BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig2180

Length=615
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAA87043.1|  N-hydroxycinnamoyl/benzoyltransferase                  150   1e-47   Ipomoea batatas [batate]
ref|NP_001234850.1|  hydroxycinnamoyl CoA quinate transferase           134   1e-44   
ref|XP_009800587.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    135   1e-44   Nicotiana sylvestris
emb|CAE46932.1|  hydroxycinnamoyl CoA quinate transferase               134   3e-44   Nicotiana tabacum [American tobacco]
ref|XP_009624297.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    133   3e-44   Nicotiana tomentosiformis
ref|XP_006343633.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    131   4e-44   Solanum tuberosum [potatoes]
ref|NP_001275483.1|  HQT                                                130   5e-44   Solanum tuberosum [potatoes]
gb|ABA46756.1|  hydroxycinnamoyl-CoA quinate-like protein               130   5e-44   Solanum tuberosum [potatoes]
emb|CDP02827.1|  unnamed protein product                                132   7e-43   Coffea canephora [robusta coffee]
gb|AFP49814.1|  caffeoyl-CoA quinic acid caffeoyl transferase 4         126   4e-41   Coffea arabica [arabica coffee]
gb|ABO77956.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyltran...    126   4e-41   Coffea canephora [robusta coffee]
gb|ABO77957.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyltran...    126   4e-41   Coffea canephora [robusta coffee]
emb|CAT00081.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyci...    126   5e-41   Coffea arabica [arabica coffee]
gb|AEM63676.1|  hydroxycinnamoyl CoA quinate hydroxycinnamoyl tra...    130   1e-39   Platycodon grandiflorus [balloon-flower]
ref|XP_009614241.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    127   8e-39   Nicotiana tomentosiformis
gb|AEK80405.1|  HQT                                                     124   2e-38   Lonicera japonica [Japanese honeysuckle]
gb|ACZ52698.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyltran...    123   5e-38   Lonicera japonica [Japanese honeysuckle]
ref|XP_009798536.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    124   8e-38   Nicotiana sylvestris
gb|ACF37072.1|  hydroxycinnamoyl CoA quinate transferase 1              118   1e-36   Cynara cardunculus var. scolymus [artichoke]
gb|ABK79689.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...    124   2e-36   Cynara cardunculus var. scolymus [artichoke]
gb|AFL93687.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyl-tra...    124   3e-36   Cynara cardunculus var. scolymus [artichoke]
gb|ABK79690.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...    124   4e-36   Cynara cardunculus var. altilis [cultivated cardoon]
ref|XP_010265527.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    115   2e-35   Nelumbo nucifera [Indian lotus]
gb|ADL62855.1|  hydroxycinnamoyl-CoA transferase 2                      117   3e-35   Cynara cardunculus var. scolymus [artichoke]
gb|KJB56501.1|  hypothetical protein B456_009G122600                    112   6e-35   Gossypium raimondii
gb|KJB56505.1|  hypothetical protein B456_009G122600                    112   7e-35   Gossypium raimondii
gb|AHG97388.1|  putative hydroxycinnamoyl CoA shikimate/quinate h...    112   7e-35   Gossypium hirsutum [American cotton]
gb|AHA14500.1|  hydroxycinnamoyl-coenzyme A quinate transperase         117   1e-34   Fagopyrum tataricum [Kangra buckwheat]
pdb|4G22|A  Chain A, Structure Of A Lys-Hct Mutant From Coffea Ca...    110   4e-34   Coffea canephora [robusta coffee]
pdb|4G2M|A  Chain A, Structure Of A Lys-Hct Mutant From Coffea Ca...    110   5e-34   Coffea canephora [robusta coffee]
emb|CDO98242.1|  unnamed protein product                                110   5e-34   Coffea canephora [robusta coffee]
pdb|4G0B|A  Chain A, Structure Of Native Hct From Coffea Canephora      110   5e-34   Coffea canephora [robusta coffee]
gb|ABO47805.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    110   5e-34   Coffea canephora [robusta coffee]
emb|CAT00088.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyci...    110   5e-34   Coffea arabica [arabica coffee]
emb|CAJ40778.1|  hydroxycinnamoyl transferase                           110   7e-34   Coffea arabica [arabica coffee]
ref|XP_011620549.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    112   9e-34   Amborella trichopoda
gb|AEM63675.1|  hydroxycinnamoyl CoA shikimate/quinate hydroxycin...    110   1e-33   Platycodon grandiflorus [balloon-flower]
gb|ABO40491.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    109   1e-33   Coffea arabica [arabica coffee]
gb|ERM93896.1|  hypothetical protein AMTR_s00137p00027820               112   1e-33   Amborella trichopoda
gb|AFN85668.1|  putative hydroxycinnamoyl CoA shikimate/quinate h...    110   1e-33   Hibiscus cannabinus [bimli-jute]
ref|XP_011020577.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    110   2e-33   Populus euphratica
ref|XP_009615699.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    114   2e-33   Nicotiana tomentosiformis
ref|XP_007023475.1|  Hydroxycinnamoyl-CoA shikimate/quinate hydro...    110   3e-33   Theobroma cacao [chocolate]
emb|CBI25231.3|  unnamed protein product                                114   3e-33   Vitis vinifera
ref|XP_002268988.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    114   3e-33   Vitis vinifera
ref|XP_012067474.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    108   3e-33   Jatropha curcas
emb|CAN82918.1|  hypothetical protein VITISV_023290                     114   3e-33   Vitis vinifera
gb|ABO77955.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    111   4e-33   Coffea canephora [robusta coffee]
gb|ACC63882.1|  quinate O-hydroxycinnamoyltransferase/shikimate O...    109   5e-33   Populus trichocarpa [western balsam poplar]
gb|AIG20957.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    110   7e-33   Lonicera japonica [Japanese honeysuckle]
ref|XP_009399564.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    110   9e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006368492.1|  transferase family protein                         109   1e-32   Populus trichocarpa [western balsam poplar]
gb|AFZ78609.1|  hydroxycinnamoyl-CoA:shikimate/quinate hydroxycin...    109   1e-32   Populus tomentosa [Chinese white poplar]
ref|NP_199704.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyc...    110   2e-32   Arabidopsis thaliana [mouse-ear cress]
gb|AFF19203.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...    104   2e-32   Erythroxylum coca [coca]
gb|AAM61215.1|  anthranilate N-benzoyltransferase                       110   3e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006392548.1|  hypothetical protein EUTSA_v10011497mg             112   3e-32   Eutrema salsugineum [saltwater cress]
gb|AFS68800.1|  hydroxycinnamoyl transferase                            107   3e-32   Lonicera japonica [Japanese honeysuckle]
gb|AFL93686.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    112   5e-32   Cynara cardunculus var. scolymus [artichoke]
emb|CCC55431.1|  hydroxycinnamoyl CoA shikimate/quinate hydroxyci...    106   5e-32   Pinus pinaster [cluster pine]
gb|ABO52899.1|  hydroxycinnamoyl-CoA:shikimate hydroxycinnamoyltr...    106   5e-32   Pinus radiata
gb|KCW53914.1|  hypothetical protein EUGRSUZ_J03126                     107   5e-32   Eucalyptus grandis [rose gum]
ref|XP_010034043.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    107   5e-32   
dbj|BAJ14794.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyci...    108   6e-32   Ipomoea batatas [batate]
ref|XP_002894568.1|  transferase family protein                         108   6e-32   Arabidopsis lyrata subsp. lyrata
ref|XP_010942061.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    105   7e-32   Elaeis guineensis
emb|CDY05770.1|  BnaC07g00330D                                          111   7e-32   
ref|XP_011467012.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    103   7e-32   Fragaria vesca subsp. vesca
ref|XP_008790160.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    103   1e-31   Phoenix dactylifera
ref|XP_010479239.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    106   1e-31   Camelina sativa [gold-of-pleasure]
gb|AAZ80046.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...    110   1e-31   Cynara cardunculus [cardoon]
ref|XP_004235891.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    108   1e-31   Solanum lycopersicum
gb|ABR17170.1|  unknown                                                 107   1e-31   Picea sitchensis
gb|AHA44839.1|  hydroxycinnamoyl-CoA shikimate hydroxycinnamoyltr...    107   2e-31   Larix kaempferi [karamatsu]
ref|XP_006341413.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    107   2e-31   Solanum tuberosum [potatoes]
gb|ACF17657.1|  putative hydroxycinnamoyl transferase                   107   2e-31   Capsicum annuum
ref|XP_010462493.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    108   3e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010480194.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    108   3e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010501253.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    108   3e-31   Camelina sativa [gold-of-pleasure]
ref|XP_009102018.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    109   3e-31   Brassica rapa
emb|CDY31956.1|  BnaA07g00390D                                          109   3e-31   Brassica napus [oilseed rape]
ref|XP_009394928.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    102   4e-31   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO55352.1|  hypothetical protein CISIN_1g014116mg                   102   5e-31   Citrus sinensis [apfelsine]
ref|XP_003543709.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    108   5e-31   Glycine max [soybeans]
ref|XP_006427659.1|  hypothetical protein CICLE_v10026558mg             102   5e-31   
ref|XP_009380783.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    102   8e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011034568.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    109   8e-31   Populus euphratica
emb|CBI83579.1|  hydroxycinnamoyl transferase                           102   8e-31   Plectranthus scutellarioides
ref|XP_002512739.1|  Anthranilate N-benzoyltransferase protein, p...    100   1e-30   Ricinus communis
gb|KHN31873.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    106   1e-30   Glycine soja [wild soybean]
gb|AEJ88365.1|  hydroxycinnamoyltransferase                             103   2e-30   Cucumis sativus [cucumbers]
ref|XP_004135880.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    103   2e-30   
gb|KEH38242.1|  shikimate/quinate hydroxycinnamoyltransferase           109   2e-30   Medicago truncatula
ref|XP_008461189.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    103   2e-30   
ref|NP_001280198.1|  shikimate O-hydroxycinnamoyltransferase-like       103   2e-30   Prunus mume [ume]
ref|XP_003637275.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    106   2e-30   
ref|XP_006493385.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    103   2e-30   Citrus sinensis [apfelsine]
gb|KEH39662.1|  shikimate/quinate hydroxycinnamoyltransferase           106   2e-30   Medicago truncatula
gb|ACA64049.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...  99.8    4e-30   Salvia miltiorrhiza [Chinese salvia]
gb|AGA20364.1|  hydroxycinnamoyl CoA shikimate/quinate hydroxycin...    102   4e-30   Leucaena leucocephala [cassie]
gb|ADG46003.1|  hydroxycinnamoyl transferase                          99.8    4e-30   Salvia miltiorrhiza [Chinese salvia]
ref|XP_010500346.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    105   4e-30   Camelina sativa [gold-of-pleasure]
ref|XP_003531748.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    103   4e-30   Glycine max [soybeans]
ref|XP_008342823.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    103   5e-30   
ref|XP_011073311.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  98.2    6e-30   Sesamum indicum [beniseed]
ref|XP_006826688.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  97.4    6e-30   Amborella trichopoda
ref|XP_007135841.1|  hypothetical protein PHAVU_010G162700g             103   7e-30   Phaseolus vulgaris [French bean]
ref|XP_006307576.1|  hypothetical protein CARUB_v10009198mg             105   7e-30   Capsella rubella
gb|AGV54440.1|  shikimate O-hydroxycinnamoyltransferase                 103   7e-30   Phaseolus vulgaris [French bean]
ref|XP_010113235.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...  96.3    9e-30   Morus notabilis
ref|XP_010063596.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  97.4    1e-29   Eucalyptus grandis [rose gum]
ref|XP_007150819.1|  hypothetical protein PHAVU_005G183200g             104   1e-29   Phaseolus vulgaris [French bean]
ref|XP_009626780.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    101   1e-29   Nicotiana tomentosiformis
ref|NP_001289240.1|  shikimate O-hydroxycinnamoyltransferase-like       102   1e-29   Pyrus x bretschneideri [bai li]
ref|XP_009626781.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    100   1e-29   Nicotiana tomentosiformis
ref|XP_006583082.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    102   2e-29   Glycine max [soybeans]
ref|XP_007215401.1|  hypothetical protein PRUPE_ppa005910mg             100   2e-29   Prunus persica
gb|AHK05938.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    100   2e-29   Caragana korshinskii
ref|XP_011082506.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  96.3    2e-29   Sesamum indicum [beniseed]
ref|XP_012071524.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    102   2e-29   Jatropha curcas
gb|ADL62854.1|  hydroxycinnamoyl-CoA transferase 1                      104   3e-29   Cynara cardunculus var. scolymus [artichoke]
gb|KFK35521.1|  hypothetical protein AALP_AA4G001700                    102   3e-29   Arabis alpina [alpine rockcress]
gb|ACJ23164.1|  hydroxycinnamoyl CoA quinate transferase 2              104   3e-29   Cynara cardunculus var. scolymus [artichoke]
ref|XP_006583083.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    101   4e-29   Glycine max [soybeans]
ref|XP_007011895.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    100   4e-29   
ref|XP_009760608.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  99.8    4e-29   Nicotiana sylvestris
gb|KEH28560.1|  shikimate/quinate hydroxycinnamoyltransferase           101   5e-29   Medicago truncatula
ref|XP_009375480.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    103   8e-29   Pyrus x bretschneideri [bai li]
ref|XP_010479238.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    103   1e-28   Camelina sativa [gold-of-pleasure]
emb|CDY22880.1|  BnaA01g18180D                                          102   1e-28   Brassica napus [oilseed rape]
gb|EYU24586.1|  hypothetical protein MIMGU_mgv1a0064641mg             96.7    1e-28   Erythranthe guttata [common monkey flower]
dbj|BAF49306.1|  putative acyltransferase                             99.4    1e-28   Clitoria ternatea
ref|XP_009146509.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    102   1e-28   Brassica rapa
ref|XP_009789449.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    114   2e-28   Nicotiana sylvestris
dbj|BAF49305.1|  putative acyltransferase                             99.8    2e-28   Clitoria ternatea
gb|KHN04193.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...  98.6    2e-28   Glycine soja [wild soybean]
ref|XP_003530223.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  98.6    2e-28   Glycine max [soybeans]
ref|XP_010481008.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    102   3e-28   
gb|EPS58183.1|  hypothetical protein M569_16633                       94.4    3e-28   Genlisea aurea
gb|AFR40280.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    110   4e-28   Populus alba [abele]
emb|CAR92145.1|  hydroxycinnamoyl CoA quinate transferase 2             104   5e-28   Cynara cardunculus var. scolymus [artichoke]
ref|XP_006303767.1|  hypothetical protein CARUB_v10011977mg             100   5e-28   Capsella rubella
gb|AFR40289.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    110   5e-28   Populus fremontii
emb|CDY44162.1|  BnaC01g22120D                                        99.8    6e-28   Brassica napus [oilseed rape]
gb|AFR40282.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    110   6e-28   Populus alba [abele]
gb|AFR40286.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    110   7e-28   Populus fremontii
gb|AFR40293.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    110   7e-28   Populus fremontii
ref|XP_002324534.1|  hypothetical protein POPTR_0018s11450g           97.4    7e-28   
gb|AFR40266.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    109   9e-28   Populus trichocarpa [western balsam poplar]
ref|XP_010094061.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...    101   1e-27   
gb|AFR40277.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    109   1e-27   Populus trichocarpa [western balsam poplar]
gb|ACI16630.1|  shikimate O-hydroxycinnamoyltransferase               95.9    1e-27   Trifolium pratense [peavine clover]
ref|XP_004507045.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  94.7    1e-27   
gb|ACI28534.1|  shikimate O-hydroxycinnamoyl transferase              95.9    1e-27   Trifolium pratense [peavine clover]
ref|XP_010479240.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    102   1e-27   Camelina sativa [gold-of-pleasure]
gb|ABR14148.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    111   1e-27   Coffea arabica [arabica coffee]
ref|XP_004507046.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  94.7    1e-27   Cicer arietinum [garbanzo]
gb|KJB68256.1|  hypothetical protein B456_010G234800                  99.0    2e-27   Gossypium raimondii
gb|KJB68255.1|  hypothetical protein B456_010G234700                  99.0    2e-27   Gossypium raimondii
ref|XP_010244666.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  89.4    3e-27   Nelumbo nucifera [Indian lotus]
ref|XP_007011894.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...  95.9    3e-27   
gb|KJB54946.1|  hypothetical protein B456_009G055900                  98.2    5e-27   Gossypium raimondii
gb|AFR40295.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    107   6e-27   Populus fremontii
gb|AFR40292.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    110   6e-27   Populus fremontii
gb|AFR40294.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    110   6e-27   Populus fremontii
gb|KJB68259.1|  hypothetical protein B456_010G235000                  97.8    6e-27   Gossypium raimondii
gb|AFR40306.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    109   6e-27   Populus nigra [black poplar]
ref|XP_010244683.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  96.3    6e-27   Nelumbo nucifera [Indian lotus]
gb|KJB54948.1|  hypothetical protein B456_009G055900                  98.2    7e-27   Gossypium raimondii
ref|XP_011018044.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  93.6    9e-27   Populus euphratica
gb|AFR40271.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    109   9e-27   Populus trichocarpa [western balsam poplar]
ref|XP_010500344.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    100   1e-26   Camelina sativa [gold-of-pleasure]
ref|XP_007215395.1|  hypothetical protein PRUPE_ppa005872mg           90.5    1e-26   
gb|AFR40272.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    109   1e-26   Populus trichocarpa [western balsam poplar]
gb|AFR40305.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    108   1e-26   Populus nigra [black poplar]
gb|KJB68253.1|  hypothetical protein B456_010G234500                  96.3    2e-26   Gossypium raimondii
ref|XP_004976123.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  93.6    2e-26   Setaria italica
ref|XP_002277474.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  90.1    2e-26   Vitis vinifera
ref|XP_008228811.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  91.7    2e-26   Prunus mume [ume]
ref|XP_007215396.1|  hypothetical protein PRUPE_ppa005873mg           90.1    3e-26   Prunus persica
ref|XP_008228810.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  91.7    3e-26   Prunus mume [ume]
ref|XP_011018051.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  94.7    3e-26   Populus euphratica
ref|XP_002324530.2|  hypothetical protein POPTR_0018s11370g           94.0    4e-26   
gb|AFR40291.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    106   5e-26   Populus fremontii
ref|XP_006303737.1|  hypothetical protein CARUB_v10011876mg           95.5    6e-26   Capsella rubella
gb|KJB54981.1|  hypothetical protein B456_009G057200                    105   1e-25   Gossypium raimondii
ref|XP_011018045.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  89.7    1e-25   Populus euphratica
ref|XP_010063590.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  97.8    1e-25   Eucalyptus grandis [rose gum]
gb|KHG19404.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    105   1e-25   Gossypium arboreum [tree cotton]
ref|NP_001145871.1|  uncharacterized protein LOC100279386             91.7    2e-25   
gb|KJB68258.1|  hypothetical protein B456_010G234900                  93.2    2e-25   Gossypium raimondii
gb|ACG47161.1|  anthranilate N-benzoyltransferase protein 2           91.3    2e-25   Zea mays [maize]
ref|XP_006652479.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  88.6    2e-25   Oryza brachyantha
ref|XP_011011266.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  92.8    2e-25   Populus euphratica
ref|XP_008777439.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  94.4    2e-25   Phoenix dactylifera
ref|XP_002446745.1|  hypothetical protein SORBIDRAFT_06g021640        87.0    4e-25   Sorghum bicolor [broomcorn]
ref|XP_010545447.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  81.3    4e-25   Tarenaya hassleriana [spider flower]
dbj|BAO20883.1|  hydroxycinnamoyl CoA: shikimate hydroxycinnamoyl...  90.9    5e-25   Panicum virgatum
ref|NP_200592.1|  anthranilate N-hydroxycinnamoyl/benzoyltransfer...  84.0    5e-25   Arabidopsis thaliana [mouse-ear cress]
gb|ACD03271.1|  hydroxycinnamoyl transferase                          94.0    6e-25   Sinopodophyllum hexandrum [Himalayan mayapple]
ref|XP_010063583.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  90.5    6e-25   Eucalyptus grandis [rose gum]
ref|XP_008381122.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  99.8    8e-25   Malus domestica [apple tree]
ref|XP_002324532.1|  hypothetical protein POPTR_0018s11380g           92.4    8e-25   Populus trichocarpa [western balsam poplar]
ref|XP_010063586.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  95.9    9e-25   
gb|EMT09803.1|  Anthranilate N-benzoyltransferase protein 1           84.7    1e-24   
ref|XP_007011892.1|  Hydroxycinnamoyl-CoA shikimate/quinate hydro...  93.6    1e-24   
ref|XP_001756433.1|  predicted protein                                85.1    2e-24   
ref|XP_006436001.1|  hypothetical protein CICLE_v10033907mg           86.3    2e-24   
ref|XP_010452842.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  87.0    2e-24   Camelina sativa [gold-of-pleasure]
ref|XP_007099552.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    106   2e-24   
gb|ADB44897.1|  hydroxycinnamoyl transferase                          92.0    3e-24   Sinopodophyllum hexandrum [Himalayan mayapple]
ref|XP_010483334.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  82.4    3e-24   Camelina sativa [gold-of-pleasure]
ref|XP_003629304.1|  Hydroxycinnamoyl-CoA quinate hydroxycinnamoy...  85.9    4e-24   
gb|AFR40273.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    101   4e-24   Populus trichocarpa [western balsam poplar]
gb|EYU21749.1|  hypothetical protein MIMGU_mgv1a006630mg              86.7    4e-24   Erythranthe guttata [common monkey flower]
ref|XP_002866234.1|  transferase family protein                       82.0    4e-24   Arabidopsis lyrata subsp. lyrata
gb|EYU24606.1|  hypothetical protein MIMGU_mgv1a005249mg              97.4    5e-24   Erythranthe guttata [common monkey flower]
ref|XP_008228829.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  83.6    5e-24   Prunus mume [ume]
emb|CDG56249.1|  hydroxycinnamoyl-CoA:shikimate hydroxycinnamoylt...  82.0    5e-24   Glechoma hederacea [gill-over-the-ground]
ref|XP_006486096.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  84.7    6e-24   Citrus sinensis [apfelsine]
gb|ABI48360.1|  putative alcohol acyltransferase 1                    91.7    6e-24   Lavandula angustifolia [lavender]
gb|KHG08871.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...  95.1    6e-24   Gossypium arboreum [tree cotton]
ref|XP_006382508.1|  hypothetical protein POPTR_0005s02810g           97.4    6e-24   Populus trichocarpa [western balsam poplar]
ref|XP_007027324.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    107   7e-24   
ref|XP_008237042.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  86.3    7e-24   Prunus mume [ume]
ref|XP_007099550.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    107   7e-24   
gb|AGH61997.1|  rosmarinic acid synthase                              90.5    8e-24   Perilla frutescens [beefsteak-mint]
gb|EYU24607.1|  hypothetical protein MIMGU_mgv1a006502mg              95.1    9e-24   Erythranthe guttata [common monkey flower]
ref|XP_011036823.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  96.7    1e-23   Populus euphratica
ref|XP_003575337.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  82.4    1e-23   Brachypodium distachyon [annual false brome]
ref|XP_008370591.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  87.8    1e-23   
gb|KFK27325.1|  hypothetical protein AALP_AA8G368300                  87.0    2e-23   Arabis alpina [alpine rockcress]
ref|XP_010101376.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...  82.0    2e-23   Morus notabilis
sp|G0LD36.1|RAS_MELOI  RecName: Full=Rosmarinate synthase; Short=...  89.4    2e-23   Melissa officinalis [sweet balm]
ref|XP_006453163.1|  hypothetical protein CICLE_v10010833mg           87.8    2e-23   Citrus clementina [clementine]
gb|EAY94737.1|  hypothetical protein OsI_16513                        83.2    2e-23   Oryza sativa Indica Group [Indian rice]
ref|XP_006280408.1|  hypothetical protein CARUB_v10026341mg           81.3    2e-23   
ref|XP_007216058.1|  hypothetical protein PRUPE_ppa017691mg           81.6    2e-23   Prunus persica
dbj|BAJ91003.1|  predicted protein                                    85.5    2e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006401163.1|  hypothetical protein EUTSA_v10013552mg           85.1    2e-23   Eutrema salsugineum [saltwater cress]
ref|XP_007217854.1|  hypothetical protein PRUPE_ppa024073mg           84.0    2e-23   
dbj|BAC78634.1|  hydroxyanthranilate hydroxycinnamoyltransferase 2    82.4    2e-23   Avena sativa [cultivated oat]
emb|CAE01635.3|  OSJNBa0029H02.19                                     82.8    3e-23   Oryza sativa Japonica Group [Japonica rice]
gb|AJA31666.1|  rosmarinic acid synthase                              86.7    3e-23   Salvia miltiorrhiza [Chinese salvia]
gb|ADA60182.1|  rosmarinic acid synthase                              86.7    3e-23   Salvia miltiorrhiza [Chinese salvia]
ref|NP_001053225.1|  Os04g0500700                                     82.8    4e-23   
dbj|BAJ93247.1|  predicted protein                                    85.1    4e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ95750.1|  predicted protein                                    85.1    4e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AEA36976.1|  rosmarinic acid synthase                              89.0    4e-23   Lavandula angustifolia [lavender]
emb|CDG56248.1|  hydroxycinnamoyl-CoA:shikimate hydroxycinnamoylt...  79.0    5e-23   Glechoma hederacea [gill-over-the-ground]
gb|AFF19202.1|  BAHD acyltransferase                                  98.6    6e-23   Erythroxylum coca [coca]
ref|XP_010942060.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  88.6    6e-23   Elaeis guineensis
ref|XP_007027325.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    104   6e-23   
dbj|BAC78635.1|  hydroxyanthranilate hydroxycinnamoyltransferase 3    79.7    6e-23   Avena sativa [cultivated oat]
ref|XP_007011897.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...  87.4    6e-23   
ref|XP_008790158.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  87.0    7e-23   
ref|XP_009366046.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  85.1    7e-23   Pyrus x bretschneideri [bai li]
dbj|BAC78633.1|  hydroxyanthranilate hydroxycinnamoyltransferase 1    78.6    9e-23   Avena sativa [cultivated oat]
gb|EPS58233.1|  hypothetical protein M569_16582                       93.2    1e-22   Genlisea aurea
ref|XP_006427031.1|  hypothetical protein CICLE_v10027308mg           87.0    1e-22   
ref|XP_006382509.1|  hypothetical protein POPTR_0005s02820g           92.0    1e-22   
ref|XP_006471700.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  79.7    1e-22   Citrus sinensis [apfelsine]
dbj|BAK06288.1|  predicted protein                                    78.2    1e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007099551.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    103   1e-22   
ref|XP_006648830.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  80.5    1e-22   
ref|XP_006471699.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  80.9    2e-22   
dbj|BAJ87836.1|  predicted protein                                    77.8    2e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB71590.1|  hypothetical protein B456_011G1315001                   102   3e-22   Gossypium raimondii
ref|XP_007027321.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    102   3e-22   
ref|XP_006432977.1|  hypothetical protein CICLE_v10002415mg           79.7    4e-22   
ref|XP_004295153.2|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  87.4    4e-22   Fragaria vesca subsp. vesca
ref|XP_002979061.1|  probable hydroxycinnamoyltransferase             89.0    4e-22   Selaginella moellendorffii
ref|XP_003580078.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  84.3    4e-22   Brachypodium distachyon [annual false brome]
ref|XP_008381165.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  80.1    5e-22   
ref|NP_001047408.1|  Os02g0611800                                     78.6    6e-22   
gb|EAZ23787.1|  hypothetical protein OsJ_07497                        78.2    7e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002991534.1|  probable hydroxycinnamoyl transferase            87.8    8e-22   Selaginella moellendorffii
gb|AFK10218.1|  hydroxycinnamoyl-coenzyme A shikimate/quinate hyd...  81.6    9e-22   Pyrus x bretschneideri [bai li]
gb|KJB71578.1|  hypothetical protein B456_011G130700                    100   1e-21   Gossypium raimondii
gb|AGW27210.1|  rosmarinic acid synthase 5                            85.1    1e-21   
emb|CDG56250.1|  hydroxycinnamoyl-CoA:hydroxyphenyllactate hydrox...  85.9    1e-21   
ref|XP_009365251.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  80.9    1e-21   
ref|XP_008777438.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  86.7    1e-21   
gb|KJB71596.1|  hypothetical protein B456_011G132100                    101   1e-21   
emb|CDG56251.1|  hydroxycinnamoyl-CoA:hydroxyphenyllactate hydrox...  85.5    1e-21   
gb|KJB71580.1|  hypothetical protein B456_011G130700                    100   1e-21   
gb|KJB71581.1|  hypothetical protein B456_011G130700                    100   1e-21   
ref|XP_008223321.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  86.3    1e-21   
ref|XP_009354208.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  77.0    1e-21   
ref|XP_008353756.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  76.6    2e-21   
ref|XP_007149778.1|  hypothetical protein PHAVU_005G098400g           96.7    2e-21   
ref|XP_010273688.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  82.8    2e-21   
ref|XP_006471643.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  77.8    2e-21   
emb|CDG56253.1|  hydroxycinnamoyltransferase 2                        88.6    2e-21   
gb|EPS67512.1|  hypothetical protein M569_07262                       87.0    2e-21   
sp|A0PDV5.1|RAS_PLESU  RecName: Full=Rosmarinate synthase; Short=...  85.5    2e-21   
gb|KHG20214.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    100   2e-21   
gb|KJB71577.1|  hypothetical protein B456_011G130700                    100   2e-21   
gb|AFF57839.1|  hydroxycinnamoyl-coenzyme A shikimate/quinate hyd...  76.6    2e-21   
ref|XP_007214866.1|  hypothetical protein PRUPE_ppa019948mg           80.1    2e-21   
ref|XP_004507047.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  81.3    3e-21   
emb|CDG56252.1|  hydroxycinnamoyltransferase 1                        86.7    3e-21   
gb|AGW27211.1|  rosmarinic acid synthase 6                            86.7    3e-21   
ref|XP_009132100.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  77.4    3e-21   
gb|KJB68254.1|  hypothetical protein B456_010G234600                  78.6    4e-21   
ref|XP_007033659.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...  88.6    4e-21   
ref|XP_011036967.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  85.5    5e-21   
ref|XP_004953073.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  79.3    5e-21   
ref|XP_007027320.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    101   5e-21   
ref|XP_009132104.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  77.4    6e-21   
gb|KJB68220.1|  hypothetical protein B456_010G233100                  96.3    7e-21   
gb|EMT08585.1|  Anthranilate N-benzoyltransferase protein 1           77.4    8e-21   
ref|XP_009366045.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  78.2    1e-20   
emb|CDY11845.1|  BnaC03g12710D                                        77.8    1e-20   
gb|EMS64907.1|  Anthranilate N-benzoyltransferase protein 3           77.0    2e-20   
ref|XP_007156887.1|  hypothetical protein PHAVU_002G025600g           92.8    2e-20   
ref|XP_006427036.1|  hypothetical protein CICLE_v10026670mg           85.5    2e-20   
emb|CDX88644.1|  BnaA03g10050D                                        75.9    2e-20   
gb|AAZ80048.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...  72.0    2e-20   
ref|XP_007149789.1|  hypothetical protein PHAVU_005G0988000g          91.7    2e-20   
gb|AAZ80047.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...  72.0    2e-20   
ref|XP_006474075.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  80.9    2e-20   
ref|XP_007216677.1|  hypothetical protein PRUPE_ppa1027182mg          66.6    3e-20   
ref|XP_004294955.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  80.9    3e-20   
gb|AGM90558.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...  76.6    3e-20   
ref|XP_006474074.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  77.8    4e-20   
emb|CDX88645.1|  BnaA03g10040D                                        75.9    5e-20   
dbj|BAJ91746.1|  predicted protein                                    83.6    5e-20   
ref|XP_002529413.1|  Anthranilate N-benzoyltransferase protein, p...  84.7    7e-20   
gb|EPS67739.1|  hypothetical protein M569_07035                       83.2    8e-20   
dbj|BAJ89730.1|  predicted protein                                    83.2    9e-20   
ref|XP_011084630.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  82.8    1e-19   
ref|XP_006465545.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  83.2    1e-19   
ref|XP_007216080.1|  hypothetical protein PRUPE_ppa018070mg           65.5    1e-19   
gb|AGW27209.1|  rosmarinic acid synthase 4                            79.7    1e-19   
ref|XP_007215406.1|  hypothetical protein PRUPE_ppa005955mg           68.9    1e-19   
ref|XP_008228828.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  67.4    1e-19   
gb|AFW72297.1|  hypothetical protein ZEAMMB73_779483                  77.0    2e-19   
ref|XP_006464645.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  74.3    2e-19   
ref|NP_001132890.1|  LOC100194386                                     76.6    2e-19   
gb|ACG29714.1|  anthranilate N-benzoyltransferase protein 1           76.6    2e-19   
ref|XP_006465544.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  82.4    2e-19   
ref|XP_006474020.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  73.9    2e-19   
gb|EYU24587.1|  hypothetical protein MIMGU_mgv1a006602mg              73.2    3e-19   
ref|XP_006474019.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  72.4    3e-19   
gb|EMS49606.1|  Anthranilate N-benzoyltransferase protein 1           66.6    3e-19   
gb|EMS50893.1|  Anthranilate N-benzoyltransferase protein 1           81.3    5e-19   
ref|XP_010527105.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  70.5    5e-19   
gb|KJB68227.1|  hypothetical protein B456_010G233600                  93.6    5e-19   
gb|KJB68229.1|  hypothetical protein B456_010G233600                  93.6    5e-19   
gb|AGW27208.1|  rosmarinic acid synthase 3                            81.6    6e-19   
gb|EYU21745.1|  hypothetical protein MIMGU_mgv1a006579mg              70.9    7e-19   
ref|XP_010273689.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  81.3    8e-19   
gb|EAY99938.1|  hypothetical protein OsI_21941                        79.7    8e-19   
ref|XP_010093469.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...  64.7    8e-19   
ref|XP_006427033.1|  hypothetical protein CICLE_v10026791mg           88.6    1e-18   
ref|XP_007149773.1|  hypothetical protein PHAVU_005G097900g           87.4    1e-18   
ref|XP_006656713.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  79.3    1e-18   
ref|XP_006453587.1|  hypothetical protein CICLE_v10010857mg           72.4    2e-18   
ref|XP_010094062.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...  60.8    2e-18   
ref|XP_006465262.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  72.0    2e-18   
ref|XP_003560989.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  77.0    3e-18   
sp|O24645.1|HCBT1_DIACA  RecName: Full=Anthranilate N-benzoyltran...  68.9    5e-18   
ref|XP_007149776.1|  hypothetical protein PHAVU_005G098200g           85.5    5e-18   
ref|NP_001169127.1|  hypothetical protein                             82.4    5e-18   
ref|XP_002452435.1|  hypothetical protein SORBIDRAFT_04g025760        76.3    7e-18   
ref|XP_010093468.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...  67.0    7e-18   
gb|EAY99941.1|  hypothetical protein OsI_21944                        84.7    9e-18   
ref|XP_006478316.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  70.9    1e-17   
sp|O23918.1|HCBT3_DIACA  RecName: Full=Anthranilate N-benzoyltran...  65.1    2e-17   
ref|XP_010911178.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  72.4    2e-17   
ref|NP_001142105.1|  hypothetical protein                             80.5    2e-17   
ref|NP_001056998.1|  Os06g0184900                                     78.2    2e-17   
ref|XP_004293649.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  66.2    2e-17   
gb|EEE65224.1|  hypothetical protein OsJ_20373                        77.8    2e-17   
ref|XP_012071530.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  76.3    2e-17   
ref|NP_001057003.1|  Os06g0185500                                     84.7    3e-17   
ref|XP_009409797.1|  PREDICTED: uncharacterized protein LOC103991972  74.7    3e-17   
gb|EEE65225.1|  hypothetical protein OsJ_20376                        85.1    3e-17   
ref|XP_004964655.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  79.0    3e-17   
ref|XP_004964653.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  82.8    4e-17   
gb|EMT01131.1|  Anthranilate N-benzoyltransferase protein 1           76.3    4e-17   
sp|O23917.1|HCBT2_DIACA  RecName: Full=Anthranilate N-benzoyltran...  65.5    5e-17   
dbj|BAK06725.1|  predicted protein                                    73.6    6e-17   
gb|EMT01833.1|  Anthranilate N-benzoyltransferase protein 1           86.7    6e-17   
ref|XP_002437977.1|  hypothetical protein SORBIDRAFT_10g005780        80.5    6e-17   
gb|EMS54072.1|  Anthranilate N-benzoyltransferase protein 3           77.4    6e-17   
ref|XP_004293648.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  64.3    7e-17   
emb|CAB06428.1|  anthranilate N-hydroxycinnamoyl/benzoyltransferase   65.1    7e-17   
ref|XP_010545859.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  73.2    7e-17   
ref|XP_003578136.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  73.2    8e-17   
ref|XP_002437976.1|  hypothetical protein SORBIDRAFT_10g005760        80.1    1e-16   
ref|XP_002436612.1|  hypothetical protein SORBIDRAFT_10g005770        80.1    1e-16   
ref|XP_006656716.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  82.0    1e-16   
ref|XP_004977868.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  76.3    1e-16   
ref|XP_006656715.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  83.2    2e-16   
ref|XP_009403058.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  76.3    2e-16   
emb|CDM84451.1|  unnamed protein product                              82.8    3e-16   
emb|CDM81864.1|  unnamed protein product                              74.3    3e-16   
ref|XP_010533496.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  73.9    4e-16   
gb|EMT19683.1|  Anthranilate N-benzoyltransferase protein 1           67.4    5e-16   
ref|NP_001150433.1|  LOC100284063                                     70.1    7e-16   
ref|XP_010547371.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  70.5    8e-16   
ref|XP_006486668.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  60.8    8e-16   
gb|AFW62334.1|  anthranilate N-benzoyltransferase protein 1           70.1    9e-16   
ref|NP_001146406.1|  hypothetical protein                             75.1    9e-16   
ref|NP_001151137.1|  LOC100284770                                     73.2    9e-16   
gb|EPS61293.1|  hypothetical protein M569_13504                       72.0    9e-16   
gb|KJB71583.1|  hypothetical protein B456_011G130900                  84.0    9e-16   
ref|XP_006474077.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  61.2    1e-15   
ref|XP_002454696.1|  hypothetical protein SORBIDRAFT_04g035780        75.5    1e-15   
ref|XP_004291518.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  66.6    1e-15   
ref|XP_007216540.1|  hypothetical protein PRUPE_ppa027223mg           79.3    1e-15   
ref|XP_007149785.1|  hypothetical protein PHAVU_005G0986000g          78.6    2e-15   
tpg|DAA53444.1|  TPA: hypothetical protein ZEAMMB73_481443            74.3    2e-15   
ref|XP_008673709.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  74.3    2e-15   
gb|ACN35114.1|  unknown                                               73.2    2e-15   
ref|XP_004973560.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  72.0    2e-15   
ref|XP_002457418.1|  hypothetical protein SORBIDRAFT_03g006970        70.5    2e-15   
gb|ACF87435.1|  unknown                                               69.3    3e-15   
ref|NP_001147464.1|  anthranilate N-benzoyltransferase protein 1      69.3    3e-15   
dbj|BAK07832.1|  predicted protein                                    75.9    4e-15   
ref|XP_002445570.1|  hypothetical protein SORBIDRAFT_07g021760        64.7    4e-15   
ref|XP_004968189.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  68.6    6e-15   
tpg|DAA53596.1|  TPA: hypothetical protein ZEAMMB73_852753            70.9    6e-15   
gb|EMT10230.1|  hypothetical protein F775_52273                       67.0    8e-15   
tpg|DAA53591.1|  TPA: hypothetical protein ZEAMMB73_253092            70.5    9e-15   
dbj|BAJ94049.1|  predicted protein                                    62.8    9e-15   
dbj|BAJ95260.1|  predicted protein                                    62.4    1e-14   
ref|XP_008673747.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  69.7    1e-14   
gb|EMS47063.1|  Anthranilate N-benzoyltransferase protein 1           64.7    2e-14   
tpg|DAA53592.1|  TPA: hypothetical protein ZEAMMB73_253092            68.9    2e-14   
gb|ACG34906.1|  anthranilate N-benzoyltransferase protein 1           68.9    2e-14   
ref|XP_003565078.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  67.4    2e-14   
ref|XP_008673748.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  70.1    2e-14   
gb|EMT31750.1|  Anthranilate N-benzoyltransferase protein 3           65.5    2e-14   
ref|NP_001062400.1|  Os08g0543400                                     68.2    2e-14   
tpg|DAA53590.1|  TPA: hypothetical protein ZEAMMB73_253092            68.6    3e-14   
gb|KDP38698.1|  hypothetical protein JCGZ_04051                       65.9    3e-14   
gb|KJB68257.1|  hypothetical protein B456_010G234800                  53.9    4e-14   
ref|XP_010682493.1|  PREDICTED: anthranilate N-benzoyltransferase...  64.7    5e-14   
dbj|BAJ95412.1|  predicted protein                                    61.2    5e-14   
gb|KDP38697.1|  hypothetical protein JCGZ_04050                       64.3    6e-14   
ref|XP_010667050.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  67.8    7e-14   
ref|XP_010667049.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  67.8    7e-14   
ref|XP_010229741.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  67.8    8e-14   
ref|XP_004956854.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  67.8    1e-13   
gb|EAZ07852.1|  hypothetical protein OsI_30111                        66.2    1e-13   
ref|XP_009403962.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  78.6    1e-13   
ref|XP_003564188.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  78.2    2e-13   
gb|KJB54947.1|  hypothetical protein B456_009G055900                  52.4    2e-13   
ref|XP_004964652.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  78.2    2e-13   
ref|XP_002462399.1|  hypothetical protein SORBIDRAFT_02g025010        63.2    2e-13   
ref|XP_010533495.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  65.9    2e-13   
ref|XP_002529412.1|  Anthranilate N-benzoyltransferase protein, p...  52.0    2e-13   
gb|AFJ04415.1|  rosmarinic acid synthase                              55.5    2e-13   
gb|EMS66509.1|  Anthranilate N-benzoyltransferase protein 3           75.9    3e-13   
gb|EYU24589.1|  hypothetical protein MIMGU_mgv1a0237891mg             73.9    3e-13   
dbj|BAJ95478.1|  predicted protein                                    61.2    4e-13   
emb|CDP21790.1|  unnamed protein product                              56.6    5e-13   
tpg|DAA53439.1|  TPA: hypothetical protein ZEAMMB73_693497            65.9    5e-13   
ref|NP_001146402.1|  uncharacterized protein LOC100279982             65.9    5e-13   
gb|ACG32145.1|  anthranilate N-benzoyltransferase protein 1           65.9    5e-13   
ref|XP_006365664.1|  PREDICTED: uncharacterized protein LOC102602033  73.9    5e-13   
tpg|DAA53440.1|  TPA: hypothetical protein ZEAMMB73_693497            65.5    5e-13   
ref|XP_010229918.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  65.9    8e-13   
ref|XP_002457417.1|  hypothetical protein SORBIDRAFT_03g006960        65.1    9e-13   
ref|XP_010672789.1|  PREDICTED: anthranilate N-benzoyltransferase...  55.1    9e-13   
ref|XP_010672788.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  61.2    1e-12   
ref|XP_010672790.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  61.2    1e-12   
ref|XP_003629311.1|  Anthranilate N-benzoyltransferase protein        72.0    2e-12   
gb|AFD64619.1|  putative hydroxycinnamoyl-CoA:shikimate/quinate h...  51.6    2e-12   
ref|XP_010265516.1|  PREDICTED: spermidine hydroxycinnamoyl trans...  60.5    2e-12   
ref|XP_008370589.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  50.1    2e-12   
gb|EMS65854.1|  Anthranilate N-benzoyltransferase protein 1           60.1    2e-12   
ref|XP_007033668.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...  59.3    2e-12   
gb|AFZ93418.1|  hydroxycinnamoyl-CoA:shikimate/quinate hydroxycin...  55.5    4e-12   
ref|XP_004977198.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  60.5    4e-12   
gb|ADD71921.1|  BAHD-type hydroxycinnamoyltransferase                 54.7    5e-12   
ref|XP_002269790.1|  PREDICTED: spermidine hydroxycinnamoyl trans...  53.9    5e-12   
gb|AFY17066.1|  hydroxycinnamoyl-coenzyme A shikimate/quinate hyd...  62.8    5e-12   
gb|EMS46676.1|  Anthranilate N-benzoyltransferase protein 1           60.8    5e-12   
gb|ABR16595.1|  unknown                                               60.5    5e-12   
gb|ABR16407.1|  unknown                                               60.5    5e-12   
ref|XP_003532110.1|  PREDICTED: spermidine hydroxycinnamoyl trans...  58.5    6e-12   
gb|KHN18130.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...  57.0    1e-11   
ref|XP_008231463.1|  PREDICTED: spermidine hydroxycinnamoyl trans...  48.5    1e-11   
ref|XP_003553113.1|  PREDICTED: spermidine hydroxycinnamoyl trans...  56.6    1e-11   
ref|XP_010232822.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  57.8    1e-11   
gb|KHN11007.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...  56.2    1e-11   
gb|EMT19921.1|  Anthranilate N-benzoyltransferase protein 2           54.7    1e-11   
ref|XP_007099549.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...  68.2    1e-11   
gb|EMS65856.1|  Anthranilate N-benzoyltransferase protein 1           59.7    2e-11   
ref|XP_009389810.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  55.1    2e-11   
ref|XP_003535207.1|  PREDICTED: spermidine hydroxycinnamoyl trans...  55.8    2e-11   
ref|XP_010538049.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  72.0    2e-11   
gb|EMT01178.1|  hypothetical protein F775_42912                       67.0    2e-11   
ref|NP_001063206.1|  Os09g0422000                                     54.7    2e-11   
ref|XP_003553115.1|  PREDICTED: spermidine hydroxycinnamoyl trans...  56.6    3e-11   
gb|KHN18128.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...  56.2    3e-11   



