLLIPMRFVWPYGGSRVFISGSFTRWSEHIPMSPMEGCPTVFQVICSLSPGYHQFKFF  75

Query  633  VDGEWRHDENQPFATGNYG  689
            VD EWRHDE+QPF  G+YG
Sbjct  76   VDNEWRHDEHQPFVIGDYG  94



>gb|KJB45263.1| hypothetical protein B456_007G298100 [Gossypium raimondii]
Length=479

 Score =   122 bits (306),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 69/94 (73%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARE----SSTVLITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPSVFQ  587
            M+ +G +   E    S  +L+  RF+WPYGG  V L+G+FT WS+  PM+P+EGCP+VFQ
Sbjct  1    MFASGPETGHENRGVSRPLLVPMRFIWPYGGSRVFLTGSFTRWSEHIPMSPMEGCPTVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             ICSL PGYHQ+KF VDGEWRHD+ QPF  GNYG
Sbjct  61   VICSLSPGYHQFKFFVDGEWRHDDRQPFVNGNYG  94



>ref|XP_007144724.1| hypothetical protein PHAVU_007G179400g [Phaseolus vulgaris]
 gb|ESW16718.1| hypothetical protein PHAVU_007G179400g [Phaseolus vulgaris]
Length=485

 Score =   122 bits (306),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +3

Query  465  VLITTRFVWPYGGRTVCLSGTFTGWSQWPMTPVEGCPSVFQTICSLPPGYHQYKFVVDGE  644
            VLI  RFVWP+GGR V L+G+FT W+  PM+P++GCPSVF+ IC L PGYHQYKF VDGE
Sbjct  23   VLIPKRFVWPHGGRMVFLTGSFTRWTTVPMSPMQGCPSVFEVICGLMPGYHQYKFNVDGE  82

Query  645  WRHDENQPFATGNYG  689
            WRHDE+QPF  GN+G
Sbjct  83   WRHDEHQPFVYGNFG  97



>gb|KJB45265.1| hypothetical protein B456_007G298100 [Gossypium raimondii]
Length=399

 Score =   122 bits (305),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 69/94 (73%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARE----SSTVLITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPSVFQ  587
            M+ +G +   E    S  +L+  RF+WPYGG  V L+G+FT WS+  PM+P+EGCP+VFQ
Sbjct  1    MFASGPETGHENRGVSRPLLVPMRFIWPYGGSRVFLTGSFTRWSEHIPMSPMEGCPTVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             ICSL PGYHQ+KF VDGEWRHD+ QPF  GNYG
Sbjct  61   VICSLSPGYHQFKFFVDGEWRHDDRQPFVNGNYG  94



>gb|KJB45264.1| hypothetical protein B456_007G298100 [Gossypium raimondii]
Length=434

 Score =   122 bits (306),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 69/94 (73%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARE----SSTVLITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPSVFQ  587
            M+ +G +   E    S  +L+  RF+WPYGG  V L+G+FT WS+  PM+P+EGCP+VFQ
Sbjct  1    MFASGPETGHENRGVSRPLLVPMRFIWPYGGSRVFLTGSFTRWSEHIPMSPMEGCPTVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             ICSL PGYHQ+KF VDGEWRHD+ QPF  GNYG
Sbjct  61   VICSLSPGYHQFKFFVDGEWRHDDRQPFVNGNYG  94



>ref|XP_009588179.1| PREDICTED: sucrose nonfermenting 4-like protein [Nicotiana tomentosiformis]
Length=484

 Score =   122 bits (306),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 70/95 (74%), Gaps = 6/95 (6%)
 Frame = +3

Query  423  MYPAGMDYARESS-----TVLITTRFVWPYGGRTVCLSGTFTGW-SQWPMTPVEGCPSVF  584
            M+ +G D  +  S     TVL+ TRFVWPYGGR V LSG+FT W     M+P+EGCP+VF
Sbjct  1    MFGSGSDSGQNHSGVGAGTVLMPTRFVWPYGGRRVLLSGSFTRWQDHITMSPMEGCPTVF  60

Query  585  QTICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            Q +C+L PGYHQYKF VDGEWRHDE+Q F +G+YG
Sbjct  61   QVVCNLTPGYHQYKFCVDGEWRHDEHQQFVSGSYG  95



>ref|XP_011627434.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Amborella 
trichopoda]
Length=481

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 68/91 (75%), Gaps = 2/91 (2%)
 Frame = +3

Query  423  MYPAGMDYARESS-TVLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQTIC  596
            M+  G D A ESS  V+I TRFVWPYGGR V L G+F  WS+   M+PVEGCP+VFQ IC
Sbjct  1    MFSPGGDPAPESSGVVVIPTRFVWPYGGRKVFLCGSFLRWSEHRQMSPVEGCPTVFQAIC  60

Query  597  SLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            +L PGYHQYKF VDGEWR+DE  PF  GNYG
Sbjct  61   NLTPGYHQYKFYVDGEWRYDERLPFVNGNYG  91



>ref|XP_006855487.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Amborella 
trichopoda]
 gb|ERN16954.1| hypothetical protein AMTR_s00057p00193960 [Amborella trichopoda]
Length=490

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 68/91 (75%), Gaps = 2/91 (2%)
 Frame = +3

Query  423  MYPAGMDYARESS-TVLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQTIC  596
            M+  G D A ESS  V+I TRFVWPYGGR V L G+F  WS+   M+PVEGCP+VFQ IC
Sbjct  1    MFSPGGDPAPESSGVVVIPTRFVWPYGGRKVFLCGSFLRWSEHRQMSPVEGCPTVFQAIC  60

Query  597  SLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            +L PGYHQYKF VDGEWR+DE  PF  GNYG
Sbjct  61   NLTPGYHQYKFYVDGEWRYDERLPFVNGNYG  91



>ref|NP_001051949.1| Os03g0856400 [Oryza sativa Japonica Group]
 gb|AAP21389.1| putative protein kinase AKINbetagamma [Oryza sativa Japonica 
Group]
 gb|AAS01982.1| putative protein kinase AKINbetagamma-2 [Oryza sativa Japonica 
Group]
 gb|ABF99987.1| protein kinase AKINbetagamma-2, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13863.1| Os03g0856400 [Oryza sativa Japonica Group]
 dbj|BAG95656.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99282.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC76569.1| hypothetical protein OsI_14400 [Oryza sativa Indica Group]
 gb|EEE60333.1| hypothetical protein OsJ_13432 [Oryza sativa Japonica Group]
Length=493

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 69/95 (73%), Gaps = 6/95 (6%)
 Frame = +3

Query  423  MYPAGMDYARESSTVL-----ITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPSVF  584
            M+  G D A ++  V      + TRFVWPYGG+ V L+G+FT W++  PM+PVEGCP+VF
Sbjct  1    MFSHGADSAHDAGAVSTGASGVPTRFVWPYGGKRVYLTGSFTRWTEHLPMSPVEGCPTVF  60

Query  585  QTICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            Q ICSL PG HQYKF VDGEWRHDE QP  TG+YG
Sbjct  61   QAICSLSPGIHQYKFCVDGEWRHDERQPTITGDYG  95



>emb|CDX95016.1| BnaC05g06550D [Brassica napus]
Length=483

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 71/95 (75%), Gaps = 6/95 (6%)
 Frame = +3

Query  423  MYPAGMDYARESST-----VLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVF  584
            M+ + +D +R +S      +L  TRFVWPYGGR V LSG+FT W++  PM+P+EGCP+VF
Sbjct  1    MFGSTVDTSRGNSAASGQQLLTPTRFVWPYGGRRVFLSGSFTRWTEHVPMSPLEGCPTVF  60

Query  585  QTICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            Q IC+L PGYHQYKF VDGEWRHDE+QPF   N G
Sbjct  61   QVICNLTPGYHQYKFYVDGEWRHDEHQPFVNANGG  95



>emb|CDP15501.1| unnamed protein product [Coffea canephora]
Length=483

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 66/82 (80%), Gaps = 1/82 (1%)
 Frame = +3

Query  447  ARESSTVLITTRFVWPYGGRTVCLSGTFTGW-SQWPMTPVEGCPSVFQTICSLPPGYHQY  623
            A    T+L+ TRFVWP+GGR V +SG+FT W +  PM+P+EGCP+VFQ + +L PGYHQ+
Sbjct  16   AEGGDTILVPTRFVWPHGGRRVFVSGSFTRWTNHIPMSPMEGCPTVFQVVYNLTPGYHQF  75

Query  624  KFVVDGEWRHDENQPFATGNYG  689
            KF VDGEWRHDE+QPF +GNYG
Sbjct  76   KFFVDGEWRHDEHQPFVSGNYG  97



>ref|XP_010921763.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Elaeis 
guineensis]
Length=493

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 70/94 (74%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARE----SSTVLITTRFVWPYGGRTVCLSGTFTGWS-QWPMTPVEGCPSVFQ  587
            M+P G + +++    S  VLI TRFVWPYGGR V L+G+FT W+    M+PVEGCPSVFQ
Sbjct  1    MFPPGTNPSQDATGASGGVLIPTRFVWPYGGRRVLLTGSFTRWTDHILMSPVEGCPSVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            T+ +L PG HQYKF VDGEWRHDE QPF  GNYG
Sbjct  61   TMWNLTPGVHQYKFCVDGEWRHDEQQPFVVGNYG  94



>ref|XP_010921766.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X5 [Elaeis 
guineensis]
Length=469

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 70/94 (74%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARE----SSTVLITTRFVWPYGGRTVCLSGTFTGWS-QWPMTPVEGCPSVFQ  587
            M+P G + +++    S  VLI TRFVWPYGGR V L+G+FT W+    M+PVEGCPSVFQ
Sbjct  1    MFPPGTNPSQDATGASGGVLIPTRFVWPYGGRRVLLTGSFTRWTDHILMSPVEGCPSVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            T+ +L PG HQYKF VDGEWRHDE QPF  GNYG
Sbjct  61   TMWNLTPGVHQYKFCVDGEWRHDEQQPFVVGNYG  94



>ref|XP_008789953.1| PREDICTED: sucrose nonfermenting 4-like protein [Phoenix dactylifera]
 ref|XP_008789954.1| PREDICTED: sucrose nonfermenting 4-like protein [Phoenix dactylifera]
 ref|XP_008789955.1| PREDICTED: sucrose nonfermenting 4-like protein [Phoenix dactylifera]
 ref|XP_008789956.1| PREDICTED: sucrose nonfermenting 4-like protein [Phoenix dactylifera]
Length=501

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 62/79 (78%), Gaps = 1/79 (1%)
 Frame = +3

Query  456  SSTVLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQTICSLPPGYHQYKFV  632
            S  V + TRFVWPYGGR V L+GTFT W+   PM+PVEGCPSVFQTI +L PG HQYKF 
Sbjct  16   SGGVAVPTRFVWPYGGRRVLLTGTFTRWTDLIPMSPVEGCPSVFQTIWNLAPGIHQYKFY  75

Query  633  VDGEWRHDENQPFATGNYG  689
            VDGEWRHDE QP+  GNYG
Sbjct  76   VDGEWRHDERQPYVVGNYG  94



>ref|XP_010921764.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X3 [Elaeis 
guineensis]
Length=482

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 70/94 (74%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARE----SSTVLITTRFVWPYGGRTVCLSGTFTGWS-QWPMTPVEGCPSVFQ  587
            M+P G + +++    S  VLI TRFVWPYGGR V L+G+FT W+    M+PVEGCPSVFQ
Sbjct  1    MFPPGTNPSQDATGASGGVLIPTRFVWPYGGRRVLLTGSFTRWTDHILMSPVEGCPSVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            T+ +L PG HQYKF VDGEWRHDE QPF  GNYG
Sbjct  61   TMWNLTPGVHQYKFCVDGEWRHDEQQPFVVGNYG  94



>ref|XP_010921762.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Elaeis 
guineensis]
Length=502

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 70/94 (74%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARE----SSTVLITTRFVWPYGGRTVCLSGTFTGWS-QWPMTPVEGCPSVFQ  587
            M+P G + +++    S  VLI TRFVWPYGGR V L+G+FT W+    M+PVEGCPSVFQ
Sbjct  1    MFPPGTNPSQDATGASGGVLIPTRFVWPYGGRRVLLTGSFTRWTDHILMSPVEGCPSVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            T+ +L PG HQYKF VDGEWRHDE QPF  GNYG
Sbjct  61   TMWNLTPGVHQYKFCVDGEWRHDEQQPFVVGNYG  94



>ref|XP_010921768.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X7 [Elaeis 
guineensis]
Length=412

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 70/94 (74%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARE----SSTVLITTRFVWPYGGRTVCLSGTFTGWS-QWPMTPVEGCPSVFQ  587
            M+P G + +++    S  VLI TRFVWPYGGR V L+G+FT W+    M+PVEGCPSVFQ
Sbjct  1    MFPPGTNPSQDATGASGGVLIPTRFVWPYGGRRVLLTGSFTRWTDHILMSPVEGCPSVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            T+ +L PG HQYKF VDGEWRHDE QPF  GNYG
Sbjct  61   TMWNLTPGVHQYKFCVDGEWRHDEQQPFVVGNYG  94



>ref|XP_010921765.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X4 [Elaeis 
guineensis]
Length=478

