BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig2154

Length=1345
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011080847.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like...    607   0.0      
ref|XP_009780466.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       604   0.0      Nicotiana sylvestris
ref|XP_011080848.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like...    602   0.0      Sesamum indicum [beniseed]
ref|XP_010323334.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1 isof...    592   0.0      Solanum lycopersicum
ref|XP_010323335.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1 isof...    591   0.0      Solanum lycopersicum
ref|XP_004500227.1|  PREDICTED: peptide transporter PTR5-like iso...    589   0.0      Cicer arietinum [garbanzo]
ref|XP_006362448.1|  PREDICTED: peptide transporter PTR1-like           585   0.0      Solanum tuberosum [potatoes]
ref|XP_006591201.1|  PREDICTED: peptide transporter PTR1-like iso...    582   0.0      Glycine max [soybeans]
ref|XP_006350821.1|  PREDICTED: peptide transporter PTR1-like           582   0.0      Solanum tuberosum [potatoes]
gb|KHN02576.1|  Peptide transporter PTR1                                582   0.0      Glycine soja [wild soybean]
gb|EYU45753.1|  hypothetical protein MIMGU_mgv1a003661mg                580   0.0      Erythranthe guttata [common monkey flower]
ref|XP_007146742.1|  hypothetical protein PHAVU_006G065900g             580   0.0      Phaseolus vulgaris [French bean]
ref|XP_003551296.1|  PREDICTED: peptide transporter PTR1                580   0.0      Glycine max [soybeans]
gb|KJB19923.1|  hypothetical protein B456_003G124700                    577   0.0      Gossypium raimondii
gb|KJB19921.1|  hypothetical protein B456_003G124700                    577   0.0      Gossypium raimondii
ref|XP_004241180.2|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       579   0.0      Solanum lycopersicum
emb|CDP09151.1|  unnamed protein product                                575   0.0      Coffea canephora [robusta coffee]
ref|XP_002298324.1|  hypothetical protein POPTR_0001s25570g             575   0.0      
ref|XP_007016184.1|  Peptide transporter 1                              574   0.0      
gb|ACJ85720.1|  unknown                                                 570   0.0      Medicago truncatula
ref|XP_009374278.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       572   0.0      Pyrus x bretschneideri [bai li]
gb|KEH34179.1|  proton-dependent oligopeptide transport family pr...    571   0.0      Medicago truncatula
ref|XP_002313394.1|  hypothetical protein POPTR_0009s04710g             571   0.0      
gb|KJB55776.1|  hypothetical protein B456_009G093900                    572   0.0      Gossypium raimondii
ref|XP_011032155.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       571   0.0      Populus euphratica
ref|XP_009346886.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like...    570   0.0      Pyrus x bretschneideri [bai li]
emb|CDP09153.1|  unnamed protein product                                571   0.0      Coffea canephora [robusta coffee]
ref|XP_008355414.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       570   0.0      
ref|XP_008355088.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    569   0.0      
ref|XP_004294248.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       569   0.0      Fragaria vesca subsp. vesca
ref|XP_009337310.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       569   0.0      Pyrus x bretschneideri [bai li]
ref|XP_009374282.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like...    569   0.0      Pyrus x bretschneideri [bai li]
ref|XP_002520427.1|  peptide transporter, putative                      568   0.0      Ricinus communis
ref|XP_009346885.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like...    569   0.0      Pyrus x bretschneideri [bai li]
ref|XP_008220400.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       567   0.0      Prunus mume [ume]
ref|XP_010033028.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       566   0.0      
gb|EYU45754.1|  hypothetical protein MIMGU_mgv1a024850mg                563   0.0      Erythranthe guttata [common monkey flower]
ref|XP_012068161.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       560   0.0      
ref|XP_009779291.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       560   0.0      Nicotiana sylvestris
ref|XP_012087906.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       560   0.0      Jatropha curcas
ref|XP_012068201.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       559   0.0      Jatropha curcas
ref|XP_009591017.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       559   0.0      Nicotiana tomentosiformis
ref|XP_007208292.1|  hypothetical protein PRUPE_ppa003364mg             558   0.0      Prunus persica
emb|CDP09152.1|  unnamed protein product                                558   0.0      Coffea canephora [robusta coffee]
gb|KHN40046.1|  Peptide transporter PTR1                                556   0.0      Glycine soja [wild soybean]
ref|XP_003544872.1|  PREDICTED: peptide transporter PTR1-like iso...    556   0.0      Glycine max [soybeans]
gb|KDO66792.1|  hypothetical protein CISIN_1g0086231mg                  555   0.0      Citrus sinensis [apfelsine]
ref|XP_010528782.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1            556   0.0      Tarenaya hassleriana [spider flower]
ref|XP_006425015.1|  hypothetical protein CICLE_v10028095mg             555   0.0      Citrus clementina [clementine]
gb|KJB36886.1|  hypothetical protein B456_006G180700                    554   0.0      Gossypium raimondii
gb|KJB21652.1|  hypothetical protein B456_004G006700                    553   0.0      Gossypium raimondii
gb|KHG08248.1|  Peptide transporter PTR1 -like protein                  553   0.0      Gossypium arboreum [tree cotton]
gb|KDO53228.1|  hypothetical protein CISIN_1g0083672mg                  552   0.0      Citrus sinensis [apfelsine]
ref|XP_006429306.1|  hypothetical protein CICLE_v10011381mg             552   0.0      Citrus clementina [clementine]
ref|XP_007026785.1|  Peptide transporter 1 isoform 1                    552   0.0      
ref|XP_004143145.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       552   0.0      Cucumis sativus [cucumbers]
ref|XP_004490642.1|  PREDICTED: peptide transporter PTR1-like           551   0.0      Cicer arietinum [garbanzo]
ref|XP_010262765.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       551   0.0      Nelumbo nucifera [Indian lotus]
ref|XP_010650937.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like...    550   0.0      
gb|KGN47104.1|  hypothetical protein Csa_6G187970                       551   0.0      Cucumis sativus [cucumbers]
ref|XP_010650936.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like...    550   0.0      Vitis vinifera
ref|XP_010044085.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1            549   0.0      Eucalyptus grandis [rose gum]
ref|XP_006403613.1|  hypothetical protein EUTSA_v10010246mg             545   0.0      Eutrema salsugineum [saltwater cress]
ref|XP_011090498.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       545   0.0      Sesamum indicum [beniseed]
ref|XP_002533893.1|  peptide transporter, putative                      562   0.0      
ref|NP_190982.1|  peptide transporter PTR1                              544   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002877959.1|  proton-dependent oligopeptide transport fami...    543   0.0      Arabidopsis lyrata subsp. lyrata
ref|XP_011081130.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       543   0.0      
ref|XP_012088023.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       543   0.0      Jatropha curcas
emb|CDY13185.1|  BnaC04g26500D                                          542   0.0      Brassica napus [oilseed rape]
ref|XP_003518298.1|  PREDICTED: peptide transporter PTR1-like           542   0.0      Glycine max [soybeans]
ref|XP_010654188.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       541   0.0      Vitis vinifera
ref|XP_006292488.1|  hypothetical protein CARUB_v10018717mg             540   0.0      Capsella rubella
gb|AFN53657.1|  putative peptide transporter                            540   0.0      Linum usitatissimum
ref|XP_009139262.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1            539   0.0      Brassica rapa
ref|XP_011077583.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       538   0.0      Sesamum indicum [beniseed]
ref|XP_008345515.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       538   0.0      Malus domestica [apple tree]
gb|EPS59528.1|  hypothetical protein M569_15276                         537   0.0      Genlisea aurea
ref|XP_010654192.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       537   0.0      Vitis vinifera
ref|XP_003529142.1|  PREDICTED: peptide transporter PTR1-like iso...    536   0.0      Glycine max [soybeans]
ref|XP_010923125.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       536   0.0      Elaeis guineensis
ref|XP_008464060.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       536   0.0      Cucumis melo [Oriental melon]
ref|XP_008442465.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    536   0.0      
ref|XP_010504206.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       535   0.0      Camelina sativa [gold-of-pleasure]
ref|XP_010427083.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1            535   0.0      Camelina sativa [gold-of-pleasure]
gb|KHG14016.1|  Peptide transporter PTR1 -like protein                  534   0.0      Gossypium arboreum [tree cotton]
ref|XP_010515930.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       535   0.0      Camelina sativa [gold-of-pleasure]
ref|XP_004137914.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2            534   0.0      Cucumis sativus [cucumbers]
ref|XP_006287367.1|  hypothetical protein CARUB_v10000567mg             534   0.0      Capsella rubella
ref|XP_007140383.1|  hypothetical protein PHAVU_008G107200g             533   0.0      Phaseolus vulgaris [French bean]
ref|XP_010558361.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       533   0.0      Tarenaya hassleriana [spider flower]
ref|XP_008388132.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       532   0.0      
ref|NP_195738.1|  peptide transporter PTR5                              531   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_011090404.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       530   0.0      Sesamum indicum [beniseed]
gb|KEH23143.1|  proton-dependent oligopeptide transport family pr...    530   0.0      Medicago truncatula
ref|XP_009774291.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       530   0.0      Nicotiana sylvestris
ref|XP_002870939.1|  proton-dependent oligopeptide transport fami...    529   1e-180   
ref|XP_010104684.1|  Peptide transporter                                530   1e-180   
ref|XP_004308641.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       529   2e-180   Fragaria vesca subsp. vesca
ref|XP_006429308.1|  hypothetical protein CICLE_v10013821mg             528   2e-180   Citrus clementina [clementine]
ref|XP_009624728.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       527   1e-179   Nicotiana tomentosiformis
ref|XP_010033021.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       526   2e-179   Eucalyptus grandis [rose gum]
ref|XP_008242154.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       526   2e-179   
ref|XP_011466487.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       526   2e-179   Fragaria vesca subsp. vesca
ref|XP_008239599.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       525   6e-179   Prunus mume [ume]
ref|XP_010101811.1|  Peptide transporter                                525   8e-179   Morus notabilis
ref|XP_006848107.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1            525   8e-179   Amborella trichopoda
ref|XP_008785424.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       524   1e-178   Phoenix dactylifera
ref|XP_010423917.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2            523   3e-178   Camelina sativa [gold-of-pleasure]
ref|XP_009405847.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       523   4e-178   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010490600.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       523   5e-178   Camelina sativa [gold-of-pleasure]
ref|XP_009624729.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       523   6e-178   Nicotiana tomentosiformis
ref|XP_010452016.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       521   3e-177   Camelina sativa [gold-of-pleasure]
ref|XP_007207074.1|  hypothetical protein PRUPE_ppa025891mg             520   3e-177   
ref|XP_007205100.1|  hypothetical protein PRUPE_ppa014631mg             519   4e-177   
ref|XP_011003666.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       520   7e-177   Populus euphratica
ref|XP_006373974.1|  hypothetical protein POPTR_0016s11940g             520   7e-177   
ref|XP_002323559.2|  proton-dependent oligopeptide transport fami...    520   9e-177   
ref|XP_004492413.1|  PREDICTED: peptide transporter PTR1-like iso...    519   1e-176   Cicer arietinum [garbanzo]
ref|XP_009795638.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       520   1e-176   Nicotiana sylvestris
ref|XP_009421313.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       519   2e-176   
ref|XP_006363097.1|  PREDICTED: peptide transporter PTR1-like           518   3e-176   
emb|CBI30424.3|  unnamed protein product                                543   1e-175   Vitis vinifera
ref|XP_008775060.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       517   1e-175   Phoenix dactylifera
gb|EYU41841.1|  hypothetical protein MIMGU_mgv1a017650mg                515   4e-175   Erythranthe guttata [common monkey flower]
ref|XP_009358875.1|  PREDICTED: uncharacterized protein LOC103949485    533   4e-175   
ref|XP_006398647.1|  hypothetical protein EUTSA_v10013125mg             515   5e-175   Eutrema salsugineum [saltwater cress]
ref|XP_011003660.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like...    515   6e-175   Populus euphratica
ref|XP_011019153.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1            514   6e-175   Populus euphratica
ref|XP_003604615.1|  Peptide transporter PTR1                           514   2e-174   Medicago truncatula
gb|KHN42300.1|  Peptide transporter PTR1                                513   2e-174   Glycine soja [wild soybean]
ref|XP_003516940.1|  PREDICTED: peptide transporter PTR1-like iso...    513   2e-174   
ref|XP_011003661.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like...    513   3e-174   Populus euphratica
ref|XP_010262762.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       513   3e-174   Nelumbo nucifera [Indian lotus]
ref|XP_004506789.1|  PREDICTED: peptide transporter PTR1-like iso...    513   6e-174   
ref|XP_009374284.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like...    510   2e-173   
ref|XP_006363053.1|  PREDICTED: peptide transporter PTR1-like           509   5e-173   
ref|XP_006848110.2|  PREDICTED: protein NRT1/ PTR FAMILY 8.1 isof...    509   1e-172   
ref|XP_010676231.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       508   3e-172   
emb|CDY10485.1|  BnaCnng03860D                                          508   3e-172   Brassica napus [oilseed rape]
ref|XP_009122828.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2            508   3e-172   Brassica rapa
gb|ERN09691.1|  hypothetical protein AMTR_s00029p00215100               508   4e-172   Amborella trichopoda
ref|XP_011466488.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       507   6e-172   Fragaria vesca subsp. vesca
ref|XP_009116102.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1            505   2e-171   Brassica rapa
gb|KJB55777.1|  hypothetical protein B456_009G093900                    504   3e-171   Gossypium raimondii
ref|XP_007016185.1|  Peptide transporter 1                              505   4e-171   
ref|XP_002309120.2|  proton-dependent oligopeptide transport fami...    504   6e-171   
ref|XP_010907628.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       504   2e-170   
ref|XP_011094976.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    521   2e-170   Sesamum indicum [beniseed]
ref|XP_004968169.1|  PREDICTED: peptide transporter PTR1-like iso...    501   1e-169   
gb|KHN06246.1|  Peptide transporter PTR1                                497   9e-169   Glycine soja [wild soybean]
gb|EYU41851.1|  hypothetical protein MIMGU_mgv1a020985mg                498   2e-168   Erythranthe guttata [common monkey flower]
ref|XP_010326140.1|  PREDICTED: uncharacterized protein LOC101268606    516   2e-168   
gb|KDO53230.1|  hypothetical protein CISIN_1g0083672mg                  496   5e-168   Citrus sinensis [apfelsine]
ref|XP_004246936.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       496   6e-168   
emb|CDX78212.1|  BnaA09g34070D                                          492   6e-168   
gb|KDO53231.1|  hypothetical protein CISIN_1g008792mg                   496   8e-168   Citrus sinensis [apfelsine]
gb|EYU26644.1|  hypothetical protein MIMGU_mgv1a003683mg                496   2e-167   Erythranthe guttata [common monkey flower]
ref|XP_006365609.1|  PREDICTED: peptide transporter PTR5-like           495   2e-167   Solanum tuberosum [potatoes]
ref|NP_001131161.1|  uncharacterized protein LOC100192469               492   9e-166   Zea mays [maize]
ref|XP_009392698.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       490   3e-165   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009405229.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       488   3e-164   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004504618.1|  PREDICTED: peptide transporter PTR2-like           488   4e-164   Cicer arietinum [garbanzo]
ref|XP_010513957.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3            487   6e-164   Camelina sativa [gold-of-pleasure]
ref|XP_010502212.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       487   9e-164   Camelina sativa [gold-of-pleasure]
ref|XP_006292510.1|  hypothetical protein CARUB_v10018740mg             486   2e-163   
ref|NP_178313.1|  peptide transporter PTR2                              485   3e-163   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010424976.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       485   4e-163   Camelina sativa [gold-of-pleasure]
gb|EPS69660.1|  hypothetical protein M569_05105                         484   7e-163   Genlisea aurea
ref|XP_002875108.1|  ATPTR2-B                                           484   1e-162   
ref|XP_006395818.1|  hypothetical protein EUTSA_v10003893mg             483   2e-162   Eutrema salsugineum [saltwater cress]
ref|XP_012072405.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       482   5e-162   Jatropha curcas
ref|NP_001041994.1|  Os01g0142800                                       482   6e-162   
dbj|BAG91734.1|  unnamed protein product                                481   9e-162   Oryza sativa Japonica Group [Japonica rice]
gb|AAP44102.1|  peptide transporter 1                                   481   2e-161   Vicia faba [broad bean]
emb|CDY03084.1|  BnaC07g21430D                                          479   5e-161   
ref|XP_007045395.1|  Peptide transporter 2 isoform 1                    479   8e-161   
ref|XP_010554363.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3 isof...    478   1e-160   Tarenaya hassleriana [spider flower]
ref|XP_006643742.1|  PREDICTED: peptide transporter PTR1-like           478   1e-160   
emb|CAA54634.1|  oligopeptide transporter 1-1                           478   2e-160   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010554364.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3 isof...    478   2e-160   Tarenaya hassleriana [spider flower]
ref|XP_008346431.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       468   3e-160   
gb|KHG06441.1|  Peptide transporter PTR2 -like protein                  477   4e-160   Gossypium arboreum [tree cotton]
ref|XP_002521890.1|  peptide transporter, putative                      477   5e-160   Ricinus communis
emb|CAN80199.1|  hypothetical protein VITISV_030909                     476   6e-160   Vitis vinifera
gb|KHG27963.1|  Peptide transporter PTR2 -like protein                  477   6e-160   Gossypium arboreum [tree cotton]
gb|KFK33424.1|  hypothetical protein AALP_AA5G011300                    477   6e-160   Arabis alpina [alpine rockcress]
ref|XP_009114212.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3            477   6e-160   Brassica rapa
ref|XP_004504617.1|  PREDICTED: peptide transporter PTR2-like           476   9e-160   
ref|XP_009101283.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3            476   9e-160   Brassica rapa
gb|KJB77816.1|  hypothetical protein B456_012G159000                    476   9e-160   Gossypium raimondii
ref|NP_001233998.2|  oligopeptide transporter 1                         476   1e-159   Solanum lycopersicum
ref|XP_003524837.1|  PREDICTED: peptide transporter PTR2-like           476   1e-159   Glycine max [soybeans]
emb|CDY17446.1|  BnaC09g20910D                                          476   1e-159   Brassica napus [oilseed rape]
ref|XP_006365835.1|  PREDICTED: peptide transporter PTR2-like           476   2e-159   Solanum tuberosum [potatoes]
gb|KJB15302.1|  hypothetical protein B456_002G169800                    475   2e-159   Gossypium raimondii
gb|AAC32034.1|  peptide transporter                                     475   2e-159   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008787880.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       475   3e-159   Phoenix dactylifera
dbj|BAJ95903.1|  predicted protein                                      475   3e-159   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009591011.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       474   5e-159   Nicotiana tomentosiformis
ref|XP_002285274.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       474   5e-159   Vitis vinifera
gb|AAD01600.1|  LeOPT1                                                  474   9e-159   Solanum lycopersicum
ref|XP_010043898.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3            474   1e-158   Eucalyptus grandis [rose gum]
ref|XP_007158832.1|  hypothetical protein PHAVU_002G185700g             474   1e-158   Phaseolus vulgaris [French bean]
ref|XP_003531124.1|  PREDICTED: peptide transporter PTR2-like           474   1e-158   Glycine max [soybeans]
ref|XP_012072525.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       473   1e-158   Jatropha curcas
gb|AIL30501.1|  oligopeptide transporter 1                              473   1e-158   Nicotiana tabacum [American tobacco]
ref|XP_002992551.1|  hypothetical protein SELMODRAFT_448814             473   2e-158   
emb|CDP05420.1|  unnamed protein product                                474   2e-158   Coffea canephora [robusta coffee]
ref|XP_010246838.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       472   3e-158   Nelumbo nucifera [Indian lotus]
ref|XP_009803584.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...    472   4e-158   Nicotiana sylvestris
emb|CDY17619.1|  BnaA06g34380D                                          474   4e-158   Brassica napus [oilseed rape]
ref|XP_003568460.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       473   5e-158   Brachypodium distachyon [annual false brome]
ref|XP_010939960.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       472   5e-158   Elaeis guineensis
gb|ABK24723.1|  unknown                                                 472   6e-158   Picea sitchensis
gb|ADQ43190.1|  peptide transporter                                     471   1e-157   Schrenkiella parvula
ref|XP_002992575.1|  hypothetical protein SELMODRAFT_135536             471   1e-157   
ref|XP_007222295.1|  hypothetical protein PRUPE_ppa003339mg             471   2e-157   Prunus persica
ref|XP_004149470.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       471   2e-157   Cucumis sativus [cucumbers]
ref|XP_006346628.1|  PREDICTED: peptide transporter PTR2-like           471   2e-157   Solanum tuberosum [potatoes]
ref|XP_011070505.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       471   2e-157   Sesamum indicum [beniseed]
gb|KDP38199.1|  hypothetical protein JCGZ_04842                         470   2e-157   Jatropha curcas
ref|XP_004297798.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       469   4e-157   Fragaria vesca subsp. vesca
ref|XP_008466783.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3 isof...    469   4e-157   Cucumis melo [Oriental melon]
ref|XP_008466778.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3 isof...    469   5e-157   Cucumis melo [Oriental melon]
ref|XP_002972518.1|  hypothetical protein SELMODRAFT_97812              468   9e-157   
ref|XP_010066525.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       469   1e-156   Eucalyptus grandis [rose gum]
ref|XP_009351619.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       468   3e-156   Pyrus x bretschneideri [bai li]
ref|XP_004972110.1|  PREDICTED: peptide transporter PTR1-like           467   3e-156   Setaria italica
ref|XP_006448044.1|  hypothetical protein CICLE_v10014643mg             468   5e-156   
ref|XP_002972318.1|  hypothetical protein SELMODRAFT_441824             466   9e-156   
gb|EMT20656.1|  Peptide transporter PTR5                                466   9e-156   
gb|AAF20002.1|AF213936_1  amino acid/peptide transporter                465   1e-155   Prunus dulcis [sweet almond]
ref|XP_004252286.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...    466   2e-155   Solanum lycopersicum
ref|XP_006492274.1|  PREDICTED: peptide transporter PTR2-like           466   2e-155   Citrus sinensis [apfelsine]
ref|XP_011021701.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       465   3e-155   Populus euphratica
ref|NP_001146682.1|  hypothetical protein                               465   4e-155   Zea mays [maize]
gb|EMT00809.1|  Peptide transporter PTR5                                465   4e-155   
ref|XP_008389126.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       465   5e-155   
gb|EYU30228.1|  hypothetical protein MIMGU_mgv1a003438mg                464   5e-155   Erythranthe guttata [common monkey flower]
ref|XP_010680056.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       464   5e-155   Beta vulgaris subsp. vulgaris [field beet]
gb|ACL52627.1|  unknown                                                 463   2e-154   Zea mays [maize]
ref|XP_010937011.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       463   2e-154   Elaeis guineensis
ref|XP_002315835.1|  Peptide transporter PTR2-B family protein          462   2e-154   Populus trichocarpa [western balsam poplar]
ref|XP_004981956.1|  PREDICTED: peptide transporter PTR2-like           462   3e-154   Setaria italica
ref|XP_010276263.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       462   3e-154   Nelumbo nucifera [Indian lotus]
gb|KJB77820.1|  hypothetical protein B456_012G159200                    462   3e-154   Gossypium raimondii
ref|XP_009419340.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       462   4e-154   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002463973.1|  hypothetical protein SORBIDRAFT_01g009900          461   1e-153   Sorghum bicolor [broomcorn]
ref|XP_001769410.1|  predicted protein                                  461   1e-153   
gb|EMS68423.1|  Peptide transporter PTR2                                460   2e-153   Triticum urartu
ref|XP_002463972.1|  hypothetical protein SORBIDRAFT_01g009890          459   4e-153   Sorghum bicolor [broomcorn]
gb|ABR32183.1|  peptide transporter                                     459   4e-153   Hakea actites
ref|XP_008798043.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       459   9e-153   Phoenix dactylifera
ref|XP_010937012.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       458   1e-152   Elaeis guineensis
dbj|BAJ95092.1|  predicted protein                                      458   2e-152   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ97409.1|  predicted protein                                      457   2e-152   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS46611.1|  Peptide transporter PTR5                                459   3e-152   Triticum urartu
ref|XP_008340556.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       449   3e-152   
ref|XP_002459192.1|  hypothetical protein SORBIDRAFT_02g000260          457   3e-152   
ref|NP_001051098.1|  Os03g0719900                                       457   5e-152   
gb|EEE59822.1|  hypothetical protein OsJ_12376                          457   5e-152   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006650508.1|  PREDICTED: peptide transporter PTR2-like           456   8e-152   
ref|XP_009405084.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       456   8e-152   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010105518.1|  Peptide transporter                                471   3e-151   
emb|CBI26754.3|  unnamed protein product                                451   5e-151   Vitis vinifera
ref|XP_008798073.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3            453   9e-151   Phoenix dactylifera
ref|XP_010680054.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       453   1e-150   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006346629.1|  PREDICTED: peptide transporter PTR2-like           452   2e-150   
ref|XP_003531411.1|  PREDICTED: peptide transporter PTR2-like           450   2e-149   Glycine max [soybeans]
ref|XP_004504619.1|  PREDICTED: peptide transporter PTR2-like           450   2e-149   
ref|XP_010680055.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       449   4e-149   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008798061.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       449   6e-149   Phoenix dactylifera
ref|XP_008466771.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    448   8e-149   
gb|EMT07041.1|  Peptide transporter PTR2                                460   1e-148   
ref|XP_003524135.1|  PREDICTED: peptide transporter PTR2-like iso...    448   1e-148   Glycine max [soybeans]
emb|CDY59420.1|  BnaA09g56930D                                          447   2e-148   Brassica napus [oilseed rape]
ref|XP_006346661.1|  PREDICTED: peptide transporter PTR2-like           452   4e-148   
gb|AAO64143.1|  putative oligopeptide transporter protein               444   4e-148   Arabidopsis thaliana [mouse-ear cress]
ref|NP_176411.2|  putative peptide/nitrate transporter                  447   4e-148   
dbj|BAF00365.1|  oligopeptide transporter - like protein                444   4e-148   
ref|XP_009117889.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       446   8e-148   
ref|XP_006658184.1|  PREDICTED: peptide transporter PTR5-like           445   1e-147   
emb|CDY45273.1|  BnaA06g09430D                                          440   2e-147   
ref|XP_010105516.1|  Peptide transporter                                444   5e-147   
gb|EMT02211.1|  Peptide transporter PTR1                                444   6e-147   
gb|ACN26865.1|  unknown                                                 442   9e-147   
dbj|BAJ85008.1|  predicted protein                                      443   9e-147   
emb|CDX81655.1|  BnaC08g39460D                                          443   1e-146   
ref|XP_009148842.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       442   2e-146   
ref|XP_006580081.1|  PREDICTED: peptide transporter PTR2-like iso...    441   3e-146   
ref|XP_006580079.1|  PREDICTED: peptide transporter PTR2-like iso...    442   3e-146   
gb|KHN29164.1|  Peptide transporter PTR2                                441   3e-146   
gb|EAY89168.1|  hypothetical protein OsI_10664                          441   5e-146   
ref|XP_010276258.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...    441   6e-146   
ref|XP_006649696.1|  PREDICTED: peptide transporter PTR2-like           441   9e-146   
ref|XP_004297797.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       440   1e-145   
ref|XP_011029471.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       440   1e-145   
ref|XP_006849517.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3            440   2e-145   
ref|XP_010430257.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    440   2e-145   
gb|EPS63244.1|  hypothetical protein M569_11542                         438   2e-145   
ref|XP_008665380.1|  PREDICTED: hypothetical protein isoform X1         440   2e-145   
ref|XP_010230764.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       451   3e-145   
gb|ABF94833.1|  Peptide transporter PTR2, putative, expressed           439   3e-145   
ref|XP_002317503.2|  Peptide transporter PTR2-B family protein          439   4e-145   
ref|XP_010497442.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.5-like       439   4e-145   
emb|CDX76167.1|  BnaA04g04310D                                          439   3e-144   
gb|KFK43704.1|  hypothetical protein AALP_AA1G162300                    436   4e-144   
ref|XP_010939959.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       436   4e-144   
gb|ACG41138.1|  peptide transporter PTR2                                437   4e-144   
ref|XP_002886485.1|  proton-dependent oligopeptide transport fami...    436   5e-144   
ref|XP_008787879.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       436   8e-144   
gb|KJB17027.1|  hypothetical protein B456_002G261400                    429   1e-143   
gb|AAB60766.1|  Strong similarity to Arabidopsis oligopeptide tra...    434   1e-143   
ref|XP_004985075.1|  PREDICTED: peptide transporter PTR2-like iso...    435   1e-143   
ref|XP_008220970.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       434   3e-143   
ref|XP_010105517.1|  Peptide transporter                                433   8e-143   
ref|XP_007158831.1|  hypothetical protein PHAVU_002G185600g             432   2e-142   
ref|XP_007225683.1|  hypothetical protein PRUPE_ppa003292mg             432   2e-142   
gb|EMS66305.1|  Peptide transporter PTR2                                439   2e-142   
ref|XP_009114213.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.4-like...    431   3e-142   
ref|XP_010228917.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...    431   5e-142   
ref|XP_010228918.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...    430   7e-142   
ref|XP_003558415.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...    430   2e-141   
ref|XP_004306584.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       429   2e-141   
ref|XP_003558412.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       429   3e-141   
dbj|BAK03852.1|  predicted protein                                      429   1e-140   
ref|NP_001058672.1|  Os07g0100600                                       427   1e-140   
ref|XP_002972320.1|  hypothetical protein SELMODRAFT_97239              427   1e-140   
dbj|BAD31819.1|  putative peptide transport protein                     427   1e-140   
emb|CDY04112.1|  BnaA09g18900D                                          426   2e-140   
ref|XP_006301212.1|  hypothetical protein CARUB_v10021609mg             426   3e-140   
gb|AFK36288.1|  unknown                                                 416   3e-140   
ref|XP_002992553.1|  hypothetical protein SELMODRAFT_135522             425   5e-140   
gb|EMT06014.1|  Peptide transporter PTR5                                424   1e-139   
ref|XP_004985080.1|  PREDICTED: peptide transporter PTR2-like           424   2e-139   
ref|XP_006649697.1|  PREDICTED: peptide transporter PTR2-like           423   5e-139   
ref|XP_010228489.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1            422   8e-139   
gb|KHN25958.1|  Peptide transporter PTR2                                422   9e-139   
gb|AFK34112.1|  unknown                                                 411   2e-138   
ref|XP_006391918.1|  hypothetical protein EUTSA_v10023384mg             420   6e-138   
ref|XP_010105519.1|  Peptide transporter                                419   2e-137   
ref|XP_004985083.1|  PREDICTED: peptide transporter PTR2-like iso...    420   2e-137   
ref|XP_004985084.1|  PREDICTED: peptide transporter PTR2-like iso...    419   2e-137   
ref|XP_010502211.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.4 isof...    419   2e-137   
gb|EEC74827.1|  hypothetical protein OsI_10666                          419   2e-137   
ref|XP_003561849.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...    419   4e-137   
ref|NP_001049488.1|  Os03g0235700                                       418   5e-137   
ref|XP_003524136.1|  PREDICTED: peptide transporter PTR2-like           422   5e-137   
gb|EAZ02458.1|  hypothetical protein OsI_24563                          417   7e-137   
ref|XP_010424977.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.4-like...    417   9e-137   
ref|XP_010228915.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...    417   1e-136   
gb|ABF94835.1|  Peptide transporter PTR2, putative, expressed           418   1e-136   
ref|XP_008366313.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       408   2e-136   
emb|CDX73503.1|  BnaC08g25000D                                          415   3e-136   
ref|XP_002465588.1|  hypothetical protein SORBIDRAFT_01g041710          416   4e-136   
ref|XP_007026784.1|  Peptide transporter 1                              414   4e-136   
ref|XP_008220969.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    413   2e-135   
ref|XP_010502210.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.4 isof...    414   3e-135   
gb|EPS59446.1|  hypothetical protein M569_15359                         412   6e-135   
ref|XP_010513956.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.4-like       411   8e-134   
ref|XP_008653226.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...    409   1e-133   
gb|ADQ43189.1|  oligopeptide transport protein                          407   6e-133   
gb|AEZ00896.1|  putative proton-dependent oligopeptide transport ...    395   2e-132   
gb|EYU41848.1|  hypothetical protein MIMGU_mgv1a022560mg                402   3e-132   
ref|XP_009129179.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    405   4e-132   
gb|ACQ90596.1|  putative peptide transporter                            407   5e-132   
gb|EMT07615.1|  Peptide transporter PTR2                                402   1e-130   
ref|XP_004985076.1|  PREDICTED: peptide transporter PTR2-like iso...    399   4e-130   
ref|XP_002875105.1|  proton-dependent oligopeptide transport fami...    400   5e-130   
gb|ABF94834.1|  Peptide transporter PTR2, putative, expressed           397   2e-129   
ref|XP_006292667.1|  hypothetical protein CARUB_v10018909mg             398   3e-129   
ref|XP_006849520.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3            397   9e-129   
ref|XP_010937010.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       393   3e-127   
ref|XP_011625353.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3            393   4e-127   
ref|XP_008346432.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       387   7e-127   
ref|NP_178311.1|  peptide transporter 4                                 390   9e-127   
ref|XP_009114214.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.5-like...    390   2e-126   
ref|XP_008665393.1|  PREDICTED: hypothetical protein isoform X2         384   2e-126   
gb|KEH34180.1|  proton-dependent oligopeptide transport family pr...    386   3e-126   
emb|CDY15809.1|  BnaC02g34280D                                          387   4e-126   
emb|CDY09395.1|  BnaA02g26150D                                          386   1e-125   
ref|XP_002981774.1|  hypothetical protein SELMODRAFT_115215             387   1e-124   
ref|XP_010229109.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       383   1e-123   
tpg|DAA44283.1|  TPA: hypothetical protein ZEAMMB73_649598              384   2e-123   
ref|XP_010276259.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...    381   5e-123   
ref|XP_006579637.1|  PREDICTED: peptide transporter PTR2-like           378   2e-122   
ref|XP_008798033.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       380   2e-122   
ref|XP_007142231.1|  hypothetical protein PHAVU_008G263300g             376   3e-122   
gb|KDO66793.1|  hypothetical protein CISIN_1g0086231mg                  373   3e-121   
gb|KHN44081.1|  Putative peptide/nitrate transporter                    377   3e-121   
ref|XP_008356408.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       371   2e-120   
ref|XP_008653244.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...    370   5e-119   
gb|EMS66306.1|  Peptide transporter PTR2                                371   7e-119   
ref|XP_004983459.1|  PREDICTED: probable peptide/nitrate transpor...    371   8e-119   
ref|XP_002967570.1|  hypothetical protein SELMODRAFT_231062             369   3e-118   
ref|XP_008653237.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...    369   3e-118   
ref|XP_004968864.1|  PREDICTED: peptide transporter PTR2-like           369   3e-118   
ref|XP_002962950.1|  hypothetical protein SELMODRAFT_165561             368   1e-117   
ref|XP_010314236.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...    364   3e-117   
gb|KJB59777.1|  hypothetical protein B456_009G271300                    368   5e-117   
gb|EMT07613.1|  Peptide transporter PTR2                                357   8e-117   
ref|XP_002962329.1|  hypothetical protein SELMODRAFT_78769              365   2e-116   
gb|ERN11102.1|  hypothetical protein AMTR_s00024p00149600               364   3e-116   
ref|XP_002464820.1|  hypothetical protein SORBIDRAFT_01g027280          364   3e-116   
ref|XP_001774033.1|  predicted protein                                  363   9e-116   
ref|XP_008649412.1|  PREDICTED: low affinity nitrate transporter ...    362   3e-115   
ref|XP_004983455.1|  PREDICTED: probable peptide/nitrate transpor...    361   3e-115   
gb|KHG28303.1|  Peptide transporter PTR1 -like protein                  363   4e-115   
gb|ACG42970.1|  peptide transporter PTR2                                362   4e-115   
ref|XP_010064621.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       362   5e-115   
ref|XP_010068667.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.2-like       361   9e-115   
ref|XP_002464816.1|  hypothetical protein SORBIDRAFT_01g027250          360   1e-114   
ref|XP_011624726.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2 isof...    356   1e-114   
ref|XP_003580478.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.5-like       359   2e-114   
gb|EMT00870.1|  Peptide transporter PTR2                                360   2e-114   
gb|EMS46619.1|  Peptide transporter PTR2                                356   3e-114   
ref|XP_002965429.1|  hypothetical protein SELMODRAFT_84173              359   4e-114   
gb|KHN13143.1|  Peptide transporter PTR3-A                              359   4e-114   
emb|CDY17448.1|  BnaC09g20890D                                          350   4e-114   
gb|EMS55921.1|  Peptide transporter PTR2                                360   5e-114   
ref|XP_001774221.1|  predicted protein                                  359   6e-114   
ref|XP_003574685.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       358   9e-114   
ref|XP_008659111.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like...    357   1e-113   
gb|KEH36217.1|  peptide transporter                                     357   1e-113   
ref|XP_008659108.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like...    358   1e-113   
ref|XP_002994164.1|  hypothetical protein SELMODRAFT_138285             358   2e-113   
gb|KFK40624.1|  hypothetical protein AALP_AA2G020300                    348   3e-113   
ref|XP_001778896.1|  predicted protein                                  356   4e-113   
ref|XP_010068673.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.2-like       356   6e-113   
tpg|DAA46631.1|  TPA: hypothetical protein ZEAMMB73_409663              358   7e-113   
ref|XP_003556370.1|  PREDICTED: peptide transporter PTR3-A-like         356   9e-113   
gb|AES81565.2|  peptide transporter                                     356   1e-112   
ref|XP_004509028.1|  PREDICTED: peptide transporter PTR3-A-like         355   2e-112   
gb|ACN40168.1|  unknown                                                 356   3e-112   
ref|XP_009611762.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       355   4e-112   
ref|XP_002526568.1|  oligopeptide transporter, putative                 354   5e-112   
ref|XP_004500964.1|  PREDICTED: peptide transporter PTR1-like iso...    353   5e-112   
ref|XP_004493813.1|  PREDICTED: peptide transporter PTR3-A-like         353   1e-111   
ref|XP_004986750.1|  PREDICTED: peptide transporter PTR2-like           353   1e-111   
ref|XP_004500965.1|  PREDICTED: peptide transporter PTR1-like iso...    352   1e-111   
ref|XP_006588501.1|  PREDICTED: NRT1-3 protein isoform X1               352   2e-111   
ref|XP_010023870.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.2-like       352   3e-111   
ref|XP_006342712.1|  PREDICTED: peptide transporter PTR5-like           353   3e-111   
ref|XP_006661603.1|  PREDICTED: peptide transporter PTR2-like           351   3e-111   
emb|CDP07455.1|  unnamed protein product                                353   4e-111   
ref|XP_008221413.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       351   4e-111   
gb|ABB46610.1|  POT family protein, expressed                           348   7e-111   
gb|EEC66460.1|  hypothetical protein OsI_32532                          350   8e-111   
ref|XP_002301859.1|  peptide transporter 2 family protein               351   9e-111   
ref|XP_007226671.1|  hypothetical protein PRUPE_ppa021364mg             350   1e-110   
ref|XP_010026812.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.2-like       350   1e-110   
ref|XP_002280835.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       351   1e-110   
gb|KEH36218.1|  peptide transporter                                     350   1e-110   
ref|XP_004985079.1|  PREDICTED: peptide transporter PTR2-like iso...    349   1e-110   
dbj|BAJ92195.1|  predicted protein                                      348   2e-110   
ref|NP_001049489.1|  Os03g0235900                                       350   2e-110   
ref|XP_007134672.1|  hypothetical protein PHAVU_010G066200g             350   2e-110   
gb|AAM08522.1|AC068654_24  Putative peptide transporter                 350   2e-110   
dbj|BAK07841.1|  predicted protein                                      348   2e-110   
gb|EAY77486.1|  hypothetical protein OsI_32529                          350   2e-110   
gb|EAZ15085.1|  hypothetical protein OsJ_30497                          350   2e-110   
ref|XP_004297842.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.2-like       350   3e-110   
ref|XP_002978223.1|  hypothetical protein SELMODRAFT_417946             350   3e-110   
ref|XP_010314654.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       350   3e-110   
ref|XP_002966337.1|  hypothetical protein SELMODRAFT_439656             350   3e-110   
ref|XP_011024449.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.2-like       349   3e-110   
gb|EAY77495.1|  hypothetical protein OsI_32539                          349   3e-110   
ref|XP_010068656.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.2-like       349   4e-110   
ref|XP_007162584.1|  hypothetical protein PHAVU_001G163500g             349   4e-110   
ref|XP_001754642.1|  predicted protein                                  348   5e-110   
gb|KEH41109.1|  peptide transporter 1                                   349   5e-110   
gb|AAK52579.1|AC079685_10  Putative LeOPT1 - oligopeptide transpo...    348   6e-110   
gb|EYU32880.1|  hypothetical protein MIMGU_mgv1a025520mg                348   6e-110   
ref|NP_001064033.2|  Os10g0110600                                       348   7e-110   
ref|XP_006420305.1|  hypothetical protein CICLE_v10004600mg             348   7e-110   
ref|XP_011029778.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.2-like       348   9e-110   
ref|XP_002280138.2|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       348   1e-109   
gb|AAK52574.2|AC079685_5  Putative LeOPT1 - oligopeptide transporter    348   1e-109   
gb|EMT14648.1|  Peptide transporter PTR2                                356   1e-109   
ref|XP_003590804.1|  Peptide transporter PTR3-A                         348   1e-109   
ref|XP_006489758.1|  PREDICTED: peptide transporter PTR3-A-like         348   1e-109   
ref|XP_003535206.1|  PREDICTED: peptide transporter PTR3-A-like         348   1e-109   
ref|XP_006420301.1|  hypothetical protein CICLE_v10004592mg             348   1e-109   
ref|XP_008372579.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.2-like       348   2e-109   
ref|XP_002314492.1|  proton-dependent oligopeptide transport fami...    347   2e-109   
ref|XP_006489759.1|  PREDICTED: peptide transporter PTR3-A-like         345   2e-109   
gb|EEE50467.1|  hypothetical protein OsJ_30510                          347   2e-109   
ref|XP_009334213.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    347   2e-109   
ref|XP_002302005.2|  hypothetical protein POPTR_0002s03070g             347   2e-109   
ref|XP_004493811.1|  PREDICTED: peptide transporter PTR3-A-like         347   2e-109   
ref|XP_007145869.1|  hypothetical protein PHAVU_007G274900g             347   3e-109   
ref|XP_003625345.1|  Peptide transporter PTR3-A                         347   3e-109   
emb|CAN63331.1|  hypothetical protein VITISV_015576                     346   4e-109   
ref|XP_002306899.1|  hypothetical protein POPTR_0005s25490g             347   5e-109   
ref|NP_001064460.1|  Os10g0370700                                       345   5e-109   
ref|XP_002285402.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.2            346   5e-109   
ref|XP_002987811.1|  hypothetical protein SELMODRAFT_21315              345   6e-109   
ref|XP_006649698.1|  PREDICTED: peptide transporter PTR2-like           345   8e-109   
ref|XP_010670967.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.2-like...    345   8e-109   