>dbj|BAA87043.1| N-hydroxycinnamoyl/benzoyltransferase [Ipomoea batatas]
 dbj|BAJ14795.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyltransferase [Ipomoea 
batatas]
Length=431

 Score =   150 bits (379),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +3

Query  183  MASEKLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKA  362
            MASEK +I IKE+TMVKPAKPTP+K+LW SN+DL+VGRIHLL VYFYRPNGSPNFFD K 
Sbjct  1    MASEKFKISIKESTMVKPAKPTPAKRLWNSNLDLIVGRIHLLTVYFYRPNGSPNFFDSKV  60

Query  363  MKEALSRVLVSFYPMAGRMGRDGDG  437
            MKEALS VLVSFYPMAGR+ RDG+G
Sbjct  61   MKEALSNVLVSFYPMAGRLARDGEG  85


 Score = 66.6 bits (161),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPLAXF  603
            GR+EI+CN EG LFV A SD    DFGDFTP L L   +P+  TSG  SSFPL  F
Sbjct  85   GRIEIDCNEEGVLFVEAESDACVDDFGDFTPSLELRKFIPTVDTSGDISSFPLIIF  140



>ref|NP_001234850.1| hydroxycinnamoyl CoA quinate transferase [Solanum lycopersicum]
 emb|CAE46933.1| hydroxycinnamoyl CoA quinate transferase [Solanum lycopersicum]
Length=430

 Score =   134 bits (336),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 75/86 (87%), Gaps = 1/86 (1%)
 Frame = +3

Query  183  MASEKL-RICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPK  359
            M SEK+ +I IKE+T+VKP+KPTP+K++W SN+DL+VGRIHLL VYFY+PNGS NFFD K
Sbjct  1    MGSEKMMKINIKESTLVKPSKPTPTKRIWSSNLDLIVGRIHLLTVYFYKPNGSSNFFDNK  60

Query  360  AMKEALSRVLVSFYPMAGRMGRDGDG  437
             +KEALS VLVSFYPMAGR+GRD  G
Sbjct  61   VIKEALSNVLVSFYPMAGRLGRDEQG  86


 Score = 73.2 bits (178),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPLAXF  603
            E GR+E+ CNGEG LFV A SD    DFGDFTP L L  L+PS  TSG  S+FPL  F
Sbjct  84   EQGRIEVNCNGEGVLFVEAESDSCVDDFGDFTPSLELRKLIPSVETSGDISTFPLVIF  141



>ref|XP_009800587.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
sylvestris]
Length=436

 Score =   135 bits (339),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 74/86 (86%), Gaps = 1/86 (1%)
 Frame = +3

Query  183  MASEK-LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPK  359
            M SEK ++I IKE+T+VKP+KPTP+K+LW SN+DL+VGRIHLL VYFY+PNGS NFFD K
Sbjct  1    MGSEKIMKINIKESTLVKPSKPTPTKRLWSSNLDLIVGRIHLLTVYFYKPNGSSNFFDSK  60

Query  360  AMKEALSRVLVSFYPMAGRMGRDGDG  437
             MKEALS VLVSFYPMAGR+ RD  G
Sbjct  61   IMKEALSNVLVSFYPMAGRLARDEQG  86


 Score = 72.0 bits (175),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPLAXF  603
            E GR+EI CNGEG LFV A SD    DFGDFTP L L  L+P+  TSG  S+FPL  F
Sbjct  84   EQGRIEINCNGEGVLFVEAESDAFVDDFGDFTPSLELRKLIPTVDTSGDISTFPLIIF  141



>emb|CAE46932.1| hydroxycinnamoyl CoA quinate transferase [Nicotiana tabacum]
Length=436

 Score =   134 bits (337),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 74/86 (86%), Gaps = 1/86 (1%)
 Frame = +3

Query  183  MASEKL-RICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPK  359
            M SEK+ +I IKE+T+VKP+KPTP+K+LW SN+DL+VGRIHLL VYFY+PNGS NFFD K
Sbjct  1    MGSEKMMKINIKESTLVKPSKPTPTKRLWSSNLDLIVGRIHLLTVYFYKPNGSSNFFDSK  60

Query  360  AMKEALSRVLVSFYPMAGRMGRDGDG  437
             MKEALS VLVSFYPMAGR+ RD  G
Sbjct  61   IMKEALSNVLVSFYPMAGRLARDEQG  86


 Score = 72.0 bits (175),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPLAXF  603
            E GR+EI CNGEG LFV A SD    DFGDFTP L L  L+P+  TSG  S+FPL  F
Sbjct  84   EQGRIEINCNGEGVLFVEAESDAFVDDFGDFTPSLELRKLIPTVDTSGDISTFPLIIF  141



>ref|XP_009624297.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
tomentosiformis]
Length=436

 Score =   133 bits (335),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 74/86 (86%), Gaps = 1/86 (1%)
 Frame = +3

Query  183  MASEK-LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPK  359
            M SEK ++I IKE+T+VKP+KPTP+K+LW SN+DL+VGRIHLL VYFY+PNGS NFFD K
Sbjct  1    MGSEKVMKINIKESTLVKPSKPTPTKRLWNSNLDLIVGRIHLLTVYFYKPNGSSNFFDSK  60

Query  360  AMKEALSRVLVSFYPMAGRMGRDGDG  437
             MKEALS VLVSFYPMAGR+ RD  G
Sbjct  61   VMKEALSNVLVSFYPMAGRLARDEQG  86


 Score = 72.0 bits (175),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPLAXF  603
            E GR+EI CNGEG LFV A SD    DFGDFTP L L  L+P+  TSG  S+FPL  F
Sbjct  84   EQGRIEINCNGEGVLFVEAESDAFVDDFGDFTPSLELRKLIPTVDTSGDISTFPLIIF  141



>ref|XP_006343633.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Solanum tuberosum]
Length=435

 Score =   131 bits (329),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 74/86 (86%), Gaps = 1/86 (1%)
 Frame = +3

Query  183  MASEKL-RICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPK  359
            M SEK+ +I IKE+T+VKP+KPTP+K++W SN+DL+VGRIHLL VYFY+PNGS +FFD K
Sbjct  1    MGSEKMMKINIKESTLVKPSKPTPTKRIWSSNLDLIVGRIHLLTVYFYKPNGSSSFFDNK  60

Query  360  AMKEALSRVLVSFYPMAGRMGRDGDG  437
             MKEALS VLVSFYPMAGR+ RD  G
Sbjct  61   VMKEALSNVLVSFYPMAGRLARDEQG  86


 Score = 74.3 bits (181),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPLAXF  603
            E GR+E+ CNGEG LFV A SD    DFGDFTP L L  L+PS  TSG  S+FPLA F
Sbjct  84   EQGRIEVNCNGEGVLFVEAESDSCIDDFGDFTPCLELKKLIPSVETSGDISTFPLAIF  141



>ref|NP_001275483.1| HQT [Solanum tuberosum]
 gb|ADF50082.1| HQT [Solanum tuberosum]
Length=433

 Score =   130 bits (328),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 74/86 (86%), Gaps = 1/86 (1%)
 Frame = +3

Query  183  MASEKL-RICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPK  359
            M SEK+ +I IKE+T+VKP+KPTP+K++W SN+DL+VGRIHLL VYFY+PNGS +FFD K
Sbjct  1    MGSEKMMKINIKESTLVKPSKPTPTKRIWSSNLDLIVGRIHLLTVYFYKPNGSSSFFDNK  60

Query  360  AMKEALSRVLVSFYPMAGRMGRDGDG  437
             MKEALS VLVSFYPMAGR+ RD  G
Sbjct  61   VMKEALSNVLVSFYPMAGRLARDEQG  86


 Score = 74.3 bits (181),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPLAXF  603
            E GR+E+ CNGEG LFV A SD    DFGDFTP L L  L+PS  TSG  S+FPLA F
Sbjct  84   EQGRIEVNCNGEGVLFVEAESDSCIDDFGDFTPCLELKKLIPSVETSGDISTFPLAIF  141



>gb|ABA46756.1| hydroxycinnamoyl-CoA quinate-like protein [Solanum tuberosum]
Length=433

 Score =   130 bits (328),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 74/86 (86%), Gaps = 1/86 (1%)
 Frame = +3

Query  183  MASEKL-RICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPK  359
            M SEK+ +I IKE+T+VKP+KPTP+K++W SN+DL+VGRIHLL VYFY+PNGS +FFD K
Sbjct  1    MGSEKMMKINIKESTLVKPSKPTPTKRIWSSNLDLIVGRIHLLTVYFYKPNGSSSFFDNK  60

Query  360  AMKEALSRVLVSFYPMAGRMGRDGDG  437
             MKEALS VLVSFYPMAGR+ RD  G
Sbjct  61   VMKEALSNVLVSFYPMAGRLARDEQG  86


 Score = 74.3 bits (181),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPLAXF  603
            E GR+E+ CNGEG LFV A SD    DFGDFTP L L  L+PS  TSG  S+FPLA F
Sbjct  84   EQGRIEVNCNGEGVLFVEAESDSCIDDFGDFTPCLELKKLIPSVETSGDISTFPLAIF  141



>emb|CDP02827.1| unnamed protein product [Coffea canephora]
Length=484

 Score =   132 bits (332),  Expect(2) = 7e-43, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +3

Query  180  NMASEKLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPK  359
            ++ SEK++I +KET MV+PA+PTP+K+LW SN+DL+V RIH+L VYFY+PNGS NFFD +
Sbjct  49   SVGSEKMKITVKETAMVRPAQPTPTKRLWNSNLDLLVARIHILTVYFYKPNGSANFFDTR  108

Query  360  AMKEALSRVLVSFYPMAGRMGRDGDG  437
             +KEALS VLVSFYPMAGR+ RD +G
Sbjct  109  VLKEALSNVLVSFYPMAGRLARDEEG  134


 Score = 68.9 bits (167),  Expect(2) = 7e-43, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPLAXF  603
            E GR+EI+CNGEG LFV A SD    DFGDF P L L  L+P+   SG  SS+PL  F
Sbjct  132  EEGRIEIDCNGEGVLFVEAESDSSVDDFGDFAPSLELRRLIPTVDCSGDISSYPLVIF  189



>gb|AFP49814.1| caffeoyl-CoA quinic acid caffeoyl transferase 4 [Coffea arabica]
Length=430

 Score =   126 bits (317),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            ++I +KET MV+PA+PTP+K+LW SN+DL+V RIH+L VYFY+PNGS NFFD + +KEAL
Sbjct  1    MKITVKETAMVRPAQPTPTKRLWNSNLDLLVARIHILTVYFYKPNGSANFFDTRVLKEAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            S VLVSFYPMAGR+ RD +G
Sbjct  61   SNVLVSFYPMAGRLARDEEG  80


 Score = 68.9 bits (167),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPLAXF  603
            E GR+EI+CNGEG LFV A SD    DFGDF P L L  L+P+   SG  SS+PL  F
Sbjct  78   EEGRIEIDCNGEGVLFVEAESDSSVDDFGDFAPSLELRRLIPTVDCSGDISSYPLVIF  135



>gb|ABO77956.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyltransferase [Coffea 
canephora]
Length=430

 Score =   126 bits (317),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            ++I +KET MV+PA+PTP+K+LW SN+DL+V RIH+L VYFY+PNGS NFFD + +KEAL
Sbjct  1    MKITVKETAMVRPAQPTPTKRLWNSNLDLLVARIHILTVYFYKPNGSANFFDTRVLKEAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            S VLVSFYPMAGR+ RD +G
Sbjct  61   SNVLVSFYPMAGRLARDEEG  80


 Score = 68.9 bits (167),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPLAXF  603
            E GR+EI+CNGEG LFV A SD    DFGDF P L L  L+P+   SG  SS+PL  F
Sbjct  78   EEGRIEIDCNGEGVLFVEAESDSSVDDFGDFAPSLELRRLIPTVDCSGDISSYPLVIF  135



>gb|ABO77957.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyltransferase [Coffea 
canephora]
Length=430

 Score =   126 bits (317),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            ++I +KET MV+PA+PTP+K+LW SN+DL+V RIH+L VYFY+PNGS NFFD + +KEAL
Sbjct  1    MKITVKETAMVRPAQPTPTKRLWNSNLDLLVARIHILTVYFYKPNGSANFFDTRVLKEAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            S VLVSFYPMAGR+ RD +G
Sbjct  61   SNVLVSFYPMAGRLARDEEG  80


 Score = 68.9 bits (167),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPLAXF  603
            E GR+EI+CNGEG LFV A SD    DFGDF P L L  L+P+   SG  SS+PL  F
Sbjct  78   EEGRIEIDCNGEGVLFVEAESDSSVDDFGDFAPSLELRRLIPTVDCSGDISSYPLVIF  135



>emb|CAT00081.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
[Coffea arabica]
Length=430

 Score =   126 bits (316),  Expect(2) = 5e-41, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            ++I +KET MV+PA+PTP+K+LW SN+DL+V RIH+L +YFY+PNGS NFFD + +KEAL
Sbjct  1    MKITVKETAMVRPAQPTPTKRLWNSNLDLLVARIHILTIYFYKPNGSANFFDTRVLKEAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            S VLVSFYPMAGR+ RD +G
Sbjct  61   SNVLVSFYPMAGRLARDEEG  80


 Score = 68.9 bits (167),  Expect(2) = 5e-41, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPLAXF  603
            E GR+EI+CNGEG LFV A SD    DFGDF P L L  L+P+   SG  SS+PL  F
Sbjct  78   EEGRIEIDCNGEGVLFVEAESDSSVDDFGDFAPSLELRRLIPTVDCSGDISSYPLVIF  135



>gb|AEM63676.1| hydroxycinnamoyl CoA quinate hydroxycinnamoyl transferase [Platycodon 
grandiflorus]
Length=443

 Score =   130 bits (326),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 73/86 (85%), Gaps = 1/86 (1%)
 Frame = +3

Query  183  MASEK-LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPK  359
            M SEK ++I +KE+TMV PAK TPS+KLW SN+DLVVGRIH+L VYFYRPNGS NFFD +
Sbjct  1    MGSEKKMKIKVKESTMVCPAKATPSEKLWNSNLDLVVGRIHILTVYFYRPNGSSNFFDAR  60

Query  360  AMKEALSRVLVSFYPMAGRMGRDGDG  437
             +KEALS VLVSFYPMAGR+ RD +G
Sbjct  61   VLKEALSNVLVSFYPMAGRLARDQEG  86


 Score = 60.5 bits (145),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 33/55 (60%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            + GRLEI CNGEG LFV A +D    DFGDFTP      L P    SG  SS+PL
Sbjct  84   QEGRLEINCNGEGVLFVEAETDSTVDDFGDFTPSAEQRQLAPMVDYSGDISSYPL  138



>ref|XP_009614241.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
tomentosiformis]
Length=434

 Score =   127 bits (318),  Expect(2) = 8e-39, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 71/82 (87%), Gaps = 1/82 (1%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNG-SPNFFDPKAMKEA  374
            +RI IKE+ MVKP+KPTPSK+LW SN+D++VGRIHLL VYFY+PNG SPNFFD + MKEA
Sbjct  1    MRINIKESIMVKPSKPTPSKRLWNSNLDVIVGRIHLLTVYFYKPNGTSPNFFDFRIMKEA  60

Query  375  LSRVLVSFYPMAGRMGRDGDGE  440
            LS VLVSFYPMAGR+ +D + E
Sbjct  61   LSNVLVSFYPMAGRLAKDNEKE  82


 Score = 60.8 bits (146),  Expect(2) = 8e-39, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 36/59 (61%), Gaps = 1/59 (2%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLL-PSXXTSGXXSSFPLAXF  603
            E  R+EI CNGEG LF+ A  D    DFGDF P L +  +L P+  TSG  SSFPL  F
Sbjct  80   EKERIEINCNGEGVLFIEAEIDAIIDDFGDFIPSLEIKKMLIPNVDTSGDISSFPLVIF  138



>gb|AEK80405.1| HQT [Lonicera japonica]
Length=439

 Score =   124 bits (312),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +3

Query  192  EKLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKE  371
            + + I +K+++MV+PAK TP KKLW SN+DLVVGRIH+L VYFYR NGS NFF+P+ +KE
Sbjct  8    KTMNITVKDSSMVQPAKNTPEKKLWNSNLDLVVGRIHILTVYFYRSNGSQNFFEPRVLKE  67

Query  372  ALSRVLVSFYPMAGRMGRDGDG  437
            ALS VLVSFYPMAGR+G+D +G
Sbjct  68   ALSNVLVSFYPMAGRLGKDDEG  89


 Score = 62.0 bits (149),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            GR+EI CNGEG LFV A SD    DFGDFTP   +  L P+   SG  SS+PL
Sbjct  89   GRVEINCNGEGVLFVEAESDCCVDDFGDFTPSTEMRRLTPTVDYSGDISSYPL  141



>gb|ACZ52698.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyltransferase [Lonicera 
japonica]
Length=439

 Score =   123 bits (309),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +3

Query  192  EKLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKE  371
            + + I +++++MV+PAK TP KKLW SN+DLVVGRIH+L VYFYR NGS NFF+P+ +KE
Sbjct  8    KTMNITVRDSSMVQPAKNTPEKKLWNSNLDLVVGRIHILTVYFYRSNGSQNFFEPRVLKE  67

Query  372  ALSRVLVSFYPMAGRMGRDGDG  437
            ALS VLVSFYPMAGR+G+D +G
Sbjct  68   ALSNVLVSFYPMAGRLGKDDEG  89


 Score = 61.6 bits (148),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            GR+EI CNGEG LFV A SD    DFGDFTP   +  L P+   SG  SS+PL
Sbjct  89   GRVEINCNGEGVLFVEAESDCCVDDFGDFTPSSEMRRLTPTVDYSGAISSYPL  141



>ref|XP_009798536.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
sylvestris]
Length=436

 Score =   124 bits (310),  Expect(2) = 8e-38, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 70/80 (88%), Gaps = 1/80 (1%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNG-SPNFFDPKAMKEA  374
            ++I IKE+ MVKP+KPTPSK+LW SN+DL+VGRIHLL VYFY+PNG SPNFFD + MKEA
Sbjct  1    MKIDIKESIMVKPSKPTPSKRLWNSNLDLIVGRIHLLTVYFYKPNGISPNFFDFRIMKEA  60

Query  375  LSRVLVSFYPMAGRMGRDGD  434
            LS +LVSFYPMAGR+ +D +
Sbjct  61   LSNILVSFYPMAGRLAKDNN  80


 Score = 60.5 bits (145),  Expect(2) = 8e-38, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 40/67 (60%), Gaps = 2/67 (3%)
 Frame = +1

Query  409  RVGWVGMEMGRLEIECNGEGALFVXAXSDXXXXDFG-DFTPXLXLXXLL-PSXXTSGXXS  582
            R+     E GR+EI CNGEG LF+ A  D    DFG DFTP L +  +L P+  TSG  S
Sbjct  74   RLAKDNNEKGRIEINCNGEGVLFIEAEIDEFIDDFGDDFTPSLEIKKMLIPNVDTSGDIS  133

Query  583  SFPLAXF  603
            SFPL  F
Sbjct  134  SFPLVIF  140



>gb|ACF37072.1| hydroxycinnamoyl CoA quinate transferase 1 [Cynara cardunculus 
var. scolymus]
 emb|CAM84302.2| hydroxycinnamoyl CoA quinate transferase [Cynara cardunculus 
var. scolymus]
Length=449

 Score =   118 bits (295),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = +3

Query  180  NMASEKLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPK  359
            N   + + I IK ++ V+P++PTPS  +W SN+DLVVGRIH+L VYFYRPNG+ NFFD  
Sbjct  12   NEHHKLMNINIKHSSFVQPSQPTPSSTIWTSNLDLVVGRIHILTVYFYRPNGASNFFDAD  71

Query  360  AMKEALSRVLVSFYPMAGRMGRDGDG  437
             MK+AL+ VLVSFYPMAGR+ RD +G
Sbjct  72   VMKKALADVLVSFYPMAGRISRDQNG  97


 Score = 62.4 bits (150),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            + GRLEI CNGEG LFV A SD    DFG+FTP   L  L P+   SG  SS+PL
Sbjct  95   QNGRLEINCNGEGVLFVEAESDSTLDDFGEFTPSPELRRLTPTVDYSGDISSYPL  149



>gb|ABK79689.1| hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltransferase [Cynara 
cardunculus var. scolymus]
Length=434

 Score =   124 bits (312),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            + + +KE+ MVKP+KPTP+++LW SN+DLVVGRIH+L VYFYRPNGS NFFD   +K+AL
Sbjct  1    MELTVKESLMVKPSKPTPNQRLWNSNLDLVVGRIHILTVYFYRPNGSSNFFDSGVLKKAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            + VLVSF+PMAGR+G DGDG
Sbjct  61   ADVLVSFFPMAGRLGNDGDG  80


 Score = 55.1 bits (131),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            GR+EI CNGEG LFV A +D    DFG+ TP   L  L P+   S   SS+PL
Sbjct  80   GRVEINCNGEGVLFVEAEADCSIDDFGEITPSPELRKLAPTVDYSDQVSSYPL  132



>gb|AFL93687.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyl-transferase [Cynara 
cardunculus var. scolymus]
Length=434

 Score =   124 bits (311),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            + + +KE+ MVKP+KPTP+++LW SN+DLVVGRIH+L VYFYRPNGS NFFD   +K AL
Sbjct  1    MELTVKESLMVKPSKPTPNQRLWNSNLDLVVGRIHILTVYFYRPNGSSNFFDSGVLKXAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            + VLVSF+PMAGR+G DGDG
Sbjct  61   ADVLVSFFPMAGRLGNDGDG  80


 Score = 54.7 bits (130),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            GR+EI CNGEG LFV A +D    DFG+ TP   L  L P+   S   SS+PL
Sbjct  80   GRVEINCNGEGVLFVEAEADCSIDDFGEITPSPELRKLAPTVDYSDQISSYPL  132



>gb|ABK79690.1| hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltransferase [Cynara 
cardunculus var. altilis]
Length=434

 Score =   124 bits (312),  Expect(2) = 4e-36, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            + + +KE+ MVKP+KPTP+++LW SN+DLVVGRIH+L VYFYRPNGS NFFD   +K+AL
Sbjct  1    MELTVKESLMVKPSKPTPNQRLWNSNLDLVVGRIHILTVYFYRPNGSSNFFDSGVLKKAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            + VLVSF+PMAGR+G DGDG
Sbjct  61   ADVLVSFFPMAGRLGNDGDG  80


 Score = 53.9 bits (128),  Expect(2) = 4e-36, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            GR+EI CNGEG LFV A +D    DFG+ TP   L  L P+   S   SS+PL
Sbjct  80   GRVEINCNGEGVLFVEAEADCSIDDFGETTPSPELRKLAPTVDYSDQVSSYPL  132



>ref|XP_010265527.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nelumbo 
nucifera]
Length=435

 Score =   115 bits (288),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I +KE+TMV+PA+ TP + LW SNVDLVV R+H   VYFYRP GS NFFDPK +KEALS+
Sbjct  3    ISVKESTMVRPAQETPQRSLWNSNVDLVVPRMHTPSVYFYRPTGSTNFFDPKVLKEALSK  62

Query  384  VLVSFYPMAGRMGRDGDG  437
             LV FYPMAGR+ RD DG
Sbjct  63   ALVPFYPMAGRLKRDEDG  80


 Score = 60.8 bits (146),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI CNGEG LFV A +     DFGDF P + L  L+P+   SG  SS+PL
Sbjct  78   EDGRIEINCNGEGVLFVEAETGSVIDDFGDFAPTMELKQLIPAVDYSGDISSYPL  132



>gb|ADL62855.1| hydroxycinnamoyl-CoA transferase 2 [Cynara cardunculus var. scolymus]
Length=432

 Score =   117 bits (292),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            + I IK ++ V+P++PTPS  +W SN+DLVVGRIH+L VYFYRPNG+ NFFD   MK+AL
Sbjct  1    MNINIKHSSFVQPSQPTPSSTIWTSNLDLVVGRIHILTVYFYRPNGASNFFDADVMKKAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            + VLVSFYPMAGR+ RD +G
Sbjct  61   ADVLVSFYPMAGRISRDRNG  80


 Score = 58.9 bits (141),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            GRLEI CNGEG LFV A  D    DFG+FTP   L  L P+   SG  SS+PL
Sbjct  80   GRLEINCNGEGVLFVEAELDSTLDDFGEFTPSPELRRLTPTVDYSGDISSYPL  132



>gb|KJB56501.1| hypothetical protein B456_009G122600 [Gossypium raimondii]
 gb|KJB56503.1| hypothetical protein B456_009G122600 [Gossypium raimondii]
 gb|KJB56504.1| hypothetical protein B456_009G122600 [Gossypium raimondii]
Length=431

 Score =   112 bits (279),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            + +KE+TMV+PA  TP + LW +NVDLVV R H   VYFYRPNG+ NFFDP+ MKEALS+
Sbjct  3    VNVKESTMVRPAGETPRRSLWNANVDLVVPRFHTPSVYFYRPNGAANFFDPQVMKEALSK  62

