BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig2283

Length=660
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006341120.1|  PREDICTED: transcription initiation factor T...  63.9    2e-08   Solanum tuberosum [potatoes]
ref|XP_010101595.1|  Transcription initiation factor TFIID subuni...  63.5    2e-08   
ref|XP_009366648.1|  PREDICTED: transcription initiation factor T...  63.2    3e-08   Pyrus x bretschneideri [bai li]
ref|XP_004246524.1|  PREDICTED: transcription initiation factor T...  62.8    4e-08   Solanum lycopersicum
ref|XP_008241261.1|  PREDICTED: transcription initiation factor T...  60.8    2e-07   Prunus mume [ume]
ref|XP_008363818.1|  PREDICTED: transcription initiation factor T...  59.7    2e-07   
ref|XP_010271712.1|  PREDICTED: transcription initiation factor T...  60.5    2e-07   Nelumbo nucifera [Indian lotus]
ref|XP_010271709.1|  PREDICTED: transcription initiation factor T...  60.5    2e-07   Nelumbo nucifera [Indian lotus]
ref|XP_009374742.1|  PREDICTED: transcription initiation factor T...  59.3    5e-07   
ref|XP_007203746.1|  hypothetical protein PRUPE_ppa017159mg           58.9    7e-07   
ref|XP_010654342.1|  PREDICTED: transcription initiation factor T...  55.8    7e-06   Vitis vinifera
ref|XP_004305348.1|  PREDICTED: transcription initiation factor T...  53.9    3e-05   Fragaria vesca subsp. vesca
gb|KEH42050.1|  transcription initiation factor TFIID subunit 12      53.5    4e-05   Medicago truncatula
gb|KEH42051.1|  transcription initiation factor TFIID subunit 12      53.5    4e-05   Medicago truncatula
ref|XP_011466777.1|  PREDICTED: transcription initiation factor T...  53.1    6e-05   Fragaria vesca subsp. vesca
ref|XP_012066476.1|  PREDICTED: transcription initiation factor T...  52.8    8e-05   Jatropha curcas
emb|CDY00904.1|  BnaC05g42960D                                        50.1    6e-04   



>ref|XP_006341120.1| PREDICTED: transcription initiation factor TFIID subunit 12-like 
[Solanum tuberosum]
Length=561

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 69/98 (70%), Gaps = 8/98 (8%)
 Frame = +3

Query  372  RGGLAIGVPAHQpgpspppasfsslappsfgQQFGGLGRGVPDSLP-SSSSAQGR-PVQG  545
            RGG+A+GVPAH P  S    +  S       QQFGGLGR +PDS P +S+++Q R P+QG
Sbjct  164  RGGMAMGVPAHHPSSSFSSLTTPSYG-----QQFGGLGRNLPDSTPPTSTTSQVRQPIQG  218

Query  546  MQGIGITGSLGSSMPMRPAGVPPQPVRSITTSSIRQQS  659
            M G+G+ GSLGS+ PMRPAGV PQ +R + +SSIR Q+
Sbjct  219  MHGMGMMGSLGSTSPMRPAGVSPQQLRPV-SSSIRPQT  255



>ref|XP_010101595.1| Transcription initiation factor TFIID subunit 12 [Morus notabilis]
 gb|EXB88734.1| Transcription initiation factor TFIID subunit 12 [Morus notabilis]
Length=603

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 59/91 (65%), Gaps = 9/91 (10%)
 Frame = +3

Query  354  TVPPPARGGLAIGVPAHQpgpspppasfsslappsfgQQFGGLGR---GVPDSLPSSSSA  524
            T  PP RGG+AIGVPAH+P PSP   +  S +       FGGLGR   G+P+S P+S+++
Sbjct  136  TSAPPPRGGVAIGVPAHRPSPSPSQPAPFSASYG----HFGGLGRSGVGLPESSPNSNAS  191

Query  525  QGRPVQGMQGIGITGSLGSSMPMRPAGVPPQ  617
            Q RP   MQGIG+ GSL S   MRP G+PP 
Sbjct  192  QVRP--SMQGIGMLGSLSSGAQMRPGGIPPH  220



>ref|XP_009366648.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009366649.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Pyrus x bretschneideri]
Length=567

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 62/97 (64%), Gaps = 7/97 (7%)
 Frame = +3