>ref|XP_011080847.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like isoform X1 [Sesamum 
indicum]
Length=600

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/385 (75%), Positives = 325/385 (84%), Gaps = 4/385 (1%)
 Frame = +2

Query  197   MEQSKAMEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMI  376
             +E ++ M E+D YTKDGTLDYRN PANKKKTG WKACPFILGNEC ERLAYYGMSSNL+ 
Sbjct  25    VEVAEVMAEEDNYTKDGTLDYRNNPANKKKTGTWKACPFILGNECCERLAYYGMSSNLLN  84

Query  377   YFQTRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMT  556
             YF T+LNQ   +ASKNL NWSGTCY+MPLVGAFLADAYLGRYWTIA+FSIIYV+GMTL+T
Sbjct  85    YFTTQLNQHNATASKNLWNWSGTCYVMPLVGAFLADAYLGRYWTIASFSIIYVLGMTLLT  144

Query  557   LSATVPGISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEK  736
             LSA+VPG+ PTC   D+C AT   TAVCF+ALY+VALGTGGIKPCVSSYGADQFDD DE 
Sbjct  145   LSASVPGLRPTCYTKDECYATNSQTAVCFLALYMVALGTGGIKPCVSSYGADQFDDADEV  204

Query  737   ERKHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRL  916
             E+ HKSSFFNWFYFSIN+GAL+A+S++VWIQ ++ WGWGFGVPAVAMA+AV FFFSGTRL
Sbjct  205   EKGHKSSFFNWFYFSINIGALIASSILVWIQVNIGWGWGFGVPAVAMAIAVAFFFSGTRL  264

Query  917   YRYQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRF  1096
             YRYQKPGGSP TRL QV+VASLRK +V VP DKSLL+ET   ES I GSRKL HTN+ RF
Sbjct  265   YRYQKPGGSPLTRLCQVLVASLRKYRVAVPGDKSLLYETTDAESAIVGSRKLDHTNQFRF  324

Query  1097  FDKAAVVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQF  1276
              DKAAV +ES  +  KGSV+PWRLCTVTQVEELK IIRLLP+WATGIIFS VYGQMG  F
Sbjct  325   LDKAAVEKES--DHSKGSVNPWRLCTVTQVEELKGIIRLLPVWATGIIFSAVYGQMGNLF  382

Query  1277  ISQAEGMNTYVG--TFKXPXASLGV  1345
             + QA  M+  +G   F+ P ASL +
Sbjct  383   LMQAGYMDARLGRSNFQIPEASLAI  407



>ref|XP_009780466.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Nicotiana sylvestris]
 ref|XP_009780467.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Nicotiana sylvestris]
 ref|XP_009780468.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Nicotiana sylvestris]
Length=578

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/378 (75%), Positives = 324/378 (86%), Gaps = 3/378 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M E+D+YTKDGT+DYRN+PANKKKTG WKACP+ILGNECSERLAYYGMS+NL++YF+ +L
Sbjct  1     MAEEDIYTKDGTVDYRNKPANKKKTGTWKACPYILGNECSERLAYYGMSTNLVLYFKNQL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             +Q   +ASKN SNWSGTCY+MPL+GAFLAD+YLGRYWTIA FSIIYV GMTL+T+SA+VP
Sbjct  61    HQHNATASKNQSNWSGTCYVMPLLGAFLADSYLGRYWTIAIFSIIYVFGMTLLTISASVP  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+ PTC   DKC AT   T+V FIALYLVALGTGGIKPCVSSYGADQFDD D  ER HK+
Sbjct  121   GLKPTCYEKDKCHATNGQTSVFFIALYLVALGTGGIKPCVSSYGADQFDDADPIERNHKN  180

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSINVGALVA+SLIVWIQQD+ WGWGFGVPAVAMALAV  FFSGTRLYRYQKP
Sbjct  181   SFFNWFYFSINVGALVASSLIVWIQQDIGWGWGFGVPAVAMALAVVSFFSGTRLYRYQKP  240

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVG-LESNIQGSRKLSHTNELRFFDKAA  1111
             GGSP TR+ QVVVAS RK +V +P+DKSLLHET    ES IQGSRKL+HTNEL FFDKAA
Sbjct  241   GGSPLTRICQVVVASFRKYRVALPADKSLLHETAAEAESAIQGSRKLAHTNELCFFDKAA  300

Query  1112  VVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAE  1291
             V  ES  ++  GS++ WRLCTVTQVEELKS+I+LLPIWATGIIFSTVY QM   F+ QA 
Sbjct  301   VKLES--DENSGSINNWRLCTVTQVEELKSVIKLLPIWATGIIFSTVYNQMSNMFVLQAT  358

Query  1292  GMNTYVGTFKXPXASLGV  1345
              M+T++G F+ P ASL V
Sbjct  359   YMDTHLGKFRIPEASLSV  376



>ref|XP_011080848.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like isoform X2 [Sesamum 
indicum]
Length=570

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/379 (75%), Positives = 321/379 (85%), Gaps = 4/379 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M E+D YTKDGTLDYRN PANKKKTG WKACPFILGNEC ERLAYYGMSSNL+ YF T+L
Sbjct  1     MAEEDNYTKDGTLDYRNNPANKKKTGTWKACPFILGNECCERLAYYGMSSNLLNYFTTQL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             NQ   +ASKNL NWSGTCY+MPLVGAFLADAYLGRYWTIA+FSIIYV+GMTL+TLSA+VP
Sbjct  61    NQHNATASKNLWNWSGTCYVMPLVGAFLADAYLGRYWTIASFSIIYVLGMTLLTLSASVP  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+ PTC   D+C AT   TAVCF+ALY+VALGTGGIKPCVSSYGADQFDD DE E+ HKS
Sbjct  121   GLRPTCYTKDECYATNSQTAVCFLALYMVALGTGGIKPCVSSYGADQFDDADEVEKGHKS  180

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GAL+A+S++VWIQ ++ WGWGFGVPAVAMA+AV FFFSGTRLYRYQKP
Sbjct  181   SFFNWFYFSINIGALIASSILVWIQVNIGWGWGFGVPAVAMAIAVAFFFSGTRLYRYQKP  240

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TRL QV+VASLRK +V VP DKSLL+ET   ES I GSRKL HTN+ RF DKAAV
Sbjct  241   GGSPLTRLCQVLVASLRKYRVAVPGDKSLLYETTDAESAIVGSRKLDHTNQFRFLDKAAV  300

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
              +ES  +  KGSV+PWRLCTVTQVEELK IIRLLP+WATGIIFS VYGQMG  F+ QA  
Sbjct  301   EKES--DHSKGSVNPWRLCTVTQVEELKGIIRLLPVWATGIIFSAVYGQMGNLFLMQAGY  358

Query  1295  MNTYVG--TFKXPXASLGV  1345
             M+  +G   F+ P ASL +
Sbjct  359   MDARLGRSNFQIPEASLAI  377



>ref|XP_010323334.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1 isoform X1 [Solanum lycopersicum]
Length=594

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/387 (72%), Positives = 328/387 (85%), Gaps = 3/387 (1%)
 Frame = +2

Query  188   LQMMEQSKAM-EEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSS  364
             L  ++ + AM EE+DVYTKDGT+DYRN+PANKKKTG WKACP+ILGNEC ERLAYYGMS+
Sbjct  2     LMNLKNNIAMAEEEDVYTKDGTVDYRNKPANKKKTGTWKACPYILGNECCERLAYYGMST  61

Query  365   NLMIYFQTRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGM  544
             NL+ YF+T+L+Q T +ASKN SNWSGTCY+MPL+GAFLAD+YLGRYWTIA FSIIYV GM
Sbjct  62    NLVYYFKTQLSQETVTASKNQSNWSGTCYVMPLLGAFLADSYLGRYWTIAIFSIIYVCGM  121

Query  545   TLMTLSATVPGISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDD  724
             TL+T+SA+VPG+ P C   +KC +T   TAV F+ALYLVALGTGGIKPCVSSYGADQFDD
Sbjct  122   TLLTVSASVPGLRPICYQKNKCHSTDSQTAVFFVALYLVALGTGGIKPCVSSYGADQFDD  181

Query  725   TDEKERKHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFS  904
              D  ER +K+SFFNWFYFSIN+GALVA+SLIVWIQQD+SWGWGFGVPA AMALAV  FFS
Sbjct  182   ADPIERNYKNSFFNWFYFSINIGALVASSLIVWIQQDISWGWGFGVPAAAMALAVVSFFS  241

Query  905   GTRLYRYQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTN  1084
             G+RLYRYQKPGGSP TR+ QVVVASLRK  V +P++KSLL+ET   ES I+GSRKL+HTN
Sbjct  242   GSRLYRYQKPGGSPLTRICQVVVASLRKFHVTLPAEKSLLYETAEAESAIKGSRKLAHTN  301

Query  1085  ELRFFDKAAVVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQM  1264
             +LRFFD+AAV   S  ++ +GS++ W+LCTVTQVEE KS+++LLPIWATGIIFSTVY QM
Sbjct  302   DLRFFDRAAVKTGS--DENRGSINSWKLCTVTQVEEFKSVVKLLPIWATGIIFSTVYNQM  359

Query  1265  GTQFISQAEGMNTYVGTFKXPXASLGV  1345
                F+ QA  M+TY+G  K P ASL V
Sbjct  360   SNYFVVQAMSMDTYLGKMKIPEASLSV  386



>ref|XP_010323335.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1 isoform X2 [Solanum lycopersicum]
 ref|XP_010323336.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1 isoform X2 [Solanum lycopersicum]
Length=584

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/376 (73%), Positives = 322/376 (86%), Gaps = 2/376 (1%)
 Frame = +2

Query  218   EEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  397
             EE+DVYTKDGT+DYRN+PANKKKTG WKACP+ILGNEC ERLAYYGMS+NL+ YF+T+L+
Sbjct  3     EEEDVYTKDGTVDYRNKPANKKKTGTWKACPYILGNECCERLAYYGMSTNLVYYFKTQLS  62

Query  398   QSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPG  577
             Q T +ASKN SNWSGTCY+MPL+GAFLAD+YLGRYWTIA FSIIYV GMTL+T+SA+VPG
Sbjct  63    QETVTASKNQSNWSGTCYVMPLLGAFLADSYLGRYWTIAIFSIIYVCGMTLLTVSASVPG  122

Query  578   ISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSS  757
             + P C   +KC +T   TAV F+ALYLVALGTGGIKPCVSSYGADQFDD D  ER +K+S
Sbjct  123   LRPICYQKNKCHSTDSQTAVFFVALYLVALGTGGIKPCVSSYGADQFDDADPIERNYKNS  182

Query  758   FFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKPG  937
             FFNWFYFSIN+GALVA+SLIVWIQQD+SWGWGFGVPA AMALAV  FFSG+RLYRYQKPG
Sbjct  183   FFNWFYFSINIGALVASSLIVWIQQDISWGWGFGVPAAAMALAVVSFFSGSRLYRYQKPG  242

Query  938   GSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAVV  1117
             GSP TR+ QVVVASLRK  V +P++KSLL+ET   ES I+GSRKL+HTN+LRFFD+AAV 
Sbjct  243   GSPLTRICQVVVASLRKFHVTLPAEKSLLYETAEAESAIKGSRKLAHTNDLRFFDRAAVK  302

Query  1118  EESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEGM  1297
               S  ++ +GS++ W+LCTVTQVEE KS+++LLPIWATGIIFSTVY QM   F+ QA  M
Sbjct  303   TGS--DENRGSINSWKLCTVTQVEEFKSVVKLLPIWATGIIFSTVYNQMSNYFVVQAMSM  360

Query  1298  NTYVGTFKXPXASLGV  1345
             +TY+G  K P ASL V
Sbjct  361   DTYLGKMKIPEASLSV  376



>ref|XP_004500227.1| PREDICTED: peptide transporter PTR5-like isoform X1 [Cicer arietinum]
 ref|XP_004500228.1| PREDICTED: peptide transporter PTR5-like isoform X2 [Cicer arietinum]
Length=570

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/379 (72%), Positives = 325/379 (86%), Gaps = 4/379 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             MEEDDVYTKDGT+DYR  PANK  TG W+ACPFILGNEC ERLAYYGMS+NL++YF+ RL
Sbjct  1     MEEDDVYTKDGTVDYRGNPANKNITGTWRACPFILGNECCERLAYYGMSTNLVLYFKERL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             +Q + +ASKN+SNWSGTCYI PL+GAF+AD+YLGRYWTIA+FSIIYV+GMTL+TLSA+V 
Sbjct  61    HQHSATASKNVSNWSGTCYITPLIGAFVADSYLGRYWTIASFSIIYVVGMTLLTLSASVS  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             GI PTC   + C AT   + VCF+ALYL+ALGTGGIKPCVSSYGADQFDD DE E++HKS
Sbjct  121   GIKPTCQGKENCHATDLQSIVCFLALYLIALGTGGIKPCVSSYGADQFDDADENEKEHKS  180

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GAL+A+SL+VWIQ +V WGWGFG+PAVAMA+AV  FFSGT+LYR QKP
Sbjct  181   SFFNWFYFSINIGALIASSLLVWIQDNVGWGWGFGIPAVAMAIAVASFFSGTKLYRNQKP  240

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QV+VAS+RK +++ P+DKSLL+E    ES I+GSRKL HTNELRFFDKAAV
Sbjct  241   GGSPLTRICQVIVASIRKYRIEAPADKSLLYEIADTESAIKGSRKLDHTNELRFFDKAAV  300

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
             + +S  +++K S + WRLCTVTQVEELKSIIRLLP+WATGIIF+TVYGQM T F+ Q + 
Sbjct  301   LGQS--DNRKDSTNSWRLCTVTQVEELKSIIRLLPVWATGIIFATVYGQMSTLFVLQGQT  358

Query  1295  MNTYVG--TFKXPXASLGV  1345
             MNT+VG  +FK P ASL +
Sbjct  359   MNTHVGNSSFKIPPASLSI  377



>ref|XP_006362448.1| PREDICTED: peptide transporter PTR1-like [Solanum tuberosum]
Length=584

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/376 (73%), Positives = 322/376 (86%), Gaps = 2/376 (1%)
 Frame = +2

Query  218   EEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  397
             EE+DVYTKDGT+DYRN+PANKKKTG WKACP+ILGNEC ERLAYYGMS+NL+ YF+T+L+
Sbjct  3     EEEDVYTKDGTVDYRNKPANKKKTGTWKACPYILGNECCERLAYYGMSTNLVYYFKTQLS  62

Query  398   QSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPG  577
             Q T +ASKN SNW+GTCY+MPL+GAFLAD+YLGRYWTIA FSIIYV GMTL+T+SA+VPG
Sbjct  63    QETATASKNQSNWAGTCYVMPLLGAFLADSYLGRYWTIAIFSIIYVCGMTLLTVSASVPG  122

Query  578   ISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSS  757
             + P C   +KC +T   TAV F+ALYLVALGTGGIKPCVSSYGADQFDD D  ER +K+S
Sbjct  123   LRPICYEKNKCHSTDSQTAVFFVALYLVALGTGGIKPCVSSYGADQFDDADPIERNYKNS  182

Query  758   FFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKPG  937
             FFNWFYFSIN+GALVA+SLIVWIQQD+SWGWGFGVPA AMA AV  FFSG+RLYRYQKPG
Sbjct  183   FFNWFYFSINIGALVASSLIVWIQQDISWGWGFGVPAAAMAFAVVSFFSGSRLYRYQKPG  242

Query  938   GSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAVV  1117
             GSP TR+ QVVVASLRK  V +P++KSLL+ET   ES I+GSRKL+HTN+LRFFD+AA V
Sbjct  243   GSPLTRICQVVVASLRKCHVTLPAEKSLLYETAEAESAIKGSRKLAHTNDLRFFDRAA-V  301

Query  1118  EESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEGM  1297
             +  LDE+ +GS++ W+LCTVTQVEE KS+++LLPIWATGIIFST Y QM   F+ QA  M
Sbjct  302   KTGLDEN-RGSINNWKLCTVTQVEEFKSVVKLLPIWATGIIFSTAYSQMSNYFVVQAMSM  360

Query  1298  NTYVGTFKXPXASLGV  1345
             +T++G  K P ASL V
Sbjct  361   DTHLGKLKIPEASLSV  376



>ref|XP_006591201.1| PREDICTED: peptide transporter PTR1-like isoform X1 [Glycine 
max]
 ref|XP_006591202.1| PREDICTED: peptide transporter PTR1-like isoform X2 [Glycine 
max]
Length=572

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/381 (73%), Positives = 322/381 (85%), Gaps = 6/381 (2%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M EDD YTKDGT+DY   PANKK+TG WKACPFILGNEC ERLAYYGMS+NL++YF+ RL
Sbjct  1     MAEDDGYTKDGTVDYCGNPANKKETGTWKACPFILGNECCERLAYYGMSTNLVLYFKKRL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             +Q +  ASKN+SNWSGTCYI PLVGAFLAD+YLGRYWTIA FSIIY +GMTL+TLSA+VP
Sbjct  61    HQHSAIASKNVSNWSGTCYITPLVGAFLADSYLGRYWTIAVFSIIYAIGMTLLTLSASVP  120

Query  575   GISPTCIAH--DKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKH  748
             GI PTC  H  + C AT  ++AVCF+ALYL+ALGTGGIKPCVSSYGADQFDDTD  E++H
Sbjct  121   GIKPTCHGHGDENCHATTLESAVCFLALYLIALGTGGIKPCVSSYGADQFDDTDPAEKEH  180

Query  749   KSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQ  928
             KSSFFNWFYFSIN+GAL+A+SL+VWIQ +V WGWGFG+PAVAMA+AV  FFSGTRLYR Q
Sbjct  181   KSSFFNWFYFSINIGALIASSLLVWIQDNVGWGWGFGIPAVAMAIAVVSFFSGTRLYRNQ  240

Query  929   KPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKA  1108
             KPGGS  TR+ QVVVAS+RK KV+VP+D+SLL+ET   ES I+GSRKL HT+ELRFFDKA
Sbjct  241   KPGGSALTRICQVVVASIRKYKVEVPADESLLYETAETESAIKGSRKLDHTDELRFFDKA  300

Query  1109  AVVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQA  1288
              V+  S  +  K S +PWRLCTVTQVEELKSI+RLLP+WATGIIFSTVYGQM T F+ Q 
Sbjct  301   TVLARS--DKVKESTNPWRLCTVTQVEELKSILRLLPVWATGIIFSTVYGQMSTLFVLQG  358

Query  1289  EGMNTYVG--TFKXPXASLGV  1345
             + M+T VG  TFK P ASL +
Sbjct  359   QTMDTRVGNSTFKIPPASLSI  379



>ref|XP_006350821.1| PREDICTED: peptide transporter PTR1-like [Solanum tuberosum]
Length=574

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/381 (72%), Positives = 317/381 (83%), Gaps = 4/381 (1%)
 Frame = +2

Query  209   KAMEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQT  388
             + + EDD+YTKDGT+D+RN PA K +TG WKACPFILGNEC ERLAYYGMS+NL++YF+ 
Sbjct  3     EVVAEDDLYTKDGTVDFRNNPAKKNETGTWKACPFILGNECCERLAYYGMSTNLVLYFKN  62

Query  389   RLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSAT  568
             RLNQ + +ASKN+SNWSGTCYI PL+GAFLADAYLGRYWTIA FSIIYV+GMTL+TLSA+
Sbjct  63    RLNQHSATASKNVSNWSGTCYITPLIGAFLADAYLGRYWTIALFSIIYVIGMTLLTLSAS  122

Query  569   VPGISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKH  748
             VPG+ P+C   D C      TAVCF+ALYL+ALGTGGIKPCVSSYGADQFDD+DE E+KH
Sbjct  123   VPGLKPSCSGEDVCHPKEVQTAVCFVALYLIALGTGGIKPCVSSYGADQFDDSDEVEKKH  182

Query  749   KSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQ  928
             KSSFFNWFYFSIN+GALVA+S++VWIQ +V WGWGFG+PAV MA+AV  FFSGTRLYR Q
Sbjct  183   KSSFFNWFYFSINIGALVASSVLVWIQDNVGWGWGFGIPAVTMAIAVVSFFSGTRLYRNQ  242

Query  929   KPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKA  1108
             KPGGSP TR+ QV+VAS RK KV VP +KSLL+ET   ES I GSRKL HT +L FFDKA
Sbjct  243   KPGGSPLTRICQVLVASFRKFKVNVPEEKSLLYETTDAESAITGSRKLDHTKDLGFFDKA  302

Query  1109  AVVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQA  1288
             AV  ES  +  KG++  WRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQM T F+ Q 
Sbjct  303   AVQTES--DHTKGNIDSWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTLFVLQG  360

Query  1289  EGMNTYVG--TFKXPXASLGV  1345
               M+T VG  +FK P ASL +
Sbjct  361   AAMDTRVGNSSFKIPPASLSI  381



>gb|KHN02576.1| Peptide transporter PTR1 [Glycine soja]
Length=572

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/381 (73%), Positives = 322/381 (85%), Gaps = 6/381 (2%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M EDD YTKDGT+DY   PANKK+TG WKACPFILGNEC ERLAYYGMS+NL++YF+ RL
Sbjct  1     MAEDDGYTKDGTVDYCGNPANKKETGTWKACPFILGNECCERLAYYGMSTNLVLYFKKRL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             +Q +  ASKN+SNWSGTCYI PLVGAFLAD+YLGRYWTIA FSIIY +GMTL+TLSA+VP
Sbjct  61    HQHSAIASKNVSNWSGTCYITPLVGAFLADSYLGRYWTIAVFSIIYAIGMTLLTLSASVP  120

Query  575   GISPTCIAH--DKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKH  748
             GI PTC  H  + C AT  ++AVCF+ALYL+ALGTGGIKPCVSSYGADQFDDTD  E++H
Sbjct  121   GIKPTCHGHGDENCHATTLESAVCFLALYLIALGTGGIKPCVSSYGADQFDDTDPAEKEH  180

Query  749   KSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQ  928
             KSSFFNWFYFSIN+GAL+A+SL+VWIQ +V WGWGFG+PAVAMA+AV  FFSGTRLYR Q
Sbjct  181   KSSFFNWFYFSINIGALIASSLLVWIQDNVGWGWGFGIPAVAMAIAVASFFSGTRLYRNQ  240

Query  929   KPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKA  1108
             KPGGS  TR+ QVVVAS+RK KV+VP+D+SLL+ET   ES I+GSRKL HT+ELRFFDKA
Sbjct  241   KPGGSALTRICQVVVASIRKYKVEVPADESLLYETAETESAIKGSRKLDHTDELRFFDKA  300

Query  1109  AVVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQA  1288
              V+  S  +  K S +PWRLCTVTQVEELKSI+RLLP+WATGIIFSTVYGQM T F+ Q 
Sbjct  301   TVLARS--DKVKESTNPWRLCTVTQVEELKSILRLLPVWATGIIFSTVYGQMSTLFVLQG  358

Query  1289  EGMNTYVG--TFKXPXASLGV  1345
             + M+T VG  TFK P ASL +
Sbjct  359   QTMDTRVGNSTFKIPPASLSI  379



>gb|EYU45753.1| hypothetical protein MIMGU_mgv1a003661mg [Erythranthe guttata]
Length=571

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/378 (70%), Positives = 323/378 (85%), Gaps = 4/378 (1%)
 Frame = +2

Query  218   EEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  397
             EEDD+YTKDGT+DY+N PANK +TG WKACP+ILGNEC ERLA+YGMSSNL++YF+ RLN
Sbjct  3     EEDDLYTKDGTVDYQNNPANKTRTGTWKACPYILGNECCERLAFYGMSSNLVVYFKERLN  62

Query  398   QSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPG  577
             Q +T+AS N+SNW+GTCYI PL+GAF+ADAYLGRYWTIA+FSI+YV+GMTL+TLSA++PG
Sbjct  63    QHSTTASNNVSNWAGTCYITPLIGAFVADAYLGRYWTIASFSILYVIGMTLLTLSASIPG  122

Query  578   ISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSS  757
             + PTCI  + C AT    AVCF+ALYL+ALGTGGIKPCVSS+GADQFDDTDE E+ HKSS
Sbjct  123   LKPTCIDKNTCHATSGQAAVCFVALYLIALGTGGIKPCVSSFGADQFDDTDELEKNHKSS  182

Query  758   FFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKPG  937
             FFNWFYF IN+GAL+AAS++V+IQ  V W WGFG+PAVAMA+AV FFFSGTRLYR QKPG
Sbjct  183   FFNWFYFVINIGALIAASVLVYIQMHVGWQWGFGIPAVAMAIAVVFFFSGTRLYRNQKPG  242

Query  938   GSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAVV  1117
             GSP TR+ QVV+AS RK  V+VP+DKSLL+ET+  ES I+GSRK+ HTN L FFDKAAV 
Sbjct  243   GSPLTRICQVVIASFRKYNVQVPADKSLLYETLDAESAIKGSRKIEHTNNLAFFDKAAV-  301

Query  1118  EESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEGM  1297
              ++  + KK  ++PW+LCTVTQVEELK+IIRLLPIWATGIIF+TVYGQMGT F+ Q   M
Sbjct  302   -DTQPDVKKAPINPWKLCTVTQVEELKAIIRLLPIWATGIIFATVYGQMGTLFVLQGLTM  360

Query  1298  NTYVG--TFKXPXASLGV  1345
             + ++G  +F+ P ASL +
Sbjct  361   DAHLGKSSFEIPAASLSI  378



>ref|XP_007146742.1| hypothetical protein PHAVU_006G065900g [Phaseolus vulgaris]
 gb|ESW18736.1| hypothetical protein PHAVU_006G065900g [Phaseolus vulgaris]
Length=570

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/379 (72%), Positives = 322/379 (85%), Gaps = 4/379 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M EDD YTKDGT+DY   PANKK+TG W+ACPFILGNEC ERLAYYGMS+NL++YF+ RL
Sbjct  1     MAEDDGYTKDGTVDYCGNPANKKETGTWRACPFILGNECCERLAYYGMSTNLVLYFKNRL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             +Q + +ASKN+SNWSGTCYI PL+GAFLAD+YLGRYWTIA FSIIYV+GMTL+TLSA+VP
Sbjct  61    HQHSATASKNVSNWSGTCYITPLIGAFLADSYLGRYWTIAGFSIIYVIGMTLLTLSASVP  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+ P C   + C AT  ++A+CF+ALYL+ALGTGGIKPCVSSYGADQFDDTD  E++HKS
Sbjct  121   GMKPACHGDENCRATTLESAICFLALYLIALGTGGIKPCVSSYGADQFDDTDPVEKEHKS  180

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GAL+A+SL+VWIQ +V WGWGFG+PAVAMA+AV  FFSGTRLYR QKP
Sbjct  181   SFFNWFYFSINIGALIASSLLVWIQDNVGWGWGFGIPAVAMAIAVVSFFSGTRLYRNQKP  240

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGS  TR+ QVV+AS+RK  V+VPSD SLL+ET   ES I+GSRKL HTNELRFFDKAAV
Sbjct  241   GGSALTRICQVVLASIRKYHVEVPSDTSLLYETSEDESAIKGSRKLDHTNELRFFDKAAV  300

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
             V  S  +  + S +PWRLCTVTQVEELKS++RLLP+WATGIIFSTVYGQM T F+ Q + 
Sbjct  301   VGRS--DKVRESTNPWRLCTVTQVEELKSVLRLLPVWATGIIFSTVYGQMSTLFVLQGQT  358

Query  1295  MNTYVG--TFKXPXASLGV  1345
             MNT+VG  +FK P ASL +
Sbjct  359   MNTHVGNSSFKIPPASLSI  377



>ref|XP_003551296.1| PREDICTED: peptide transporter PTR1 [Glycine max]
Length=572

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/381 (72%), Positives = 323/381 (85%), Gaps = 6/381 (2%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M EDD YTKDGT+DY   PANKK+TG WKACP+ILGNEC ERLAYYGMS+NL++YF+ RL
Sbjct  1     MAEDDGYTKDGTVDYCGNPANKKETGTWKACPYILGNECCERLAYYGMSTNLVLYFKNRL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             NQ + +ASKN+SNWSGTCYI PL+GA+LAD+YLGRYWTIA FSIIY +GMTL+TLSA+VP
Sbjct  61    NQHSATASKNVSNWSGTCYITPLIGAYLADSYLGRYWTIAVFSIIYAIGMTLLTLSASVP  120

Query  575   GISPTCIAH--DKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKH  748
             GI PTC  H  + C AT  ++AVCF+ALYL+ALGTGGIKPCVSSYGADQFDDTD  E++ 
Sbjct  121   GIKPTCHGHGDENCRATTLESAVCFLALYLIALGTGGIKPCVSSYGADQFDDTDSAEKER  180

Query  749   KSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQ  928
             KSSFFNWFYFSIN+GAL+A+SL+VWIQ +V WGWGFG+PAVAMA+AV  FFSGTRLYR Q
Sbjct  181   KSSFFNWFYFSINIGALIASSLLVWIQDNVGWGWGFGIPAVAMAIAVVSFFSGTRLYRNQ  240

Query  929   KPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKA  1108
             KPGGS  TR+ QVV+AS+RK  V+VP+D+SLL+ET   ES I+GSRKL HTNELRFFDKA
Sbjct  241   KPGGSAITRICQVVMASIRKYNVEVPADESLLYETAETESAIKGSRKLDHTNELRFFDKA  300

Query  1109  AVVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQA  1288
             AV+ +S  +  K S +PWRLCTVTQVEELKSI+R+LP+WATGIIFSTVYGQM T F+ Q 
Sbjct  301   AVLAQS--DKVKESTNPWRLCTVTQVEELKSILRILPVWATGIIFSTVYGQMSTLFVLQG  358

Query  1289  EGMNTYVG--TFKXPXASLGV  1345
             + M+T VG  TFK P ASL +
Sbjct  359   QTMDTRVGNSTFKIPPASLSI  379



>gb|KJB19923.1| hypothetical protein B456_003G124700 [Gossypium raimondii]
 gb|KJB19924.1| hypothetical protein B456_003G124700 [Gossypium raimondii]
Length=528

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/379 (72%), Positives = 315/379 (83%), Gaps = 4/379 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M E D YTKDGT+D++  PAN KKTG WKACPFI+GNEC ERLAYYGMSSNL+ YF+ RL
Sbjct  1     MAESDFYTKDGTVDHKGNPANIKKTGTWKACPFIIGNECCERLAYYGMSSNLVRYFKHRL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             NQ T+ A++N  NWSGTCYI PL+GAFLADAYLGRYWTIA FSIIYV GMTL+ +SATV 
Sbjct  61    NQHTSVATRNNQNWSGTCYITPLIGAFLADAYLGRYWTIALFSIIYVFGMTLLAMSATVH  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             GI P C   D C  T   +AV F+ALYLVALGTGGIKPCVSSYGADQFDDT+E E+KHKS
Sbjct  121   GIKPRCYTEDNCDPTVTQSAVFFVALYLVALGTGGIKPCVSSYGADQFDDTNETEKKHKS  180

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GAL+A+S++VW+Q +VSWGWGFG+PA+AMA+AV FFFSGTRLYR QKP
Sbjct  181   SFFNWFYFSINIGALIASSVLVWVQDNVSWGWGFGIPAIAMAIAVVFFFSGTRLYRNQKP  240

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TRL QVVVAS RK +V VP+DKSLL+ET+  ESNI+GSRK+ HT +L FFDKAAV
Sbjct  241   GGSPLTRLCQVVVASFRKCRVAVPADKSLLYETMDAESNIKGSRKVEHTEDLSFFDKAAV  300

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               ES  +D KG+V+ WRLCTVTQVEELK++IRLLPIWATGIIF+ VY QM   F+ Q E 
Sbjct  301   ETES--DDIKGTVNSWRLCTVTQVEELKAVIRLLPIWATGIIFAAVYSQMSNLFVLQGER  358

Query  1295  MNTYVG--TFKXPXASLGV  1345
             MNT+VG  TFK P ASL +
Sbjct  359   MNTHVGNSTFKIPPASLSI  377



>gb|KJB19921.1| hypothetical protein B456_003G124700 [Gossypium raimondii]
 gb|KJB19922.1| hypothetical protein B456_003G124700 [Gossypium raimondii]
Length=570

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/379 (72%), Positives = 315/379 (83%), Gaps = 4/379 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M E D YTKDGT+D++  PAN KKTG WKACPFI+GNEC ERLAYYGMSSNL+ YF+ RL
Sbjct  1     MAESDFYTKDGTVDHKGNPANIKKTGTWKACPFIIGNECCERLAYYGMSSNLVRYFKHRL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             NQ T+ A++N  NWSGTCYI PL+GAFLADAYLGRYWTIA FSIIYV GMTL+ +SATV 
Sbjct  61    NQHTSVATRNNQNWSGTCYITPLIGAFLADAYLGRYWTIALFSIIYVFGMTLLAMSATVH  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             GI P C   D C  T   +AV F+ALYLVALGTGGIKPCVSSYGADQFDDT+E E+KHKS
Sbjct  121   GIKPRCYTEDNCDPTVTQSAVFFVALYLVALGTGGIKPCVSSYGADQFDDTNETEKKHKS  180

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GAL+A+S++VW+Q +VSWGWGFG+PA+AMA+AV FFFSGTRLYR QKP
Sbjct  181   SFFNWFYFSINIGALIASSVLVWVQDNVSWGWGFGIPAIAMAIAVVFFFSGTRLYRNQKP  240

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TRL QVVVAS RK +V VP+DKSLL+ET+  ESNI+GSRK+ HT +L FFDKAAV
Sbjct  241   GGSPLTRLCQVVVASFRKCRVAVPADKSLLYETMDAESNIKGSRKVEHTEDLSFFDKAAV  300

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               ES  +D KG+V+ WRLCTVTQVEELK++IRLLPIWATGIIF+ VY QM   F+ Q E 
Sbjct  301   ETES--DDIKGTVNSWRLCTVTQVEELKAVIRLLPIWATGIIFAAVYSQMSNLFVLQGER  358

Query  1295  MNTYVG--TFKXPXASLGV  1345
             MNT+VG  TFK P ASL +
Sbjct  359   MNTHVGNSTFKIPPASLSI  377



>ref|XP_004241180.2| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Solanum lycopersicum]
Length=655

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/381 (72%), Positives = 317/381 (83%), Gaps = 4/381 (1%)
 Frame = +2

Query  209   KAMEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQT  388
             + + EDD+YTKDGT+D+RN PA + +TG WKACPFILGNEC ERLAYYGMS+NL++YF+ 
Sbjct  84    EVVAEDDLYTKDGTVDFRNNPAKRNETGTWKACPFILGNECCERLAYYGMSTNLVLYFKK  143

Query  389   RLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSAT  568
             RLNQ + +ASKN+SNWSGTCYI PL+GAFLADAYLGRYWTIA FSIIYV+GMTL+TLSA+
Sbjct  144   RLNQHSATASKNVSNWSGTCYITPLIGAFLADAYLGRYWTIALFSIIYVIGMTLLTLSAS  203

Query  569   VPGISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKH  748
             VPG+ P+C   D C      TAVCF+ALYL+ALGTGGIKPCVSSYGADQFDD+DE E+KH
Sbjct  204   VPGLKPSCSGEDVCHPKEVQTAVCFVALYLIALGTGGIKPCVSSYGADQFDDSDEVEKKH  263

Query  749   KSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQ  928
             KSSFFNWFYFSIN+GAL+A+S++VWIQ +V WGWGFG+PAV MA+A+  FFSGTRLYR Q
Sbjct  264   KSSFFNWFYFSINIGALIASSVLVWIQDNVGWGWGFGIPAVTMAIAIVSFFSGTRLYRNQ  323

Query  929   KPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKA  1108
             KPGGSP TR+ QV+VAS RK KV VP +KSLL+ET   ES I GSRKL HT +L FFDKA
Sbjct  324   KPGGSPLTRICQVLVASFRKFKVNVPEEKSLLYETTDAESAITGSRKLDHTEDLSFFDKA  383

Query  1109  AVVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQA  1288
             AV  E LD   KG++  WRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQM T F+ Q 
Sbjct  384   AVQTE-LDH-VKGNIDSWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMSTLFVLQG  441

Query  1289  EGMNTYVG--TFKXPXASLGV  1345
               M+T VG  +FK P ASL +
Sbjct  442   AAMDTRVGNSSFKIPPASLSI  462



>emb|CDP09151.1| unnamed protein product [Coffea canephora]
Length=570

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/379 (71%), Positives = 319/379 (84%), Gaps = 4/379 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M EDD+YTKDGT+D R  PA K +TG W+ACP+ILGNEC ERLAYYGMSSNL+++F+ RL
Sbjct  1     MAEDDLYTKDGTVDCRGNPAKKNETGTWRACPYILGNECCERLAYYGMSSNLVLFFKHRL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
              Q   +ASKN+S+WSGTCYI PL+GAF ADAYLGR+WTIA FSIIYV+GMTL+TLSA++P
Sbjct  61    GQHNATASKNVSDWSGTCYITPLIGAFFADAYLGRFWTIACFSIIYVLGMTLLTLSASIP  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+ PTC   + C ATG  ++V F+ALYL+ALGTGGIKPCVSSYGADQFDDTDE E+KHK+
Sbjct  121   GLKPTCHGKESCHATGTQSSVVFLALYLIALGTGGIKPCVSSYGADQFDDTDEVEKKHKA  180

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GAL+A+S++VW+Q +V WGWGFG+PAV MA+A   FFSG+RLYR QKP
Sbjct  181   SFFNWFYFSINIGALIASSVLVWVQDNVGWGWGFGIPAVTMAIAAVSFFSGSRLYRNQKP  240

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TRL QV+VAS +K KV+VP DKSLL+E    ES I+GSRKL HT++L FFDKAAV
Sbjct  241   GGSPLTRLCQVLVASFKKYKVEVPEDKSLLYECKDTESAIEGSRKLGHTSDLVFFDKAAV  300

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               ES  + K+GSV PWRLCTVTQVEELK+IIRLLPIWATGIIFS+VYGQM T F+ Q E 
Sbjct  301   ERES--DYKRGSVDPWRLCTVTQVEELKAIIRLLPIWATGIIFSSVYGQMSTLFVLQGET  358

Query  1295  MNTYVG--TFKXPXASLGV  1345
             MNTYVG  TF+ P ASLG+
Sbjct  359   MNTYVGHSTFQIPPASLGI  377



>ref|XP_002298324.1| hypothetical protein POPTR_0001s25570g [Populus trichocarpa]
 gb|EEE83129.1| hypothetical protein POPTR_0001s25570g [Populus trichocarpa]
Length=570

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/379 (70%), Positives = 314/379 (83%), Gaps = 4/379 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M E+DVYTKDGT+DYR  PANKK+TG W+ACP+I+GNE  ERLAYYGMSSNL++YF+ RL
Sbjct  1     MAEEDVYTKDGTVDYRGNPANKKETGTWRACPYIIGNEFCERLAYYGMSSNLILYFKHRL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             NQ + +A++N  NW GTCY+ PL+GAF ADAYLGRYWTIA FSIIYVMGMTL+T+SATVP
Sbjct  61    NQQSATATRNNLNWGGTCYLTPLIGAFFADAYLGRYWTIACFSIIYVMGMTLLTISATVP  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+ P C A D C  T   +A+ F++LYL+ALGTGGIKPCVSSYGADQFDD DE E+KHKS
Sbjct  121   GLRPKCYAEDDCNPTDAQSALAFVSLYLIALGTGGIKPCVSSYGADQFDDADEVEKKHKS  180

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFY SINVGAL+A S++VW+Q +VSWGWGFG+PA+AMA+AV  FFSGTRL+RYQKP
Sbjct  181   SFFNWFYLSINVGALIAGSVLVWVQDNVSWGWGFGIPAIAMAIAVASFFSGTRLFRYQKP  240

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QV++AS RK+KV+VP+DK+LL+ET   ESNI+GSRKL HT E  F DKAAV
Sbjct  241   GGSPLTRICQVLLASFRKKKVEVPADKALLYETADAESNIKGSRKLDHTEEFSFLDKAAV  300

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               E+  +D KG V PWRLCTVTQVEELKSIIRLLPIWATGIIF+ VY QMG  F+ Q E 
Sbjct  301   --ETEKDDIKGPVDPWRLCTVTQVEELKSIIRLLPIWATGIIFTAVYSQMGNLFVLQGEQ  358

Query  1295  MNTYVG--TFKXPXASLGV  1345
             M+ YVG   F+ P ASL +
Sbjct  359   MDKYVGNSNFQIPSASLSI  377



>ref|XP_007016184.1| Peptide transporter 1 [Theobroma cacao]
 gb|EOY33803.1| Peptide transporter 1 [Theobroma cacao]
Length=569

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/379 (71%), Positives = 318/379 (84%), Gaps = 5/379 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             ME+DD+YTKDGT+DY+  PANKK+TG W+ACPFI+GNE  ERLAYYGMS+NL++YF+ RL
Sbjct  1     MEKDDIYTKDGTVDYKGNPANKKETGTWRACPFIIGNEGCERLAYYGMSTNLVLYFKHRL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             NQ +  A+KN  NW GTCYI PL+GAFLADAYLGRYWTIA FSIIY+ GMTL+ LSA+V 
Sbjct  61    NQHSAVATKNNQNWGGTCYITPLIGAFLADAYLGRYWTIACFSIIYIFGMTLLALSASVH  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             GI P C   D C  T   +A+ F+ALYL+ALGTGGIKPCVSSYGADQFDDTDEKE+KHKS
Sbjct  121   GIRPRCYTKDSCDPTDTQSAMAFLALYLIALGTGGIKPCVSSYGADQFDDTDEKEKKHKS  180

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GAL+AAS++VW+Q +VSWGWGFG+PA+AMA+AV FFFSGTRLYRYQKP
Sbjct  181   SFFNWFYFSINIGALIAASVLVWVQDNVSWGWGFGIPAIAMAIAVCFFFSGTRLYRYQKP  240

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TRL QV+VAS+RK KV VP+DKS+L+ET   ESNI+GSRK+ HT +L FFDKAAV
Sbjct  241   GGSPLTRLCQVLVASIRKYKVAVPADKSILYETADAESNIKGSRKIDHTTDLSFFDKAAV  300

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               E+  +  KGS +PWRLCTVTQVEELK+IIRLLPIWA+GIIFSTVY QMG  F+ Q E 
Sbjct  301   --ETERDHIKGS-NPWRLCTVTQVEELKAIIRLLPIWASGIIFSTVYSQMGNLFVLQGER  357