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 70/94 (74%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARE----SSTVLITTRFVWPYGGRTVCLSGTFTGWS-QWPMTPVEGCPSVFQ  587
            M+P G + +++    S  VLI TRFVWPYGGR V L+G+FT W+    M+PVEGCPSVFQ
Sbjct  1    MFPPGTNPSQDATGASGGVLIPTRFVWPYGGRRVLLTGSFTRWTDHILMSPVEGCPSVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            T+ +L PG HQYKF VDGEWRHDE QPF  GNYG
Sbjct  61   TMWNLTPGVHQYKFCVDGEWRHDEQQPFVVGNYG  94



>ref|XP_009148157.1| PREDICTED: sucrose nonfermenting 4-like protein [Brassica rapa]
Length=484

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 71/96 (74%), Gaps = 7/96 (7%)
 Frame = +3

Query  423  MYPAGMDYARESST------VLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSV  581
            M+ + +D +R +S       +L  TRFVWPYGGR V LSG+FT W++  PM+P+EGCP+V
Sbjct  1    MFGSTVDTSRGNSAASGQQQLLTPTRFVWPYGGRRVFLSGSFTRWTEHVPMSPLEGCPTV  60

Query  582  FQTICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            FQ IC+L PGYHQYKF VDGEWRHDE+QPF   N G
Sbjct  61   FQVICNLTPGYHQYKFYVDGEWRHDEHQPFVNANGG  96



>emb|CDX93522.1| BnaA06g05260D [Brassica napus]
Length=484

 Score =   120 bits (302),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 71/96 (74%), Gaps = 7/96 (7%)
 Frame = +3

Query  423  MYPAGMDYARESST------VLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSV  581
            M+ + +D +R +S       +L  TRFVWPYGGR V LSG+FT W++  PM+P+EGCP+V
Sbjct  1    MFGSTVDTSRGNSAASGQQQLLTPTRFVWPYGGRRVFLSGSFTRWTEHVPMSPLEGCPTV  60

Query  582  FQTICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            FQ IC+L PGYHQYKF VDGEWRHDE+QPF   N G
Sbjct  61   FQVICNLTPGYHQYKFYVDGEWRHDEHQPFVNANGG  96



>gb|KHG04062.1| Sucrose nonfermenting 4-like protein [Gossypium arboreum]
Length=543

 Score =   121 bits (303),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 63/79 (80%), Gaps = 1/79 (1%)
 Frame = +3

Query  456  SSTVLITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPSVFQTICSLPPGYHQYKFV  632
            S ++LI  RFVWPYGG  V L G+FT WS+  PM+P+EGCP+VFQ ICSL PGYHQ+KF 
Sbjct  16   SRSLLIPMRFVWPYGGSRVFLCGSFTRWSEHIPMSPMEGCPTVFQVICSLSPGYHQFKFF  75

Query  633  VDGEWRHDENQPFATGNYG  689
            VD EWRHDE+QPF  G+YG
Sbjct  76   VDNEWRHDEHQPFVIGDYG  94



>ref|XP_009387023.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=418

 Score =   120 bits (300),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 63/84 (75%), Gaps = 1/84 (1%)
 Frame = +3

Query  441  DYARESSTVLITTRFVWPYGGRTVCLSGTFTGWS-QWPMTPVEGCPSVFQTICSLPPGYH  617
            D A  S  VLI T+FVWPYGGRTV L G+FTGW+ ++PM P E CP++FQ + SL PG H
Sbjct  11   DTAGISGQVLIATKFVWPYGGRTVSLIGSFTGWTDRYPMFPAEDCPNIFQAVYSLTPGIH  70

Query  618  QYKFVVDGEWRHDENQPFATGNYG  689
            QYKF VDGEWRHD+ QP   GNYG
Sbjct  71   QYKFFVDGEWRHDDQQPHVVGNYG  94



>ref|XP_009387018.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009387019.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009387020.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009387022.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=484

 Score =   120 bits (301),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 63/84 (75%), Gaps = 1/84 (1%)
 Frame = +3

Query  441  DYARESSTVLITTRFVWPYGGRTVCLSGTFTGWS-QWPMTPVEGCPSVFQTICSLPPGYH  617
            D A  S  VLI T+FVWPYGGRTV L G+FTGW+ ++PM P E CP++FQ + SL PG H
Sbjct  11   DTAGISGQVLIATKFVWPYGGRTVSLIGSFTGWTDRYPMFPAEDCPNIFQAVYSLTPGIH  70

Query  618  QYKFVVDGEWRHDENQPFATGNYG  689
            QYKF VDGEWRHD+ QP   GNYG
Sbjct  71   QYKFFVDGEWRHDDQQPHVVGNYG  94



>ref|XP_008388557.1| PREDICTED: sucrose nonfermenting 4-like protein [Malus domestica]
Length=480

 Score =   120 bits (301),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 65/87 (75%), Gaps = 1/87 (1%)
 Frame = +3

Query  432  AGMDYARESSTVLITTRFVWPYGGRTVCLSGTFTGW-SQWPMTPVEGCPSVFQTICSLPP  608
            A    +R S  VLI TRFVWPYGGR+V +SG+FT W  Q PM PVEGCP+VFQ + +L P
Sbjct  8    AAHQSSRLSVPVLIPTRFVWPYGGRSVFVSGSFTRWLEQIPMAPVEGCPTVFQVVWNLTP  67

Query  609  GYHQYKFVVDGEWRHDENQPFATGNYG  689
            GYHQYKF VDG+WRHDE+QPF   N G
Sbjct  68   GYHQYKFFVDGQWRHDEHQPFVNANGG  94



>ref|XP_004302417.1| PREDICTED: sucrose nonfermenting 4-like protein [Fragaria vesca 
subsp. vesca]
Length=482

 Score =   120 bits (300),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 64/76 (84%), Gaps = 1/76 (1%)
 Frame = +3

Query  465  VLITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPSVFQTICSLPPGYHQYKFVVDG  641
            +LI TRFVWPYGGR V LSG+FT W +  PM+P+EGCP+VFQ + +L PGYHQYKF VDG
Sbjct  18   ILIPTRFVWPYGGRRVFLSGSFTRWEEHIPMSPMEGCPTVFQVVWNLTPGYHQYKFFVDG  77

Query  642  EWRHDENQPFATGNYG  689
            EWRH+E+QPF TGN+G
Sbjct  78   EWRHNEHQPFVTGNFG  93



>ref|XP_006650929.1| PREDICTED: sucrose nonfermenting 4-like protein-like [Oryza brachyantha]
Length=487

 Score =   120 bits (300),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 69/90 (77%), Gaps = 2/90 (2%)
 Frame = +3

Query  423  MYPAGMDYARESSTVLITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPSVFQTICS  599
            M+  G D A E+++    TRFVWPYGG+ V L+G+FT W++  PM+PVEGCP+VFQ IC+
Sbjct  1    MFSHGTDSAPEAASGF-PTRFVWPYGGKRVYLTGSFTRWTEHLPMSPVEGCPTVFQAICN  59

Query  600  LPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            L PG HQYKF VDGEWRHDE QP  TG+YG
Sbjct  60   LSPGIHQYKFCVDGEWRHDERQPTITGDYG  89



>emb|CDY22651.1| BnaC08g42850D [Brassica napus]
Length=482

 Score =   120 bits (300),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 64/79 (81%), Gaps = 1/79 (1%)
 Frame = +3

Query  456  SSTVLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQTICSLPPGYHQYKFV  632
            S+ ++  TRFVWPYGG  V LSG+FT W++  PM+P+EGCPSVFQ IC+L PGYHQYKF 
Sbjct  16   SAQLVTPTRFVWPYGGTRVFLSGSFTRWTEHVPMSPLEGCPSVFQVICNLTPGYHQYKFY  75

Query  633  VDGEWRHDENQPFATGNYG  689
            VDGEWRHDE+QPF  GN G
Sbjct  76   VDGEWRHDEHQPFVNGNGG  94



>ref|XP_010674700.1| PREDICTED: sucrose nonfermenting 4-like protein [Beta vulgaris 
subsp. vulgaris]
Length=490

 Score =   119 bits (299),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 71/95 (75%), Gaps = 6/95 (6%)
 Frame = +3

Query  423  MYPAGMDYARESST-----VLITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPSVF  584
            M+ +  D A  S++     +LI  RFVWPYGGR V LSG+FTGWS+   M+P+EGCP+ F
Sbjct  1    MFGSNPDSAAHSNSGLPGNLLIPFRFVWPYGGRRVFLSGSFTGWSEHILMSPMEGCPTAF  60

Query  585  QTICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            Q IC+L PGYHQYKF VDGEWR+DE+QPF +G YG
Sbjct  61   QVICNLTPGYHQYKFNVDGEWRYDEHQPFVSGTYG  95



>ref|XP_010938454.1| PREDICTED: sucrose nonfermenting 4-like protein [Elaeis guineensis]
 ref|XP_010938455.1| PREDICTED: sucrose nonfermenting 4-like protein [Elaeis guineensis]
Length=502

 Score =   119 bits (299),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 61/76 (80%), Gaps = 1/76 (1%)
 Frame = +3

Query  465  VLITTRFVWPYGGRTVCLSGTFTGWS-QWPMTPVEGCPSVFQTICSLPPGYHQYKFVVDG  641
            V+I  RFVWPYGGR V L+GTFT W+   PM+PVEGCPSVFQT+ +L PG HQYKF VDG
Sbjct  19   VVIPMRFVWPYGGRRVLLTGTFTRWTDHIPMSPVEGCPSVFQTVWNLTPGIHQYKFYVDG  78

Query  642  EWRHDENQPFATGNYG  689
            EWRHDE QP+  GNYG
Sbjct  79   EWRHDERQPYVVGNYG  94



>gb|KDP40000.1| hypothetical protein JCGZ_01998 [Jatropha curcas]
Length=483

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 69/91 (76%), Gaps = 9/91 (10%)
 Frame = +3

Query  438  MDYARESS------TVLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQTIC  596
            MD ARE+       TVL+  RFVWP+GGR+V LSG+F  W++  PM+P+EGCP+VFQ IC
Sbjct  1    MDSAREAGGAGVAGTVLM--RFVWPHGGRSVFLSGSFDRWTRLVPMSPMEGCPTVFQAIC  58

Query  597  SLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            S+ PGYHQYKF+VDGEWRHDE QP  T  YG
Sbjct  59   SITPGYHQYKFLVDGEWRHDERQPCLTSEYG  89



>ref|XP_004230211.1| PREDICTED: sucrose nonfermenting 4-like protein [Solanum lycopersicum]
Length=483

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 65/87 (75%), Gaps = 1/87 (1%)
 Frame = +3

Query  432  AGMDYARESSTVLITTRFVWPYGGRTVCLSGTFTGW-SQWPMTPVEGCPSVFQTICSLPP  608
            +G ++   +  VL+ TRFVWPYGGR V LSG+FT W     M+P+EGCP+VFQ +C+L P
Sbjct  8    SGQNHTGVAGAVLMPTRFVWPYGGRRVLLSGSFTRWQDHITMSPMEGCPTVFQVVCNLVP  67

Query  609  GYHQYKFVVDGEWRHDENQPFATGNYG  689
            GYHQYKF VDGEW HDE QP  +GNYG
Sbjct  68   GYHQYKFFVDGEWCHDERQPVVSGNYG  94



>gb|AAO61673.1| AKIN betagamma [Medicago truncatula]
Length=485

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 61/76 (80%), Gaps = 1/76 (1%)
 Frame = +3

Query  465  VLITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPSVFQTICSLPPGYHQYKFVVDG  641
            +LI  RFVWPYGG  V L G+FT WS+  PM+P+EGCPSVFQ ICSL PGYHQ+KF VDG
Sbjct  23   ILIPKRFVWPYGGTRVYLIGSFTRWSEHIPMSPMEGCPSVFQVICSLMPGYHQFKFNVDG  82

Query  642  EWRHDENQPFATGNYG  689
            +WR+DE QPF  GNYG
Sbjct  83   QWRYDEQQPFVNGNYG  98



>ref|XP_003626272.1| 5'-AMP-activated protein kinase subunit beta-1 [Medicago truncatula]
 gb|AES82490.1| sucrose nonfermenting-like protein [Medicago truncatula]
Length=485

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 61/76 (80%), Gaps = 1/76 (1%)
 Frame = +3

Query  465  VLITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPSVFQTICSLPPGYHQYKFVVDG  641
            +LI  RFVWPYGG  V L G+FT WS+  PM+P+EGCPSVFQ ICSL PGYHQ+KF VDG
Sbjct  23   ILIPKRFVWPYGGTRVYLIGSFTRWSEHIPMSPMEGCPSVFQVICSLMPGYHQFKFNVDG  82

Query  642  EWRHDENQPFATGNYG  689
            +WR+DE QPF  GNYG
Sbjct  83   QWRYDEQQPFVNGNYG  98



>ref|NP_001105555.1| protein kinase AKINbetagamma-2 [Zea mays]
 gb|AAG31752.1|AF276086_1 protein kinase AKINbetagamma-2 [Zea mays]
Length=496

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 69/97 (71%), Gaps = 8/97 (8%)
 Frame = +3

Query  423  MYPAGMDYARESSTVLIT-------TRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPS  578
            M+  G D A ++  V ++       TRFVWPYGG+ V +SG+FT WS+  PM+P+EGCP+
Sbjct  1    MFSHGADSAHDAGAVGVSSGGATVPTRFVWPYGGKRVFVSGSFTRWSEHLPMSPIEGCPT  60

Query  579  VFQTICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            VFQ ICSL PG H+YKF VDGEWRHDE QP  +G +G
Sbjct  61   VFQAICSLSPGIHEYKFFVDGEWRHDERQPTISGEFG  97