Query  372  RGGLAIGVPAHQpgpspppasfsslappsfgQQFGGLGRG---VPDSLPSSSSAQGRP-V  539
            RGG+AIGV AH  GPS P  +  S +       FGG+GRG   VP+ +P+SS +Q RP +
Sbjct  129  RGGIAIGVSAHHTGPSTPQPTPYSSSYG---HHFGGMGRGGVSVPEPVPNSSPSQVRPSM  185

Query  540  QGMQGIGITGSLGSSMPMRPAGVPPQPVRSITTSSIR  650
            QGMQGIG+ GSLGSS  MRP G+P    +    SS+R
Sbjct  186  QGMQGIGMMGSLGSSSQMRPTGIPAHHPQRPVQSSLR  222



>ref|XP_004246524.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Solanum 
lycopersicum]
Length=566

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 83/139 (60%), Gaps = 27/139 (19%)
 Frame = +3

Query  306  QQPSPFQHLTHPPSSLTVPPPA-------------------RGGLAIGVPAHQpgpsppp  428
            QQPSPFQH + PP     PP +                   RGG+A+GVPAH P  S   
Sbjct  129  QQPSPFQHFSLPPPPPPPPPHSSSSSSSVSSSSVSMQNQNPRGGMAMGVPAHHPSSSFSS  188

Query  429  asfsslappsfgQQFGGLGRGVPDSLP-SSSSAQGR-PVQGMQGIGITGSLGSSMPMRPA  602
             +  S       QQFGGLGR +PDS P +S+++Q R P+QGM G+G+ GSLGS+ PMRPA
Sbjct  189  LTTPSYG-----QQFGGLGRNLPDSTPPTSTTSQVRQPIQGMHGMGMMGSLGSTSPMRPA  243

Query  603  GVPPQPVRSITTSSIRQQS  659
            G+ PQ +R + +S+IR Q+
Sbjct  244  GISPQQLRPV-SSAIRPQT  261



>ref|XP_008241261.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Prunus 
mume]
 ref|XP_008241262.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Prunus 
mume]
Length=578

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 61/94 (65%), Gaps = 11/94 (12%)
 Frame = +3

Query  372  RGGLAIGVPAHQpgpspppasfsslappsfgQQFGGLGRG---VPDSLPSSSSAQGRP-V  539
            RGG+AIGVPA       P     +    S+GQ FGGLGRG   VP+S+ +SS++Q RP  
Sbjct  126  RGGIAIGVPA---HHPSPSPPQPAPFSSSYGQHFGGLGRGGAAVPESVSNSSASQVRPSA  182

Query  540  QGMQGIGITGSLGSSMPMRPAGV----PPQPVRS  629
            QGMQG+ + GSLGSS  MRPAGV    P +PV+S
Sbjct  183  QGMQGMAMMGSLGSSSQMRPAGVSAQHPQRPVQS  216



>ref|XP_008363818.1| PREDICTED: transcription initiation factor TFIID subunit 12-like 
[Malus domestica]
Length=246

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 61/97 (63%), Gaps = 7/97 (7%)
 Frame = +3

Query  372  RGGLAIGVPAHQpgpspppasfsslappsfgQQFGGLGRG---VPDSLPSSSSAQGRP-V  539
            RGG+AIGV AH  GPS P  +  S +       FGG+GRG   VP+ + +SS +Q RP +
Sbjct  130  RGGIAIGVSAHHTGPSTPQPTPYSSSYG---HHFGGMGRGGVSVPEPVSNSSPSQVRPSM  186

Query  540  QGMQGIGITGSLGSSMPMRPAGVPPQPVRSITTSSIR  650
            QGMQGIG+ GSLGSS  MRP G+P    +    SS+R
Sbjct  187  QGMQGIGMMGSLGSSSQMRPTGIPAHHPQRPVQSSLR  223



>ref|XP_010271712.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Nelumbo nucifera]
Length=382

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 53/86 (62%), Gaps = 3/86 (3%)
 Frame = +3

Query  372  RGGLAIGVPAHQpgpspppasfsslappsfgQQFGGLGRG---VPDSLPSSSSAQGRPVQ  542
            RGGLAIGVPAH   P   P S+SS    SF QQFGGL R    VPD   SSS+   +P+Q
Sbjct  146  RGGLAIGVPAHHARPPQQPTSYSSFGTSSFNQQFGGLSRNSVNVPDPNNSSSTQVRQPIQ  205

Query  543  GMQGIGITGSLGSSMPMRPAGVPPQP  620
            G+Q IG+ GS GS   +RP GV   P
Sbjct  206  GIQSIGMIGSHGSGSQLRPGGVSANP  231