Query  1295  MNTYVG--TFKXPXASLGV  1345
             M+T VG   F+ P ASL +
Sbjct  358   MDTRVGHSKFRIPPASLSI  376



>gb|ACJ85720.1| unknown [Medicago truncatula]
Length=517

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/379 (72%), Positives = 323/379 (85%), Gaps = 4/379 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             MEE++VYTKDGT+DY   PAN+KKTG WKACPFILGNEC ERLAYYGMS+NL++YF+ RL
Sbjct  1     MEEENVYTKDGTVDYLGNPANRKKTGTWKACPFILGNECCERLAYYGMSTNLVLYFKERL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             +Q +  ASKN+SNW+GTCYI PL+GAF+AD+YLGRYWTIA+FSI+YV+GMTL+TLSA V 
Sbjct  61    HQHSAVASKNVSNWAGTCYITPLIGAFVADSYLGRYWTIASFSILYVIGMTLLTLSAPVS  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             GI P C   D C AT   +AVCF+ALYL+ALGTGGIKPCVSSYGADQFDD DE E+KHKS
Sbjct  121   GIKPECQGKDNCHATTLQSAVCFLALYLIALGTGGIKPCVSSYGADQFDDDDEDEKKHKS  180

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GAL+A+SL+VWIQ +V WGWGFG+PAVAMA+AV  FFSGT+LYR QKP
Sbjct  181   SFFNWFYFSINIGALIASSLLVWIQDNVGWGWGFGIPAVAMAIAVVSFFSGTKLYRNQKP  240

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QV+VAS+RK +V  P+DKSLL+E    ES I+GSRKL HTNELRFFDKAAV
Sbjct  241   GGSPLTRIAQVIVASIRKYRVDAPTDKSLLYEIADTESAIKGSRKLDHTNELRFFDKAAV  300

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               ES  ++ K S++PWRLCTVTQVEELKSI+RLLP+WATGIIF+TVYGQM T F+ Q + 
Sbjct  301   QGES--DNLKESINPWRLCTVTQVEELKSILRLLPVWATGIIFATVYGQMSTLFVLQGQT  358

Query  1295  MNTYVG--TFKXPXASLGV  1345
             MNT+VG  +FK P ASL +
Sbjct  359   MNTHVGNSSFKIPPASLSI  377



>ref|XP_009374278.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like [Pyrus x bretschneideri]
 ref|XP_009374279.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like [Pyrus x bretschneideri]
Length=582

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/385 (71%), Positives = 317/385 (82%), Gaps = 4/385 (1%)
 Frame = +2

Query  197   MEQSKAMEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMI  376
             + ++   EE DVYTKDGT+D+R  PA +  TG WKACPFILGNEC ERLAYYGMSSNL+I
Sbjct  7     LAKAAPPEEKDVYTKDGTVDFRGNPAKRNATGTWKACPFILGNECCERLAYYGMSSNLVI  66

Query  377   YFQTRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMT  556
             YF+T+LNQ++  A+KN SNWSGTCY+ PL+GA LADAYLGRY TIA+FSIIYV+GMTL+T
Sbjct  67    YFKTQLNQTSAVAAKNNSNWSGTCYLTPLLGAVLADAYLGRYKTIASFSIIYVIGMTLLT  126

Query  557   LSATVPGISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEK  736
             +SA+VPG+ PTC++ D C A G  TA  FIALYL+ALGTGGIKPCVSSYGADQFDD DE 
Sbjct  127   MSASVPGMKPTCVSKDDCHANGGQTAATFIALYLIALGTGGIKPCVSSYGADQFDDDDEV  186

Query  737   ERKHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRL  916
             E+KHK+SFFNWFYFSINVGAL+A+S++VWIQ +V WGWGFGVPAVAMA+AV  FFSGTRL
Sbjct  187   EKKHKASFFNWFYFSINVGALIASSVLVWIQDNVGWGWGFGVPAVAMAIAVLSFFSGTRL  246

Query  917   YRYQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRF  1096
             YR QKPGGSP TR+ QVVVAS+RK KVKVP DKSLL+ET   ES+IQGSRKL HTNE RF
Sbjct  247   YRNQKPGGSPVTRIIQVVVASVRKYKVKVPEDKSLLYETADAESSIQGSRKLDHTNEFRF  306

Query  1097  FDKAAVVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQF  1276
             FDKAAV  E  D++ K S SPWRL TVTQVEELKSIIRLLPIWATGIIF+  Y QM   F
Sbjct  307   FDKAAV--EVPDDNIKDSKSPWRLTTVTQVEELKSIIRLLPIWATGIIFAAAYNQMSNFF  364

Query  1277  ISQAEGMNTYVG--TFKXPXASLGV  1345
             + Q   M+  VG  +F+ P ASL V
Sbjct  365   VLQGTLMDVRVGHSSFEIPAASLSV  389



>gb|KEH34179.1| proton-dependent oligopeptide transport family protein [Medicago 
truncatula]
Length=570

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/379 (72%), Positives = 324/379 (85%), Gaps = 4/379 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             MEE++VYTKDGT+DY   PAN+KKTG WKACPFILGNEC ERLAYYGMS+NL++YF+ RL
Sbjct  1     MEEENVYTKDGTVDYLGNPANRKKTGTWKACPFILGNECCERLAYYGMSTNLVLYFKERL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             +Q +  ASKN+SNW+GTCYI PL+GAF+AD+YLGRYWTIA+FSI+YV+GMTL+TLSA+V 
Sbjct  61    HQHSAVASKNVSNWAGTCYITPLIGAFVADSYLGRYWTIASFSILYVIGMTLLTLSASVS  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             GI P C   D C AT   +AVCF+ALYL+ALGTGGIKPCVSSYGADQFDD DE E+KHKS
Sbjct  121   GIKPECQGKDNCHATTLQSAVCFLALYLIALGTGGIKPCVSSYGADQFDDDDEDEKKHKS  180

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GAL+A+SL+VWIQ +V WGWGFG+PAVAMA+AV  FFSGT+LYR QKP
Sbjct  181   SFFNWFYFSINIGALIASSLLVWIQDNVGWGWGFGIPAVAMAIAVVSFFSGTKLYRNQKP  240

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QV+VAS+RK +V  P+DKSLL+E    ES I+GSRKL HTNELRFFDKAAV
Sbjct  241   GGSPLTRIAQVIVASIRKYRVDAPTDKSLLYEIADTESAIKGSRKLDHTNELRFFDKAAV  300

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               ES  ++ K S++PWRLCTVTQVEELKSI+RLLP+WATGIIF+TVYGQM T F+ Q + 
Sbjct  301   QGES--DNLKESINPWRLCTVTQVEELKSILRLLPVWATGIIFATVYGQMSTLFVLQGQT  358

Query  1295  MNTYVG--TFKXPXASLGV  1345
             MNT+VG  +FK P ASL +
Sbjct  359   MNTHVGNSSFKIPPASLSI  377



>ref|XP_002313394.1| hypothetical protein POPTR_0009s04710g [Populus trichocarpa]
 ref|XP_006379037.1| hypothetical protein POPTR_0009s04710g [Populus trichocarpa]
 ref|XP_006379038.1| hypothetical protein POPTR_0009s04710g [Populus trichocarpa]
 ref|XP_006379039.1| hypothetical protein POPTR_0009s04710g [Populus trichocarpa]
 gb|EEE87349.1| hypothetical protein POPTR_0009s04710g [Populus trichocarpa]
 gb|ERP56834.1| hypothetical protein POPTR_0009s04710g [Populus trichocarpa]
 gb|ERP56835.1| hypothetical protein POPTR_0009s04710g [Populus trichocarpa]
 gb|ERP56836.1| hypothetical protein POPTR_0009s04710g [Populus trichocarpa]
Length=570

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/379 (70%), Positives = 314/379 (83%), Gaps = 4/379 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M E+DVYTKDGT+DY   PAN+K+TG W+ACPFI+GNE  ERLAYYGMSSNL++YF+ RL
Sbjct  1     MAEEDVYTKDGTVDYLGNPANRKETGTWRACPFIIGNEFCERLAYYGMSSNLVLYFKHRL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             NQS+ +A++N  NW GTCY+ PL+GAF+ADAYLGRYWTIA+FS IYV GMTL+T+SATV 
Sbjct  61    NQSSATATRNNLNWGGTCYLTPLIGAFVADAYLGRYWTIASFSTIYVAGMTLLTMSATVH  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+ P C + D C  TG  TAV F+ALYL+ALGTGGIKPCVSSYGADQFDD DE E+KHKS
Sbjct  121   GLRPECYSKDHCHPTGGQTAVTFVALYLIALGTGGIKPCVSSYGADQFDDADETEKKHKS  180

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFY SINVGAL+A S++VWIQ +VSWGWGFG+PA+AMA+AV  FFSGT+L+RYQKP
Sbjct  181   SFFNWFYLSINVGALIAGSVLVWIQDNVSWGWGFGIPAIAMAIAVVSFFSGTKLFRYQKP  240

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QV+VAS RK+KV+VP+DKSLLHET   ESNI+GSRKL HT E  F DKAAV
Sbjct  241   GGSPLTRICQVLVASFRKQKVEVPADKSLLHETADAESNIKGSRKLDHTEEFSFLDKAAV  300

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               E+  +D KG+  PW LCTVTQVEELK+IIRLLPIWATGIIFS VY QMG  F+ Q E 
Sbjct  301   --ETEKDDIKGTGDPWNLCTVTQVEELKAIIRLLPIWATGIIFSAVYSQMGNLFVLQGET  358

Query  1295  MNTYVG--TFKXPXASLGV  1345
             M+ +VG  TF+ P ASL +
Sbjct  359   MDKFVGNSTFEIPSASLSI  377



>gb|KJB55776.1| hypothetical protein B456_009G093900 [Gossypium raimondii]
Length=596

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/390 (68%), Positives = 321/390 (82%), Gaps = 4/390 (1%)
 Frame = +2

Query  182   IGLQMMEQSKAMEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMS  361
             I +Q     K+MEEDD+YT DGT+DY+  PANKKKTG W+ CPFI+GNE  ERLAYYGMS
Sbjct  16    ILVQTFHIEKSMEEDDIYTNDGTVDYKGNPANKKKTGTWRTCPFIIGNEVCERLAYYGMS  75

Query  362   SNLMIYFQTRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMG  541
             +NL++YF+ +LNQ ++ A+ N  NW GTCYI P++GAFLAD+YLGRYWTIA FSI+Y++G
Sbjct  76    TNLVLYFKHQLNQHSSVAATNNQNWGGTCYITPIIGAFLADSYLGRYWTIACFSIVYIIG  135

Query  542   MTLMTLSATVPGISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFD  721
             MTL+ LSA+V GI P C A D C  T   +A+ F+ALYL+ALGTGGIKPCVSSYGADQFD
Sbjct  136   MTLLALSASVRGIRPRCYAEDNCNPTEVQSAMTFLALYLIALGTGGIKPCVSSYGADQFD  195

Query  722   DTDEKERKHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFF  901
             DTDEKE+KHKSSFFNWFY SIN+GAL+A S++VW+Q +VSWGWG G+PA+AMA+AV FFF
Sbjct  196   DTDEKEKKHKSSFFNWFYLSINIGALIAGSVLVWVQDNVSWGWGLGIPAIAMAIAVCFFF  255

Query  902   SGTRLYRYQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHT  1081
             SGT LYR Q PGGSP TRLFQV+VAS+RK KV VP++KS+LHET   ESNI+GSRK+ HT
Sbjct  256   SGTCLYRNQVPGGSPVTRLFQVLVASIRKYKVAVPANKSVLHETADKESNIKGSRKIDHT  315

Query  1082  NELRFFDKAAVVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQ  1261
             N+L FFDKAAV  E+  +  KGSV+PWRLCTVTQVEELK+IIRLLP+WA+GIIFST+  Q
Sbjct  316   NDLSFFDKAAVEIET--DQLKGSVNPWRLCTVTQVEELKAIIRLLPVWASGIIFSTICSQ  373

Query  1262  MGTQFISQAEGMNTYVG--TFKXPXASLGV  1345
             MG+ F+ Q E M+T+VG   FK P ASL +
Sbjct  374   MGSLFVLQGERMDTHVGHSNFKIPAASLSI  403



>ref|XP_011032155.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Populus euphratica]
 ref|XP_011032156.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Populus euphratica]
Length=570

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/379 (70%), Positives = 313/379 (83%), Gaps = 4/379 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M E+DVYTKDGT+DY   PAN+K+TG W+ACPFI+GNE  ERLAYYGMSSNL++YF+ RL
Sbjct  1     MAEEDVYTKDGTVDYLGNPANRKETGTWRACPFIIGNEFCERLAYYGMSSNLVLYFKHRL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             NQS+ +A++N  NW GTCYI PL+GAF+ADAYLGRYWTIA+FS IYV GMTL+T+SATVP
Sbjct  61    NQSSATATRNNLNWGGTCYITPLIGAFVADAYLGRYWTIASFSSIYVAGMTLLTMSATVP  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+ P C + D C  T   TAV F+ALYL+ALGTGGIKPCVSSYGADQFDD DE E+KHKS
Sbjct  121   GLRPECYSKDHCHPTDGQTAVTFVALYLIALGTGGIKPCVSSYGADQFDDADETEKKHKS  180

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFY SINVGAL+A S++VWIQ +VSWGWGFG+PA+AMA+AV  FFSGT+L+RYQKP
Sbjct  181   SFFNWFYLSINVGALIAGSVLVWIQDNVSWGWGFGIPAIAMAIAVVSFFSGTKLFRYQKP  240

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QV+VAS RKRKV+VP+DKSLLHET   ESNI+GSRKL HT E  F DKAAV
Sbjct  241   GGSPVTRICQVLVASFRKRKVEVPADKSLLHETADAESNIKGSRKLDHTKEFSFLDKAAV  300

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               E+  +D K +  PW LCTVTQVEELK+IIRLLPIWATGIIFS VY QMG  F+ Q E 
Sbjct  301   --ETEKDDIKSTGDPWNLCTVTQVEELKAIIRLLPIWATGIIFSAVYSQMGNLFVLQGET  358

Query  1295  MNTYVG--TFKXPXASLGV  1345
             M+ +VG  TF+ P ASL +
Sbjct  359   MDKFVGNSTFEIPSASLSI  377



>ref|XP_009346886.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like isoform X2 [Pyrus 
x bretschneideri]
 ref|XP_009346887.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like isoform X2 [Pyrus 
x bretschneideri]
Length=582

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/383 (70%), Positives = 317/383 (83%), Gaps = 4/383 (1%)
 Frame = +2

Query  203   QSKAMEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYF  382
             ++   EE+DVYTKDGT+D+R  PA +  TG WKACPFILGNEC ERLAYYGMSSNL+IYF
Sbjct  9     KAAVAEENDVYTKDGTVDFRGNPAKRNATGTWKACPFILGNECCERLAYYGMSSNLVIYF  68

Query  383   QTRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLS  562
             +T+LNQ++ +A+KN SNWSGTCY+ PL+GAFLADAYLGRY TIA+FSIIYV+GMTL+T+S
Sbjct  69    KTQLNQTSAAAAKNNSNWSGTCYLTPLLGAFLADAYLGRYKTIASFSIIYVIGMTLLTMS  128

Query  563   ATVPGISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKER  742
             A+VPG+ PTC++ D C A G  TA  FIALYL+ALGTGGIKPCVSSYGADQFDD DE E+
Sbjct  129   ASVPGMKPTCVSKDVCHANGGQTAATFIALYLIALGTGGIKPCVSSYGADQFDDDDEVEK  188

Query  743   KHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYR  922
             KHK SFFNWFYFSINVGA++A+S++VWIQ++V W WGFGVPAVAMA+AV  FFSGTRLYR
Sbjct  189   KHKGSFFNWFYFSINVGAMIASSVLVWIQENVGWEWGFGVPAVAMAIAVLSFFSGTRLYR  248

Query  923   YQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFD  1102
              QKPGGSP TR+ QV+VAS+R  K+KVP DKSLL+ET   ES+IQGSRKL HTNE RFFD
Sbjct  249   NQKPGGSPLTRIIQVIVASIRNYKLKVPEDKSLLYETADAESSIQGSRKLDHTNEFRFFD  308

Query  1103  KAAVVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFIS  1282
             KAAVV +   +  K S SPWRL TVTQVEELKSIIRLLPIWATGIIF+ VY QM   F+ 
Sbjct  309   KAAVVVQG--DQIKDSKSPWRLSTVTQVEELKSIIRLLPIWATGIIFAAVYSQMSNFFVL  366

Query  1283  QAEGMNTYVG--TFKXPXASLGV  1345
             Q   M+  VG  +F+ P ASL +
Sbjct  367   QGTLMDIRVGHSSFEIPAASLSI  389



>emb|CDP09153.1| unnamed protein product [Coffea canephora]
Length=618

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/379 (72%), Positives = 309/379 (82%), Gaps = 3/379 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             ME DD YTKDGT+DYR  PA+K+KTG WKACP+ILGNECSERLAYYGMSSNLMIYF  +L
Sbjct  48    MEADDYYTKDGTVDYRKNPADKRKTGTWKACPYILGNECSERLAYYGMSSNLMIYFTKQL  107

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             NQ T  AS+NLSNWSGTCYIMPL+GAFLAD+YLGRYWTIA+FS IY +GMTL+TLSA+VP
Sbjct  108   NQHTADASRNLSNWSGTCYIMPLLGAFLADSYLGRYWTIASFSTIYFIGMTLLTLSASVP  167

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+ PTC A D C  TG  T VCFIALYLVALGTGGIKPCVSSYGADQFDD DE E+  K 
Sbjct  168   GLKPTCSAKDVCQPTGTQTTVCFIALYLVALGTGGIKPCVSSYGADQFDDADETEKNFKG  227

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GAL+A+SL+V+IQ  V WGWGFG+PA AMA+AV  FFSGTR+YRYQ P
Sbjct  228   SFFNWFYFSINIGALIASSLLVYIQLHVGWGWGFGIPAAAMAIAVVSFFSGTRIYRYQIP  287

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TRL QV+VAS RK  V +P+DKS L+E     S I GSRKL HT+    FDKAAV
Sbjct  288   GGSPLTRLCQVLVASFRKHSVPLPADKSQLYEVADETSAIVGSRKLEHTDSFSCFDKAAV  347

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               ES D   +  VS WRLCTVTQVEELKSI+RLLP+WATGI+FS VYGQMG  F+SQAE 
Sbjct  348   ETES-DRANESKVSAWRLCTVTQVEELKSIVRLLPVWATGIMFSAVYGQMGNLFVSQAEV  406

Query  1295  MNTYVG--TFKXPXASLGV  1345
             M+T++G  +F+ P ASL V
Sbjct  407   MDTHLGKTSFEIPEASLSV  425



>ref|XP_008355414.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like [Malus domestica]
Length=582

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/387 (71%), Positives = 313/387 (81%), Gaps = 4/387 (1%)
 Frame = +2

Query  191   QMMEQSKAMEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNL  370
              M+ ++   EE D YTKDGT+D+R  PA +  TG WKACPFILGNEC ERLAYYGMSSNL
Sbjct  5     DMLAKAAPPEEKDAYTKDGTVDFRGNPAKRNATGTWKACPFILGNECCERLAYYGMSSNL  64

Query  371   MIYFQTRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTL  550
             +IYF+T+LNQ++  A+KN SNW GTCY+ PL+GAFLADAYLGRY TIA+FSIIYV GMTL
Sbjct  65    VIYFKTQLNQTSAVAAKNNSNWXGTCYLTPLLGAFLADAYLGRYKTIASFSIIYVXGMTL  124

Query  551   MTLSATVPGISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTD  730
             +T+SA+VPG+ PTC++ D C A G   A  FIALYL+ALGTGGIKPCVSSYGADQFDD D
Sbjct  125   LTMSASVPGMKPTCVSKDDCHANGGQXAATFIALYLIALGTGGIKPCVSSYGADQFDDDD  184

Query  731   EKERKHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGT  910
             E E+KHK SFFNWFYFSINVGAL+A+S++VWIQ +V WGWGFGVPAVAMA+AV  FFSGT
Sbjct  185   EVEKKHKGSFFNWFYFSINVGALIASSVLVWIQDNVGWGWGFGVPAVAMAIAVLSFFSGT  244

Query  911   RLYRYQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNEL  1090
              LYR QKPGGSP TR+ QVVVAS+RK KVKVP+DKSLL+ET   ES+IQGSRKL HTNE 
Sbjct  245   XLYRNQKPGGSPVTRIIQVVVASVRKYKVKVPADKSLLYETADAESSIQGSRKLDHTNEF  304

Query  1091  RFFDKAAVVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGT  1270
             RFFDKAAV  E  D+  K S SPWRL TVTQVEELKSIIRLLPIWATGIIF+  Y QM  
Sbjct  305   RFFDKAAV--EVQDDHLKDSKSPWRLTTVTQVEELKSIIRLLPIWATGIIFAAAYNQMSN  362

Query  1271  QFISQAEGMNTYVG--TFKXPXASLGV  1345
              F+ Q   M+  VG  +FK P ASL V
Sbjct  363   FFVLQGTLMDVRVGHSSFKIPAASLSV  389



>ref|XP_008355088.1| PREDICTED: LOW QUALITY PROTEIN: protein NRT1/ PTR FAMILY 8.2-like 
[Malus domestica]
Length=582

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/378 (72%), Positives = 314/378 (83%), Gaps = 4/378 (1%)
 Frame = +2

Query  218   EEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  397
             EE++VYTKDGT+D+R  PA + +TG WKACPFILGNEC ERLAYYGMSSNL+IYF+T+LN
Sbjct  14    EENNVYTKDGTVDFRGNPAKRNETGTWKACPFILGNECCERLAYYGMSSNLVIYFKTQLN  73

Query  398   QSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPG  577
             Q++  A+KN SNWSGTCY+ PL+GAFLADAYLGRY TIA+FSIIYV+GMTL+T+SA+VPG
Sbjct  74    QTSAVAAKNNSNWSGTCYLTPLLGAFLADAYLGRYKTIASFSIIYVVGMTLLTMSASVPG  133

Query  578   ISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSS  757
             + PTC++ D C A G   A  FIALYL+ALGTGGIKPCVSSYGADQFDD DE E+KHK S
Sbjct  134   MKPTCVSKDDCHANGGQIAATFIALYLIALGTGGIKPCVSSYGADQFDDDDEVEKKHKGS  193

Query  758   FFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKPG  937
             FFNWFYFSINVGAL+A+S++VWIQ +V WGWGFGVPAVAMA+AV  FFSGT LYR QKPG
Sbjct  194   FFNWFYFSINVGALIASSVLVWIQDNVGWGWGFGVPAVAMAIAVLSFFSGTXLYRNQKPG  253

Query  938   GSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAVV  1117
             GSP TR+ QVVVAS+RK KVKVP+DKSLL+ET   ES+IQGSRKL HTNE RFFDKAAV 
Sbjct  254   GSPVTRIIQVVVASVRKYKVKVPADKSLLYETADAESSIQGSRKLDHTNEFRFFDKAAV-  312

Query  1118  EESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEGM  1297
              E  D+  K S SPWRL TVTQVEELKSIIRLLPIWATGIIF+  Y QM   F+ Q   +
Sbjct  313   -EVQDDHLKDSKSPWRLTTVTQVEELKSIIRLLPIWATGIIFAAAYNQMSNFFVLQGPQV  371

Query  1298  NTYVG--TFKXPXASLGV  1345
             +  VG  +FK P ASL V
Sbjct  372   DVRVGHSSFKIPAASLSV  389



>ref|XP_004294248.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Fragaria vesca 
subsp. vesca]
 ref|XP_011460922.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Fragaria vesca 
subsp. vesca]
Length=586

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/378 (72%), Positives = 314/378 (83%), Gaps = 4/378 (1%)
 Frame = +2

Query  218   EEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  397
             E+DDVYTKDGT+DY+  PANKK TG WKACPFILGNEC ERLAYYGMSSNL+IYF+TRL+
Sbjct  18    EDDDVYTKDGTVDYKGDPANKKVTGTWKACPFILGNECCERLAYYGMSSNLVIYFKTRLH  77

Query  398   QSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPG  577
             QS+  A+K+ SNWSGTCY+ PL+GAFLADAYLGRY TIA+FSIIYV+GMTL+TLSA+VPG
Sbjct  78    QSSARAAKSNSNWSGTCYLTPLLGAFLADAYLGRYKTIASFSIIYVIGMTLLTLSASVPG  137

Query  578   ISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSS  757
             + PTC++ D C A    TA CFIALYL+ALGTGGIKPCVSSYGADQFDD DE E+KHK S
Sbjct  138   MKPTCVSKDDCYANNGQTAACFIALYLIALGTGGIKPCVSSYGADQFDDDDEVEKKHKGS  197

Query  758   FFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKPG  937
             FFNWFYFSINVGAL+A+S++VWIQ +  W WGFG+PAVAMA+AV  FFSGTRLYR QKPG
Sbjct  198   FFNWFYFSINVGALIASSVLVWIQMNEGWSWGFGIPAVAMAIAVVCFFSGTRLYRNQKPG  257

Query  938   GSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAVV  1117
             GSP TR+ QV+VAS+RK KVKVP DKS+L+ET   ES I+GSRKL HTNE  FFDKAAVV
Sbjct  258   GSPLTRIIQVLVASVRKYKVKVPEDKSILYETTDAESAIKGSRKLDHTNEFSFFDKAAVV  317

Query  1118  EESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEGM  1297
             E +  +  K S  PWRL TVTQVEELKSIIRLLP+WATGIIF+ VY QM   F+ Q   M
Sbjct  318   EPT--DHIKDSKDPWRLATVTQVEELKSIIRLLPVWATGIIFAAVYNQMSNFFVLQGTLM  375

Query  1298  NTYVG--TFKXPXASLGV  1345
             + +VG  +F+ P ASL V
Sbjct  376   DLHVGKSSFEIPAASLSV  393



>ref|XP_009337310.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like [Pyrus x bretschneideri]
 ref|XP_009337311.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like [Pyrus x bretschneideri]
Length=582

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/383 (70%), Positives = 317/383 (83%), Gaps = 4/383 (1%)
 Frame = +2

Query  203   QSKAMEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYF  382
             ++   EE+DVYTKDGT+D+R  PA +  TG WKACPFILGNEC ERLAYYGMSSNL+IYF
Sbjct  9     KAAVAEENDVYTKDGTVDFRGNPAKRNATGTWKACPFILGNECCERLAYYGMSSNLVIYF  68

Query  383   QTRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLS  562
             +T+LNQ++ +A+KN SNWSGTCY+ PL+GAFLADAYLGRY TIA+FSIIYV+GMTL+T+S
Sbjct  69    KTQLNQTSAAAAKNNSNWSGTCYLTPLLGAFLADAYLGRYKTIASFSIIYVIGMTLLTMS  128

Query  563   ATVPGISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKER  742
             A+VPG+ PTC++ D C A G  TA  FIALYL+ALGTGGIKPCVSSYGADQFDD DE E+
Sbjct  129   ASVPGMKPTCVSKDVCHANGGQTAATFIALYLIALGTGGIKPCVSSYGADQFDDDDEVEK  188

Query  743   KHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYR  922
             KHK SFFNWFYFSINVGA++A+S++VWIQ++V W WGFGVPAVAMA+AV  FFSGTRLYR
Sbjct  189   KHKGSFFNWFYFSINVGAMIASSVLVWIQENVGWEWGFGVPAVAMAIAVLSFFSGTRLYR  248

Query  923   YQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFD  1102
              QKPGGSP TR+ QV+VAS+R  K+KVP DKSLL+ET   ES+IQGSRKL HTNE RFFD
Sbjct  249   NQKPGGSPLTRIIQVIVASIRNYKLKVPEDKSLLYETADAESSIQGSRKLDHTNEFRFFD  308

Query  1103  KAAVVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFIS  1282
             KAAVV +   +  K S SPWRL TVTQVEELKSIIRLLPIWATGIIF+ VY QM   F+ 
Sbjct  309   KAAVVVQG--DQIKDSKSPWRLSTVTQVEELKSIIRLLPIWATGIIFAAVYSQMSNFFVL  366

Query  1283  QAEGMNTYVG--TFKXPXASLGV  1345
             Q   M+  VG  +F+ P ASL +
Sbjct  367   QGTLMDIRVGHSSFEIPAASLSI  389



>ref|XP_009374282.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009374283.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like isoform X1 [Pyrus 
x bretschneideri]
Length=582

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/387 (71%), Positives = 316/387 (82%), Gaps = 4/387 (1%)
 Frame = +2

Query  191   QMMEQSKAMEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNL  370
              M+ ++   EE DVYTKDGT+D+R +PA +  TG WKACPFILGNEC ERLAYYGMSSN 
Sbjct  5     DMLAKAAPPEEKDVYTKDGTVDFRGKPAKRNATGTWKACPFILGNECCERLAYYGMSSNR  64

Query  371   MIYFQTRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTL  550
             +IYF+T+LNQ++  A+KN SNWSGTCY+ PL+GAFLADAYLGRY TIA+FSIIY +GMTL
Sbjct  65    VIYFKTQLNQTSAVAAKNNSNWSGTCYLTPLLGAFLADAYLGRYKTIASFSIIYFIGMTL  124

Query  551   MTLSATVPGISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTD  730
             +T+SA+VPG+ PTC++ D C A G  TA  FIALYL+ALGTGGIKPCVSSYGADQFDD D
Sbjct  125   LTMSASVPGMKPTCVSKDDCHANGGQTAATFIALYLIALGTGGIKPCVSSYGADQFDDDD  184

Query  731   EKERKHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGT  910
             E E+KHK+SFFNWFYFSINVGAL+A+S++VWIQ +V WGWGFGVPAVAMA+AV  FFSGT
Sbjct  185   EVEKKHKASFFNWFYFSINVGALIASSVLVWIQDNVGWGWGFGVPAVAMAIAVLSFFSGT  244

Query  911   RLYRYQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNEL  1090
             RLYR QKPGGSP TR+ QVVVAS+RK KVKVP DKSLL+ET   ES+IQGSRKL HTNE 
Sbjct  245   RLYRNQKPGGSPVTRIIQVVVASVRKYKVKVPEDKSLLYETADAESSIQGSRKLDHTNEF  304

Query  1091  RFFDKAAVVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGT  1270
             RFFDKAAV  E  D++ K S SPWRL TVTQVEELKSIIRLLPIWA GIIF+    QM  
Sbjct  305   RFFDKAAV--EVQDDNIKDSKSPWRLTTVTQVEELKSIIRLLPIWAAGIIFAAACNQMSN  362

Query  1271  QFISQAEGMNTYVG--TFKXPXASLGV  1345
              F+ Q   M+  VG  +FK P ASL V
Sbjct  363   FFVLQGTLMDVRVGHSSFKIPAASLIV  389



>ref|XP_002520427.1| peptide transporter, putative [Ricinus communis]
 gb|EEF41840.1| peptide transporter, putative [Ricinus communis]
Length=571

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/380 (70%), Positives = 317/380 (83%), Gaps = 5/380 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             MEE+D+YTKDGT+DYR  PA+KKKTG W+ACPFI+GNEC ERLAYYGMSSNL++YF+  L
Sbjct  1     MEEEDIYTKDGTVDYRGNPASKKKTGTWRACPFIIGNECCERLAYYGMSSNLVLYFKNIL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             NQS+ +A+KN S+WSGTCY  PL+GAFLADAY GRYWTIA FSIIYV+GMTL+ LSA++P
Sbjct  61    NQSSATATKNNSDWSGTCYTTPLIGAFLADAYFGRYWTIAIFSIIYVIGMTLLALSASIP  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             GI P C A D C  T   +AV F+ALYLVALGTGGIKPCVSSYGADQFDDTDE E+KHK 
Sbjct  121   GIKPKCYAKDDCDPTDAQSAVFFLALYLVALGTGGIKPCVSSYGADQFDDTDENEKKHKG  180

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSINVG L+A+S++V++Q + SWGWGFG+PA+AMA+AV  FFSGT+LYR QKP
Sbjct  181   SFFNWFYFSINVGGLIASSVLVYVQMNWSWGWGFGIPAIAMAIAVVSFFSGTKLYRNQKP  240

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVG-LESNIQGSRKLSHTNELRFFDKAA  1111
             GGSPFTRLFQV+VAS++K K+KVP+DK+LL+E     ESNI+GSR++ HT +  FFDKAA
Sbjct  241   GGSPFTRLFQVIVASIKKYKIKVPADKALLYEISNDAESNIKGSRRIDHTKDFSFFDKAA  300

Query  1112  VVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAE  1291
             V  E+  ++ K SV PW+LCTVTQVEELKSIIRLLP+WATGIIF+ VY QM   F+ Q +
Sbjct  301   VETET--DNVKDSVDPWKLCTVTQVEELKSIIRLLPVWATGIIFAAVYSQMSNLFVLQGD  358

Query  1292  GMNTYVG--TFKXPXASLGV  1345
              MN YVG  +FK P ASL V
Sbjct  359   QMNKYVGNSSFKIPSASLSV  378



>ref|XP_009346885.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like isoform X1 [Pyrus 
x bretschneideri]
Length=615

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/383 (70%), Positives = 317/383 (83%), Gaps = 4/383 (1%)
 Frame = +2

Query  203   QSKAMEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYF  382
             ++   EE+DVYTKDGT+D+R  PA +  TG WKACPFILGNEC ERLAYYGMSSNL+IYF
Sbjct  42    KAAVAEENDVYTKDGTVDFRGNPAKRNATGTWKACPFILGNECCERLAYYGMSSNLVIYF  101

Query  383   QTRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLS  562
             +T+LNQ++ +A+KN SNWSGTCY+ PL+GAFLADAYLGRY TIA+FSIIYV+GMTL+T+S
Sbjct  102   KTQLNQTSAAAAKNNSNWSGTCYLTPLLGAFLADAYLGRYKTIASFSIIYVIGMTLLTMS  161

Query  563   ATVPGISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKER  742
             A+VPG+ PTC++ D C A G  TA  FIALYL+ALGTGGIKPCVSSYGADQFDD DE E+
Sbjct  162   ASVPGMKPTCVSKDVCHANGGQTAATFIALYLIALGTGGIKPCVSSYGADQFDDDDEVEK  221

Query  743   KHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYR  922
             KHK SFFNWFYFSINVGA++A+S++VWIQ++V W WGFGVPAVAMA+AV  FFSGTRLYR
Sbjct  222   KHKGSFFNWFYFSINVGAMIASSVLVWIQENVGWEWGFGVPAVAMAIAVLSFFSGTRLYR  281

Query  923   YQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFD  1102
              QKPGGSP TR+ QV+VAS+R  K+KVP DKSLL+ET   ES+IQGSRKL HTNE RFFD
Sbjct  282   NQKPGGSPLTRIIQVIVASIRNYKLKVPEDKSLLYETADAESSIQGSRKLDHTNEFRFFD  341

Query  1103  KAAVVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFIS  1282
             KAAVV +   +  K S SPWRL TVTQVEELKSIIRLLPIWATGIIF+ VY QM   F+ 
Sbjct  342   KAAVVVQG--DQIKDSKSPWRLSTVTQVEELKSIIRLLPIWATGIIFAAVYSQMSNFFVL  399

Query  1283  QAEGMNTYVG--TFKXPXASLGV  1345
             Q   M+  VG  +F+ P ASL +
Sbjct  400   QGTLMDIRVGHSSFEIPAASLSI  422



>ref|XP_008220400.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like [Prunus mume]
Length=581

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/383 (72%), Positives = 314/383 (82%), Gaps = 5/383 (1%)
 Frame = +2

Query  206   SKAMEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQ  385
             +KA   +DVYTKDGTLD+R  PA +  TG WKACPFILGNEC ERLAYYGMSSNL+IYF+
Sbjct  8     TKAAAAEDVYTKDGTLDFRGNPAKRNSTGTWKACPFILGNECCERLAYYGMSSNLVIYFK  67

Query  386   TRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSA  565
             T+LNQ++  A+KN SNW GTCY+ PL+GAFLADAYLGRY TIA+FSIIYV+GMTL+T+SA
Sbjct  68    TQLNQTSAVAAKNNSNWGGTCYLTPLLGAFLADAYLGRYKTIASFSIIYVIGMTLLTMSA  127

Query  566   TVPGISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERK  745
             +VPG+ PTC   D C A G  TA  FIALYL+ALGTGGIKPCVSSYGADQFDD DE E+K
Sbjct  128   SVPGLKPTCSGKDNCHANGGQTAATFIALYLIALGTGGIKPCVSSYGADQFDDDDEVEKK  187

Query  746   HKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRY  925
             HK SFFNWFYFSINVGAL+A+S++VWIQ++V WGWGFGVPAVAMA+AV  FFSGTRLYRY
Sbjct  188   HKGSFFNWFYFSINVGALIASSVLVWIQENVGWGWGFGVPAVAMAIAVVSFFSGTRLYRY  247

Query  926   QKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLE-SNIQGSRKLSHTNELRFFD  1102
             QKPGGSP TR+ QV+VAS+RK KVKVP DKSLL+ET   E S+IQGSRKL HTNE RFFD
Sbjct  248   QKPGGSPLTRIIQVLVASVRKYKVKVPEDKSLLYETADAESSSIQGSRKLDHTNEFRFFD  307

Query  1103  KAAVVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFIS  1282
             KAAV  +S  +  K S  PWRL TVTQVEELKSIIRLLPIWATGIIF+ VY QM   F+ 
Sbjct  308   KAAVEVQS--DHIKDSKDPWRLSTVTQVEELKSIIRLLPIWATGIIFAAVYNQMSNFFVL  365

Query  1283  QAEGMNTYVG--TFKXPXASLGV  1345
             Q   M+  VG  +F+ P ASL +
Sbjct  366   QGTLMDIRVGHSSFEIPAASLSI  388



>ref|XP_010033028.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Eucalyptus grandis]
 ref|XP_010033029.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Eucalyptus grandis]
 ref|XP_010033030.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Eucalyptus grandis]
 ref|XP_010033031.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Eucalyptus grandis]
 ref|XP_010033032.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Eucalyptus grandis]
 gb|KCW52563.1| hypothetical protein EUGRSUZ_J01942 [Eucalyptus grandis]
Length=570

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/379 (71%), Positives = 312/379 (82%), Gaps = 4/379 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M E+DVYTKDGT+DY+  PANKKKTG WKACPFILGNEC ERLAYYGMSSNL++YF+ RL
Sbjct  1     MGEEDVYTKDGTVDYKGDPANKKKTGTWKACPFILGNECCERLAYYGMSSNLVLYFKLRL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             +Q +T+AS N++NW+GTCYI PL+GAF ADAYLGRYWTIA FSIIYV GMTL+TLSA+V 
Sbjct  61    HQHSTTASNNVTNWAGTCYITPLIGAFFADAYLGRYWTIACFSIIYVFGMTLLTLSASVS  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+ PTC   D C AT   +AVCFIALYL+ALGTGGIKPCVSSYGADQFDD DE E+K K 
Sbjct  121   GLKPTCTGKDNCHATDIQSAVCFIALYLIALGTGGIKPCVSSYGADQFDDADEAEKKRKG  180

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSINVGAL+A S +V+IQ +V WG GFG+PA AMA+AV  FFSGTRLYR QKP
Sbjct  181   SFFNWFYFSINVGALIAGSFLVYIQDNVGWGLGFGIPAAAMAIAVCTFFSGTRLYRNQKP  240

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TRL QVVVAS RK +V+VP+DKS L+ET   ES I+GSRKL HT +L FFDKAAV
Sbjct  241   GGSPLTRLSQVVVASFRKYRVEVPADKSQLYETADAESAIKGSRKLDHTQDLSFFDKAAV  300

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               E+  +  K  V+PWRLCTVTQVEELK+IIRLLP+WATGI+F+TVY QMGT F+ Q   
Sbjct  301   --ETQTDHVKDPVNPWRLCTVTQVEELKAIIRLLPVWATGIVFATVYNQMGTLFVLQGYT  358

Query  1295  MNTYVG--TFKXPXASLGV  1345
             M+ +VG  TF+ P ASL +
Sbjct  359   MDPHVGNSTFEIPAASLSI  377



>gb|EYU45754.1| hypothetical protein MIMGU_mgv1a024850mg [Erythranthe guttata]
Length=571

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/380 (74%), Positives = 318/380 (84%), Gaps = 5/380 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M E+D YTKDGT+DY+N PA++ KTG WKACPFILGNEC ERLAYYGMSSNL++YF  +L
Sbjct  1     MAEEDNYTKDGTVDYKNDPADRNKTGTWKACPFILGNECCERLAYYGMSSNLLLYFTNQL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             NQ + SASKNLS WSGTCY+ PL+GAFLADAYLGRY TIA+FSIIYVMGMTL+TLSA+VP
Sbjct  61    NQHSASASKNLSIWSGTCYVTPLLGAFLADAYLGRYRTIASFSIIYVMGMTLLTLSASVP  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+ PTC   D+CTAT    AVC++ALYLVA GTGGIKPCVSSYGADQFDD DE E+ HKS
Sbjct  121   GLRPTCHKKDECTATNPQIAVCYVALYLVAFGTGGIKPCVSSYGADQFDDADEVEKGHKS  180

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GALVA+S++VWIQ ++ WGWGFGVPAVAMA+AV FFFSGTRLYR QKP
Sbjct  181   SFFNWFYFSINIGALVASSVLVWIQVNIGWGWGFGVPAVAMAVAVGFFFSGTRLYRNQKP  240

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLE-SNIQGSRKLSHTNELRFFDKAA  1111
             GGSP TRL QVVVASLRKR+V VP DKSLL ET   E + I GSRKL HT E RFFDKAA
Sbjct  241   GGSPLTRLCQVVVASLRKRRVAVPEDKSLLFETSDAEAAAIVGSRKLDHTTEFRFFDKAA  300

Query  1112  VVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAE  1291
             V  E   +  K S++PWRLCTVTQVEELK+II+LLP+WATGIIFS VYGQMG  F+ QAE
Sbjct  301   V--EVQSDYNKESINPWRLCTVTQVEELKAIIKLLPVWATGIIFSAVYGQMGNLFLLQAE  358

Query  1292  GMNTYVG--TFKXPXASLGV  1345
              MNT +G  TFK P ASL +
Sbjct  359   YMNTRLGNTTFKIPEASLSI  378



>ref|XP_012068161.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Jatropha curcas]
 ref|XP_012068169.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Jatropha curcas]
 ref|XP_012068178.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Jatropha curcas]
 gb|KDP46546.1| hypothetical protein JCGZ_08518 [Jatropha curcas]
Length=570

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/379 (69%), Positives = 312/379 (82%), Gaps = 4/379 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M E+D+YTKDGT+DYR  PANKK+TG W+ACPFI+GNEC ERLAYYGMSSNL++YF+  L
Sbjct  1     MAEEDIYTKDGTVDYRGNPANKKETGTWRACPFIIGNECCERLAYYGMSSNLVLYFKNIL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             NQ + +A+KN S+WSGTCY  PL+GAFLADA+LGRY TIA F  IYV+GMTL+ LSA+VP
Sbjct  61    NQDSATATKNNSDWSGTCYTTPLIGAFLADAFLGRYRTIAIFMSIYVIGMTLLALSASVP  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+ P C + + C  T   +A CF+ALYL+ALGTGGIKPCVSSYGADQFDDTDE E+KHK 
Sbjct  121   GLKPKCYSKNDCDPTDGQSAACFVALYLIALGTGGIKPCVSSYGADQFDDTDEVEKKHKG  180