Query  384  VLVSFYPMAGRMGRDGDG  437
             LV FYPMAGR+ RD DG
Sbjct  63   ALVPFYPMAGRLKRDEDG  80


 Score = 62.4 bits (150),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+CNGEG LFV A ++    DFGDF P L L  L+P+   SG  S++PL
Sbjct  78   EDGRIEIDCNGEGVLFVEAETNSVIDDFGDFAPTLELRQLIPTVDYSGGISTYPL  132



>gb|KJB56505.1| hypothetical protein B456_009G122600 [Gossypium raimondii]
Length=404

 Score =   112 bits (279),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            + +KE+TMV+PA  TP + LW +NVDLVV R H   VYFYRPNG+ NFFDP+ MKEALS+
Sbjct  3    VNVKESTMVRPAGETPRRSLWNANVDLVVPRFHTPSVYFYRPNGAANFFDPQVMKEALSK  62

Query  384  VLVSFYPMAGRMGRDGDG  437
             LV FYPMAGR+ RD DG
Sbjct  63   ALVPFYPMAGRLKRDEDG  80


 Score = 62.4 bits (150),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+CNGEG LFV A ++    DFGDF P L L  L+P+   SG  S++PL
Sbjct  78   EDGRIEIDCNGEGVLFVEAETNSVIDDFGDFAPTLELRQLIPTVDYSGGISTYPL  132



>gb|AHG97388.1| putative hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyl 
transferase [Gossypium hirsutum]
 gb|KJB56502.1| hypothetical protein B456_009G122600 [Gossypium raimondii]
Length=499

 Score =   112 bits (280),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = +3

Query  186  ASEKLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAM  365
            ++  + + +KE+TMV+PA  TP + LW +NVDLVV R H   VYFYRPNG+ NFFDP+ M
Sbjct  65   STTTMIVNVKESTMVRPAGETPRRSLWNANVDLVVPRFHTPSVYFYRPNGAANFFDPQVM  124

Query  366  KEALSRVLVSFYPMAGRMGRDGDG  437
            KEALS+ LV FYPMAGR+ RD DG
Sbjct  125  KEALSKALVPFYPMAGRLKRDEDG  148


 Score = 62.0 bits (149),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+CNGEG LFV A ++    DFGDF P L L  L+P+   SG  S++PL
Sbjct  146  EDGRIEIDCNGEGVLFVEAETNSVIDDFGDFAPTLELRQLIPTVDYSGGISTYPL  200



>gb|AHA14500.1| hydroxycinnamoyl-coenzyme A quinate transperase [Fagopyrum tataricum]
Length=435

 Score =   117 bits (292),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 64/83 (77%), Gaps = 0/83 (0%)
 Frame = +3

Query  189  SEKLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMK  368
             +K+ I ++ +TMVKPAK TP + LW SNVDLVV RIH   VYFYRPNGS NFFDP  +K
Sbjct  2    EKKMIINVRNSTMVKPAKETPQRSLWNSNVDLVVPRIHTPSVYFYRPNGSTNFFDPNPVK  61

Query  369  EALSRVLVSFYPMAGRMGRDGDG  437
            EALSR LV FYPMAGR+ RD DG
Sbjct  62   EALSRALVYFYPMAGRLRRDEDG  84


 Score = 56.6 bits (135),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+CNGEG LFV A +     DFGDF P L L  L+P+   S   SS+ L
Sbjct  82   EDGRIEIDCNGEGVLFVEAETTSVIDDFGDFAPTLELRKLIPTVDYSQGISSYSL  136



>pdb|4G22|A Chain A, Structure Of A Lys-Hct Mutant From Coffea Canephora 
(Crystal Form 1)
 pdb|4G22|B Chain B, Structure Of A Lys-Hct Mutant From Coffea Canephora 
(Crystal Form 1)
Length=439

 Score =   110 bits (276),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = +3

Query  186  ASEKLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAM  365
            A   ++I +KE+TMV+PA+ TP + LW SNVDLVV   H   VYFYRP GS NFFD K +
Sbjct  2    AMGSMKIEVKESTMVRPAQETPGRNLWNSNVDLVVPNFHTPSVYFYRPTGSSNFFDAKVL  61

Query  366  KEALSRVLVSFYPMAGRMGRDGDG  437
            K+ALSR LV FYPMAGR+ RD DG
Sbjct  62   KDALSRALVPFYPMAGRLKRDEDG  85


 Score = 61.2 bits (147),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EIECNGEG LFV A SD    DFGDF P L L  L+P+   S   SS+ L
Sbjct  83   EDGRIEIECNGEGVLFVEAESDGVVDDFGDFAPTLELRRLIPAVDYSQGISSYAL  137



>pdb|4G2M|A Chain A, Structure Of A Lys-Hct Mutant From Coffea Canephora 
(Crystal Form 2)
Length=439

 Score =   110 bits (275),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = +3

Query  186  ASEKLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAM  365
            A   ++I +KE+TMV+PA+ TP + LW SNVDLVV   H   VYFYRP GS NFFD K +
Sbjct  2    AMGSMKIEVKESTMVRPAQETPGRNLWNSNVDLVVPNFHTPSVYFYRPTGSSNFFDAKVL  61

Query  366  KEALSRVLVSFYPMAGRMGRDGDG  437
            K+ALSR LV FYPMAGR+ RD DG
Sbjct  62   KDALSRALVPFYPMAGRLKRDEDG  85


 Score = 61.2 bits (147),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EIECNGEG LFV A SD    DFGDF P L L  L+P+   S   SS+ L
Sbjct  83   EDGRIEIECNGEGVLFVEAESDGVVDDFGDFAPTLELRRLIPAVDYSQGISSYAL  137



>emb|CDO98242.1| unnamed protein product [Coffea canephora]
Length=434

 Score =   110 bits (275),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            ++I +KE+TMV+PA+ TP + LW SNVDLVV   H   VYFYRP GS NFFD K +K+AL
Sbjct  1    MKIEVKESTMVRPAQETPGRNLWNSNVDLVVPNFHTPSVYFYRPTGSSNFFDAKVLKDAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            SR LV FYPMAGR+ RD DG
Sbjct  61   SRALVPFYPMAGRLKRDEDG  80


 Score = 61.2 bits (147),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EIECNGEG LFV A SD    DFGDF P L L  L+P+   S   SS+ L
Sbjct  78   EDGRIEIECNGEGVLFVEAESDGVVDDFGDFAPTLELRRLIPAVDYSQGISSYAL  132



>pdb|4G0B|A Chain A, Structure Of Native Hct From Coffea Canephora
 pdb|4G0B|B Chain B, Structure Of Native Hct From Coffea Canephora
Length=436

 Score =   110 bits (275),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            ++I +KE+TMV+PA+ TP + LW SNVDLVV   H   VYFYRP GS NFFD K +K+AL
Sbjct  3    MKIEVKESTMVRPAQETPGRNLWNSNVDLVVPNFHTPSVYFYRPTGSSNFFDAKVLKDAL  62

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            SR LV FYPMAGR+ RD DG
Sbjct  63   SRALVPFYPMAGRLKRDEDG  82


 Score = 61.2 bits (147),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EIECNGEG LFV A SD    DFGDF P L L  L+P+   S   SS+ L
Sbjct  80   EDGRIEIECNGEGVLFVEAESDGVVDDFGDFAPTLELRRLIPAVDYSQGISSYAL  134



>gb|ABO47805.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Coffea canephora]
Length=434

 Score =   110 bits (275),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            ++I +KE+TMV+PA+ TP + LW SNVDLVV   H   VYFYRP GS NFFD K +K+AL
Sbjct  1    MKIEVKESTMVRPAQETPGRNLWNSNVDLVVPNFHTPSVYFYRPTGSSNFFDAKVLKDAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            SR LV FYPMAGR+ RD DG
Sbjct  61   SRALVPFYPMAGRLKRDEDG  80


 Score = 61.2 bits (147),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EIECNGEG LFV A SD    DFGDF P L L  L+P+   S   SS+ L
Sbjct  78   EDGRIEIECNGEGVLFVEAESDGVVDDFGDFAPTLELRRLIPAVDYSQGISSYAL  132



>emb|CAT00088.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
[Coffea arabica]
Length=232

 Score =   110 bits (275),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            ++I +KE+TMV+PA+ TP + LW SNVDLVV   H   VYFYRP GS NFFD K +K+AL
Sbjct  1    MKIEVKESTMVRPAQETPGRNLWNSNVDLVVPNFHTPSVYFYRPTGSSNFFDAKVLKDAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            SR LV FYPMAGR+ RD DG
Sbjct  61   SRALVPFYPMAGRLKRDEDG  80


 Score = 60.8 bits (146),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EIECNGEG LFV A SD    DFGDF P L L  L+P+   S   SS+ L
Sbjct  78   EDGRIEIECNGEGVLFVEAESDGVVDDFGDFAPTLELRRLIPAVDYSQGISSYAL  132



>emb|CAJ40778.1| hydroxycinnamoyl transferase [Coffea arabica]
Length=434

 Score =   110 bits (274),  Expect(2) = 7e-34, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            ++I +KE+TMV+PA+ TP + LW SNVDLVV   H   VYFYRP GS NFFD K +K+AL
Sbjct  1    MKIEVKESTMVRPAQETPRRNLWNSNVDLVVPNFHTPSVYFYRPTGSSNFFDAKVLKDAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            SR LV FYPMAGR+ RD DG
Sbjct  61   SRALVPFYPMAGRLKRDEDG  80


 Score = 61.2 bits (147),  Expect(2) = 7e-34, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EIECNGEG LFV A SD    DFGDF P L L  L+P+   S   SS+ L
Sbjct  78   EDGRIEIECNGEGVLFVEAESDGVVDDFGDFAPTLELRRLIPAVDYSQGISSYAL  132



>ref|XP_011620549.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Amborella 
trichopoda]
Length=138

 Score =   112 bits (280),  Expect(2) = 9e-34, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I +K +TMV+PA+ TP   LW SNVDLVV R+H   VYFYRPNG+PNFFD + +KEALSR
Sbjct  3    ITVKGSTMVRPAQQTPRIALWNSNVDLVVPRMHTPSVYFYRPNGAPNFFDTQVLKEALSR  62

Query  384  VLVSFYPMAGRMGRDGDG  437
             LV FYPMAGR+ RD DG
Sbjct  63   ALVPFYPMAGRLRRDEDG  80


 Score = 58.5 bits (140),  Expect(2) = 9e-34, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+C+G+G LFV A +D    DFGDF P + L  LLP    +   S++PL
Sbjct  78   EDGRIEIDCDGQGVLFVEAYTDSVVDDFGDFAPTMELKQLLPKVNYTEDISAYPL  132



>gb|AEM63675.1| hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyl transferase 
[Platycodon grandiflorus]
Length=434

 Score =   110 bits (275),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            ++I ++E+TMVKPA+ TP K LW SNVDLVV   H   VYFYRPNGS NFFD K +K+AL
Sbjct  1    MKIEVRESTMVKPAEETPIKTLWNSNVDLVVPNFHTPSVYFYRPNGSANFFDAKVLKDAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            S++LV FYPM GR+ RD DG
Sbjct  61   SQILVPFYPMGGRLKRDEDG  80


 Score = 60.1 bits (144),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+CNGEG LFV A +D    DFGDF P L L  L+PS   S   S+ PL
Sbjct  78   EDGRIEIDCNGEGVLFVEAETDGVVDDFGDFAPTLELRKLIPSVDYSLEISAIPL  132



>gb|ABO40491.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Coffea arabica]
Length=434

 Score =   109 bits (272),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            ++I +KE+TMV+PA  TP + LW SNVDLVV   H   VYFYRP GS NFFD K +K+AL
Sbjct  1    MKIEVKESTMVRPAHETPRRNLWNSNVDLVVPNFHTPSVYFYRPTGSSNFFDAKVLKDAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            SR LV FYPMAGR+ RD DG
Sbjct  61   SRALVPFYPMAGRLKRDEDG  80


 Score = 61.2 bits (147),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EIECNGEG LFV A SD    DFGDF P L L  L+P+   S   SS+ L
Sbjct  78   EDGRIEIECNGEGVLFVEAESDGVVDDFGDFAPTLELRRLIPAVDYSQGISSYAL  132



>gb|ERM93896.1| hypothetical protein AMTR_s00137p00027820 [Amborella trichopoda]
Length=143

 Score =   112 bits (280),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I +K +TMV+PA+ TP   LW SNVDLVV R+H   VYFYRPNG+PNFFD + +KEALSR
Sbjct  3    ITVKGSTMVRPAQQTPRIALWNSNVDLVVPRMHTPSVYFYRPNGAPNFFDTQVLKEALSR  62

Query  384  VLVSFYPMAGRMGRDGDG  437
             LV FYPMAGR+ RD DG
Sbjct  63   ALVPFYPMAGRLRRDEDG  80


 Score = 58.2 bits (139),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+C+G+G LFV A +D    DFGDF P + L  LLP    +   S++PL
Sbjct  78   EDGRIEIDCDGQGVLFVEAYTDSVVDDFGDFAPTMELKQLLPKVNYTEDISAYPL  132



>gb|AFN85668.1| putative hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyl 
transferase [Hibiscus cannabinus]
Length=431

 Score =   110 bits (276),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I +KE+TMV+PA  TP + LW +NVDLVV R H   VYFYRP G+ NFFDP+ MKEALS+
Sbjct  3    INVKESTMVQPAGETPRRSLWNANVDLVVPRFHTPSVYFYRPTGAANFFDPQVMKEALSK  62

Query  384  VLVSFYPMAGRMGRDGDG  437
             LV FYPMAGR+ RD DG
Sbjct  63   ALVPFYPMAGRLKRDEDG  80


 Score = 59.3 bits (142),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+CN EG LFV A +     DFGDF P L L  L+P+   SG  S++PL
Sbjct  78   EDGRIEIDCNAEGVLFVEAETTSVIDDFGDFAPTLELRQLIPTVDYSGGISTYPL  132



>ref|XP_011020577.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Populus 
euphratica]
Length=431

 Score =   110 bits (276),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I +KE+TMV+PA+ TP ++LW SNVDLVV R H   VYFYRP G+ NFFD K +KEALS+
Sbjct  3    INVKESTMVQPAEETPRRRLWNSNVDLVVPRFHTPSVYFYRPTGASNFFDAKVLKEALSK  62

Query  384  VLVSFYPMAGRMGRDGDG  437
             LV FYPMAGR+ RD DG
Sbjct  63   ALVPFYPMAGRLRRDDDG  80


 Score = 59.3 bits (142),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            GR+EI+CN EG LFV A +     DFGDF P L L  L+P+   SG  S++PL
Sbjct  80   GRIEIDCNAEGVLFVEAETASVVADFGDFAPTLELKQLIPTVDYSGGISTYPL  132



>ref|XP_009615699.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Nicotiana 
tomentosiformis]
 sp|Q8GSM7.1|HST_TOBAC RecName: Full=Shikimate O-hydroxycinnamoyltransferase; AltName: 
Full=Hydroxycinnamoyl transferase; AltName: Full=Hydroxycinnamoyl-Coenzyme 
A shikimate/quinate hydroxycinnamoyltransferase 
[Nicotiana tabacum]
 emb|CAD47830.1| hydroxycinnamoyl transferase [Nicotiana tabacum]
Length=435

 Score =   114 bits (284),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            ++I +KE+TMVKPA  TP ++LW SNVDLVV   H   VYFYRP GSPNFFD K +KEAL
Sbjct  1    MKIEVKESTMVKPAAETPQQRLWNSNVDLVVPNFHTPSVYFYRPTGSPNFFDGKVLKEAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            S+ LV FYPMAGR+ RD DG
Sbjct  61   SKALVPFYPMAGRLCRDEDG  80


 Score = 55.5 bits (132),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 33/55 (60%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+C G+G LFV A SD    DFGDF P L L  L+P+   S    S+ L
Sbjct  78   EDGRIEIDCKGQGVLFVEAESDGVVDDFGDFAPTLELRQLIPAVDYSQGIQSYAL  132



>ref|XP_007023475.1| Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
isoform 1 [Theobroma cacao]
 ref|XP_007023476.1| Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
isoform 1 [Theobroma cacao]
 gb|EOY26097.1| Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
isoform 1 [Theobroma cacao]
 gb|EOY26098.1| Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
isoform 1 [Theobroma cacao]
Length=431

 Score =   110 bits (276),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            + +KE+TMV+PA+ TP + LW SNVDLVV R H   VYFYRP G+ NFFDP+ MKEALS+
Sbjct  3    VNVKESTMVRPAEETPRQSLWNSNVDLVVPRFHTPSVYFYRPTGASNFFDPQVMKEALSK  62

Query  384  VLVSFYPMAGRMGRDGDG  437
             LV FYPM GR+ RD DG
Sbjct  63   ALVPFYPMGGRLKRDEDG  80


 Score = 58.5 bits (140),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+CNGEG L V A ++    DFGDF P L L  L+P+   SG   ++PL
Sbjct  78   EDGRIEIDCNGEGVLLVEAETNSVIDDFGDFAPTLELRQLIPTVDYSGGIGTYPL  132



>emb|CBI25231.3| unnamed protein product [Vitis vinifera]
Length=406

 Score =   114 bits (284),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I ++E+TMV+PA+ TP + LW SNVDLVV R+H   VYFYRP+G+ NFFDP+ MKEALS+
Sbjct  3    INVRESTMVRPAEETPRRSLWNSNVDLVVPRMHTPSVYFYRPSGAANFFDPQVMKEALSK  62

Query  384  VLVSFYPMAGRMGRDGDG  437
            VLV FYPMAGR+ RD DG
Sbjct  63   VLVPFYPMAGRLRRDEDG  80


 Score = 55.1 bits (131),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 33/55 (60%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+CN EG LFV A +     DFGDF P L L  L+P+   SG   S+ L
Sbjct  78   EDGRIEIDCNAEGVLFVEADTGSVIDDFGDFAPTLELRQLIPTVDYSGDIGSYSL  132



>ref|XP_002268988.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Vitis vinifera]
Length=429

 Score =   114 bits (284),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I ++E+TMV+PA+ TP + LW SNVDLVV R+H   VYFYRP+G+ NFFDP+ MKEALS+
Sbjct  3    INVRESTMVRPAEETPRRSLWNSNVDLVVPRMHTPSVYFYRPSGAANFFDPQVMKEALSK  62

Query  384  VLVSFYPMAGRMGRDGDG  437
            VLV FYPMAGR+ RD DG
Sbjct  63   VLVPFYPMAGRLRRDEDG  80


 Score = 55.1 bits (131),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 33/55 (60%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+CN EG LFV A +     DFGDF P L L  L+P+   SG   S+ L
Sbjct  78   EDGRIEIDCNAEGVLFVEADTGSVIDDFGDFAPTLELRQLIPTVDYSGDIGSYSL  132



>ref|XP_012067474.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Jatropha 
curcas]
 gb|KDP41953.1| hypothetical protein JCGZ_26971 [Jatropha curcas]
Length=431

 Score =   108 bits (270),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I +KE+T+VKPA+ TP + LW +NVDLVV R H   VYFYRP G+P FFDP  +KE LS+
Sbjct  3    ITVKESTLVKPAEETPRRGLWNANVDLVVPRFHTPSVYFYRPTGAPTFFDPNVVKEGLSK  62

Query  384  VLVSFYPMAGRMGRDGDG  437
             LV FYPMAGR+ RD DG
Sbjct  63   ALVPFYPMAGRLRRDEDG  80


 Score = 60.1 bits (144),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+CN EG LFV A +     DFGDF P L L  L+P+   SG  S++PL
Sbjct  78   EDGRIEIDCNAEGVLFVVAETSSVIDDFGDFAPTLELKKLIPTVDYSGGISTYPL  132



>emb|CAN82918.1| hypothetical protein VITISV_023290 [Vitis vinifera]
Length=429

 Score =   114 bits (284),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I ++E+TMV+PA+ TP + LW SNVDLVV R+H   VYFYRP+G+ NFFDP+ MKEALS+
Sbjct  3    INVRESTMVRPAEETPRRSLWNSNVDLVVPRMHTPSVYFYRPSGAANFFDPQVMKEALSK  62

Query  384  VLVSFYPMAGRMGRDGDG  437
            VLV FYPMAGR+ RD DG
Sbjct  63   VLVPFYPMAGRLRRDEDG  80


 Score = 55.1 bits (131),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 33/55 (60%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+CN EG LFV A +     DFGDF P L L  L+P+   SG   S+ L
Sbjct  78   EDGRIEIDCNAEGVLFVEADTGSVIDDFGDFAPTLELRQLIPTVDYSGDIGSYSL  132



>gb|ABO77955.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Coffea canephora]
Length=434

 Score =   111 bits (277),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 62/81 (77%), Gaps = 0/81 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            ++I +KE+TMV+PA+ TP + LW SNVDLVV   H   VYFYRP GS NFFD K +K+AL
Sbjct  1    MKIEVKESTMVRPAQETPGRNLWNSNVDLVVPNFHTPSVYFYRPTGSSNFFDAKVLKDAL  60

Query  378  SRVLVSFYPMAGRMGRDGDGE  440
            SR LV FYPMAGR+ RD DG+
Sbjct  61   SRALVPFYPMAGRLKRDEDGQ  81


 Score = 57.0 bits (136),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E G++EIECNGEG LFV A SD    DFGDF P L    L+P+   S   SS+ L
Sbjct  78   EDGQIEIECNGEGVLFVEAESDGVVDDFGDFAPTLEHRRLIPAVDYSQGISSYAL  132



>gb|ACC63882.1| quinate O-hydroxycinnamoyltransferase/shikimate O-hydroxycinnamoyltransferase 
[Populus trichocarpa]
 gb|AFZ78608.1| hydroxycinnamoyl-CoA:shikimate/quinate hydroxycinnamoyl transferase 
[Populus tomentosa]
Length=433

 Score =   109 bits (272),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I +KE+TMV+PA+ TP + LW SNVDLVV R H   VYFYRP G+ NFFD K +KEALS+
Sbjct  3    INVKESTMVQPAEETPRRGLWNSNVDLVVPRFHTPSVYFYRPTGASNFFDAKVLKEALSK  62

Query  384  VLVSFYPMAGRMGRDGDG  437
             LV FYPMAGR+ RD DG
Sbjct  63   ALVPFYPMAGRLRRDDDG  80


 Score = 58.9 bits (141),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            GR+EI+CN EG LFV A +     DFGDF P L L  L+P+   SG  S++PL
Sbjct  80   GRIEIDCNAEGVLFVEAGTASVVADFGDFAPTLELKQLIPTVDYSGGISTYPL  132



>gb|AIG20957.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Lonicera japonica]
Length=424

 Score =   110 bits (274),  Expect(2) = 7e-33, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            +RI +KE+TMV+PA+  P + LW SNVDLVV   H   VYFY P GS NFFDPK +K+AL
Sbjct  1    MRISVKESTMVRPAQDLPPRSLWNSNVDLVVPNFHTPSVYFYNPTGSSNFFDPKVLKDAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            SR LV FYPMAGR+ RD DG
Sbjct  61   SRALVPFYPMAGRLRRDEDG  80


 Score = 57.8 bits (138),  Expect(2) = 7e-33, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EIECNG G LFV A SD    DFGDF P L +  L+P+   S   SS+ L
Sbjct  78   EDGRIEIECNGAGVLFVEAESDGVIGDFGDFAPTLEMRKLIPAVDYSQGISSYAL  132



>ref|XP_009399564.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Musa 
acuminata subsp. malaccensis]
Length=444

 Score =   110 bits (276),  Expect(2) = 9e-33, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            + I ++ +TMV+PA+PTP ++LW SN+DLVV R H   VYFYRP+GS +FFD  AM++AL
Sbjct  2    VEINVRRSTMVRPAEPTPRRQLWNSNLDLVVPRFHTPSVYFYRPDGSADFFDAAAMRDAL  61

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            +R LV FYPMAGR+GRD DG
Sbjct  62   ARALVLFYPMAGRLGRDEDG  81


 Score = 56.6 bits (135),  Expect(2) = 9e-33, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+CNG+G LFV A +     DFGDF P + L  L+P    +   S+FPL
Sbjct  79   EDGRIEIDCNGQGVLFVEADTGASVDDFGDFAPTMELKQLIPKVDYTDDISAFPL  133



>ref|XP_006368492.1| transferase family protein [Populus trichocarpa]
 gb|ACC63883.1| quinate O-hydroxycinnamoyltransferase/shikimate O-hydroxycinnamoyltransferase 
[Populus trichocarpa]
 gb|ERP65061.1| transferase family protein [Populus trichocarpa]
Length=431

 Score =   109 bits (273),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I +KE+TMV+PA+ TP + LW SNVDLVV R H   VYFYRP G+PNFFD K +K ALS+
Sbjct  3    INVKESTMVQPAEETPRRGLWNSNVDLVVPRFHTPSVYFYRPTGAPNFFDAKVLKGALSK  62

Query  384  VLVSFYPMAGRMGRDGDG  437
             LV FYPMAGR+ RD DG
Sbjct  63   ALVPFYPMAGRLRRDEDG  80


 Score = 57.4 bits (137),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 33/55 (60%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI CN EG LFV A +     DF DF P L L  L+P+   SG  S++PL
Sbjct  78   EDGRIEINCNAEGVLFVEAETTSVIDDFADFAPTLELKQLIPTVDYSGGISTYPL  132



>gb|AFZ78609.1| hydroxycinnamoyl-CoA:shikimate/quinate hydroxycinnamoyl transferase 
[Populus tomentosa]
Length=431

 Score =   109 bits (273),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I +KE+TMV+PA+ TP + LW SNVDLVV R H   VYFYRP G+PNFFD K +K ALS+
Sbjct  3    INVKESTMVQPAEETPRRGLWNSNVDLVVPRFHTPSVYFYRPTGAPNFFDAKVLKGALSK  62

Query  384  VLVSFYPMAGRMGRDGDG  437
             LV FYPMAGR+ RD DG
Sbjct  63   ALVPFYPMAGRLRRDEDG  80


 Score = 57.4 bits (137),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 33/55 (60%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI CN EG LFV A +     DF DF P L L  L+P+   SG  S++PL
Sbjct  78   EDGRIEINCNAEGVLFVEAETTSVIDDFADFAPTLELKQLIPTVDYSGGISTYPL  132



>ref|NP_199704.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
[Arabidopsis thaliana]
 sp|Q9FI78.1|HST_ARATH RecName: Full=Shikimate O-hydroxycinnamoyltransferase; AltName: 
Full=Hydroxycinnamoyl transferase; AltName: Full=Hydroxycinnamoyl-Coenzyme 
A shikimate/quinate hydroxycinnamoyltransferase 
[Arabidopsis thaliana]
 dbj|BAB10316.1| anthranilate N-benzoyltransferase [Arabidopsis thaliana]
 dbj|BAE98378.1| anthranilate N-benzoyltransferase [Arabidopsis thaliana]
 gb|ABH04595.1| At5g48930 [Arabidopsis thaliana]
 gb|AED95744.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
[Arabidopsis thaliana]
Length=433

 Score =   110 bits (275),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            ++I I+++TMV+PA  TP   LW SNVDLV+ R H   VYFYRP G+ NFFDP+ MKEAL
Sbjct  1    MKINIRDSTMVRPATETPITNLWNSNVDLVIPRFHTPSVYFYRPTGASNFFDPQVMKEAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            S+ LV FYPMAGR+ RD DG
Sbjct  61   SKALVPFYPMAGRLKRDDDG  80


 Score = 55.8 bits (133),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 31/53 (58%), Gaps = 0/53 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            GR+EI+CNG G LFV A +     DFGDF P L L  L+P    S    SFPL
Sbjct  80   GRIEIDCNGAGVLFVVADTPSVIDDFGDFAPTLNLRQLIPEVDHSAGIHSFPL  132



>gb|AFF19203.1| hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltransferase [Erythroxylum 
coca]
Length=433

 Score =   104 bits (260),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = +3

Query  210  IKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSRVL  389
            IKE+T+V+PA+ TP+ +L  SN+DL+V RIHLL VYFY+P  S NFFD K +KE LS+ L
Sbjct  3    IKESTIVRPARETPTTRLQSSNLDLLVARIHLLTVYFYKPTSSENFFDAKVLKEGLSQAL  62

Query  390  VSFYPMAGRMGRDGDG  437
            V FYP+AGR+ RD +G
Sbjct  63   VHFYPVAGRLQRDENG  78


 Score = 61.2 bits (147),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+CNGEG LFV A S     DFGDFTP   +  L+P    S   SSFPL
Sbjct  76   ENGRIEIDCNGEGVLFVEAESSRVMDDFGDFTPSFEMLELVPEVDYSDHISSFPL  130



>gb|AAM61215.1| anthranilate N-benzoyltransferase [Arabidopsis thaliana]
Length=433

 Score =   110 bits (275),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            ++I I+++TMV+PA  TP   LW SNVDLV+ R H   VYFYRP G+ NFFDP+ MKEAL
Sbjct  1    MKINIRDSTMVRPATETPITNLWNSNVDLVIPRFHTPSVYFYRPTGASNFFDPQVMKEAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            S+ LV FYPMAGR+ RD DG
Sbjct  61   SKALVPFYPMAGRLKRDDDG  80


 Score = 55.1 bits (131),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 31/53 (58%), Gaps = 0/53 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            GR+EI+CNG G LFV A +     DFGDF P L L  L+P    S    SFPL
Sbjct  80   GRIEIDCNGAGVLFVVADTPSVIDDFGDFAPTLNLRQLIPEVDHSTGIHSFPL  132



>ref|XP_006392548.1| hypothetical protein EUTSA_v10011497mg [Eutrema salsugineum]
 gb|ESQ29834.1| hypothetical protein EUTSA_v10011497mg [Eutrema salsugineum]
Length=433

 Score =   112 bits (281),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            ++I I+++TMV+PA  TPS  LW SNVDL++ R H   VYFYRP GS NFFDP+ MKEAL
Sbjct  1    MKINIRDSTMVRPAAETPSTYLWNSNVDLIIPRFHTPSVYFYRPTGSSNFFDPEVMKEAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            S+ LV FYPMAGR+ RD DG
Sbjct  61   SKALVPFYPMAGRLKRDDDG  80


 Score = 53.1 bits (126),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 30/53 (57%), Gaps = 0/53 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            GR+EI+CN  G LFV A +     DFGDF P L L  L+P    S    SFPL
Sbjct  80   GRIEIDCNAAGVLFVVADTPSVIDDFGDFAPTLNLRQLIPDVDHSPGIHSFPL  132



>gb|AFS68800.1| hydroxycinnamoyl transferase [Lonicera japonica]
Length=430

 Score =   107 bits (268),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            +RI +KE+T V+PA+  P + LW SNVDLVV   H   VYFY P GS NFFDPK +K+AL
Sbjct  1    MRISVKESTTVRPAQDLPPRSLWNSNVDLVVPNFHTPSVYFYNPTGSSNFFDPKVLKDAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            SR LV FYPMAGR+ RD DG
Sbjct  61   SRALVPFYPMAGRLRRDEDG  80


 Score = 57.8 bits (138),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EIECNG G LFV A SD    DFGDF P L +  L+P+   S   SS+ L
Sbjct  78   EDGRIEIECNGAGVLFVEAESDGVIGDFGDFAPTLEMRKLIPAVDYSQGISSYAL  132



>gb|AFL93686.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl-transferase 
[Cynara cardunculus var. scolymus]
Length=436

 Score =   112 bits (279),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            ++I ++E+TMV+PAK TP   LW SNVDLVV   H   VYFYRPNG+ NFFDPK MK+AL
Sbjct  1    MKIEVRESTMVRPAKETPRINLWNSNVDLVVPNFHTPSVYFYRPNGAANFFDPKVMKDAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            SR LV FYPM GR+ RD DG
Sbjct  61   SRALVPFYPMGGRLKRDEDG  80


 Score = 52.8 bits (125),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 33/55 (60%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+C G+G LFV A SD    DFGDF P L L  L+P+   +    S+ L
Sbjct  78   EDGRIEIDCQGQGVLFVEAESDGVIDDFGDFAPTLELRKLIPAVDYTLGIESYSL  132



>emb|CCC55431.1| hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Pinus pinaster]
Length=433

 Score =   106 bits (264),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I +K + MV+PA PTP + LW SNVDLVV RIH   VYFYRP GSP+FF    +++ALS+
Sbjct  3    ITVKSSQMVRPAAPTPQRDLWNSNVDLVVPRIHTASVYFYRPTGSPDFFSMNILRDALSK  62

Query  384  VLVSFYPMAGRMGRDGDG  437
            +LV FYPMAGR+ RD DG
Sbjct  63   LLVPFYPMAGRLKRDPDG  80


 Score = 58.5 bits (140),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            GR+EI CNGEG L V A +D    DFGDF P + L  L+P    S   SS+PL
Sbjct  80   GRIEINCNGEGVLLVEAITDSVIDDFGDFAPTMELKQLIPKVNYSEDISSYPL  132



>gb|ABO52899.1| hydroxycinnamoyl-CoA:shikimate hydroxycinnamoyltransferase [Pinus 
radiata]
Length=433

 Score =   106 bits (264),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I +K + MV+PA PTP + LW SNVDLVV RIH   VYFYRP GSP+FF    +++ALS+
Sbjct  3    ITVKNSQMVRPAAPTPQRDLWNSNVDLVVPRIHTASVYFYRPTGSPDFFSMNILRDALSK  62

Query  384  VLVSFYPMAGRMGRDGDG  437
            +LV FYPMAGR+ RD DG
Sbjct  63   LLVPFYPMAGRLKRDPDG  80


 Score = 58.5 bits (140),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            GR+EI CNGEG L V A +D    DFGDF P + L  L+P    S   SS+PL
Sbjct  80   GRIEINCNGEGVLLVEAITDSVIDDFGDFAPTMELKQLIPKVNYSEDISSYPL  132



>gb|KCW53914.1| hypothetical protein EUGRSUZ_J03126 [Eucalyptus grandis]
Length=497

 Score =   107 bits (266),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = +3

Query  180  NMASEKLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPK  359
            N+    + + ++E+TMV+PA  T    LW SNVDLVV  +H   VYFYRPNGSP+FFDPK
Sbjct  58   NIVWFDMIVSVRESTMVRPAGETRIHALWNSNVDLVVPSMHTPSVYFYRPNGSPDFFDPK  117

Query  360  AMKEALSRVLVSFYPMAGRMGRDGDG  437
             +KE LS+ LV FYPMAGR+ RD DG
Sbjct  118  VLKEGLSKALVPFYPMAGRLRRDEDG  143


 Score = 57.8 bits (138),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+CN EG LFV A +     DFGDF P L L  L+P+   S   S++PL
Sbjct  141  EDGRIEIDCNAEGVLFVEAETSSAVDDFGDFAPTLELRKLIPAVDYSAGLSTYPL  195



>ref|XP_010034043.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
Length=492

 Score =   107 bits (266),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = +3

Query  180  NMASEKLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPK  359
            N+    + + ++E+TMV+PA  T    LW SNVDLVV  +H   VYFYRPNGSP+FFDPK
Sbjct  53   NIVWFDMIVSVRESTMVRPAGETRIHALWNSNVDLVVPSMHTPSVYFYRPNGSPDFFDPK  112

Query  360  AMKEALSRVLVSFYPMAGRMGRDGDG  437
             +KE LS+ LV FYPMAGR+ RD DG
Sbjct  113  VLKEGLSKALVPFYPMAGRLRRDEDG  138