>ref|XP_010271709.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Nelumbo nucifera]
 ref|XP_010271711.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Nelumbo nucifera]
Length=558

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 53/86 (62%), Gaps = 3/86 (3%)
 Frame = +3

Query  372  RGGLAIGVPAHQpgpspppasfsslappsfgQQFGGLGRG---VPDSLPSSSSAQGRPVQ  542
            RGGLAIGVPAH   P   P S+SS    SF QQFGGL R    VPD   SSS+   +P+Q
Sbjct  146  RGGLAIGVPAHHARPPQQPTSYSSFGTSSFNQQFGGLSRNSVNVPDPNNSSSTQVRQPIQ  205

Query  543  GMQGIGITGSLGSSMPMRPAGVPPQP  620
            G+Q IG+ GS GS   +RP GV   P
Sbjct  206  GIQSIGMIGSHGSGSQLRPGGVSANP  231



>ref|XP_009374742.1| PREDICTED: transcription initiation factor TFIID subunit 12-like 
[Pyrus x bretschneideri]
Length=592

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 60/96 (63%), Gaps = 8/96 (8%)
 Frame = +3

Query  372  RGGLAIGVPAHQpgpspppasfsslappsfgQQFGGLGRG---VPDSLPSSSSAQGRPVQ  542
            RGG++IGVPAH  GPSPP  +    +       FGG+GRG   VP+S+ +SS +Q RP  
Sbjct  155  RGGISIGVPAHHSGPSPPQPAPYLSSYG---HHFGGMGRGGVSVPESVSNSSPSQVRP--  209

Query  543  GMQGIGITGSLGSSMPMRPAGVPPQPVRSITTSSIR  650
             MQG+G+ GSLGSS  MRP G+P    +    SS+R
Sbjct  210  SMQGMGMMGSLGSSSQMRPTGIPAHHPQRTVQSSVR  245



>ref|XP_007203746.1| hypothetical protein PRUPE_ppa017159mg [Prunus persica]
 gb|EMJ04945.1| hypothetical protein PRUPE_ppa017159mg [Prunus persica]
Length=509

 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 46/63 (73%), Gaps = 8/63 (13%)
 Frame = +3

Query  465  QQFGGLGRG---VPDSLPSSSSAQGRP-VQGMQGIGITGSLGSSMPMRPAGV----PPQP  620
            Q FGGLGRG   VP+ + +SS++Q RP VQGMQG+ + GSLGSS  MRPAGV    P +P
Sbjct  156  QHFGGLGRGGAAVPEPVSNSSASQVRPSVQGMQGMAMMGSLGSSSQMRPAGVSAQHPQRP  215

Query  621  VRS  629
            V+S
Sbjct  216  VQS  218



>ref|XP_010654342.1| PREDICTED: transcription initiation factor TFIID subunit 12, 
partial [Vitis vinifera]
Length=495

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 60/100 (60%), Gaps = 10/100 (10%)
 Frame = +3

Query  372  RGGLAIGVPAHQpgpspppasfsslappsfgQQFGGLGR---GVPDSLPSSSSAQGRP-V  539
            RGG+AIGVPA QP P       +        QQ+GGLGR    VP+S+ +++++Q RP +
Sbjct  86   RGGIAIGVPAGQPTPFSSLNPPTFG------QQYGGLGRSAVNVPESVANTNTSQVRPSI  139

Query  540  QGMQGIGITGSLGSSMPMRPAGVPPQPVRSITTSSIRQQS  659
            QG QG+G+ G+LGS   MRP G+     +    SS+R QS
Sbjct  140  QGSQGMGMMGTLGSGSQMRPGGISAHHQQRPVQSSLRPQS  179



>ref|XP_004305348.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X2 [Fragaria vesca subsp. vesca]
Length=538

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 57/90 (63%), Gaps = 9/90 (10%)
 Frame = +3

Query  363  PPARGGLAIGVPAHQpgpspppasfsslappsfgQQFGGLGRGVPDSLP----SSSSAQG  530
            PP RGG+AIGVPAH P P  P  +    +       FGGLGRG   SLP    +S+++Q 
Sbjct  112  PPPRGGIAIGVPAHHPSPPSPQPTPYPSSYG----HFGGLGRGAGVSLPEPSANSNASQV  167

Query  531  RP-VQGMQGIGITGSLGSSMPMRPAGVPPQ  617
            RP + GMQG+G+ GSLGSS  MRPAG+ P 
Sbjct  168  RPPMPGMQGMGMLGSLGSSSQMRPAGISPH  197