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSINVGAL+A+S++V++Q + SWGWGFG+PA+AM +A+T F+ GTRLYR QKP
Sbjct  181   SFFNWFYFSINVGALIASSVLVYVQDNWSWGWGFGIPAIAMLIALTSFYLGTRLYRNQKP  240

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TRLFQV+VAS+RK KVKVP+DKSLLHET   ESNI+GSRK+ HT +  FFDKAAV
Sbjct  241   GGSPLTRLFQVIVASIRKYKVKVPADKSLLHETADAESNIKGSRKVEHTKDFSFFDKAAV  300

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               E+  ++ K SV PWRL TVTQVEELKSIIRLLPIWATGIIF+ VY QM   F+ Q + 
Sbjct  301   --ETEKDNVKESVDPWRLSTVTQVEELKSIIRLLPIWATGIIFAAVYSQMSNLFVLQGDQ  358

Query  1295  MNTYVG--TFKXPXASLGV  1345
             MN YVG  +FK P ASL V
Sbjct  359   MNKYVGNSSFKIPSASLSV  377



>ref|XP_009779291.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Nicotiana sylvestris]
 ref|XP_009779292.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Nicotiana sylvestris]
Length=572

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/377 (71%), Positives = 309/377 (82%), Gaps = 10/377 (3%)
 Frame = +2

Query  221   EDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQ  400
             EDD+YTKDGT+DYRN PA K +TG WKACPFILGNEC ERLAYYGMS+NL++YF+ RLNQ
Sbjct  11    EDDLYTKDGTVDYRNNPAKKAETGTWKACPFILGNECCERLAYYGMSTNLVLYFKKRLNQ  70

Query  401   STTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPGI  580
              + +ASKN+SNWSGTCYI PL+GAFLADAYLGRYWTIA FSIIYV+GMTL+TLSA+VPG+
Sbjct  71    HSATASKNVSNWSGTCYITPLIGAFLADAYLGRYWTIACFSIIYVIGMTLLTLSASVPGL  130

Query  581   SPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSF  760
              P+    +        TAVCF+ALYL+ALGTGGIKPCVSSYGADQFDD DE E+KHKSSF
Sbjct  131   KPSSDPKEV------QTAVCFVALYLIALGTGGIKPCVSSYGADQFDDADEVEKKHKSSF  184

Query  761   FNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKPGG  940
             FNWFYFSIN+GAL+A+S++VWIQ ++ WGWGFG+PAV MA+ V  FFSGTRLYR QKPGG
Sbjct  185   FNWFYFSINIGALIASSVLVWIQDNMGWGWGFGIPAVTMAIDVVSFFSGTRLYRNQKPGG  244

Query  941   SPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAVVE  1120
             SP TR+ QVVVAS RK KV VP DK+ L+ET   ES I GSRKL HT +LRFFDKAAV  
Sbjct  245   SPLTRICQVVVASFRKFKVDVPGDKTSLYETTDAESAITGSRKLDHTKDLRFFDKAAVQT  304

Query  1121  ESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEGMN  1300
             ES  +  KG++  WRLCTVTQVEELK+IIRLLPIWATGIIFS VY QM T F+ Q   M+
Sbjct  305   ES--DHMKGNIDQWRLCTVTQVEELKAIIRLLPIWATGIIFSAVYSQMSTMFVLQGASMD  362

Query  1301  TYVG--TFKXPXASLGV  1345
             T+VG  +F  P ASL +
Sbjct  363   THVGNSSFMIPPASLSI  379



>ref|XP_012087906.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Jatropha curcas]
 gb|KDP24486.1| hypothetical protein JCGZ_25050 [Jatropha curcas]
Length=568

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/378 (68%), Positives = 315/378 (83%), Gaps = 4/378 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M EDD++TKDGT++ + +PANKKKTGNWKAC FILGNEC ERLAYYGMS+NL+ Y Q RL
Sbjct  1     MAEDDLFTKDGTVNIKGKPANKKKTGNWKACRFILGNECCERLAYYGMSTNLVNYLQERL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             NQ   +AS N++NWSGTCYI PL+GAFLADAYLGRYWTIA+F IIY++GM L+T SA++P
Sbjct  61    NQGNVAASNNVTNWSGTCYITPLIGAFLADAYLGRYWTIASFVIIYILGMALLTFSASLP  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+ P+C   D C  TG  +AVCF+ALYL+ALGTGGIKPCVSS+GADQFD+TD+ E++ KS
Sbjct  121   GLKPSC-DKDSCHPTGTQSAVCFVALYLIALGTGGIKPCVSSFGADQFDETDDIEKEKKS  179

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYF+IN+GALVA+S++VWIQ +V WGWGFG+P VAMA+AV FFFSG++LYR QKP
Sbjct  180   SFFNWFYFTINIGALVASSVLVWIQMNVGWGWGFGIPTVAMAIAVVFFFSGSKLYRIQKP  239

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+FQV+VAS RK  VKVP DKSLL+ET   ES+IQGSRKL HT++L+FFDKAAV
Sbjct  240   GGSPLTRIFQVIVASFRKLHVKVPVDKSLLYETTDEESHIQGSRKLEHTDKLKFFDKAAV  299

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               E+  +  K +  PWRLCTVTQVEELK+IIRLLP+WA+GI+FSTVY QM T F+ Q   
Sbjct  300   --ETQSDSLKSTPDPWRLCTVTQVEELKAIIRLLPVWASGIVFSTVYSQMSTMFVLQGNT  357

Query  1295  MNTYVG-TFKXPXASLGV  1345
             M+ ++G  FK P ASL +
Sbjct  358   MDQHMGPKFKIPSASLSL  375



>ref|XP_012068201.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Jatropha curcas]
 gb|KDP46548.1| hypothetical protein JCGZ_08520 [Jatropha curcas]
Length=570

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/379 (69%), Positives = 312/379 (82%), Gaps = 4/379 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M E+D+YTKDGT+DYR  PANKK+TG W+ACPFI+GNEC ERLAYYGMSSNL++YF+  L
Sbjct  1     MAEEDIYTKDGTVDYRGNPANKKETGTWRACPFIIGNECCERLAYYGMSSNLVLYFKNIL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             NQ + +A+KN S+WSGTCY  PL+GAFLADA+LGRY TIA F  IYV+GMTL+ LSA+VP
Sbjct  61    NQDSATATKNNSDWSGTCYTTPLIGAFLADAFLGRYRTIAIFMSIYVIGMTLLALSASVP  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+ P C + + C  T   +A CF+ALYL+ALGTGGIKPCVSSYGADQFDDTDE E+KHK 
Sbjct  121   GLKPKCYSKNDCDPTDGQSAACFVALYLIALGTGGIKPCVSSYGADQFDDTDEVEKKHKG  180

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSINVGAL+A+S++V++Q++ SWGWGFG+PA+AM +A+T F+ GTR YR QKP
Sbjct  181   SFFNWFYFSINVGALIASSVLVYVQENWSWGWGFGIPAIAMLIALTSFYLGTRYYRNQKP  240

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TRLFQV+VAS+RK KVKVP+DKSLLHET   ESNI+GSRK+ HT +  FFDKAAV
Sbjct  241   GGSPLTRLFQVIVASIRKYKVKVPADKSLLHETADAESNIKGSRKVEHTKDFSFFDKAAV  300

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               E+  ++ K SV PWRL TVTQVEELKSIIRLLPIWATGIIF+ VY QM   F+ Q + 
Sbjct  301   --ETEKDNVKESVDPWRLSTVTQVEELKSIIRLLPIWATGIIFAAVYSQMSNLFVLQGDQ  358

Query  1295  MNTYVG--TFKXPXASLGV  1345
             MN YVG  +FK P ASL V
Sbjct  359   MNKYVGNSSFKIPSASLSV  377



>ref|XP_009591017.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Nicotiana tomentosiformis]
Length=572

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/377 (71%), Positives = 310/377 (82%), Gaps = 10/377 (3%)
 Frame = +2

Query  221   EDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQ  400
             EDD+YTKDGT+DYRN PA K +TG+WKACPFILGNEC ERLAYYGMS+NL++YF+ RLNQ
Sbjct  11    EDDLYTKDGTVDYRNNPAKKTETGSWKACPFILGNECCERLAYYGMSTNLVLYFKKRLNQ  70

Query  401   STTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPGI  580
              + +ASKN+SNWSGTCYI PL+GAFLADAYLGRYWTIA FSIIYV+GMTL+TLSA+VPG+
Sbjct  71    HSATASKNVSNWSGTCYITPLIGAFLADAYLGRYWTIACFSIIYVIGMTLLTLSASVPGL  130

Query  581   SPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSF  760
              P+    +        TAVCF+ALYL+ALGTGGIKPCVSSYGADQFDD DE E+KHKSSF
Sbjct  131   KPSSDPKEV------QTAVCFVALYLIALGTGGIKPCVSSYGADQFDDADEVEKKHKSSF  184

Query  761   FNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKPGG  940
             FNWFYFSIN+GAL+A+S++VWIQ +V WGWGFG+PAV MA+AV  FFSGTRLYR Q+PGG
Sbjct  185   FNWFYFSINIGALIASSVLVWIQDNVGWGWGFGIPAVTMAIAVVSFFSGTRLYRNQRPGG  244

Query  941   SPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAVVE  1120
             SP TR+ QVVVAS RK KV VP DK+ L+ET   ES I GSRKL HT +L FFDKAAV  
Sbjct  245   SPLTRICQVVVASFRKFKVDVPGDKTSLYETTDAESAITGSRKLDHTKDLCFFDKAAVQT  304

Query  1121  ESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEGMN  1300
             ES  +  KG++  WRLCTVTQVEELK+IIRLLPIWATGI+FS VY QM T F+ Q   M+
Sbjct  305   ES--DHMKGNIDGWRLCTVTQVEELKAIIRLLPIWATGIVFSAVYSQMSTMFVLQGASMD  362

Query  1301  TYVG--TFKXPXASLGV  1345
             T VG  +FK P ASL +
Sbjct  363   TRVGNSSFKIPPASLSI  379



>ref|XP_007208292.1| hypothetical protein PRUPE_ppa003364mg [Prunus persica]
 gb|EMJ09491.1| hypothetical protein PRUPE_ppa003364mg [Prunus persica]
Length=581

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/383 (70%), Positives = 313/383 (82%), Gaps = 5/383 (1%)
 Frame = +2

Query  206   SKAMEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQ  385
             +KA   +DVYTKDGT+D+   PA +  TG WKACPFILGNEC ERLAYYGMSSNL++YF+
Sbjct  8     TKAAAAEDVYTKDGTVDFHGNPAKRNATGTWKACPFILGNECCERLAYYGMSSNLVLYFK  67

Query  386   TRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSA  565
             T+L+Q++  A+KN SNWSGTCY+ PL+GAFLADAYLGRY TIA+FSIIYV+GMTL+T+SA
Sbjct  68    TQLHQTSAVAAKNNSNWSGTCYLTPLLGAFLADAYLGRYKTIASFSIIYVIGMTLLTMSA  127

Query  566   TVPGISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERK  745
             +VPG+ PTC   D C A G  TA  FIALYL+ALGTGGIKPCVSSYGADQFDD DE E+K
Sbjct  128   SVPGLKPTCSGKDNCHANGGQTAATFIALYLIALGTGGIKPCVSSYGADQFDDDDEVEKK  187

Query  746   HKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRY  925
             HK SFFNWFYFSINVGAL+A+S++VWIQ++V WGWGFGVPAVAMA+AV  FFSG+RLYR 
Sbjct  188   HKGSFFNWFYFSINVGALIASSVLVWIQENVGWGWGFGVPAVAMAIAVVSFFSGSRLYRN  247

Query  926   QKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLE-SNIQGSRKLSHTNELRFFD  1102
             QKPGGSP TR+ QV+VAS+RK KVKVP DKSLL+ET   E S+IQGSRKL HTNE RFFD
Sbjct  248   QKPGGSPLTRIIQVLVASVRKYKVKVPEDKSLLYETADAESSSIQGSRKLDHTNEFRFFD  307

Query  1103  KAAVVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFIS  1282
             KAAV  +S  +  K S  PWRL TVTQVEELKSIIRLLPIWATGIIF+ VY QM   F+ 
Sbjct  308   KAAVEVQS--DHIKDSKDPWRLSTVTQVEELKSIIRLLPIWATGIIFAAVYNQMSNFFVL  365

Query  1283  QAEGMNTYVG--TFKXPXASLGV  1345
             Q   M+  VG  +F+ P ASL +
Sbjct  366   QGNLMDIRVGHSSFEIPAASLSI  388



>emb|CDP09152.1| unnamed protein product [Coffea canephora]
Length=604

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/379 (71%), Positives = 303/379 (80%), Gaps = 3/379 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             ME DD YTKDGT+DYR  PA+K+KTG WKACP+ILGNEC ERLAYYGMSSNLMIYF  +L
Sbjct  1     MEADDYYTKDGTVDYRKNPADKRKTGTWKACPYILGNECCERLAYYGMSSNLMIYFTKQL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             NQ T  AS+N+SNWSGTCYIMPL+GAFLAD+ LGRYWTIA+FSIIY +GMTL+TLSA+VP
Sbjct  61    NQHTAEASRNVSNWSGTCYIMPLLGAFLADSCLGRYWTIASFSIIYFIGMTLLTLSASVP  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+ P C A D C  T   T V F+ALYLVALGTGGIKPCVSSYGADQFDD DE E+  KS
Sbjct  121   GLKPACSAEDVCDPTSIQTTVSFLALYLVALGTGGIKPCVSSYGADQFDDADETEKNFKS  180

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GALVA+S +V+IQ  V WGWGFG+PA AMA+AV  FFSGTR+YRYQ P
Sbjct  181   SFFNWFYFSINIGALVASSFLVYIQLHVGWGWGFGIPAAAMAIAVVSFFSGTRIYRYQIP  240

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TRL QV+VASLRK  V +P+DKS L+E     S I GSRKL HT    FFDKAAV
Sbjct  241   GGSPLTRLCQVLVASLRKYDVPLPADKSQLYEVADETSAIVGSRKLEHTKAFSFFDKAAV  300

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               ES D   +  VS WRLCTVTQVEELKSI+RLLP+WATGII S VY QMG  F+SQAE 
Sbjct  301   ETES-DRTNESKVSAWRLCTVTQVEELKSILRLLPVWATGIIVSAVYSQMGNLFVSQAEV  359

Query  1295  MNTYVGT--FKXPXASLGV  1345
             M+T++G   FK P ASL V
Sbjct  360   MDTHLGNTRFKIPEASLSV  378



>gb|KHN40046.1| Peptide transporter PTR1 [Glycine soja]
Length=571

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/370 (71%), Positives = 308/370 (83%), Gaps = 3/370 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M E+DVYTKDGT+DYR   ANKK+TG W+ACPFILGNEC ERLAYYGMS+NL+ YF T+L
Sbjct  1     MAEEDVYTKDGTVDYRGNRANKKETGTWRACPFILGNECCERLAYYGMSTNLVTYFNTKL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             NQS  +ASKN +NW GTCYI PL+GAF+ADAYLGRY TI  FSI+YV+GMTL+TLSA+VP
Sbjct  61    NQSGPTASKNNANWGGTCYITPLIGAFVADAYLGRYLTILCFSIVYVIGMTLLTLSASVP  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             GI P+C     C AT   +AVCF+ALYL+ALGTGGIKPCVSS+GADQFDD DE E++HKS
Sbjct  121   GIKPSCDDQGNCHATQAQSAVCFVALYLIALGTGGIKPCVSSFGADQFDDADEAEKEHKS  180

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFY SIN+GAL+AAS++VW+Q +VSWGWGFG+PAVAMA+AV  FFSGTRLYR QKP
Sbjct  181   SFFNWFYLSINIGALIAASVLVWVQTNVSWGWGFGIPAVAMAIAVVSFFSGTRLYRNQKP  240

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHET-VGLESNIQGSRKLSHTNELRFFDKAA  1111
             GGSP TR+ QV+VAS+RK  V+VP+DKS L+E     ES I+GSRKL HTN LRF DKAA
Sbjct  241   GGSPLTRMCQVIVASIRKSDVQVPNDKSGLYEIEEDSESAIEGSRKLDHTNGLRFLDKAA  300

Query  1112  VVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAE  1291
             V+ +S  ++ K  V+PWRLCTVTQVEELK+IIRLLPIWATGIIFSTVY QMG+ FI Q +
Sbjct  301   VLGDS--DNVKDPVNPWRLCTVTQVEELKAIIRLLPIWATGIIFSTVYSQMGSYFILQGD  358

Query  1292  GMNTYVGTFK  1321
              MN  VG  K
Sbjct  359   TMNNRVGNIK  368



>ref|XP_003544872.1| PREDICTED: peptide transporter PTR1-like isoform X1 [Glycine 
max]
 ref|XP_006596417.1| PREDICTED: peptide transporter PTR1-like isoform X2 [Glycine 
max]
Length=571

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/370 (71%), Positives = 308/370 (83%), Gaps = 3/370 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M E+DVYTKDGT+DYR   ANKK+TG W+ACPFILGNEC ERLAYYGMS+NL+ YF T+L
Sbjct  1     MAEEDVYTKDGTVDYRGNRANKKETGTWRACPFILGNECCERLAYYGMSTNLVTYFNTKL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             NQS  +ASKN +NW GTCYI PL+GAF+ADAYLGRY TI  FSI+YV+GMTL+TLSA+VP
Sbjct  61    NQSGPTASKNNANWGGTCYITPLIGAFVADAYLGRYLTILCFSIVYVIGMTLLTLSASVP  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             GI P+C     C AT   +AVCF+ALYL+ALGTGGIKPCVSS+GADQFDD DE E++HKS
Sbjct  121   GIKPSCDDQGNCHATQAQSAVCFVALYLIALGTGGIKPCVSSFGADQFDDADEAEKEHKS  180

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFY SIN+GAL+AAS++VW+Q +VSWGWGFG+PAVAMA+AV  FFSGTRLYR QKP
Sbjct  181   SFFNWFYLSINIGALIAASVLVWVQTNVSWGWGFGIPAVAMAIAVVSFFSGTRLYRNQKP  240

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHET-VGLESNIQGSRKLSHTNELRFFDKAA  1111
             GGSP TR+ QV+VAS+RK  V+VP+DKS L+E     ES I+GSRKL HTN LRF DKAA
Sbjct  241   GGSPLTRMCQVIVASIRKSDVQVPNDKSGLYEIEEDSESAIEGSRKLDHTNGLRFLDKAA  300

Query  1112  VVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAE  1291
             V+ +S  ++ K  V+PWRLCTVTQVEELK+IIRLLPIWATGIIFSTVY QMG+ FI Q +
Sbjct  301   VLGDS--DNVKDPVNPWRLCTVTQVEELKAIIRLLPIWATGIIFSTVYSQMGSYFILQGD  358

Query  1292  GMNTYVGTFK  1321
              MN  VG  K
Sbjct  359   TMNNRVGNIK  368



>gb|KDO66792.1| hypothetical protein CISIN_1g0086231mg, partial [Citrus sinensis]
Length=547

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/381 (69%), Positives = 314/381 (82%), Gaps = 7/381 (2%)
 Frame = +2

Query  218   EEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  397
             EE+D+YTKDGTLDY+  PA+K KTG WKACPFILGNEC ERLAYYGMS+NL+ YF+ +L+
Sbjct  3     EEEDIYTKDGTLDYKGNPADKTKTGTWKACPFILGNECCERLAYYGMSTNLVRYFKHQLD  62

Query  398   QSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPG  577
             QS+++ASKN+ +WSGTCYI PL+GAFLADAYLGRYWTIA FSIIYV+GMT +T++A+V G
Sbjct  63    QSSSTASKNVLDWSGTCYITPLIGAFLADAYLGRYWTIAIFSIIYVIGMTFLTVTASVSG  122

Query  578   ISPTCIA---HDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKH  748
             + P C      + C  T   +A  F+ALYL+ALGTGGIKPCVSSYGADQFDD DE E+KH
Sbjct  123   LKPVCHGPRGEETCQVTDAQSATFFVALYLIALGTGGIKPCVSSYGADQFDDADEAEKKH  182

Query  749   KSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQ  928
             KSSFFNWFYFSIN+GAL+A+S++VWIQ +  WGWGFG+PAVAMA+AV  FFSGTRL+R Q
Sbjct  183   KSSFFNWFYFSINIGALIASSVLVWIQDNEGWGWGFGIPAVAMAIAVVSFFSGTRLFRNQ  242

Query  929   KPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKA  1108
             KPGGSP TR+ QVV AS+RK KV++P+DKSLL+ET   ESNI GSRKL HT +  FFDKA
Sbjct  243   KPGGSPLTRICQVVAASIRKHKVELPADKSLLYETADAESNITGSRKLDHTKDFSFFDKA  302

Query  1109  AVVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQA  1288
             AV  E   ++ K SV+PWRLCTVTQVEELK+I+RLLPIWATGIIFS VY QM + F+ Q 
Sbjct  303   AV--EIQSDNIKESVNPWRLCTVTQVEELKAIVRLLPIWATGIIFSAVYSQMSSLFVLQG  360

Query  1289  EGMNTYVG--TFKXPXASLGV  1345
             E M+T+VG  +FK P ASL +
Sbjct  361   ERMDTHVGNSSFKIPPASLSI  381



>ref|XP_010528782.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1 [Tarenaya hassleriana]
Length=570

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/378 (68%), Positives = 309/378 (82%), Gaps = 2/378 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             MEE DVYT+DGT+D    PANK+KTGNWKAC FILGNEC ERLAYYGM +NL+ Y + R+
Sbjct  1     MEEKDVYTQDGTVDINKNPANKEKTGNWKACRFILGNECCERLAYYGMGTNLVNYLEKRM  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             NQ   +A+ N++NWSGTCYI PL+GAFLADAYLGRYWTIA F  IYV GMTL+TLSA+VP
Sbjct  61    NQGNATAANNVTNWSGTCYITPLIGAFLADAYLGRYWTIAIFVFIYVSGMTLLTLSASVP  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             GI P+    D C  T    AVCF+ALYL+ALGTGGIKPCVSS+GADQFD+ DE E+K KS
Sbjct  121   GIRPSNCTGDTCHPTSGQVAVCFVALYLIALGTGGIKPCVSSFGADQFDENDEAEKKKKS  180

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSINVGAL+AA+++VWIQ +V WGWGFG+PAVAMA+AV FFF+G+R YR Q+P
Sbjct  181   SFFNWFYFSINVGALIAATVLVWIQMNVGWGWGFGIPAVAMAIAVIFFFAGSRYYRLQRP  240

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+FQV+VA+ RK  VKVP DKSLL+ET   ESNI+GSRKL+HT++L+FFDKAAV
Sbjct  241   GGSPLTRIFQVIVAAFRKMSVKVPEDKSLLYETADEESNIKGSRKLAHTDKLKFFDKAAV  300

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               +S D  K G ++ WRLCTVTQVEELKSIIRLLP+WA+GI+F+TVY QM T F+ Q   
Sbjct  301   ETQS-DSIKDGQINLWRLCTVTQVEELKSIIRLLPVWASGIVFATVYSQMNTMFVLQGNT  359

Query  1295  MNTYVGT-FKXPXASLGV  1345
             M+ ++G  F+ P ASL +
Sbjct  360   MDQHMGKHFEIPSASLSL  377



>ref|XP_006425015.1| hypothetical protein CICLE_v10028095mg [Citrus clementina]
 ref|XP_006488478.1| PREDICTED: peptide transporter PTR1-like isoform X1 [Citrus sinensis]
 ref|XP_006488479.1| PREDICTED: peptide transporter PTR1-like isoform X2 [Citrus sinensis]
 ref|XP_006488480.1| PREDICTED: peptide transporter PTR1-like isoform X3 [Citrus sinensis]
 gb|ESR38255.1| hypothetical protein CICLE_v10028095mg [Citrus clementina]
Length=574

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/381 (69%), Positives = 314/381 (82%), Gaps = 7/381 (2%)
 Frame = +2

Query  218   EEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  397
             EE+D+YTKDGTLDY+  PA+K KTG WKACPFILGNEC ERLAYYGMS+NL+ YF+ +L+
Sbjct  3     EEEDIYTKDGTLDYKGNPADKTKTGTWKACPFILGNECCERLAYYGMSTNLVRYFKHQLD  62

Query  398   QSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPG  577
             QS+++ASKN+ +WSGTCYI PL+GAFLADAYLGRYWTIA FSIIYV+GMT +T++A+V G
Sbjct  63    QSSSTASKNVLDWSGTCYITPLIGAFLADAYLGRYWTIAIFSIIYVIGMTFLTVTASVSG  122

Query  578   ISPTCIA---HDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKH  748
             + P C      + C  T   +A  F+ALYL+ALGTGGIKPCVSSYGADQFDD DE E+KH
Sbjct  123   LKPVCHGPRGEETCQVTDAQSATFFVALYLIALGTGGIKPCVSSYGADQFDDADEAEKKH  182

Query  749   KSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQ  928
             KSSFFNWFYFSIN+GAL+A+S++VWIQ +  WGWGFG+PAVAMA+AV  FFSGTRL+R Q
Sbjct  183   KSSFFNWFYFSINIGALIASSVLVWIQDNEGWGWGFGIPAVAMAIAVVSFFSGTRLFRNQ  242

Query  929   KPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKA  1108
             KPGGSP TR+ QVV AS+RK KV++P+DKSLL+ET   ESNI GSRKL HT +  FFDKA
Sbjct  243   KPGGSPLTRICQVVAASIRKHKVELPADKSLLYETADAESNITGSRKLDHTKDFSFFDKA  302

Query  1109  AVVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQA  1288
             AV  E   ++ K SV+PWRLCTVTQVEELK+I+RLLPIWATGIIFS VY QM + F+ Q 
Sbjct  303   AV--EIQSDNIKESVNPWRLCTVTQVEELKAIVRLLPIWATGIIFSAVYSQMSSLFVLQG  360

Query  1289  EGMNTYVG--TFKXPXASLGV  1345
             E M+T+VG  +FK P ASL +
Sbjct  361   ERMDTHVGNSSFKIPPASLSI  381



>gb|KJB36886.1| hypothetical protein B456_006G180700 [Gossypium raimondii]
Length=569

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/375 (69%), Positives = 311/375 (83%), Gaps = 4/375 (1%)
 Frame = +2

Query  224   DDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQS  403
             DD+YTKDGT+D   +PANKKKTGNWKAC FILGNEC ERLAYYGM +NL+ Y Q +LNQ 
Sbjct  5     DDIYTKDGTVDINKKPANKKKTGNWKACSFILGNECCERLAYYGMGTNLVNYLQEQLNQG  64

Query  404   TTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPGIS  583
               +AS N++NWSGTCYI PL+GAF+ADAYLGRYWTIA FSIIY  GMTL+TLS+++PG+ 
Sbjct  65    NVAASNNVTNWSGTCYITPLIGAFVADAYLGRYWTIAIFSIIYFFGMTLLTLSSSIPGLK  124

Query  584   PTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSFF  763
             P+C   D C  T    AV F+ALY++ALGTGGIKPCVSS+GADQFD+TDE ERK KSSFF
Sbjct  125   PSCTG-DVCHPTQEQIAVFFVALYMIALGTGGIKPCVSSFGADQFDETDEVERKRKSSFF  183

Query  764   NWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKPGGS  943
             NWFYFSIN+GALVA+S++VWIQ +V W WGFG+PAVAMA+AV FFF+G+R YR QKPGGS
Sbjct  184   NWFYFSINIGALVASSVLVWIQMNVGWDWGFGIPAVAMAIAVVFFFAGSRTYRLQKPGGS  243

Query  944   PFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAVVEE  1123
             P TR+ QV+VAS +K  VKVP+DKSLL+E    ESNIQGSRKL HT++L+FFDKAAV  E
Sbjct  244   PLTRIAQVIVASFKKLNVKVPADKSLLYEVADNESNIQGSRKLEHTDKLKFFDKAAVETE  303

Query  1124  SLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEGMNT  1303
             + D DK+ S++PWRLCTVTQVEELKS+IRLLP+WA+GIIF+TVY QM T F+ Q   M+ 
Sbjct  304   N-DHDKE-SLNPWRLCTVTQVEELKSVIRLLPVWASGIIFATVYSQMNTMFVLQGNTMDQ  361

Query  1304  YVG-TFKXPXASLGV  1345
             ++G TFK P ASL +
Sbjct  362   HMGPTFKIPSASLSL  376



>gb|KJB21652.1| hypothetical protein B456_004G006700 [Gossypium raimondii]
 gb|KJB21653.1| hypothetical protein B456_004G006700 [Gossypium raimondii]
Length=576

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/379 (67%), Positives = 311/379 (82%), Gaps = 5/379 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             MEEDD+YTKDGT+DY+  PANKK TG W+ACP+I+GNE  ERLAYYGMS+NL++YF+ +L
Sbjct  1     MEEDDIYTKDGTVDYKGNPANKKTTGTWRACPYIIGNEGCERLAYYGMSTNLVLYFKHQL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             NQ + +ASKN  NW GTCYI PL+GAFLAD+YLGRYWTIA FSIIY++GMTL+ +SA+V 
Sbjct  61    NQHSATASKNNQNWGGTCYITPLIGAFLADSYLGRYWTIACFSIIYIIGMTLLAMSASVD  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+ P C + D C  T R + + F+ALYL+ALGTGGIKPCVSSYGADQFDDTDE+E+ HKS
Sbjct  121   GMKPFCYSKDNCNPTDRQSTITFLALYLIALGTGGIKPCVSSYGADQFDDTDEREKIHKS  180

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GAL+AAS++VW+Q +VSWGWGFG+PA+AMA+AV FFF+GTRLYR Q P
Sbjct  181   SFFNWFYFSINIGALIAASVLVWVQTNVSWGWGFGIPAIAMAIAVGFFFAGTRLYRNQIP  240

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TRL QV+VAS+RK  V VP+DKSLL+E    ESNI+GSRK+ HT++L FFDKAAV
Sbjct  241   GGSPLTRLCQVLVASIRKYNVAVPADKSLLYEKADAESNIKGSRKIDHTDDLSFFDKAAV  300

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               ++   D+   ++PWRLCTVTQVEELK+IIRLLPIWA+GIIF+ VY QM + F  Q E 
Sbjct  301   ETQT---DQLKGINPWRLCTVTQVEELKAIIRLLPIWASGIIFAAVYSQMSSLFTLQGER  357

Query  1295  MNTYVG--TFKXPXASLGV  1345
             M+T V    F  P ASL +
Sbjct  358   MDTRVAHSNFHIPPASLSI  376



>gb|KHG08248.1| Peptide transporter PTR1 -like protein [Gossypium arboreum]
Length=569

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/375 (69%), Positives = 310/375 (83%), Gaps = 4/375 (1%)
 Frame = +2

Query  224   DDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQS  403
             DD+YTKDGT+D   +PANKKKTGNWKAC FILGNEC ERLAYYGM +NL+ Y Q +LNQ 
Sbjct  5     DDIYTKDGTVDINKKPANKKKTGNWKACSFILGNECCERLAYYGMGTNLVNYLQEQLNQG  64

Query  404   TTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPGIS  583
               +AS N++NWSGTCYI PL+GAF+ADAYLGRYWTIA FSIIY  GMTL+TLS+++PG+ 
Sbjct  65    NVAASNNVTNWSGTCYITPLIGAFVADAYLGRYWTIAIFSIIYFFGMTLLTLSSSIPGLK  124

Query  584   PTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSFF  763
             P+C   D C  T    AV F+ALY++ALGTGGIKPCVSS+GADQFD+TDE ERK KSSFF
Sbjct  125   PSCTG-DVCHPTQEQIAVFFVALYMIALGTGGIKPCVSSFGADQFDETDEVERKRKSSFF  183

Query  764   NWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKPGGS  943
             NWFYFSIN+GALVA+S++VWIQ +V W WGFG+PAVAMA+AV FFF+G+R YR QKPGGS
Sbjct  184   NWFYFSINIGALVASSVLVWIQMNVGWDWGFGIPAVAMAIAVVFFFAGSRTYRLQKPGGS  243

Query  944   PFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAVVEE  1123
             P TR+ QV+VAS +K  VKVP+DKSLL+E    ESNIQGSRKL HT++L+FFDKAAV  E
Sbjct  244   PLTRIAQVIVASFKKLNVKVPADKSLLYEVADNESNIQGSRKLEHTDKLKFFDKAAVETE  303

Query  1124  SLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEGMNT  1303
             + D DK+ S++PWRLCTVTQVEELKS+IRLLP+WA+GIIF+TVY QM T F+ Q   M+ 
Sbjct  304   N-DHDKE-SLNPWRLCTVTQVEELKSVIRLLPVWASGIIFATVYSQMNTMFVLQGNTMDQ  361

Query  1304  YVG-TFKXPXASLGV  1345
             ++G  FK P ASL +
Sbjct  362   HMGPNFKIPSASLSL  376



>gb|KDO53228.1| hypothetical protein CISIN_1g0083672mg [Citrus sinensis]
 gb|KDO53229.1| hypothetical protein CISIN_1g0083672mg [Citrus sinensis]
Length=568

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/378 (68%), Positives = 311/378 (82%), Gaps = 4/378 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M E+D+YTKDGT+D   +PANKKKTGNWKAC FILGNEC ERLAYYGMS+NL+ Y Q +L
Sbjct  1     MAEEDIYTKDGTVDIHKKPANKKKTGNWKACRFILGNECCERLAYYGMSTNLVNYLQKQL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             NQ   +AS N++NWSGTCYI PL+GAFLAD+Y+GR+WTIA+FSIIY +GMTL+TL+A+V 
Sbjct  61    NQGNVTASNNVTNWSGTCYITPLIGAFLADSYMGRFWTIASFSIIYCLGMTLLTLTASVS  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+ P+C   D C  TG  TAV F+ALYL+ALGTGGIKPCVSS+GADQFD+TD+ ER+ KS
Sbjct  121   GLKPSC-DKDACHPTGAQTAVTFVALYLIALGTGGIKPCVSSFGADQFDETDDGEREKKS  179

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFY SIN+GALVA+S++VWIQ +V WGWGFG+PAVAMA+AV FFFSG+RLYR QKP
Sbjct  180   SFFNWFYLSINIGALVASSVLVWIQMNVGWGWGFGIPAVAMAIAVVFFFSGSRLYRIQKP  239

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QV+VAS RK  V VP+DKSLL+ET   E NIQGSRKL  T++ +FFDKAAV
Sbjct  240   GGSPLTRIMQVIVASFRKSNVVVPADKSLLYETADEECNIQGSRKLESTSKFKFFDKAAV  299

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               E+  +  KGS  PWRLCTVTQVEELK+IIRLLP+WA+GI+F+TVY QM T F+ Q   
Sbjct  300   --ETQTDRVKGSADPWRLCTVTQVEELKAIIRLLPVWASGIVFATVYSQMSTMFVLQGNT  357

Query  1295  MNTYVG-TFKXPXASLGV  1345
             M+ ++G  FK P ASL +
Sbjct  358   MDQHMGPNFKIPSASLSL  375



>ref|XP_006429306.1| hypothetical protein CICLE_v10011381mg [Citrus clementina]
 ref|XP_006429307.1| hypothetical protein CICLE_v10011381mg [Citrus clementina]
 ref|XP_006480967.1| PREDICTED: peptide transporter PTR1-like isoform X1 [Citrus sinensis]
 ref|XP_006480968.1| PREDICTED: peptide transporter PTR1-like isoform X2 [Citrus sinensis]
 ref|XP_006480969.1| PREDICTED: peptide transporter PTR1-like isoform X3 [Citrus sinensis]
 gb|ESR42546.1| hypothetical protein CICLE_v10011381mg [Citrus clementina]
 gb|ESR42547.1| hypothetical protein CICLE_v10011381mg [Citrus clementina]
Length=568

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/378 (68%), Positives = 311/378 (82%), Gaps = 4/378 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M E+D+YTKDGT+D   +PANKKKTGNWKAC FILGNEC ERLAYYGMS+NL+ Y Q +L
Sbjct  1     MAEEDIYTKDGTVDIHKKPANKKKTGNWKACRFILGNECCERLAYYGMSTNLVNYLQKQL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             NQ   +AS N++NWSGTCYI PL+GAFLAD+Y+GR+WTIA+FSIIY +GMTL+TL+A+V 
Sbjct  61    NQGNVTASNNVTNWSGTCYITPLIGAFLADSYMGRFWTIASFSIIYCLGMTLLTLTASVS  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+ P+C   D C  TG  TAV F+ALYL+ALGTGGIKPCVSS+GADQFD+TD+ ER+ KS
Sbjct  121   GLKPSC-DKDACHPTGAQTAVTFVALYLIALGTGGIKPCVSSFGADQFDETDDGEREKKS  179

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFY SIN+GALVA+S++VWIQ +V WGWGFG+PAVAMA+AV FFFSG+RLYR QKP
Sbjct  180   SFFNWFYLSINIGALVASSVLVWIQMNVGWGWGFGIPAVAMAIAVVFFFSGSRLYRIQKP  239

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QV+VAS RK  V VP+DKSLL+ET   E NIQGSRKL  T++ +FFDKAAV
Sbjct  240   GGSPLTRIMQVIVASFRKSNVVVPADKSLLYETADEECNIQGSRKLESTSKFKFFDKAAV  299

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               E+  +  KGS  PWRLCTVTQVEELK+IIRLLP+WA+GI+F+TVY QM T F+ Q   
Sbjct  300   --ETQTDRVKGSADPWRLCTVTQVEELKAIIRLLPVWASGIVFATVYSQMSTMFVLQGNT  357

Query  1295  MNTYVG-TFKXPXASLGV  1345
             M+ ++G  FK P ASL +
Sbjct  358   MDQHMGPNFKIPSASLSL  375



>ref|XP_007026785.1| Peptide transporter 1 isoform 1 [Theobroma cacao]
 ref|XP_007026786.1| Peptide transporter 1 isoform 1 [Theobroma cacao]
 gb|EOY07287.1| Peptide transporter 1 isoform 1 [Theobroma cacao]
 gb|EOY07288.1| Peptide transporter 1 isoform 1 [Theobroma cacao]
Length=568

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/378 (69%), Positives = 312/378 (83%), Gaps = 4/378 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M EDD+YT DGT+D    PANK KTGNWKAC FILGNEC ERLAYYGM +NL+ Y + RL
Sbjct  1     MGEDDIYTNDGTVDIHKNPANKSKTGNWKACRFILGNECCERLAYYGMGTNLVNYLEQRL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             NQ   +AS N++NWSGTCYI PL+GAFLADAYLGRYWTIA FSIIYV+GMTL+TLSA+V 
Sbjct  61    NQGNVTASNNVTNWSGTCYITPLIGAFLADAYLGRYWTIAGFSIIYVLGMTLLTLSASVT  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+ P+C   D C  T   +AV F+ALY++ALGTGGIKPCVSS+GADQFD+TD+ ERK KS
Sbjct  121   GLKPSC-NGDVCHPTASQSAVFFVALYMIALGTGGIKPCVSSFGADQFDETDDIERKKKS  179

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GALVA+S++VWIQ +V WGWGFG+PA AMA+AV FFFSG+R+YR Q+P
Sbjct  180   SFFNWFYFSINIGALVASSVLVWIQMNVGWGWGFGIPAAAMAIAVVFFFSGSRMYRLQRP  239

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+FQV+V+S RK  VKVP+D+SLL+ET   E +IQGSRKL HT++L+FFDKAAV
Sbjct  240   GGSPLTRIFQVIVSSFRKLNVKVPADESLLYETADQECSIQGSRKLEHTDKLKFFDKAAV  299

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               E+  +  KGSV+PWRLCTVT+VEELKSIIRLLPIWA+GI+F+TVY QM T F+ Q   
Sbjct  300   --ETQTDYVKGSVNPWRLCTVTEVEELKSIIRLLPIWASGIVFATVYSQMSTMFVLQGNT  357

Query  1295  MNTYVGT-FKXPXASLGV  1345
             M+ ++G  FK P ASL +
Sbjct  358   MDQHMGPHFKIPSASLSL  375



>ref|XP_004143145.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Cucumis sativus]
Length=570

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/377 (68%), Positives = 313/377 (83%), Gaps = 3/377 (1%)
 Frame = +2

Query  218   EEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  397
             EED +YT+DGT+DYR  PA + +TG W+ACP+ILGNE  ERLAYYGMSSNL++YF+  LN
Sbjct  3     EEDSIYTQDGTVDYRGDPAVRTQTGTWRACPYILGNEFCERLAYYGMSSNLVLYFKDHLN  62

Query  398   QSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPG  577
             Q + +ASKN++NW GTCYI PL+GAFLADAYLGRY TIA FSI+YV GMTL+TLSA+VPG
Sbjct  63    QHSATASKNVNNWIGTCYITPLIGAFLADAYLGRYRTIAAFSILYVFGMTLLTLSASVPG  122

Query  578   ISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSS  757
             + PTC++ D C AT   +A+CF+ALYL+ALGTGGIKPCVSSYGADQFDD DE E+KHKSS
Sbjct  123   LKPTCVSKDDCHATTAQSALCFLALYLIALGTGGIKPCVSSYGADQFDDADETEKKHKSS  182

Query  758   FFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKPG  937
             FFNWFY SINVG L+A+S++VW+Q++VSWGWGFG+PA+AMA+AV  FFSGTRLYR QKPG
Sbjct  183   FFNWFYLSINVGGLIASSVLVWVQENVSWGWGFGIPAIAMAIAVVSFFSGTRLYRNQKPG  242

Query  938   GSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAVV  1117
             GSPFTR+ QV+VAS RK KVKVP  K+ L+ET   ES+I GSRKL HT++ RFFDKAAV 
Sbjct  243   GSPFTRICQVIVASFRKYKVKVPESKA-LYETADSESSIVGSRKLDHTDDFRFFDKAAVE  301

Query  1118  EESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEGM  1297
              ES D+  KGSV  W+LCTVTQVEELK+IIRLLP+WATGI F+ VY Q+ T F+ Q + M
Sbjct  302   LES-DQMLKGSVDRWKLCTVTQVEELKAIIRLLPVWATGITFAAVYSQISTLFVLQGDRM  360

Query  1298  NTYVG-TFKXPXASLGV  1345
             + ++G  F+ P ASL +
Sbjct  361   DPHIGPNFEIPAASLSI  377



>ref|XP_004490642.1| PREDICTED: peptide transporter PTR1-like [Cicer arietinum]
Length=570

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/379 (68%), Positives = 311/379 (82%), Gaps = 4/379 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M EDDV TKDGT+DY   PANK+KTG W+ACPFILGNEC ERLA+YGMS+NL+ YF+ +L
Sbjct  1     MAEDDVCTKDGTVDYLGNPANKRKTGTWRACPFILGNECCERLAFYGMSTNLVRYFKYQL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             +Q + +ASKN ++W GTCYI PL+GAF+ADAYLGR+WTI  FSI+YV+GMTL+TLSA+V 
Sbjct  61    HQHSATASKNAADWGGTCYITPLIGAFVADAYLGRFWTIFCFSIVYVIGMTLLTLSASVS  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+ PTC A D C AT   +AVCF+ALYL+ALGTGGIKPCVSS+GADQFDD DE E++HKS
Sbjct  121   GLKPTCYAKDDCHATHEQSAVCFVALYLIALGTGGIKPCVSSFGADQFDDADEVEKEHKS  180