 Score = 57.8 bits (138),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+CN EG LFV A +     DFGDF P L L  L+P+   S   S++PL
Sbjct  136  EDGRIEIDCNAEGVLFVEAETSSAVDDFGDFAPTLELRKLIPAVDYSAGLSTYPL  190



>dbj|BAJ14794.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Ipomoea batatas]
Length=431

 Score =   108 bits (269),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            ++I +KE+TMV+PA+ TP  +LW SNVDLVV   H   VYFYRPNG+ +FF+ KA+K+ L
Sbjct  1    MKISVKESTMVRPAEETPRIRLWNSNVDLVVPNFHTPSVYFYRPNGADDFFESKALKDGL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            SR LV FYPMAGR+ RD DG
Sbjct  61   SRALVPFYPMAGRLTRDEDG  80


 Score = 56.6 bits (135),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 33/55 (60%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+CNG G L V A SD    DFGDF P L L  L+P+   S    S+PL
Sbjct  78   EDGRIEIDCNGAGVLLVEAESDGFVDDFGDFAPTLELRQLIPTVDYSQGIESYPL  132



>ref|XP_002894568.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70827.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
Length=433

 Score =   108 bits (270),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            ++I I+++TMV+PA  TP   LW SNVDLV+ R H   VYFYRP G+ NFFDP+ MK+AL
Sbjct  1    MKINIRDSTMVRPAAETPITNLWNSNVDLVIPRFHTPSVYFYRPTGASNFFDPQIMKDAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            S+ LV FYPMAGR+ RD DG
Sbjct  61   SKALVPFYPMAGRLKRDDDG  80


 Score = 55.8 bits (133),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 31/53 (58%), Gaps = 0/53 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            GR+EI+CNG G LFV A +     DFGDF P L L  L+P    S    SFPL
Sbjct  80   GRIEIDCNGAGVLFVVADTPSVIDDFGDFAPTLNLRQLIPDVDHSAGIHSFPL  132



>ref|XP_010942061.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Elaeis guineensis]
Length=434

 Score =   105 bits (261),  Expect(2) = 7e-32, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I  + +TMV+PA+PTP ++LW SN+DLVV R H   VYFYRP+GS +FFD + ++ AL++
Sbjct  3    ISERRSTMVRPAEPTPRRRLWNSNLDLVVPRFHTPSVYFYRPDGSADFFDAERLRAALAK  62

Query  384  VLVSFYPMAGRMGRDGDG  437
             LV FYPMAGR+GRD DG
Sbjct  63   ALVPFYPMAGRLGRDEDG  80


 Score = 59.3 bits (142),  Expect(2) = 7e-32, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+CNGEG LFV A ++    DFGDF P + L  L+P    +   S+FPL
Sbjct  78   EDGRIEIDCNGEGVLFVEAAAERTVDDFGDFAPTMELKQLIPKVVYTDDISAFPL  132



>emb|CDY05770.1| BnaC07g00330D [Brassica napus]
Length=433

 Score =   111 bits (278),  Expect(2) = 7e-32, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            ++I I+++TMV+PA  TPS  LW SNVDLV+ R H   VYFYRP G+ NFFDP+ MKEAL
Sbjct  1    MKINIRDSTMVRPAAETPSTYLWNSNVDLVIPRFHTPSVYFYRPTGASNFFDPQVMKEAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            ++ LV FYPMAGR+ RD DG
Sbjct  61   AKALVPFYPMAGRLKRDDDG  80


 Score = 53.1 bits (126),  Expect(2) = 7e-32, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 30/53 (57%), Gaps = 0/53 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            GR+EI+CN  G LFV A +     DFGDF P L L  L+P    S    SFPL
Sbjct  80   GRIEIDCNAAGVLFVVADTPSVIDDFGDFAPTLELRQLIPEVDHSPGIHSFPL  132



>ref|XP_011467012.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Fragaria 
vesca subsp. vesca]
Length=437

 Score =   103 bits (258),  Expect(2) = 7e-32, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 62/81 (77%), Gaps = 1/81 (1%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPS-KKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEA  374
            + + +KE+T+VKPA+ T   + LW +NVDLV+  IH   +YFYRPNG+ NFFDP+ +K A
Sbjct  4    VNVTVKESTIVKPAEETTEPRSLWNANVDLVIPSIHTPSIYFYRPNGASNFFDPRVLKHA  63

Query  375  LSRVLVSFYPMAGRMGRDGDG  437
            LS+VLV FYPMAGR+ RD DG
Sbjct  64   LSKVLVPFYPMAGRLKRDDDG  84


 Score = 60.5 bits (145),  Expect(2) = 7e-32, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            GR+EI CNGEG LFV A S     DFGDF P L L  L+P+   S   SS+PL
Sbjct  84   GRIEINCNGEGVLFVVAESSSVIDDFGDFAPTLELRKLIPTVDYSAGISSYPL  136



>ref|XP_008790160.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Phoenix dactylifera]
 ref|XP_008790161.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Phoenix dactylifera]
 ref|XP_008790163.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Phoenix dactylifera]
Length=434

 Score =   103 bits (258),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I  + +T+V PA+PTP ++LW S++DLVV R H   VYFYRP+GSP+FFD + ++ AL++
Sbjct  3    ITERRSTLVGPAEPTPRRRLWNSSLDLVVPRFHTPSVYFYRPDGSPDFFDAERLRAALAK  62

Query  384  VLVSFYPMAGRMGRDGDG  437
             LV FYPMAGR+GRD DG
Sbjct  63   ALVPFYPMAGRLGRDEDG  80


 Score = 60.1 bits (144),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+CNGEG LFV A +D    DFGDF P + L  L+P    +   S+FPL
Sbjct  78   EDGRIEIDCNGEGVLFVEAVADGMVDDFGDFAPTMELKRLIPKVEYTDDISAFPL  132



>ref|XP_010479239.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=431

 Score =   106 bits (264),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            ++I I+++T+V+PA  TP   LW SNVDL++ R H   VYFYRP G+ NFFDP+ +KEAL
Sbjct  1    MKINIRDSTVVRPAAETPVINLWNSNVDLIIPRFHTPSVYFYRPTGASNFFDPQVLKEAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            S+ LV+FYP+AGR+ RD DG
Sbjct  61   SKALVAFYPIAGRLKRDNDG  80


 Score = 57.4 bits (137),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            GR+EI+CNGEG LFV A +     DFGDF P L L  L+P    S    +FPL
Sbjct  80   GRIEIDCNGEGVLFVVADTPSVIDDFGDFAPSLTLRQLIPDVDYSAGVHTFPL  132



>gb|AAZ80046.1| hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltransferase [Cynara 
cardunculus]
Length=436

 Score =   110 bits (276),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            ++I ++E+TMV+PA+ TP   LW SNVDLVV   H   VYFYRPNG+ NFFDPK MK+AL
Sbjct  1    MKIEVRESTMVRPAEETPRINLWNSNVDLVVPNFHTPSVYFYRPNGAANFFDPKVMKDAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            SR LV FYPM GR+ RD DG
Sbjct  61   SRALVPFYPMGGRLKRDEDG  80


 Score = 52.8 bits (125),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 33/55 (60%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+C G+G LFV A SD    DFGDF P L L  L+P+   +    S+ L
Sbjct  78   EDGRIEIDCQGQGVLFVEAESDGVIDDFGDFAPTLELRKLIPAVDYTLGIESYSL  132



>ref|XP_004235891.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Solanum lycopersicum]
Length=435

 Score =   108 bits (270),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            ++I +K +TMV+PA  TP  +LW SNVDLVV   H   VYFYRP GSPNFFD K +KEAL
Sbjct  1    MKIEVKNSTMVQPATETPQLRLWNSNVDLVVPNFHTPSVYFYRPTGSPNFFDGKVVKEAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            S+ LV FYPMAGR+ RD DG
Sbjct  61   SKALVPFYPMAGRLCRDEDG  80


 Score = 55.1 bits (131),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 33/55 (60%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+C G+G LFV A SD    DFGDF P L L  L+P+   S    S+ L
Sbjct  78   EDGRIEIDCKGQGVLFVEAESDGVVDDFGDFAPTLELRRLIPAVDYSQGIESYAL  132



>gb|ABR17170.1| unknown [Picea sitchensis]
Length=433

 Score =   107 bits (268),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I +K + MV+PA PTP + LW SNVDLVV RIH   VYFYRP+GSP+FF    +++ALS+
Sbjct  3    ITVKSSQMVRPAAPTPQRDLWNSNVDLVVPRIHTASVYFYRPSGSPDFFSMHILRDALSK  62

Query  384  VLVSFYPMAGRMGRDGDG  437
            VLV FYPMAGR+ RD DG
Sbjct  63   VLVPFYPMAGRLKRDPDG  80


 Score = 55.5 bits (132),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 31/53 (58%), Gaps = 0/53 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            GR+EI CNGEG L V A +D    DFGDF P + L  L+P    S   SS+ L
Sbjct  80   GRIEINCNGEGVLLVEATTDSVIDDFGDFAPTMELKQLIPKVNYSEDISSYAL  132



>gb|AHA44839.1| hydroxycinnamoyl-CoA shikimate hydroxycinnamoyltransferase [Larix 
kaempferi]
Length=433

 Score =   107 bits (267),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I +K + MV+PA PTP + LW SNVDLVV RIH   VYFYRP GSP+FF    +++ALS+
Sbjct  3    ITVKSSQMVRPAAPTPQRDLWNSNVDLVVPRIHTASVYFYRPTGSPDFFSMHILRDALSK  62

Query  384  VLVSFYPMAGRMGRDGDG  437
            VLV FYPMAGR+ RD DG
Sbjct  63   VLVPFYPMAGRLKRDPDG  80


 Score = 55.5 bits (132),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 31/53 (58%), Gaps = 0/53 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            GR+EI CNGEG L V A +D    DFGDF P + L  L+P    S   SS+ L
Sbjct  80   GRIEINCNGEGVLLVEAITDSVIDDFGDFAPTMELKQLIPKVNYSEDISSYAL  132



>ref|XP_006341413.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Solanum 
tuberosum]
Length=435

 Score =   107 bits (268),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            ++I +K++TMV+PA  TP  +LW SNVDLVV   H   VYFYRP GSPNFFD K +KEAL
Sbjct  1    MKIEVKKSTMVQPATETPQLRLWNSNVDLVVPNFHTPSVYFYRPTGSPNFFDGKVLKEAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            S+ LV FYPM GR+ RD DG
Sbjct  61   SKALVPFYPMGGRLCRDEDG  80


 Score = 55.1 bits (131),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 33/55 (60%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+C G+G LFV A SD    DFGDF P L L  L+P+   S    S+ L
Sbjct  78   EDGRIEIDCKGQGVLFVEAESDGVVDDFGDFAPTLELRRLIPAVDYSQGIESYAL  132



>gb|ACF17657.1| putative hydroxycinnamoyl transferase [Capsicum annuum]
Length=435

 Score =   107 bits (268),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            ++I ++E+TMV+PA  TP  +LW SNVDLVV   H   VYFYRPNGS NFFD K +K+AL
Sbjct  1    MKIEVRESTMVQPATETPQIRLWNSNVDLVVPNFHTPSVYFYRPNGSANFFDGKVLKDAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            SR LV FYPM GR+ RD DG
Sbjct  61   SRALVPFYPMGGRLCRDEDG  80


 Score = 55.1 bits (131),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 33/55 (60%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+C G+G LFV A SD    DFGDF P L L  L+P+   S    S+ L
Sbjct  78   EDGRIEIDCKGQGVLFVEAESDGVVDDFGDFAPTLELRRLIPAVDYSQGIESYAL  132



>ref|XP_010462493.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=431

 Score =   108 bits (271),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            ++I I+++TMV+PA  TP   LW SNVDL++ R H   VYFYRP G+ NFFDP+ +KEAL
Sbjct  1    MKINIRDSTMVRPAAETPITNLWNSNVDLIIPRFHTPSVYFYRPTGASNFFDPQVLKEAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            S+ LV FYPMAGR+ RD DG
Sbjct  61   SKALVPFYPMAGRLKRDDDG  80


 Score = 53.9 bits (128),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 31/53 (58%), Gaps = 0/53 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            GR+E++CNG G LFV A +     DFGDF P L L  L+P    S    +FPL
Sbjct  80   GRIELDCNGAGVLFVVADTPSVIDDFGDFAPTLTLRQLIPDVDYSAGVHTFPL  132



>ref|XP_010480194.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=431

 Score =   108 bits (271),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            ++I I+++TMV+PA  TP   LW SNVDL++ R H   VYFYRP G+ NFFDP+ +KEAL
Sbjct  1    MKINIRDSTMVRPAAETPITNLWNSNVDLIIPRFHTPSVYFYRPTGASNFFDPQVLKEAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            S+ LV FYPMAGR+ RD DG
Sbjct  61   SKALVPFYPMAGRLKRDDDG  80


 Score = 53.5 bits (127),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 31/53 (58%), Gaps = 0/53 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            GR+E++CNG G LFV A +     DFGDF P L L  L+P    S    +FPL
Sbjct  80   GRIELDCNGAGVLFVVADTPSVIDDFGDFAPTLTLRQLIPDVDYSAGVHTFPL  132



>ref|XP_010501253.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Camelina 
sativa]
Length=431

 Score =   108 bits (270),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            ++I I+++TMV+PA  TP   LW SNVDL++ R H   VYFYRP G+ NFFDP+ +KEAL
Sbjct  1    MKINIRDSTMVRPAAETPLTNLWNSNVDLIIPRFHTPSVYFYRPTGASNFFDPQVLKEAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            S+ LV FYPMAGR+ RD DG
Sbjct  61   SKALVPFYPMAGRLKRDDDG  80


 Score = 53.5 bits (127),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 31/53 (58%), Gaps = 0/53 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            GR+E++CNG G LFV A +     DFGDF P L L  L+P    S    +FPL
Sbjct  80   GRIELDCNGAGVLFVVADTPSVIDDFGDFAPTLTLRQLIPDVDYSAGVHTFPL  132



>ref|XP_009102018.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Brassica 
rapa]
Length=433

 Score =   109 bits (273),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            ++I I+++TMV+PA  TPS  LW SNVDLV+ R H   VYFYRP G+ NFFDP  MKEAL
Sbjct  1    MKINIRDSTMVRPAGETPSTYLWNSNVDLVIPRFHTPSVYFYRPTGASNFFDPGVMKEAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            ++ LV FYPMAGR+ RD DG
Sbjct  61   AKALVPFYPMAGRLKRDDDG  80


 Score = 52.4 bits (124),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 30/53 (57%), Gaps = 0/53 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            GR+EI+CN  G LFV A +     DFGDF P L L  L+P    S    SFPL
Sbjct  80   GRIEIDCNAAGVLFVVADTPSLIDDFGDFAPTLDLRQLIPDVDHSPGIHSFPL  132



>emb|CDY31956.1| BnaA07g00390D [Brassica napus]
Length=433

 Score =   109 bits (273),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            ++I I+++TMV+PA  TPS  LW SNVDLV+ R H   VYFYRP G+ NFFDP  MKEAL
Sbjct  1    MKINIRDSTMVRPAGETPSTYLWNSNVDLVIPRFHTPSVYFYRPTGASNFFDPGVMKEAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            ++ LV FYPMAGR+ RD DG
Sbjct  61   AKALVPFYPMAGRLKRDDDG  80


 Score = 52.4 bits (124),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 30/53 (57%), Gaps = 0/53 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            GR+EI+CN  G LFV A +     DFGDF P L L  L+P    S    SFPL
Sbjct  80   GRIEIDCNAAGVLFVVADTPSLIDDFGDFAPTLDLRQLIPDVDHSPGIHSFPL  132



>ref|XP_009394928.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Musa 
acuminata subsp. malaccensis]
Length=441

 Score =   102 bits (254),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I ++ +TMV+PA+PT  ++LW SN+DLVV R H   VYFYRP+GS  FFD   M+++L+R
Sbjct  4    INVRRSTMVRPAEPTQRRRLWNSNLDLVVPRFHTPSVYFYRPDGSAGFFDAAVMRQSLAR  63

Query  384  VLVSFYPMAGRMGRDGDG  437
             LV FYPMAGR+ RD DG
Sbjct  64   ALVPFYPMAGRLARDEDG  81


 Score = 59.7 bits (143),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+CNGEG LFV A +D    DFGDF P + L  L+P    +   ++FPL
Sbjct  79   EDGRIEIDCNGEGVLFVEADTDAAVDDFGDFAPTMELKQLIPKVDYTDDIAAFPL  133



>gb|KDO55352.1| hypothetical protein CISIN_1g014116mg [Citrus sinensis]
Length=149

 Score =   102 bits (255),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I +KE+TMV+PA  TP   LW +NVDLVV R H   VYFYRP G+ NFFD   +K+ALS+
Sbjct  3    INVKESTMVRPAAETPRVALWNANVDLVVPRFHTPSVYFYRPTGAANFFDAGVLKDALSK  62

Query  384  VLVSFYPMAGRMGRDGDG  437
             LV FYPMAGR+ RD DG
Sbjct  63   ALVPFYPMAGRLKRDDDG  80


 Score = 58.9 bits (141),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            GR+EI+CN EG LFV A +     DFGDF P L L  L+P+   SG  S++PL
Sbjct  80   GRIEIDCNAEGVLFVEAETTSLIDDFGDFAPTLELKQLIPTIDYSGGISTYPL  132



>ref|XP_003543709.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Glycine max]
Length=439

 Score =   108 bits (269),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I +K++TMV+PA+ TP + LW SNVDLVV   H   VYFYRPNG  NFFD K MKEALS+
Sbjct  3    INVKQSTMVRPAEETPRRALWNSNVDLVVPNFHTPSVYFYRPNGVSNFFDAKVMKEALSK  62

Query  384  VLVSFYPMAGRMGRDGDG  437
            VLV FYPMA R+ RD DG
Sbjct  63   VLVPFYPMAARLRRDDDG  80


 Score = 53.5 bits (127),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            GR+EI C+ +G LFV A +     DFGDF+P L L  L+PS   S    S+PL
Sbjct  80   GRVEIYCDAQGVLFVEAETTAAIEDFGDFSPTLELRQLIPSVDYSAGIHSYPL  132



>ref|XP_006427659.1| hypothetical protein CICLE_v10026558mg [Citrus clementina]
 gb|ESR40899.1| hypothetical protein CICLE_v10026558mg [Citrus clementina]
Length=189

 Score =   102 bits (255),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I +KE+TMV+PA  TP   LW +NVDLVV R H   VYFYRP G+ NFFD   +K+ALS+
Sbjct  3    INVKESTMVRPAAETPRVALWNANVDLVVPRFHTPSVYFYRPTGAANFFDAGVLKDALSK  62

Query  384  VLVSFYPMAGRMGRDGDG  437
             LV FYPMAGR+ RD DG
Sbjct  63   ALVPFYPMAGRLKRDDDG  80


 Score = 58.5 bits (140),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            GR+EI+CN EG LFV A +     DFGDF P L L  L+P+   SG  S++PL
Sbjct  80   GRIEIDCNAEGVLFVEAETTSLIDDFGDFAPTLELKQLIPTIDYSGGISTYPL  132



>ref|XP_009380783.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Musa 
acuminata subsp. malaccensis]
Length=440

 Score =   102 bits (255),  Expect(2) = 8e-31, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I +++TTMV+PA+ TP ++LW SN+DLVV R H   VYFYRPNGS  FFD   ++ AL R
Sbjct  4    INLRQTTMVRPAEQTPRRRLWNSNLDLVVPRFHTPSVYFYRPNGSRGFFDAAVLRSALGR  63

Query  384  VLVSFYPMAGRMGRDGDG  437
             LV FYPMAGR+GR  DG
Sbjct  64   ALVPFYPMAGRLGRGEDG  81


 Score = 58.2 bits (139),  Expect(2) = 8e-31, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 36/56 (64%), Gaps = 1/56 (2%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXS-DXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+CNGEG LFV A + D    DFGDF P + +  L+P    +G  SSFPL
Sbjct  79   EDGRVEIDCNGEGVLFVEAEAPDATVDDFGDFAPTMEMKQLIPHVDYTGDISSFPL  134



>ref|XP_011034568.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Populus 
euphratica]
Length=431

 Score =   109 bits (272),  Expect(2) = 8e-31, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I +KE+TMV+PA+ TP + LW SNVDLVV R H   VYFYRP G+PNFFD K +K ALS+
Sbjct  3    INVKESTMVQPAEETPRRGLWNSNVDLVVPRFHTPSVYFYRPTGAPNFFDAKVLKGALSK  62

Query  384  VLVSFYPMAGRMGRDGDG  437
             LV FYPMAGR+ RD DG
Sbjct  63   ALVPFYPMAGRLRRDEDG  80


 Score = 51.6 bits (122),  Expect(2) = 8e-31, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 31/55 (56%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI CN EG LFV A +     DF DF P   L  L+P+   SG  S++ L
Sbjct  78   EDGRIEINCNAEGVLFVEAETTSVIDDFADFAPTSELKQLIPTVDYSGGISTYAL  132



>emb|CBI83579.1| hydroxycinnamoyl transferase [Solenostemon scutellarioides]
Length=427

 Score =   102 bits (253),  Expect(2) = 8e-31, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            ++I ++++T+V+P+  TP+  LW SNVDLVV   H   VYFYRP+G+ NFFD   MK AL
Sbjct  1    MKIHVRDSTLVRPSAATPAVSLWNSNVDLVVPNFHTPSVYFYRPSGADNFFDTAVMKAAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
             R LVSFYPMAGR+ RD DG
Sbjct  61   GRALVSFYPMAGRLKRDEDG  80


 Score = 58.9 bits (141),  Expect(2) = 8e-31, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+CN EG LFV A SD    D+GDF P L L  L+P+   S   S++PL
Sbjct  78   EDGRVEIDCNAEGVLFVEAESDGTVDDYGDFAPSLELRRLIPAVDYSQGISAYPL  132



>ref|XP_002512739.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
 gb|EEF49242.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
Length=431

 Score =   100 bits (250),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I +KE+T+V P++ TP   LW SNVDLVV R H   VYFYRP G+ NFFDP  +K AL +
Sbjct  3    INVKESTLVPPSEETPRVGLWNSNVDLVVPRFHTPSVYFYRPTGASNFFDPDVLKAALGK  62

Query  384  VLVSFYPMAGRMGRDGDG  437
             LV FYPMAGR+ RD DG
Sbjct  63   ALVPFYPMAGRLRRDEDG  80


 Score = 59.7 bits (143),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+CN EG L V A ++    DFGDF P L L  L+P+   SG  S+FPL
Sbjct  78   EDGRIEIDCNAEGVLLVVAETNAVVDDFGDFAPTLELKQLIPTVDYSGGISTFPL  132



>gb|KHN31873.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=439

 Score =   106 bits (265),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I +K++TMV+PA+ TP + LW SNVDLVV   H   VYFYRPNG  NFFD K MKEALS+
Sbjct  3    INVKQSTMVRPAEETPRRALWNSNVDLVVPNFHTPSVYFYRPNGVSNFFDAKVMKEALSK  62

Query  384  VLVSFYPMAGRMGRDGDG  437
             LV FYPMA R+ RD DG
Sbjct  63   ALVPFYPMAARLRRDDDG  80


 Score = 53.5 bits (127),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            GR+EI C+ +G LFV A +     DFGDF+P L L  L+PS   S    S+PL
Sbjct  80   GRVEIYCDAQGVLFVEAETTAAIEDFGDFSPTLELRQLIPSVDYSAGIHSYPL  132



>gb|AEJ88365.1| hydroxycinnamoyltransferase [Cucumis sativus]
Length=430

 Score =   103 bits (258),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I +K++TMV PA+ TP K LW SNVDLVV  +H   VYFYRP G  NFFD + +KE LS+
Sbjct  3    ITVKDSTMVTPAEETPHKSLWNSNVDLVVPSMHTPSVYFYRPTGDSNFFDAEVLKEGLSK  62

Query  384  VLVSFYPMAGRMGRDGDG  437
             LV FYPMAGR+ RD DG
Sbjct  63   ALVPFYPMAGRLRRDEDG  80


 Score = 55.8 bits (133),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 32/55 (58%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI CN EG L V A +     DFGDF P L L  L+P+   SG   S+PL
Sbjct  78   EDGRIEIYCNAEGVLLVEAETTAVIDDFGDFAPTLQLRQLIPAVDYSGGIESYPL  132



>ref|XP_004135880.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Cucumis sativus]
 gb|KGN45212.1| hypothetical protein Csa_7G431440 [Cucumis sativus]
Length=430

 Score =   103 bits (258),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I IK++TMV PA+ TP + LW SNVDLVV  +H   VYFYRP G  NFFD + +KE LS+
Sbjct  3    ITIKDSTMVTPAEETPHRSLWNSNVDLVVPSMHTPSVYFYRPTGDSNFFDAEVLKEGLSK  62

Query  384  VLVSFYPMAGRMGRDGDG  437
             LV FYPMAGR+ RD DG
Sbjct  63   ALVPFYPMAGRLRRDEDG  80


 Score = 55.8 bits (133),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 32/55 (58%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI CN EG L V A +     DFGDF P L L  L+P+   SG   S+PL
Sbjct  78   EDGRIEIYCNAEGVLLVEAETTAVIDDFGDFAPTLQLRQLIPAVDYSGGIESYPL  132



>gb|KEH38242.1| shikimate/quinate hydroxycinnamoyltransferase [Medicago truncatula]
Length=432

 Score =   109 bits (272),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I +KE+T+V+PA+ TP K LW SNVDLVV   H   VYFYRPNG+ NFFD K MKEALS+
Sbjct  3    INVKESTVVRPAEETPRKALWNSNVDLVVPNFHTPSVYFYRPNGTSNFFDAKIMKEALSK  62

Query  384  VLVSFYPMAGRMGRDGDG  437
            VLV FYPMA R+ RD DG
Sbjct  63   VLVPFYPMAARLRRDEDG  80


 Score = 50.4 bits (119),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 32/55 (58%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+E+ C+G+G LFV A +     DF DF P L L  L+P+   S    ++PL
Sbjct  78   EDGRVELYCDGQGVLFVDADTTASVDDFSDFAPTLRLRQLIPAVDYSAGIETYPL  132



>ref|XP_008461189.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Cucumis 
melo]
Length=150

 Score =   103 bits (258),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I +K++TMV PA+ TP + LW SNVDLVV  +H   VYFYRP G+ NFFD + +KE LS+
Sbjct  3    ITVKDSTMVTPAEETPHRSLWNSNVDLVVPSMHTPSVYFYRPTGASNFFDVEVLKEGLSK  62

Query  384  VLVSFYPMAGRMGRDGDG  437
             LV FYPMAGR+ RD DG
Sbjct  63   ALVPFYPMAGRLRRDEDG  80


 Score = 56.2 bits (134),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 32/55 (58%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI CN EG L V A +     DFGDF P L L  L+P+   SG   S+PL
Sbjct  78   EDGRIEIYCNAEGVLLVEAETTAVIDDFGDFAPTLQLRQLIPAVDYSGGIESYPL  132



>ref|NP_001280198.1| shikimate O-hydroxycinnamoyltransferase-like [Prunus mume]
 dbj|BAE48668.1| Alcohol acyl-transferase [Prunus mume]
Length=438

 Score =   103 bits (257),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 59/83 (71%), Gaps = 3/83 (4%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPN---GSPNFFDPKAMK  368
            + + ++ETT+VKPA  TP K LW SNVDLV+  IH   VYFYRPN    S NFFDP  +K
Sbjct  3    VNVSVRETTLVKPAAETPRKALWNSNVDLVIPSIHTPSVYFYRPNQNGASSNFFDPAVLK  62

Query  369  EALSRVLVSFYPMAGRMGRDGDG  437
             ALS+ LV FYPMAGR+ RD DG
Sbjct  63   LALSKALVPFYPMAGRLKRDDDG  85


 Score = 56.2 bits (134),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            GR+EI+CNGEG LFV A +     DFGDF P L L  L+P+   S   SS+ L
Sbjct  85   GRIEIDCNGEGVLFVEAETSSVIDDFGDFAPTLELRRLIPAVDYSAGISSYAL  137



>ref|XP_003637275.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Medicago truncatula]
Length=432

 Score =   106 bits (265),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I +KE+ +V+PA+ TP K LW SNVDLVV   H   VYFYRPNG+ NFFD K MKEALS+
Sbjct  3    INVKESMVVRPAEETPRKALWNSNVDLVVPNFHTPSVYFYRPNGTSNFFDAKIMKEALSK  62

Query  384  VLVSFYPMAGRMGRDGDG  437
            VLV FYPMA R+ RD DG
Sbjct  63   VLVLFYPMAARLRRDEDG  80


 Score = 52.8 bits (125),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 33/55 (60%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+E+ C+G+G LFV A +     DFGDF P L L  L+P+   S    ++PL
Sbjct  78   EDGRIELYCDGQGVLFVDADTTASVDDFGDFAPTLRLRQLIPAVDYSAGIETYPL  132



>ref|XP_006493385.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Citrus 
sinensis]
Length=430

 Score =   103 bits (256),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I +KE+TMV+PA  TP   LW +NVDLVV R H   VYFYRP G+ NFFD   +K+ALS+
Sbjct  3    INLKESTMVRPAAETPRVALWNANVDLVVPRFHTPSVYFYRPTGAANFFDAGVLKDALSK  62

Query  384  VLVSFYPMAGRMGRDGDG  437
             LV FYPMAGR+ RD DG
Sbjct  63   ALVPFYPMAGRLKRDDDG  80


 Score = 56.6 bits (135),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            GR+EI+CN EG L V A +     DFGDF P L L  L+P+   SG  S++PL
Sbjct  80   GRIEIDCNAEGVLLVEAETTSLIDDFGDFAPTLELKQLIPTIDYSGGISTYPL  132



>gb|KEH39662.1| shikimate/quinate hydroxycinnamoyltransferase [Medicago truncatula]
Length=432

 Score =   106 bits (265),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I +KE+ +V+PA+ TP K LW SNVDLVV   H   VYFYRPNG+ NFFD K MKEALS+
Sbjct  3    INVKESMVVRPAEETPRKALWNSNVDLVVPNFHTPSVYFYRPNGTSNFFDAKIMKEALSK  62

Query  384  VLVSFYPMAGRMGRDGDG  437
            VLV FYPMA R+ RD DG
Sbjct  63   VLVLFYPMAARLRRDEDG  80


 Score = 52.8 bits (125),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 33/55 (60%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+E+ C+G+G LFV A +     DFGDF P L L  L+P+   S    ++PL
Sbjct  78   EDGRIELYCDGQGVLFVDADTTASVDDFGDFAPTLRLRQLIPAVDYSAGIETYPL  132



>gb|ACA64049.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Salvia miltiorrhiza]
Length=427

 Score = 99.8 bits (247),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            ++I +K++T+V+P+  TP+  LW SNVDLVV   H   VYFYRP+G+  FFD  AMK AL
Sbjct  1    MKIDVKDSTLVRPSAATPAVNLWNSNVDLVVPNFHTPSVYFYRPSGAAGFFDTAAMKAAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
             R LV FYPMAGR+ RD DG
Sbjct  61   GRALVPFYPMAGRLKRDEDG  80


 Score = 58.9 bits (141),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI CN EG LFV A SD    D+GDF P L L  L+P+   S   S++PL
Sbjct  78   EDGRIEINCNAEGVLFVEAESDGSVDDYGDFAPTLELRRLIPAVDYSQEISAYPL  132



>gb|AGA20364.1| hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyl transferase 
[Leucaena leucocephala]
Length=439

 Score =   102 bits (254),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I +K +TMV+PA+ TP + LW SNVDLVV   H   VYFYRP G+ NFFD + MK+AL++
Sbjct  3    INVKASTMVRPAEETPRRALWNSNVDLVVPNFHTPSVYFYRPTGAANFFDAEVMKQALAK  62

Query  384  VLVSFYPMAGRMGRDGDG  437
             LV FYPMAGR+ RD DG
Sbjct  63   ALVPFYPMAGRLRRDEDG  80


 Score = 56.2 bits (134),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+CNGEG L V A +     DFGDF P L L  L+P+   SG   ++PL
Sbjct  78   EDGRVEIDCNGEGVLLVEAETIGVIDDFGDFAPTLELRQLIPAVDYSGGIETYPL  132



>gb|ADG46003.1| hydroxycinnamoyl transferase [Salvia miltiorrhiza]
Length=427

 Score = 99.8 bits (247),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            ++I +K++T+V+P+  TP+  LW SNVDLVV   H   VYFYRP+G+  FFD  AMK AL
Sbjct  1    MKIDVKDSTLVRPSAATPAVNLWNSNVDLVVPNFHTPSVYFYRPSGAAGFFDTAAMKAAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
             R LV FYPMAGR+ RD DG
Sbjct  61   GRALVPFYPMAGRLKRDEDG  80


 Score = 58.9 bits (141),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI CN EG LFV A SD    D+GDF P L L  L+P+   S   S++PL
Sbjct  78   EDGRIEINCNAEGVLFVEAESDGSVDDYGDFAPTLELRRLIPAVDYSQEISAYPL  132



>ref|XP_010500346.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=472

 Score =   105 bits (262),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 63/95 (66%), Gaps = 0/95 (0%)
 Frame = +3

Query  153  HKKDYCFNTNMASEKLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPN  332
            H     F  N     ++I I+++T+++PA  TP   LW SNVDL++ R H   VYFYRP 
Sbjct  27   HSIKLFFACNNPYATMKINIRDSTIIRPAAETPVTNLWNSNVDLIIPRFHTPSVYFYRPT  86

Query  333  GSPNFFDPKAMKEALSRVLVSFYPMAGRMGRDGDG  437
            G  NFFDP+ +K+ALS+ LV FYP+AGR+ RD DG
Sbjct  87   GVSNFFDPQVLKDALSKALVPFYPIAGRLKRDNDG  121


 Score = 53.1 bits (126),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 30/53 (57%), Gaps = 0/53 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            GR+EI+CNG G LFV A +     D GDF P L L  L+P    S    +FPL
Sbjct  121  GRIEIDCNGAGVLFVVADTPSVIDDLGDFAPSLTLRQLIPDVDYSAGVHTFPL  173



>ref|XP_003531748.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
1 [Glycine max]
 ref|XP_003531749.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
2 [Glycine max]
Length=429

 Score =   103 bits (258),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            + I +KE+TMV+PA+    + +W SNVDLVV   H   VYFYR NG+PNFFD K MKEAL
Sbjct  1    MMINVKESTMVRPAEEVARRVVWNSNVDLVVPNFHTPSVYFYRSNGAPNFFDGKVMKEAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            ++VLV FYPMAGR+ RD DG
Sbjct  61   TKVLVPFYPMAGRLLRDDDG  80


 Score = 54.7 bits (130),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            GR+EI+C+G+G LFV A +     DFGDF P L L  L+P+   S   +S+PL
Sbjct  80   GRVEIDCDGQGVLFVEADTGAVIDDFGDFAPTLELRQLIPAVDYSQGIASYPL  132



>ref|XP_008342823.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Malus 
domestica]
Length=438

 Score =   103 bits (258),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 60/82 (73%), Gaps = 2/82 (2%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYR--PNGSPNFFDPKAMKE  371
            + + ++E+T+VKPA+ TP K LW  NVDLV+  IH   VYFYR  PNG+ NFFDP  +K 
Sbjct  3    VNVTVRESTLVKPAEETPKKALWNXNVDLVIPSIHTPSVYFYRXNPNGASNFFDPAVLKH  62