>gb|ACN35851.1| unknown [Zea mays]
 gb|AFW66923.1| protein kinase AKINbetagamma-2 [Zea mays]
Length=496

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 69/97 (71%), Gaps = 8/97 (8%)
 Frame = +3

Query  423  MYPAGMDYARESSTVLIT-------TRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPS  578
            M+  G D A ++  V ++       TRFVWPYGG+ V +SG+FT WS+  PM+P+EGCP+
Sbjct  1    MFSHGADSAHDAGAVGVSSGGATVPTRFVWPYGGKRVFVSGSFTRWSEHLPMSPIEGCPT  60

Query  579  VFQTICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            VFQ ICSL PG H+YKF VDGEWRHDE QP  +G +G
Sbjct  61   VFQAICSLSPGIHEYKFFVDGEWRHDERQPTISGEFG  97



>ref|XP_008648222.1| PREDICTED: AKINbetagamma-1 protein kinase isoform X1 [Zea mays]
 gb|ACL53758.1| unknown [Zea mays]
 tpg|DAA52575.1| TPA: protein kinase AKINbetagamma-1 [Zea mays]
Length=497

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 70/98 (71%), Gaps = 9/98 (9%)
 Frame = +3

Query  423  MYPAGMDYARESSTVLITT--------RFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCP  575
            M+  G D A ++ TV +++        RFVWPYGG+ V +SG+FT WS+  PM+PVEGCP
Sbjct  1    MFSHGADSAHDAGTVGVSSGVGATVPARFVWPYGGKRVFVSGSFTRWSEHLPMSPVEGCP  60

Query  576  SVFQTICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            +VFQ ICSL PG H+YKF VDGEWRHDE QP  +G +G
Sbjct  61   TVFQAICSLSPGIHEYKFYVDGEWRHDERQPTISGEFG  98



>ref|NP_001105005.1| AKINbetagamma-1 protein kinase [Zea mays]
 gb|AAG31751.1|AF276085_1 protein kinase AKINbetagamma-1 [Zea mays]
Length=497

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 70/98 (71%), Gaps = 9/98 (9%)
 Frame = +3

Query  423  MYPAGMDYARESSTVLITT--------RFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCP  575
            M+  G D A ++ TV +++        RFVWPYGG+ V +SG+FT WS+  PM+PVEGCP
Sbjct  1    MFSHGADSAHDAGTVGVSSGVGATVPARFVWPYGGKRVFVSGSFTRWSEHLPMSPVEGCP  60

Query  576  SVFQTICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            +VFQ ICSL PG H+YKF VDGEWRHDE QP  +G +G
Sbjct  61   TVFQAICSLSPGIHEYKFYVDGEWRHDERQPTISGEFG  98



>ref|XP_002466066.1| hypothetical protein SORBIDRAFT_01g000600 [Sorghum bicolor]
 gb|EER93064.1| hypothetical protein SORBIDRAFT_01g000600 [Sorghum bicolor]
Length=496

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 69/97 (71%), Gaps = 8/97 (8%)
 Frame = +3

Query  423  MYPAGMDYARESSTVLITT-------RFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPS  578
            M+  G D A ++  V ++T       RFVWPYGG+ V +SG+FT WS+  PM+PVEGCP+
Sbjct  1    MFSHGADSAHDAGAVGVSTGGATVPTRFVWPYGGKRVFVSGSFTRWSEHLPMSPVEGCPT  60

Query  579  VFQTICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            VFQ ICSL PG H+YKF VDGEWRHDE QP  +G +G
Sbjct  61   VFQAICSLSPGIHEYKFFVDGEWRHDERQPTISGEFG  97



>gb|AFW66924.1| hypothetical protein ZEAMMB73_799257 [Zea mays]
Length=440

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 69/97 (71%), Gaps = 8/97 (8%)
 Frame = +3

Query  423  MYPAGMDYARESSTVLIT-------TRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPS  578
            M+  G D A ++  V ++       TRFVWPYGG+ V +SG+FT WS+  PM+P+EGCP+
Sbjct  1    MFSHGADSAHDAGAVGVSSGGATVPTRFVWPYGGKRVFVSGSFTRWSEHLPMSPIEGCPT  60

Query  579  VFQTICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            VFQ ICSL PG H+YKF VDGEWRHDE QP  +G +G
Sbjct  61   VFQAICSLSPGIHEYKFFVDGEWRHDERQPTISGEFG  97



>ref|XP_003559740.1| PREDICTED: sucrose nonfermenting 4-like protein [Brachypodium 
distachyon]
Length=494

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 70/96 (73%), Gaps = 7/96 (7%)
 Frame = +3

Query  423  MYPAGMDYARESSTVLIT------TRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPSV  581
            M+  G D AR+++   +       TRFVWPYGG+ V L+G+FT WS+  PM+PVEGCP+V
Sbjct  1    MFSHGADSARDAAGAAVGVSAAVPTRFVWPYGGKRVFLTGSFTRWSEHLPMSPVEGCPAV  60

Query  582  FQTICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            FQ ICSL PG +QYKF VDGEW+HDE QP  TG+YG
Sbjct  61   FQAICSLSPGIYQYKFFVDGEWKHDERQPTITGDYG  96



>ref|XP_007205127.1| hypothetical protein PRUPE_ppa004966mg [Prunus persica]
 gb|EMJ06326.1| hypothetical protein PRUPE_ppa004966mg [Prunus persica]
Length=483

 Score =   117 bits (294),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 68/94 (72%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARESS----TVLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQ  587
            M+ +G   A ES      VL  TRFVWPYGGR V LSG+FT W +  PM+PVEGCP+VFQ
Sbjct  1    MFGSGPGTAHESRGLSGPVLFPTRFVWPYGGRRVFLSGSFTRWLELIPMSPVEGCPTVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             + +L PGYHQYKF VDGEWRH+E QPF TGN G
Sbjct  61   VVWNLTPGYHQYKFCVDGEWRHNEQQPFVTGNCG  94



>dbj|BAK02043.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK04642.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=497

 Score =   117 bits (292),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 61/74 (82%), Gaps = 1/74 (1%)
 Frame = +3

Query  471  ITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPSVFQTICSLPPGYHQYKFVVDGEW  647
            + TRFVWP+GG+ V LSG+FT WS+  PM+PVEGCP+VFQ ICSLPPG +QYKF VDG+W
Sbjct  28   VPTRFVWPHGGKRVFLSGSFTRWSEHLPMSPVEGCPTVFQAICSLPPGIYQYKFNVDGQW  87

Query  648  RHDENQPFATGNYG  689
            RHDE QP  TG YG
Sbjct  88   RHDEGQPTITGEYG  101



>dbj|BAO51911.1| SnRK1 beta-gamma subunit [Hordeum vulgare subsp. vulgare]
Length=497

 Score =   117 bits (292),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 61/74 (82%), Gaps = 1/74 (1%)
 Frame = +3

Query  471  ITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPSVFQTICSLPPGYHQYKFVVDGEW  647
            + TRFVWP+GG+ V LSG+FT WS+  PM+PVEGCP+VFQ ICSLPPG +QYKF VDG+W
Sbjct  28   VPTRFVWPHGGKRVFLSGSFTRWSEHLPMSPVEGCPTVFQAICSLPPGIYQYKFNVDGQW  87

Query  648  RHDENQPFATGNYG  689
            RHDE QP  TG YG
Sbjct  88   RHDEGQPTITGEYG  101



>ref|XP_008802115.1| PREDICTED: sucrose nonfermenting 4-like protein [Phoenix dactylifera]
 ref|XP_008802116.1| PREDICTED: sucrose nonfermenting 4-like protein [Phoenix dactylifera]
Length=502

 Score =   117 bits (292),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 63/84 (75%), Gaps = 1/84 (1%)
 Frame = +3

Query  441  DYARESSTVLITTRFVWPYGGRTVCLSGTFTGWS-QWPMTPVEGCPSVFQTICSLPPGYH  617
            D    S  VLI T+FVWPYGG+ V L+G+FT W+    M+PVEGCPSVFQTI +L PG H
Sbjct  11   DATGASGGVLIPTQFVWPYGGKRVLLTGSFTRWTDHIMMSPVEGCPSVFQTIWNLAPGIH  70

Query  618  QYKFVVDGEWRHDENQPFATGNYG  689
            QYKF VDGEWRHDE QP+  GNYG
Sbjct  71   QYKFYVDGEWRHDERQPYVVGNYG  94



>ref|XP_010024670.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Eucalyptus 
grandis]
 gb|KCW61110.1| hypothetical protein EUGRSUZ_H03882 [Eucalyptus grandis]
Length=480

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 61/79 (77%), Gaps = 1/79 (1%)
 Frame = +3

Query  456  SSTVLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQTICSLPPGYHQYKFV  632
            +  VLI  RFVWP+GG  V L G+F  WS    M+PVEGCP+VFQ +CS+PPGYHQ+KF 
Sbjct  11   AGVVLIPMRFVWPFGGTNVFLCGSFNRWSHLVQMSPVEGCPTVFQALCSIPPGYHQFKFY  70

Query  633  VDGEWRHDENQPFATGNYG  689
            VDGEWRHDE+QP ATG +G
Sbjct  71   VDGEWRHDEHQPHATGEFG  89



>ref|XP_010024669.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Eucalyptus 
grandis]
 gb|KCW61111.1| hypothetical protein EUGRSUZ_H03882 [Eucalyptus grandis]
Length=483

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 61/79 (77%), Gaps = 1/79 (1%)
 Frame = +3

Query  456  SSTVLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQTICSLPPGYHQYKFV  632
            +  VLI  RFVWP+GG  V L G+F  WS    M+PVEGCP+VFQ +CS+PPGYHQ+KF 
Sbjct  11   AGVVLIPMRFVWPFGGTNVFLCGSFNRWSHLVQMSPVEGCPTVFQALCSIPPGYHQFKFY  70

Query  633  VDGEWRHDENQPFATGNYG  689
            VDGEWRHDE+QP ATG +G
Sbjct  71   VDGEWRHDEHQPHATGEFG  89



>ref|XP_012089046.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X3 [Jatropha 
curcas]
Length=470

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 67/82 (82%), Gaps = 2/82 (2%)
 Frame = +3

Query  423  MYPAGMDYARESSTVLITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPSVFQTICS  599
            M+ +G   A +++ V +  RFVWPYGGR+V LSG+FTGW++  PM+PVEGCP+VFQ +CS
Sbjct  1    MFSSGPVTAHDNTGV-VPMRFVWPYGGRSVFLSGSFTGWTEHIPMSPVEGCPTVFQVVCS  59

Query  600  LPPGYHQYKFVVDGEWRHDENQ  665
            L PGYHQYKF VDGEWRHDE+Q
Sbjct  60   LTPGYHQYKFFVDGEWRHDEHQ  81



>ref|XP_008370464.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Malus 
domestica]
Length=221

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 63/82 (77%), Gaps = 1/82 (1%)
 Frame = +3

Query  447  ARESSTVLITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPSVFQTICSLPPGYHQY  623
            +R S  VLI  RFVWPYGGR+V LSG+FT W +  PM P+EGCP+VFQ + +L PGYHQY
Sbjct  15   SRLSVPVLIPYRFVWPYGGRSVFLSGSFTRWLEPIPMAPMEGCPTVFQVVWNLTPGYHQY  74

Query  624  KFVVDGEWRHDENQPFATGNYG  689
            KF VDG+WRH+E+QPF   N G
Sbjct  75   KFFVDGQWRHNEHQPFVNANGG  96



>ref|XP_008370463.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Malus 
domestica]
Length=222

 Score =   112 bits (279),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 63/82 (77%), Gaps = 1/82 (1%)
 Frame = +3

Query  447  ARESSTVLITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPSVFQTICSLPPGYHQY  623
            +R S  VLI  RFVWPYGGR+V LSG+FT W +  PM P+EGCP+VFQ + +L PGYHQY
Sbjct  15   SRLSVPVLIPYRFVWPYGGRSVFLSGSFTRWLEPIPMAPMEGCPTVFQVVWNLTPGYHQY  74

Query  624  KFVVDGEWRHDENQPFATGNYG  689
            KF VDG+WRH+E+QPF   N G
Sbjct  75   KFFVDGQWRHNEHQPFVNANGG  96



>ref|XP_008246396.1| PREDICTED: sucrose nonfermenting 4-like protein [Prunus mume]
Length=483

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 68/94 (72%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARESS----TVLITTRFVWPYGGRTVCLSGTFTGW-SQWPMTPVEGCPSVFQ  587
            M+ +G   A ES      VLI TRFVWPYGGR V LSG+FT W    PM+P+EGCP+VFQ
Sbjct  1    MFGSGPGTAHESRGLSGPVLIPTRFVWPYGGRRVFLSGSFTRWLEHIPMSPMEGCPTVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             + +L PGYHQYKF VDGEWR++E QPF TGN G
Sbjct  61   VVWNLTPGYHQYKFYVDGEWRYNEQQPFVTGNCG  94



>ref|XP_003521702.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoformX1 
[Glycine max]
 ref|XP_006577235.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 
X2 [Glycine max]
 ref|XP_006577236.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 
X3 [Glycine max]
 gb|KHN03985.1| Sucrose nonfermenting 4-like protein [Glycine soja]
Length=478