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GAL+AASL+VWIQ +VSWG GFG+PA    +AV  FFSGTRLYR QKP
Sbjct  181   SFFNWFYFSINIGALIAASLLVWIQDNVSWGLGFGIPAXXXXIAVVSFFSGTRLYRNQKP  240

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QV+VAS+RK  V+VP DKSLL+ET    S+IQGSRKL  +N LRFFDKAAV
Sbjct  241   GGSPVTRICQVIVASVRKYNVEVPDDKSLLYETDETVSSIQGSRKLERSNGLRFFDKAAV  300

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
             +E    ++ K S +PWRLC +TQVEELK+IIRLLPIWATGIIF+TVYGQM   F+ Q E 
Sbjct  301   LENP--DNAKDSTNPWRLCPITQVEELKAIIRLLPIWATGIIFATVYGQMSNYFVLQGET  358

Query  1295  MNTYVG--TFKXPXASLGV  1345
             MNT++G   F+ P ASL +
Sbjct  359   MNTHIGNSNFQIPPASLSI  377



>ref|XP_010262765.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Nelumbo nucifera]
 ref|XP_010262766.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Nelumbo nucifera]
 ref|XP_010262768.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Nelumbo nucifera]
 ref|XP_010262769.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Nelumbo nucifera]
 ref|XP_010262770.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Nelumbo nucifera]
Length=568

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/378 (69%), Positives = 312/378 (83%), Gaps = 4/378 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M E+D+YTKDGT D+RN+PA KK+TG WKACP+ILGNEC ERLAYYGMS+NL+ Y + +L
Sbjct  1     MAEEDIYTKDGTTDFRNKPAIKKETGTWKACPYILGNECCERLAYYGMSTNLVNYLKFQL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             +Q    A+ N++NWSGTCYI PL+GAFLAD+YLGRYWTIA+FSIIYV GMTL+TLSA+V 
Sbjct  61    HQHNVVAANNVTNWSGTCYITPLIGAFLADSYLGRYWTIASFSIIYVCGMTLLTLSASVR  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+ P C   D C  T   +AVCF+ALYLVALGTGGIKPCVSS+GADQFDDTDE E+K+KS
Sbjct  121   GLKPNC-EKDVCHPTEAQSAVCFVALYLVALGTGGIKPCVSSFGADQFDDTDEVEKKYKS  179

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GAL+AAS++VWIQ +V WGWGFG+PAVAMA+AV  FFSGTRLYR QKP
Sbjct  180   SFFNWFYFSINIGALLAASVLVWIQTNVGWGWGFGIPAVAMAIAVMSFFSGTRLYRNQKP  239

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR  QVVVAS RK +VKVPSDKSLL+ET  +ES ++GSRKL +T +  F DKAAV
Sbjct  240   GGSPLTRFCQVVVASFRKFQVKVPSDKSLLYETADVESVVKGSRKLDYTEQFSFLDKAAV  299

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               E+  +  KG  +PWRLCTVTQVEELK+IIRLLPIWATGI+FSTVY QMGT F+ Q   
Sbjct  300   QTET--DHIKGFANPWRLCTVTQVEELKAIIRLLPIWATGIMFSTVYSQMGTLFVLQGNT  357

Query  1295  MNTYVGT-FKXPXASLGV  1345
             M+ ++G  F+ P ASL +
Sbjct  358   MDLHMGPHFQIPSASLSI  375



>ref|XP_010650937.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like isoform X2 [Vitis 
vinifera]
 emb|CBI16003.3| unnamed protein product [Vitis vinifera]
Length=569

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/378 (68%), Positives = 309/378 (82%), Gaps = 3/378 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M E+D YTKDGT++Y+  PANKKKTG W ACP+ILGNE  ERLAYYGMSSNL++YF+ +L
Sbjct  1     MAEEDNYTKDGTINYQGNPANKKKTGTWTACPYILGNEFCERLAYYGMSSNLVLYFKYKL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             +Q + +ASKN+ NWSGTCY+ P +GAFLADAYLGRYWTIA+FSIIYV+GMTL+T++A+VP
Sbjct  61    HQDSATASKNVLNWSGTCYLTPFIGAFLADAYLGRYWTIASFSIIYVIGMTLLTVTASVP  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+ P C     C  T   TAVCF+ALYLVALGTGGIKPCVSSYGADQFDDTDE E+ HKS
Sbjct  121   GLKPNCSPSGVCDPTETQTAVCFLALYLVALGTGGIKPCVSSYGADQFDDTDEHEKTHKS  180

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFY SINVGAL+A S++VWIQ+++ WG GFG+PA AMA+AV  FFSGTRLYR QKP
Sbjct  181   SFFNWFYLSINVGALIAGSILVWIQENIGWGVGFGIPAAAMAIAVVSFFSGTRLYRNQKP  240

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QVVVASL+K +V+VP+DKSLL+E    ES IQGSRKL HT +L FFDKAAV
Sbjct  241   GGSPLTRMSQVVVASLKKYRVQVPADKSLLYEIADGESGIQGSRKLDHTKDLSFFDKAAV  300

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               E   +  K S  PW++CTVTQVEELK+IIRLLP+WATGIIFS VY QMG+ F+ Q E 
Sbjct  301   --EIQSDHIKDSPDPWKICTVTQVEELKAIIRLLPVWATGIIFSAVYSQMGSLFVVQGES  358

Query  1295  MNTYVG-TFKXPXASLGV  1345
             M+ ++G  F+ P ASL +
Sbjct  359   MDPHMGRHFEIPSASLSI  376



>gb|KGN47104.1| hypothetical protein Csa_6G187970 [Cucumis sativus]
Length=608

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/377 (68%), Positives = 313/377 (83%), Gaps = 3/377 (1%)
 Frame = +2

Query  218   EEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  397
             EED +YT+DGT+DYR  PA + +TG W+ACP+ILGNE  ERLAYYGMSSNL++YF+  LN
Sbjct  41    EEDSIYTQDGTVDYRGDPAVRTQTGTWRACPYILGNEFCERLAYYGMSSNLVLYFKDHLN  100

Query  398   QSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPG  577
             Q + +ASKN++NW GTCYI PL+GAFLADAYLGRY TIA FSI+YV GMTL+TLSA+VPG
Sbjct  101   QHSATASKNVNNWIGTCYITPLIGAFLADAYLGRYRTIAAFSILYVFGMTLLTLSASVPG  160

Query  578   ISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSS  757
             + PTC++ D C AT   +A+CF+ALYL+ALGTGGIKPCVSSYGADQFDD DE E+KHKSS
Sbjct  161   LKPTCVSKDDCHATTAQSALCFLALYLIALGTGGIKPCVSSYGADQFDDADETEKKHKSS  220

Query  758   FFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKPG  937
             FFNWFY SINVG L+A+S++VW+Q++VSWGWGFG+PA+AMA+AV  FFSGTRLYR QKPG
Sbjct  221   FFNWFYLSINVGGLIASSVLVWVQENVSWGWGFGIPAIAMAIAVVSFFSGTRLYRNQKPG  280

Query  938   GSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAVV  1117
             GSPFTR+ QV+VAS RK KVKVP  K+ L+ET   ES+I GSRKL HT++ RFFDKAAV 
Sbjct  281   GSPFTRICQVIVASFRKYKVKVPESKA-LYETADSESSIVGSRKLDHTDDFRFFDKAAVE  339

Query  1118  EESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEGM  1297
              ES D+  KGSV  W+LCTVTQVEELK+IIRLLP+WATGI F+ VY Q+ T F+ Q + M
Sbjct  340   LES-DQMLKGSVDRWKLCTVTQVEELKAIIRLLPVWATGITFAAVYSQISTLFVLQGDRM  398

Query  1298  NTYVG-TFKXPXASLGV  1345
             + ++G  F+ P ASL +
Sbjct  399   DPHIGPNFEIPAASLSI  415



>ref|XP_010650936.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like isoform X1 [Vitis 
vinifera]
Length=582

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/378 (68%), Positives = 309/378 (82%), Gaps = 3/378 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M E+D YTKDGT++Y+  PANKKKTG W ACP+ILGNE  ERLAYYGMSSNL++YF+ +L
Sbjct  14    MAEEDNYTKDGTINYQGNPANKKKTGTWTACPYILGNEFCERLAYYGMSSNLVLYFKYKL  73

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             +Q + +ASKN+ NWSGTCY+ P +GAFLADAYLGRYWTIA+FSIIYV+GMTL+T++A+VP
Sbjct  74    HQDSATASKNVLNWSGTCYLTPFIGAFLADAYLGRYWTIASFSIIYVIGMTLLTVTASVP  133

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+ P C     C  T   TAVCF+ALYLVALGTGGIKPCVSSYGADQFDDTDE E+ HKS
Sbjct  134   GLKPNCSPSGVCDPTETQTAVCFLALYLVALGTGGIKPCVSSYGADQFDDTDEHEKTHKS  193

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFY SINVGAL+A S++VWIQ+++ WG GFG+PA AMA+AV  FFSGTRLYR QKP
Sbjct  194   SFFNWFYLSINVGALIAGSILVWIQENIGWGVGFGIPAAAMAIAVVSFFSGTRLYRNQKP  253

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QVVVASL+K +V+VP+DKSLL+E    ES IQGSRKL HT +L FFDKAAV
Sbjct  254   GGSPLTRMSQVVVASLKKYRVQVPADKSLLYEIADGESGIQGSRKLDHTKDLSFFDKAAV  313

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               E   +  K S  PW++CTVTQVEELK+IIRLLP+WATGIIFS VY QMG+ F+ Q E 
Sbjct  314   --EIQSDHIKDSPDPWKICTVTQVEELKAIIRLLPVWATGIIFSAVYSQMGSLFVVQGES  371

Query  1295  MNTYVG-TFKXPXASLGV  1345
             M+ ++G  F+ P ASL +
Sbjct  372   MDPHMGRHFEIPSASLSI  389



>ref|XP_010044085.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1 [Eucalyptus grandis]
 ref|XP_010044086.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1 [Eucalyptus grandis]
 gb|KCW86092.1| hypothetical protein EUGRSUZ_B02793 [Eucalyptus grandis]
Length=571

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/378 (67%), Positives = 310/378 (82%), Gaps = 4/378 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M E+D+YTKDGT+  R  PA++ KTGNWKAC FILGNEC ERLAYYGM +NL+ Y   RL
Sbjct  4     MAEEDIYTKDGTVTIRGDPADRTKTGNWKACRFILGNECCERLAYYGMGTNLVNYIHERL  63

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             +QS  +AS N++NWSGTCYI PL+GAFLAD+YLGRYWTIA FS++YV+GMTL+T+SA+VP
Sbjct  64    HQSNVAASNNVTNWSGTCYITPLIGAFLADSYLGRYWTIAIFSMVYVLGMTLLTISASVP  123

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+ P+C  + +C      TA CF+ALYL+ALGTGGIKPCVSS+GADQFD+TDE ERK KS
Sbjct  124   GLKPSC-ENGECHPKTSQTAACFVALYLIALGTGGIKPCVSSFGADQFDETDEPERKKKS  182

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFY SIN+GAL+A+S++VWIQ +V WGWGFG+PAVAMA+A+ FFFSG+RLYR QKP
Sbjct  183   SFFNWFYLSINIGALIASSVLVWIQMNVGWGWGFGIPAVAMAIAIVFFFSGSRLYRIQKP  242

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QV+VAS RK KV+VP+DK+ LHET   E  IQGSRKL HT+EL+FFDKAAV
Sbjct  243   GGSPLTRIAQVIVASFRKMKVEVPADKTHLHETADAECTIQGSRKLEHTDELQFFDKAAV  302

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               E   ++ KG+  PWRLCTVTQVEELKSIIRLLP+WA+GI+F+TVY QM T F+ Q   
Sbjct  303   --EIPTDNIKGNTDPWRLCTVTQVEELKSIIRLLPVWASGIVFATVYSQMSTMFVLQGNT  360

Query  1295  MNTYVGT-FKXPXASLGV  1345
             ++ ++G  FK P ASL +
Sbjct  361   LDQHMGPHFKIPSASLSL  378



>ref|XP_006403613.1| hypothetical protein EUTSA_v10010246mg [Eutrema salsugineum]
 gb|ESQ45066.1| hypothetical protein EUTSA_v10010246mg [Eutrema salsugineum]
Length=570

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/378 (68%), Positives = 303/378 (80%), Gaps = 2/378 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             MEE DVYT+DGT+D    PANKKKTGNWKAC FILGNEC ERLAYYGM +NL+ Y ++RL
Sbjct  1     MEEKDVYTEDGTVDINKNPANKKKTGNWKACRFILGNECCERLAYYGMGTNLVNYLESRL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             NQ   +A+ N++NWSGTCYI PL+GAF+ADAYLGRYWTIA F  IYV GMTL+TLSA+VP
Sbjct  61    NQGNATAANNVTNWSGTCYITPLIGAFVADAYLGRYWTIAIFVFIYVSGMTLLTLSASVP  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+ P+    D C      TAV F+ALY++ALGTGGIKPCVSS+GADQFDD DE E+  KS
Sbjct  121   GLRPSNCNGDTCHPNTGQTAVFFVALYMIALGTGGIKPCVSSFGADQFDDNDEAEKLKKS  180

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSINVGALVAA+++VWIQ +V WGWGFGVP VAM +AVTFFF G+R YR Q+P
Sbjct  181   SFFNWFYFSINVGALVAATVLVWIQMNVGWGWGFGVPTVAMVIAVTFFFMGSRFYRLQRP  240

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+FQV+VAS RK  VKVP DKSLL ET   ESNI GSRKL HT+ L+FFDKAAV
Sbjct  241   GGSPLTRIFQVIVASFRKVSVKVPEDKSLLFETADDESNITGSRKLEHTDNLKFFDKAAV  300

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               +S D  K+G V+PWRLC+VTQVEELKSII LLP+WA+GI+F+TVY QM T F+ Q   
Sbjct  301   ESQS-DSIKEGEVNPWRLCSVTQVEELKSIITLLPVWASGILFATVYSQMNTMFVLQGNT  359

Query  1295  MNTYVG-TFKXPXASLGV  1345
             ++ ++G  F+ P ASL +
Sbjct  360   LDQHMGKNFEIPSASLSL  377



>ref|XP_011090498.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Sesamum indicum]
Length=568

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/381 (68%), Positives = 306/381 (80%), Gaps = 4/381 (1%)
 Frame = +2

Query  209   KAMEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQT  388
             + M  +D YTKDGTLD+R+ PANK KTG WKA PFILGN+C ERLA+YGMSSNL++Y+ T
Sbjct  2     EVMGNEDKYTKDGTLDFRSNPANKNKTGAWKASPFILGNQCCERLAFYGMSSNLLLYYTT  61

Query  389   RLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSAT  568
             +LNQ + +ASKNLSNW GTCY++PL GAFLADAYLGRYWTIA FS+IYV+GMTL+TLSA+
Sbjct  62    QLNQHSATASKNLSNWLGTCYVLPLFGAFLADAYLGRYWTIAGFSVIYVLGMTLLTLSAS  121

Query  569   VPGISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKH  748
             VPG+ PTC   D+C AT   T VC +ALYLVALG GG+KPCVSSYGADQFDD DE E+ H
Sbjct  122   VPGLRPTCYKKDECYATNSQTTVCTVALYLVALGFGGMKPCVSSYGADQFDDADEVEKGH  181

Query  749   KSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQ  928
             KSSFFNW YFS+NVG L+  S+ VWIQ ++ WGWG+GV AVAMA+ V FFF GTRLYRYQ
Sbjct  182   KSSFFNWLYFSMNVGMLIGCSVPVWIQVNIGWGWGYGVSAVAMAIGVAFFFLGTRLYRYQ  241

Query  929   KPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKA  1108
             KPG +P TRL QV+VASLRK +V+VPSDKSLL+ET   +S I GS KL HTN+  F DKA
Sbjct  242   KPGSNPLTRLCQVLVASLRKYRVEVPSDKSLLYETADADSTIVGSHKLDHTNQFCFLDKA  301

Query  1109  AVVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQA  1288
             AV +ES  +  KGSV+PW LCTVTQVEELK IIRLLP+ ATGIIF+TV+GQM   F+ QA
Sbjct  302   AVEKES--DHSKGSVNPWTLCTVTQVEELKWIIRLLPVLATGIIFNTVFGQMSNLFLLQA  359

Query  1289  EGMNTYVG--TFKXPXASLGV  1345
             E M+  +G   FK P ASL V
Sbjct  360   EYMDARLGRSNFKVPVASLAV  380



>ref|XP_002533893.1| peptide transporter, putative [Ricinus communis]
 gb|EEF28493.1| peptide transporter, putative [Ricinus communis]
Length=1121

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/397 (67%), Positives = 319/397 (80%), Gaps = 6/397 (2%)
 Frame = +2

Query  158   YIFSKLTKIGLQMMEQSKAMEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSE  337
             Y F  L  + LQ+ E++  M EDD+YTKDGTL+ +  PANKKKTGNWKAC FILGNEC E
Sbjct  537   YFFWLLAVLSLQIPEET--MAEDDIYTKDGTLNIKGEPANKKKTGNWKACRFILGNECCE  594

Query  338   RLAYYGMSSNLMIYFQTRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIAT  517
             RLAYYGMS+NL+ Y Q RLNQ   +AS N++NWSGTCYI PL+GAFLADAY GRYWTIA+
Sbjct  595   RLAYYGMSTNLVNYLQDRLNQGNVAASNNVTNWSGTCYITPLIGAFLADAYFGRYWTIAS  654

Query  518   FSIIYVMGMTLMTLSATVPGISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVS  697
             F +IY+ GM L+T+SA+ PG+ P C  H  C  T   TAV F ALYL+ALGTGGIKPCVS
Sbjct  655   FVMIYIFGMALLTISASAPGLKPFCDKHS-CHPTKTQTAVTFAALYLIALGTGGIKPCVS  713

Query  698   SYGADQFDDTDEKERKHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAM  877
             S+GADQFD+TD+ E+K KSSFFNWFYFSIN+GAL+A+S++VWIQ +V WGWGFGVPAVAM
Sbjct  714   SFGADQFDETDDDEKKKKSSFFNWFYFSINIGALIASSVLVWIQMNVGWGWGFGVPAVAM  773

Query  878   ALAVTFFFSGTRLYRYQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQ  1057
             A+AV FFF+G++LYR Q+PGGSP TRL QV+VAS RK  V+VP DKSLL+ET   ES IQ
Sbjct  774   AIAVVFFFAGSKLYRLQRPGGSPITRLLQVIVASFRKLNVQVPDDKSLLYETTDEESQIQ  833

Query  1058  GSRKLSHTNELRFFDKAAVVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGI  1237
             GSRKL HT++L+FFDKAAV  E+  +  K S +PWRLCTVTQVEELK+IIRLLP+WA+GI
Sbjct  834   GSRKLEHTDKLKFFDKAAV--ETQTDSVKDSTNPWRLCTVTQVEELKAIIRLLPVWASGI  891

Query  1238  IFSTVYGQMGTQFISQAEGMNTYVGT-FKXPXASLGV  1345
             +F+TVYGQM T F+ Q   MN ++G  FK P ASL +
Sbjct  892   VFATVYGQMSTMFVLQGNTMNQHMGPHFKIPSASLSL  928


 Score =   538 bits (1387),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 254/379 (67%), Positives = 312/379 (82%), Gaps = 4/379 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             ME++D+YTKDGT+D+   PA KKKTG WKACP+ILGNEC ERLAYYG+++NL+ Y + +L
Sbjct  1     MEQEDIYTKDGTIDFSGNPAIKKKTGTWKACPYILGNECCERLAYYGINTNLVNYLKFQL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             NQ +  A  N++NWSGTCY+MPL+GAFLADAYLGRYWTIA+FSIIYV+GMTL+TLSA++ 
Sbjct  61    NQGSVQAVNNVTNWSGTCYVMPLLGAFLADAYLGRYWTIASFSIIYVLGMTLLTLSASLH  120

Query  575   GISPTCIAH-DKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHK  751
             G+ P+C  H + C  TG+ TAV F+ LYL+ALGTGGIKPCVSS+GADQFDD+DE E+K K
Sbjct  121   GLMPSCDNHTNVCNPTGKQTAVFFLGLYLIALGTGGIKPCVSSFGADQFDDSDEAEKKKK  180

Query  752   SSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQK  931
             SSFFNWFYFSIN+GALVA+S++VWIQ +V WGWGFG+PAVAMA+AV  FFSG +LYR Q+
Sbjct  181   SSFFNWFYFSINIGALVASSVLVWIQTNVGWGWGFGIPAVAMAIAVMTFFSGIKLYRNQR  240

Query  932   PGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAA  1111
             PGGSP TR+ QV+VASLRK +V+VP D+SLL ET   ES ++GSRKL HT +L FFDKAA
Sbjct  241   PGGSPLTRICQVIVASLRKFRVQVPKDESLLFETSDEESAVKGSRKLDHTEQLSFFDKAA  300

Query  1112  VVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAE  1291
             V  E+  +  KGSV+ W LCTVTQVEELKS+IRLLPIWATGIIFS VY QMGT F+ Q  
Sbjct  301   V--ETPSDCVKGSVNKWSLCTVTQVEELKSVIRLLPIWATGIIFSAVYSQMGTLFVLQGN  358

Query  1292  GMNTYVG-TFKXPXASLGV  1345
              M+  +  +F+ P ASL +
Sbjct  359   TMDLQMSRSFEIPSASLSL  377



>ref|NP_190982.1| peptide transporter PTR1 [Arabidopsis thaliana]
 sp|Q9M390.1|PTR1_ARATH RecName: Full=Protein NRT1/ PTR FAMILY 8.1; Short=AtNPF8.1; AltName: 
Full=Peptide transporter PTR1 [Arabidopsis thaliana]
 gb|AAK25865.1|AF360155_1 putative peptide transport protein [Arabidopsis thaliana]
 emb|CAB70988.1| peptide transport-like protein [Arabidopsis thaliana]
 gb|AAM44932.1| putative peptide transport protein [Arabidopsis thaliana]
 gb|AAM61341.1| peptide transport-like protein [Arabidopsis thaliana]
 gb|AEE79192.1| peptide transporter PTR1 [Arabidopsis thaliana]
Length=570

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/378 (67%), Positives = 302/378 (80%), Gaps = 2/378 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             MEE DVYT+DGT+D    PANK+KTGNWKAC FILGNEC ERLAYYGM +NL+ Y ++RL
Sbjct  1     MEEKDVYTQDGTVDIHKNPANKEKTGNWKACRFILGNECCERLAYYGMGTNLVNYLESRL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             NQ   +A+ N++NWSGTCYI PL+GAF+ADAYLGRYWTIATF  IYV GMTL+TLSA+VP
Sbjct  61    NQGNATAANNVTNWSGTCYITPLIGAFIADAYLGRYWTIATFVFIYVSGMTLLTLSASVP  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+ P     D C      TAV F+ALY++ALGTGGIKPCVSS+GADQFD+ DE E+  KS
Sbjct  121   GLKPGNCNADTCHPNSSQTAVFFVALYMIALGTGGIKPCVSSFGADQFDENDENEKIKKS  180

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSINVGAL+AA+++VWIQ +V WGWGFGVP VAM +AV FFF G+R YR Q+P
Sbjct  181   SFFNWFYFSINVGALIAATVLVWIQMNVGWGWGFGVPTVAMVIAVCFFFFGSRFYRLQRP  240

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+FQV+VA+ RK  VKVP DKSLL ET   ESNI+GSRKL HT+ L+FFDKAAV
Sbjct  241   GGSPLTRIFQVIVAAFRKISVKVPEDKSLLFETADDESNIKGSRKLVHTDNLKFFDKAAV  300

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               +S D  K G V+PWRLC+VTQVEELKSII LLP+WATGI+F+TVY QM T F+ Q   
Sbjct  301   ESQS-DSIKDGEVNPWRLCSVTQVEELKSIITLLPVWATGIVFATVYSQMSTMFVLQGNT  359

Query  1295  MNTYVG-TFKXPXASLGV  1345
             M+ ++G  F+ P ASL +
Sbjct  360   MDQHMGKNFEIPSASLSL  377



>ref|XP_002877959.1| proton-dependent oligopeptide transport family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH54218.1| proton-dependent oligopeptide transport family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=570

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/378 (67%), Positives = 303/378 (80%), Gaps = 2/378 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             MEE DVYT+DGT+D    PANK+KTGNWKAC FILGNEC ERLAYYGM +NL+ Y ++RL
Sbjct  1     MEEKDVYTQDGTVDIHKNPANKEKTGNWKACRFILGNECCERLAYYGMGTNLVNYLESRL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             NQ   +A+ N++NWSGTCYI PL+GAF+ADAYLGRYWTIATF  IYV GMTL+TLSA+VP
Sbjct  61    NQGNATAANNVTNWSGTCYITPLIGAFIADAYLGRYWTIATFVFIYVSGMTLLTLSASVP  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+ P     D C      TAV F+ALY++ALGTGGIKPCVSS+GADQFD+ DE E+  KS
Sbjct  121   GLKPGNCNADTCHPNSGQTAVFFVALYMIALGTGGIKPCVSSFGADQFDENDEAEKIKKS  180

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSINVGAL+AA+++VWIQ +V WGWGFGVP VAM +AV FFF G+R YR Q+P
Sbjct  181   SFFNWFYFSINVGALIAATVLVWIQMNVGWGWGFGVPTVAMVIAVCFFFLGSRFYRLQRP  240

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+FQV+VA+ RK +VKVP DKSLL ET   ESNI+GSRKL HT+ L+FFDKAAV
Sbjct  241   GGSPLTRIFQVIVAAFRKMRVKVPEDKSLLFETADDESNIKGSRKLVHTDNLKFFDKAAV  300

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               +S D  K G V+PWRLC+VTQVEELKSII LLP+WATGI+F+TVY QM T F+ Q   
Sbjct  301   EIQS-DSIKDGEVNPWRLCSVTQVEELKSIISLLPVWATGIVFATVYSQMNTMFVLQGNT  359

Query  1295  MNTYVG-TFKXPXASLGV  1345
             M+ ++G  F+ P ASL +
Sbjct  360   MDQHMGKNFEIPSASLSL  377



>ref|XP_011081130.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Sesamum indicum]
Length=549

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/380 (68%), Positives = 302/380 (79%), Gaps = 27/380 (7%)
 Frame = +2

Query  212   AMEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTR  391
             AM EDD+YTKDGT+DY N PA K KTG WKACPFILGNEC ERLAYYGMSSNL++YF+ +
Sbjct  2     AMAEDDLYTKDGTVDYHNNPAKKNKTGTWKACPFILGNECCERLAYYGMSSNLVVYFKEQ  61

Query  392   LNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATV  571
             LNQ +T+AS N+SNWSGTCYI PL+GAF+ADAYLGRYWTIA FSIIYV+GMTL+TLSA++
Sbjct  62    LNQHSTTASNNVSNWSGTCYITPLIGAFVADAYLGRYWTIALFSIIYVIGMTLLTLSASI  121

Query  572   PGISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHK  751
             PG+ PTC A D C AT    AVCF+ALYL+ALGTGGIKPCVSSYGADQFDDTDE E+KHK
Sbjct  122   PGLKPTCQAKDSCHATSTQAAVCFVALYLIALGTGGIKPCVSSYGADQFDDTDEVEKKHK  181

Query  752   SSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQK  931
             SSFFNWFYFSIN+GAL+AAS++VW                       FFFSGTRLYR QK
Sbjct  182   SSFFNWFYFSINIGALIAASVLVW-----------------------FFFSGTRLYRNQK  218

Query  932   PGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAA  1111
             PGGSP TR+ QV++AS RK +++VP+DKSLL+E    ES I+GSRKL HT +L FFDKAA
Sbjct  219   PGGSPLTRICQVLIASFRKYRIEVPADKSLLYECKDAESAIKGSRKLEHTEDLGFFDKAA  278

Query  1112  VVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAE  1291
             V  E+  +  KGSV PWRLCTVTQVEELK+IIRLLP+WATGIIF+TVYGQM T F+ Q  
Sbjct  279   V--ETQSDHMKGSVDPWRLCTVTQVEELKAIIRLLPVWATGIIFATVYGQMSTLFVLQGL  336

Query  1292  GMNTYVGT--FKXPXASLGV  1345
              M+  VG   F+ P ASLG+
Sbjct  337   TMDAQVGKTGFEIPAASLGI  356



>ref|XP_012088023.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Jatropha curcas]
 gb|KDP24485.1| hypothetical protein JCGZ_25049 [Jatropha curcas]
Length=565

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/378 (67%), Positives = 309/378 (82%), Gaps = 3/378 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M E D+YT+DGT+D+   PA+KKKTG WKACP ILGNEC ERLAYYG+++NL+ Y + +L
Sbjct  1     MAEQDIYTRDGTIDFHGNPADKKKTGTWKACPCILGNECCERLAYYGINTNLVNYLKFQL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             NQS+  A  N++NWSGTCY+MPL+GAFLADAYLGRYWTIA+FSIIYV+GMTL+TLSA+V 
Sbjct  61    NQSSVEAINNVTNWSGTCYVMPLLGAFLADAYLGRYWTIASFSIIYVLGMTLLTLSASVK  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+ P+C   + C  TG +T+V F+ LYL+ALGTGGIKPCVSS+GADQFDD+DE E+K KS
Sbjct  121   GLKPSCNHSNVCHPTGTETSVFFLGLYLIALGTGGIKPCVSSFGADQFDDSDETEKKQKS  180

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GAL+A+S++VWIQ +V WGWGFG+PAVAMA+AV  FFSGT+ YR  KP
Sbjct  181   SFFNWFYFSINIGALIASSILVWIQTNVGWGWGFGIPAVAMAIAVMSFFSGTKFYRNLKP  240

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR  QV+VASLRK +V+VP D+SLL ET   ES ++GSRKL HT +L FFDKAAV
Sbjct  241   GGSPLTRTCQVIVASLRKFRVQVPDDESLLFETSDEESAVKGSRKLHHTKQLSFFDKAAV  300

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               ES  +  KGS+ PWRLCTVTQVEELKSIIRLLPIWATGIIFS VY QMGT F+ Q   
Sbjct  301   ETES--DRVKGSIHPWRLCTVTQVEELKSIIRLLPIWATGIIFSAVYTQMGTLFVLQGNT  358

Query  1295  MNTYV-GTFKXPXASLGV  1345
             M+  +  +F+ P ASL +
Sbjct  359   MDLQITSSFQIPSASLSL  376



>emb|CDY13185.1| BnaC04g26500D [Brassica napus]
Length=559

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/378 (68%), Positives = 299/378 (79%), Gaps = 2/378 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             MEE DVYT+DGT+D    PANKKKTGNWKAC FILGNEC ERLAYYGM +NL+ Y ++RL
Sbjct  1     MEEKDVYTEDGTVDIHKNPANKKKTGNWKACRFILGNECCERLAYYGMGTNLVNYLESRL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             NQ   +A+ N++NWSGTCYI PL+GAFLADAYLGRYWTIATF  IYV GMTL+TLSA+VP
Sbjct  61    NQGNATAANNVTNWSGTCYITPLIGAFLADAYLGRYWTIATFVFIYVSGMTLLTLSASVP  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+ P     D C      TAV F+ALY++ALGTGGIKPCVSS+GADQFD+ DE E+  KS
Sbjct  121   GLKPGNCNGDTCHPNSGQTAVFFVALYMIALGTGGIKPCVSSFGADQFDENDEAEKLKKS  180

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSINVGALVAA+++VWIQ +V WGWGFGVP VAM +AV FFF G+R YR Q+P
Sbjct  181   SFFNWFYFSINVGALVAATVLVWIQMNVGWGWGFGVPTVAMVIAVVFFFLGSRYYRLQRP  240

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+FQV+VA+ RK  VKVP DKSLL ET   ESNI GSRKL HT+ L FFDKAA 
Sbjct  241   GGSPLTRIFQVIVAAFRKVSVKVPEDKSLLFETADDESNITGSRKLEHTDNLMFFDKAA-  299

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
             VE   D  K G V+PWRLC+VTQVEELKSII LLP+WA+GI+F+TVY QM T F+ Q   
Sbjct  300   VESHSDSIKDGEVNPWRLCSVTQVEELKSIITLLPVWASGIVFATVYSQMNTMFVLQGNT  359

Query  1295  MNTYVG-TFKXPXASLGV  1345
             M+ ++G  F+ P ASL +
Sbjct  360   MDQHMGKNFEIPSASLSL  377



>ref|XP_003518298.1| PREDICTED: peptide transporter PTR1-like [Glycine max]
 gb|KHN46171.1| Peptide transporter PTR1 [Glycine soja]
Length=573

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/371 (70%), Positives = 305/371 (82%), Gaps = 4/371 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M E+DVYTKDGT+DYR   ANK +TG W+ACPFILGNECSERLAYYGMS+NL+ YF T+L
Sbjct  1     MTEEDVYTKDGTVDYRGNRANKNETGTWRACPFILGNECSERLAYYGMSTNLVTYFNTKL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             NQS  +ASKN +NW GTCYI PL+GAF+ADAYLGRY TI  FSI+YV+GMTL+TLSA+VP
Sbjct  61    NQSGPTASKNNANWGGTCYITPLIGAFVADAYLGRYRTILYFSIVYVIGMTLLTLSASVP  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             GI P+C     C AT   +A+CF+ALYL+ALGTGGIKPCVSS+GADQFDD DE E++HKS
Sbjct  121   GIKPSCDDQGNCHATEAQSAMCFVALYLIALGTGGIKPCVSSFGADQFDDADEAEKEHKS  180

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFY SIN+G LVAASL+VW+Q  VSWGWGFG+PAVAMA+AV  F SGTRLYR QKP
Sbjct  181   SFFNWFYLSINIGGLVAASLLVWVQTTVSWGWGFGIPAVAMAIAVVSFLSGTRLYRIQKP  240

Query  935   GGSPFTRLFQVVVASLRKRKVKVPS-DKSLLHET-VGLESNIQGSRKLSHTNELRFFDKA  1108
             GGSP TR+ QV+VAS+RK KV+V + D+S  +E     ES IQGSRKL HTN L FFDKA
Sbjct  241   GGSPLTRMCQVIVASIRKSKVQVTNDDRSAFYEIEQDSESAIQGSRKLEHTNGLSFFDKA  300

Query  1109  AVVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQA  1288
             AV+ +S  ++ K  ++PWRLCTVTQVEELK+IIRLLPIWATGIIFSTVY QMG+ FI Q 
Sbjct  301   AVIRDS--DNVKDPINPWRLCTVTQVEELKAIIRLLPIWATGIIFSTVYSQMGSYFILQG  358

Query  1289  EGMNTYVGTFK  1321
             + M+  +G+ K
Sbjct  359   DTMDNRLGSNK  369



>ref|XP_010654188.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like [Vitis vinifera]
 ref|XP_010654189.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like [Vitis vinifera]
 ref|XP_010654190.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like [Vitis vinifera]
 ref|XP_010654191.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like [Vitis vinifera]
Length=569

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/378 (67%), Positives = 306/378 (81%), Gaps = 3/378 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M E+D+YTKDGT+D+R+ PA KK+TG WKACP+ILGNEC ERLAYYG+++NL+ Y + +L
Sbjct  1     MAEEDIYTKDGTIDFRSNPAVKKETGTWKACPYILGNECCERLAYYGINTNLVNYLKFQL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             NQ    A  N++NWSGTCY+ PL+GAFLADAYLGRYWTIA FSIIYV GMTL+TLSA+  
Sbjct  61    NQRNVVAINNVTNWSGTCYVTPLLGAFLADAYLGRYWTIAGFSIIYVFGMTLLTLSASAH  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+ P C   + C  TG  TAV F+ LYL+ALGTGGIKPCVSS+GADQFDD+DE ERK KS
Sbjct  121   GLKPLCDGQNVCYPTGLQTAVFFVGLYLIALGTGGIKPCVSSFGADQFDDSDETERKSKS  180

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GAL+A+S++VW+Q +V WGWGFG+PAVAM +AV  FFSGTRLYR QKP
Sbjct  181   SFFNWFYFSINIGALLASSVLVWVQTNVGWGWGFGIPAVAMGIAVMSFFSGTRLYRNQKP  240

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QV+VASLRK +V+VP+DK LL+ET   ES + GSRKL HT  L FFDKAAV
Sbjct  241   GGSPLTRICQVIVASLRKFQVEVPADKCLLYETADSESAVTGSRKLDHTKHLSFFDKAAV  300

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               E+  +  KGSV  WRLCTVTQVEELKSIIRLLPIWATGI+FS VY QMGT F+ Q   
Sbjct  301   --ETHIDAIKGSVDSWRLCTVTQVEELKSIIRLLPIWATGIVFSAVYSQMGTLFVLQGNT  358

Query  1295  MNTYV-GTFKXPXASLGV  1345
             M+ ++ G+F+ P ASL +
Sbjct  359   MDLHITGSFQIPSASLSL  376



>ref|XP_006292488.1| hypothetical protein CARUB_v10018717mg [Capsella rubella]
 gb|EOA25386.1| hypothetical protein CARUB_v10018717mg [Capsella rubella]
Length=570

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/378 (67%), Positives = 303/378 (80%), Gaps = 2/378 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             MEE DVYT+DGT+D    PANK+KTGNWKAC FILGNEC ERLAYYGM +NL+ Y ++RL
Sbjct  1     MEEKDVYTEDGTVDIHKNPANKEKTGNWKACRFILGNECCERLAYYGMGTNLVNYLESRL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             NQ   +A+ N++NWSGTCYI PL+GAFLADAYLGRYWTIATF  IYV GMTL+TLSA+VP
Sbjct  61    NQGNATAANNVTNWSGTCYITPLIGAFLADAYLGRYWTIATFVFIYVSGMTLLTLSASVP  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+ P     + C      TAV F+ALY++ALGTGGIKPCVSS+GADQFD+ DE E+  KS
Sbjct  121   GLKPGNCDGNTCHPNSGQTAVFFVALYMIALGTGGIKPCVSSFGADQFDENDEAEKVKKS  180

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSINVGAL+AA+++VWIQ +V WGWGFGVP VAM +AV FFF G+R YR Q+P
Sbjct  181   SFFNWFYFSINVGALIAATVLVWIQMNVGWGWGFGVPTVAMVIAVCFFFLGSRFYRLQRP  240

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+FQV+VA+ RK +VKVP DKSLL ET   ESNI+GSRKL HT+ L+FFDKAAV
Sbjct  241   GGSPLTRIFQVIVAAFRKIRVKVPEDKSLLFETADDESNIKGSRKLVHTDNLKFFDKAAV  300

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               +S D  K G V+PWRLC+VTQVEELKSII LLP+WA+GI+F+TVY QM T F+ Q   
Sbjct  301   ESQS-DSIKDGEVNPWRLCSVTQVEELKSIITLLPVWASGIVFATVYSQMNTMFVLQGNT  359

Query  1295  MNTYVG-TFKXPXASLGV  1345
             ++ ++G  F+ P ASL +
Sbjct  360   LDQHMGKNFEIPSASLSL  377



>gb|AFN53657.1| putative peptide transporter [Linum usitatissimum]
Length=571

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/379 (67%), Positives = 307/379 (81%), Gaps = 3/379 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M E++  TKDGTLD++  PA+K+ TG WKACPFI+GNEC ERLAYYGMSSNL++YF+ +L
Sbjct  1     MSEEEFLTKDGTLDHKGNPADKRITGTWKACPFIIGNECCERLAYYGMSSNLVLYFKNQL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             NQS+ +A+KN S+WSGTCY+ PL+GAFLADAYLGRYWTIA FSIIYV GMTL+ +SA+VP
Sbjct  61    NQSSATATKNNSDWSGTCYLTPLLGAFLADAYLGRYWTIAGFSIIYVFGMTLLAMSASVP  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+ PTCI+ D C AT   +AV F+ALY++ALGTGGIKPCVSSYGADQFDD D +E++HK+
Sbjct  121   GLKPTCISKDNCHATEGQSAVFFVALYMIALGTGGIKPCVSSYGADQFDDADVEEKEHKA  180

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSINVGALVA+SL+VW+Q++VSWG GFG+PA+AMA+AV  FFSGTR YRYQ P
Sbjct  181   SFFNWFYFSINVGALVASSLLVWVQENVSWGLGFGIPAIAMAIAVASFFSGTRKYRYQTP  240

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QV+VAS RK KV  P+DKSLL+E+   ES I GSRKL HT +  F DKAA 
Sbjct  241   GGSPLTRICQVIVASCRKYKVSPPNDKSLLYESADSESGITGSRKLDHTKDFSFLDKAA-  299

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
             VE   D  K  SV+PWRLCTVTQ+EE K+IIRLLPIWATGI+F+ VY QM   F+ Q + 
Sbjct  300   VETEKDHIKDTSVNPWRLCTVTQIEEFKAIIRLLPIWATGIVFAAVYSQMSNLFVLQGDT  359

Query  1295  MNTYVGT--FKXPXASLGV  1345
             M+  VG   FK   A++ V
Sbjct  360   MDKRVGNSKFKISAANVSV  378



>ref|XP_009139262.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1 [Brassica rapa]
Length=571

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/377 (67%), Positives = 298/377 (79%), Gaps = 2/377 (1%)
 Frame = +2

Query  218   EEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  397
             EE DVYT+DGT+D    PANKKKTGNWKAC FILGNEC ERLAYYGM +NL+ Y ++RLN
Sbjct  3     EEKDVYTEDGTVDIHKNPANKKKTGNWKACRFILGNECCERLAYYGMGTNLVNYLESRLN  62

Query  398   QSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPG  577
             Q   +A+ N++NWSGTCYI PL+GAFLADAYLGRYWTIATF  IYV GMTL+TLSA+VPG
Sbjct  63    QGNATAANNVTNWSGTCYITPLIGAFLADAYLGRYWTIATFVFIYVSGMTLLTLSASVPG  122

Query  578   ISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSS  757
             + P     D C      TAV F+ALY++ALGTGGIKPCVSS+GADQFD+ DE E+  KSS
Sbjct  123   LKPGNCNGDTCHPNSGQTAVFFVALYMIALGTGGIKPCVSSFGADQFDENDEAEKLKKSS  182

Query  758   FFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKPG  937
             FFNWFYFSINVGALVAA+++VWIQ +V WGWGFGVP VAM +AV FFF G+R YR Q+PG
Sbjct  183   FFNWFYFSINVGALVAATVLVWIQMNVGWGWGFGVPTVAMVIAVVFFFLGSRYYRLQRPG  242

Query  938   GSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAVV  1117
             GSP TR+FQV+VA+ RK  V VP DKSLL ET   ESNI GSRKL HT+ L+FFDKAA V
Sbjct  243   GSPLTRIFQVIVAAFRKVSVTVPEDKSLLFETADDESNITGSRKLEHTDNLKFFDKAA-V  301