Query  372  ALSRVLVSFYPMAGRMGRDGDG  437
            ALS+ LV FYPMAGR+ RD DG
Sbjct  63   ALSKALVPFYPMAGRLKRDDDG  84


 Score = 54.3 bits (129),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            GR+EI+C G+G LFV A +     DFGDF P L L  L+PS   +   S++PL
Sbjct  84   GRIEIDCGGQGVLFVEAETGSVIDDFGDFAPTLELRRLIPSVDYAAGISTYPL  136



>ref|XP_011073311.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Sesamum indicum]
Length=433

 Score = 98.2 bits (243),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            ++I +KE+ +V PA  TP   LW SNVDLVV  IH+  VYFY P G+ NFFDP  +K AL
Sbjct  1    MKIYVKESALVLPAAVTPCVTLWNSNVDLVVCNIHIPTVYFYGPTGAVNFFDPAVLKAAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
             R LV FYP+AGR+ RD DG
Sbjct  61   GRALVPFYPVAGRLKRDKDG  80


 Score = 59.7 bits (143),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPLA  597
            GR+EI+CN EG LFV A SD    DFGDF P L L  L+P    S   S+FPL 
Sbjct  80   GRIEIDCNAEGVLFVEAESDAVVDDFGDFAPTLELRRLIPPVDYSQGISTFPLV  133



>ref|XP_006826688.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Amborella 
trichopoda]
 gb|ERM93925.1| hypothetical protein AMTR_s00137p00072760 [Amborella trichopoda]
Length=455

 Score = 97.4 bits (241),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = +3

Query  189  SEKLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMK  368
            S ++ I +K++++V+P   TP  ++W SN DLVV R+H+ ++YF+R NG+PNFF+   +K
Sbjct  19   STEMIITVKQSSLVRPNAETPVLEMWISNADLVVPRMHVPLLYFFRSNGAPNFFESDLLK  78

Query  369  EALSRVLVSFYPMAGRMGRDGDG  437
            E+LSR LVSFYP+AGR+ RD  G
Sbjct  79   ESLSRALVSFYPLAGRLKRDRRG  101


 Score = 60.5 bits (145),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPLA  597
            GR+EI+CN EGALFV A SD    DFGDF P + L  L P    +   SSFPL 
Sbjct  101  GRIEIDCNAEGALFVEAYSDTAIDDFGDFAPTMELKRLAPKVDYTEDISSFPLV  154



>ref|XP_007135841.1| hypothetical protein PHAVU_010G162700g [Phaseolus vulgaris]
 gb|ESW07835.1| hypothetical protein PHAVU_010G162700g [Phaseolus vulgaris]
Length=433

 Score =   103 bits (258),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I +KE+TMV+PA+    + LW SNVDLVV   H   VYFYRPNG+ NFFD   +KEALSR
Sbjct  3    ITVKESTMVRPAEELHRRLLWNSNVDLVVPNFHTPSVYFYRPNGASNFFDGNILKEALSR  62

Query  384  VLVSFYPMAGRMGRDGDG  437
            VLV FYPMAGR+ RD DG
Sbjct  63   VLVPFYPMAGRLRRDEDG  80


 Score = 53.9 bits (128),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+C+G+G LFV A +     DFGDF P L L  L+P+   S    ++PL
Sbjct  78   EDGRVEIDCDGQGVLFVEADTGAVVDDFGDFAPTLELRQLIPAVDYSQGIETYPL  132



>ref|XP_006307576.1| hypothetical protein CARUB_v10009198mg [Capsella rubella]
 gb|EOA40474.1| hypothetical protein CARUB_v10009198mg [Capsella rubella]
Length=431

 Score =   105 bits (262),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I I+++TMV+PA  TP   LW SNVDL++ R H   VYFYRP G+ NFFDP+ +K+ALS+
Sbjct  3    INIRDSTMVRPAAETPITNLWNSNVDLIIPRFHTPSVYFYRPTGASNFFDPQLLKDALSK  62

Query  384  VLVSFYPMAGRMGRDGDG  437
             LV FYPMAGR+ RD DG
Sbjct  63   ALVPFYPMAGRLKRDDDG  80


 Score = 52.0 bits (123),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 30/53 (57%), Gaps = 0/53 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            GR+E++CN  G LFV A +     DFGDF P L L  L+P    S    +FPL
Sbjct  80   GRIELDCNAAGVLFVVADTPSVIDDFGDFAPTLTLRQLIPQVDYSAGVHTFPL  132



>gb|AGV54440.1| shikimate O-hydroxycinnamoyltransferase [Phaseolus vulgaris]
Length=433

 Score =   103 bits (258),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I +KE+TMV+PA+    + LW SNVDLVV   H   VYFYRPNG+ NFFD   +KEALSR
Sbjct  3    ITVKESTMVRPAEELHRRLLWNSNVDLVVPNFHTPSVYFYRPNGASNFFDGNILKEALSR  62

Query  384  VLVSFYPMAGRMGRDGDG  437
            VLV FYPMAGR+ RD DG
Sbjct  63   VLVPFYPMAGRLRRDEDG  80


 Score = 53.9 bits (128),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+C+G+G LFV A +     DFGDF P L L  L+P+   S    ++PL
Sbjct  78   EDGRVEIDCDGQGVLFVEADTGAVIDDFGDFAPTLELRQLIPAVDYSQGIETYPL  132



>ref|XP_010113235.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
 gb|EXC76036.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
Length=439

 Score = 96.3 bits (238),  Expect(2) = 9e-30, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 62/82 (76%), Gaps = 2/82 (2%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNG--SPNFFDPKAMKE  371
            ++I +K+ T+VKPA+ TP + +W SN+DLVV  +H   VYFYRP G  S +FF+ + +KE
Sbjct  1    MKIIVKKRTIVKPAEETPRRSIWNSNLDLVVSNMHTPSVYFYRPAGSNSDHFFNAEVLKE  60

Query  372  ALSRVLVSFYPMAGRMGRDGDG  437
            AL+RVLV+FYP+AGR+ RD  G
Sbjct  61   ALARVLVTFYPVAGRLSRDASG  82


 Score = 61.2 bits (147),  Expect(2) = 9e-30, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPLAXF  603
            GR+EI+CN EG LFV A +     DFGDF P   L  L+P+   SG  SS+PLA F
Sbjct  82   GRIEIDCNAEGVLFVEAETSSVIDDFGDFAPTPQLKALIPAVDLSGGISSYPLAVF  137



>ref|XP_010063596.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010063597.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 gb|KCW70836.1| hypothetical protein EUGRSUZ_F03978 [Eucalyptus grandis]
Length=454

 Score = 97.4 bits (241),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 59/81 (73%), Gaps = 0/81 (0%)
 Frame = +3

Query  195  KLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEA  374
            ++ I +K +T+V PA+ TP   LW +NVDLVV  +H   VYFYRP GS +FFD + +KEA
Sbjct  7    RMIINVKGSTVVCPAEDTPRCTLWNANVDLVVPSMHTPSVYFYRPTGSDDFFDSRVLKEA  66

Query  375  LSRVLVSFYPMAGRMGRDGDG  437
            LSR LV FYPMAGR+ RD DG
Sbjct  67   LSRALVLFYPMAGRLKRDEDG  87


 Score = 59.7 bits (143),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+CN EG LFV A +     DFGDF P L L  L+P+   SG  SS+P+
Sbjct  85   EDGRIEIDCNAEGVLFVEAETSSVINDFGDFAPTLELRKLIPAVDYSGGISSYPV  139



>ref|XP_007150819.1| hypothetical protein PHAVU_005G183200g [Phaseolus vulgaris]
 gb|ESW22813.1| hypothetical protein PHAVU_005G183200g [Phaseolus vulgaris]
Length=456

 Score =   104 bits (260),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 63/89 (71%), Gaps = 0/89 (0%)
 Frame = +3

Query  171  FNTNMASEKLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFF  350
            ++ ++   K+ I IK++TMV+PA+ TP + LW SNVDLVV   H   VYFYRP+G+ NFF
Sbjct  13   YHCDLEGRKMIINIKQSTMVRPAEETPRRPLWNSNVDLVVPNFHTPSVYFYRPSGASNFF  72

Query  351  DPKAMKEALSRVLVSFYPMAGRMGRDGDG  437
            D   MK ALS+ LV FYPMA R+ RD DG
Sbjct  73   DTAVMKAALSKALVPFYPMAARLRRDDDG  101


 Score = 52.4 bits (124),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            GR+EI C+G+G LFV A +     DFGDF+P L L  L+P+   S    ++PL
Sbjct  101  GRIEIFCDGQGVLFVEADTTAAIDDFGDFSPSLELRQLIPAVDYSAGIETYPL  153



>ref|XP_009626780.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X1 [Nicotiana tomentosiformis]
Length=439

 Score =   101 bits (251),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 58/81 (72%), Gaps = 1/81 (1%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP-NGSPNFFDPKAMKEA  374
            ++I +KE TMVKPA  TP   LW SNVDLVV   H   VYFYRP +G+ NFFD   +KEA
Sbjct  8    MKIVVKELTMVKPATDTPQTNLWNSNVDLVVPNFHTPSVYFYRPLSGASNFFDSNVLKEA  67

Query  375  LSRVLVSFYPMAGRMGRDGDG  437
            LS+ LV FYPMAGR+ +D DG
Sbjct  68   LSKALVPFYPMAGRLKKDEDG  88


 Score = 55.5 bits (132),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 33/55 (60%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EIEC G+G LFV A SD    DFGDF P L L  L+P+   +    S+ L
Sbjct  86   EDGRIEIECRGQGVLFVEAESDGTVDDFGDFAPTLELRRLIPAVDYTQGIHSYAL  140



>ref|NP_001289240.1| shikimate O-hydroxycinnamoyltransferase-like [Pyrus x bretschneideri]
 gb|AFF57841.1| hydroxycinnamoyl-coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
3 [Pyrus x bretschneideri]
Length=438

 Score =   102 bits (254),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 60/82 (73%), Gaps = 2/82 (2%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYR--PNGSPNFFDPKAMKE  371
            + + ++E+T+VKPA+ TP K LW SNVDLV+  IH   VYFYR  PNG+ NFFD   +K 
Sbjct  3    VNVTVRESTLVKPAEETPKKALWNSNVDLVIPSIHTPSVYFYRPNPNGTSNFFDAAVLKH  62

Query  372  ALSRVLVSFYPMAGRMGRDGDG  437
            ALS+ LV FYPMAGR+ RD DG
Sbjct  63   ALSKALVPFYPMAGRLKRDDDG  84


 Score = 54.3 bits (129),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            GR+EI+C G+G LFV A +     DFGDF P L L  L+PS   +   S++PL
Sbjct  84   GRIEIDCGGQGVLFVEAETGSVIDDFGDFAPTLELRKLIPSVDYAAGISTYPL  136



>ref|XP_009626781.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Nicotiana tomentosiformis]
Length=432

 Score =   100 bits (250),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 58/81 (72%), Gaps = 1/81 (1%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP-NGSPNFFDPKAMKEA  374
            ++I +KE TMVKPA  TP   LW SNVDLVV   H   VYFYRP +G+ NFFD   +KEA
Sbjct  1    MKIVVKELTMVKPATDTPQTNLWNSNVDLVVPNFHTPSVYFYRPLSGASNFFDSNVLKEA  60

Query  375  LSRVLVSFYPMAGRMGRDGDG  437
            LS+ LV FYPMAGR+ +D DG
Sbjct  61   LSKALVPFYPMAGRLKKDEDG  81


 Score = 55.8 bits (133),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 33/55 (60%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EIEC G+G LFV A SD    DFGDF P L L  L+P+   +    S+ L
Sbjct  79   EDGRIEIECRGQGVLFVEAESDGTVDDFGDFAPTLELRRLIPAVDYTQGIHSYAL  133



>ref|XP_006583082.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Glycine max]
Length=465

 Score =   102 bits (255),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 63/90 (70%), Gaps = 0/90 (0%)
 Frame = +3

Query  168  CFNTNMASEKLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNF  347
            C     +S ++ I +KE+T+V+PA+    + +W SNVDLVV   H   VYFYR NG+ NF
Sbjct  18   CLLCEQSSREMIINVKESTVVRPAEEVARRVVWNSNVDLVVPNFHTPSVYFYRSNGTSNF  77

Query  348  FDPKAMKEALSRVLVSFYPMAGRMGRDGDG  437
            FD K +KEALS+VLV FYPMAGR+ RD DG
Sbjct  78   FDGKVLKEALSKVLVPFYPMAGRLRRDEDG  107


 Score = 53.9 bits (128),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+C+G+G LFV A +     DFGDF P L L  L+P+   S    ++PL
Sbjct  105  EDGRVEIDCDGQGVLFVEADTGAVIDDFGDFAPTLELRQLIPAVDYSQGIETYPL  159



>ref|XP_007215401.1| hypothetical protein PRUPE_ppa005910mg [Prunus persica]
 gb|EMJ16600.1| hypothetical protein PRUPE_ppa005910mg [Prunus persica]
Length=438

 Score =   100 bits (248),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 58/83 (70%), Gaps = 3/83 (4%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNG---SPNFFDPKAMK  368
            + + ++E+T+V+PA  TP   LW SNVDLV+  IH   VYFYRPN    S NFFDP  +K
Sbjct  3    VNVSVRESTLVRPAAETPKHALWNSNVDLVIPSIHTPSVYFYRPNQNGVSSNFFDPAVLK  62

Query  369  EALSRVLVSFYPMAGRMGRDGDG  437
             ALS+ LV FYPMAGR+ RD DG
Sbjct  63   HALSKALVPFYPMAGRLKRDDDG  85


 Score = 56.2 bits (134),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            GR+EI+CNGEG LFV A +     DFGDF P L L  L+P+   S   SS+ L
Sbjct  85   GRIEIDCNGEGVLFVEAETSSVIDDFGDFAPTLELRRLIPAVDYSAGISSYAL  137



>gb|AHK05938.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
[Caragana korshinskii]
Length=434

 Score =   100 bits (250),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I ++E+TMV+P++    + LW SNVDLVV   H   VYFYR NG+ NFFD K +KEALS+
Sbjct  3    INVRESTMVRPSEEVARRTLWNSNVDLVVPNFHTPSVYFYRANGASNFFDAKVLKEALSK  62

Query  384  VLVSFYPMAGRMGRDGDG  437
            VLV FYPMAGR+ RD DG
Sbjct  63   VLVPFYPMAGRLRRDDDG  80


 Score = 55.5 bits (132),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            GR+EI+C+G+G LFV A +     DFGDF P L L  L+P+   SG   ++PL
Sbjct  80   GRVEIDCDGQGVLFVEADTGAVIDDFGDFAPTLHLRQLIPAVDYSGGIETYPL  132



>ref|XP_011082506.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Sesamum indicum]
Length=432

 Score = 96.3 bits (238),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 55/80 (69%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            ++I +K++T+V+PA  TP   LW SN+DLVV   H   VYFYRP  + NFFD   +K AL
Sbjct  1    MKINVKDSTLVRPAAATPMVSLWNSNIDLVVPNFHTPSVYFYRPTAADNFFDAGVLKAAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
             R LV FYPMAGR+ RD DG
Sbjct  61   GRALVPFYPMAGRLKRDEDG  80


 Score = 60.1 bits (144),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+CN EG LFV A SD    DFGDF P L L  L+P+   S   S++PL
Sbjct  78   EDGRVEIDCNAEGVLFVEAESDGVVDDFGDFAPTLELRRLIPAVDYSQGISTYPL  132



>ref|XP_012071524.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Jatropha 
curcas]
 gb|KDP38692.1| hypothetical protein JCGZ_04045 [Jatropha curcas]
Length=437

 Score =   102 bits (255),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = +3

Query  183  MASEKLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKA  362
            MA ++++I +KE+++V PAK TP   +W SN+DL+V  IH+  VYFY+PNG+ NFFD + 
Sbjct  1    MALKEMKISVKESSIVLPAKDTPRTSIWTSNLDLLVPTIHIPTVYFYKPNGASNFFDSEV  60

Query  363  MKEALSRVLVSFYPMAGRMGRDGDG  437
            +K+ALS VLV FYP+AGR+  D +G
Sbjct  61   LKKALSHVLVPFYPLAGRLRTDKNG  85


 Score = 53.1 bits (126),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 35/55 (64%), Gaps = 2/55 (4%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSX--XTSGXXSSFPL  594
            GR++IECN +G LFV A +     DFGDFTP L +  L+P+    +S   SS+PL
Sbjct  85   GRIDIECNAKGVLFVEAETGSVIDDFGDFTPSLKMMQLVPTMDGYSSEDISSYPL  139



>gb|ADL62854.1| hydroxycinnamoyl-CoA transferase 1 [Cynara cardunculus var. scolymus]
Length=443

 Score =   104 bits (259),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 62/79 (78%), Gaps = 2/79 (3%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPS--KKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKE  371
            + I I ++++V P++      K+LW SN+DLVVGRIH+L VYFYRPNGS  FFDP  MK+
Sbjct  9    MNIDIMKSSIVPPSELIADCPKQLWTSNLDLVVGRIHILTVYFYRPNGSSKFFDPNVMKK  68

Query  372  ALSRVLVSFYPMAGRMGRD  428
            AL+ VLVSFYPMAGR+GRD
Sbjct  69   ALADVLVSFYPMAGRLGRD  87


 Score = 51.2 bits (121),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 29/55 (53%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E  R+ I CN EG LFV A SD    DFG+  P      L PS   SG  SS+PL
Sbjct  88   ETDRIVINCNNEGVLFVEAESDSTLDDFGELKPSPVFRQLTPSVDYSGDISSYPL  142



>gb|KFK35521.1| hypothetical protein AALP_AA4G001700 [Arabis alpina]
Length=424

 Score =   102 bits (254),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = +3

Query  225  MVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSRVLVSFYP  404
            MV+PA  TPS  LW SNVDLV+ R H   VYFYRP G  NFFDP+ MK+ALS+ LV FYP
Sbjct  1    MVRPASETPSTYLWNSNVDLVIPRFHTPSVYFYRPTGGSNFFDPQVMKDALSKALVPFYP  60

Query  405  MAGRMGRDGDG  437
            MAGR+ RD DG
Sbjct  61   MAGRLKRDDDG  71


 Score = 53.1 bits (126),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 30/53 (57%), Gaps = 0/53 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            GR+EI+CN  G LFV A +     DFGDF P L L  L+P    S    SFPL
Sbjct  71   GRIEIDCNAAGVLFVVADTPSVIDDFGDFAPTLTLRQLIPEVDHSPGIHSFPL  123



>gb|ACJ23164.1| hydroxycinnamoyl CoA quinate transferase 2 [Cynara cardunculus 
var. scolymus]
Length=443

 Score =   104 bits (259),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 62/79 (78%), Gaps = 2/79 (3%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPS--KKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKE  371
            + I I ++++V P++      K+LW SN+DLVVGRIH+L VYFYRPNGS  FFDP  MK+
Sbjct  9    MNIDIMKSSIVPPSELIADCPKQLWTSNLDLVVGRIHILTVYFYRPNGSSKFFDPNVMKK  68

Query  372  ALSRVLVSFYPMAGRMGRD  428
            AL+ VLVSFYPMAGR+GRD
Sbjct  69   ALADVLVSFYPMAGRLGRD  87


 Score = 50.8 bits (120),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 29/55 (53%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E  R+ I CN EG LFV A SD    DFG+  P      L PS   SG  SS+PL
Sbjct  88   ETDRIVINCNNEGVLFVEAESDSTLDDFGELKPSPEFRQLTPSVDYSGDISSYPL  142



>ref|XP_006583083.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X3 [Glycine max]
Length=462

 Score =   101 bits (252),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 63/85 (74%), Gaps = 0/85 (0%)
 Frame = +3

Query  183  MASEKLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKA  362
            ++S ++ I +KE+T+V+PA+    + +W SNVDLVV   H   VYFYR NG+ NFFD K 
Sbjct  20   LSSREMIINVKESTVVRPAEEVARRVVWNSNVDLVVPNFHTPSVYFYRSNGTSNFFDGKV  79

Query  363  MKEALSRVLVSFYPMAGRMGRDGDG  437
            +KEALS+VLV FYPMAGR+ RD DG
Sbjct  80   LKEALSKVLVPFYPMAGRLRRDEDG  104


 Score = 53.9 bits (128),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+C+G+G LFV A +     DFGDF P L L  L+P+   S    ++PL
Sbjct  102  EDGRVEIDCDGQGVLFVEADTGAVIDDFGDFAPTLELRQLIPAVDYSQGIETYPL  156



>ref|XP_007011895.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 ref|XP_007011896.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOY29514.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOY29515.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
Length=449

 Score =   100 bits (248),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 64/81 (79%), Gaps = 1/81 (1%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYF-YRPNGSPNFFDPKAMKEA  374
            ++I I  +TMV+PA+ TP+++LW SN+DLV+ R H+ +VYF Y+ +GS NFFD + +KE+
Sbjct  1    MKITINGSTMVRPARDTPNRRLWNSNLDLVISRYHVALVYFFYKSDGSSNFFDTQLLKES  60

Query  375  LSRVLVSFYPMAGRMGRDGDG  437
            LS +LV FYPMAGR+G D +G
Sbjct  61   LSNLLVPFYPMAGRLGYDENG  81


 Score = 55.1 bits (131),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 32/56 (57%), Gaps = 0/56 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPLA  597
            E GRLEI CN EG LF+ + +     D GDF P   L  L+P+   SG  SSFPL 
Sbjct  79   ENGRLEIVCNAEGVLFIESETAATLDDLGDFAPSSKLRQLVPTVDYSGDISSFPLV  134



>ref|XP_009760608.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
sylvestris]
 ref|XP_009760609.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
sylvestris]
Length=432

 Score = 99.8 bits (247),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 58/81 (72%), Gaps = 1/81 (1%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP-NGSPNFFDPKAMKEA  374
            ++I +KE+TMVKPA  TP   LW SNVDLVV   H   VYFYRP + + NFFD   +KEA
Sbjct  1    MKIEVKESTMVKPATDTPQTNLWNSNVDLVVPNFHTPSVYFYRPLSSASNFFDSNMLKEA  60

Query  375  LSRVLVSFYPMAGRMGRDGDG  437
            LS+ LV FYPMAGR+ RD DG
Sbjct  61   LSKALVPFYPMAGRLKRDEDG  81


 Score = 55.5 bits (132),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 33/55 (60%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EIEC G+G LFV A SD    DFGDF P L L  L+P+   S    S+ L
Sbjct  79   EDGRIEIECIGQGVLFVEAESDGIVDDFGDFAPTLKLRRLIPAVDYSQGIHSYAL  133



>gb|KEH28560.1| shikimate/quinate hydroxycinnamoyltransferase [Medicago truncatula]
Length=433

 Score =   101 bits (252),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I ++++TMV+P++    + +W SNVDLVV   H   VYFYRPNG+ NFFD K +KEALS+
Sbjct  3    INVRDSTMVRPSEEVTQRTVWNSNVDLVVPNFHTPSVYFYRPNGASNFFDAKVLKEALSK  62

Query  384  VLVSFYPMAGRMGRDGDG  437
            VLV FYPMAGR+ RD DG
Sbjct  63   VLVPFYPMAGRLRRDEDG  80


 Score = 53.1 bits (126),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+C+G+G LFV A +     DFGDF P L L  L+P+   S    ++PL
Sbjct  78   EDGRVEIDCDGQGVLFVEADTGGVVDDFGDFAPTLELRQLIPAVDYSRGIETYPL  132



>ref|XP_009375480.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Pyrus 
x bretschneideri]
 ref|XP_009375481.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Pyrus 
x bretschneideri]
Length=438

 Score =   103 bits (256),  Expect(2) = 8e-29, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 59/82 (72%), Gaps = 2/82 (2%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP--NGSPNFFDPKAMKE  371
            + + ++E+TMVKPA+ TP K LW SNVDLV+  IH   VYFYRP  NG  NFFDP  +K 
Sbjct  3    VNVTVRESTMVKPAEETPKKALWNSNVDLVIPSIHTPSVYFYRPNQNGGSNFFDPAVLKH  62

Query  372  ALSRVLVSFYPMAGRMGRDGDG  437
            ALS+ LV FYPMAG + RD DG
Sbjct  63   ALSKALVPFYPMAGGLKRDDDG  84


 Score = 50.8 bits (120),  Expect(2) = 8e-29, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            GR+EI+C G+G LFV A +     DFGDF P L L  L+P+   S   S++ L
Sbjct  84   GRIEIDCGGQGVLFVEAETGSVLDDFGDFAPTLELRRLIPAVDYSAGVSTYAL  136



>ref|XP_010479238.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=428

 Score =   103 bits (257),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            ++I I+++T+V+PA  TP  KLW S+VDL+  + H   VYFYRP G+ NFFDP+ +K+AL
Sbjct  1    MKINIRDSTIVRPAAETPVTKLWNSHVDLIDAKYHTPTVYFYRPTGANNFFDPQVLKDAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            S+ LV+FYPMAGR+ +D DG
Sbjct  61   SKALVTFYPMAGRLKKDDDG  80


 Score = 50.1 bits (118),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 30/53 (57%), Gaps = 0/53 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            GR+EI+CNG G LFV A +     D GDF P L L  L+P+   S    + PL
Sbjct  80   GRIEIDCNGAGVLFVVADTPSAIDDLGDFAPSLTLCQLIPNVDYSVGVQTLPL  132



>emb|CDY22880.1| BnaA01g18180D [Brassica napus]
Length=428

 Score =   102 bits (253),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            ++I  +  TMV+PA  TPS  LW SNVDL++ R H   VYFYRPNG+ NFFDP  +KEAL
Sbjct  1    MKINTRNATMVRPAAETPSTYLWNSNVDLIIARYHSSSVYFYRPNGASNFFDPHVLKEAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            ++ LV FYP AG + RD +G
Sbjct  61   AKALVPFYPFAGSLRRDENG  80


 Score = 51.6 bits (122),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 31/55 (56%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+CN  GALF+ A +     D GDF P + L  L+P    S    +FPL
Sbjct  78   ENGRIEIDCNAAGALFIVADTPSVIDDLGDFAPSVNLSKLVPHVDYSPGIHTFPL  132



>gb|EYU24586.1| hypothetical protein MIMGU_mgv1a0064641mg, partial [Erythranthe 
guttata]
Length=269

 Score = 96.7 bits (239),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 55/80 (69%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            ++I +K + +V+PA  TP+  LW SNVDLVV   H   VYFYRP G+ +FFD   +K AL
Sbjct  1    MKIDVKRSALVRPAAATPAVSLWNSNVDLVVPNFHTPSVYFYRPTGAADFFDAAVLKAAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
             R LV FYPMAGR+ RD DG
Sbjct  61   GRALVPFYPMAGRLKRDEDG  80


 Score = 57.0 bits (136),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+CN EG LFV A SD    ++GDF P L L  L+P+   +   S++PL
Sbjct  78   EDGRIEIDCNAEGVLFVEAESDGQVDEYGDFAPTLELRRLIPAVDYTQGISTYPL  132



>dbj|BAF49306.1| putative acyltransferase [Clitoria ternatea]
Length=436

 Score = 99.4 bits (246),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I +KE+TMV+PA+    + +W SNVDLVV   H   VYFYR  G+ NFFD K MKEALS+
Sbjct  3    INVKESTMVRPAEEVARRVVWNSNVDLVVPNFHTPSVYFYRATGASNFFDAKIMKEALSK  62

Query  384  VLVSFYPMAGRMGRDGDG  437
            VLV FYPMAGR+ RD DG
Sbjct  63   VLVPFYPMAGRLRRDEDG  80


 Score = 53.9 bits (128),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+C+G+G LFV A +     DFGDF P L L  L+P+   S    ++PL
Sbjct  78   EDGRVEIDCDGQGVLFVEADTGAVIDDFGDFAPTLQLRQLIPAIDYSQGIETYPL  132



>ref|XP_009146509.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Brassica 
rapa]
Length=428

 Score =   102 bits (253),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            ++I  +  TMV+PA  TPS  LW SNVDL++ R H   VYFYRPNG+ NFFDP  +KEAL
Sbjct  1    MKINTRNATMVRPAAETPSTYLWNSNVDLIIARYHSSSVYFYRPNGASNFFDPHVLKEAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            ++ LV FYP AG + RD +G
Sbjct  61   AKALVPFYPFAGSLRRDENG  80


 Score = 51.6 bits (122),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 31/55 (56%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+CN  GALF+ A +     D GDF P + L  L+P    S    +FPL
Sbjct  78   ENGRIEIDCNAAGALFIVADTPSVIDDLGDFAPSVNLSKLVPHVDYSPGIHTFPL  132



>ref|XP_009789449.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Nicotiana 
sylvestris]
 ref|XP_009783860.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Nicotiana 
sylvestris]
Length=435

 Score =   114 bits (284),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            ++I +KE+TMVKPA  TP ++LW SNVDLVV   H   VYFYRP GSPNFFD K +KEAL
Sbjct  1    MKIEVKESTMVKPATETPQQRLWNSNVDLVVPNFHTPSVYFYRPTGSPNFFDGKVLKEAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            S+ LV FYPMAGR+ RD DG
Sbjct  61   SKALVPFYPMAGRLCRDEDG  80


 Score = 38.9 bits (89),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 32/55 (58%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+C G+G LFV A SD    DF DF P L L  L+P+   S    S+ L
Sbjct  78   EDGRIEIDCKGQGVLFVEAESDGVVDDFDDFAPTLELRQLIPAVDYSQGIQSYAL  132



>dbj|BAF49305.1| putative acyltransferase [Clitoria ternatea]
Length=433

 Score = 99.8 bits (247),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I +KE++MV+PA+ TP++ LW SNVDLVV   H   VYFY PNG+ +FF  K +K+ALS+
Sbjct  3    IKVKESSMVRPAEETPTRALWNSNVDLVVPNFHTPSVYFYTPNGASDFFHAKILKDALSK  62

Query  384  VLVSFYPMAGRMGRDGDG  437
             LV+FYPMA R+ RD DG
Sbjct  63   TLVTFYPMAARLRRDDDG  80


 Score = 53.1 bits (126),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            GR+EI C+G+G LFV A +     DFGDF P L L  L+PS   S    ++PL
Sbjct  80   GRVEIFCDGQGVLFVEAHTTASVDDFGDFAPTLELRQLIPSVDYSAGIETYPL  132



>gb|KHN04193.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=436

 Score = 98.6 bits (244),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I +KE+T+V+PA+    + +W SNVDLVV   H   VYFYR NG+ NFFD K +KEALS+
Sbjct  3    INVKESTVVRPAEEVARRVVWNSNVDLVVPNFHTPSVYFYRSNGTSNFFDGKVLKEALSK  62

Query  384  VLVSFYPMAGRMGRDGDG  437
            VLV FYPMAGR+ RD DG
Sbjct  63   VLVPFYPMAGRLRRDEDG  80


 Score = 53.9 bits (128),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+C+G+G LFV A +     DFGDF P L L  L+P+   S    ++PL
Sbjct  78   EDGRVEIDCDGQGVLFVEADTGAVIDDFGDFAPTLELRQLIPAVDYSQGIETYPL  132



>ref|XP_003530223.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X1 [Glycine max]
 ref|XP_006583084.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X4 [Glycine max]
Length=438

 Score = 98.6 bits (244),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I +KE+T+V+PA+    + +W SNVDLVV   H   VYFYR NG+ NFFD K +KEALS+
Sbjct  3    INVKESTVVRPAEEVARRVVWNSNVDLVVPNFHTPSVYFYRSNGTSNFFDGKVLKEALSK  62

Query  384  VLVSFYPMAGRMGRDGDG  437
            VLV FYPMAGR+ RD DG
Sbjct  63   VLVPFYPMAGRLRRDEDG  80


 Score = 53.9 bits (128),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+C+G+G LFV A +     DFGDF P L L  L+P+   S    ++PL
Sbjct  78   EDGRVEIDCDGQGVLFVEADTGAVIDDFGDFAPTLELRQLIPAVDYSQGIETYPL  132



>ref|XP_010481008.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=143

 Score =   102 bits (255),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            ++I I+++T+V+PA  TP  +LW S+VDL++ + H   VYFYRP G+ NFFDP+ +K+AL
Sbjct  1    MKINIRDSTIVRPAAETPVTELWNSHVDLIIAKYHSPTVYFYRPTGASNFFDPQVLKDAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            S+ LV FYPMAGR+ +D DG
Sbjct  61   SKALVPFYPMAGRLKKDDDG  80


 Score = 49.7 bits (117),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 30/53 (57%), Gaps = 0/53 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            GR+EI+CNG G LFV A +     D GDF P L L  L+P+   S    + PL
Sbjct  80   GRIEIDCNGAGVLFVFADTPSAIDDLGDFAPSLTLCQLIPNVDYSVGVQTLPL  132



>gb|EPS58183.1| hypothetical protein M569_16633, partial [Genlisea aurea]
Length=142

 Score = 94.4 bits (233),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 54/80 (68%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            ++I +  +TMV P+  TP   LW SNVDLVV   H   VYFYRP G+ +FFD + +K AL
Sbjct  1    MKIAVIGSTMVPPSSETPKVSLWNSNVDLVVPNFHTPSVYFYRPTGAADFFDAEVLKAAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
             R LV FYPMAGR+ RD DG
Sbjct  61   GRALVPFYPMAGRLKRDEDG  80


 Score = 57.8 bits (138),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+CNG G LFV A SD    DFGDF P L L  L+P+   S   S +PL
Sbjct  78   EDGRIEIDCNGAGVLFVEAESDGAVDDFGDFAPTLELRRLIPAVDYSLGISDYPL  132



>gb|AFR40280.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus alba]
 gb|AFR40285.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus alba]
Length=111

 Score =   110 bits (276),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I +KE+TMV+PA+ TP + LW SNVDLVV R H   VYFYRP G+PNFFD K +K ALS+
Sbjct  3    INVKESTMVQPAEETPRRGLWNSNVDLVVPRFHTPSVYFYRPTGAPNFFDAKVLKGALSK  62

Query  384  VLVSFYPMAGRMGRDGDG  437
             LV+FYPMAGR+ RD DG
Sbjct  63   ALVAFYPMAGRLRRDEDG  80


 Score = 41.2 bits (95),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 20/33 (61%), Gaps = 0/33 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTP  528
            E GR+EI CN EG LFV A +     DF DF P
Sbjct  78   EDGRIEINCNAEGVLFVEAETTSVIDDFADFAP  110



>emb|CAR92145.1| hydroxycinnamoyl CoA quinate transferase 2 [Cynara cardunculus 
var. scolymus]
Length=443

 Score =   104 bits (259),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 62/79 (78%), Gaps = 2/79 (3%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPS--KKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKE  371
            + I I ++++V P++      K+LW SN+DLVVGRIH+L VYFYRPNGS  FFDP  MK+
Sbjct  9    MNIDIMKSSIVPPSELIADCPKQLWTSNLDLVVGRIHILTVYFYRPNGSSKFFDPNVMKK  68

Query  372  ALSRVLVSFYPMAGRMGRD  428
            AL+ VLVSFYPMAGR+GRD
Sbjct  69   ALADVLVSFYPMAGRLGRD  87


 Score = 47.4 bits (111),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 28/55 (51%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E   + I CN EG LFV A SD    DFG+  P      L PS   SG  SS+PL
Sbjct  88   ETDGIVINCNNEGVLFVEAESDSTLDDFGELKPSPEFRQLTPSVDYSGDISSYPL  142