 Score =   114 bits (286),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 67/94 (71%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARESSTV----LITTRFVWPYGGRTVCLSGTFTGWS-QWPMTPVEGCPSVFQ  587
            M+ +  D A E S V    LI  RFVWPYGG TV L+G+FT WS    M+P+EGCP+VFQ
Sbjct  1    MFASVADGAFEGSGVSGPFLIPQRFVWPYGGTTVFLTGSFTRWSNHIAMSPMEGCPAVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             +C+L PG+HQYKF VDGEWRHDE QPF  G+ G
Sbjct  61   VVCNLMPGFHQYKFNVDGEWRHDEQQPFVNGSCG  94



>ref|XP_007147040.1| hypothetical protein PHAVU_006G091100g [Phaseolus vulgaris]
 ref|XP_007147041.1| hypothetical protein PHAVU_006G091100g [Phaseolus vulgaris]
 gb|ESW19034.1| hypothetical protein PHAVU_006G091100g [Phaseolus vulgaris]
 gb|ESW19035.1| hypothetical protein PHAVU_006G091100g [Phaseolus vulgaris]
Length=478

 Score =   114 bits (284),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 61/79 (77%), Gaps = 1/79 (1%)
 Frame = +3

Query  456  SSTVLITTRFVWPYGGRTVCLSGTFTGWS-QWPMTPVEGCPSVFQTICSLPPGYHQYKFV  632
            S ++LI  RFVWPYGGR V LSG+FT WS    M+P+EGCP+VFQ +C+L PG HQYKF 
Sbjct  16   SGSILIPQRFVWPYGGRRVFLSGSFTRWSDHIAMSPMEGCPAVFQVVCNLLPGLHQYKFN  75

Query  633  VDGEWRHDENQPFATGNYG  689
            VDGEWRHDE QP  +G+ G
Sbjct  76   VDGEWRHDEQQPSVSGSCG  94



>ref|XP_010528890.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Tarenaya 
hassleriana]
Length=488

 Score =   114 bits (284),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 62/79 (78%), Gaps = 1/79 (1%)
 Frame = +3

Query  456  SSTVLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQTICSLPPGYHQYKFV  632
            S  +L   RF WP+GGR V LSG+FT W++  PM+P+EGCP+ FQ +C+L PGYH+YKF 
Sbjct  16   SGQILTPVRFFWPHGGRRVFLSGSFTRWTEHVPMSPMEGCPTAFQVVCNLAPGYHEYKFC  75

Query  633  VDGEWRHDENQPFATGNYG  689
            VDGEWRHDE+QPF TG+ G
Sbjct  76   VDGEWRHDEHQPFVTGSGG  94



>ref|XP_010549766.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Tarenaya 
hassleriana]
Length=489

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 60/79 (76%), Gaps = 1/79 (1%)
 Frame = +3

Query  456  SSTVLITTRFVWPYGGRTVCLSGTFTGW-SQWPMTPVEGCPSVFQTICSLPPGYHQYKFV  632
            S  +L   RFVWP+GGR V LSG+FT W    PM+P+EGCP+ FQ +C+L PGYH+YKF 
Sbjct  16   SGQLLTPMRFVWPHGGRRVFLSGSFTRWIEHVPMSPMEGCPTAFQVVCNLAPGYHEYKFF  75

Query  633  VDGEWRHDENQPFATGNYG  689
            VDG+WRHDE+QPF  GN G
Sbjct  76   VDGKWRHDEHQPFVNGNGG  94



>ref|XP_004980982.1| PREDICTED: sucrose nonfermenting 4-like protein-like [Setaria 
italica]
Length=494

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 67/97 (69%), Gaps = 8/97 (8%)
 Frame = +3

Query  423  MYPAGMDYARESSTVLITT-------RFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPS  578
            M+  G D A ++  V ++T       RFVWPYGG+ V +SG+FT WS+   M+PVEGCPS
Sbjct  1    MFSHGADSAHDAGGVGVSTAGATVPARFVWPYGGKRVFVSGSFTRWSEHLQMSPVEGCPS  60

Query  579  VFQTICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            VFQ  CSL PG +QYKF VDGEWRHDE QP  +G YG
Sbjct  61   VFQATCSLSPGMYQYKFFVDGEWRHDERQPTVSGEYG  97



>ref|XP_003554656.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 
1 [Glycine max]
Length=478

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 68/94 (72%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARESSTV----LITTRFVWPYGGRTVCLSGTFTGWS-QWPMTPVEGCPSVFQ  587
            M+ + +D A E S V    LI  RFVWPYGG TV L+G+FT WS    M+P+EGCP+VFQ
Sbjct  1    MFASVVDGACEGSGVSGPILIPRRFVWPYGGTTVFLTGSFTRWSNHIAMSPMEGCPAVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             +C+L PG+HQYKF VDGEWRHD+ QPF  G+ G
Sbjct  61   VVCNLMPGFHQYKFNVDGEWRHDDQQPFVNGSCG  94



>ref|XP_010524503.1| PREDICTED: sucrose nonfermenting 4-like protein [Tarenaya hassleriana]
Length=490

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 68/95 (72%), Gaps = 6/95 (6%)
 Frame = +3

Query  423  MYPAGMDYARES-----STVLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVF  584
            M+   MD  RE+     S+V+I   FVW +GGRT+ L+G+FT WS+  PM+ VEGCP+VF
Sbjct  1    MFGPNMDSMREAGGDATSSVVIPVPFVWRHGGRTIYLTGSFTRWSEVVPMSQVEGCPNVF  60

Query  585  QTICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            Q IC+L PGYHQYKF+VDGEWRHDE+ P     YG
Sbjct  61   QVICNLVPGYHQYKFLVDGEWRHDEHLPCTNSEYG  95



>gb|KHN43289.1| Sucrose nonfermenting 4-like protein [Glycine soja]
Length=485

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 68/94 (72%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARESSTV----LITTRFVWPYGGRTVCLSGTFTGWS-QWPMTPVEGCPSVFQ  587
            M+ + +D A E S V    LI  RFVWPYGG TV L+G+FT WS    M+P+EGCP+VFQ
Sbjct  1    MFASVVDGACEGSGVSGPILIPRRFVWPYGGTTVFLTGSFTRWSNHIAMSPMEGCPAVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             +C+L PG+HQYKF VDGEWRHD+ QPF  G+ G
Sbjct  61   VVCNLMPGFHQYKFNVDGEWRHDDQQPFVNGSCG  94



>ref|XP_008223132.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X3 [Prunus 
mume]
Length=470

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 60/72 (83%), Gaps = 2/72 (3%)
 Frame = +3

Query  480  RFVWPYGGRTVCLSGTFTG-WSQW-PMTPVEGCPSVFQTICSLPPGYHQYKFVVDGEWRH  653
            RFVWPYGGR+V LSG+F   WS+  PMTPVEGCP+VFQ I S+ PGYHQYKF VDGEWRH
Sbjct  2    RFVWPYGGRSVFLSGSFARRWSELIPMTPVEGCPTVFQAIYSVMPGYHQYKFFVDGEWRH  61

Query  654  DENQPFATGNYG  689
            DE+QP+ +G YG
Sbjct  62   DEHQPYVSGEYG  73



>ref|XP_010098308.1| Sucrose nonfermenting 4-like protein [Morus notabilis]
 gb|EXB74812.1| Sucrose nonfermenting 4-like protein [Morus notabilis]
Length=493

 Score =   111 bits (278),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 68/94 (72%), Gaps = 5/94 (5%)
 Frame = +3

Query  423  MYPAGMDYARES----STVLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQ  587
            M+ A MD  RE     STVL+  RFVWPYGGR+V +SG+FT WS+  PM+ VEG  ++FQ
Sbjct  1    MFGANMDSGREVGGVPSTVLVPMRFVWPYGGRSVFVSGSFTRWSELIPMSLVEGSSTIFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
             I S+ PG+HQ+KF VDG+WRHDE QP+ +  YG
Sbjct  61   AIYSVVPGHHQFKFFVDGQWRHDECQPYMSSEYG  94



>ref|XP_010551058.1| PREDICTED: sucrose nonfermenting 4-like protein [Tarenaya hassleriana]
 ref|XP_010551059.1| PREDICTED: sucrose nonfermenting 4-like protein [Tarenaya hassleriana]
Length=490

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 66/95 (69%), Gaps = 6/95 (6%)
 Frame = +3

Query  423  MYPAGMDYARES-----STVLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVF  584
            M+   MD  RE+     S+V+I   F+W +GGR V L+G+FT WS+  PM+ VEGCP+VF
Sbjct  1    MFGPNMDSMREAGGDATSSVVIPVPFIWRHGGRNVYLTGSFTRWSELVPMSQVEGCPTVF  60

Query  585  QTICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            Q IC+L PGYHQYKF VDGEW+HDE+ P     YG
Sbjct  61   QVICNLAPGYHQYKFFVDGEWKHDEHLPCTNSEYG  95



>gb|KJB72644.1| hypothetical protein B456_011G188600 [Gossypium raimondii]
Length=404

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 64/96 (67%), Gaps = 7/96 (7%)
 Frame = +3

Query  423  MYPAGMDYARESSTV------LITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSV  581
            M+ + M+  RE+S V      L   +F WPYGGR V +SG+F  W++  PM+ VEG P+V
Sbjct  1    MFASDMNSVREASRVTTAGMMLFPIQFTWPYGGRNVFISGSFNRWAELVPMSQVEGAPNV  60

Query  582  FQTICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            FQ +C++  G H+YKF+VDGEWRHDE QP   G YG
Sbjct  61   FQAVCAVSHGCHEYKFLVDGEWRHDERQPHKNGEYG  96



>ref|XP_004293513.1| PREDICTED: sucrose nonfermenting 4-like protein [Fragaria vesca 
subsp. vesca]
Length=484

 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = +3

Query  465  VLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQTICSLPPGYHQYKFVVDG  641
            +LI TRF WPYGG+ V LSG+FT W +  PM+P+EG P+VFQ + +L PGYHQYKF VDG
Sbjct  18   ILIPTRFEWPYGGKWVFLSGSFTRWVELIPMSPMEGRPAVFQVVWNLTPGYHQYKFFVDG  77

Query  642  EWRHDENQPFATGNYG  689
            EWRH E+QPF TG +G
Sbjct  78   EWRHIEHQPFVTGKFG  93



>gb|KJB72643.1| hypothetical protein B456_011G188600 [Gossypium raimondii]
Length=446

 Score =   106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 64/96 (67%), Gaps = 7/96 (7%)
 Frame = +3

Query  423  MYPAGMDYARESSTV------LITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSV  581
            M+ + M+  RE+S V      L   +F WPYGGR V +SG+F  W++  PM+ VEG P+V
Sbjct  1    MFASDMNSVREASRVTTAGMMLFPIQFTWPYGGRNVFISGSFNRWAELVPMSQVEGAPNV  60

Query  582  FQTICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            FQ +C++  G H+YKF+VDGEWRHDE QP   G YG
Sbjct  61   FQAVCAVSHGCHEYKFLVDGEWRHDERQPHKNGEYG  96



>gb|KHG02417.1| Sucrose nonfermenting 4-like protein [Gossypium arboreum]
Length=505

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 65/96 (68%), Gaps = 7/96 (7%)
 Frame = +3

Query  423  MYPAGMDYARESSTV------LITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSV  581
            M+ + M+  RE+S V      L   +F WPYGGR+V +SG+F  W++  PM+ VEG P+V
Sbjct  9    MFASDMNSVREASRVTTAGMMLFPIQFTWPYGGRSVFISGSFNRWAELVPMSQVEGAPNV  68

Query  582  FQTICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            FQ +C++  G H+YKF+VDGEWRHDE QP   G YG
Sbjct  69   FQAVCAVSHGCHEYKFLVDGEWRHDERQPHKNGEYG  104



>gb|KJB72641.1| hypothetical protein B456_011G188600 [Gossypium raimondii]
Length=468

 Score =   106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 64/96 (67%), Gaps = 7/96 (7%)
 Frame = +3

Query  423  MYPAGMDYARESSTV------LITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSV  581
            M+ + M+  RE+S V      L   +F WPYGGR V +SG+F  W++  PM+ VEG P+V
Sbjct  1    MFASDMNSVREASRVTTAGMMLFPIQFTWPYGGRNVFISGSFNRWAELVPMSQVEGAPNV  60

Query  582  FQTICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            FQ +C++  G H+YKF+VDGEWRHDE QP   G YG
Sbjct  61   FQAVCAVSHGCHEYKFLVDGEWRHDERQPHKNGEYG  96



>gb|KJB72638.1| hypothetical protein B456_011G188600 [Gossypium raimondii]
 gb|KJB72639.1| hypothetical protein B456_011G188600 [Gossypium raimondii]
Length=488

 Score =   106 bits (265),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 64/96 (67%), Gaps = 7/96 (7%)
 Frame = +3

Query  423  MYPAGMDYARESSTV------LITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSV  581
            M+ + M+  RE+S V      L   +F WPYGGR V +SG+F  W++  PM+ VEG P+V
Sbjct  1    MFASDMNSVREASRVTTAGMMLFPIQFTWPYGGRNVFISGSFNRWAELVPMSQVEGAPNV  60

Query  582  FQTICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            FQ +C++  G H+YKF+VDGEWRHDE QP   G YG
Sbjct  61   FQAVCAVSHGCHEYKFLVDGEWRHDERQPHKNGEYG  96



>gb|KHG20472.1| Sucrose nonfermenting 4-like protein [Gossypium arboreum]
Length=489

 Score =   105 bits (263),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 66/96 (69%), Gaps = 7/96 (7%)
 Frame = +3

Query  423  MYPAGMDYARESS------TVLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSV  581
            M+ + M+ AR++       TVL   +F WP+GGR+V LSG+F  W++  PM+ VEGCP+ 
Sbjct  1    MFASDMNPARDAGRVTTVGTVLFPIQFTWPHGGRSVFLSGSFNRWTELVPMSQVEGCPNA  60