Query  1118  EESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEGM  1297
             E   D  K G V+PWRLC+VTQVEELKSII LLP+WA+GI+F+TVY QM T F+ Q   M
Sbjct  302   ESHSDSIKDGEVNPWRLCSVTQVEELKSIITLLPVWASGIVFATVYSQMNTMFVLQGNTM  361

Query  1298  NTYVG-TFKXPXASLGV  1345
             + ++G  F+ P ASL +
Sbjct  362   DQHMGKNFEIPSASLSL  378



>ref|XP_011077583.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Sesamum indicum]
 ref|XP_011077584.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Sesamum indicum]
 ref|XP_011077585.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Sesamum indicum]
Length=575

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/378 (67%), Positives = 305/378 (81%), Gaps = 4/378 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M E+D YT+DGT++   +PANK KTGNWKAC FIL  EC ERLAYYGMS+NL+ Y + RL
Sbjct  1     MGEEDTYTRDGTVNIHKKPANKLKTGNWKACRFILVTECCERLAYYGMSTNLVNYLKIRL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             NQ   +AS N++NWSGTCYI PL+GAFLAD+YLGRYWTIA+F  +YV+GMTL+TLSA+V 
Sbjct  61    NQENATASNNVTNWSGTCYITPLIGAFLADSYLGRYWTIASFCTVYVIGMTLLTLSASVH  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+ P C   + C  T   TA+CF+ALYLVALGTGGIKPCVSS+GADQFDD DEKE+K KS
Sbjct  121   GLKPEC-DKNGCHPTTSQTAICFLALYLVALGTGGIKPCVSSFGADQFDDNDEKEKKRKS  179

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFY SIN+GAL+A+S++VWIQ +V W WGFG+PAVAMA+AV FFF G+RLYR Q+P
Sbjct  180   SFFNWFYLSINIGALIASSVLVWIQMNVGWSWGFGIPAVAMAIAVAFFFFGSRLYRIQRP  239

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QV+VASLRK  VKVP+DKSLL+ET    S+IQG RKL HT + RF D+AAV
Sbjct  240   GGSPLTRIVQVLVASLRKFNVKVPADKSLLYETTDSGSDIQGCRKLEHTEKFRFLDRAAV  299

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               E +  + KG V+PWRLCTVTQVEE KSIIRLLPIWATGI+FSTVY QM T F+ Q + 
Sbjct  300   QTEPI--NVKGVVNPWRLCTVTQVEEFKSIIRLLPIWATGIVFSTVYSQMSTMFVLQGDT  357

Query  1295  MNTYVGT-FKXPXASLGV  1345
             M+ ++G+ FK P ASL +
Sbjct  358   MDQHIGSKFKIPSASLSL  375



>ref|XP_008345515.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Malus domestica]
Length=568

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/378 (67%), Positives = 305/378 (81%), Gaps = 4/378 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M + D+YT DGT+D   +PANKKKTGNWKAC FILGNEC ERLAYYGM +NL+ Y + RL
Sbjct  1     MADSDLYTNDGTVDIHKKPANKKKTGNWKACRFILGNECCERLAYYGMGTNLVNYLEKRL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
                T  A+ ++SNWSGTCY  PL+GAFLADAYLGRYWTIA FSI+YV+GMTL+TL+A++ 
Sbjct  61    GMGTAKAATSVSNWSGTCYATPLIGAFLADAYLGRYWTIAIFSIVYVLGMTLLTLTASIN  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+ P C +   C AT    A CF+ALYL+A+GTGGIKPCVSS+GADQFD+TDE ERK KS
Sbjct  121   GLKPHCDS-SGCNATASQRAACFVALYLIAIGTGGIKPCVSSFGADQFDETDETERKKKS  179

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFY SINVGAL+A++++VW+Q +V W WGFGVPAVAMA+AV FFFSG++LYR QKP
Sbjct  180   SFFNWFYMSINVGALIASTVLVWMQMNVGWNWGFGVPAVAMAIAVVFFFSGSKLYRLQKP  239

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QVVVAS+RK KVK+P++KSLL+ET   E NIQGSRKL HTN+L FFDKAAV
Sbjct  240   GGSPLTRIAQVVVASIRKCKVKIPANKSLLYETADEECNIQGSRKLEHTNKLGFFDKAAV  299

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               ES  +  K   SPW LCTVTQVEELKS+IRLLPIWA+GI+F+TVYGQM T F+ Q   
Sbjct  300   --ESETDRAKELPSPWSLCTVTQVEELKSVIRLLPIWASGIVFATVYGQMSTMFVLQGNT  357

Query  1295  MNTYVG-TFKXPXASLGV  1345
             ++ ++G  FK P ASL V
Sbjct  358   LDQHMGPNFKIPSASLSV  375



>gb|EPS59528.1| hypothetical protein M569_15276, partial [Genlisea aurea]
Length=571

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/380 (68%), Positives = 309/380 (81%), Gaps = 4/380 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M EDD+YTKDGT+D+   PA K +TG+WKACPFILGNEC+ERLAYYGMSSNL+IYF+ RL
Sbjct  1     MAEDDLYTKDGTVDFHGNPAKKNETGSWKACPFILGNECAERLAYYGMSSNLVIYFKERL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
              + +++AS ++SNWSGTCY+ PL+GAF+ADAYLGRYWTIATFS+IY  GMTL+TLSA++P
Sbjct  61    GKHSSAASNSVSNWSGTCYLTPLIGAFIADAYLGRYWTIATFSMIYAFGMTLLTLSASIP  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             GI PTC + D C A G  +AV F+ALYLVALGTGGIKPCVSS+GADQFDDTDE ++K KS
Sbjct  121   GIKPTCESKDSCHANGAQSAVFFVALYLVALGTGGIKPCVSSFGADQFDDTDEADKKRKS  180

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GAL+A+S++VW+Q +V W WGFG+PAV M +AV  FF GTRLYR QKP
Sbjct  181   SFFNWFYFSINIGALIASSVLVWVQTNVGWQWGFGIPAVTMLVAVVSFFCGTRLYRNQKP  240

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETV-GLESNIQGSRKLSHTNELRFFDKAA  1111
             GGSP TR+ QVVVAS RK K++VP D  LL+ET    ES I+GSRKL HT +L FFDKAA
Sbjct  241   GGSPLTRICQVVVASFRKYKIEVPEDGKLLYETADDTESAIKGSRKLEHTGDLSFFDKAA  300

Query  1112  VVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAE  1291
             VV    DE K  S  PWRLCTVTQVEELK+++RLLPIWATGI+F+TVYGQMGT F+ Q  
Sbjct  301   VVAHG-DEVKSPSNDPWRLCTVTQVEELKAVVRLLPIWATGIVFATVYGQMGTLFVLQGA  359

Query  1292  GMNTYVGT--FKXPXASLGV  1345
              M+  +G   F  P ASL +
Sbjct  360   TMDARMGNSGFTIPAASLTI  379



>ref|XP_010654192.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Vitis vinifera]
 emb|CAN72572.1| hypothetical protein VITISV_034788 [Vitis vinifera]
Length=568

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/378 (67%), Positives = 305/378 (81%), Gaps = 4/378 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M EDD+YTKDGT++  N+PANKKKTG WKAC FILGNEC ERLAYYGMS+NL+ Y Q RL
Sbjct  1     MAEDDMYTKDGTMNIHNKPANKKKTGQWKACRFILGNECCERLAYYGMSTNLVNYLQIRL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             NQ   +AS N++NWSGTCYI PL+GAFLADAY GR+W IA FSIIY  GM L+T++A++ 
Sbjct  61    NQGNVTASNNVTNWSGTCYITPLIGAFLADAYFGRFWIIAIFSIIYFCGMVLLTMTASIK  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+ P+C   + C  T   +AVCFIALYL+ALGTGGIKPCVSS+GADQFD  DE E+K KS
Sbjct  121   GLRPSC-DDNGCDPTKLQSAVCFIALYLIALGTGGIKPCVSSFGADQFDVNDEAEKKKKS  179

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFY SINVGAL+A+S++VWIQ +V WGWGFG+PAVAMA+AV  FFSG+R+YR QKP
Sbjct  180   SFFNWFYLSINVGALIASSVLVWIQMNVGWGWGFGIPAVAMAIAVVSFFSGSRMYRLQKP  239

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QV+VAS RK  VKVP++KSLL+ET   ESNI+GS KL HT +LRFFDKAAV
Sbjct  240   GGSPLTRICQVLVASTRKYHVKVPNNKSLLYETKDAESNIKGSCKLEHTEKLRFFDKAAV  299

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               ES  +  K S +PW+LCTVTQVEELKSI+RLLP+WATGI+FSTVY QM T F+ Q   
Sbjct  300   EVES--DHVKSSNNPWKLCTVTQVEELKSILRLLPVWATGILFSTVYSQMSTMFVLQGNT  357

Query  1295  MNTYVG-TFKXPXASLGV  1345
             M+ ++G  FK P ASL +
Sbjct  358   MDQHMGPNFKIPSASLSL  375



>ref|XP_003529142.1| PREDICTED: peptide transporter PTR1-like isoformX1 [Glycine max]
 ref|XP_006583629.1| PREDICTED: peptide transporter PTR1-like isoform X2 [Glycine 
max]
 gb|KHN22722.1| Peptide transporter PTR1 [Glycine soja]
Length=568

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/378 (67%), Positives = 306/378 (81%), Gaps = 4/378 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M EDD+YT+DGT+    +PANKKKTGNWKAC FILGNECSERLAYYGMS+NL+ Y + R 
Sbjct  1     MAEDDIYTQDGTITISKKPANKKKTGNWKACYFILGNECSERLAYYGMSTNLVNYLRERF  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             NQ   +A+ N++ WSGTCYI PL+GAFLAD+YLGRYWTI++FSI+YV+GM L+TLSA+ P
Sbjct  61    NQGNATAANNVTTWSGTCYITPLIGAFLADSYLGRYWTISSFSIVYVIGMILLTLSASAP  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+ P+C A + C  T   TA CFIALYL+ALGTGGIKPCVS++GADQFDD+DEKE+  KS
Sbjct  121   GLKPSCDA-NGCHPTSAQTATCFIALYLIALGTGGIKPCVSAFGADQFDDSDEKEKIKKS  179

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GALVA+S++VWIQ +V WGWGFGVPAVAM +A+ FFF G+RLYR Q P
Sbjct  180   SFFNWFYFSINIGALVASSVLVWIQMNVGWGWGFGVPAVAMVIAIIFFFGGSRLYRLQIP  239

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QV+VA+LRK  ++VP+DKSLLHET+ LES I+GSRKL HTN  +  DKAAV
Sbjct  240   GGSPLTRICQVIVAALRKIGLQVPNDKSLLHETIDLESVIKGSRKLDHTNRFKCLDKAAV  299

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               ES D  K  S +PWRLCTVTQVEELKS+I LLP+WA+ I F+TVYGQM T F+ Q   
Sbjct  300   ETES-DHTKDLS-NPWRLCTVTQVEELKSVISLLPVWASLIAFATVYGQMSTMFVLQGNT  357

Query  1295  MNTYVGT-FKXPXASLGV  1345
             M+  +G  FK P ASL +
Sbjct  358   MDQRIGPHFKIPSASLTI  375



>ref|XP_010923125.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Elaeis guineensis]
 ref|XP_010923126.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Elaeis guineensis]
 ref|XP_010923127.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Elaeis guineensis]
 ref|XP_010923129.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Elaeis guineensis]
 ref|XP_010923130.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Elaeis guineensis]
Length=574

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/375 (67%), Positives = 303/375 (81%), Gaps = 4/375 (1%)
 Frame = +2

Query  224   DDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQS  403
             +D YTKDGT D R  PA KK TGNW+ACP+IL NEC ERLAYYGMS+NL+ Y + RLNQ 
Sbjct  6     EDKYTKDGTTDLRGNPAVKKDTGNWRACPYILANECCERLAYYGMSTNLVNYMKERLNQG  65

Query  404   TTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPGIS  583
              T+AS N++NWSGTCYIMPL+GAFLADAYLGRYWTIA+F ++Y+ G+TL+T++A+V G+ 
Sbjct  66    NTTASNNVTNWSGTCYIMPLLGAFLADAYLGRYWTIASFMMVYISGLTLLTMTASVKGLK  125

Query  584   PTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSFF  763
             P+C  HD C  T   TAV F+ALYL+ALGTGGIKPCVSS+GADQFD++DE E+K KSSFF
Sbjct  126   PSC-DHDVCDPTNSQTAVVFVALYLIALGTGGIKPCVSSFGADQFDESDESEKKRKSSFF  184

Query  764   NWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKPGGS  943
             NWFYFSIN+GALVA+S++VWIQ +V WGWGFG+PAV MA+AV  FF GT LYR+QKPGGS
Sbjct  185   NWFYFSINIGALVASSVLVWIQDNVGWGWGFGIPAVVMAIAVASFFVGTALYRHQKPGGS  244

Query  944   PFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAVVEE  1123
             P TR+ QVVVAS RK  VKVP+DKSLL+E    ES IQGSRKL HT + +F DKAAV  +
Sbjct  245   PLTRIAQVVVASFRKSGVKVPADKSLLYEISEKESVIQGSRKLEHTEKFKFLDKAAVATQ  304

Query  1124  SLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEGMNT  1303
               D+  K  V PWRLCTVTQVEELKS++R+LPIWA+GIIFSTVY QM T F+ Q + ++ 
Sbjct  305   --DDKMKDPVDPWRLCTVTQVEELKSVVRILPIWASGIIFSTVYSQMSTMFVLQGDTLDP  362

Query  1304  YVGT-FKXPXASLGV  1345
             ++G  FK P ASL +
Sbjct  363   HMGPHFKIPPASLSI  377



>ref|XP_008464060.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Cucumis melo]
Length=570

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/377 (68%), Positives = 316/377 (84%), Gaps = 3/377 (1%)
 Frame = +2

Query  218   EEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  397
             EED +YT+DGT++YR  PA + +TG W+ACP+ILGNE  ERLAYYGMSSNL++YF+  LN
Sbjct  3     EEDSIYTQDGTVNYRGDPAVRTQTGTWRACPYILGNEFCERLAYYGMSSNLVLYFKHHLN  62

Query  398   QSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPG  577
             Q + +ASKN++NWSGTCYI PL+GAFLADAYLGRY TIA FSI+YV GMTL+TLSA+VPG
Sbjct  63    QDSATASKNVNNWSGTCYITPLIGAFLADAYLGRYRTIAAFSIVYVFGMTLLTLSASVPG  122

Query  578   ISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSS  757
             + PTC++ D C AT   +A+CF+ALYL+ALGTGGIKPCVSSYGADQFDD +E E+KHKSS
Sbjct  123   LKPTCVSKDDCHATTAQSALCFLALYLIALGTGGIKPCVSSYGADQFDDANETEKKHKSS  182

Query  758   FFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKPG  937
             FFNWFY SIN+GAL+A+S++VW+Q++VSWGWGFG+PA+AMA+A+  FFSGTRLYR QKPG
Sbjct  183   FFNWFYLSINIGALIASSVLVWVQENVSWGWGFGIPAIAMAIAIVSFFSGTRLYRNQKPG  242

Query  938   GSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAVV  1117
             GSPFTR+ QVVVA+ RK  VKVP  K+ L+ET   ES+I GSRKL HT++ RFFDKAAV 
Sbjct  243   GSPFTRICQVVVATFRKYNVKVPESKA-LYETADSESSIVGSRKLDHTDDFRFFDKAAVE  301

Query  1118  EESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEGM  1297
              ES D+  KGSV PW+LCTVTQVEELK+IIRLLP+WATGI F+ VY QM + F+ Q + M
Sbjct  302   LES-DQMLKGSVDPWKLCTVTQVEELKAIIRLLPVWATGITFAAVYSQMSSLFVLQGDRM  360

Query  1298  NTYVG-TFKXPXASLGV  1345
             + ++G TF+ P ASL +
Sbjct  361   DPHIGPTFEIPAASLSI  377



>ref|XP_008442465.1| PREDICTED: LOW QUALITY PROTEIN: protein NRT1/ PTR FAMILY 8.1 
[Cucumis melo]
Length=569

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/379 (66%), Positives = 305/379 (80%), Gaps = 5/379 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M EDD+YTKDGT+D   +PA K KTGNWKAC FILGNEC ERLAYYGMS+NL+ Y Q RL
Sbjct  1     MAEDDIYTKDGTVDIHKKPAVKXKTGNWKACRFILGNECCERLAYYGMSTNLVNYLQIRL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             N    +AS  +++WSGTCY+ PL+GAFLADAYLGR+WTIA+FSIIYV GMTL+TL+A++P
Sbjct  61    NMDNVAASNTVTSWSGTCYLTPLIGAFLADAYLGRFWTIASFSIIYVFGMTLLTLAASIP  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+ P+C +   C  +G  TA  FIALYL+ALGTGGIKPCVSS+GADQFD+ DE ERK KS
Sbjct  121   GLKPSCDS-SGCHPSGGQTAATFIALYLIALGTGGIKPCVSSFGADQFDENDEAERKKKS  179

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSINVGA++A+S++VWIQ +V WGWGFGVPAVAMA+AV FFFSG+ LYR QKP
Sbjct  180   SFFNWFYFSINVGAMIASSVLVWIQMNVGWGWGFGVPAVAMAIAVVFFFSGSSLYRLQKP  239

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETV-GLESNIQGSRKLSHTNELRFFDKAA  1111
              GSP TR+ QV+VA+ RK +V+VP DKSLLHET   +ES I+GSRKL HTN  +F DKA 
Sbjct  240   AGSPLTRILQVIVAACRKHRVQVPEDKSLLHETADDIESKIEGSRKLEHTNNFKFLDKAC  299

Query  1112  VVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAE  1291
             V  E+ ++  KG  + WRLCTVTQVEELKSI+RLLP+WA+GI+F+ VY QM T F+ Q  
Sbjct  300   V--ETENDRIKGLQNEWRLCTVTQVEELKSIVRLLPVWASGIVFAAVYSQMSTMFVLQGN  357

Query  1292  GMNTYVG-TFKXPXASLGV  1345
              ++ ++G +FK P ASL +
Sbjct  358   TLDQHIGPSFKIPSASLSI  376



>ref|XP_010504206.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Camelina sativa]
Length=570

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/378 (66%), Positives = 301/378 (80%), Gaps = 2/378 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M+E DVYT+DGT+D    PANK+KTGNWKAC FILGNEC ERLAYYGM +NL+ Y ++RL
Sbjct  1     MDEKDVYTEDGTVDIHKNPANKEKTGNWKACRFILGNECCERLAYYGMGTNLVNYLESRL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             NQ   +A+ N++NWSGTCYI PL+GAFLADAYLGRYWTIA F  IYV GMTL+TLSA+VP
Sbjct  61    NQGNATAANNVTNWSGTCYITPLIGAFLADAYLGRYWTIAIFVFIYVSGMTLLTLSASVP  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+ P     + C      TAV F+ALY++ALGTGGIKPCVSS+GADQFD+ DE E+  KS
Sbjct  121   GLKPGNCDGNTCHPNSGQTAVFFVALYMIALGTGGIKPCVSSFGADQFDENDEAEKVKKS  180

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSINVGAL+AA+++VWIQ +V WGWGFGVP VAM +AV FFF G+R YR Q+P
Sbjct  181   SFFNWFYFSINVGALIAATVLVWIQMNVGWGWGFGVPTVAMVIAVGFFFLGSRFYRLQRP  240

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+FQV+VA+ RK +VKVP DKSLL ET   ESNI+GSRKL HT+ L FFDKAAV
Sbjct  241   GGSPLTRIFQVIVAAFRKMRVKVPEDKSLLFETADDESNIKGSRKLVHTDNLNFFDKAAV  300

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               +S D  K G V+PWRLC+VTQVEELKSII LLP+WA+GI+F+TVY QM T F+ Q   
Sbjct  301   ESQS-DSIKGGEVNPWRLCSVTQVEELKSIITLLPVWASGIVFATVYSQMNTMFVLQGNT  359

Query  1295  MNTYVG-TFKXPXASLGV  1345
             ++ ++G  F+ P ASL +
Sbjct  360   LDQHMGPNFEIPSASLSL  377



>ref|XP_010427083.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1 [Camelina sativa]
Length=570

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/378 (66%), Positives = 301/378 (80%), Gaps = 2/378 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M+E DVYT+DGT+D    PANK+KTGNWKAC FILGNEC ERLAYYGM +NL+ Y ++RL
Sbjct  1     MDEKDVYTEDGTVDIHKNPANKEKTGNWKACRFILGNECCERLAYYGMGTNLVNYLESRL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             NQ   +A+ N++NWSGTCYI PL+GAFLADAYLGRYWTIA F  IYV GMTL+TLSA+VP
Sbjct  61    NQGNATAANNVTNWSGTCYITPLIGAFLADAYLGRYWTIAIFVFIYVSGMTLLTLSASVP  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+ P     + C      TAV F+ALY++ALGTGGIKPCVSS+GADQFD+ DE E+  KS
Sbjct  121   GLKPGNCDGNTCHPNSGQTAVFFVALYMIALGTGGIKPCVSSFGADQFDENDEAEKVKKS  180

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSINVGAL+AA+++VWIQ +V WGWGFGVP VAM +AV FFF G+R YR Q+P
Sbjct  181   SFFNWFYFSINVGALIAATVLVWIQMNVGWGWGFGVPTVAMVIAVCFFFLGSRFYRLQRP  240

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+FQV+VA+ RK +VKVP DKSLL ET   ESNI+GSRKL HT+ L FFDKAAV
Sbjct  241   GGSPLTRIFQVIVAAFRKIRVKVPEDKSLLFETADDESNIKGSRKLVHTDNLNFFDKAAV  300

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               +S D  K G V+PWRLC+VTQVEELKSII LLP+WA+GI+F+TVY QM T F+ Q   
Sbjct  301   ESQS-DSIKDGEVNPWRLCSVTQVEELKSIITLLPVWASGIVFATVYSQMNTMFVLQGNT  359

Query  1295  MNTYVG-TFKXPXASLGV  1345
             ++ ++G  F+ P ASL +
Sbjct  360   LDQHMGPNFEIPSASLSL  377



>gb|KHG14016.1| Peptide transporter PTR1 -like protein [Gossypium arboreum]
Length=552

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/379 (68%), Positives = 297/379 (78%), Gaps = 22/379 (6%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M E D YTKDGT+D++  PAN KKTG WKACPFI+GNEC ERLAYYGMSSNL+ YF+ RL
Sbjct  1     MAESDFYTKDGTVDHKGNPANIKKTGTWKACPFIIGNECCERLAYYGMSSNLVRYFKHRL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             NQ  + A++N  NWSGTCYI PL+GAFLADAYLGRYWTIA FSIIYV GMTL+ +SATV 
Sbjct  61    NQHASVATRNNQNWSGTCYITPLIGAFLADAYLGRYWTIALFSIIYVFGMTLLAMSATVH  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             GI P C   D C  T   +AV F+ALYLVALGTGGIKPCVSSYGADQFDDTDE E+KHKS
Sbjct  121   GIKPRCYTEDNCDPTVTQSAVFFVALYLVALGTGGIKPCVSSYGADQFDDTDETEKKHKS  180

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GAL+A+S++VW+Q +VSWGW                  GTRLYR QKP
Sbjct  181   SFFNWFYFSINIGALIASSVLVWVQDNVSWGW------------------GTRLYRNQKP  222

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TRL QVVVAS RK +V +P+DKSLL+ET   ESNI+GSRK+ HT +L FFD+AAV
Sbjct  223   GGSPLTRLCQVVVASFRKCRVAIPADKSLLYETTDAESNIKGSRKVEHTEDLSFFDRAAV  282

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               ES  ++KKG+V+ WRLCTVTQVEELK++IRLLPIWATGIIF+ VY QM   F+ Q E 
Sbjct  283   ETES--DEKKGTVNSWRLCTVTQVEELKAVIRLLPIWATGIIFAAVYSQMSNLFVLQGER  340

Query  1295  MNTYVG--TFKXPXASLGV  1345
             MNT+VG  TFK P ASL +
Sbjct  341   MNTHVGNSTFKIPPASLSI  359



>ref|XP_010515930.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Camelina sativa]
 ref|XP_010515931.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Camelina sativa]
Length=570

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/378 (66%), Positives = 301/378 (80%), Gaps = 2/378 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M+E DVYT+DGT+D    PANK+KTGNWKAC FILGNEC ERLAYYGM +NL+ Y ++RL
Sbjct  1     MDEKDVYTEDGTVDIHKNPANKEKTGNWKACRFILGNECCERLAYYGMGTNLVNYLESRL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             NQ   +A+ N++NWSGTCYI PL+GAFLADAYLGRYWTIA F  IYV GMTL+TLSA+VP
Sbjct  61    NQGNATAANNVTNWSGTCYITPLIGAFLADAYLGRYWTIAIFVFIYVSGMTLLTLSASVP  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+ P     + C      TAV F+ALY++ALGTGGIKPCVSS+GADQFD+ DE E+  KS
Sbjct  121   GLKPGNCDGNTCHPNSGQTAVFFVALYMIALGTGGIKPCVSSFGADQFDENDEAEKVKKS  180

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSINVGAL+AA+++VWIQ +V WGWGFGVP VAM +AV FFF G+R YR Q+P
Sbjct  181   SFFNWFYFSINVGALIAATVLVWIQMNVGWGWGFGVPTVAMLIAVFFFFLGSRFYRLQRP  240

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+FQV+VA+ RK +VKVP DKSLL ET   ESNI+GSRKL HT+ L FFDKAAV
Sbjct  241   GGSPLTRIFQVIVAAFRKMRVKVPDDKSLLFETADDESNIKGSRKLVHTDNLNFFDKAAV  300

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               +S D  K G V+PWRLC+VTQVEELKS+I LLP+WA+GI+F+TVY QM T F+ Q   
Sbjct  301   ESQS-DSIKDGEVNPWRLCSVTQVEELKSVITLLPVWASGIVFATVYSQMNTMFVLQGNT  359

Query  1295  MNTYVG-TFKXPXASLGV  1345
             ++ ++G  F+ P ASL +
Sbjct  360   LDQHMGPNFEIPSASLSL  377



>ref|XP_004137914.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2 [Cucumis sativus]
 gb|KGN58792.1| hypothetical protein Csa_3G732500 [Cucumis sativus]
Length=569

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/379 (65%), Positives = 306/379 (81%), Gaps = 5/379 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M EDD+YTKDGT+D   +PA KKKTGNWKAC FILGNEC ERLAYYGMS+NL+ Y Q RL
Sbjct  1     MAEDDIYTKDGTVDVHKKPAIKKKTGNWKACRFILGNECCERLAYYGMSTNLVNYLQIRL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             N    +AS ++++WSGTCY+ PL+GAFLADAYLGR+WTIA+FSIIY  GMTL+T++A++P
Sbjct  61    NMDNVTASNSVTSWSGTCYLTPLIGAFLADAYLGRFWTIASFSIIYAFGMTLLTMAASIP  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+ P+C +   C  +G  TA  F+ALYL+ALGTGGIKPCVSS+GADQFD+ DE ERK KS
Sbjct  121   GLKPSCDS-SGCHPSGGQTAATFVALYLIALGTGGIKPCVSSFGADQFDENDEVERKKKS  179

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSINVGA++A+S++VWIQ +V WGWGFGVPAVAMA+AV FFFSG+ LYR QKP
Sbjct  180   SFFNWFYFSINVGAMIASSVLVWIQMNVGWGWGFGVPAVAMAIAVVFFFSGSSLYRLQKP  239

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETV-GLESNIQGSRKLSHTNELRFFDKAA  1111
              GSP TR+ QV+VA+ RK +V VP DKSLLHET   +ES I+GSRKL HTN  +F DKA+
Sbjct  240   AGSPLTRILQVIVAACRKHQVHVPEDKSLLHETADDIESKIEGSRKLEHTNNFKFLDKAS  299

Query  1112  VVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAE  1291
             V  E+ ++  KG  + WRLCTVTQVEELKSI+RLLP+WA+GI+F+ VY QM T F+ Q  
Sbjct  300   V--ETENDRIKGLPNEWRLCTVTQVEELKSIVRLLPVWASGIVFAAVYSQMSTMFVLQGN  357

Query  1292  GMNTYVG-TFKXPXASLGV  1345
              ++ ++G +FK P ASL +
Sbjct  358   TLDQHIGPSFKIPSASLSI  376



>ref|XP_006287367.1| hypothetical protein CARUB_v10000567mg [Capsella rubella]
 gb|EOA20265.1| hypothetical protein CARUB_v10000567mg [Capsella rubella]
Length=577

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/384 (65%), Positives = 310/384 (81%), Gaps = 5/384 (1%)
 Frame = +2

Query  200   EQSKAMEED-DVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMI  376
             E++   EED D+YT+DGTLD   +PANKKKTG WKAC FILG EC ERLAYYGMS+NL+ 
Sbjct  4     EKTTMGEEDMDIYTQDGTLDIYKKPANKKKTGTWKACRFILGTECCERLAYYGMSTNLVN  63

Query  377   YFQTRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMT  556
             Y + ++N    +A+ ++SNWSGTCY  PL+GAF+ADAYLGRYWTI+TF +IY+ GMTL+T
Sbjct  64    YLEKQMNMENVTATTSVSNWSGTCYATPLIGAFIADAYLGRYWTISTFVVIYIAGMTLLT  123

Query  557   LSATVPGISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEK  736
             +SA+VPG++PTC   DKC AT   TA+ FIALYL+ALGTGGIKPCVSS+GADQFDDTDE+
Sbjct  124   MSASVPGLTPTC-NGDKCHATSAQTALTFIALYLIALGTGGIKPCVSSFGADQFDDTDEE  182

Query  737   ERKHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRL  916
             E++ KSSFFNWFYF INVGA++A+S++VWIQ +V WGWG G+P VAMA+AV FFF+G++ 
Sbjct  183   EKESKSSFFNWFYFVINVGAMIASSVLVWIQMNVGWGWGLGIPTVAMAIAVVFFFAGSKF  242

Query  917   YRYQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRF  1096
             YR QKPGGSP TR+ QV+VAS RK KV+VP D+SLL+E    ES+I+GSRKL HT  L F
Sbjct  243   YRLQKPGGSPLTRMLQVIVASCRKSKVRVPEDESLLYENQDAESSIRGSRKLEHTKILTF  302

Query  1097  FDKAAVVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQF  1276
             FDKAAV  ES  ++K  + S W+LCTVTQVEELK++IRLLPIWATGI+F+ VY QMGT F
Sbjct  303   FDKAAVETES--DNKAAATSSWKLCTVTQVEELKALIRLLPIWATGIVFAAVYSQMGTVF  360

Query  1277  ISQAEGMNTYVG-TFKXPXASLGV  1345
             + Q   M+ ++G  FK P ASL +
Sbjct  361   VLQGNTMDQHMGPNFKIPSASLSL  384



>ref|XP_007140383.1| hypothetical protein PHAVU_008G107200g [Phaseolus vulgaris]
 ref|XP_007140384.1| hypothetical protein PHAVU_008G107200g [Phaseolus vulgaris]
 ref|XP_007140385.1| hypothetical protein PHAVU_008G107200g [Phaseolus vulgaris]
 gb|ESW12377.1| hypothetical protein PHAVU_008G107200g [Phaseolus vulgaris]
 gb|ESW12378.1| hypothetical protein PHAVU_008G107200g [Phaseolus vulgaris]
 gb|ESW12379.1| hypothetical protein PHAVU_008G107200g [Phaseolus vulgaris]
Length=566

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/378 (67%), Positives = 302/378 (80%), Gaps = 4/378 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M EDD+YT+DGT+    +PANKKKTGNWKAC FILGNEC ERLAYYGMS+NL+ Y Q R 
Sbjct  1     MAEDDIYTQDGTITISKKPANKKKTGNWKACYFILGNECCERLAYYGMSTNLVNYLQERF  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             NQ   +A+ N++ WSGTCY+ PL+GAFLAD+YLGRYWTIA+FS+IYV+GM L+TLSA+ P
Sbjct  61    NQGNVTAANNVTTWSGTCYLTPLIGAFLADSYLGRYWTIASFSVIYVIGMILLTLSASAP  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             GI P+C A + C  T   T+ CFIALYLVALGTGGIKPCVS++GADQFDD+D+KE   KS
Sbjct  121   GIKPSCDA-NGCHPTSAQTSACFIALYLVALGTGGIKPCVSAFGADQFDDSDKKETIRKS  179

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GALVA+S++VWIQ +V WGWGFGVPAVAM +A+ FFF G+RLYR Q P
Sbjct  180   SFFNWFYFSINIGALVASSVLVWIQINVGWGWGFGVPAVAMVIAIIFFFGGSRLYRLQIP  239

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QV+VA LRK  ++VP DKSLLHETV +ES I+GSRKL HTN  +  DKAAV
Sbjct  240   GGSPLTRICQVIVAVLRKISLQVPDDKSLLHETVDVESVIKGSRKLDHTNRFKCLDKAAV  299

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               E+  +      +PWRLCTVTQVEE+KSII LLP+WA+ I FSTVYGQMGT F+ Q   
Sbjct  300   --ETQSDHTTRLPNPWRLCTVTQVEEVKSIISLLPVWASLIAFSTVYGQMGTMFVLQGNT  357

Query  1295  MNTYVGT-FKXPXASLGV  1345
             M+ +VG  FK P ASL +
Sbjct  358   MDQHVGPHFKIPSASLTI  375



>ref|XP_010558361.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like [Tarenaya hassleriana]
Length=570

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/378 (65%), Positives = 303/378 (80%), Gaps = 2/378 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M E+D+YT+DGT+D R RPANKK+TGNWKAC FILGNEC ERLAYYGM +NL+ Y +  L
Sbjct  1     MTEEDIYTQDGTVDIRKRPANKKETGNWKACRFILGNECCERLAYYGMGTNLVNYLEKNL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             NQ   +A+ +++NWSGTCY  PL+GAFLADAYLGRYWTIA+F IIYV GMTL+TLSA+VP
Sbjct  61    NQGNVAAANSVTNWSGTCYATPLLGAFLADAYLGRYWTIASFVIIYVFGMTLLTLSASVP  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+ P+C   D C  T   T V FIALY++ALGTGGIKPCVSS+GADQFD++D+ E+K KS
Sbjct  121   GLKPSC-QGDVCNPTTGQTVVFFIALYMIALGTGGIKPCVSSFGADQFDESDDAEKKRKS  179

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSINVGA++A+S++VWIQ +V WGWGFGVP VAM +AV FFF+G++ YR QKP
Sbjct  180   SFFNWFYFSINVGAMIASSVLVWIQMNVGWGWGFGVPTVAMVIAVMFFFAGSKYYRLQKP  239

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QV+VA+ +K KVKVP DKSLL+E    ES I+GSRKL HT++L FFDKAAV
Sbjct  240   GGSPITRILQVIVAAFKKSKVKVPDDKSLLYEVEDAESTIKGSRKLEHTDKLTFFDKAAV  299

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               ES +       +PWRLCTVTQVEELK++IRLLP+WA+GI+F+TVY QM T F+ Q   
Sbjct  300   YSESDNPKTSSPPNPWRLCTVTQVEELKALIRLLPVWASGIVFATVYSQMSTMFVLQGNT  359

Query  1295  MNTYVGT-FKXPXASLGV  1345
             M+ ++G  F  P ASL +
Sbjct  360   MDQHMGPHFTIPSASLSL  377



>ref|XP_008388132.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like [Malus domestica]
Length=568

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/378 (67%), Positives = 300/378 (79%), Gaps = 4/378 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M  DD YT DGTLD   +PANKKKTGNWKAC FILGNEC ERLAYYGMS+NL+ Y + RL
Sbjct  1     MVGDDFYTNDGTLDIHKKPANKKKTGNWKACRFILGNECCERLAYYGMSTNLVNYLEKRL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
                  +A+ ++SNWSGTCY  PL+GAFLADAYLGRYWTIA FSI+YV+GMTL+TL+A++ 
Sbjct  61    GMGNVTAATSVSNWSGTCYATPLIGAFLADAYLGRYWTIAIFSIVYVLGMTLLTLTASIN  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+ P C +   C +T    A CF+ALYL+A+GTGGIKPCVSS+GADQFD+TDE ERK KS
Sbjct  121   GLKPHCDS-SGCNSTSSQRATCFVALYLIAVGTGGIKPCVSSFGADQFDETDETERKKKS  179

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFY SINVGAL+A++++VW+Q +V W WGFGVPAVAM +AV FFF G++LYR QKP
Sbjct  180   SFFNWFYMSINVGALIASTVLVWMQMNVGWNWGFGVPAVAMGIAVVFFFLGSKLYRLQKP  239

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QVV AS+RK KVKVP+DKSLL+ET   E NIQGSRKL HTN L FFDKAAV
Sbjct  240   GGSPLTRIAQVVAASIRKXKVKVPADKSLLYETADEECNIQGSRKLEHTNXLGFFDKAAV  299

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               ES     K   SPW LCTVTQVEELKSIIRLLPIWA+GI+F+TVYGQM T F+ Q   
Sbjct  300   --ESETNRAKELPSPWSLCTVTQVEELKSIIRLLPIWASGIVFATVYGQMSTMFVLQGNT  357

Query  1295  MNTYVG-TFKXPXASLGV  1345
             ++ ++G  FK P ASL +
Sbjct  358   LDQHMGPNFKIPSASLSL  375



>ref|NP_195738.1| peptide transporter PTR5 [Arabidopsis thaliana]
 sp|Q9LFB8.1|PTR5_ARATH RecName: Full=Protein NRT1/ PTR FAMILY 8.2; Short=AtNPF8.2; AltName: 
Full=Peptide transporter PTR5 [Arabidopsis thaliana]
 emb|CAB69846.1| oligopeptide transporter-like protein [Arabidopsis thaliana]
 gb|AED90307.1| peptide transporter PTR5 [Arabidopsis thaliana]
Length=570

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/381 (66%), Positives = 307/381 (81%), Gaps = 8/381 (2%)
 Frame = +2

Query  215   MEED-DVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTR  391
             ME+D D+YTKDGTLD   +PANK KTG WKAC FILG EC ERLAYYGMS+NL+ Y + +
Sbjct  1     MEDDKDIYTKDGTLDIHKKPANKNKTGTWKACRFILGTECCERLAYYGMSTNLINYLEKQ  60

Query  392   LNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATV  571
             +N    SASK++SNWSGTCY  PL+GAF+ADAYLGRYWTIA+F +IY+ GMTL+T+SA+V
Sbjct  61    MNMENVSASKSVSNWSGTCYATPLIGAFIADAYLGRYWTIASFVVIYIAGMTLLTISASV  120

Query  572   PGISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHK  751
             PG++PTC + + C AT   TA+ FIALYL+ALGTGGIKPCVSS+GADQFDDTDEKE++ K
Sbjct  121   PGLTPTC-SGETCHATAGQTAITFIALYLIALGTGGIKPCVSSFGADQFDDTDEKEKESK  179

Query  752   SSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQK  931
             SSFFNWFYF INVGA++A+S++VWIQ +V WGWG GVP VAMA+AV FFF+G+  YR QK
Sbjct  180   SSFFNWFYFVINVGAMIASSVLVWIQMNVGWGWGLGVPTVAMAIAVVFFFAGSNFYRLQK  239

Query  932   PGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAA  1111
             PGGSP TR+ QV+VAS RK KVK+P D+SLL+E    ES+I GSRKL HT  L FFDKAA
Sbjct  240   PGGSPLTRMLQVIVASCRKSKVKIPEDESLLYENQDAESSIIGSRKLEHTKILTFFDKAA  299

Query  1112  VVEESLDEDKKGSV--SPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQ  1285
             V  ES   D KG+   S W+LCTVTQVEELK++IRLLPIWATGI+F++VY QMGT F+ Q
Sbjct  300   VETES---DNKGAAKSSSWKLCTVTQVEELKALIRLLPIWATGIVFASVYSQMGTVFVLQ  356

Query  1286  AEGMNTYVG-TFKXPXASLGV  1345
                ++ ++G  FK P ASL +
Sbjct  357   GNTLDQHMGPNFKIPSASLSL  377



>ref|XP_011090404.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Sesamum indicum]
Length=568

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/381 (66%), Positives = 301/381 (79%), Gaps = 4/381 (1%)
 Frame = +2

Query  209   KAMEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQT  388
             + M  +D YTKDGT D+RN PANK KTG WKA PFILGN+C ERLA+YGMSSNL++Y+ T
Sbjct  2     EVMGNEDKYTKDGTSDFRNNPANKNKTGAWKASPFILGNQCCERLAFYGMSSNLLLYYTT  61

Query  389   RLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSAT  568
             +LNQ + +ASKNLSNW GTCY++PL GAFLADAYLGRYWTIA FS+IYV+GMTL+TLSA+
Sbjct  62    QLNQHSATASKNLSNWLGTCYVLPLFGAFLADAYLGRYWTIAGFSVIYVLGMTLLTLSAS  121

Query  569   VPGISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKH  748
             VPG+ P C    +C  T   TAV  +ALYLVALG+GG+KPCVSSYGADQFDD DE E+  
Sbjct  122   VPGLRPRCYKKVECYETDSQTAVFSLALYLVALGSGGMKPCVSSYGADQFDDGDEVEKGQ  181

Query  749   KSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQ  928
             KSSFFNWFYFS N+G L+  S+ V IQ ++ WGWGFGV AVAMA+AV FF SG+R+YRYQ
Sbjct  182   KSSFFNWFYFSTNIGVLIGCSIPVLIQVNIGWGWGFGVSAVAMAIAVAFFISGSRVYRYQ  241

Query  929   KPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKA  1108
              PGG+P TRL QV+VASLRK +V+VP DKS+L+ET   ES I GSRKL HTN+ RF DKA
Sbjct  242   NPGGNPLTRLCQVLVASLRKYRVEVPGDKSILYETADAESAIVGSRKLDHTNQFRFLDKA  301

Query  1109  AVVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQA  1288
             AV  E   +   GSV+PWRLCTV+QVEELK IIRLLP+ ATGIIF+TV+GQM   F+ QA
Sbjct  302   AV--EKASDHSNGSVNPWRLCTVSQVEELKWIIRLLPVLATGIIFNTVFGQMSNLFLLQA  359

Query  1289  EGMNTYVG--TFKXPXASLGV  1345
             E M+  +G   FK P ASL +
Sbjct  360   EYMDARLGLSNFKIPIASLAI  380



>gb|KEH23143.1| proton-dependent oligopeptide transport family protein [Medicago 
truncatula]
Length=568

 Score =   530 bits (1364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/378 (66%), Positives = 304/378 (80%), Gaps = 4/378 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M E+D+YT+DGT+D   +PANKKKTGNWKAC FILGNEC ERLAYYGMS+NL+ Y   R 
Sbjct  1     MAEEDIYTQDGTIDIYRKPANKKKTGNWKACWFILGNECCERLAYYGMSTNLVNYLGERF  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             NQ   +A+K+++ WSGTCYI PL+GAFLAD+YLGRYWTIA+FS+IYV+GM L+TLSATVP
Sbjct  61    NQGNAAAAKSVTTWSGTCYITPLLGAFLADSYLGRYWTIASFSVIYVIGMVLLTLSATVP  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+ P+C   + C  T   TA  +IALYL+ALGTGGIKPCVSS+GADQFD+TDEKERK KS
Sbjct  121   GLKPSCDG-NVCHPTSAQTAAMYIALYLIALGTGGIKPCVSSFGADQFDETDEKERKKKS  179