>ref|XP_006303767.1| hypothetical protein CARUB_v10011977mg [Capsella rubella]
 gb|EOA36665.1| hypothetical protein CARUB_v10011977mg [Capsella rubella]
Length=430

 Score =   100 bits (250),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            ++I I+++TMV+PA  TP   LW SNVDL++ + H   VYFYRP G  +FFDP+ +K+AL
Sbjct  1    MKIKIQDSTMVRPAAETPITSLWNSNVDLIMAKYHTPSVYFYRPTGDSSFFDPQVLKDAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            S+ LV FYP+AGR+ +D DG
Sbjct  61   SKALVPFYPVAGRLKKDDDG  80


 Score = 50.4 bits (119),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 30/53 (57%), Gaps = 0/53 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            GR+EI+CNG G LFV A +     DFGDF P   L  L+P    S    +FPL
Sbjct  80   GRIEIDCNGAGVLFVVADTPSAIDDFGDFAPTPTLGLLIPHVDYSIGVHTFPL  132



>gb|AFR40289.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
 gb|AFR40290.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
 gb|AFR40299.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40300.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40301.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40302.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40303.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40304.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40307.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40308.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40309.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40310.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40311.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40312.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40313.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
Length=111

 Score =   110 bits (275),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I +KE+TMV+PA+ TP + LW SNVDLVV R H   VYFYRP G+PNFFD K +K ALS+
Sbjct  3    INVKESTMVQPAEETPQRGLWNSNVDLVVPRFHTPSVYFYRPTGAPNFFDAKVLKGALSK  62

Query  384  VLVSFYPMAGRMGRDGDG  437
             LV FYPMAGR+ RD DG
Sbjct  63   ALVPFYPMAGRLRRDEDG  80


 Score = 41.2 bits (95),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 20/33 (61%), Gaps = 0/33 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTP  528
            E GR+EI CN EG LFV A +     DF DF P
Sbjct  78   EDGRIEINCNAEGVLFVEAETTSVIDDFADFAP  110



>emb|CDY44162.1| BnaC01g22120D [Brassica napus]
Length=428

 Score = 99.8 bits (247),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            ++I I+   MV+PA  TPS  LW SNVDL++ R H   VYFYR NG+ NFFDP+ +KEAL
Sbjct  1    MKINIRNAAMVRPAAETPSTYLWNSNVDLIIARYHSSSVYFYRSNGASNFFDPQVLKEAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            ++ LV FYP AG + RD +G
Sbjct  61   AKALVPFYPFAGSLRRDENG  80


 Score = 51.6 bits (122),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 31/55 (56%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+CN  GALF+ A +     D GDF P + L  L+P    S    +FPL
Sbjct  78   ENGRIEIDCNAAGALFIVADTPSVIDDLGDFAPSVNLSKLVPHVDYSPGIHTFPL  132



>gb|AFR40282.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus alba]
 gb|AFR40284.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus alba]
Length=111

 Score =   110 bits (274),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I +KE+TMV+PA+ TP + LW SNVDLVV R H   VYFYRP G+PNFFD K +K ALS+
Sbjct  3    INVKESTMVQPAEETPRRGLWNSNVDLVVPRFHTPSVYFYRPTGAPNFFDAKVLKGALSK  62

Query  384  VLVSFYPMAGRMGRDGDG  437
             LV FYPMAGR+ RD DG
Sbjct  63   ALVXFYPMAGRLRRDEDG  80


 Score = 41.2 bits (95),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 20/33 (61%), Gaps = 0/33 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTP  528
            E GR+EI CN EG LFV A +     DF DF P
Sbjct  78   EDGRIEINCNAEGVLFVEAETTSVIDDFADFAP  110



>gb|AFR40286.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
 gb|AFR40287.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
 gb|AFR40288.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
 gb|AFR40296.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
 gb|AFR40298.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
Length=111

 Score =   110 bits (274),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I +KE+TMV+PA+ TP + LW SNVDLVV R H   VYFYRP G+PNFFD K +K ALS+
Sbjct  3    INVKESTMVQPAEKTPQRGLWNSNVDLVVPRFHTPSVYFYRPTGAPNFFDAKVLKGALSK  62

Query  384  VLVSFYPMAGRMGRDGDG  437
             LV FYPMAGR+ RD DG
Sbjct  63   ALVPFYPMAGRLRRDEDG  80


 Score = 41.2 bits (95),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 20/33 (61%), Gaps = 0/33 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTP  528
            E GR+EI CN EG LFV A +     DF DF P
Sbjct  78   EDGRIEINCNAEGVLFVEAETTSVIDDFADFAP  110



>gb|AFR40293.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
 gb|AFR40297.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
Length=111

 Score =   110 bits (274),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I +KE+TMV+PA+ TP + LW SNVDLVV R H   VYFYRP G+PNFFD K +K ALS+
Sbjct  3    INVKESTMVQPAEXTPQRGLWNSNVDLVVPRFHTPSVYFYRPTGAPNFFDAKVLKGALSK  62

Query  384  VLVSFYPMAGRMGRDGDG  437
             LV FYPMAGR+ RD DG
Sbjct  63   ALVPFYPMAGRLRRDEDG  80


 Score = 41.2 bits (95),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 20/33 (61%), Gaps = 0/33 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTP  528
            E GR+EI CN EG LFV A +     DF DF P
Sbjct  78   EDGRIEINCNAEGVLFVEAETTSVIDDFADFAP  110



>ref|XP_002324534.1| hypothetical protein POPTR_0018s11450g [Populus trichocarpa]
 gb|EEF03099.1| hypothetical protein POPTR_0018s11450g [Populus trichocarpa]
Length=430

 Score = 97.4 bits (241),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            +++ +K++TMV+P++ TP++ LW SN+DL+V   H+  VYFY+PNGS  FF+ + +K+AL
Sbjct  1    MKVDVKQSTMVRPSRETPNRSLWSSNLDLLVPMFHVQTVYFYKPNGSSRFFETQVLKDAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            S VLV FYP AGRMG+   G
Sbjct  61   SDVLVPFYPAAGRMGKHESG  80


 Score = 53.5 bits (127),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 31/56 (55%), Gaps = 0/56 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPLA  597
            E GR EI CNGEG LFV A +     D GDFT    L  L+P    SG  SSFPL 
Sbjct  78   ESGRTEIHCNGEGILFVEAETSCFIDDLGDFTDSSKLLPLVPEVDYSGGISSFPLV  133



>gb|AFR40266.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40267.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40268.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40269.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40270.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40274.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40275.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40276.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40278.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40279.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus alba]
 gb|AFR40281.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus alba]
 gb|AFR40283.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus alba]
Length=111

 Score =   109 bits (273),  Expect(2) = 9e-28, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I +KE+TMV+PA+ TP + LW SNVDLVV R H   VYFYRP G+PNFFD K +K ALS+
Sbjct  3    INVKESTMVQPAEETPRRGLWNSNVDLVVPRFHTPSVYFYRPTGAPNFFDAKVLKGALSK  62

Query  384  VLVSFYPMAGRMGRDGDG  437
             LV FYPMAGR+ RD DG
Sbjct  63   ALVPFYPMAGRLRRDEDG  80


 Score = 41.2 bits (95),  Expect(2) = 9e-28, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 20/33 (61%), Gaps = 0/33 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTP  528
            E GR+EI CN EG LFV A +     DF DF P
Sbjct  78   EDGRIEINCNAEGVLFVEAETTSVIDDFADFAP  110



>ref|XP_010094061.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
 gb|EXB55151.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
Length=447

 Score =   101 bits (251),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            + I +KE+T+V+PA+ TP ++LW S++DLVV  +H   VYFYRP G+ NFFD   +K AL
Sbjct  14   IDINVKESTLVRPAEETPRRRLWNSSLDLVVPSVHTPSVYFYRPTGAANFFDVAVVKAAL  73

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            SR LV FYPMAGR+ RD DG
Sbjct  74   SRALVPFYPMAGRLRRDDDG  93


 Score = 49.3 bits (116),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 31/53 (58%), Gaps = 0/53 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            GR+EI+CN +G LFV A +     DFG+F P   L  L+PS   S   SS+ L
Sbjct  93   GRIEIDCNAKGVLFVVAETTSLIDDFGEFAPTPELRRLIPSVDYSAGISSYSL  145



>gb|AFR40277.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
Length=110

 Score =   109 bits (272),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I +KE+TMV+PA+ TP + LW SNVDLVV R H   VYFYRP G+PNFFD K +K ALS+
Sbjct  3    INVKESTMVQPAEETPRRGLWNSNVDLVVPRFHTPSVYFYRPTGAPNFFDAKVLKGALSK  62

Query  384  VLVSFYPMAGRMGRDGDG  437
             LV FYPMAGR+ RD DG
Sbjct  63   ALVPFYPMAGRLRRDEDG  80


 Score = 41.2 bits (95),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 20/33 (61%), Gaps = 0/33 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTP  528
            E GR+EI CN EG LFV A +     DF DF P
Sbjct  78   EDGRIEINCNAEGVLFVEAETTSVIDDFADFAP  110



>gb|ACI16630.1| shikimate O-hydroxycinnamoyltransferase [Trifolium pratense]
Length=434

 Score = 95.9 bits (237),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 58/79 (73%), Gaps = 1/79 (1%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPN-GSPNFFDPKAMKEALS  380
            I ++++TMV+P++    + LW SNVDLVV   H   VYFYR N G+ NFFD K MKEALS
Sbjct  3    INVRDSTMVRPSEEVTRRTLWNSNVDLVVPNFHTPSVYFYRSNNGTSNFFDAKIMKEALS  62

Query  381  RVLVSFYPMAGRMGRDGDG  437
            +VLV FYPMAGR+ RD DG
Sbjct  63   KVLVPFYPMAGRLRRDEDG  81


 Score = 54.7 bits (130),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+C+G+G LFV A +     DFGDF P L L  L+P+   S    S+PL
Sbjct  79   EDGRVEIDCDGQGVLFVEADTGAVIDDFGDFAPTLELRQLIPAVDYSRGIESYPL  133



>ref|XP_004507045.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X1 [Cicer arietinum]
Length=449

 Score = 94.7 bits (234),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = +3

Query  195  KLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEA  374
            ++ I ++++TMV+P+     + +W SNVDLVV   H   VYFYR N + NFFD K +KEA
Sbjct  13   EMIINVRDSTMVRPSDEVTRRTVWNSNVDLVVPNFHTPSVYFYRTNSASNFFDAKIIKEA  72

Query  375  LSRVLVSFYPMAGRMGRDGDG  437
            LS+VLV FYPMAGR+ RD DG
Sbjct  73   LSKVLVPFYPMAGRLRRDEDG  93


 Score = 55.8 bits (133),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+CNG+G LF+ A +     DFGDF P L L  L+P+   S    ++PL
Sbjct  91   EDGRVEIDCNGQGVLFIEADTGVVIDDFGDFAPTLKLRQLIPAVDYSQGIETYPL  145



>gb|ACI28534.1| shikimate O-hydroxycinnamoyl transferase [Trifolium pratense]
Length=434

 Score = 95.9 bits (237),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 58/79 (73%), Gaps = 1/79 (1%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPN-GSPNFFDPKAMKEALS  380
            I ++++TMV+P++    + LW SNVDLVV   H   VYFYR N G+ NFFD K MKEALS
Sbjct  3    INVRDSTMVRPSEEVTRRTLWNSNVDLVVPNFHTPSVYFYRSNNGTSNFFDAKIMKEALS  62

Query  381  RVLVSFYPMAGRMGRDGDG  437
            +VLV FYPMAGR+ RD DG
Sbjct  63   KVLVPFYPMAGRLRRDEDG  81


 Score = 54.7 bits (130),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+C+G+G LFV A +     DFGDF P L L  L+P+   S    S+PL
Sbjct  79   EDGRVEIDCDGQGVLFVEADTGAVIDDFGDFAPTLELRQLIPAVDYSRGIESYPL  133



>ref|XP_010479240.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=431

 Score =   102 bits (254),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            ++I I ++T+V+PA  TP+  LW S+VDL++ + H   VYFYRP G+ NFFDP+ +K+AL
Sbjct  1    MKINILDSTIVRPAAETPTTNLWNSHVDLIIAKYHTPSVYFYRPTGASNFFDPQVLKDAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            S+ LV FYPMAGR+ +D DG
Sbjct  61   SKALVPFYPMAGRLKKDNDG  80


 Score = 48.1 bits (113),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 29/53 (55%), Gaps = 0/53 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            GR+EI+CNG G LFV A +     D G+F P L L  L+P    S    + PL
Sbjct  80   GRIEIDCNGAGVLFVVADTPSVIDDLGEFAPSLTLRQLIPDVDYSVGVHTLPL  132



>gb|ABR14148.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Coffea arabica]
Length=84

 Score =   111 bits (277),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            ++I +KE+TMV+PA+ TP + LW SNVDLVV   H   VYFYRP GS NFFD K +K+AL
Sbjct  1    MKIKVKESTMVRPAQETPRRNLWNSNVDLVVPNFHTPSVYFYRPTGSSNFFDAKVLKDAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            SR LV FYPMAGR+ RD DG
Sbjct  61   SRALVPFYPMAGRLKRDEDG  80



>ref|XP_004507046.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Cicer arietinum]
Length=436

 Score = 94.7 bits (234),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I ++++TMV+P+     + +W SNVDLVV   H   VYFYR N + NFFD K +KEALS+
Sbjct  3    INVRDSTMVRPSDEVTRRTVWNSNVDLVVPNFHTPSVYFYRTNSASNFFDAKIIKEALSK  62

Query  384  VLVSFYPMAGRMGRDGDG  437
            VLV FYPMAGR+ RD DG
Sbjct  63   VLVPFYPMAGRLRRDEDG  80


 Score = 55.8 bits (133),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+CNG+G LF+ A +     DFGDF P L L  L+P+   S    ++PL
Sbjct  78   EDGRVEIDCNGQGVLFIEADTGVVIDDFGDFAPTLKLRQLIPAVDYSQGIETYPL  132



>gb|KJB68256.1| hypothetical protein B456_010G234800 [Gossypium raimondii]
Length=445

 Score = 99.0 bits (245),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            + + +K  +M++PA+ TP ++ W SN+D+V+   H+ +++FY+PNGS +FF P+ ++EAL
Sbjct  1    MDVSVKRWSMIRPAQDTPKERQWISNLDMVITTYHVPLLFFYKPNGSSDFFKPQVLQEAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            S+ LV FYPMAGR+GRD +G
Sbjct  61   SKTLVQFYPMAGRLGRDENG  80


 Score = 50.4 bits (119),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 31/55 (56%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GRLEI CN EG L++ A +     D   FTP   L  L+P+   SG  SS+PL
Sbjct  78   ENGRLEIVCNAEGVLWIEAETTSAMDDLDGFTPCSKLRKLVPTADYSGDISSYPL  132



>gb|KJB68255.1| hypothetical protein B456_010G234700, partial [Gossypium raimondii]
Length=463

 Score = 99.0 bits (245),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            + + +K  +M++PA+ TP ++ W SN+D+V+   HL +++FY+PNGS +FF P+ ++EAL
Sbjct  19   MDVSVKRWSMIRPAQDTPKERQWISNLDVVMTTYHLPLLFFYKPNGSSDFFKPQVLQEAL  78

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            S+ LV FYPMAGR+GRD +G
Sbjct  79   SKTLVQFYPMAGRLGRDENG  98


 Score = 50.4 bits (119),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 31/55 (56%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GRLEI CN EG L++ A +     D   FTP   L  L+P+   SG  SS+PL
Sbjct  96   ENGRLEIVCNAEGVLWIEAETTSAMDDLDGFTPCSKLRKLVPTADYSGDISSYPL  150



>ref|XP_010244666.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nelumbo 
nucifera]
 ref|XP_010244671.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nelumbo 
nucifera]
Length=440

 Score = 89.4 bits (220),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 57/82 (70%), Gaps = 1/82 (1%)
 Frame = +3

Query  195  KLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEA  374
            K+ I +KE+T V PA+PTP + LW SN D +V R H+  VYF+  +GS  FF+   +K+A
Sbjct  8    KMIINVKESTTVGPAEPTPERTLWISNADQLVRRAHIPTVYFFTSDGSTGFFNLHLLKQA  67

Query  375  LSRVLVSFYPMAGRMGR-DGDG  437
            LS+VLV FYP AGR+ R D DG
Sbjct  68   LSKVLVPFYPTAGRLNRNDQDG  89


 Score = 60.1 bits (144),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            GRLEI CNGEG LFV A ++    DFGDFTP   L  L+P+   S   SS+PL
Sbjct  89   GRLEINCNGEGVLFVEAETNSVIDDFGDFTPSPVLRQLIPAVDYSKDISSYPL  141



>ref|XP_007011894.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative [Theobroma cacao]
 gb|EOY29513.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative [Theobroma cacao]
Length=543

 Score = 95.9 bits (237),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            ++  I  +TMV+PA+ TP+++LW SN+DLV+ R H+  V FY+ + S NFFD + +KE+L
Sbjct  1    MKTTINGSTMVRPARDTPNRRLWNSNLDLVISRYHVTSVCFYKSDASSNFFDTQLLKESL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            S +LV FYPMAGR+G D +G
Sbjct  61   SNILVPFYPMAGRLGYDENG  80


 Score = 53.1 bits (126),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 31/56 (55%), Gaps = 0/56 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPLA  597
            E GRLEI CN EG  F+ A +     D GDF P   L  L+P+   SG  SSFPL 
Sbjct  78   ENGRLEIVCNAEGVSFIEAETATTIDDLGDFAPRSKLGQLVPTVDYSGDISSFPLV  133



>gb|KJB54946.1| hypothetical protein B456_009G055900 [Gossypium raimondii]
Length=445

 Score = 98.2 bits (243),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            + + +K +TM++PA+ TP ++ W SN+D+V+   H+ +++FY+PNGS +FF P+ +KEAL
Sbjct  1    MDVTVKGSTMIRPAQDTPKERQWISNLDMVMATYHVPLLFFYKPNGSSDFFKPQVLKEAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            S+ LV FYPMAGR+G D +G
Sbjct  61   SKTLVPFYPMAGRLGLDENG  80


 Score = 49.7 bits (117),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 31/56 (55%), Gaps = 0/56 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPLA  597
            E GRLEI CN EG L++ A +     D   FTP   L  L+P+   SG  SS+PL 
Sbjct  78   ENGRLEILCNAEGVLWIEAETTSAMDDLEGFTPSSELRKLVPTVDYSGDISSYPLV  133



>gb|AFR40295.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
Length=111

 Score =   107 bits (266),  Expect(2) = 6e-27, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I +KE+TMV+PA   P + LW SNVDLVV R H   VYFYRP G+PNFFD K +K ALS+
Sbjct  3    INVKESTMVQPAXXXPQRGLWNSNVDLVVPRFHTPSVYFYRPTGAPNFFDAKVLKGALSK  62

Query  384  VLVSFYPMAGRMGRDGDG  437
             LV FYPMAGR+ RD DG
Sbjct  63   ALVPFYPMAGRLRRDEDG  80


 Score = 41.2 bits (95),  Expect(2) = 6e-27, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 20/33 (61%), Gaps = 0/33 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTP  528
            E GR+EI CN EG LFV A +     DF DF P
Sbjct  78   EDGRIEINCNAEGVLFVEAETTSVIDDFADFAP  110



>gb|AFR40292.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
Length=102

 Score =   110 bits (274),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I +KE+TMV+PA+ TP + LW SNVDLVV R H   VYFYRP G+PNFFD K +K ALS+
Sbjct  3    INVKESTMVQPAEXTPQRGLWNSNVDLVVPRFHTPSVYFYRPTGAPNFFDAKVLKGALSK  62

Query  384  VLVSFYPMAGRMGRDGDG  437
             LV FYPMAGR+ RD DG
Sbjct  63   ALVPFYPMAGRLRRDEDG  80



>gb|AFR40294.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
Length=104

 Score =   110 bits (274),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I +KE+TMV+PA+ TP + LW SNVDLVV R H   VYFYRP G+PNFFD K +K ALS+
Sbjct  3    INVKESTMVQPAEKTPQRGLWNSNVDLVVPRFHTPSVYFYRPTGAPNFFDAKVLKGALSK  62

Query  384  VLVSFYPMAGRMGRDGDG  437
             LV FYPMAGR+ RD DG
Sbjct  63   ALVPFYPMAGRLRRDEDG  80



>gb|KJB68259.1| hypothetical protein B456_010G235000 [Gossypium raimondii]
Length=362

 Score = 97.8 bits (242),  Expect(2) = 6e-27, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            + + +K  +M++PA+ TP ++ W SN+DLV+   H+ +++FY+PNGS +FF P+ ++EAL
Sbjct  1    MDVSVKRWSMIRPAQDTPKERQWISNLDLVMPTDHVPLLFFYKPNGSSDFFKPQVLQEAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            S+ LV FYPMAGR+GRD +G
Sbjct  61   SKTLVQFYPMAGRLGRDENG  80


 Score = 50.1 bits (118),  Expect(2) = 6e-27, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 31/55 (56%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GRLEI CN EG L++ A +     D   FTP   L  L+P+   SG  SS+PL
Sbjct  78   ENGRLEILCNAEGVLWIEAETTSAMDDLDGFTPCSKLRKLVPTADYSGDISSYPL  132



>gb|AFR40306.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
Length=94

 Score =   109 bits (273),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I +KE+TMV+PA+ TP + LW SNVDLVV R H   VYFYRP G+PNFFD K +K ALS+
Sbjct  3    INVKESTMVQPAEETPQRGLWNSNVDLVVPRFHTPSVYFYRPTGAPNFFDAKVLKGALSK  62

Query  384  VLVSFYPMAGRMGRDGDG  437
             LV FYPMAGR+ RD DG
Sbjct  63   ALVPFYPMAGRLRRDEDG  80



>ref|XP_010244683.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nelumbo 
nucifera]
Length=440

 Score = 96.3 bits (238),  Expect(2) = 6e-27, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I +KE+TMV+PA+ TP + LW SN DLVV R H  +VYF+R NGS +FF+   +KEALS+
Sbjct  3    INMKESTMVRPAESTPEQTLWISNADLVVRRSHTPIVYFFRSNGSADFFNLHLLKEALSK  62

Query  384  VLVSFYPMAGRMGRDGDG  437
            VLV FYP+AGR+  + +G
Sbjct  63   VLVPFYPVAGRLNGNNEG  80


 Score = 51.2 bits (121),  Expect(2) = 6e-27, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 31/55 (56%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GRLEI CNG+G L V A +     DFGDF+    L  L+P    S   SS+PL
Sbjct  79   EGGRLEINCNGKGVLLVEAETGSTIDDFGDFSATQELRQLIPVVDYSQHISSYPL  133



>gb|KJB54948.1| hypothetical protein B456_009G055900 [Gossypium raimondii]
Length=445

 Score = 98.2 bits (243),  Expect(2) = 7e-27, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            + + +K +TM++PA+ TP ++ W SN+D+V+   H+ +++FY+PNGS +FF P+ +KEAL
Sbjct  1    MDVTVKGSTMIRPAQDTPKERQWISNLDMVMATYHVPLLFFYKPNGSSDFFKPQVLKEAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            S+ LV FYPMAGR+G D +G
Sbjct  61   SKTLVPFYPMAGRLGLDENG  80


 Score = 49.7 bits (117),  Expect(2) = 7e-27, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 31/56 (55%), Gaps = 0/56 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPLA  597
            E GRLEI CN EG L++ A +     D   FTP   L  L+P+   SG  SS+PL 
Sbjct  78   ENGRLEILCNAEGVLWIEAETTSAMDDLEGFTPSSELRKLVPTVDYSGDISSYPLV  133



>ref|XP_011018044.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X1 [Populus euphratica]
Length=438

 Score = 93.6 bits (231),  Expect(2) = 9e-27, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +3

Query  192  EKLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKE  371
            EK+++ +K++ MV+P++ TP + LW SN+DL+V   H+  VYFY+PNGS  FF+ + + +
Sbjct  7    EKMKVDVKQSIMVRPSRDTPKRSLWSSNLDLLVPMFHVQTVYFYKPNGSSRFFETQVLTD  66

Query  372  ALSRVLVSFYPMAGRMGRDGDG  437
            ALS VLV FYP AGRM +   G
Sbjct  67   ALSDVLVPFYPAAGRMRKHESG  88


 Score = 53.9 bits (128),  Expect(2) = 9e-27, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 32/56 (57%), Gaps = 0/56 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPLA  597
            E GR+EI CNGEG LFV A +     D GDFT    L  L+P    +G  SSFPL 
Sbjct  86   ESGRIEINCNGEGVLFVEAETSCFADDLGDFTDSSKLLPLVPEVDYAGGISSFPLV  141



>gb|AFR40271.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
Length=106

 Score =   109 bits (272),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I +KE+TMV+PA+ TP + LW SNVDLVV R H   VYFYRP G+PNFFD K +K ALS+
Sbjct  3    INVKESTMVQPAEETPRRGLWNSNVDLVVPRFHTPSVYFYRPTGAPNFFDAKVLKGALSK  62

Query  384  VLVSFYPMAGRMGRDGDG  437
             LV FYPMAGR+ RD DG
Sbjct  63   ALVPFYPMAGRLRRDEDG  80



>ref|XP_010500344.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=431

 Score =   100 bits (250),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            ++I I++ T+V+PA  TP   LW S+VDL++ + H   VYFYRP G+ NFFDP+ +K+AL
Sbjct  1    MKINIRDFTIVRPAAETPVTNLWNSHVDLIIAKYHTPSVYFYRPTGASNFFDPQVLKDAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            S+ LV FYPMAGR+ +D DG
Sbjct  61   SKALVPFYPMAGRLKKDDDG  80


 Score = 46.6 bits (109),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 28/53 (53%), Gaps = 0/53 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            GR+EI+CN  G LFV A +     D GDF P L L  L+P    S    + PL
Sbjct  80   GRIEIDCNDAGVLFVVADTLSVIDDLGDFAPSLTLRQLIPDVDYSVGVHTLPL  132



>ref|XP_007215395.1| hypothetical protein PRUPE_ppa005872mg [Prunus persica]
 gb|EMJ16594.1| hypothetical protein PRUPE_ppa005872mg [Prunus persica]
Length=440

 Score = 90.5 bits (223),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 61/86 (71%), Gaps = 6/86 (7%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSP------NFFDPK  359
            + + ++E+T+VKPA+ TP + LW +N+DLV+   H   VYFYR N +       NFFDP+
Sbjct  4    VNVSVRESTLVKPAEETPGQVLWMTNLDLVILGNHTPSVYFYRQNQNSVHGHHNNFFDPQ  63

Query  360  AMKEALSRVLVSFYPMAGRMGRDGDG  437
             +K+ALS+ LV FYP+AGR+G +G+G
Sbjct  64   VLKQALSKALVPFYPLAGRLGMEGNG  89


 Score = 56.6 bits (135),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 37/61 (61%), Gaps = 1/61 (2%)
 Frame = +1

Query  415  GWVGME-MGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFP  591
            G +GME  GR EI+CN EGALFV A +     DFGDF P L    L+P+   S   S++P
Sbjct  81   GRLGMEGNGRGEIDCNSEGALFVVAETGSTIEDFGDFAPTLEFRKLIPAVDYSAGISTYP  140

Query  592  L  594
            L
Sbjct  141  L  141



>gb|AFR40272.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
Length=109

 Score =   109 bits (272),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I +KE+TMV+PA+ TP + LW SNVDLVV R H   VYFYRP G+PNFFD K +K ALS+
Sbjct  3    INVKESTMVQPAEETPRRGLWNSNVDLVVPRFHTPSVYFYRPTGAPNFFDAKVLKGALSK  62

Query  384  VLVSFYPMAGRMGRDGDG  437
             LV FYPMAGR+ RD DG
Sbjct  63   ALVPFYPMAGRLRRDEDG  80



>gb|AFR40305.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
Length=88

 Score =   108 bits (270),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I +KE+TMV+PA+ TP + LW  NVDLVV R H   VYFYRP G+PNFFD K +K ALS+
Sbjct  3    INVKESTMVQPAEETPQRGLWNXNVDLVVPRFHTPSVYFYRPTGAPNFFDAKVLKGALSK  62

Query  384  VLVSFYPMAGRMGRDGDG  437
             LV FYPMAGR+ RD DG
Sbjct  63   ALVPFYPMAGRLRRDEDG  80



>gb|KJB68253.1| hypothetical protein B456_010G234500 [Gossypium raimondii]
Length=445

 Score = 96.3 bits (238),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            + + +K  +M++PA+ TP +K W SN+D+V+   HL ++ FY+PNGS +FF P+ ++EAL
Sbjct  1    MDVSVKRWSMIRPAQDTPKEKQWISNLDVVMTTYHLPLLIFYKPNGSSDFFKPQVLQEAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            S+ LV FYPMAGR+G D +G
Sbjct  61   SKTLVQFYPMAGRLGHDENG  80


 Score = 50.1 bits (118),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 31/55 (56%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GRLEI CN EG L++ A +     D   FTP   L  L+P+   SG  SS+PL
Sbjct  78   ENGRLEILCNAEGVLWIEAETTSAMDDLDGFTPCSKLRKLVPTADYSGDISSYPL  132



>ref|XP_004976123.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Setaria 
italica]
Length=439

 Score = 93.6 bits (231),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 57/83 (69%), Gaps = 3/83 (4%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPN---FFDPKAMK  368
            + I ++ +TMV+PA+ TP ++LW SN+DLVV R H   VYFYR  G P    FFD + M+
Sbjct  1    MAITVRRSTMVRPARETPRQRLWNSNLDLVVPRFHTPSVYFYRRGGGPEAEGFFDGERMR  60

Query  369  EALSRVLVSFYPMAGRMGRDGDG  437
             AL+  LV FYPMAGR+ RD DG
Sbjct  61   RALAEALVPFYPMAGRLARDEDG  83


 Score = 53.1 bits (126),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 36/56 (64%), Gaps = 1/56 (2%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXS-DXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+CNGEG LFV A + +    D+GDF P + L  L+P+   +   S+FPL
Sbjct  81   EDGRVEIDCNGEGVLFVEADAPNAAIDDYGDFAPTMELKRLIPAVDYTDDISAFPL  136



>ref|XP_002277474.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Vitis vinifera]
 emb|CBI36545.3| unnamed protein product [Vitis vinifera]
Length=433

 Score = 90.1 bits (222),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 56/81 (69%), Gaps = 1/81 (1%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNG-SPNFFDPKAMKEA  374
            ++I +K+ +MV PAK TP   LW SN+D VV RIH+  VY Y+PN    NFFD   +KEA
Sbjct  1    MKIEVKKWSMVCPAKHTPKHTLWMSNLDSVVPRIHVPTVYLYKPNAFCSNFFDASRLKEA  60

Query  375  LSRVLVSFYPMAGRMGRDGDG  437
            LS  LV FYP+AGR+G D +G
Sbjct  61   LSNALVQFYPVAGRLGLDANG  81


 Score = 56.2 bits (134),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 36/61 (59%), Gaps = 1/61 (2%)
 Frame = +1

Query  415  GWVGMEM-GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFP  591
            G +G++  GR++I CNGEG LF  A +D    D GDFTP   L  L+P    S   SS+P
Sbjct  73   GRLGLDANGRIQINCNGEGVLFQEAEADAIIDDLGDFTPSHRLRHLIPVVDHSAHISSYP  132

Query  592  L  594
            L
Sbjct  133  L  133



>ref|XP_008228811.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Prunus 
mume]
Length=440

 Score = 91.7 bits (226),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 62/86 (72%), Gaps = 6/86 (7%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSP------NFFDPK  359
            + + ++E+T+VKPA+ TP + LW +N+DLV+   H   VYFYR N +       NFFDP+
Sbjct  4    VNVSVRESTLVKPAEETPRQVLWMTNLDLVILGNHTPSVYFYRQNQNSVHGHHNNFFDPQ  63

Query  360  AMKEALSRVLVSFYPMAGRMGRDGDG  437
             +K+ALS+ LV FYP+AGR+G++G+G
Sbjct  64   VLKQALSKALVPFYPLAGRLGKEGNG  89


 Score = 54.3 bits (129),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            GR EI+CN EGALF+ A +     DFGDF P L    L+P+   S   S++PL
Sbjct  89   GRGEIDCNAEGALFIVAETSSTIEDFGDFAPTLEFRKLIPAVDYSAGISTYPL  141



>ref|XP_007215396.1| hypothetical protein PRUPE_ppa005873mg [Prunus persica]
 gb|EMJ16595.1| hypothetical protein PRUPE_ppa005873mg [Prunus persica]
Length=440

 Score = 90.1 bits (222),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 61/86 (71%), Gaps = 6/86 (7%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSP------NFFDPK  359
            + + ++E+T+VKPA+ TP + LW +N+DLV+   H   VYFYR N +       NFFDP+
Sbjct  4    VNVSVRESTLVKPAEETPRQVLWMTNLDLVILGNHTPSVYFYRQNQNSVHGHHNNFFDPQ  63

Query  360  AMKEALSRVLVSFYPMAGRMGRDGDG  437
             +K+ALS+ LV FYP+AGR+G +G+G
Sbjct  64   VLKQALSKALVPFYPLAGRLGMEGNG  89


 Score = 55.8 bits (133),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 37/61 (61%), Gaps = 1/61 (2%)
 Frame = +1

Query  415  GWVGME-MGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFP  591
            G +GME  GR EI+CN EGALFV A +     DFGDF P L    L+P+   S   S++P
Sbjct  81   GRLGMEGNGRGEIDCNSEGALFVVAETGSTIDDFGDFAPTLEFRKLIPAVDYSTGISTYP  140

Query  592  L  594
            L
Sbjct  141  L  141



>ref|XP_008228810.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Prunus 
mume]
Length=440

 Score = 91.7 bits (226),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 62/86 (72%), Gaps = 6/86 (7%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSP------NFFDPK  359
            + + ++E+T+VKPA+ TP + LW +N+DLV+   H   VYFYR N +       NFFDP+
Sbjct  4    VNVSVRESTLVKPAEETPRQVLWMTNLDLVILGNHTPSVYFYRQNQNSVHGHHNNFFDPQ  63

Query  360  AMKEALSRVLVSFYPMAGRMGRDGDG  437
             +K+ALS+ LV FYP+AGR+G++G+G
Sbjct  64   VLKQALSKALVPFYPLAGRLGKEGNG  89


 Score = 53.9 bits (128),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            GR EI+CN EGALFV A +     DFGDF P L    L+P+   S   S++PL
Sbjct  89   GRGEIDCNAEGALFVVAETGSTIDDFGDFAPTLEFRKLIPAVDYSAGISTYPL  141



>ref|XP_011018051.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Populus 
euphratica]
 ref|XP_011018052.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Populus 
euphratica]
Length=440

 Score = 94.7 bits (234),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            ++I IKE++MV P + TP+ +L  +N+DL   + H+ +++ Y+PNGS NFF+ K +KEAL
Sbjct  1    MQIIIKESSMVLPNQDTPNHRLEVTNLDLFHAKYHVPLLFLYKPNGSSNFFEVKGLKEAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            S+VLVSFYP+AGR+ RD +G
Sbjct  61   SKVLVSFYPVAGRLARDANG  80


 Score = 50.8 bits (120),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 32/53 (60%), Gaps = 1/53 (2%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            GR+EI CNGEG LF+ A +D    DF DF P   L  L+P+  +S    S+PL
Sbjct  80   GRIEINCNGEGVLFIEAETDSAMGDFADFKPSDELRQLIPTVDSSDIF-SYPL  131