Query  582  FQTICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            FQ + ++P G H+YKF VDGEWRHDE QP  TG YG
Sbjct  61   FQAVYAVPLGCHEYKFFVDGEWRHDERQPHKTGEYG  96



>ref|XP_007035544.1| Sucrose nonfermenting 4 [Theobroma cacao]
 gb|EOY06470.1| Sucrose nonfermenting 4 [Theobroma cacao]
Length=489

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 57/76 (75%), Gaps = 1/76 (1%)
 Frame = +3

Query  465  VLITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPSVFQTICSLPPGYHQYKFVVDG  641
            VL   +F WP+GGRTV LSG+F  W++  PM+ VEGCP+VFQ +C++P G H+YKF VDG
Sbjct  16   VLFPIQFTWPHGGRTVFLSGSFNRWTELMPMSQVEGCPNVFQAVCAVPHGCHEYKFFVDG  75

Query  642  EWRHDENQPFATGNYG  689
            EWRHDE QP   G YG
Sbjct  76   EWRHDERQPHRNGEYG  91



>ref|XP_009376652.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009376691.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Pyrus 
x bretschneideri]
Length=483

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 60/82 (73%), Gaps = 1/82 (1%)
 Frame = +3

Query  447  ARESSTVLITTRFVWPYGGRTVCLSGTFTGW-SQWPMTPVEGCPSVFQTICSLPPGYHQY  623
            +R S  VLI   FVWPYGGR+V LSG+FT W    PM P+EG P+VFQ + +L PGYHQY
Sbjct  15   SRLSVPVLIPYPFVWPYGGRSVFLSGSFTRWLEHIPMAPMEGHPTVFQVVWNLTPGYHQY  74

Query  624  KFVVDGEWRHDENQPFATGNYG  689
            KF VDG+WRH+E+QPF   N G
Sbjct  75   KFFVDGQWRHNEHQPFVNANGG  96



>ref|XP_009376653.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Pyrus 
x bretschneideri]
 ref|XP_009376692.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Pyrus 
x bretschneideri]
Length=482

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 60/82 (73%), Gaps = 1/82 (1%)
 Frame = +3

Query  447  ARESSTVLITTRFVWPYGGRTVCLSGTFTGW-SQWPMTPVEGCPSVFQTICSLPPGYHQY  623
            +R S  VLI   FVWPYGGR+V LSG+FT W    PM P+EG P+VFQ + +L PGYHQY
Sbjct  15   SRLSVPVLIPYPFVWPYGGRSVFLSGSFTRWLEHIPMAPMEGHPTVFQVVWNLTPGYHQY  74

Query  624  KFVVDGEWRHDENQPFATGNYG  689
            KF VDG+WRH+E+QPF   N G
Sbjct  75   KFFVDGQWRHNEHQPFVNANGG  96



>ref|XP_011014797.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Populus 
euphratica]
Length=448

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 60/88 (68%), Gaps = 4/88 (5%)
 Frame = +3

Query  438  MDYARESS---TVLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQTICSLP  605
            M+  RE+    T  +  RFVW +GGR V LSG+F  W +  PM+PVEGCP+VFQ I  + 
Sbjct  1    MESVREAGDGVTGTVLMRFVWTHGGRNVFLSGSFNRWGELIPMSPVEGCPNVFQAIYDIT  60

Query  606  PGYHQYKFVVDGEWRHDENQPFATGNYG  689
            PG HQYKF VDGEWRHDE QP +T  YG
Sbjct  61   PGNHQYKFCVDGEWRHDELQPHSTTEYG  88



>ref|XP_011014792.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Populus 
euphratica]
 ref|XP_011014793.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Populus 
euphratica]
 ref|XP_011014795.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Populus 
euphratica]
 ref|XP_011014796.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Populus 
euphratica]
Length=478

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 60/88 (68%), Gaps = 4/88 (5%)
 Frame = +3

Query  438  MDYARESS---TVLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQTICSLP  605
            M+  RE+    T  +  RFVW +GGR V LSG+F  W +  PM+PVEGCP+VFQ I  + 
Sbjct  1    MESVREAGDGVTGTVLMRFVWTHGGRNVFLSGSFNRWGELIPMSPVEGCPNVFQAIYDIT  60

Query  606  PGYHQYKFVVDGEWRHDENQPFATGNYG  689
            PG HQYKF VDGEWRHDE QP +T  YG
Sbjct  61   PGNHQYKFCVDGEWRHDELQPHSTTEYG  88



>ref|XP_006380178.1| hypothetical protein POPTR_0008s22640g [Populus trichocarpa]
 gb|ERP57975.1| hypothetical protein POPTR_0008s22640g [Populus trichocarpa]
Length=480

 Score =   103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 60/88 (68%), Gaps = 4/88 (5%)
 Frame = +3

Query  438  MDYARESS---TVLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQTICSLP  605
            M+  RE+    T  +  RFVW +GGR V LSG+F  W +  PM+PVEGCP+VFQ I  + 
Sbjct  1    MESVREAGGGVTGTVLMRFVWTHGGRNVFLSGSFNRWGELIPMSPVEGCPNVFQAIYDIT  60

Query  606  PGYHQYKFVVDGEWRHDENQPFATGNYG  689
            PG HQYKF VDGEWRHDE QP +T  YG
Sbjct  61   PGNHQYKFCVDGEWRHDELQPHSTTEYG  88



>ref|XP_011044505.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Populus 
euphratica]
Length=480

 Score =   103 bits (257),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 55/74 (74%), Gaps = 1/74 (1%)
 Frame = +3

Query  471  ITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQTICSLPPGYHQYKFVVDGEW  647
            + TRFVW +GGR V LSG+F  W +  PM+PVEGCP+VFQ I  +  G HQYKF+VDGEW
Sbjct  15   VLTRFVWTHGGRNVFLSGSFNRWGELIPMSPVEGCPNVFQAIYGITHGNHQYKFLVDGEW  74

Query  648  RHDENQPFATGNYG  689
            RHDE QP+ T  YG
Sbjct  75   RHDELQPYTTTEYG  88



>ref|XP_011044506.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Populus 
euphratica]
Length=424

 Score =   102 bits (254),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 61/88 (69%), Gaps = 4/88 (5%)
 Frame = +3

Query  438  MDYARESS---TVLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQTICSLP  605
            M+  RE+    T  + TRFVW +GGR V LSG+F  W +  PM+PVEGCP+VFQ I  + 
Sbjct  1    MEPVREAGGGVTGTVLTRFVWTHGGRNVFLSGSFNRWGELIPMSPVEGCPNVFQAIYGIT  60

Query  606  PGYHQYKFVVDGEWRHDENQPFATGNYG  689
             G HQYKF+VDGEWRHDE QP+ T  YG
Sbjct  61   HGNHQYKFLVDGEWRHDELQPYTTTEYG  88



>gb|KJB38630.1| hypothetical protein B456_006G264100 [Gossypium raimondii]
Length=486

 Score =   102 bits (255),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 65/96 (68%), Gaps = 7/96 (7%)
 Frame = +3

Query  423  MYPAGMDYARESS------TVLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSV  581
            M+ + M+ AR++        VL   +F WP+GGR+V LSG+F  W++  PM+ VEGCP+V
Sbjct  1    MFASDMNPARDAGRVTTAGAVLFPIQFTWPHGGRSVFLSGSFNRWTELVPMSQVEGCPNV  60

Query  582  FQTICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            FQ + ++P G H+YKF VDGEWRHDE QP  T  YG
Sbjct  61   FQAVYAVPLGCHEYKFFVDGEWRHDERQPHKTVEYG  96



>ref|XP_002314455.2| hypothetical protein POPTR_0010s02420g [Populus trichocarpa]
 gb|EEF00626.2| hypothetical protein POPTR_0010s02420g [Populus trichocarpa]
Length=463

 Score =   102 bits (254),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 60/88 (68%), Gaps = 4/88 (5%)
 Frame = +3

Query  438  MDYARESS---TVLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQTICSLP  605
            M+  RE+    T  +  RFVW +GGR V LSG+F  W +  PM+PVEGCP+VFQ I  + 
Sbjct  1    MESVREAGGGVTGAVLMRFVWTHGGRNVFLSGSFNRWGELIPMSPVEGCPNVFQAIYGIT  60

Query  606  PGYHQYKFVVDGEWRHDENQPFATGNYG  689
             G HQYKF+VDGEWRHDE QP+ T  YG
Sbjct  61   HGNHQYKFLVDGEWRHDELQPYTTTEYG  88



>gb|KHG18811.1| Sucrose nonfermenting 4-like protein [Gossypium arboreum]
Length=470

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 60/86 (70%), Gaps = 3/86 (3%)
 Frame = +3

Query  441  DYARESST--VLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQTICSLPPG  611
            D  R S+   VL+  +F WPYGG  V +SG+F GW++   M+ VEGCP+VF+ +C++P G
Sbjct  11   DAGRVSTAGMVLLPIQFTWPYGGDDVSISGSFNGWTELVRMSQVEGCPNVFKAVCAVPHG  70

Query  612  YHQYKFVVDGEWRHDENQPFATGNYG  689
             H+YKF VDGEWRHDE QP   G YG
Sbjct  71   SHEYKFFVDGEWRHDEQQPHRNGEYG  96



>gb|KJB28629.1| hypothetical protein B456_005G059200 [Gossypium raimondii]
Length=470

 Score =   100 bits (250),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 60/86 (70%), Gaps = 3/86 (3%)
 Frame = +3

Query  441  DYARESST--VLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQTICSLPPG  611
            D  R S+   VL+  +F WP+GG  V +SG+F GW++   M+ VEGCP+VF+ +C++P G
Sbjct  11   DAGRVSTAGMVLLPIQFTWPHGGDDVSISGSFNGWTELVRMSQVEGCPNVFKAVCAVPHG  70

Query  612  YHQYKFVVDGEWRHDENQPFATGNYG  689
             H+YKF VDGEWRHDE QP   G YG
Sbjct  71   SHEYKFFVDGEWRHDEQQPHRNGEYG  96



>gb|KDD72481.1| hypothetical protein H632_c3290p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=114

 Score = 94.7 bits (234),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 54/77 (70%), Gaps = 1/77 (1%)
 Frame = +3

Query  462  TVLITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPSVFQTICSLPPGYHQYKFVVD  638
            ++ + T+FVW +GG  V L G+FT W +   M+PVE  PSVFQ +  LPPGYHQYKF+VD
Sbjct  2    SLFVPTKFVWRFGGNQVHLCGSFTRWVETVTMSPVENEPSVFQVVVHLPPGYHQYKFIVD  61

Query  639  GEWRHDENQPFATGNYG  689
            GEWRHDE QPF     G
Sbjct  62   GEWRHDEAQPFMPDPLG  78



>ref|XP_006382512.1| kinase family protein [Populus trichocarpa]
 gb|ERP60309.1| kinase family protein [Populus trichocarpa]
Length=475

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 59/90 (66%), Gaps = 2/90 (2%)
 Frame = +3

Query  423  MYPAGMDYARESSTVLITTRFVWPYGGRTVCLSGTFTGW-SQWPMTPVEGCPSVFQTICS  599
            M+ +G     ++S V I  RFVWPYGG  V + GTFT W    PM+PVEGCP+VFQ + S
Sbjct  1    MFGSGSSTGHDNSGV-IPVRFVWPYGGGEVSIFGTFTRWIDLLPMSPVEGCPNVFQIVVS  59

Query  600  LPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            L PG HQ+KF VDG+WR DE   F  G YG
Sbjct  60   LVPGLHQFKFRVDGQWRVDEQLSFVDGPYG  89



>ref|XP_001770299.1| predicted protein [Physcomitrella patens]
 gb|EDQ64974.1| predicted protein, partial [Physcomitrella patens]
Length=466

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 51/74 (69%), Gaps = 1/74 (1%)
 Frame = +3

Query  471  ITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPSVFQTICSLPPGYHQYKFVVDGEW  647
            + TRFVWP+GGR V L G FT W    P++PVEG   VFQ ICSL PGYH YKF+VDGEW
Sbjct  1    VPTRFVWPHGGRRVYLCGDFTRWQDTLPLSPVEGSSRVFQVICSLAPGYHTYKFIVDGEW  60

Query  648  RHDENQPFATGNYG  689
            RHDE Q     + G
Sbjct  61   RHDEQQAHMAESNG  74



>ref|XP_004496022.1| PREDICTED: sucrose nonfermenting 4-like protein-like [Cicer arietinum]
Length=489

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +3

Query  468  LITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPSVFQTICSLPPGYHQYKFVVDGE  644
            LI   FVWPYGG TV LSG+FT WS   PM+P+E CP+ FQ   +L PG+HQYKF VDGE
Sbjct  19   LIPQLFVWPYGGTTVFLSGSFTRWSTVIPMSPMECCPTAFQVTWNLTPGFHQYKFNVDGE  78

Query  645  WRHDENQPFATGNYG  689
            WRHDE QPF   + G
Sbjct  79   WRHDEQQPFINVSVG  93



>gb|KHG30800.1| Sucrose nonfermenting 4-like protein [Gossypium arboreum]
Length=217

 Score = 94.7 bits (234),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 60/94 (64%), Gaps = 16/94 (17%)
 Frame = +3