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GAL+A+S++VWIQ +V WGWGFGVPAVAM LAV FFF G+ LYR Q P
Sbjct  180   SFFNWFYFSINIGALIASSVLVWIQMNVGWGWGFGVPAVAMVLAVIFFFGGSVLYRLQIP  239

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QV+VA+ RK +++VP DK+LLHET+ +ES I+GSRKL HTN LR  DKAA+
Sbjct  240   GGSPLTRICQVLVAACRKLRLQVPEDKNLLHETIDVESVIKGSRKLDHTNNLRCLDKAAI  299

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               E+  +  K   +PWRLCTVTQVEELKSII LLP+WAT I F+TVY QM T F+ Q   
Sbjct  300   --ETQTDRTKELTNPWRLCTVTQVEELKSIINLLPVWATLIAFATVYSQMNTMFVLQGNT  357

Query  1295  MNTYVGT-FKXPXASLGV  1345
             M+ ++G  F+ P ASL +
Sbjct  358   MDQHIGPHFQIPSASLSL  375



>ref|XP_009774291.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Nicotiana sylvestris]
Length=569

 Score =   530 bits (1364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/378 (67%), Positives = 309/378 (82%), Gaps = 3/378 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M EDD Y KDGT+DYRN PA KK+TG W+ACP+ILGNEC ERLAYYG+++NL+ Y + ++
Sbjct  1     MAEDDKYVKDGTVDYRNNPAIKKETGTWRACPYILGNECCERLAYYGINTNLVNYLKFQM  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             N+S+  A  N++NWSGTCY+ PL+GAFLADAYLGRYWTIA FSIIYV GMT++TLSA+V 
Sbjct  61    NESSVVAVNNVTNWSGTCYVTPLLGAFLADAYLGRYWTIAAFSIIYVFGMTVLTLSASVH  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+ P C  ++ C   G    + ++ LYL+ALGTGGIKPCVSS+GADQFDD+DE E+K KS
Sbjct  121   GLKPPCDDNNTCHPKGIQIGIFYLGLYLIALGTGGIKPCVSSFGADQFDDSDETEKKKKS  180

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GALVA++++VWIQ +V WGWGFG+PAVAMA+AV  FFSGTRLYR QKP
Sbjct  181   SFFNWFYFSINIGALVASTVLVWIQTNVGWGWGFGIPAVAMAVAVVSFFSGTRLYRNQKP  240

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+FQV+VAS RK KVK+P D SLL+ETV  ES +QGSRKL HT +L FFDKAAV
Sbjct  241   GGSPLTRIFQVIVASFRKFKVKIPRDSSLLYETVDEESAVQGSRKLDHTEQLSFFDKAAV  300

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               E+  +  KGSV+PW LCTVTQVEELKSIIRLLPIWATGIIFS+VY QMGT F+ Q   
Sbjct  301   --ETQSDKIKGSVNPWSLCTVTQVEELKSIIRLLPIWATGIIFSSVYSQMGTLFVLQGNT  358

Query  1295  MNTYV-GTFKXPXASLGV  1345
             M+ ++  +F+ P ASL +
Sbjct  359   MDLHMTNSFEIPSASLSL  376



>ref|XP_002870939.1| proton-dependent oligopeptide transport family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH47198.1| proton-dependent oligopeptide transport family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=570

 Score =   529 bits (1363),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 251/381 (66%), Positives = 307/381 (81%), Gaps = 8/381 (2%)
 Frame = +2

Query  215   MEED-DVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTR  391
             MEED D+YT+DGTLD   +PANK KTG WKAC FILG EC ERLAYYGMS+NL+ Y + +
Sbjct  1     MEEDKDIYTQDGTLDIHKKPANKNKTGTWKACRFILGTECCERLAYYGMSTNLVNYLEKQ  60

Query  392   LNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATV  571
             +N  T +AS +++NWSGTCY  PL+GAF+ADAYLGRYWTIA+F +IY+ GMTL+T+SA+V
Sbjct  61    MNMETVTASNSVTNWSGTCYATPLIGAFIADAYLGRYWTIASFVVIYISGMTLLTISASV  120

Query  572   PGISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHK  751
             PG++PTC + + C AT   TAV FIALYL+ALGTGGIKPCVSS+GADQFDDTDEKE++ K
Sbjct  121   PGLTPTC-SGNSCHATASQTAVTFIALYLIALGTGGIKPCVSSFGADQFDDTDEKEKESK  179

Query  752   SSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQK  931
             SSFFNWFYF INVGA++A+S++VWIQ +V WGWG GVP VAM +AV FFF+G++ YR QK
Sbjct  180   SSFFNWFYFVINVGAMIASSVLVWIQMNVGWGWGLGVPTVAMGVAVVFFFAGSKFYRLQK  239

Query  932   PGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAA  1111
             PGGSP TR+ QV+VAS RK KVKVP D+SLL+E    ES+I GSRKL HT  L FFDKAA
Sbjct  240   PGGSPLTRMLQVIVASCRKSKVKVPEDESLLYENQDAESSIIGSRKLEHTKILTFFDKAA  299

Query  1112  VVEESLDEDKKGSV--SPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQ  1285
             V  ES   D KG+   S W+LCTVTQVEELK++IRLLPIWATGI+F++VY QMGT F+ Q
Sbjct  300   VQTES---DNKGAAKSSLWKLCTVTQVEELKALIRLLPIWATGIVFASVYSQMGTVFVLQ  356

Query  1286  AEGMNTYVG-TFKXPXASLGV  1345
                ++ ++G  FK P ASL +
Sbjct  357   GNTLDQHMGPNFKIPSASLSL  377



>ref|XP_010104684.1| Peptide transporter [Morus notabilis]
 gb|EXC01490.1| Peptide transporter [Morus notabilis]
Length=588

 Score =   530 bits (1364),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 255/397 (64%), Positives = 305/397 (77%), Gaps = 22/397 (6%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             ME+DDVYTKDGT+D+R  PANKK+TG WKACPFILGNE  ERLAYYGMSSNL+ YF+ RL
Sbjct  1     MEDDDVYTKDGTIDHRGNPANKKETGTWKACPFILGNEFCERLAYYGMSSNLVTYFKERL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
              Q +++A+ N  NWSGTCYI PL+GAFLAD+YLGRYWTIA FS IYV GMT +TL+A+VP
Sbjct  61    GQHSSTAANNTLNWSGTCYITPLIGAFLADSYLGRYWTIAIFSTIYVTGMTFLTLTASVP  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+ PTC  +D C AT    A   +ALY +ALGTGGIKPCVSSYGADQFDD DE E+KHK+
Sbjct  121   GLKPTCHGNDGCHATDSQKAAFILALYTIALGTGGIKPCVSSYGADQFDDADEVEKKHKA  180

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFY SINVGAL+A+S++VW+Q++VSWG GFG+PA  MA+A+  FFSGTRLYR QKP
Sbjct  181   SFFNWFYLSINVGALIASSVLVWVQENVSWGLGFGIPAATMAVAIVSFFSGTRLYRNQKP  240

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNE---------  1087
             GGSP  R+ QVVVA++RKR V+VP+DK+LL+E    ES I+GSRKL HT +         
Sbjct  241   GGSPLIRIAQVVVAAMRKRWVEVPADKALLYEVADAESVIKGSRKLDHTQDFRQVSQLES  300

Query  1088  ---------LRFFDKAAVVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGII  1240
                      LRFFDKAAV  E   +  K SV+PW LCTVTQVEELK+IIRLLPIWATGI+
Sbjct  301   LTRVYYTCSLRFFDKAAV--EIQTDHIKDSVNPWMLCTVTQVEELKAIIRLLPIWATGIM  358

Query  1241  FSTVYGQMGTQFISQAEGMNTYVG--TFKXPXASLGV  1345
             FS VY QMG+ F+ Q   M+  +   +FK P ASL +
Sbjct  359   FSAVYSQMGSLFVLQGLTMDRRLAPSSFKIPSASLSI  395



>ref|XP_004308641.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like [Fragaria vesca 
subsp. vesca]
Length=586

 Score =   529 bits (1363),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 251/379 (66%), Positives = 307/379 (81%), Gaps = 4/379 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             + EDD+YTKDGT+DYR  PANK  TG WKACPFILGNE  ERLA+YG+S+NL++YF+  L
Sbjct  17    IAEDDLYTKDGTVDYRGNPANKNVTGTWKACPFILGNEFCERLAFYGLSANLVLYFKNHL  76

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             +QS+ +A+K++SNW+GTCY+ PL+GAFLADAYLGRY TIA+F+IIYV+GM L+T+S +VP
Sbjct  77    HQSSAAAAKSISNWTGTCYLTPLIGAFLADAYLGRYKTIASFTIIYVIGMALLTMSTSVP  136

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+ PTC+  D C  T   +A C++ALYL+AL TGGIKPCVS+YGADQFD+ DE E+KHKS
Sbjct  137   GLKPTCVLEDDCYVTPGQSAACYVALYLIALATGGIKPCVSAYGADQFDEDDEVEKKHKS  196

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYF +NVGAL+A+SL+VWIQ +  W WGFG+PAVAMA+AV  FF GTRLYR QKP
Sbjct  197   SFFNWFYFVVNVGALIASSLLVWIQTNKGWEWGFGIPAVAMAIAVVSFFLGTRLYRNQKP  256

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QVVVAS+RK KVKVP DKS+ +ET   ES I+GSRKL HTNE RFFDKA V
Sbjct  257   GGSPITRIVQVVVASVRKYKVKVPEDKSVFYETADAESAIKGSRKLEHTNEFRFFDKAVV  316

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               E   ++ KG  +PWRLCTVTQVEELKSIIRLLP+WATGIIF+ V+ QMG  F+ Q   
Sbjct  317   --ELPTDNIKGFKNPWRLCTVTQVEELKSIIRLLPVWATGIIFAAVFSQMGNFFVLQGSL  374

Query  1295  MNTYVG--TFKXPXASLGV  1345
             M+ +VG  +F+ P A L V
Sbjct  375   MDLHVGSSSFEIPAACLSV  393



>ref|XP_006429308.1| hypothetical protein CICLE_v10013821mg [Citrus clementina]
 gb|ESR42548.1| hypothetical protein CICLE_v10013821mg [Citrus clementina]
Length=550

 Score =   528 bits (1359),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 246/376 (65%), Positives = 301/376 (80%), Gaps = 3/376 (1%)
 Frame = +2

Query  221   EDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQ  400
             E+D++  DGT+D+ N+PA KK+TG WKACP+ILGNEC ERLAYYG+++NL+ Y +  LNQ
Sbjct  4     EEDIHINDGTIDFGNKPAVKKETGTWKACPYILGNECCERLAYYGINTNLVNYLRFELNQ  63

Query  401   STTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPGI  580
                 A  N++NWSGTCY+MPL+GAFLADAYLGRYWTIA+FSIIYV+GMT++T+SA+V G+
Sbjct  64    GNVQAVNNVTNWSGTCYVMPLIGAFLADAYLGRYWTIASFSIIYVIGMTILTMSASVHGL  123

Query  581   SPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSF  760
              P C   + C  TG   AV F+ LYL+ALGTGGIKPCVSS+GADQFDD DE E+K KSSF
Sbjct  124   KPLCDKRNVCHPTGLQIAVFFVGLYLIALGTGGIKPCVSSFGADQFDDYDEAEKKKKSSF  183

Query  761   FNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKPGG  940
             FNWFYFSIN+GALVAAS +VWIQ +V WGWGFG+PAVAMA+AV  FF+G+RLYRYQKPGG
Sbjct  184   FNWFYFSINIGALVAASCLVWIQTNVGWGWGFGIPAVAMAIAVVSFFAGSRLYRYQKPGG  243

Query  941   SPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAVVE  1120
             SP TR+ QV+VAS RK ++KVP+DKSLL+ET   E  + GS KL HT +L F DKAAV  
Sbjct  244   SPLTRICQVLVASFRKFRIKVPADKSLLYETADTEFAVIGSHKLDHTKQLSFLDKAAV--  301

Query  1121  ESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEGMN  1300
             E+  +  KGSV+ WRLCTVTQVEE KSIIRLLPIWA GI+FS VY QMGT F+ Q   M+
Sbjct  302   ETPSDCVKGSVNAWRLCTVTQVEEFKSIIRLLPIWAIGIVFSAVYSQMGTLFVLQGNTMD  361

Query  1301  TYV-GTFKXPXASLGV  1345
              ++  +F+ P ASL +
Sbjct  362   LHIDNSFEIPSASLSL  377



>ref|XP_009624728.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Nicotiana tomentosiformis]
Length=569

 Score =   527 bits (1357),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 253/378 (67%), Positives = 308/378 (81%), Gaps = 3/378 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M EDD Y KDGT+DYRN PA KK+TG W+ACP+ILGNEC ERLAYYG+++NL+ Y + ++
Sbjct  1     MAEDDKYVKDGTVDYRNNPAIKKETGTWRACPYILGNECCERLAYYGINTNLVNYLKFQM  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             N+S+  A  N++NWSGTCY+ PL+GAFLADAYLGRYWTIA FSIIYV GMT++TLSA+V 
Sbjct  61    NESSVVAVNNVTNWSGTCYVTPLLGAFLADAYLGRYWTIAAFSIIYVFGMTVLTLSASVH  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+ P C  ++ C   G    + ++ LYL+ALGTGGIKPCVSS+GADQFDD+DE E+K KS
Sbjct  121   GLKPPCDDNNTCHPKGIQIGIFYLGLYLIALGTGGIKPCVSSFGADQFDDSDEIEKKKKS  180

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GALVA++++VWIQ +V WGWGFG+PAVAMA+AV  FFSGTRLYR QKP
Sbjct  181   SFFNWFYFSINIGALVASTVLVWIQTNVGWGWGFGIPAVAMAVAVVSFFSGTRLYRNQKP  240

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+FQV+VAS RK KVK+P D SLL+ET   ES +QGSRKL HT +L FFDKAAV
Sbjct  241   GGSPLTRIFQVIVASFRKFKVKIPRDTSLLYETADEESAVQGSRKLDHTEQLSFFDKAAV  300

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               E+  +  KGSV+PW LCTVTQVEELKSIIRLLPIWATGIIFS+VY QMGT F+ Q   
Sbjct  301   --ETQSDKIKGSVNPWSLCTVTQVEELKSIIRLLPIWATGIIFSSVYSQMGTLFVLQGNT  358

Query  1295  MNTYV-GTFKXPXASLGV  1345
             M+ ++  +F+ P ASL +
Sbjct  359   MDLHMTNSFQIPSASLSL  376



>ref|XP_010033021.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Eucalyptus grandis]
 gb|KCW52547.1| hypothetical protein EUGRSUZ_J01932 [Eucalyptus grandis]
Length=570

 Score =   526 bits (1356),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 255/377 (68%), Positives = 302/377 (80%), Gaps = 4/377 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             MEE+DVYTKDGT+DY+  PA+K+KTG WKACPFILGNEC ERLA+YGM +NL++YF+  L
Sbjct  1     MEEEDVYTKDGTVDYKGDPADKRKTGTWKACPFILGNECCERLAFYGMGANLVLYFKLHL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             +Q  T+AS NL+NW+GTCYI  L+GAF ADAYLGRYWTIA FSIIYV GMTL+TLSA+V 
Sbjct  61    HQHGTTASNNLTNWAGTCYITTLIGAFFADAYLGRYWTIACFSIIYVFGMTLLTLSASVS  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+ P+C   D C AT   +AVCFIALYL+ALG+GGIKPCVSSYGADQFDD DE E+K K 
Sbjct  121   GLKPSCTGKDNCHATNIQSAVCFIALYLIALGSGGIKPCVSSYGADQFDDADEAEKKRKG  180

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFY SIN+GAL+A  ++V+IQ +V W  GFG+PA AMA+AV  FFSGTRLYR Q P
Sbjct  181   SFFNWFYLSINIGALIAEFVLVYIQDNVGWALGFGIPAAAMAIAVATFFSGTRLYRNQNP  240

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TRL QVVVAS RK +V+VP+DKSLL+ET   +S I+GSRKL HT +L FFDKAAV
Sbjct  241   GGSPLTRLCQVVVASFRKYRVEVPADKSLLYETADAKSAIKGSRKLDHTQDLSFFDKAAV  300

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               E+  +  K  V+PWRLCTVTQVEELK IIRLLP+WA+ I+F TVY QMGT F+ Q   
Sbjct  301   --ETQTDHIKEPVNPWRLCTVTQVEELKVIIRLLPVWASQIVFVTVYNQMGTLFVLQGST  358

Query  1295  MNTYVG--TFKXPXASL  1339
             M+ +VG  TFK P AS 
Sbjct  359   MDPHVGNSTFKIPAASF  375



>ref|XP_008242154.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Prunus mume]
Length=569

 Score =   526 bits (1355),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 254/378 (67%), Positives = 303/378 (80%), Gaps = 3/378 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             MEE+D++TKDGT DY+NRPA KK TG WKACP+ILGNEC ERLAYYG+++NL+ Y + +L
Sbjct  1     MEEEDIHTKDGTTDYQNRPAIKKNTGTWKACPYILGNECCERLAYYGINTNLVNYLKFQL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             NQ    A  N++NWSGTCY+ PL+GAFLADAYLGRYWTIA FSIIYV GMTL+TLSA++ 
Sbjct  61    NQRNVVAVNNVTNWSGTCYVTPLLGAFLADAYLGRYWTIAAFSIIYVFGMTLLTLSASLQ  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+ P C  ++ C  TG    V F+ LYL+ALGTGGIKPCVSS+GADQFDD+DE E+K+K 
Sbjct  121   GLKPPCDTNNVCHPTGLQAGVFFMGLYLIALGTGGIKPCVSSFGADQFDDSDEAEKKNKG  180

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GALVA+S++VWIQ +V W WGFG+PAVAMALAV  FFSGTRLYR Q+P
Sbjct  181   SFFNWFYFSINIGALVASSVLVWIQTNVGWSWGFGIPAVAMALAVVSFFSGTRLYRNQRP  240

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QV VAS RK +VKVP DKSLL+ET   ES ++GSRKL HT EL   DKAAV
Sbjct  241   GGSPLTRICQVFVASFRKFRVKVPGDKSLLYETADEESVVKGSRKLDHTEELSLLDKAAV  300

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               E+  +  KGSV  WRLCTVTQVEELKS++RLLPIWATGIIFS VY QMGT F+ Q   
Sbjct  301   --ETPSDKIKGSVMAWRLCTVTQVEELKSLVRLLPIWATGIIFSAVYSQMGTLFVLQGNT  358

Query  1295  MNTYV-GTFKXPXASLGV  1345
             M+ +V  +F+ P ASL +
Sbjct  359   MDLHVTKSFEIPSASLSL  376



>ref|XP_011466487.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Fragaria vesca 
subsp. vesca]
Length=578

 Score =   526 bits (1355),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 251/378 (66%), Positives = 300/378 (79%), Gaps = 4/378 (1%)
 Frame = +2

Query  218   EEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  397
             E D+VYTKDGT DYRN+PA K KTG WKACP+ILGNEC ERLAYYG+++NL+ Y + ++N
Sbjct  10    EIDNVYTKDGTTDYRNQPAMKNKTGTWKACPYILGNECCERLAYYGINTNLVNYLKFQMN  69

Query  398   QSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPG  577
             Q    A  N++NWSGTCY+ PL+GAFLADAYLGRY+TI  FSI+YV+GMTL+TLSA+V G
Sbjct  70    QRNVEAVNNVTNWSGTCYVTPLLGAFLADAYLGRYYTIVAFSIVYVLGMTLLTLSASVQG  129

Query  578   ISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSS  757
             + P C  ++ C+ T       F  LYL+ALGTGGIKPCVSS+GADQFDDTDE E+K+K S
Sbjct  130   LKPPCDKNNVCSPTQFQAGAFFTGLYLIALGTGGIKPCVSSFGADQFDDTDEAEKKNKGS  189

Query  758   FFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKPG  937
             FFNWFYFSIN+GALVA+S++VWIQ +V WGWGFG+PAVAMALAV  FFSGTRLYR  +P 
Sbjct  190   FFNWFYFSINIGALVASSVLVWIQTNVGWGWGFGIPAVAMALAVVSFFSGTRLYRNLRPS  249

Query  938   GSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAVV  1117
             GSP TR+ QV+VAS RK K +VP DKSLL ET   ES ++GSRKL HT +L F DKAAVV
Sbjct  250   GSPLTRICQVMVASFRKYKEQVPRDKSLLFETAEDESAVKGSRKLDHTEQLSFLDKAAVV  309

Query  1118  EESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEGM  1297
              +S  +  KGSV  WRLCTVTQVEELKSIIRLLPIWATGIIFS VY QMGT F+ Q   M
Sbjct  310   TQS--DRTKGSVMAWRLCTVTQVEELKSIIRLLPIWATGIIFSAVYSQMGTLFVLQGNTM  367

Query  1298  NTYVG--TFKXPXASLGV  1345
             + ++G  +F+ P ASL +
Sbjct  368   DLHLGNTSFEIPSASLSL  385



>ref|XP_008239599.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Prunus mume]
Length=568

 Score =   525 bits (1352),  Expect = 6e-179, Method: Compositional matrix adjust.
 Identities = 250/380 (66%), Positives = 297/380 (78%), Gaps = 8/380 (2%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M EDD YT DGT+D    PANKKKTGNW+AC FILGNEC ERLAYYGMS+NL+ Y   RL
Sbjct  1     MGEDDDYTNDGTVDIHKNPANKKKTGNWRACRFILGNECCERLAYYGMSTNLVNYLGKRL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             +    +AS  ++NWSGTCY  PL+GAFLADAYLGRYWTIA FS+IY +GMT +TL+A++ 
Sbjct  61    SMGNVAASTTVTNWSGTCYATPLIGAFLADAYLGRYWTIAIFSVIYALGMTFLTLTASIK  120

Query  575   GISPTCIAHDK--CTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKH  748
             G+ P C   DK  C AT    A CF+ALY++ALGTGGIKPCVSS+GADQFD+TDE ERK 
Sbjct  121   GLKPRC---DKSGCQATSSQRAACFVALYMIALGTGGIKPCVSSFGADQFDETDETERKK  177

Query  749   KSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQ  928
             KSSFFNWFY SIN+GAL+A++++VW Q  V W WGFG+PAVAMA+AV FFF G++LYR Q
Sbjct  178   KSSFFNWFYLSINIGALIASTVLVWTQMTVGWNWGFGIPAVAMAIAVVFFFLGSKLYRLQ  237

Query  929   KPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKA  1108
             KPGGSP TR+ QV+ AS+RK  VKVP+DKSLL ET   E NIQGSRKL HT++LRFFDKA
Sbjct  238   KPGGSPLTRIIQVIFASIRKCNVKVPADKSLLFETPDEECNIQGSRKLEHTDKLRFFDKA  297

Query  1109  AVVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQA  1288
             AV  ES  +  K   +PWRLCTVTQVEELKSIIRLLPIWA+GI+F+ VY QM T F+ Q 
Sbjct  298   AV--ESETDHAKDLPNPWRLCTVTQVEELKSIIRLLPIWASGIVFAAVYSQMSTMFVLQG  355

Query  1289  EGMNTYVG-TFKXPXASLGV  1345
               M+ ++G  FK P ASL +
Sbjct  356   NTMDQHMGPNFKIPSASLSL  375



>ref|XP_010101811.1| Peptide transporter [Morus notabilis]
 gb|EXB89948.1| Peptide transporter [Morus notabilis]
Length=569

 Score =   525 bits (1351),  Expect = 8e-179, Method: Compositional matrix adjust.
 Identities = 256/380 (67%), Positives = 310/380 (82%), Gaps = 7/380 (2%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             MEEDD+YTKDGTLD    PANKK TG+WKAC +ILGNEC ERLAYYGMS+NL+ Y + RL
Sbjct  1     MEEDDIYTKDGTLDINKNPANKKTTGHWKACRYILGNECCERLAYYGMSTNLVNYLEERL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             N    +A+ N++NW+GTCYI PL+GAFLAD+YLGRYWTIA+FSIIYV GMTL+TLS++VP
Sbjct  61    NMGNAAAANNVTNWAGTCYITPLIGAFLADSYLGRYWTIASFSIIYVFGMTLLTLSSSVP  120

Query  575   GISPTCIAHDK--CTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKH  748
             G+ P+C   DK  C      TAV FIALY++AL TGGIKPCVSS+GADQFD+TDEKERK 
Sbjct  121   GLKPSC---DKAGCHPKTLQTAVGFIALYMIALATGGIKPCVSSFGADQFDETDEKERKK  177

Query  749   KSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQ  928
             KSSFFNWFYFSINVGAL+A+S++VWIQ +V WGWGFG+PAVAMA+AV FFFSG+RLYR Q
Sbjct  178   KSSFFNWFYFSINVGALIASSVLVWIQMNVGWGWGFGIPAVAMAIAVVFFFSGSRLYRLQ  237

Query  929   KPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKA  1108
             KPGGSP TR+ QV++AS RK   +VP DKSLL+ET   E +IQGSRKL HT++L FFDKA
Sbjct  238   KPGGSPLTRIVQVIIASFRKFNAQVPEDKSLLYETADEECDIQGSRKLEHTDKLTFFDKA  297

Query  1109  AVVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQA  1288
             AV  E+ D  K G  +PW LCT++QVEELKS+IRLLPIWA+GI+FSTVY QM T F+ Q 
Sbjct  298   AVQTET-DHIKGGLANPWLLCTISQVEELKSVIRLLPIWASGIVFSTVYSQMNTMFVLQG  356

Query  1289  EGMNTYVGT-FKXPXASLGV  1345
               ++ ++G+ F+ P ASL +
Sbjct  357   NTLDQHMGSHFEIPSASLSL  376



>ref|XP_006848107.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1 [Amborella trichopoda]
 ref|XP_011624723.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1 [Amborella trichopoda]
 ref|XP_011624724.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1 [Amborella trichopoda]
 ref|XP_011624725.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1 [Amborella trichopoda]
 gb|ERN09688.1| hypothetical protein AMTR_s00029p00214340 [Amborella trichopoda]
Length=567

 Score =   525 bits (1351),  Expect = 8e-179, Method: Compositional matrix adjust.
 Identities = 249/377 (66%), Positives = 305/377 (81%), Gaps = 3/377 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M +  +YT+DGT+D+  +PA K KTGNWKACPFILGNEC ERLAYYGM +NL+ Y + RL
Sbjct  1     MSDPAIYTQDGTVDHTGKPAIKDKTGNWKACPFILGNECCERLAYYGMGTNLVNYMKYRL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             NQ + +A+ +++NWSGTCYI+PLVGAF+ADAY GRY  IA FS IYV+GMTL+TLSA+V 
Sbjct  61    NQPSATAANSVTNWSGTCYILPLVGAFVADAYWGRYKVIAVFSAIYVVGMTLLTLSASVG  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+SPTC    +C  T    AV F++LYL+ALGTGGIKPCVSS+GADQFD+ DE E+K KS
Sbjct  121   GLSPTC-HSGQCHVTSGQVAVFFVSLYLIALGTGGIKPCVSSFGADQFDEADEYEKKKKS  179

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GAL+A+SL+VWIQ++V WGWGFG+PAVAMA+A+  F +GTRLYR QKP
Sbjct  180   SFFNWFYFSINIGALIASSLLVWIQENVGWGWGFGIPAVAMAIAIFSFLAGTRLYRNQKP  239

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QV VAS+RK  V VPSDKSLL+ET   ES IQGSRKL HTNE  FFDKAAV
Sbjct  240   GGSPITRIAQVFVASIRKSSVTVPSDKSLLYETAEQESVIQGSRKLDHTNEFIFFDKAAV  299

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               E+  +  KG  +PW+LCTVTQVEE K+IIR+LPIWA+GIIF+TVY QM T F+ Q + 
Sbjct  300   ETEA--DKFKGIPNPWKLCTVTQVEEWKAIIRILPIWASGIIFATVYSQMNTMFVLQGDT  357

Query  1295  MNTYVGTFKXPXASLGV  1345
             M+ ++G+FK P ASL +
Sbjct  358   MDPHMGSFKIPAASLSL  374



>ref|XP_008785424.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Phoenix dactylifera]
 ref|XP_008785425.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Phoenix dactylifera]
 ref|XP_008785426.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Phoenix dactylifera]
 ref|XP_008785427.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Phoenix dactylifera]
 ref|XP_008785428.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Phoenix dactylifera]
Length=574

 Score =   524 bits (1350),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 246/375 (66%), Positives = 301/375 (80%), Gaps = 4/375 (1%)
 Frame = +2

Query  224   DDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQS  403
             +D YTKDGT D R  PA KK TGNW+ACP+IL NEC ERLAYYGMS+NL+ Y + RL+Q+
Sbjct  6     EDKYTKDGTTDIRGNPAVKKDTGNWRACPYILANECCERLAYYGMSTNLVNYMKDRLHQN  65

Query  404   TTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPGIS  583
              T+A+ N++NWSGTCYIMPL+GAFLADAYLGRYWTIA+F I+Y+ G+TL+T++++V G+ 
Sbjct  66    NTTAANNVTNWSGTCYIMPLLGAFLADAYLGRYWTIASFMIVYISGLTLLTMTSSVNGLK  125

Query  584   PTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSFF  763
             P+C  +  C  T   TAV FIALYL+ALGTGGIKPCVSS+GADQFD++DE E+K KSSFF
Sbjct  126   PSC-DNGVCDPTNAQTAVVFIALYLIALGTGGIKPCVSSFGADQFDESDESEKKRKSSFF  184

Query  764   NWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKPGGS  943
             NWFYFSIN+GALVA+S++VWIQ +V WGWGFG+PAV MA+AV  FF GT LYR+QKPGGS
Sbjct  185   NWFYFSINIGALVASSVLVWIQNNVGWGWGFGIPAVVMAIAVVSFFLGTALYRHQKPGGS  244

Query  944   PFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAVVEE  1123
             P TR+ QVVVAS RK  V +P DKS L+E    ES IQGSRKL HT++ +F DKAAVV +
Sbjct  245   PLTRIAQVVVASFRKYGVNLPHDKSSLYEISEKESVIQGSRKLEHTDQFKFLDKAAVVTQ  304

Query  1124  SLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEGMNT  1303
               D+  K  V PWRLCTVTQVEELKS++R+LPIWATGIIFSTVY QM T F+ Q   ++ 
Sbjct  305   --DDKMKDPVDPWRLCTVTQVEELKSVVRILPIWATGIIFSTVYSQMSTMFVLQGNTLDP  362

Query  1304  YVGT-FKXPXASLGV  1345
             ++G  FK P ASL +
Sbjct  363   HMGPHFKIPSASLSI  377



>ref|XP_010423917.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2 [Camelina sativa]
 ref|XP_010423918.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2 [Camelina sativa]
Length=573

 Score =   523 bits (1348),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 245/374 (66%), Positives = 300/374 (80%), Gaps = 4/374 (1%)
 Frame = +2

Query  227   DVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQST  406
             D YT+DGTLD   +PANKK TG WKAC FILG EC ERLAYYGMS+NL+ Y + ++N   
Sbjct  10    DTYTQDGTLDIYKKPANKKTTGTWKACRFILGTECCERLAYYGMSTNLVNYLEKQMNMEN  69

Query  407   TSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPGISP  586
              +AS ++SNWSGTCY  PL+GAF+ADAYLGRYWTIA F  IY+ GMTL+T+SA+VPG++P
Sbjct  70    VTASTSVSNWSGTCYATPLIGAFVADAYLGRYWTIAIFVAIYIAGMTLLTMSASVPGLTP  129

Query  587   TCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSFFN  766
             TC + D C ATG   A+ FIALYL+ALGTGGIKPCVSS+GADQFDDTDE+E++ KSSFFN
Sbjct  130   TC-SGDTCHATGGQIALTFIALYLIALGTGGIKPCVSSFGADQFDDTDEEEKESKSSFFN  188

Query  767   WFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKPGGSP  946
             WFYF INVGA++A+S++VWIQ +V WGWG GVP V MA+AV FFF+G++ YR QKPGGSP
Sbjct  189   WFYFVINVGAMIASSVLVWIQMNVGWGWGLGVPTVTMAIAVVFFFAGSKFYRLQKPGGSP  248

Query  947   FTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAVVEES  1126
              TR+ QV+VAS RK KV+VP DKSLL+E    ES+I+GSRKL HT  L FFDKAAV  ES
Sbjct  249   LTRMLQVIVASCRKSKVRVPEDKSLLYENQDAESSIRGSRKLEHTKILTFFDKAAVETES  308

Query  1127  LDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEGMNTY  1306
               ++K+ + S W+LCTVTQVEELK++IRLLPIWATGI+F+ VY QMGT F+ Q   M+ +
Sbjct  309   --DNKEAAPSSWKLCTVTQVEELKALIRLLPIWATGIVFAAVYSQMGTVFVLQGNTMDQH  366

Query  1307  VG-TFKXPXASLGV  1345
             +G  FK P ASL +
Sbjct  367   MGPNFKIPSASLSL  380



>ref|XP_009405847.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009405848.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009405849.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009405850.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Musa acuminata 
subsp. malaccensis]
Length=580

 Score =   523 bits (1347),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 240/379 (63%), Positives = 305/379 (80%), Gaps = 5/379 (1%)
 Frame = +2

Query  215   MEE-DDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTR  391
             ME+  D YT+DGT D    PA KK TGNW+ACP+IL NEC ERLAYYGMS+NL+ Y + R
Sbjct  1     MEDIKDEYTQDGTTDIHGNPAIKKNTGNWRACPYILANECCERLAYYGMSTNLVNYMKDR  60

Query  392   LNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATV  571
             L+Q   +A+ N++NWSGTCYIMPL+GAF+ADAY+GRYWTI++F I+Y++G+TL+T++A+V
Sbjct  61    LHQGNVTAANNVTNWSGTCYIMPLLGAFIADAYIGRYWTISSFMIVYILGLTLLTMTASV  120

Query  572   PGISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHK  751
              G+ P+C  +  C  T   TA  F ALYL+ALGTGGIKPCVSS+GADQFDD+DE E+K K
Sbjct  121   KGLKPSC-QNGVCDPTRAQTAAVFTALYLIALGTGGIKPCVSSFGADQFDDSDESEKKRK  179

Query  752   SSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQK  931
             SSFFNWFYFSIN+GAL+A+S++VWIQ DV WGWGFG+PAV MA+AV  FF GTRLYR+QK
Sbjct  180   SSFFNWFYFSINIGALIASSVLVWIQTDVGWGWGFGIPAVVMAIAVVSFFMGTRLYRHQK  239

Query  932   PGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAA  1111
             PGGSP TR+ QV+VASLRK  VKVP+DKSLL+E    ES IQGSRKL HT++ +F DKAA
Sbjct  240   PGGSPLTRIAQVMVASLRKAGVKVPADKSLLYEITQKESAIQGSRKLDHTDQFKFLDKAA  299

Query  1112  VVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAE  1291
             V  E+ ++  +  V+PWRLCT+TQVEELKSI+R+LP+WA+GI+FSTVY QM T F+ Q  
Sbjct  300   V--ETQEDKARSPVNPWRLCTITQVEELKSILRILPVWASGIVFSTVYSQMSTMFVLQGN  357

Query  1292  GMNTYVGT-FKXPXASLGV  1345
              ++ ++G  F+ P ASL +
Sbjct  358   TLDRHMGPHFQIPSASLSI  376



>ref|XP_010490600.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like [Camelina sativa]
Length=575

 Score =   523 bits (1346),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 246/385 (64%), Positives = 306/385 (79%), Gaps = 5/385 (1%)
 Frame = +2

Query  197   MEQSKAMEED-DVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLM  373
             M + + ++ D D YT+DGTL+   +PANKK TG WKAC FILG EC ERLAYYGMS+NL+
Sbjct  1     MTKGEDIDMDLDTYTQDGTLNIYKKPANKKTTGTWKACRFILGTECCERLAYYGMSTNLV  60

Query  374   IYFQTRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLM  553
              Y + ++N    +AS ++SNWSGTCY  PL+GAF+ADAYLGRYWTIA F  IY+ GMTL+
Sbjct  61    NYLEKQMNMENVTASTSVSNWSGTCYATPLIGAFVADAYLGRYWTIAIFVAIYIAGMTLL  120

Query  554   TLSATVPGISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDE  733
             T+SA+VPG++PTC + D C ATG   A+ F+ALYL+ALGTGGIKPCVSS+GADQFDDTDE
Sbjct  121   TMSASVPGLTPTC-SGDTCHATGGQIALTFVALYLIALGTGGIKPCVSSFGADQFDDTDE  179

Query  734   KERKHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTR  913
             KE++ KSSFFNWFYF INVGA++A+S++VWIQ +V WGWG GVP V MA+AV FFF+G++
Sbjct  180   KEKESKSSFFNWFYFVINVGAMIASSVLVWIQMNVGWGWGLGVPTVTMAIAVVFFFAGSK  239

Query  914   LYRYQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELR  1093
              YR QKPGGSP TR+ QV+VAS RK KV+VP DKSLL+E    ES+I+GSRKL HT  L 
Sbjct  240   FYRLQKPGGSPLTRMLQVIVASCRKSKVRVPEDKSLLYENQDAESSIRGSRKLEHTKILT  299

Query  1094  FFDKAAVVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQ  1273
             FFDKAAV  ES  ++K+ + S W+LCTVTQVEELK++IRLLPIWATGI+F+ VY QMGT 
Sbjct  300   FFDKAAVETES--DNKEAAPSSWKLCTVTQVEELKALIRLLPIWATGIVFAAVYSQMGTV  357

Query  1274  FISQAEGMNTYVG-TFKXPXASLGV  1345
             F+ Q   M+ ++G  FK P ASL +
Sbjct  358   FVLQGNTMDQHMGPNFKIPSASLSL  382



>ref|XP_009624729.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like [Nicotiana tomentosiformis]
Length=579

 Score =   523 bits (1346),  Expect = 6e-178, Method: Compositional matrix adjust.
 Identities = 245/386 (63%), Positives = 303/386 (78%), Gaps = 6/386 (2%)
 Frame = +2

Query  197   MEQSKAMEEDDV--YTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNL  370
             M +   ME DD   YTKDGT+D   +PANKKKTG WKACPFILG+E  ERLAYYGMS+NL
Sbjct  1     MAREARMERDDDEDYTKDGTVDIYKKPANKKKTGTWKACPFILGDEGCERLAYYGMSTNL  60

Query  371   MIYFQTRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTL  550
             + Y Q +LN +  ++S++++NW GTCY+ PL+GAFLADAYLGRYWTIATFS +Y++GM  
Sbjct  61    VNYIQQKLNLNNAASSRSVTNWQGTCYVTPLLGAFLADAYLGRYWTIATFSTLYIIGMAF  120

Query  551   MTLSATVPGISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTD  730
             +T+SA++ G+ P C  ++ C  TG      F+A+YL+A GTGGIKPCVSS+GADQFDD D
Sbjct  121   LTMSASISGLKPAC-DNESCNPTGSQKTAFFVAIYLIAFGTGGIKPCVSSFGADQFDDND  179

Query  731   EKERKHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGT  910
             E E+K KSSFFNWFY SIN+GAL+A+S++VWIQ +V WGWGFGVPAVAMA+A+ FFFSGT
Sbjct  180   ETEKKSKSSFFNWFYLSINIGALIASSVLVWIQMNVGWGWGFGVPAVAMAIALVFFFSGT  239

Query  911   RLYRYQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNEL  1090
             RLYR Q PGGSP TR+ QV VAS+RK  VK P D+SLL+ET  +ESNI+GSRKL H+ E 
Sbjct  240   RLYRLQPPGGSPLTRILQVFVASIRKCNVKPPPDESLLYETSDVESNIKGSRKLEHSEEF  299

Query  1091  RFFDKAAVVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGT  1270
             RFFDKAAV  E+  +   GSV+PW+LCTVTQVEE+KSIIRLLP+WATGI+FS VY QM T
Sbjct  300   RFFDKAAV--ETGSDKVNGSVNPWKLCTVTQVEEVKSIIRLLPVWATGIVFSCVYSQMST  357

Query  1271  QFISQAEGMNTYVGT-FKXPXASLGV  1345
              F+ Q   M+ ++GT F  P A L +
Sbjct  358   MFVLQGNIMDQHIGTNFTIPSACLSI  383



>ref|XP_010452016.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like [Camelina sativa]
 ref|XP_010452017.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like [Camelina sativa]
Length=575

 Score =   521 bits (1341),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 246/385 (64%), Positives = 304/385 (79%), Gaps = 5/385 (1%)
 Frame = +2

Query  197   MEQSKAMEED-DVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLM  373
             M + + M+ D D YT DGTLD   +PANKK TG WKAC FILG EC ERLAYYGMS+NL+
Sbjct  1     MTKGEDMDMDLDTYTLDGTLDIYKKPANKKTTGTWKACRFILGTECCERLAYYGMSTNLV  60

Query  374   IYFQTRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLM  553
              Y + ++N    +AS ++SNWSGTCY  PL+GAF+ADAYLGRYWTIA F  IY+ GMTL+
Sbjct  61    NYLEKQMNMENVTASTSVSNWSGTCYATPLIGAFVADAYLGRYWTIAIFVAIYIAGMTLL  120

Query  554   TLSATVPGISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDE  733
             T++A+VPG++PTC + D C ATG   A+ FIALYL+ALGTGGIKPCVSS+GADQFDDTDE
Sbjct  121   TMTASVPGLTPTC-SGDTCHATGGQIALTFIALYLIALGTGGIKPCVSSFGADQFDDTDE  179

Query  734   KERKHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTR  913
              E++ KSSFFNWFYF INVGA++A+S++VWIQ +V WGWG GVP V MA++V FFF+G++
Sbjct  180   VEKESKSSFFNWFYFVINVGAMIASSVLVWIQMNVGWGWGLGVPTVTMAISVVFFFAGSK  239

Query  914   LYRYQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELR  1093
              YR QKPGGSP TR+ QV+VAS RK KV+VP DKSLL+E    ES+I+GSRKL HT  L 
Sbjct  240   FYRLQKPGGSPLTRMLQVIVASCRKSKVRVPEDKSLLYENQDAESSIRGSRKLEHTKILT  299

Query  1094  FFDKAAVVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQ  1273
             FFDKAAV  ES  ++K+ + S W+LCTVTQVEELK++IRLLPIWATGI+F+ VY QMGT 
Sbjct  300   FFDKAAVETES--DNKEAAPSSWKLCTVTQVEELKALIRLLPIWATGIVFAAVYSQMGTV  357

Query  1274  FISQAEGMNTYVG-TFKXPXASLGV  1345
             F+ Q   M+ ++G  FK P ASL +
Sbjct  358   FVLQGNTMDQHMGPNFKIPSASLSL  382