>ref|XP_002324530.2| hypothetical protein POPTR_0018s11370g [Populus trichocarpa]
 gb|EEF03095.2| hypothetical protein POPTR_0018s11370g [Populus trichocarpa]
Length=440

 Score = 94.0 bits (232),  Expect(2) = 4e-26, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            ++I +KE++MV P + TP  +L  +N+DL   + H+ ++Y Y+PNGS NFF+ K +KEAL
Sbjct  1    MQITVKESSMVLPTQDTPDHRLEVTNLDLFHAKYHVPLLYLYKPNGSSNFFEVKVLKEAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            S+VL SFYP+AGR+ RD +G
Sbjct  61   SKVLESFYPVAGRLARDANG  80


 Score = 51.2 bits (121),  Expect(2) = 4e-26, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 32/53 (60%), Gaps = 1/53 (2%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            GR+EI CNGEG LF+ A +D    DF DF P   L  L+P+   S   SS+PL
Sbjct  80   GRIEINCNGEGVLFIEAETDSAMGDFVDFKPSDELRQLIPTVDYSD-ISSYPL  131



>gb|AFR40291.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
Length=111

 Score =   106 bits (265),  Expect(2) = 5e-26, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I +KE+TMV+PA+ TP + LW SNVDLVV R H   VYFYRP G+PNFFD K +K ALS+
Sbjct  3    INVKESTMVQPAEKTPQRGLWNSNVDLVVPRFHTPSVYFYRPTGAPNFFDAKVLKGALSK  62

Query  384  VLVSFYPMAGRMGRDGDG  437
             LV FYPMAGR   D DG
Sbjct  63   ALVPFYPMAGRXXXDEDG  80


 Score = 38.5 bits (88),  Expect(2) = 5e-26, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 20/33 (61%), Gaps = 0/33 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTP  528
            E GR+EI CN  G LFV AX     XDF DF P
Sbjct  78   EDGRIEINCNAXGVLFVEAXXTSVIXDFADFAP  110



>ref|XP_006303737.1| hypothetical protein CARUB_v10011876mg [Capsella rubella]
 gb|EOA36635.1| hypothetical protein CARUB_v10011876mg [Capsella rubella]
Length=426

 Score = 95.5 bits (236),  Expect(2) = 6e-26, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 58/79 (73%), Gaps = 0/79 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            ++I I+++T+V+PA  TP   LW SNVDL++ R H   VYFYRP    NFF+P+ +K+AL
Sbjct  1    MKINIRDSTIVRPAGETPITSLWNSNVDLIIPRFHTPSVYFYRPTSDSNFFNPQVLKDAL  60

Query  378  SRVLVSFYPMAGRMGRDGD  434
            S+VLV FYP+AGR+ R  D
Sbjct  61   SKVLVPFYPVAGRLKRGND  79


 Score = 48.9 bits (115),  Expect(2) = 6e-26, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 29/52 (56%), Gaps = 0/52 (0%)
 Frame = +1

Query  439  RLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            R++I+CN  G LFV A +     DFGDF P L L  L+P    S    +FPL
Sbjct  81   RIKIDCNSAGVLFVVADTPSVIDDFGDFAPTLALRQLIPGVDYSAGIHTFPL  132



>gb|KJB54981.1| hypothetical protein B456_009G057200 [Gossypium raimondii]
Length=436

 Score =   105 bits (263),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            + I IKE++MV PA+ TP  +LW SN++L++   H+  VYF+RPNGS NFFD + +KEAL
Sbjct  4    MEITIKESSMVYPAEETPKHRLWSSNLELLMTLHHVPTVYFFRPNGSSNFFDTRVLKEAL  63

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            S+VLV FYPMAGR+GRD +G
Sbjct  64   SKVLVPFYPMAGRLGRDENG  83


 Score = 37.7 bits (86),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 30/57 (53%), Gaps = 2/57 (4%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXD-FGD-FTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI CNG+GALF+ A +D    D  GD       L  L+P        SS+PL
Sbjct  81   ENGRIEIVCNGKGALFLEAETDYVIDDLIGDTMINSSELWRLVPKVDYFADISSYPL  137



>ref|XP_011018045.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Populus euphratica]
 ref|XP_011018046.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Populus euphratica]
 ref|XP_011018047.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Populus euphratica]
Length=430

 Score = 89.7 bits (221),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            +++ +K++ MV+P++ TP + LW SN+DL+V   H+  VYFY+PNGS  FF+ + + +AL
Sbjct  1    MKVDVKQSIMVRPSRDTPKRSLWSSNLDLLVPMFHVQTVYFYKPNGSSRFFETQVLTDAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            S VLV FYP AGRM +   G
Sbjct  61   SDVLVPFYPAAGRMRKHESG  80


 Score = 53.9 bits (128),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 32/56 (57%), Gaps = 0/56 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPLA  597
            E GR+EI CNGEG LFV A +     D GDFT    L  L+P    +G  SSFPL 
Sbjct  78   ESGRIEINCNGEGVLFVEAETSCFADDLGDFTDSSKLLPLVPEVDYAGGISSFPLV  133



>ref|XP_010063590.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 gb|KCW70827.1| hypothetical protein EUGRSUZ_F03973 [Eucalyptus grandis]
 gb|KCW70828.1| hypothetical protein EUGRSUZ_F03973 [Eucalyptus grandis]
 gb|KCW70829.1| hypothetical protein EUGRSUZ_F03973 [Eucalyptus grandis]
Length=445

 Score = 97.8 bits (242),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 60/81 (74%), Gaps = 0/81 (0%)
 Frame = +3

Query  195  KLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEA  374
            ++ I +K TTMV+PA+ TP   LW +N+DLVV  +H   VYFYRP GS +FFD + +KEA
Sbjct  7    RMIINVKGTTMVRPAEDTPRCTLWNANLDLVVPSMHTPSVYFYRPTGSDDFFDSEVLKEA  66

Query  375  LSRVLVSFYPMAGRMGRDGDG  437
            LSR LV FYP+AGR+ RD +G
Sbjct  67   LSRALVLFYPVAGRLKRDKNG  87


 Score = 45.8 bits (107),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 30/53 (57%), Gaps = 1/53 (2%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            GR+EI+CN EG LFV A +     D GDF   L L  L+P+   S   SS PL
Sbjct  87   GRIEIDCNAEGVLFVEAETSSVVDDLGDFA-TLELRKLIPAVNYSSGISSDPL  138



>gb|KHG19404.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Gossypium arboreum]
Length=433

 Score =   105 bits (262),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            + I IKE++MV PA+ TP  +LW SN++L++   H+  VYF+RPNGS NFFD   +KEAL
Sbjct  1    MEITIKESSMVHPAEETPKHRLWSSNLELLMTLHHVPTVYFFRPNGSSNFFDTGVLKEAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            S+VLV FYPMAGR+GRD +G
Sbjct  61   SKVLVPFYPMAGRLGRDENG  80


 Score = 37.7 bits (86),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 30/57 (53%), Gaps = 2/57 (4%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXD-FGD-FTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI CNG+GALF+ A +D    D  GD       L  L+P        SS+PL
Sbjct  78   ENGRIEIVCNGKGALFLEAETDYVIDDLIGDTMINSSELWRLVPKVDYFADISSYPL  134



>ref|NP_001145871.1| uncharacterized protein LOC100279386 [Zea mays]
 ref|XP_008667774.1| PREDICTED: uncharacterized protein LOC100279386 isoform X1 [Zea 
mays]
 gb|ACF84552.1| unknown [Zea mays]
 gb|ACF86236.1| unknown [Zea mays]
 gb|ACL52770.1| unknown [Zea mays]
 gb|ACN28217.1| unknown [Zea mays]
 tpg|DAA37089.1| TPA: anthranilate N-benzoyltransferase protein 2 isoform 1 [Zea 
mays]
 tpg|DAA37090.1| TPA: anthranilate N-benzoyltransferase protein 2 isoform 2 [Zea 
mays]
Length=440

 Score = 91.7 bits (226),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 58/84 (69%), Gaps = 4/84 (5%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNG----SPNFFDPKAM  365
            + I ++ +TMV+PA+ TP ++LW SN+DLVV R H   VYFYR +G    +  FFD + M
Sbjct  1    MAITVRRSTMVRPARETPRQRLWNSNLDLVVPRFHTPSVYFYRRDGPVPDAEGFFDGERM  60

Query  366  KEALSRVLVSFYPMAGRMGRDGDG  437
            + AL+  LV FYPMAGR+ RD DG
Sbjct  61   RRALAEALVPFYPMAGRLARDEDG  84


 Score = 51.6 bits (122),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 35/56 (63%), Gaps = 1/56 (2%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXS-DXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+CNGEG LFV A + D    D+GDF P + L  L+P+   +   S+F L
Sbjct  82   EDGRVEIDCNGEGVLFVEADAPDASVDDYGDFAPTMELKRLIPTVDYTDDISAFSL  137



>gb|KJB68258.1| hypothetical protein B456_010G234900 [Gossypium raimondii]
Length=429

 Score = 93.2 bits (230),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            + + +K  +M++PA+ TP ++ W SN+DLV+   H+ +++FY+PNGS ++  P+ ++EAL
Sbjct  1    MDVSVKRWSMIRPAQDTPKERQWISNLDLVMPTDHVPLLFFYKPNGSSDYSKPQVLQEAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            S+ LV FYPMAGR+GRD +G
Sbjct  61   SKTLVQFYPMAGRLGRDENG  80


 Score = 50.1 bits (118),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 30/55 (55%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GRLEI CN EG L++ A +     D  DFTP   L  L+P     G  SS+PL
Sbjct  78   ENGRLEILCNAEGVLWIEAETTSAMDDLDDFTPCSKLTKLVPKADYFGDISSYPL  132



>gb|ACG47161.1| anthranilate N-benzoyltransferase protein 2 [Zea mays]
Length=442

 Score = 91.3 bits (225),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 58/84 (69%), Gaps = 4/84 (5%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNG----SPNFFDPKAM  365
            + I ++ +TMV+PA+ TP ++LW SN+DLVV R H   VYFYR +G    +  FFD + M
Sbjct  1    MAITVRRSTMVRPARETPRQRLWNSNLDLVVPRFHTPSVYFYRRDGPVPDAEGFFDGERM  60

Query  366  KEALSRVLVSFYPMAGRMGRDGDG  437
            + AL+  LV FYPMAGR+ RD DG
Sbjct  61   RRALAEALVPFYPMAGRLARDEDG  84


 Score = 51.6 bits (122),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 35/56 (63%), Gaps = 1/56 (2%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXS-DXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+CNGEG LFV A + D    D+GDF P + L  L+P+   +   S+F L
Sbjct  82   EDGRVEIDCNGEGVLFVEADAPDASVDDYGDFAPTMELKRLIPTVDYTDDISAFSL  137



>ref|XP_006652479.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Oryza 
brachyantha]
Length=440

 Score = 88.6 bits (218),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 57/84 (68%), Gaps = 4/84 (5%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYR---PNGSPN-FFDPKAM  365
            + I ++ +TMV+PA  TP ++LW SN+DLVV R H   VYFYR     G+P  FFD + M
Sbjct  1    MAITVRRSTMVRPAGETPRQRLWNSNLDLVVPRFHTPSVYFYRRGTEEGAPEGFFDGERM  60

Query  366  KEALSRVLVSFYPMAGRMGRDGDG  437
            + AL+  LV FYPMAGR+ RD DG
Sbjct  61   RRALAEALVLFYPMAGRLARDEDG  84


 Score = 54.3 bits (129),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 36/56 (64%), Gaps = 1/56 (2%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXA-XSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+C+GEG LFV A  +D    D+GDF P + L  L+P+   +   SSFPL
Sbjct  82   EDGRVEIDCSGEGVLFVEADATDASVDDYGDFAPTMELKRLIPTVEYTDDISSFPL  137



>ref|XP_011011266.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Populus 
euphratica]
Length=433

 Score = 92.8 bits (229),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            +++  KE+ +V+P +  P + LW SN+DL+  R +L  VY Y+PNGS NFF+   +KEAL
Sbjct  1    MKVNTKESIIVRPVQEMPKQSLWLSNMDLLHPRYYLPTVYLYKPNGSANFFEATVLKEAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
             RVLV FYP+AGR+ RD +G
Sbjct  61   GRVLVPFYPVAGRLARDENG  80


 Score = 50.1 bits (118),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 28/43 (65%), Gaps = 0/43 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPS  558
            E GR+EI CNGEG LFV A +D    + G+F P + L  L+P+
Sbjct  78   ENGRIEINCNGEGVLFVVADTDSTTEELGEFMPSMELRQLIPT  120



>ref|XP_008777439.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Phoenix 
dactylifera]
Length=431

 Score = 94.4 bits (233),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  210  IKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSRVL  389
            I ET +V P+  TP  ++W SN+DL+V R H   VYFYRPNG+PNFF  +AMK AL + L
Sbjct  7    ILETGLVTPSDDTPKHEIWLSNLDLLVARGHTPTVYFYRPNGAPNFFSAEAMKAALGKAL  66

Query  390  VSFYPMAGRMGRDGDG  437
            V FYP+AGR+G   +G
Sbjct  67   VPFYPLAGRLGVSREG  82


 Score = 48.1 bits (113),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 27/46 (59%), Gaps = 0/46 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSG  573
            GR+EI+C GEG LFV A SD    +FGDF P   +  LL     SG
Sbjct  82   GRVEIQCTGEGVLFVVARSDSTVDEFGDFAPSTEMRQLLVPSVESG  127



>ref|XP_002446745.1| hypothetical protein SORBIDRAFT_06g021640 [Sorghum bicolor]
 gb|EES11073.1| hypothetical protein SORBIDRAFT_06g021640 [Sorghum bicolor]
Length=441

 Score = 87.0 bits (214),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 55/83 (66%), Gaps = 5/83 (6%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNG-----SPNFFDPKAMK  368
            I ++ +TMV+PA+ TP ++LW SN+DLVV R H   VYFYR        +  FFD + M+
Sbjct  3    ITVRRSTMVRPARETPRQRLWNSNLDLVVPRFHTPSVYFYRRGDGAAAPAEGFFDGERMR  62

Query  369  EALSRVLVSFYPMAGRMGRDGDG  437
             AL+  LV FYPMAGR+ RD DG
Sbjct  63   RALAEALVPFYPMAGRLARDEDG  85


 Score = 54.7 bits (130),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 36/56 (64%), Gaps = 1/56 (2%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXS-DXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+CNGEG LFV A + D    D+GDF P + L  L+P+   +   S+FPL
Sbjct  83   EDGRVEIDCNGEGVLFVEADAPDVSVDDYGDFAPTMDLKRLIPTVDYTDDISAFPL  138



>ref|XP_010545447.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Tarenaya 
hassleriana]
Length=441

 Score = 81.3 bits (199),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            ++I +K++T+VKPAK TP   LW SN+DL+  R+H+  ++FY+P  S N    + +K+AL
Sbjct  1    MKIRVKQSTIVKPAKETPRHSLWLSNIDLIQVRLHMGTLHFYKPLLSSNVVGTRFLKDAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            S +LV +YP AGR+ R  +G
Sbjct  61   SDILVPYYPAAGRLRRGENG  80


 Score = 60.8 bits (146),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPLAXF  603
            E GRLE+ CNGEG LFV A +D    D G  TP L L  L PS   SG  SS+PL  F
Sbjct  78   ENGRLEVHCNGEGVLFVEAETDSTVSDIGLHTPSLDLARLAPSVDYSGGISSYPLLLF  135



>dbj|BAO20883.1| hydroxycinnamoyl CoA: shikimate hydroxycinnamoyl transferase 
[Panicum virgatum]
Length=438

 Score = 90.9 bits (224),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 56/82 (68%), Gaps = 2/82 (2%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGS--PNFFDPKAMKE  371
            + I ++ +TMV+PA+ TP ++LW SN+DLVV R H   VYFYR  G     FFD + M+ 
Sbjct  1    MAITVRRSTMVRPARETPRQRLWNSNLDLVVPRFHTPSVYFYRRGGPEVEGFFDSERMRR  60

Query  372  ALSRVLVSFYPMAGRMGRDGDG  437
            AL+  LV FYPMAGR+ RD DG
Sbjct  61   ALAEALVPFYPMAGRLARDEDG  82


 Score = 50.8 bits (120),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 34/56 (61%), Gaps = 1/56 (2%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXD-FGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+CNGEG LFV   +     D +GDF P + L  L+P+   +   S+FPL
Sbjct  80   EDGRVEIDCNGEGVLFVEVDAPNAAVDNYGDFAPTMELKRLIPAVDYTDDISAFPL  135



>ref|NP_200592.1| anthranilate N-hydroxycinnamoyl/benzoyltransferase-like protein 
[Arabidopsis thaliana]
 gb|AAK95303.1|AF410317_1 AT5g57840/MTI20_9 [Arabidopsis thaliana]
 dbj|BAB08854.1| N-hydroxycinnamoyl/benzoyltransferase [Arabidopsis thaliana]
 gb|AAN31075.1| At5g57840/MTI20_9 [Arabidopsis thaliana]
 gb|AED96958.1| anthranilate N-hydroxycinnamoyl/benzoyltransferase-like protein 
[Arabidopsis thaliana]
Length=443

 Score = 84.0 bits (206),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            ++I +K+ T+VKPA+ TP+  LW SN+DL+  R+H+  +YFY+P  S +  + +++ EAL
Sbjct  1    MKIRVKQATIVKPAEETPTHNLWLSNLDLIQVRLHMGTLYFYKPCSSSDRPNTQSLIEAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            S+VLV FYP AGR+ ++ +G
Sbjct  61   SKVLVFFYPAAGRLQKNTNG  80


 Score = 57.8 bits (138),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPLAXF  603
            GRLE++CNGEG LFV A SD    D G  T  L L  L+P+   +G  SS+PL  F
Sbjct  80   GRLEVQCNGEGVLFVEAESDSTVQDIGLLTQSLDLSQLVPTVDYAGDISSYPLLLF  135



>gb|ACD03271.1| hydroxycinnamoyl transferase [Sinopodophyllum hexandrum]
Length=139

 Score = 94.0 bits (232),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 59/78 (76%), Gaps = 1/78 (1%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I ++   +V+PA+ TP K LW SN+D +  ++ +  VYFYRP+GS NFFD KAMKE+LS+
Sbjct  3    IKVRREEIVEPAEETPKKILWTSNIDQLF-KLLIPSVYFYRPDGSTNFFDVKAMKESLSK  61

Query  384  VLVSFYPMAGRMGRDGDG  437
             LVSFYPMAGR+ R+ DG
Sbjct  62   ALVSFYPMAGRLKRNEDG  79


 Score = 47.4 bits (111),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 29/55 (53%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+E +CNG+G L V A ++    D GDF P   L  L+P        S +PL
Sbjct  77   EDGRVETDCNGKGVLLVEAETETSLDDLGDFRPTTELRQLIPRVDNPMDISPYPL  131



>ref|XP_010063583.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010063585.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 gb|KCW70825.1| hypothetical protein EUGRSUZ_F03972 [Eucalyptus grandis]
 gb|KCW70826.1| hypothetical protein EUGRSUZ_F03972 [Eucalyptus grandis]
Length=445

 Score = 90.5 bits (223),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +3

Query  195  KLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEA  374
            ++ I +K +TMV PAK TP    W +NVDL+V  +H   VYFYRP  S +FFD + +KEA
Sbjct  7    RMIINVKGSTMVSPAKDTPRCTQWLANVDLMVPTLHTPSVYFYRPTRSDDFFDSRVLKEA  66

Query  375  LSRVLVSFYPMAGRMGRDGDG  437
            LS+ LV FYP+AGR+ RD +G
Sbjct  67   LSKALVLFYPVAGRLKRDENG  87


 Score = 50.8 bits (120),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 33/55 (60%), Gaps = 1/55 (2%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+CN EG LFV A +     DFGDF   L L  L+P+   SG  SS P+
Sbjct  85   ENGRIEIDCNAEGVLFVEAETSSVVDDFGDFA-TLELRKLIPTVDYSGGISSDPI  138



>ref|XP_008381122.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Malus 
domestica]
Length=438

 Score = 99.8 bits (247),  Expect(2) = 8e-25, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 59/82 (72%), Gaps = 2/82 (2%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP--NGSPNFFDPKAMKE  371
            + + ++E+TMVKPA+ TP K LW SNVDLV+  IH   VYFYRP  NG  NFFDP  +K 
Sbjct  3    VNVIMRESTMVKPAEETPKKTLWNSNVDLVIPSIHTASVYFYRPNQNGGSNFFDPVVLKH  62

Query  372  ALSRVLVSFYPMAGRMGRDGDG  437
            ALS+ LV FYPMA R+ R+ DG
Sbjct  63   ALSKALVLFYPMARRLKRNDDG  84


 Score = 40.8 bits (94),  Expect(2) = 8e-25, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 25/39 (64%), Gaps = 0/39 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLL  552
            GR++I+  G+GALFV A +     DFGDF P L L  L+
Sbjct  84   GRIQIDYGGQGALFVEAETGSILDDFGDFAPTLELRRLI  122



>ref|XP_002324532.1| hypothetical protein POPTR_0018s11380g [Populus trichocarpa]
 gb|EEF03097.1| hypothetical protein POPTR_0018s11380g [Populus trichocarpa]
Length=440

 Score = 92.4 bits (228),  Expect(2) = 8e-25, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            ++I IKE++MV P + TP+ +L  +N+DL   + H+ +++ Y+PNGS NFF+ K +KEAL
Sbjct  1    MQITIKESSMVVPTQDTPNHRLEVTNLDLFHAKYHVPLLFIYKPNGSSNFFEGKVLKEAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            S+VL SFYP+AGR+ RD  G
Sbjct  61   SKVLESFYPVAGRLARDAKG  80


 Score = 48.5 bits (114),  Expect(2) = 8e-25, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 31/53 (58%), Gaps = 1/53 (2%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            GR+EI CNGEG LFV A +D    DF  F P   L  L+P+   S   SS+PL
Sbjct  80   GRIEINCNGEGVLFVEAETDSAMGDFVGFKPSDELRQLIPTVDYSD-ISSYPL  131



>ref|XP_010063586.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010063587.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010063588.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010063589.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 gb|KCW70830.1| hypothetical protein EUGRSUZ_F03974 [Eucalyptus grandis]
Length=445

 Score = 95.9 bits (237),  Expect(2) = 9e-25, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 59/81 (73%), Gaps = 0/81 (0%)
 Frame = +3

Query  195  KLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEA  374
            ++ I +K +TMV+PA+ TP   LW +NVDLVV  +H   VYFYRP G  +FFD + +KEA
Sbjct  7    RMIINVKGSTMVRPAEDTPRCTLWNANVDLVVPSMHTPSVYFYRPTGLDDFFDSRVLKEA  66

Query  375  LSRVLVSFYPMAGRMGRDGDG  437
            LSR LV FYP+AGR+ RD +G
Sbjct  67   LSRALVLFYPLAGRLKRDKNG  87


 Score = 44.7 bits (104),  Expect(2) = 9e-25, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 30/53 (57%), Gaps = 1/53 (2%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            GR+EI+CN EG LFV A +     D GDF   L L  L+P+   S   SS P+
Sbjct  87   GRIEIDCNAEGVLFVEAETSSVVDDLGDFA-TLELRKLIPAVNYSSGISSDPV  138



>gb|EMT09803.1| Anthranilate N-benzoyltransferase protein 1 [Aegilops tauschii]
Length=520

 Score = 84.7 bits (208),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 59/84 (70%), Gaps = 4/84 (5%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFY-RPNG---SPNFFDPKAM  365
            + I ++++TMV+PA+ T   +LW S++DL+V R H   VYFY RP G   +  FFD + M
Sbjct  1    MAIMVRQSTMVRPARETMPTRLWNSHLDLLVPRFHTPSVYFYRRPEGAAATEGFFDGERM  60

Query  366  KEALSRVLVSFYPMAGRMGRDGDG  437
            ++AL+  LV+FYPMAGR+ RD DG
Sbjct  61   RQALAEALVTFYPMAGRLARDKDG  84


 Score = 55.5 bits (132),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXS-DXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPLA  597
            GR+EI+CNGEG LFV A + D    D+GDF P + L  L+P+   +   SSFPL 
Sbjct  84   GRVEIDCNGEGVLFVEADAPDTTVADYGDFAPTMELNRLIPAIDYTQEISSFPLV  138



>ref|XP_007011892.1| Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase, 
putative [Theobroma cacao]
 gb|EOY29511.1| Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase, 
putative [Theobroma cacao]
Length=442

 Score = 93.6 bits (231),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            + I  K++TMV PA+ T   +LW SN++L++   H+  VYF+RPNGS NFF+ + + EAL
Sbjct  1    MEITTKKSTMVYPAEETQKHRLWSSNLELLMTLHHVPTVYFFRPNGSSNFFNAQVLMEAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            S+VLV FYPMAGR+ RD  G
Sbjct  61   SKVLVPFYPMAGRLARDEKG  80


 Score = 46.6 bits (109),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 31/56 (55%), Gaps = 1/56 (2%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXD-FGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI CN EGALFV A +D    D  GD      L  L+P+   +   SS+PL
Sbjct  78   EKGRVEINCNAEGALFVEAETDVVIDDLIGDTIRSSELWRLVPTVDYAADISSYPL  133



>ref|XP_001756433.1| predicted protein [Physcomitrella patens]
 gb|EDQ78829.1| predicted protein [Physcomitrella patens]
Length=410

 Score = 85.1 bits (209),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 58/82 (71%), Gaps = 2/82 (2%)
 Frame = +3

Query  195  KLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPN-GSPNFFDPKAMKE  371
            +L + I++ +MV+P++PTP + LW S +DLV+ RIH   VYFY  N GS +F + + + E
Sbjct  8    QLDVTIRKQSMVRPSEPTPERILWNSGLDLVIPRIHTQSVYFYNNNDGSDDFLNHEKLAE  67

Query  372  ALSRVLVSFYPMAGRMGRDGDG  437
            AL + LV FYPMAGR+ R G+G
Sbjct  68   ALGKTLVPFYPMAGRLKR-GEG  88


 Score = 55.1 bits (131),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 31/55 (56%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI CNGEG L V A +D    DFG+F P      L+P    S   SSFPL
Sbjct  87   EGGRVEINCNGEGVLLVEAEADAKITDFGEFAPDPRFRHLVPQVDYSQEISSFPL  141



>ref|XP_006436001.1| hypothetical protein CICLE_v10033907mg, partial [Citrus clementina]
 gb|ESR49241.1| hypothetical protein CICLE_v10033907mg, partial [Citrus clementina]
Length=137

 Score = 86.3 bits (212),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYR-PNGSPNFFDPKAMKEA  374
            + I +KE+TM++PA+ TP   L  S +DL++   H+  VYFYR PNGS  FF+   +KEA
Sbjct  1    MEIHVKESTMIQPAQDTPKHCLRMSVLDLLMPSEHIPAVYFYRRPNGSSKFFEAGLLKEA  60

Query  375  LSRVLVSFYPMAGRMGRDGDG  437
            LS+VLV+FYP+AGR+ +D +G
Sbjct  61   LSKVLVAFYPLAGRLTKDENG  81


 Score = 53.1 bits (126),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 32/55 (58%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR EI CNGEG LFV A ++    DFGDF   L L  L+P+   +   S +PL
Sbjct  79   ENGRTEIRCNGEGVLFVEAQANCVIDDFGDFESSLKLMQLVPTVDDTKDASFYPL  133



>ref|XP_010452842.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=443

 Score = 87.0 bits (214),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            ++I IK+TT+VKPAK TP+  LW SN+DL+  R H+  +YF+ P  S NF + + + +AL
Sbjct  1    MKIWIKQTTIVKPAKETPTHSLWLSNLDLIQVRFHMGTLYFFNPCSSSNFPNTQLLIDAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
             +VLV FYP AGR+ +D +G
Sbjct  61   RKVLVLFYPAAGRLQKDKNG  80


 Score = 52.0 bits (123),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 33/56 (59%), Gaps = 0/56 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPLAXF  603
            GRLE+ C+G+G +FV A +D    + G  T  L L  L+P+   SG  SSFPL  F
Sbjct  80   GRLEVRCSGDGVMFVEAETDSTVQNIGLVTQSLDLSQLVPTIDYSGDISSFPLVLF  135



>ref|XP_007099552.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Theobroma cacao]
 gb|EOY20480.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Theobroma cacao]
Length=224

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            + I +KE+TMV PA+ TP+++LW SN+DLVV   H+  VYFY+PNGS +FFD K +KE+L
Sbjct  1    MEITMKESTMVCPAEETPNQRLWLSNLDLVVTVYHMSTVYFYKPNGSSDFFDTKVLKESL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            S++LV FYP+AGR+G D +G
Sbjct  61   SKILVPFYPVAGRLGYDENG  80



>gb|ADB44897.1| hydroxycinnamoyl transferase [Sinopodophyllum hexandrum]
Length=438

 Score = 92.0 bits (227),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 59/78 (76%), Gaps = 1/78 (1%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I ++   +V+PA+ TP K LW SN+D +  ++ +  VYFYRP+GS NFFD KAMKE+LS+
Sbjct  3    IKVRREEIVEPAEETPKKILWTSNIDQLF-KLLIPSVYFYRPDGSTNFFDVKAMKESLSK  61

Query  384  VLVSFYPMAGRMGRDGDG  437
             LVSFYPMAGR+ R+ DG
Sbjct  62   ALVSFYPMAGRLKRNEDG  79


 Score = 47.0 bits (110),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 29/55 (53%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+E +CNG+G L V A ++    D GDF P   L  L+P        S +PL
Sbjct  77   EDGRVETDCNGKGVLLVEAETETSLDDLGDFRPTTELRQLIPRVDNPMDISPYPL  131



>ref|XP_010483334.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=443

 Score = 82.4 bits (202),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            ++I +K++ +VKPAK TPS  LW SN+D +  R H+  +YF+ P  S N  + + + +AL
Sbjct  1    MKIWVKQSAIVKPAKETPSHSLWLSNLDQIQVRFHMGTLYFFNPCSSSNLPNTQLLIDAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            S+VLV FYP+AGR+ +D +G
Sbjct  61   SKVLVLFYPVAGRLQKDKNG  80


 Score = 56.6 bits (135),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 33/56 (59%), Gaps = 0/56 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPLAXF  603
            GRLE+ CNGEG ++V A +D    D G  T  L L  L+P+   SG  SSFPL  F
Sbjct  80   GRLEVRCNGEGVMYVEAETDSTVQDIGLLTQSLDLSELVPTIDYSGDISSFPLVLF  135



>ref|XP_003629304.1| Hydroxycinnamoyl-CoA quinate hydroxycinnamoyltransferase [Medicago 
truncatula]
 gb|AET03780.1| shikimate/quinate hydroxycinnamoyltransferase [Medicago truncatula]
Length=420

 Score = 85.9 bits (211),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +3

Query  225  MVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSRVLVSFYP  404
            MV+P+K    +++W SNVDL    IH   +YFYR N +  FFD K MKEALS+VLVSFYP
Sbjct  1    MVQPSKEVARRRVWNSNVDLKTPNIHTPSIYFYRTNTTSKFFDTKIMKEALSKVLVSFYP  60

Query  405  MAGRMGRDGDG  437
            MAGR   D DG
Sbjct  61   MAGRFCYDKDG  71


 Score = 52.8 bits (125),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            GR+EI+C+G+G LFV A ++    DFGDF P L L  L+P    S    ++PL
Sbjct  71   GRVEIDCDGQGVLFVEAATNSFIDDFGDFAPTLHLGQLIPIVDYSRGIETYPL  123



>gb|AFR40273.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
Length=74

 Score =   101 bits (252),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  383
            I +KE+TMV+PA+ TP + LW SNVDLVV R H   VYFYRP G+PNFFD K +K ALS+
Sbjct  3    INVKESTMVQPAEETPRRGLWNSNVDLVVPRFHTPSVYFYRPTGAPNFFDAKVLKGALSK  62

Query  384  VLVSFYPMAGRM  419
             LV FYPMAGR+
Sbjct  63   ALVPFYPMAGRL  74



>gb|EYU21749.1| hypothetical protein MIMGU_mgv1a006630mg [Erythranthe guttata]
Length=437

 Score = 86.7 bits (213),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 55/82 (67%), Gaps = 2/82 (2%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPN--FFDPKAMKE  371
            ++I +KE+TMV+PA  TP   LW SNVDLV+   H+  VYFYR   + +  FFD   +KE
Sbjct  1    MKIVVKESTMVRPAAETPRVSLWNSNVDLVMNNFHITSVYFYRRPAAADGSFFDAAVLKE  60

Query  372  ALSRVLVSFYPMAGRMGRDGDG  437
            AL R  V FYP+AGR+ +D +G
Sbjct  61   ALGRATVLFYPIAGRLKKDANG  82


 Score = 51.6 bits (122),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 32/54 (59%), Gaps = 1/54 (2%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXL-XXLLPSXXTSGXXSSFPL  594
            GR EI+CN EG LFV A SD    DFGDF P L L   L+P    +   S++PL
Sbjct  82   GRFEIDCNAEGVLFVEAESDGVVDDFGDFAPSLELRRRLIPVVDYTQGFSTYPL  135



>ref|XP_002866234.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42493.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
Length=443

 Score = 82.0 bits (201),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            ++I +K+ T+VKPA+ TP+  LW SN+DL+  R H+  +YFY P  S +  + +++ +AL
Sbjct  1    MKIQVKQATIVKPAEETPTHNLWLSNLDLIQVRFHMGTLYFYNPCSSSDRPNTQSLIDAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            S+VLV FYP AGR+ +D +G
Sbjct  61   SKVLVLFYPAAGRLQKDTNG  80


 Score = 56.2 bits (134),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPLAXF  603
            GRLE++CNGEG LFV A +D    D G  T  L L  L+P+   +G  SS+PL  F
Sbjct  80   GRLEVQCNGEGVLFVEAETDSTVQDIGLLTQSLDLSQLVPTVDYAGDISSYPLLLF  135



>gb|EYU24606.1| hypothetical protein MIMGU_mgv1a005249mg [Erythranthe guttata]
Length=492

 Score = 97.4 bits (241),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 62/99 (63%), Gaps = 1/99 (1%)
 Frame = +3

Query  144  LNFHKKDYCFNTNMASEKLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRI-HLLVVYF  320
            ++  K   CF        ++I +K++TMV P   TPS KLW SNVDLV     H   VYF
Sbjct  34   VSLSKNLSCFFPAEKVNHMKITVKKSTMVAPNAATPSGKLWLSNVDLVTATTYHTRSVYF  93

Query  321  YRPNGSPNFFDPKAMKEALSRVLVSFYPMAGRMGRDGDG  437
            YR NG+ +FFDP  +  ALSRVLV +YP+AGR+ RD DG
Sbjct  94   YRFNGAADFFDPAVLMAALSRVLVEYYPIAGRLTRDEDG  132


 Score = 40.8 bits (94),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 29/55 (53%), Gaps = 1/55 (2%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+ I C GEGALFV A  D    D G F P   L  L P+   S   S++PL
Sbjct  130  EDGRISINCTGEGALFVEAECDGEIDDLGGFAPRPDL-SLNPAVDYSLGISTYPL  183



>ref|XP_008228829.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Prunus 
mume]
Length=443

 Score = 83.6 bits (205),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 53/82 (65%), Gaps = 1/82 (1%)
 Frame = +3