Query  423  MYPAGMDYARE----SSTVLITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPSVFQ  587
            M+ +G +   E    S  +L+  RF+WPYGG  V L+G+FT WS+  PM+P+EGCP+VFQ
Sbjct  1    MFASGSETGHENRGVSRPLLVPMRFIWPYGGSRVFLTGSFTRWSEHIPMSPMEGCPTVFQ  60

Query  588  TICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
                       +KF VDGEWRHDE QPF  GNYG
Sbjct  61   -----------FKFFVDGEWRHDERQPFVNGNYG  83



>ref|XP_002953462.1| hypothetical protein VOLCADRAFT_63727 [Volvox carteri f. nagariensis]
 gb|EFJ45435.1| hypothetical protein VOLCADRAFT_63727 [Volvox carteri f. nagariensis]
Length=456

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 50/68 (74%), Gaps = 1/68 (1%)
 Frame = +3

Query  471  ITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPSVFQTICSLPPGYHQYKFVVDGEW  647
            + TRFVW +GGR V L G+FT W +  PM PV+G P VF  +  LPPGYHQYKF+VDG+W
Sbjct  5    VPTRFVWRFGGRQVHLCGSFTRWVETVPMAPVDGTPGVFAVVVHLPPGYHQYKFIVDGKW  64

Query  648  RHDENQPF  671
            RHDE  PF
Sbjct  65   RHDETAPF  72



>ref|XP_011036820.1| PREDICTED: sucrose nonfermenting 4-like protein [Populus euphratica]
 ref|XP_011036821.1| PREDICTED: sucrose nonfermenting 4-like protein [Populus euphratica]
Length=475

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 59/90 (66%), Gaps = 2/90 (2%)
 Frame = +3

Query  423  MYPAGMDYARESSTVLITTRFVWPYGGRTVCLSGTFTGW-SQWPMTPVEGCPSVFQTICS  599
            M+ +G     ++S V I  RFVWPYGG  V + GTFT W    P++PVEGCP+VFQ + S
Sbjct  1    MFGSGSSTGHDNSGV-IPVRFVWPYGGGEVSIFGTFTRWIDLLPLSPVEGCPNVFQIVVS  59

Query  600  LPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            L PG HQ+KF VDG+W+ DE   F  G YG
Sbjct  60   LVPGLHQFKFRVDGQWQVDEQLSFVDGPYG  89



>ref|XP_002319007.1| kinase family protein [Populus trichocarpa]
 gb|EEE94930.1| kinase family protein [Populus trichocarpa]
Length=488

 Score = 95.1 bits (235),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 52/72 (72%), Gaps = 1/72 (1%)
 Frame = +3

Query  477  TRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQTICSLPPGYHQYKFVVDGEWRH  653
             RFVWPYGG  V + GTFT W+   PM+P+EGCP+V+Q + SL PG HQ+KF VDG+WR 
Sbjct  18   VRFVWPYGGGEVSIFGTFTRWTDLIPMSPMEGCPNVYQVVISLVPGLHQFKFYVDGQWRV  77

Query  654  DENQPFATGNYG  689
            DE   F +G YG
Sbjct  78   DEQLSFVSGPYG  89



>ref|XP_011399865.1| 5'-AMP-activated protein kinase subunit gamma-1 [Auxenochlorella 
protothecoides]
 gb|KFM26917.1| 5'-AMP-activated protein kinase subunit gamma-1 [Auxenochlorella 
protothecoides]
Length=543

 Score = 95.5 bits (236),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 49/68 (72%), Gaps = 1/68 (1%)
 Frame = +3

Query  471  ITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPSVFQTICSLPPGYHQYKFVVDGEW  647
            + TRF+W +GG  V L G+FT W +  PMTPVEG P  F  I  LP GYHQYKF+VDGEW
Sbjct  5    VPTRFLWRFGGSQVHLCGSFTRWVETVPMTPVEGQPGAFSVIVQLPAGYHQYKFIVDGEW  64

Query  648  RHDENQPF  671
            RHDE QPF
Sbjct  65   RHDETQPF  72



>gb|EYU45566.1| hypothetical protein MIMGU_mgv1a006371mg [Erythranthe guttata]
Length=446

 Score = 94.0 bits (232),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +3

Query  552  MTPVEGCPSVFQTICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            MTPVEGCP+VFQTICSLPPGYHQ+KFVVDGEWRHDE+QPF + N G
Sbjct  1    MTPVEGCPTVFQTICSLPPGYHQFKFVVDGEWRHDEHQPFISSNIG  46



>ref|XP_001703192.1| hypothetical protein CHLREDRAFT_140612 [Chlamydomonas reinhardtii]
 gb|EDO96568.1| predicted protein [Chlamydomonas reinhardtii]
Length=473

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 49/68 (72%), Gaps = 1/68 (1%)
 Frame = +3

Query  471  ITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPSVFQTICSLPPGYHQYKFVVDGEW  647
            + TRFVW +GGR V L G+FT W +  PM PV+G P +F  +  LPPGYHQYKF+VDG W
Sbjct  5    VPTRFVWRFGGRQVHLCGSFTRWVETVPMAPVDGSPGLFAVVVHLPPGYHQYKFIVDGRW  64

Query  648  RHDENQPF  671
            RHDE  PF
Sbjct  65   RHDETAPF  72



>ref|XP_011023639.1| PREDICTED: sucrose nonfermenting 4-like protein [Populus euphratica]
Length=476

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 52/72 (72%), Gaps = 1/72 (1%)
 Frame = +3

Query  477  TRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPSVFQTICSLPPGYHQYKFVVDGEWRH  653
             RFVWPYGG  V + GTFT W+   P++P+EGCP+V+Q + SL PG HQ+KF VDG+WR 
Sbjct  18   VRFVWPYGGGEVSIFGTFTRWTDLIPLSPMEGCPNVYQVVVSLVPGLHQFKFYVDGQWRV  77

Query  654  DENQPFATGNYG  689
            DE   F +G YG
Sbjct  78   DEQLSFVSGPYG  89



>ref|XP_003058117.1| carbohydrate-binding module family 48 protein [Micromonas pusilla 
CCMP1545]
 gb|EEH58068.1| carbohydrate-binding module family 48 protein [Micromonas pusilla 
CCMP1545]
Length=508

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 50/74 (68%), Gaps = 3/74 (4%)
 Frame = +3

Query  477  TRFVWPYGGRTVCLSGTFTGWSQWPMTPVEGCPS---VFQTICSLPPGYHQYKFVVDGEW  647
            TRFVW YGG+ V L G+FT W +     +E  P+   VF  +C+LPPGYHQYKF+VDGEW
Sbjct  14   TRFVWAYGGKQVHLCGSFTNWLETVPMAIEPNPTGGEVFAVVCNLPPGYHQYKFIVDGEW  73

Query  648  RHDENQPFATGNYG  689
            RHDENQ F     G
Sbjct  74   RHDENQAFIQDPLG  87



>ref|XP_002499707.1| carbohydrate-binding module family 48 protein [Micromonas sp. 
RCC299]
 gb|ACO60965.1| carbohydrate-binding module family 48 protein [Micromonas sp. 
RCC299]
Length=590

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 51/69 (74%), Gaps = 5/69 (7%)
 Frame = +3

Query  477  TRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCP---SVFQTICSLPPGYHQYKFVVDGE  644
            TRF+W YGG+ V L G+FT W +  PM P E  P   SVF  +C+LPPGYHQYKF+VDGE
Sbjct  14   TRFMWGYGGKQVHLCGSFTNWLETVPMAP-EPAPNGGSVFAVVCNLPPGYHQYKFIVDGE  72

Query  645  WRHDENQPF  671
            WRHDENQ F
Sbjct  73   WRHDENQAF  81



>ref|XP_002991688.1| hypothetical protein SELMODRAFT_161836 [Selaginella moellendorffii]
 gb|EFJ07259.1| hypothetical protein SELMODRAFT_161836 [Selaginella moellendorffii]
Length=481

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 54/81 (67%), Gaps = 1/81 (1%)
 Frame = +3

Query  450  RESSTVLITTRFVWPYGGRTVCLSGTFTGW-SQWPMTPVEGCPSVFQTICSLPPGYHQYK  626
            +  +  L+ T F+WP+GG  V L G+FT W +  PMTP+E CP+VFQ   +LP GYH+YK
Sbjct  9    KSRNLALVPTTFIWPHGGAQVLLCGSFTSWLTTLPMTPLENCPTVFQGTFNLPVGYHEYK  68

Query  627  FVVDGEWRHDENQPFATGNYG  689
            F+VDG+WR D   P A   +G
Sbjct  69   FIVDGQWRWDHQGPVAHDLHG  89



>ref|XP_002991046.1| hypothetical protein SELMODRAFT_229585 [Selaginella moellendorffii]
 gb|EFJ07854.1| hypothetical protein SELMODRAFT_229585 [Selaginella moellendorffii]
Length=481

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 54/81 (67%), Gaps = 1/81 (1%)
 Frame = +3

Query  450  RESSTVLITTRFVWPYGGRTVCLSGTFTGW-SQWPMTPVEGCPSVFQTICSLPPGYHQYK  626
            +  +  L+ T F+WP+GG  V L G+FT W +  PMTP+E CP+VFQ   +LP GYH+YK
Sbjct  9    KSRNLALVPTTFIWPHGGAQVLLCGSFTSWLTTLPMTPLENCPTVFQGTFNLPVGYHEYK  68

Query  627  FVVDGEWRHDENQPFATGNYG  689
            F+VDG+WR D   P A   +G
Sbjct  69   FIVDGQWRWDHQGPVAHDLHG  89



>ref|XP_007510428.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18773.1| predicted protein [Bathycoccus prasinos]
Length=862

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 40/76 (53%), Positives = 51/76 (67%), Gaps = 4/76 (5%)
 Frame = +3

Query  456  SSTVLITTRFVWPYGGRTVCLSGTFTGWSQW-PMTPVEGCPS---VFQTICSLPPGYHQY  623
            S +++  T+F W Y G+ V L G+FT W +  PM P    P+   VF  +C+LP GYHQY
Sbjct  38   SPSIVYPTKFTWHYEGKVVHLCGSFTNWLETVPMAPEIVPPNGNQVFSVVCNLPSGYHQY  97

Query  624  KFVVDGEWRHDENQPF  671
            KF+VDGEWRHDENQ F
Sbjct  98   KFIVDGEWRHDENQAF  113



>ref|XP_009604836.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X5 [Nicotiana 
tomentosiformis]
Length=424

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 50/83 (60%), Gaps = 3/83 (4%)
 Frame = +3

Query  444  YARESSTVLITTRFVWPYGGRTVCLSGTFTGWS-QWPMTPVEGCPSVFQTICSLPPGYHQ  620
            +  E   VLIT  F W YGG  V L G+F GW+ Q  M  VEG  +VFQ I  LPPGYHQ
Sbjct  37   FGSEEEMVLIT--FTWRYGGSQVFLYGSFNGWTDQLLMNLVEGSAAVFQRIIDLPPGYHQ  94

Query  621  YKFVVDGEWRHDENQPFATGNYG  689
            YKF++DG W+ D+ Q      YG
Sbjct  95   YKFLIDGTWQVDQEQLCVQDEYG  117



>ref|XP_009604835.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X4 [Nicotiana 
tomentosiformis]
Length=475

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 50/83 (60%), Gaps = 3/83 (4%)
 Frame = +3

Query  444  YARESSTVLITTRFVWPYGGRTVCLSGTFTGWS-QWPMTPVEGCPSVFQTICSLPPGYHQ  620
            +  E   VLIT  F W YGG  V L G+F GW+ Q  M  VEG  +VFQ I  LPPGYHQ
Sbjct  37   FGSEEEMVLIT--FTWRYGGSQVFLYGSFNGWTDQLLMNLVEGSAAVFQRIIDLPPGYHQ  94

Query  621  YKFVVDGEWRHDENQPFATGNYG  689
            YKF++DG W+ D+ Q      YG
Sbjct  95   YKFLIDGTWQVDQEQLCVQDEYG  117



>ref|XP_009604831.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009604832.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Nicotiana 
tomentosiformis]
Length=509

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 50/83 (60%), Gaps = 3/83 (4%)
 Frame = +3

Query  444  YARESSTVLITTRFVWPYGGRTVCLSGTFTGWS-QWPMTPVEGCPSVFQTICSLPPGYHQ  620
            +  E   VLIT  F W YGG  V L G+F GW+ Q  M  VEG  +VFQ I  LPPGYHQ
Sbjct  37   FGSEEEMVLIT--FTWRYGGSQVFLYGSFNGWTDQLLMNLVEGSAAVFQRIIDLPPGYHQ  94

Query  621  YKFVVDGEWRHDENQPFATGNYG  689
            YKF++DG W+ D+ Q      YG
Sbjct  95   YKFLIDGTWQVDQEQLCVQDEYG  117



>ref|XP_003081623.1| protein kinase, putative (ISS) [Ostreococcus tauri]
Length=510

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 45/68 (66%), Gaps = 3/68 (4%)
 Frame = +3

Query  477  TRFVWPYGGRTVCLSGTFTGWSQ-WPMTPV--EGCPSVFQTICSLPPGYHQYKFVVDGEW  647
            TRF W YGGR V L G+FT W +  PM      G    F  +C LPPGYHQYKF+VDG+W
Sbjct  26   TRFAWAYGGRNVHLCGSFTNWLETVPMAQEGGNGDGRTFTVMCDLPPGYHQYKFIVDGQW  85

Query  648  RHDENQPF  671
            RHDENQ F
Sbjct  86   RHDENQAF  93



>emb|CEF99376.1| CBS domain [Ostreococcus tauri]
Length=571

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 45/68 (66%), Gaps = 3/68 (4%)
 Frame = +3