>gb|KEH42050.1| transcription initiation factor TFIID subunit 12 [Medicago truncatula]
Length=395

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 43/90 (48%), Positives = 55/90 (61%), Gaps = 11/90 (12%)
 Frame = +3

Query  372  RGGLAIGVPAHQpgpspppasfsslappsfgQQFGGLGRGVPDSLPSSSSAQGRPVQGMQ  551
            RGG+AIGVPAH   PSPP +S  S       Q FGG+GR   DS  +S+++Q R    MQ
Sbjct  124  RGGMAIGVPAHHQSPSPPFSSSFS-------QHFGGMGRS--DSTTNSNTSQVRAP--MQ  172

Query  552  GIGITGSLGSSMPMRPAGVPPQPVRSITTS  641
            G+G  GS GS+  MRP G+PP   R + +S
Sbjct  173  GMGTLGSFGSNSQMRPGGMPPHQQRPVQSS  202



>gb|KEH42051.1| transcription initiation factor TFIID subunit 12 [Medicago truncatula]
Length=515

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 43/90 (48%), Positives = 55/90 (61%), Gaps = 11/90 (12%)
 Frame = +3

Query  372  RGGLAIGVPAHQpgpspppasfsslappsfgQQFGGLGRGVPDSLPSSSSAQGRPVQGMQ  551
            RGG+AIGVPAH   PSPP +S  S       Q FGG+GR   DS  +S+++Q R    MQ
Sbjct  124  RGGMAIGVPAHHQSPSPPFSSSFS-------QHFGGMGRS--DSTTNSNTSQVRAP--MQ  172

Query  552  GIGITGSLGSSMPMRPAGVPPQPVRSITTS  641
            G+G  GS GS+  MRP G+PP   R + +S
Sbjct  173  GMGTLGSFGSNSQMRPGGMPPHQQRPVQSS  202



>ref|XP_011466777.1| PREDICTED: transcription initiation factor TFIID subunit 12 isoform 
X1 [Fragaria vesca subsp. vesca]
Length=541

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 57/93 (61%), Gaps = 12/93 (13%)
 Frame = +3

Query  363  PPARGGLAIGVPAHQpgpspppasfsslappsfgQQFGGLGRGVPDSLP----SSSSAQG  530
            PP RGG+AIGVPAH P P  P  +    +       FGGLGRG   SLP    +S+++Q 
Sbjct  112  PPPRGGIAIGVPAHHPSPPSPQPTPYPSSYG----HFGGLGRGAGVSLPEPSANSNASQV  167

Query  531  RPVQ----GMQGIGITGSLGSSMPMRPAGVPPQ  617
            R V+    GMQG+G+ GSLGSS  MRPAG+ P 
Sbjct  168  RSVRPPMPGMQGMGMLGSLGSSSQMRPAGISPH  200



>ref|XP_012066476.1| PREDICTED: transcription initiation factor TFIID subunit 12 [Jatropha 
curcas]
 gb|KDP42726.1| hypothetical protein JCGZ_23666 [Jatropha curcas]
Length=535

 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 57/96 (59%), Gaps = 11/96 (11%)
 Frame = +3

Query  372  RGGLAIGVPAHQpgpspppasfsslappsfgQQFGGLGRG---VPDSLPSSSSAQGRPVQ  542
            RGG+AIGVPA        P    +    SFGQQFG L RG   VP+S+ ++S++Q R   
Sbjct  134  RGGVAIGVPA------SHPTPSPAPFSSSFGQQFGALTRGTVNVPESVANASNSQVR--H  185

Query  543  GMQGIGITGSLGSSMPMRPAGVPPQPVRSITTSSIR  650
            GMQG+G+TGS+ S   +RP G+P    +    SSIR
Sbjct  186  GMQGMGMTGSMSSGSQIRPVGIPAHHQQRPVQSSIR  221



>emb|CDY00904.1| BnaC05g42960D [Brassica napus]
Length=527

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 38/52 (73%), Gaps = 3/52 (6%)
 Frame = +3

Query  465  QQFGGLGRG---VPDSLPSSSSAQGRPVQGMQGIGITGSLGSSMPMRPAGVP  611
            QQ+GGLGRG   + ++  +SS  QGR +QG QG+G+ G++GS   MRP+G+P
Sbjct  167  QQYGGLGRGTVGMSEASSNSSVTQGRMMQGTQGMGMMGTIGSGSQMRPSGMP  218



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1063448340092