Query  189  SEKLRICIKETTMVKPAK-PTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAM  365
            +EK+ + I+E+TMV+PA+  TP   LW SN DL     H   VYFYR +G  NFFD   +
Sbjct  2    AEKVMVSIRESTMVRPAEESTPRGSLWLSNSDLAFPPFHTSSVYFYRSSGKHNFFDKGVL  61

Query  366  KEALSRVLVSFYPMAGRMGRDG  431
            K+AL + LV FYPMAGR   +G
Sbjct  62   KQALGKALVPFYPMAGRFKLNG  83


 Score = 54.3 bits (129),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 33/55 (60%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            + GR+EI+CN EG +FV A S     DFGDF P      L+P+   SG  SS+P+
Sbjct  84   QNGRVEIDCNAEGVVFVVAESSSAIDDFGDFAPTPDFLTLIPTIDYSGGISSYPI  138



>emb|CDG56249.1| hydroxycinnamoyl-CoA:shikimate hydroxycinnamoyltransferase 2 
[Glechoma hederacea]
Length=430

 Score = 82.0 bits (201),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 57/83 (69%), Gaps = 3/83 (4%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGS---PNFFDPKAMK  368
            ++I ++++T+V+P+  TP+  LW SNVDLVV   H   VYFYRP+G     +FFD   MK
Sbjct  1    MKIEVRDSTLVRPSAATPAVSLWNSNVDLVVPNFHTPSVYFYRPDGGAAAADFFDTAVMK  60

Query  369  EALSRVLVSFYPMAGRMGRDGDG  437
             AL R LV FYPMAGR+ RD DG
Sbjct  61   AALGRALVPFYPMAGRLKRDEDG  83


 Score = 55.8 bits (133),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+CN EG LFV A SD    D+GDF P L L  L+P+   S   S++ L
Sbjct  81   EDGRVEIDCNAEGVLFVEAESDGSVDDYGDFAPNLELRRLIPAVDYSQGISTYAL  135



>ref|XP_006486096.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Citrus 
sinensis]
Length=433

 Score = 84.7 bits (208),  Expect(2) = 6e-24, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYR-PNGSPNFFDPKAMKEA  374
            + I +KE+TM++PA+ TP   L  S +DL++   H+  VYFYR PNGS  FF+   +KEA
Sbjct  1    MEIHVKESTMIQPAQDTPKHCLRMSVLDLLMPSEHIPAVYFYRRPNGSSKFFEAGLLKEA  60

Query  375  LSRVLVSFYPMAGRMGRDGDG  437
            LS+VLV+FYP+AGR+ +D +G
Sbjct  61   LSKVLVAFYPLAGRLTKDENG  81


 Score = 53.1 bits (126),  Expect(2) = 6e-24, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 32/55 (58%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR EI CNGEG LFV A ++    DFGDF   L L  L+P+   +   S +PL
Sbjct  79   ENGRTEIRCNGEGVLFVEAQANCVIDDFGDFESSLKLMQLVPTVDDTKDASFYPL  133



>gb|ABI48360.1| putative alcohol acyltransferase 1 [Lavandula angustifolia]
Length=460

 Score = 91.7 bits (226),  Expect(2) = 6e-24, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVV-GRIHLLVVYFYRPNGSPNFFDPKAMKEA  374
            ++I IKE+TMV+PA  TPS  LW SN+DL+     H L V+FY  +GS NFFD  A+KEA
Sbjct  1    MKIEIKESTMVRPAAETPSGSLWLSNLDLLSPANYHTLSVHFYSHDGSANFFDATALKEA  60

Query  375  LSRVLVSFYPMAGRM  419
            LSR LV FYP AGR+
Sbjct  61   LSRALVDFYPYAGRL  75


 Score = 46.2 bits (108),  Expect(2) = 6e-24, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 30/55 (55%), Gaps = 1/55 (2%)
 Frame = +1

Query  439  RLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPLAXF  603
            RLEIECNGEG L V A       + GDFTP   L  L+P    S   S++PL  F
Sbjct  82   RLEIECNGEGILLVEAECSGALDELGDFTPRPEL-NLIPKVDYSKGMSTYPLMLF  135



>gb|KHG08871.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
-like protein [Gossypium arboreum]
Length=434

 Score = 95.1 bits (235),  Expect(2) = 6e-24, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 60/82 (73%), Gaps = 1/82 (1%)
 Frame = +3

Query  195  KLRICIKETTMVKPAKP-TPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKE  371
            ++ I IKE+T+V+P +  TP   LW SN+DL+V R H+  VYFY+PNG   FFD   +KE
Sbjct  4    EMEISIKESTIVRPVEEYTPRGSLWNSNLDLLVVRSHVPTVYFYKPNGCSGFFDTGRLKE  63

Query  372  ALSRVLVSFYPMAGRMGRDGDG  437
            ALS+VLV FYP+AGR+G D +G
Sbjct  64   ALSKVLVPFYPIAGRLGHDENG  85


 Score = 42.7 bits (99),  Expect(2) = 6e-24, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 30/58 (52%), Gaps = 6/58 (10%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDF---GDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GRLEI CN EG LFV A +     D    GDFT       L+P    SG  SS+PL
Sbjct  83   ENGRLEITCNDEGVLFVEAETSSVLEDLIGNGDFTDN---SHLVPKVDYSGGISSYPL  137



>ref|XP_006382508.1| hypothetical protein POPTR_0005s02810g [Populus trichocarpa]
 gb|ERP60305.1| hypothetical protein POPTR_0005s02810g [Populus trichocarpa]
Length=443

 Score = 97.4 bits (241),  Expect(2) = 6e-24, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 63/82 (77%), Gaps = 1/82 (1%)
 Frame = +3

Query  195  KLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP-NGSPNFFDPKAMKE  371
            ++ I  K++T+V+PA+ TP K LW SN+DL+V  +H+  +YFY+P NGS NFFDP+ +KE
Sbjct  3    RVEIRTKQSTIVRPAEDTPEKSLWSSNLDLLVPMVHIPTIYFYKPVNGSSNFFDPQVLKE  62

Query  372  ALSRVLVSFYPMAGRMGRDGDG  437
            ALS+ LV F+ MAGR+ +D +G
Sbjct  63   ALSKALVPFHHMAGRLEKDENG  84


 Score = 40.4 bits (93),  Expect(2) = 6e-24, Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 28/55 (51%), Gaps = 1/55 (2%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+ I CN +G LFV A +     + GDFTP   +   +P    S    S+PL
Sbjct  82   ENGRMSILCNAKGVLFVEAETSSTIDEVGDFTPHSEMLQFIPEVDRSSIF-SYPL  135



>ref|XP_007027324.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Theobroma cacao]
 gb|EOY07826.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Theobroma cacao]
Length=437

 Score =   107 bits (267),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            + + +KE+TMV PA+ TP+++LW SN+DLVV R H+  VYFY+PNGS +FFD K +KE+L
Sbjct  1    MEVTMKESTMVCPAEETPNQRLWVSNLDLVVTRYHICTVYFYKPNGSSDFFDTKVLKESL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
             ++LV FYP+AGR+G D +G
Sbjct  61   GKILVPFYPIAGRLGYDENG  80



>ref|XP_008237042.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Prunus 
mume]
Length=446

 Score = 86.3 bits (212),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 52/77 (68%), Gaps = 1/77 (1%)
 Frame = +3

Query  189  SEKLRICIKETTMVKPAKP-TPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAM  365
            +EK+ + IKE+TMVKPA+  TP   LW SN+DL   R     VYFYR  G  NFFD   +
Sbjct  2    AEKVTVSIKESTMVKPAEESTPRGSLWLSNLDLEYSRHDTSTVYFYRSTGDENFFDLVVL  61

Query  366  KEALSRVLVSFYPMAGR  416
            K+ALS+ LV FYPMAGR
Sbjct  62   KQALSKALVPFYPMAGR  78


 Score = 51.2 bits (121),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 32/58 (55%), Gaps = 0/58 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPLAXF  603
            + GR+EI+CN EG LFV A S     DFGDF     L  L+P    +G  SSFP   F
Sbjct  84   QNGRMEIDCNAEGVLFVVAESISAIDDFGDFVLNPNLRELIPGVDYAGGISSFPFFAF  141



>ref|XP_007099550.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Theobroma cacao]
 gb|EOY20478.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Theobroma cacao]
Length=339

 Score =   107 bits (266),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            + I +KE+TMV PA+ TP+++LW SN+DLVV   H+  VYFY+PNGS +FFD K +KE+L
Sbjct  1    MEITMKESTMVCPAEETPNQRLWLSNLDLVVTVYHMSTVYFYKPNGSSDFFDTKVLKESL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            S++LV FYP+AGR+G D +G
Sbjct  61   SKILVPFYPVAGRLGYDENG  80



>gb|AGH61997.1| rosmarinic acid synthase [Perilla frutescens]
Length=432

 Score = 90.5 bits (223),  Expect(2) = 8e-24, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 56/80 (70%), Gaps = 1/80 (1%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVV-GRIHLLVVYFYRPNGSPNFFDPKAMKEA  374
            +RI +KE+TMV+PA  TPS  +W SN+DL+     H L V+FYR +G+ NFFDP  +K A
Sbjct  1    MRIEVKESTMVRPAAETPSGSVWLSNLDLLSPANYHTLSVHFYRHDGAANFFDPAVLKAA  60

Query  375  LSRVLVSFYPMAGRMGRDGD  434
            LSR LV FYP AGR+  + D
Sbjct  61   LSRALVDFYPYAGRLKLNDD  80


 Score = 46.6 bits (109),  Expect(2) = 8e-24, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 30/56 (54%), Gaps = 1/56 (2%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPLAXF  603
             RLEI+CNGEG L V A SD    + GDF P   L   +P    S   SS+PL  F
Sbjct  81   NRLEIDCNGEGVLLVEAESDGALEELGDFDPRPEL-NFIPKVDYSKGISSYPLMLF  135



>gb|EYU24607.1| hypothetical protein MIMGU_mgv1a006502mg [Erythranthe guttata]
Length=441

 Score = 95.1 bits (235),  Expect(2) = 9e-24, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 58/81 (72%), Gaps = 1/81 (1%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRI-HLLVVYFYRPNGSPNFFDPKAMKEA  374
            ++I +K++T+V P   TPS KLW SNVDLV     H  ++YFYR NGS NFFDP  +  A
Sbjct  1    MKITVKKSTVVTPNAATPSGKLWISNVDLVTATTYHTRILYFYRFNGSANFFDPAVLMAA  60

Query  375  LSRVLVSFYPMAGRMGRDGDG  437
            LSRVLV +YP+AGR+ RD +G
Sbjct  61   LSRVLVEYYPVAGRLTRDEEG  81


 Score = 42.4 bits (98),  Expect(2) = 9e-24, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 29/55 (53%), Gaps = 1/55 (2%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+ I CNGEG LFV A  D    D G F P   L  L P+   S   S++PL
Sbjct  79   EEGRISINCNGEGVLFVEAECDGEIDDLGGFAPRPDL-SLNPAVDYSLGISTYPL  132



>ref|XP_011036823.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Populus 
euphratica]
Length=443

 Score = 96.7 bits (239),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 64/82 (78%), Gaps = 1/82 (1%)
 Frame = +3

Query  195  KLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP-NGSPNFFDPKAMKE  371
            ++ I +KE+T+V+PA+ TP K LW SN+DL+V  +H+  +YFY+P NGS NFFDP+ +K+
Sbjct  3    RVEIRMKESTIVRPAEDTPEKSLWSSNLDLLVPSVHIPTIYFYKPVNGSSNFFDPQVLKD  62

Query  372  ALSRVLVSFYPMAGRMGRDGDG  437
            ALS+ LV F+ +AGR+ +D +G
Sbjct  63   ALSKALVPFHHVAGRLEKDENG  84


 Score = 40.4 bits (93),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 28/55 (51%), Gaps = 1/55 (2%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+ I CN +G LFV A +     + GDFTP   +   +P    S    S+PL
Sbjct  82   ENGRMSILCNAKGVLFVEAETSSTIDEVGDFTPHSEMLQFIPEVDRSSIF-SYPL  135



>ref|XP_003575337.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Brachypodium 
distachyon]
Length=442

 Score = 82.4 bits (202),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 56/83 (67%), Gaps = 3/83 (4%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPN---FFDPKAMK  368
            ++I ++ +T+V+PA+ TP  +LW +N DLVV R H   VYFYR + +     +FD + M+
Sbjct  1    MKITVRGSTVVRPAEETPRMRLWNANPDLVVPRFHTPSVYFYRRDAAVEVGCYFDAERMR  60

Query  369  EALSRVLVSFYPMAGRMGRDGDG  437
             AL+  LV FYPMAGR+ RD DG
Sbjct  61   RALAEALVPFYPMAGRLARDEDG  83


 Score = 54.3 bits (129),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 36/56 (64%), Gaps = 1/56 (2%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXS-DXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+CN EG LFV A + D    D+GDF P + L  L+P+   +G  SS+PL
Sbjct  81   EDGRVEIDCNAEGVLFVEADAPDGTVDDYGDFAPTMELKRLIPAIDFTGGISSYPL  136



>ref|XP_008370591.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Malus 
domestica]
Length=332

 Score = 87.8 bits (216),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 59/85 (69%), Gaps = 2/85 (2%)
 Frame = +3

Query  183  MASEKLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP--NGSPNFFDP  356
            MA + +++ ++++TMVKP +  P + LW SN+DLV    H+  VYFYRP  N   NFFDP
Sbjct  1    MAEKVMKVSVRDSTMVKPVEEMPPRALWLSNLDLVRRVNHMPSVYFYRPDQNCRSNFFDP  60

Query  357  KAMKEALSRVLVSFYPMAGRMGRDG  431
              +K ALS+ LV FYP+AGR+ ++G
Sbjct  61   AVLKHALSKALVLFYPLAGRLKQNG  85


 Score = 48.9 bits (115),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 32/54 (59%), Gaps = 1/54 (2%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDF-GDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            GRLEI+CN EG LFV A +     D+ GDF P      L+PS  +S   SS+PL
Sbjct  86   GRLEIDCNAEGVLFVVAETTSVDLDYLGDFAPTDEFNNLIPSVDSSVGLSSYPL  139



>gb|KFK27325.1| hypothetical protein AALP_AA8G368300 [Arabis alpina]
Length=444

 Score = 87.0 bits (214),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            ++I +K+ T+VKP++ TP   LW SN+DL+  R H+ ++YFY P  S NF + +++ EAL
Sbjct  1    MKIRVKQETVVKPSEETPKHSLWLSNLDLIQVRFHMGILYFYNPCSSSNFPNTQSLIEAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            S+VLV FYP AGR+ +D +G
Sbjct  61   SKVLVLFYPAAGRLQKDKNG  80


 Score = 49.3 bits (116),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 31/56 (55%), Gaps = 0/56 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPLAXF  603
            GRLE+ C+GEG LFV A +D    D G  T  L +  L+P+   S   SS PL  F
Sbjct  80   GRLEVRCSGEGVLFVEAETDSTVQDIGLLTQSLDVSQLVPTLDYSQDISSIPLLLF  135



>ref|XP_010101376.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
 gb|EXB88323.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
Length=446

 Score = 82.0 bits (201),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 57/81 (70%), Gaps = 2/81 (2%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYR--PNGSPNFFDPKAMKE  371
            ++I +KE T+V+PA+ TP + LW S++DL+VG  H+  VYFYR   +G+ +FFD   +K 
Sbjct  2    IKIEVKEATVVRPAEETPRRVLWSSSLDLLVGSNHVPTVYFYRRPTDGAADFFDVAVLKA  61

Query  372  ALSRVLVSFYPMAGRMGRDGD  434
             L + LV FYP+AGR+ ++ D
Sbjct  62   TLGKALVPFYPLAGRLRQNND  82


 Score = 54.7 bits (130),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
             R+EI+CN EG LFV A +D    DFGDF P      L+P+   SG  SS+P+
Sbjct  84   NRIEIDCNAEGVLFVEAETDSALDDFGDFAPSPEFHGLIPAVDYSGGISSYPV  136



>sp|G0LD36.1|RAS_MELOI RecName: Full=Rosmarinate synthase; Short=MoRAS; AltName: Full=Hydroxycinnamoyl-CoA:hydroxyphenyllactate 
hydroxycinnamoyltransferase 
[Melissa officinalis]
 emb|CBW35684.1| hydroxycinnamoyl-CoA:hydroxyphenyllactate hydroxycinnamoyltransferase 
[Melissa officinalis]
Length=427

 Score = 89.4 bits (220),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVV-GRIHLLVVYFYRPNGSPNFFDPKAMKEA  374
            +RI IK++TMVKPA  TP   +W +N+DL+     H L V+FY  +GS NFFD  A+KEA
Sbjct  1    MRIDIKDSTMVKPAAETPGGSVWLTNLDLLSPANYHTLSVHFYHHDGSENFFDAAALKEA  60

Query  375  LSRVLVSFYPMAGRM  419
            LSR LV FYP AGR+
Sbjct  61   LSRALVDFYPYAGRL  75


 Score = 47.4 bits (111),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 35/64 (55%), Gaps = 1/64 (2%)
 Frame = +1

Query  412  VGWVGMEMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFP  591
             G + ++  RLEI+CNGEG L V A SD    + G+F P   L  L+P    +   S++P
Sbjct  72   AGRLKLKDNRLEIDCNGEGVLLVEAESDGALAELGEFAPRPDL-NLIPQVDYAKGISTYP  130

Query  592  LAXF  603
            L  F
Sbjct  131  LMLF  134



>ref|XP_006453163.1| hypothetical protein CICLE_v10010833mg [Citrus clementina]
 ref|XP_006474347.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Citrus 
sinensis]
 gb|ESR66403.1| hypothetical protein CICLE_v10010833mg [Citrus clementina]
Length=447

 Score = 87.8 bits (216),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 56/81 (69%), Gaps = 1/81 (1%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYR-PNGSPNFFDPKAMKEA  374
            + I IKE+T V+PA+ TP   L  +N+DL +G  H+  VY YR PN   NFFD  A+KEA
Sbjct  1    MEIQIKESTTVRPAEETPKHCLRLTNLDLFLGTSHVPTVYVYRRPNDCTNFFDAGALKEA  60

Query  375  LSRVLVSFYPMAGRMGRDGDG  437
            LS VLV FYP+AGR G+D +G
Sbjct  61   LSHVLVPFYPVAGRFGKDENG  81


 Score = 48.5 bits (114),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 32/56 (57%), Gaps = 2/56 (4%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGD-FTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+E++CN EG LFV A +     D GD FTP   L  L+P   T    SS+PL
Sbjct  79   ENGRMEVKCNAEGVLFVVAEASCVIDDLGDSFTPSFKLQQLVPRVDTKD-ISSYPL  133



>gb|EAY94737.1| hypothetical protein OsI_16513 [Oryza sativa Indica Group]
Length=155

 Score = 83.2 bits (204),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 52/83 (63%), Gaps = 5/83 (6%)
 Frame = +3

Query  204  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYR-----PNGSPNFFDPKAMK  368
            I ++ +TMV+PA  TP  +LW SN+DLVV R H   VYFYR           FFD + M+
Sbjct  3    ITVRRSTMVRPAWETPRVRLWNSNLDLVVPRFHTPSVYFYRRGPEGGGAPEGFFDGERMR  62

Query  369  EALSRVLVSFYPMAGRMGRDGDG  437
             AL+  LV FYPMAGR+ RD DG
Sbjct  63   RALAEALVPFYPMAGRLARDEDG  85


 Score = 53.1 bits (126),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (63%), Gaps = 1/56 (2%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXS-DXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+CNGEG LFV A + D    D+GDF P + L  L+P+   +   SSF L
Sbjct  83   EDGRVEIDCNGEGVLFVEADAPDASVDDYGDFAPTMELKRLIPAVDYTDDISSFSL  138



>ref|XP_006280408.1| hypothetical protein CARUB_v10026341mg, partial [Capsella rubella]
 gb|EOA13306.1| hypothetical protein CARUB_v10026341mg, partial [Capsella rubella]
Length=472

 Score = 81.3 bits (199),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = +3

Query  195  KLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEA  374
            +++I +K+ T+VKPAK TP+  LW SN+DL+  R H+  +YFY    S N  + K++ +A
Sbjct  29   QMKIRVKQATIVKPAKETPTHSLWLSNLDLIQVRFHMGKLYFYNLCSSSNLPNTKSLIDA  88

Query  375  LSRVLVSFYPMAGRMGRDGDG  437
            LS+VL  FYP AGR+ +D +G
Sbjct  89   LSKVLFLFYPAAGRLQKDKNG  109


 Score = 55.1 bits (131),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 32/56 (57%), Gaps = 0/56 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPLAXF  603
            GRLE+ CNGEG + V A +D    D G  T  L L  L+P+   SG  SSFPL  F
Sbjct  109  GRLEVRCNGEGIMLVEAETDSTVQDIGLLTQSLDLSQLVPTIDYSGDISSFPLVLF  164



>ref|XP_007216058.1| hypothetical protein PRUPE_ppa017691mg [Prunus persica]
 gb|EMJ17257.1| hypothetical protein PRUPE_ppa017691mg [Prunus persica]
Length=443

 Score = 81.6 bits (200),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 51/78 (65%), Gaps = 1/78 (1%)
 Frame = +3

Query  189  SEKLRICIKETTMVKPAKP-TPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAM  365
            +EK+ + I+E+TMV+PA+  TP   LW SN DL     H   VYFY+ +G  NFFD   +
Sbjct  2    AEKVMVSIRESTMVRPAEESTPRGSLWLSNSDLAFPPFHTSSVYFYKSSGEHNFFDKGVL  61

Query  366  KEALSRVLVSFYPMAGRM  419
            K+AL + LV FYPMAGR 
Sbjct  62   KQALGKALVPFYPMAGRF  79


 Score = 54.3 bits (129),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 33/55 (60%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            + GR+EI+CN EG +FV A S     DFGDF P      L+P+   SG  SS+P+
Sbjct  84   QNGRVEIDCNAEGVVFVVAESSSAVDDFGDFAPTPDFLTLIPTIDYSGGISSYPI  138



>dbj|BAJ91003.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=147

 Score = 85.5 bits (210),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 54/82 (66%), Gaps = 2/82 (2%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYR--PNGSPNFFDPKAMKE  371
            + I ++ +TMV+PA   P ++LW SN+DLVV R H   VYFYR    G+  FFD   M+ 
Sbjct  1    MAITVRRSTMVRPAVERPRERLWNSNLDLVVPRFHTPSVYFYRRPEAGADGFFDAGRMRL  60

Query  372  ALSRVLVSFYPMAGRMGRDGDG  437
            AL+  LV FYPMAGR+ RD DG
Sbjct  61   ALADALVPFYPMAGRLARDEDG  82


 Score = 50.8 bits (120),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 34/56 (61%), Gaps = 1/56 (2%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXX-DFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+C+GEG LFV A +      D+GDF P + L  L+P    +   SSFPL
Sbjct  80   EDGRVEIDCSGEGVLFVEADAPTATVDDYGDFAPTMDLKRLIPPVDYTDDISSFPL  135



>ref|XP_006401163.1| hypothetical protein EUTSA_v10013552mg [Eutrema salsugineum]
 gb|ESQ42616.1| hypothetical protein EUTSA_v10013552mg [Eutrema salsugineum]
Length=443

 Score = 85.1 bits (209),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  377
            ++I +K+ T+VKPA+ TP+  LW SN+DL+  R H+ ++YFY P  S N  + +++ +AL
Sbjct  1    MKIRVKQATVVKPAEETPTHSLWLSNLDLIQVRFHMGMLYFYNPCSSSNLSNTQSLIDAL  60

Query  378  SRVLVSFYPMAGRMGRDGDG  437
            S+VLV FYP AGR+ +D  G
Sbjct  61   SKVLVPFYPAAGRLQKDKSG  80


 Score = 50.8 bits (120),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 30/56 (54%), Gaps = 0/56 (0%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPLAXF  603
            GRLE+ CNGEG L V A +D    D G  T  L L  L+P+   S   SS PL  F
Sbjct  80   GRLEVRCNGEGVLLVEAETDSTLKDIGLLTQSLDLSQLVPTLDYSADISSLPLLLF  135



>ref|XP_007217854.1| hypothetical protein PRUPE_ppa024073mg [Prunus persica]
 gb|EMJ19053.1| hypothetical protein PRUPE_ppa024073mg [Prunus persica]
Length=430

 Score = 84.0 bits (206),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 58/88 (66%), Gaps = 4/88 (5%)
 Frame = +3

Query  189  SEKLRICIKETTMVKPAK-PTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAM  365
            +EK+ + ++E+TMV+PA+  TP   LW SN DL     H   VYFYR +G  NFFD + +
Sbjct  2    TEKVTVSVRESTMVRPAEESTPRGSLWLSNSDLAFTPFHTSSVYFYRTSGELNFFDRRVL  61

Query  366  KEALSRVLVSFYPMAGRM---GRDGDGE  440
            K+ALS+VLV F PMAGR     ++G GE
Sbjct  62   KQALSKVLVPFCPMAGRFKLNDQNGRGE  89


 Score = 52.0 bits (123),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 32/55 (58%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            + GR EI+CN EG LFV A S+    DFGDF P      L+P+   S   SS+PL
Sbjct  84   QNGRGEIDCNAEGVLFVVAESNSVVDDFGDFAPTSDFLKLIPAVEYSVGISSYPL  138



>dbj|BAC78634.1| hydroxyanthranilate hydroxycinnamoyltransferase 2 [Avena sativa]
Length=440

 Score = 82.4 bits (202),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 54/83 (65%), Gaps = 3/83 (4%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYR---PNGSPNFFDPKAMK  368
            ++I ++ TT+V PA  TP  +LW +N DLVV R H   VYFYR    +G+  +FD   M+
Sbjct  1    MKITVRSTTVVVPAAETPRLRLWNANPDLVVPRFHTPSVYFYRRGDGDGAACYFDAARMR  60

Query  369  EALSRVLVSFYPMAGRMGRDGDG  437
             AL+  LV+FYPMAGR+  D DG
Sbjct  61   RALAEALVTFYPMAGRLAHDEDG  83


 Score = 53.5 bits (127),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 36/56 (64%), Gaps = 1/56 (2%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXS-DXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+CN EG LF+ A + D    DFGDF P + L  L+P+   +G  SS+PL
Sbjct  81   EDGRVEIDCNAEGVLFLEADAPDGTVDDFGDFAPTMGLKRLIPTVDFTGGISSYPL  136



>emb|CAE01635.3| OSJNBa0029H02.19 [Oryza sativa Japonica Group]
Length=484

 Score = 82.8 bits (203),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 53/85 (62%), Gaps = 5/85 (6%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYR-----PNGSPNFFDPKA  362
            + I ++ +TMV+PA  TP  +LW SN+DLVV R H   VYFYR           FFD + 
Sbjct  1    MAITVRRSTMVRPAWETPRVRLWNSNLDLVVPRFHTPSVYFYRRGPEGGGAPEGFFDGER  60

Query  363  MKEALSRVLVSFYPMAGRMGRDGDG  437
            M+ AL+  LV FYPMAGR+ RD DG
Sbjct  61   MRRALAEALVPFYPMAGRLARDEDG  85


 Score = 52.8 bits (125),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (63%), Gaps = 1/56 (2%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXS-DXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+CNGEG LFV A + D    D+GDF P + L  L+P+   +   SSF L
Sbjct  83   EDGRVEIDCNGEGVLFVEADAPDASVDDYGDFAPTMELKRLIPAVDYTDDISSFSL  138



>gb|AJA31666.1| rosmarinic acid synthase [Salvia miltiorrhiza]
Length=427

 Score = 86.7 bits (213),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVV-GRIHLLVVYFYRPNGSPNFFDPKAMKEA  374
            ++I I ++TMV+PA  TPS  LW SN+DL+     H L V+FYR +GS NFF+  A+KEA
Sbjct  1    MKIDITDSTMVQPAAETPSGSLWLSNLDLLSPANYHTLSVHFYRHDGSGNFFEAAALKEA  60

Query  375  LSRVLVSFYPMAGRM  419
            L R LV FYP AGR+
Sbjct  61   LGRALVEFYPYAGRL  75


 Score = 48.9 bits (115),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 35/64 (55%), Gaps = 1/64 (2%)
 Frame = +1

Query  412  VGWVGMEMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFP  591
             G + ++  RLEI+CNGEG L V A SD    + GDF P   L  L+P    +   S++P
Sbjct  72   AGRLQLKDNRLEIDCNGEGVLLVEAESDGTLEELGDFAPRPDL-TLIPKVNYAKGISTYP  130

Query  592  LAXF  603
            L  F
Sbjct  131  LMLF  134



>gb|ADA60182.1| rosmarinic acid synthase [Salvia miltiorrhiza]
Length=427

 Score = 86.7 bits (213),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVV-GRIHLLVVYFYRPNGSPNFFDPKAMKEA  374
            ++I I ++TMV+PA  TPS  LW SN+DL+     H L V+FYR +GS NFF+  A+KEA
Sbjct  1    MKIDITDSTMVQPAAETPSGSLWLSNLDLLSPANYHTLSVHFYRHDGSGNFFEAAALKEA  60

Query  375  LSRVLVSFYPMAGRM  419
            L R LV FYP AGR+
Sbjct  61   LGRALVEFYPYAGRL  75


 Score = 48.9 bits (115),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 35/64 (55%), Gaps = 1/64 (2%)
 Frame = +1

Query  412  VGWVGMEMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFP  591
             G + ++  RLEI+CNGEG L V A SD    + GDF P   L  L+P    +   S++P
Sbjct  72   AGRLQLKDNRLEIDCNGEGVLLVEAESDGTLEELGDFAPRPDL-TLIPKVNYAKGISTYP  130

Query  592  LAXF  603
            L  F
Sbjct  131  LMLF  134



>ref|NP_001053225.1| Os04g0500700 [Oryza sativa Japonica Group]
 emb|CAC09509.2| H0711G06.15 [Oryza sativa Indica Group]
 dbj|BAF15139.1| Os04g0500700 [Oryza sativa Japonica Group]
 dbj|BAG96851.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99596.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC77573.1| hypothetical protein OsI_16514 [Oryza sativa Indica Group]
 gb|EEE61270.1| hypothetical protein OsJ_15346 [Oryza sativa Japonica Group]
Length=442

 Score = 82.8 bits (203),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 53/85 (62%), Gaps = 5/85 (6%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYR-----PNGSPNFFDPKA  362
            + I ++ +TMV+PA  TP  +LW SN+DLVV R H   VYFYR           FFD + 
Sbjct  1    MAITVRRSTMVRPAWETPRVRLWNSNLDLVVPRFHTPSVYFYRRGPEGGGAPEGFFDGER  60

Query  363  MKEALSRVLVSFYPMAGRMGRDGDG  437
            M+ AL+  LV FYPMAGR+ RD DG
Sbjct  61   MRRALAEALVPFYPMAGRLARDEDG  85


 Score = 52.4 bits (124),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (63%), Gaps = 1/56 (2%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXS-DXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+CNGEG LFV A + D    D+GDF P + L  L+P+   +   SSF L
Sbjct  83   EDGRVEIDCNGEGVLFVEADAPDASVDDYGDFAPTMELKRLIPAVDYTDDISSFSL  138



>dbj|BAJ93247.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=438

 Score = 85.1 bits (209),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 54/82 (66%), Gaps = 2/82 (2%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYR--PNGSPNFFDPKAMKE  371
            + I ++ +TMV+PA   P ++LW SN+DLVV R H   VYFYR    G+  FFD   M+ 
Sbjct  1    MAITVRRSTMVRPAVERPRERLWNSNLDLVVPRFHTPSVYFYRRPEAGADGFFDADRMRL  60

Query  372  ALSRVLVSFYPMAGRMGRDGDG  437
            AL+  LV FYPMAGR+ RD DG
Sbjct  61   ALADALVPFYPMAGRLARDEDG  82


 Score = 50.4 bits (119),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 34/56 (61%), Gaps = 1/56 (2%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXX-DFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+C+GEG LFV A +      D+GDF P + L  L+P    +   SSFPL
Sbjct  80   EDGRVEIDCSGEGVLFVEADAPTATVDDYGDFAPTMDLKRLIPPVDYTDDISSFPL  135



>dbj|BAJ95750.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=438

 Score = 85.1 bits (209),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 54/82 (66%), Gaps = 2/82 (2%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYR--PNGSPNFFDPKAMKE  371
            + I ++ +TMV+PA   P ++LW SN+DLVV R H   VYFYR    G+  FFD   M+ 
Sbjct  1    MAITVRRSTMVRPAVERPRERLWNSNLDLVVPRFHTPSVYFYRRPEAGADGFFDADRMRL  60

Query  372  ALSRVLVSFYPMAGRMGRDGDG  437
            AL+  LV FYPMAGR+ RD DG
Sbjct  61   ALADALVPFYPMAGRLARDEDG  82


 Score = 50.1 bits (118),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 34/56 (61%), Gaps = 1/56 (2%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXX-DFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+C+GEG LFV A +      D+GDF P + L  L+P    +   SSFPL
Sbjct  80   EDGRVEIDCSGEGVLFVEADAPTATVDDYGDFAPTMDLKRLIPPVDYTDDISSFPL  135



>gb|AEA36976.1| rosmarinic acid synthase [Lavandula angustifolia]
Length=460

 Score = 89.0 bits (219),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVV-GRIHLLVVYFYRPNGSPNFFDPKAMKEA  374
            ++I IKE+TMV+PA  TPS  LW SN+DL+     H L V+FY  +GS NFF   A+KEA
Sbjct  1    MKIEIKESTMVRPAAETPSGSLWLSNLDLLSPANYHTLSVHFYSHDGSANFFGAAALKEA  60

Query  375  LSRVLVSFYPMAGRM  419
            LSR LV FYP AGR+
Sbjct  61   LSRALVDFYPYAGRL  75


 Score = 46.2 bits (108),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 30/56 (54%), Gaps = 1/56 (2%)
 Frame = +1

Query  436  GRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPLAXF  603
             RLEIECNGEG L V A       + GDFTP   L  L+P    S   S++PL  F
Sbjct  81   NRLEIECNGEGILLVEAECGGALDELGDFTPRPQL-NLIPKVDYSKGMSAYPLMLF  135



>emb|CDG56248.1| hydroxycinnamoyl-CoA:shikimate hydroxycinnamoyltransferase 1 
[Glechoma hederacea]
Length=434

 Score = 79.0 bits (193),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 56/83 (67%), Gaps = 3/83 (4%)
 Frame = +3

Query  198  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGS---PNFFDPKAMK  368
            ++I ++++T+V+P+  TP+  LW SNVDLVV   H   VYFYRP+G     +FFD   MK
Sbjct  1    MKIEVRDSTLVRPSAATPAVSLWNSNVDLVVPNFHTPSVYFYRPDGGAAAADFFDTAVMK  60

Query  369  EALSRVLVSFYPMAGRMGRDGDG  437
             AL   LV FYPMAGR+ RD DG
Sbjct  61   AALGLALVPFYPMAGRLKRDEDG  83


 Score = 55.8 bits (133),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = +1

Query  430  EMGRLEIECNGEGALFVXAXSDXXXXDFGDFTPXLXLXXLLPSXXTSGXXSSFPL  594
            E GR+EI+CN EG LFV A SD    D+GDF P L L  L+P+   S   S++ L
Sbjct  81   EDGRVEIDCNAEGVLFVEAESDGSVDDYGDFAPNLELRRLIPAVDYSQGISTYAL  135



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 889770574917