Query  477  TRFVWPYGGRTVCLSGTFTGWSQ-WPMTPV--EGCPSVFQTICSLPPGYHQYKFVVDGEW  647
            TRF W YGGR V L G+FT W +  PM      G    F  +C LPPGYHQYKF+VDG+W
Sbjct  26   TRFAWAYGGRNVHLCGSFTNWLETVPMAQEGGNGDGRTFTVMCDLPPGYHQYKFIVDGQW  85

Query  648  RHDENQPF  671
            RHDENQ F
Sbjct  86   RHDENQAF  93



>gb|AFW58138.1| hypothetical protein ZEAMMB73_812855 [Zea mays]
Length=200

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 48/74 (65%), Gaps = 3/74 (4%)
 Frame = +3

Query  468  LITTRFVWPYGGRTVCLSGTFTGWSQWPMTPVEGCPSVFQTICSLPPGYHQYKFVVDGEW  647
            ++  RF WPYGGR+    G+FTGW + PM  V    +VFQ +  LPPG +QY+F+VDG W
Sbjct  1    MVLQRFSWPYGGRSATFCGSFTGWRECPMGLVG---AVFQVVFDLPPGVYQYRFLVDGVW  57

Query  648  RHDENQPFATGNYG  689
            R DE +PF    YG
Sbjct  58   RCDETKPFVRDEYG  71



>ref|XP_003591122.1| 5'-AMP-activated protein kinase subunit beta-1 [Medicago truncatula]
Length=501

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 46/67 (69%), Gaps = 1/67 (1%)
 Frame = +3

Query  483  FVWPYGGRTVCLSGTFTGWS-QWPMTPVEGCPSVFQTICSLPPGYHQYKFVVDGEWRHDE  659
            FVWP+GG +  L G+FTGWS   PM+ +EG P+ FQ +C L P  H Y+F VDG WRHDE
Sbjct  32   FVWPHGGESAFLCGSFTGWSTNLPMSRIEGRPTGFQVVCYLTPELHTYQFCVDGVWRHDE  91

Query  660  NQPFATG  680
             QPF  G
Sbjct  92   QQPFING  98



>gb|AES61373.2| sucrose nonfermenting-like protein [Medicago truncatula]
Length=478

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 46/67 (69%), Gaps = 1/67 (1%)
 Frame = +3

Query  483  FVWPYGGRTVCLSGTFTGWS-QWPMTPVEGCPSVFQTICSLPPGYHQYKFVVDGEWRHDE  659
            FVWP+GG +  L G+FTGWS   PM+ +EG P+ FQ +C L P  H Y+F VDG WRHDE
Sbjct  32   FVWPHGGESAFLCGSFTGWSTNLPMSRIEGRPTGFQVVCYLTPELHTYQFCVDGVWRHDE  91

Query  660  NQPFATG  680
             QPF  G
Sbjct  92   QQPFING  98



>ref|XP_008668068.1| PREDICTED: SNF4 isoform X1 [Zea mays]
 gb|ACN34638.1| unknown [Zea mays]
 tpg|DAA38027.1| TPA: hypothetical protein ZEAMMB73_994295 [Zea mays]
Length=452

 Score = 83.2 bits (204),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 49/74 (66%), Gaps = 3/74 (4%)
 Frame = +3

Query  468  LITTRFVWPYGGRTVCLSGTFTGWSQWPMTPVEGCPSVFQTICSLPPGYHQYKFVVDGEW  647
            ++  RF WPYGGR+  L G+FTGW ++PM  V    + FQ +  LPPG +QY+F+VDG W
Sbjct  1    MVMQRFSWPYGGRSASLCGSFTGWREYPMGLV---GAEFQVVFDLPPGVYQYRFLVDGVW  57

Query  648  RHDENQPFATGNYG  689
            R DE +PF    YG
Sbjct  58   RCDETKPFVCDEYG  71



>ref|XP_008661809.1| PREDICTED: uncharacterized protein LOC100279316 isoform X2 [Zea 
mays]
Length=428

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 48/74 (65%), Gaps = 3/74 (4%)
 Frame = +3

Query  468  LITTRFVWPYGGRTVCLSGTFTGWSQWPMTPVEGCPSVFQTICSLPPGYHQYKFVVDGEW  647
            ++  RF WPYGGR+    G+FTGW + PM  V    +VFQ +  LPPG +QY+F+VDG W
Sbjct  1    MVLQRFSWPYGGRSATFCGSFTGWRECPMGLV---GAVFQVVFDLPPGVYQYRFLVDGVW  57

Query  648  RHDENQPFATGNYG  689
            R DE +PF    YG
Sbjct  58   RCDETKPFVRDEYG  71



>ref|XP_008661808.1| PREDICTED: uncharacterized protein LOC100279316 isoform X1 [Zea 
mays]
 gb|ACF88122.1| unknown [Zea mays]
 gb|ACG32376.1| SNF4 [Zea mays]
 gb|ACL52486.1| unknown [Zea mays]
 gb|AFW58139.1| SNF4 [Zea mays]
Length=448

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 48/74 (65%), Gaps = 3/74 (4%)
 Frame = +3

Query  468  LITTRFVWPYGGRTVCLSGTFTGWSQWPMTPVEGCPSVFQTICSLPPGYHQYKFVVDGEW  647
            ++  RF WPYGGR+    G+FTGW + PM  V    +VFQ +  LPPG +QY+F+VDG W
Sbjct  1    MVLQRFSWPYGGRSATFCGSFTGWRECPMGLV---GAVFQVVFDLPPGVYQYRFLVDGVW  57

Query  648  RHDENQPFATGNYG  689
            R DE +PF    YG
Sbjct  58   RCDETKPFVRDEYG  71



>ref|XP_010249337.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Nelumbo 
nucifera]
Length=470

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 51/75 (68%), Gaps = 1/75 (1%)
 Frame = +3

Query  468  LITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPSVFQTICSLPPGYHQYKFVVDGE  644
            ++ T F WPYGG+ V L+G+FT W++   MT +E   +VFQ I  L PGYHQYKF+VDG 
Sbjct  1    MVLTIFEWPYGGQHVFLTGSFTRWTEHIRMTLMENSGTVFQAIWDLTPGYHQYKFLVDGV  60

Query  645  WRHDENQPFATGNYG  689
            WR +E +P  T  YG
Sbjct  61   WRFNEQEPCVTDEYG  75



>ref|XP_010528891.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Tarenaya 
hassleriana]
Length=440

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  552  MTPVEGCPSVFQTICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            M+P+EGCP+ FQ +C+L PGYH+YKF VDGEWRHDE+QPF TG+ G
Sbjct  1    MSPMEGCPTAFQVVCNLAPGYHEYKFCVDGEWRHDEHQPFVTGSGG  46



>ref|XP_011073279.1| PREDICTED: sucrose nonfermenting 4-like protein [Sesamum indicum]
Length=470

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 48/75 (64%), Gaps = 1/75 (1%)
 Frame = +3

Query  468  LITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPSVFQTICSLPPGYHQYKFVVDGE  644
            ++ T F W YGG  V LSG+F GWS+  PM  VEG  ++FQ I  LPPG +QYKF+VDG 
Sbjct  1    MVQTPFTWRYGGHQVFLSGSFNGWSERMPMFLVEGSENIFQRIIDLPPGCYQYKFLVDGT  60

Query  645  WRHDENQPFATGNYG  689
            WR D+ Q      YG
Sbjct  61   WRADQQQICDLDEYG  75



>ref|XP_009778508.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X6 [Nicotiana 
sylvestris]
Length=382

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 47/76 (62%), Gaps = 3/76 (4%)
 Frame = +3

Query  465  VLITTRFVWPYGGRTVCLSGTFTGWS-QWPMTPVEGCPSVFQTICSLPPGYHQYKFVVDG  641
            VLIT  F W YGG  V L G+F GW+ Q  M  VEG  +VFQ I  LPPGYHQYKF +DG
Sbjct  2    VLIT--FTWRYGGSQVFLYGSFNGWTDQLLMNLVEGSATVFQRIIDLPPGYHQYKFFIDG  59

Query  642  EWRHDENQPFATGNYG  689
             W+ D+ Q      YG
Sbjct  60   TWQVDQEQLCVQDEYG  75



>ref|XP_009778504.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Nicotiana 
sylvestris]
Length=459

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 47/76 (62%), Gaps = 3/76 (4%)
 Frame = +3

Query  465  VLITTRFVWPYGGRTVCLSGTFTGWS-QWPMTPVEGCPSVFQTICSLPPGYHQYKFVVDG  641
            VLIT  F W YGG  V L G+F GW+ Q  M  VEG  +VFQ I  LPPGYHQYKF +DG
Sbjct  2    VLIT--FTWRYGGSQVFLYGSFNGWTDQLLMNLVEGSATVFQRIIDLPPGYHQYKFFIDG  59

Query  642  EWRHDENQPFATGNYG  689
             W+ D+ Q      YG
Sbjct  60   TWQVDQEQLCVQDEYG  75



>ref|XP_009778507.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X5 [Nicotiana 
sylvestris]
Length=433

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 47/76 (62%), Gaps = 3/76 (4%)
 Frame = +3

Query  465  VLITTRFVWPYGGRTVCLSGTFTGWS-QWPMTPVEGCPSVFQTICSLPPGYHQYKFVVDG  641
            VLIT  F W YGG  V L G+F GW+ Q  M  VEG  +VFQ I  LPPGYHQYKF +DG
Sbjct  2    VLIT--FTWRYGGSQVFLYGSFNGWTDQLLMNLVEGSATVFQRIIDLPPGYHQYKFFIDG  59

Query  642  EWRHDENQPFATGNYG  689
             W+ D+ Q      YG
Sbjct  60   TWQVDQEQLCVQDEYG  75



>ref|XP_009778502.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009778503.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Nicotiana 
sylvestris]
Length=467

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 47/76 (62%), Gaps = 3/76 (4%)
 Frame = +3

Query  465  VLITTRFVWPYGGRTVCLSGTFTGWS-QWPMTPVEGCPSVFQTICSLPPGYHQYKFVVDG  641
            VLIT  F W YGG  V L G+F GW+ Q  M  VEG  +VFQ I  LPPGYHQYKF +DG
Sbjct  2    VLIT--FTWRYGGSQVFLYGSFNGWTDQLLMNLVEGSATVFQRIIDLPPGYHQYKFFIDG  59

Query  642  EWRHDENQPFATGNYG  689
             W+ D+ Q      YG
Sbjct  60   TWQVDQEQLCVQDEYG  75



>ref|XP_004975479.1| PREDICTED: sucrose nonfermenting 4-like protein-like [Setaria 
italica]
Length=453

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 47/74 (64%), Gaps = 3/74 (4%)
 Frame = +3

Query  468  LITTRFVWPYGGRTVCLSGTFTGWSQWPMTPVEGCPSVFQTICSLPPGYHQYKFVVDGEW  647
            ++  RF WP+GGR     G+FTGW ++PM  V    S FQ +  LPPG +QY+F+VDG W
Sbjct  1    MVLQRFSWPHGGRHASFCGSFTGWREYPMALV---GSEFQVVFDLPPGVYQYRFLVDGVW  57

Query  648  RHDENQPFATGNYG  689
            R D+ +PF    YG
Sbjct  58   RCDDTKPFVRDEYG  71



>ref|XP_006341460.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 
X4 [Solanum tuberosum]
Length=380

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 46/75 (61%), Gaps = 1/75 (1%)
 Frame = +3

Query  468  LITTRFVWPYGGRTVCLSGTFTGWS-QWPMTPVEGCPSVFQTICSLPPGYHQYKFVVDGE  644
            ++   F W +GG  V L G+F GWS Q PM  VE   +VFQ    LPPGYH+YKF+VDG 
Sbjct  1    MVLVTFTWSHGGTHVFLCGSFDGWSEQIPMNLVEDSAAVFQRTVDLPPGYHKYKFLVDGI  60

Query  645  WRHDENQPFATGNYG  689
            W+ D++Q      YG
Sbjct  61   WQVDQDQLCVQDEYG  75



>ref|XP_006341457.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 
X1 [Solanum tuberosum]
Length=465

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 48/76 (63%), Gaps = 3/76 (4%)
 Frame = +3

Query  465  VLITTRFVWPYGGRTVCLSGTFTGWS-QWPMTPVEGCPSVFQTICSLPPGYHQYKFVVDG  641
            VL+T  F W +GG  V L G+F GWS Q PM  VE   +VFQ    LPPGYH+YKF+VDG
Sbjct  2    VLVT--FTWSHGGTHVFLCGSFDGWSEQIPMNLVEDSAAVFQRTVDLPPGYHKYKFLVDG  59

Query  642  EWRHDENQPFATGNYG  689
             W+ D++Q      YG
Sbjct  60   IWQVDQDQLCVQDEYG  75



>ref|XP_004235851.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Solanum 
lycopersicum]
Length=466

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 47/75 (63%), Gaps = 1/75 (1%)
 Frame = +3

Query  468  LITTRFVWPYGGRTVCLSGTFTGWS-QWPMTPVEGCPSVFQTICSLPPGYHQYKFVVDGE  644
            ++   F W +GG  V L G+F GWS Q PM  VEG  +VFQ    +PPGYH+YKF+VDG 
Sbjct  1    MVLLTFTWSHGGIHVFLCGSFDGWSEQIPMNLVEGSAAVFQRTVDVPPGYHKYKFLVDGI  60

Query  645  WRHDENQPFATGNYG  689
            W+ D++Q      YG
Sbjct  61   WQVDQDQLCVQDEYG  75



>ref|XP_010249336.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Nelumbo 
nucifera]
Length=474

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 49/79 (62%), Gaps = 5/79 (6%)
 Frame = +3

Query  468  LITTRFVWPYGGRTVCLSGTFTGW-----SQWPMTPVEGCPSVFQTICSLPPGYHQYKFV  632
            ++ T F WPYGG+ V L+G+FT +         MT +E   +VFQ I  L PGYHQYKF+
Sbjct  1    MVLTIFEWPYGGQHVFLTGSFTSYMIRWTEHIRMTLMENSGTVFQAIWDLTPGYHQYKFL  60

Query  633  VDGEWRHDENQPFATGNYG  689
            VDG WR +E +P  T  YG
Sbjct  61   VDGVWRFNEQEPCVTDEYG  79



>ref|XP_010942338.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Elaeis 
guineensis]
Length=467

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 47/75 (63%), Gaps = 1/75 (1%)
 Frame = +3

Query  468  LITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPSVFQTICSLPPGYHQYKFVVDGE  644
            ++ TR  WPYGG  V + G+F  W++  PM  ++G  + FQ    LPPG +QY+F+VDG 
Sbjct  1    MVLTRLSWPYGGHHVFICGSFLRWAEHRPMMLMDGSLTEFQAFFDLPPGAYQYRFLVDGT  60

Query  645  WRHDENQPFATGNYG  689
            WR DE QP  T  YG
Sbjct  61   WRFDEQQPCLTDEYG  75



>ref|XP_010942339.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Elaeis 
guineensis]
Length=454

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 47/75 (63%), Gaps = 1/75 (1%)
 Frame = +3

Query  468  LITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPSVFQTICSLPPGYHQYKFVVDGE  644
            ++ TR  WPYGG  V + G+F  W++  PM  ++G  + FQ    LPPG +QY+F+VDG 
Sbjct  1    MVLTRLSWPYGGHHVFICGSFLRWAEHRPMMLMDGSLTEFQAFFDLPPGAYQYRFLVDGT  60

Query  645  WRHDENQPFATGNYG  689
            WR DE QP  T  YG
Sbjct  61   WRFDEQQPCLTDEYG  75



>ref|XP_010921767.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X6 [Elaeis 
guineensis]
Length=440

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 51/71 (72%), Gaps = 5/71 (7%)
 Frame = +3

Query  423  MYPAGMDYARE----SSTVLITTRFVWPYGGRTVCLSGTFTGWS-QWPMTPVEGCPSVFQ  587
            M+P G + +++    S  VLI TRFVWPYGGR V L+G+FT W+    M+PVEGCPSVFQ
Sbjct  1    MFPPGTNPSQDATGASGGVLIPTRFVWPYGGRRVLLTGSFTRWTDHILMSPVEGCPSVFQ  60

Query  588  TICSLPPGYHQ  620
            T+ +L PG HQ
Sbjct  61   TMWNLTPGVHQ  71



>ref|XP_005650760.1| hypothetical protein COCSUDRAFT_46541 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26216.1| hypothetical protein COCSUDRAFT_46541 [Coccomyxa subellipsoidea 
C-169]
Length=1188

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 33/55 (60%), Positives = 40/55 (73%), Gaps = 1/55 (2%)
 Frame = +3

Query  510  VCLSGTFTGWSQW-PMTPVEGCPSVFQTICSLPPGYHQYKFVVDGEWRHDENQPF  671
            V L G+FT W +  PM PV+G P +F  +  LPPGYHQYKF+VDGEWRHDE Q +
Sbjct  250  VHLCGSFTRWVETVPMAPVDGQPGLFSVVVHLPPGYHQYKFIVDGEWRHDELQAY  304



>emb|CCD59754.1| 5-AMP-activated protein kinase , beta subunit,putative [Schistosoma 
mansoni]
Length=287

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 50/83 (60%), Gaps = 3/83 (4%)
 Frame = +3

Query  435  GMDYARESSTVL-ITTRFVWPYGGRTVCLSGTFTGW-SQWPMTPVEGCPSVFQTICSLPP  608
            G+D + E+  V  + T F W  GG+ V +SGTF GW S+ PM         F TI  LP 
Sbjct  81   GLDISEENQPVQSVPTVFKWDGGGKDVYISGTFNGWRSKIPMVK-SSSKHNFYTIIDLPL  139

Query  609  GYHQYKFVVDGEWRHDENQPFAT  677
            G HQYKF+VDG W+ D+NQP +T
Sbjct  140  GEHQYKFIVDGHWKLDQNQPVST  162



>dbj|BAJ98914.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=256

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 45/74 (61%), Gaps = 3/74 (4%)
 Frame = +3

Query  468  LITTRFVWPYGGRTVCLSGTFTGWSQWPMTPVEGCPSVFQTICSLPPGYHQYKFVVDGEW  647
            ++  RF WP+GG+     G+FTGW + PM  V    + FQ +  LPPG +QY+F+VDG W
Sbjct  1    MVLRRFAWPFGGQRASFCGSFTGWRECPMGLV---GTEFQVVFDLPPGLYQYRFLVDGVW  57

Query  648  RHDENQPFATGNYG  689
            R D+ +P     YG
Sbjct  58   RCDDTKPIVRDEYG  71



>ref|XP_011263621.1| PREDICTED: 5'-AMP-activated protein kinase subunit beta-1-like, 
partial [Camponotus floridanus]
Length=154

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 40/67 (60%), Gaps = 3/67 (4%)
 Frame = +3

Query  456  SSTVLITTRFVWPYGGRTVCLSGTFTGWSQWPMTPVEGCPSVFQTICSLPPGYHQYKFVV  635
            +   ++ T F W  GG+ V +SGTFTGW   PM    G    F TI  LP G HQYKF V
Sbjct  89   ADNKVLPTVFKWEGGGKQVYISGTFTGWKTLPMVKSHGD---FVTIIDLPEGEHQYKFFV  145

Query  636  DGEWRHD  656
            DGEWRHD
Sbjct  146  DGEWRHD  152



>ref|XP_001419967.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98260.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=482

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 45/73 (62%), Gaps = 12/73 (16%)
 Frame = +3

Query  477  TRFVWPYGG-RTVCLSGTFTGWSQ-WPMTPVEGCPS------VFQTICSLPPGYHQYKFV  632
            TRF W Y G   V L G+FT W +  PM     C +      VF  +C LPPGYHQYKF+
Sbjct  11   TRFQWTYAGANNVHLCGSFTNWLETVPM----ACETHGDGNRVFTVMCDLPPGYHQYKFI  66

Query  633  VDGEWRHDENQPF  671
            VDG+WRHDENQ F
Sbjct  67   VDGQWRHDENQAF  79



>gb|EFX67948.1| putative AMP-activated protein kinase beta non-catalytic subunit 
[Daphnia pulex]
Length=274

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 45/81 (56%), Gaps = 3/81 (4%)
 Frame = +3

Query  447  ARESSTVLITTRFVWPYGGRTVCLSGTFTGWSQWPMTPVEGCPSVFQTICSLPPGYHQYK  626
            A E+S  ++ T F W  GG+ V ++GTF+ W   PM    G    F TI  LP G HQYK
Sbjct  80   AEENSPKVLPTVFKWDGGGKQVYITGTFSNWKTIPMVKSHGD---FVTIVDLPEGEHQYK  136

Query  627  FVVDGEWRHDENQPFATGNYG  689
            F+VDGEW HD  +P      G
Sbjct  137  FLVDGEWMHDPTEPVTDNGIG  157



>ref|XP_008776278.1| PREDICTED: sucrose nonfermenting 4-like protein [Phoenix dactylifera]
Length=467

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 45/75 (60%), Gaps = 1/75 (1%)
 Frame = +3

Query  468  LITTRFVWPYGGRTVCLSGTFTGWSQ-WPMTPVEGCPSVFQTICSLPPGYHQYKFVVDGE  644
            ++ TR  WPYGG  V + G+F  W    PM  V+G  + FQ    LPPG +QY+F+VDG 
Sbjct  1    MVLTRLAWPYGGHHVFICGSFLRWIDPRPMMLVDGSLTEFQAFFDLPPGAYQYRFLVDGI  60

Query  645  WRHDENQPFATGNYG  689
            WR DE +P  +  YG
Sbjct  61   WRFDEQKPCLSDEYG  75



>emb|CAH66402.1| OSIGBa0155K12.5 [Oryza sativa Indica Group]
Length=451

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 45/74 (61%), Gaps = 3/74 (4%)
 Frame = +3

Query  468  LITTRFVWPYGGRTVCLSGTFTGWSQWPMTPVEGCPSVFQTICSLPPGYHQYKFVVDGEW  647
            ++  RF WPYGG+     G+FTGW + PM  V    + FQ +  LPPG +QY+F+VDG W
Sbjct  1    MVLRRFAWPYGGQRASFCGSFTGWRECPMGLV---GAEFQVVFDLPPGVYQYRFLVDGVW  57

Query  648  RHDENQPFATGNYG  689
            R DE +P     YG
Sbjct  58   RCDETKPCVRDEYG  71



>gb|EAY93966.1| hypothetical protein OsI_15744 [Oryza sativa Indica Group]
Length=451

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 45/74 (61%), Gaps = 3/74 (4%)
 Frame = +3

Query  468  LITTRFVWPYGGRTVCLSGTFTGWSQWPMTPVEGCPSVFQTICSLPPGYHQYKFVVDGEW  647
            ++  RF WPYGG+     G+FTGW + PM  V    + FQ +  LPPG +QY+F+VDG W
Sbjct  1    MVLRRFAWPYGGQRASFCGSFTGWRECPMGLV---GAEFQVVFDLPPGVYQYRFLVDGVW  57

Query  648  RHDENQPFATGNYG  689
            R DE +P     YG
Sbjct  58   RCDETKPCVRDEYG  71



>emb|CAD40779.1| OSJNBb0012E08.3 [Oryza sativa Japonica Group]
 gb|EAZ30607.1| hypothetical protein OsJ_14660 [Oryza sativa Japonica Group]
Length=451

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 45/74 (61%), Gaps = 3/74 (4%)
 Frame = +3

Query  468  LITTRFVWPYGGRTVCLSGTFTGWSQWPMTPVEGCPSVFQTICSLPPGYHQYKFVVDGEW  647
            ++  RF WPYGG+     G+FTGW + PM  V    + FQ +  LPPG +QY+F+VDG W
Sbjct  1    MVLRRFAWPYGGQRASFCGSFTGWRECPMGLV---GAEFQVVFDLPPGVYQYRFLVDGVW  57

Query  648  RHDENQPFATGNYG  689
            R DE +P     YG
Sbjct  58   RCDETKPCVRDEYG  71



>gb|KJB28630.1| hypothetical protein B456_005G059200 [Gossypium raimondii]
Length=420

 Score = 73.6 bits (179),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +3

Query  552  MTPVEGCPSVFQTICSLPPGYHQYKFVVDGEWRHDENQPFATGNYG  689
            M+ VEGCP+VF+ +C++P G H+YKF VDGEWRHDE QP   G YG
Sbjct  1    MSQVEGCPNVFKAVCAVPHGSHEYKFFVDGEWRHDEQQPHRNGEYG  46



>gb|EFN63325.1| 5'-AMP-activated protein kinase subunit beta-1, partial [Camponotus 
floridanus]
Length=181

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 40/67 (60%), Gaps = 3/67 (4%)
 Frame = +3

Query  456  SSTVLITTRFVWPYGGRTVCLSGTFTGWSQWPMTPVEGCPSVFQTICSLPPGYHQYKFVV  635
            +   ++ T F W  GG+ V +SGTFTGW   PM    G    F TI  LP G HQYKF V
Sbjct  117  ADNKVLPTVFKWEGGGKQVYISGTFTGWKTLPMVKSHGD---FVTIIDLPEGEHQYKFFV  173

Query  636  DGEWRHD  656
            DGEWRHD
Sbjct  174  DGEWRHD  180



>ref|XP_003579641.1| PREDICTED: sucrose nonfermenting 4-like protein [Brachypodium 
distachyon]
Length=456

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 45/74 (61%), Gaps = 3/74 (4%)
 Frame = +3

Query  468  LITTRFVWPYGGRTVCLSGTFTGWSQWPMTPVEGCPSVFQTICSLPPGYHQYKFVVDGEW  647
            ++  RF WPYGG+     G+FTGW + PM  V    + FQ +  LPPG +QY+F+VDG W
Sbjct  1    MVLRRFAWPYGGQRASFCGSFTGWRECPMGLV---GTEFQVVFDLPPGVYQYRFLVDGVW  57

Query  648  RHDENQPFATGNYG  689
            R D+ +P     YG
Sbjct  58   RCDDTKPVVHDEYG  71



>ref|XP_011648266.1| PREDICTED: 5'-AMP-activated protein kinase subunit beta-1 isoform 
X2 [Pogonomyrmex barbatus]
Length=277

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  456  SSTVLITTRFVWPYGGRTVCLSGTFTGWSQWPMTPVEGCPSVFQTICSLPPGYHQYKFVV  635
            + + ++ T F W  GG+ V +SGTFTGW   PM    G    F TI  LP G HQYKF V
Sbjct  86   ADSKVLPTVFKWEGGGKQVYISGTFTGWKTLPMVKSHGD---FVTIIDLPEGEHQYKFFV  142

Query  636  DGEWRHD  656
            DGEWRHD
Sbjct  143  DGEWRHD  149



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1183832463410