>ref|XP_007207074.1| hypothetical protein PRUPE_ppa025891mg [Prunus persica]
 gb|EMJ08273.1| hypothetical protein PRUPE_ppa025891mg [Prunus persica]
Length=568

 Score =   520 bits (1340),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 250/380 (66%), Positives = 298/380 (78%), Gaps = 9/380 (2%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M  DD YT DGT+D    PANKKKTGNW+AC FILGNEC ERLAYYGMS+NL+ Y    L
Sbjct  1     MAYDD-YTNDGTVDIHKNPANKKKTGNWRACGFILGNECCERLAYYGMSTNLVNYLGKHL  59

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             +    +AS  ++NWSGTCY  PL+GAFLADAYLGRYWTIA FS+IY +GMT +TL+A++ 
Sbjct  60    SMGNVAASTTVTNWSGTCYATPLIGAFLADAYLGRYWTIAIFSVIYALGMTFLTLTASIK  119

Query  575   GISPTCIAHDK--CTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKH  748
             G+ P C   DK  C AT    A CF+ALY++ALGTGGIKPCVSS+GADQFD+TDE ERK 
Sbjct  120   GLKPWC---DKSGCQATSSQRAACFVALYMIALGTGGIKPCVSSFGADQFDETDETERKK  176

Query  749   KSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQ  928
             KSSFFNWFY SIN+GAL+A++++VWIQ  V W WGFG+PAVAMA+AV FFF G++LYR Q
Sbjct  177   KSSFFNWFYLSINIGALIASTVLVWIQMTVGWNWGFGIPAVAMAIAVVFFFFGSKLYRLQ  236

Query  929   KPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKA  1108
             KPGGSP TR+ QV+VAS+RK  VKVP+DKSLL+ET   E NIQGSRKL HT++LRFFDKA
Sbjct  237   KPGGSPLTRIIQVIVASIRKCNVKVPADKSLLYETPDEECNIQGSRKLEHTDKLRFFDKA  296

Query  1109  AVVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQA  1288
             AV  ES  +  K   +PWRLCTVTQVEELKSIIRLLPIWA+GI+F+ VY QM T F+ Q 
Sbjct  297   AV--ESETDHAKDLPNPWRLCTVTQVEELKSIIRLLPIWASGIVFAAVYSQMSTMFVLQG  354

Query  1289  EGMNTYVG-TFKXPXASLGV  1345
               M+ ++G  FK P ASL +
Sbjct  355   NTMDQHMGPNFKIPSASLSL  374



>ref|XP_007205100.1| hypothetical protein PRUPE_ppa014631mg [Prunus persica]
 gb|EMJ06299.1| hypothetical protein PRUPE_ppa014631mg [Prunus persica]
Length=530

 Score =   519 bits (1336),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 250/378 (66%), Positives = 301/378 (80%), Gaps = 3/378 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             MEE+D++TKDGT+DY+NRPA KK TG WKACP+ILGNEC ERLAYYG+++NL+ Y + +L
Sbjct  1     MEEEDIHTKDGTIDYQNRPAIKKNTGTWKACPYILGNECCERLAYYGINTNLVNYLKFQL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             NQ    A  N++NWSGTCY+ PL+GAFLADAYLGRYWTIA FSIIYV GMTL+TLSA++ 
Sbjct  61    NQRNVVAVNNVTNWSGTCYVTPLLGAFLADAYLGRYWTIAAFSIIYVFGMTLLTLSASLQ  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+ P C  ++ C  TG    V F+ LYL+ALGTGGIKPCVSS+GADQFDD+DE E+K+K 
Sbjct  121   GLKPPCDTNNVCHPTGLQAGVFFMGLYLIALGTGGIKPCVSSFGADQFDDSDEAEKKNKG  180

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GALVA+S++VWIQ +V W WGFG+PAVAMALAV  FF GTRLYR Q+P
Sbjct  181   SFFNWFYFSINIGALVASSVLVWIQTNVGWSWGFGIPAVAMALAVVSFFLGTRLYRNQRP  240

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QV VAS  K +VKVP DKSLL+ET   E  ++GSRKL HT EL F DKAAV
Sbjct  241   GGSPLTRICQVFVASFGKFRVKVPGDKSLLYETADEEPVVKGSRKLDHTEELSFLDKAAV  300

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               E+  +  K SV  WRLCTVTQVEELKS+++LLPIWATGIIFS VY QMGT F+ Q   
Sbjct  301   --ETPSDKIKDSVMAWRLCTVTQVEELKSLVKLLPIWATGIIFSAVYSQMGTLFVLQGNT  358

Query  1295  MNTYV-GTFKXPXASLGV  1345
             M+ +V  +F+ P ASL +
Sbjct  359   MDLHVTKSFEIPSASLSL  376



>ref|XP_011003666.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Populus euphratica]
Length=568

 Score =   520 bits (1338),  Expect = 7e-177, Method: Compositional matrix adjust.
 Identities = 246/375 (66%), Positives = 301/375 (80%), Gaps = 3/375 (1%)
 Frame = +2

Query  224   DDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQS  403
             +D +TKDG  D+R  PA KK+TG WKACP+ILGNEC ERLAYYG+++NL+ Y + +LNQS
Sbjct  3     EDGFTKDGATDFRGNPAIKKETGTWKACPYILGNECCERLAYYGINTNLVNYLKFQLNQS  62

Query  404   TTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPGIS  583
                A  N++NWSGTCY+MPL+GAFLADAYLGRYWTIA+FSIIYV GMTL+TLSA++ G+ 
Sbjct  63    NAVAVNNVTNWSGTCYVMPLLGAFLADAYLGRYWTIASFSIIYVFGMTLLTLSASIHGLK  122

Query  584   PTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSFF  763
             P+C   + C  TG  T+V F+ LYL+ALGTGGIKPCVSS+GADQFDD+DE E+K KSSFF
Sbjct  123   PSCDRTNVCHTTGLRTSVFFLGLYLIALGTGGIKPCVSSFGADQFDDSDENEKKKKSSFF  182

Query  764   NWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKPGGS  943
             NWFYFSIN+GAL+AAS++VWIQ +V WGWGFG+PAVAMA++V  FFSGTRLYR Q+ GGS
Sbjct  183   NWFYFSINIGALIAASVLVWIQTNVGWGWGFGIPAVAMAVSVVSFFSGTRLYRNQRLGGS  242

Query  944   PFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAVVEE  1123
             P TR+ QV+VAS RK  V+VP DKSLL ET   ES + GSRKL HT++L F DKAAV  E
Sbjct  243   PLTRMCQVLVASFRKFHVEVPHDKSLLFETADHESAVIGSRKLDHTDQLSFLDKAAV--E  300

Query  1124  SLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEGMNT  1303
             +  +  KGS + W+LCTVTQVEE KSIIRLLP+WATGIIF+ VY QMGT F+ Q   M+ 
Sbjct  301   TPSDRLKGSANQWKLCTVTQVEEFKSIIRLLPVWATGIIFAAVYSQMGTLFVLQGNTMDL  360

Query  1304  YVG-TFKXPXASLGV  1345
              +G +F+ P ASL +
Sbjct  361   RMGKSFEIPSASLSL  375



>ref|XP_006373974.1| hypothetical protein POPTR_0016s11940g [Populus trichocarpa]
 gb|ERP51771.1| hypothetical protein POPTR_0016s11940g [Populus trichocarpa]
Length=568

 Score =   520 bits (1338),  Expect = 7e-177, Method: Compositional matrix adjust.
 Identities = 250/375 (67%), Positives = 305/375 (81%), Gaps = 3/375 (1%)
 Frame = +2

Query  224   DDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQS  403
             +D +TKDG  D+R  PA KK+TG WKACP+ILGNEC ERLAYYG+++NL+ Y + +LNQS
Sbjct  3     EDGFTKDGAADFRGNPAIKKETGTWKACPYILGNECCERLAYYGINTNLVNYLKFQLNQS  62

Query  404   TTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPGIS  583
                A  N++NWSGTCY+MPL+GAFLADAYLGRYWTIA+FSIIYV GMTL+TLSA++ G+ 
Sbjct  63    NVVAVNNVTNWSGTCYVMPLLGAFLADAYLGRYWTIASFSIIYVFGMTLLTLSASIHGLK  122

Query  584   PTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSFF  763
             P+C   + C  TG  T+V F+ LYL+ALGTGGIKPCVSS+GADQFDD+DE E+K KSSFF
Sbjct  123   PSCDRTNVCHTTGLQTSVFFLGLYLIALGTGGIKPCVSSFGADQFDDSDEDEKKRKSSFF  182

Query  764   NWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKPGGS  943
             NWFYFSIN+GAL+AAS++VWIQ +V WGWGFG+PAVAMA+AV  FFSGTRLYR Q+ GGS
Sbjct  183   NWFYFSINIGALIAASVLVWIQTNVGWGWGFGIPAVAMAIAVVSFFSGTRLYRNQRLGGS  242

Query  944   PFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAVVEE  1123
             P TR+ QV+VAS RK +V+VP+DKSLL ET   ES + GSRKL HT++L FFDKAAV  E
Sbjct  243   PLTRMCQVLVASFRKFRVEVPNDKSLLFETADHESAVMGSRKLDHTDQLSFFDKAAV--E  300

Query  1124  SLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEGMNT  1303
             +  +  KGS + W+LCTVTQVEELKSIIRLLP+WATGIIFS VY QMGT F+ Q   M+ 
Sbjct  301   TPSDRLKGSANQWKLCTVTQVEELKSIIRLLPVWATGIIFSAVYSQMGTLFVLQGNTMDL  360

Query  1304  YVG-TFKXPXASLGV  1345
              +G +F+ P ASL +
Sbjct  361   RMGKSFEIPSASLSL  375



>ref|XP_002323559.2| proton-dependent oligopeptide transport family protein [Populus 
trichocarpa]
 gb|EEF05320.2| proton-dependent oligopeptide transport family protein [Populus 
trichocarpa]
Length=569

 Score =   520 bits (1338),  Expect = 9e-177, Method: Compositional matrix adjust.
 Identities = 256/378 (68%), Positives = 308/378 (81%), Gaps = 5/378 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M E D YT +GT+D    PANKKKTGNWK+C FILGNEC ERLAYYGMS+NL+ Y   RL
Sbjct  1     MAETD-YTNNGTVDIEGNPANKKKTGNWKSCRFILGNECCERLAYYGMSTNLVNYLGDRL  59

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             NQ   +A+ N++NWSGTCY+ PL+GAFLAD+YLGRYWTIA+F IIY++GMTL+TLSA+V 
Sbjct  60    NQGNVAAANNVTNWSGTCYVTPLIGAFLADSYLGRYWTIASFVIIYIIGMTLLTLSASVT  119

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+ P+C   D C  T   TA CF+ALY++ALGTGGIKPCVSS+GADQFD+TDE ERK KS
Sbjct  120   GLKPSC-DKDSCHPTTGQTAACFVALYMIALGTGGIKPCVSSFGADQFDETDETERKKKS  178

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFY SIN+GALVA+S++VWIQ +V WGWGFGVPAVAMA+AV FFF G++LYR QKP
Sbjct  179   SFFNWFYLSINIGALVASSVLVWIQMNVGWGWGFGVPAVAMAVAVVFFFLGSKLYRIQKP  238

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QV+VAS RK  V+VP+DKSLL+ET   ES IQGSRKL HTN+ +FFDKAAV
Sbjct  239   GGSPITRIVQVIVASFRKSNVQVPADKSLLYETAEEESQIQGSRKLEHTNKFKFFDKAAV  298

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               ++ D++ KG  SPWRLCTVTQVEELKSIIRLLP+WA+GI+FSTVY QM T F+ Q   
Sbjct  299   --KTQDDNIKGLTSPWRLCTVTQVEELKSIIRLLPVWASGIVFSTVYSQMSTMFVLQGNT  356

Query  1295  MNTYVGT-FKXPXASLGV  1345
             M+ ++G  F+ P ASL +
Sbjct  357   MDQHMGPHFQIPSASLSL  374



>ref|XP_004492413.1| PREDICTED: peptide transporter PTR1-like isoform X1 [Cicer arietinum]
 ref|XP_004492414.1| PREDICTED: peptide transporter PTR1-like isoform X2 [Cicer arietinum]
Length=568

 Score =   519 bits (1337),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 245/378 (65%), Positives = 301/378 (80%), Gaps = 4/378 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M ED +YT+DGT++   +PANKKKTGNWKAC FILGNEC ERLAYYGMS+NL+ Y   R 
Sbjct  1     MAEDAIYTQDGTINIYKKPANKKKTGNWKACWFILGNECCERLAYYGMSTNLVNYLGQRY  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             NQ   +A+ +++ WSGTCYI PL+GAF+AD+Y GRYWTIA+FSIIYV+GM ++TLSA+VP
Sbjct  61    NQGNAAAANSVTTWSGTCYITPLLGAFVADSYFGRYWTIASFSIIYVIGMVILTLSASVP  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+ P+C A + C  T   TAVC+IALYLVALGTGGIKPCVSS+GADQFD+TDE ERK KS
Sbjct  121   GVKPSCDA-NGCHPTSAQTAVCYIALYLVALGTGGIKPCVSSFGADQFDETDENERKKKS  179

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GALVA+S++VWIQ +V W WGFGVPAVAM +A+ FFF G+ LYR Q P
Sbjct  180   SFFNWFYFSINIGALVASSVLVWIQMNVGWEWGFGVPAVAMIIAIIFFFGGSPLYRIQVP  239

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QV+VA+ RK  ++VP DKSLLHET+ +ES I+GSRKL HTN LR  DKAA+
Sbjct  240   GGSPLTRICQVIVAACRKLSLQVPDDKSLLHETIDVESVIKGSRKLDHTNNLRCLDKAAI  299

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               E+  +  +   +PWRLCTVTQVEELKSII LLP+WA+ I F+TVY QM T F+ Q   
Sbjct  300   --ETQSDRVRNLSNPWRLCTVTQVEELKSIIYLLPVWASLIAFATVYCQMNTMFVLQGNT  357

Query  1295  MNTYVG-TFKXPXASLGV  1345
             M+ ++G  F+ P ASL +
Sbjct  358   MDQHIGPNFQIPSASLSL  375



>ref|XP_009795638.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Nicotiana sylvestris]
Length=578

 Score =   520 bits (1338),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 243/385 (63%), Positives = 302/385 (78%), Gaps = 4/385 (1%)
 Frame = +2

Query  194   MMEQSKAMEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLM  373
             M  +++   +DD YTKDGT+D   +PANKKKTG WKACPFILG+E  ERLAYYGMS+NL+
Sbjct  1     MDIEARMERDDDDYTKDGTVDIYKKPANKKKTGTWKACPFILGDEGCERLAYYGMSTNLV  60

Query  374   IYFQTRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLM  553
              Y Q +LN S  ++S++++NW GTCY+ PL+GAFLADAYLGRYWTIATFS +Y++G+  +
Sbjct  61    NYIQQKLNLSNAASSRSVTNWQGTCYVTPLLGAFLADAYLGRYWTIATFSTLYIIGIAFL  120

Query  554   TLSATVPGISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDE  733
             T+SA++ G+ P C  +  C  TG      F+A+YL+A GTGGIKPCVSS+GADQFDD DE
Sbjct  121   TMSASIGGLKPAC-DNGSCHPTGSQKTAFFVAIYLIAFGTGGIKPCVSSFGADQFDDNDE  179

Query  734   KERKHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTR  913
              E+K KSSFFNWFY SINVGAL+A+S++VWIQ +V WGWGFGVPAVAMA+A+ FFFSGTR
Sbjct  180   TEKKSKSSFFNWFYLSINVGALIASSVLVWIQMNVGWGWGFGVPAVAMAIALVFFFSGTR  239

Query  914   LYRYQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELR  1093
             LYR Q PGGSP TR+ QV VAS+RK  VK P D+SLL+ET  +ESNI+GSRKL H+ E R
Sbjct  240   LYRLQPPGGSPLTRILQVFVASIRKCNVKPPRDESLLYETSDVESNIKGSRKLEHSEEFR  299

Query  1094  FFDKAAVVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQ  1273
             FFDKAAV  E+  +   GSV+PW+LCTVTQVEE+KSIIRLLP+WATGI+FS VY QM T 
Sbjct  300   FFDKAAV--ETGSDKVNGSVNPWKLCTVTQVEEVKSIIRLLPVWATGIVFSCVYSQMSTM  357

Query  1274  FISQAEGMNTYVG-TFKXPXASLGV  1345
             F+ Q   M+ ++G  F  P A L +
Sbjct  358   FVLQGNIMDQHIGPNFTIPSACLSI  382



>ref|XP_009421313.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009421314.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009421315.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009421316.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Musa acuminata 
subsp. malaccensis]
Length=580

 Score =   519 bits (1336),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 243/375 (65%), Positives = 298/375 (79%), Gaps = 6/375 (2%)
 Frame = +2

Query  224   DDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQS  403
             D  YT+DGT D   RPA +K TGNW+ACP+IL NEC ERLAYYGMS+NL+ Y + RLNQ 
Sbjct  5     DKRYTEDGTTDVHGRPAVRKNTGNWRACPYILANECCERLAYYGMSTNLVNYMKDRLNQG  64

Query  404   TTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPGIS  583
                A+ N++NWSGTCYI PL+GAF+ADAYLGRY TIA+F I+Y++G+ L+T++A+V G+ 
Sbjct  65    NAKAANNVTNWSGTCYITPLLGAFIADAYLGRYRTIASFMIVYIIGLILLTMTASVEGLK  124

Query  584   PTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSFF  763
               C  H  C  T   TAV F+ALYL+ALGTGGIKPCVSS+GADQFD++DE E+K KSSFF
Sbjct  125   APC-NHGVCDPTTAQTAVVFVALYLIALGTGGIKPCVSSFGADQFDESDESEKKRKSSFF  183

Query  764   NWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKPGGS  943
             NWFYFSIN+GAL+A+S++VWIQ +V WGWGFG+PAV M++AV  FF GT LYR+QKPGGS
Sbjct  184   NWFYFSINIGALIASSVLVWIQNNVGWGWGFGIPAVVMSIAVVSFFLGTPLYRHQKPGGS  243

Query  944   PFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAVVEE  1123
             P TR+ QV+VASLRK  + VP DKSLL+E    ES IQGSRKL HT+E +F DKAA+V +
Sbjct  244   PITRVAQVIVASLRKSGMDVPDDKSLLYEVADKESVIQGSRKLGHTDEFKFLDKAAIVTQ  303

Query  1124  SLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEGMNT  1303
                EDK   VSPW+LCTVTQVEELKS++RLLPIWATGI+FSTVYGQMGT F+ Q   ++ 
Sbjct  304   ---EDKN-PVSPWKLCTVTQVEELKSVVRLLPIWATGIVFSTVYGQMGTMFVLQGNTLDP  359

Query  1304  YVGT-FKXPXASLGV  1345
             Y+G  FK P ASL +
Sbjct  360   YMGPHFKIPAASLSI  374



>ref|XP_006363097.1| PREDICTED: peptide transporter PTR1-like [Solanum tuberosum]
Length=570

 Score =   518 bits (1334),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 246/379 (65%), Positives = 304/379 (80%), Gaps = 9/379 (2%)
 Frame = +2

Query  218   EEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  397
             E+D+ + KDGT+DY+N PA K +TG W+ACP+ILGNEC ERLAYYG+++NL+ Y + ++N
Sbjct  3     EDDNKFVKDGTVDYKNNPAIKNQTGTWRACPYILGNECCERLAYYGINTNLVNYLKYQMN  62

Query  398   QSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPG  577
             +S+  A  N++NWSGTCY+ PL+GAFLADAYLGR+WTIA FSIIYV GMT++TLSA++ G
Sbjct  63    ESSVVAVNNVTNWSGTCYVTPLLGAFLADAYLGRFWTIAAFSIIYVFGMTVLTLSASIHG  122

Query  578   ISPTCIAHDK--CTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHK  751
             + P C  HD   C   G    + ++ LYL+ALGTGGIKPCVSS+GADQFDD+DE E+K K
Sbjct  123   LKPPC-DHDNNSCHPKGLQIGIFYLGLYLIALGTGGIKPCVSSFGADQFDDSDETEKKKK  181

Query  752   SSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQK  931
             SSFFNWFYFSIN+GALVA++++VWIQ +V WGWGFG+PAVAMA+AV  FFSGT+LYR QK
Sbjct  182   SSFFNWFYFSINIGALVASTVLVWIQTNVGWGWGFGIPAVAMAIAVVSFFSGTKLYRNQK  241

Query  932   PGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAA  1111
             PGGSP TR+FQVVVAS RK KVK   D S+L ET   ES +QGSRKL HT +L FFDKAA
Sbjct  242   PGGSPLTRIFQVVVASFRKIKVK---DTSVLFETNDEESVVQGSRKLDHTQQLSFFDKAA  298

Query  1112  VVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAE  1291
             V  E+  E  KGS++PW LCTVTQVEELKSIIRLLPIWATGIIFS+VY QMGT F+ Q  
Sbjct  299   V--ETQSEKIKGSINPWSLCTVTQVEELKSIIRLLPIWATGIIFSSVYSQMGTLFVLQGN  356

Query  1292  GMNTYV-GTFKXPXASLGV  1345
              M+ ++  +F+ P ASL +
Sbjct  357   TMDLHMTKSFEIPSASLSL  375



>emb|CBI30424.3| unnamed protein product [Vitis vinifera]
Length=1454

 Score =   543 bits (1398),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 255/378 (67%), Positives = 306/378 (81%), Gaps = 3/378 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M E+D+YTKDGT+D+R+ PA KK+TG WKACP+ILGNEC ERLAYYG+++NL+ Y + +L
Sbjct  1     MAEEDIYTKDGTIDFRSNPAVKKETGTWKACPYILGNECCERLAYYGINTNLVNYLKFQL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             NQ    A  N++NWSGTCY+ PL+GAFLADAYLGRYWTIA FSIIYV GMTL+TLSA+  
Sbjct  61    NQRNVVAINNVTNWSGTCYVTPLLGAFLADAYLGRYWTIAGFSIIYVFGMTLLTLSASAH  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+ P C   + C  TG  TAV F+ LYL+ALGTGGIKPCVSS+GADQFDD+DE ERK KS
Sbjct  121   GLKPLCDGQNVCYPTGLQTAVFFVGLYLIALGTGGIKPCVSSFGADQFDDSDETERKSKS  180

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GAL+A+S++VW+Q +V WGWGFG+PAVAM +AV  FFSGTRLYR QKP
Sbjct  181   SFFNWFYFSINIGALLASSVLVWVQTNVGWGWGFGIPAVAMGIAVMSFFSGTRLYRNQKP  240

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QV+VASLRK +V+VP+DK LL+ET   ES + GSRKL HT  L FFDKAAV
Sbjct  241   GGSPLTRICQVIVASLRKFQVEVPADKCLLYETADSESAVTGSRKLDHTKHLSFFDKAAV  300

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               E+  +  KGSV  WRLCTVTQVEELKSIIRLLPIWATGI+FS VY QMGT F+ Q   
Sbjct  301   --ETHIDAIKGSVDSWRLCTVTQVEELKSIIRLLPIWATGIVFSAVYSQMGTLFVLQGNT  358

Query  1295  MNTYV-GTFKXPXASLGV  1345
             M+ ++ G+F+ P ASL +
Sbjct  359   MDLHITGSFQIPSASLSL  376


 Score =   540 bits (1391),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 255/378 (67%), Positives = 305/378 (81%), Gaps = 4/378 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M EDD+YTKDGT++  N+PANKKKTG WKAC FILGNEC ERLAYYGMS+NL+ Y Q RL
Sbjct  663   MAEDDMYTKDGTMNIHNKPANKKKTGQWKACRFILGNECCERLAYYGMSTNLVNYLQIRL  722

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             NQ   +AS N++NWSGTCYI PL+GAFLADAY GR+W IA FSIIY  GM L+T++A++ 
Sbjct  723   NQGNVTASNNVTNWSGTCYITPLIGAFLADAYFGRFWIIAIFSIIYFCGMVLLTMTASIK  782

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+ P+C   + C  T   +AVCFIALYL+ALGTGGIKPCVSS+GADQFD  DE E+K KS
Sbjct  783   GLRPSC-DDNGCDPTKLQSAVCFIALYLIALGTGGIKPCVSSFGADQFDVNDEAEKKKKS  841

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFY SINVGAL+A+S++VWIQ +V WGWGFG+PAVAMA+AV  FFSG+R+YR QKP
Sbjct  842   SFFNWFYLSINVGALIASSVLVWIQMNVGWGWGFGIPAVAMAIAVVSFFSGSRMYRLQKP  901

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QV+VAS RK  VKVP++KSLL+ET   ESNI+GS KL HT +LRFFDKAAV
Sbjct  902   GGSPLTRICQVLVASTRKYHVKVPNNKSLLYETKDAESNIKGSCKLEHTEKLRFFDKAAV  961

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               ES  +  K S +PW+LCTVTQVEELKSI+RLLP+WATGI+FSTVY QM T F+ Q   
Sbjct  962   EVES--DHVKSSNNPWKLCTVTQVEELKSILRLLPVWATGILFSTVYSQMSTMFVLQGNT  1019

Query  1295  MNTYVG-TFKXPXASLGV  1345
             M+ ++G  FK P ASL +
Sbjct  1020  MDQHMGPNFKIPSASLSL  1037



>ref|XP_008775060.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Phoenix dactylifera]
Length=576

 Score =   517 bits (1331),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 246/379 (65%), Positives = 299/379 (79%), Gaps = 5/379 (1%)
 Frame = +2

Query  215   MEE-DDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTR  391
             MEE +D YTKDGT D    PA +K TGNW+ACP+IL NEC ERLAYYGMS+NL+ Y +  
Sbjct  1     MEEAEDKYTKDGTTDIHGNPAVRKGTGNWRACPYILANECCERLAYYGMSTNLVNYLKDH  60

Query  392   LNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATV  571
             L+Q  ++A+ N++NWSGTCYI+PL+GAFLADAYLGRYWTIA+F IIY+ G+TL+TL+A+V
Sbjct  61    LHQGNSTAANNVTNWSGTCYILPLLGAFLADAYLGRYWTIASFMIIYIFGLTLLTLTASV  120

Query  572   PGISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHK  751
              G+ P C  +  C  T   +AV F+ALYLVALGTGGIKPCVSS+GADQFDD+DE E+K K
Sbjct  121   GGLKPAC-RNGVCDPTNAQSAVFFVALYLVALGTGGIKPCVSSFGADQFDDSDESEKKRK  179

Query  752   SSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQK  931
             SSFFNWFYFSIN+GALVAA ++VWIQ++  WGWGFG+PAV M++AV  FFSGT LYR+QK
Sbjct  180   SSFFNWFYFSINIGALVAALVLVWIQENKGWGWGFGIPAVVMSIAVVSFFSGTALYRHQK  239

Query  932   PGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAA  1111
             PGGSP TR+ QVVVAS RK   KVP+DKSLL+E    ES IQGSRKL HTN+  F DKAA
Sbjct  240   PGGSPLTRIAQVVVASFRKSGAKVPADKSLLYEIPEKESAIQGSRKLEHTNQFEFLDKAA  299

Query  1112  VVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAE  1291
             V   S DE   G   PW LCTVTQVEELKS++R+LPIWA+GI+F+TVY QMGT F+ Q +
Sbjct  300   V--RSQDEKIGGPADPWMLCTVTQVEELKSVLRILPIWASGIVFATVYSQMGTMFVLQGD  357

Query  1292  GMNTYVGT-FKXPXASLGV  1345
              ++  +G  FK P AS+ V
Sbjct  358   TLDRRMGPHFKIPAASVSV  376



>gb|EYU41841.1| hypothetical protein MIMGU_mgv1a017650mg [Erythranthe guttata]
Length=568

 Score =   515 bits (1327),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 247/380 (65%), Positives = 300/380 (79%), Gaps = 9/380 (2%)
 Frame = +2

Query  215   MEED--DVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQT  388
             ME+D  D+YTKDGT+D+  +PANK KTG WKAC FIL  EC ERLAYYGM +NL+ Y  T
Sbjct  1     MEDDKADIYTKDGTVDFYKKPANKDKTGTWKACRFILVTECCERLAYYGMGTNLVNYLTT  60

Query  389   RLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSAT  568
             RL     +AS +++NWSGTCYI PL+GAFLAD+YLGRYWTIATFS IYV+GM L+T+SA+
Sbjct  61    RLGLGNVAASNSVTNWSGTCYITPLLGAFLADSYLGRYWTIATFSSIYVLGMALLTMSAS  120

Query  569   VPGISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKH  748
             +PG+ P C+  D C  T   TA  F ALYL+ALGTGGIKPCVSS+GADQFD++DE E+K 
Sbjct  121   IPGLKPECV-DDVCHPTSSQTATFFAALYLIALGTGGIKPCVSSFGADQFDESDETEKKK  179

Query  749   KSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQ  928
             KSSFFN+FY SIN+GA++A+S++VWIQ +V WGWGFGVPAV+MA+AV FFF GT LYR Q
Sbjct  180   KSSFFNYFYLSINIGAMIASSVLVWIQMNVGWGWGFGVPAVSMAVAVIFFFVGTSLYRIQ  239

Query  929   KPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKA  1108
              PGGSP TR+ QV+VA ++K  V+VP DKSLL+ET   ESNIQGSRKL HT++ RF DKA
Sbjct  240   LPGGSPLTRICQVLVACMKKVNVEVPMDKSLLYETDDNESNIQGSRKLEHTDKFRFLDKA  299

Query  1109  AVVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQA  1288
             AV  ES DE+    V PW LCTVTQVEE KS++RLLPIWATGI+FSTVY QM T F+ Q 
Sbjct  300   AVATES-DEN----VKPWSLCTVTQVEEFKSVLRLLPIWATGIVFSTVYSQMSTMFVLQG  354

Query  1289  EGMNTYVG-TFKXPXASLGV  1345
             + M+ ++G  FK P ASL +
Sbjct  355   DTMDQHLGRNFKIPAASLSL  374



>ref|XP_009358875.1| PREDICTED: uncharacterized protein LOC103949485 [Pyrus x bretschneideri]
Length=1143

 Score =   533 bits (1374),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 254/379 (67%), Positives = 302/379 (80%), Gaps = 4/379 (1%)
 Frame = +2

Query  212   AMEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTR  391
             AM +DD+YT DGTLD   +PANKKKTGNWKAC FILGNEC ERLAYYGMS+NL+ Y + R
Sbjct  575   AMADDDLYTNDGTLDIHKKPANKKKTGNWKACRFILGNECCERLAYYGMSTNLVNYLEKR  634

Query  392   LNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATV  571
             L     +A+ ++SNWSGTCY  PL+GAFLADAYLGRYWTIA FSI+YV+GMTL+TL+A++
Sbjct  635   LGMGNVTAATSVSNWSGTCYATPLIGAFLADAYLGRYWTIAIFSIVYVLGMTLLTLTASI  694

Query  572   PGISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHK  751
              G+ P C     C  T    A CF+ALYL+A+GTGGIKPCVSS+GADQFD+TDE ERK K
Sbjct  695   NGLKPHCDI-SGCNTTSSQRAACFVALYLIAVGTGGIKPCVSSFGADQFDETDETERKKK  753

Query  752   SSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQK  931
             SSFFNWFY SINVGAL+A++++VW+Q +V W WGFGVPAVAM +AV FFF G++LYR QK
Sbjct  754   SSFFNWFYMSINVGALIASTVLVWMQMNVGWNWGFGVPAVAMGIAVAFFFLGSKLYRLQK  813

Query  932   PGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAA  1111
             PGGSP TR+ QVV AS+RK KVKVP+DKSLL+ET   E NIQGSRKL HTN+L FFDKAA
Sbjct  814   PGGSPLTRIAQVVAASIRKCKVKVPADKSLLYETADEECNIQGSRKLEHTNKLGFFDKAA  873

Query  1112  VVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAE  1291
             V  ES     K   SPW LCTVTQVEELKSIIR+LPIWA+GI+F+TVYGQM T F+ Q  
Sbjct  874   V--ESETNRAKELPSPWSLCTVTQVEELKSIIRVLPIWASGIVFATVYGQMSTMFVLQGN  931

Query  1292  GMNTYVG-TFKXPXASLGV  1345
              ++ ++G  FK P ASL +
Sbjct  932   TLDQHMGPNFKIPSASLSL  950


 Score =   526 bits (1354),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 252/378 (67%), Positives = 305/378 (81%), Gaps = 3/378 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             MEE+D++TKDGT DY+NRPA KK TG WKACP+ILGNEC ERLAYYG+++NL+ Y + +L
Sbjct  1     MEEEDIHTKDGTTDYQNRPAIKKNTGTWKACPYILGNECCERLAYYGINTNLVNYLKFQL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             NQ    A  N++NWSGTCY+ PL+GAFLADAY+GRYWTIA FSIIYV GMTL+TLSA++ 
Sbjct  61    NQRNVVAVNNVTNWSGTCYVTPLLGAFLADAYMGRYWTIAAFSIIYVFGMTLLTLSASIQ  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+ P C  ++ C  TG  T V F  LYL+ALGTGGIKPCVSS+GADQFDD+D+ E+K+KS
Sbjct  121   GLKPPCDNNNVCHPTGLQTGVFFTGLYLIALGTGGIKPCVSSFGADQFDDSDDAEKKNKS  180

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GALVA+S++VWIQ +V W WGFG+PAVAMALAV  FFSGTRLYR Q P
Sbjct  181   SFFNWFYFSINIGALVASSVLVWIQTNVGWSWGFGIPAVAMALAVVSFFSGTRLYRTQIP  240

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QV+VAS RK +V+VP DKSLL+ET   ES ++GSRKL HT++L F DKAAV
Sbjct  241   GGSPLTRICQVLVASFRKFRVRVPRDKSLLYETADQESVVKGSRKLDHTDQLSFLDKAAV  300

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               E+  +  KGS  PWRLC+VTQVEE KS+IRLLPIWATGIIFS VY QMGT F+ Q   
Sbjct  301   --ETQSDKVKGSAMPWRLCSVTQVEEHKSLIRLLPIWATGIIFSAVYSQMGTLFVLQGNT  358

Query  1295  MNTYVG-TFKXPXASLGV  1345
             M+ +V  +F+ P ASL +
Sbjct  359   MDLHVSKSFEIPSASLSL  376



>ref|XP_006398647.1| hypothetical protein EUTSA_v10013125mg [Eutrema salsugineum]
 gb|ESQ40100.1| hypothetical protein EUTSA_v10013125mg [Eutrema salsugineum]
Length=565

 Score =   515 bits (1326),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 241/374 (64%), Positives = 297/374 (79%), Gaps = 4/374 (1%)
 Frame = +2

Query  227   DVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQST  406
             D++T+DGTLD   +PANK+KTG WKAC FILG EC ERLAYYGMS NL+ Y +  L+   
Sbjct  2     DMFTQDGTLDIHKKPANKEKTGTWKACRFILGTECCERLAYYGMSINLVNYVEKHLSMGN  61

Query  407   TSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPGISP  586
              +AS +++NWSGTCY  PL+GAFLADAYLGRY+TIA+F I+Y+ GMTL+TLSA+VPG++P
Sbjct  62    VAASNSVTNWSGTCYATPLIGAFLADAYLGRYFTIASFVIVYICGMTLLTLSASVPGLTP  121

Query  587   TCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSFFN  766
             TC   D C ATG  TA+ F+ALYL+ALGTGGIKPCVSS+GADQFDDTDE ER+ KSSFFN
Sbjct  122   TCNGED-CHATGGQTAITFVALYLIALGTGGIKPCVSSFGADQFDDTDEVERESKSSFFN  180

Query  767   WFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKPGGSP  946
             WFYF INVGA++A+S++VWIQ ++ WGWGFG+P VAMALAV  FF+G++ YR QKPGGSP
Sbjct  181   WFYFVINVGAMIASSVLVWIQMNIGWGWGFGIPTVAMALAVLLFFAGSKFYRLQKPGGSP  240

Query  947   FTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAVVEES  1126
              TR+ QV+VAS RK KVK+P D+SLL+E    ESNIQGSRKL HT +L FFDKAAV  ES
Sbjct  241   ITRMLQVIVASFRKSKVKLPEDESLLYEIQDAESNIQGSRKLEHTTKLTFFDKAAVETES  300

Query  1127  LDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEGMNTY  1306
               + K  + S W+LCTVTQVEELK++I LLP+WA+GI+F+ VY QM T F+ Q   M+  
Sbjct  301   --DKKDAAKSAWKLCTVTQVEELKALIGLLPVWASGIVFAAVYSQMSTMFVLQGNTMDKR  358

Query  1307  VGT-FKXPXASLGV  1345
             +G  F  P ASL +
Sbjct  359   MGPHFTIPSASLSL  372



>ref|XP_011003660.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like isoform X1 [Populus 
euphratica]
Length=576

 Score =   515 bits (1326),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 255/385 (66%), Positives = 312/385 (81%), Gaps = 5/385 (1%)
 Frame = +2

Query  194   MMEQSKAMEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLM  373
             M  + + M E D YT +GT+D +  PA+KKKTGNWK+C FILGNEC ERLAYYGMS+NL+
Sbjct  1     MKVRKETMAEAD-YTNNGTVDIKGNPADKKKTGNWKSCRFILGNECCERLAYYGMSTNLV  59

Query  374   IYFQTRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLM  553
              Y   RLNQ   +A+ N++NWSGTCY+ PL+GAFLAD+YLGRYWTIA+F IIY++GMTL+
Sbjct  60    NYLGDRLNQGNVAAANNVTNWSGTCYVTPLIGAFLADSYLGRYWTIASFVIIYIVGMTLL  119

Query  554   TLSATVPGISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDE  733
             TLSA+V G+ P+C   D C  T   TA CF+ALY++ALGTGGIKPCVSS+GADQFD+TDE
Sbjct  120   TLSASVTGLKPSC-NKDSCYPTTGQTAACFVALYMIALGTGGIKPCVSSFGADQFDETDE  178

Query  734   KERKHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTR  913
              ER+ KSSFFNWFY SIN+GALVA+S++VWIQ +V WGWGFGVPAV MA+AV FFF G++
Sbjct  179   TEREKKSSFFNWFYLSINIGALVASSVLVWIQMNVGWGWGFGVPAVVMAVAVVFFFLGSK  238

Query  914   LYRYQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELR  1093
             LYR QKPGGSP TR+ QV+VAS RK  V+VP+DKSLL+ETV  ES IQGSRKL HTN+ +
Sbjct  239   LYRIQKPGGSPITRIVQVIVASFRKSNVQVPADKSLLYETVEEESQIQGSRKLEHTNKFK  298

Query  1094  FFDKAAVVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQ  1273
             FFDKAAV  ++ D++ KG  SPWRLCTVTQVEELKSIIRLLP+WA+GI+FSTVY QM T 
Sbjct  299   FFDKAAV--KTQDDNIKGLTSPWRLCTVTQVEELKSIIRLLPVWASGIVFSTVYSQMSTM  356

Query  1274  FISQAEGMNTYVGT-FKXPXASLGV  1345
             F+ Q   M+ ++G  F+ P ASL +
Sbjct  357   FVLQGNTMDQHLGPHFQIPSASLSL  381



>ref|XP_011019153.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1 [Populus euphratica]
Length=567

 Score =   514 bits (1325),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 252/378 (67%), Positives = 308/378 (81%), Gaps = 5/378 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M +DD Y+ DGT+D +  PANK+KTG WKAC FILGNEC ERLAYYGMS+NL+ Y + RL
Sbjct  1     MAQDD-YSNDGTVDIKGNPANKEKTGKWKACRFILGNECCERLAYYGMSTNLVNYLEDRL  59

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             NQ   +AS N++NWSGTCYI PL+GAFLAD+YLGRYWTIA+F +IY++GMTL+TLSA+VP
Sbjct  60    NQGNVAASNNVTNWSGTCYITPLIGAFLADSYLGRYWTIASFVVIYIIGMTLLTLSASVP  119

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G++P+C   D C  T   TA  F+ALY +ALGTGGIKPCVSS+GADQFD+TDE ERK KS
Sbjct  120   GLAPSC-DKDSCHPTTGQTAAFFVALYFIALGTGGIKPCVSSFGADQFDETDETERKKKS  178

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFY SIN+GAL+A+S++VWIQ +V WGWGFG+PAV MA+AV FFF G++LYR QKP
Sbjct  179   SFFNWFYLSINIGALIASSVLVWIQMNVGWGWGFGIPAVVMAVAVVFFFLGSKLYRIQKP  238

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QV+VAS RK +V+VP+DKSLL+ET G  S IQGSRKL HT++ +FFDKAAV
Sbjct  239   GGSPITRIVQVIVASSRKYRVQVPADKSLLYETTGEGSQIQGSRKLEHTDKFKFFDKAAV  298

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               E+  ++ KG  SPWRLCTVTQVEELKSIIRLLP+WA+GI+F+TVY QM T F+ Q   
Sbjct  299   --ETQTDNIKGLTSPWRLCTVTQVEELKSIIRLLPVWASGIVFATVYSQMSTMFVLQGNT  356

Query  1295  MNTY-VGTFKXPXASLGV  1345
             M+ + V  FK P ASL +
Sbjct  357   MDQHMVPHFKIPSASLSL  374



>ref|XP_003604615.1| Peptide transporter PTR1 [Medicago truncatula]
 gb|AES86812.1| proton-dependent oligopeptide transport family protein [Medicago 
truncatula]
Length=577

 Score =   514 bits (1323),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 244/377 (65%), Positives = 293/377 (78%), Gaps = 4/377 (1%)
 Frame = +2

Query  218   EEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  397
             EED +YT+DGT+D    PANKKKTGNWKAC FILGNEC ERLAYYGMS+NL+ Y + R  
Sbjct  12    EEDGLYTEDGTIDIHKNPANKKKTGNWKACRFILGNECCERLAYYGMSTNLVNYLEDRYG  71

Query  398   QSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPG  577
                 +A+  ++ WSGTCYI PL+GAFLADAYLGRYWTIA+FS IYV+GM L+T SA  PG
Sbjct  72    LGNAAAANTVTTWSGTCYITPLLGAFLADAYLGRYWTIASFSSIYVIGMGLLTFSAIAPG  131

Query  578   ISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSS  757
             + P+C   D C  T   TA  FIALYL+ALGTGGIKPCVSS+GADQFD+ DE ERK KSS
Sbjct  132   LKPSC-DTDGCHPTSGQTAALFIALYLIALGTGGIKPCVSSFGADQFDENDETERKKKSS  190

Query  758   FFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKPG  937
             FFNWFYFSIN+GAL+A+S++VWIQ +V WGWGFGVP VAM +A+ FFF G+R YR Q PG
Sbjct  191   FFNWFYFSINIGALIASSVLVWIQMNVGWGWGFGVPGVAMVIAIIFFFIGSRWYRLQIPG  250

Query  938   GSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAVV  1117
             GSP TR+ QV+VA+ +K   +VP DKSLL+ET  +ESNI+GSRKL HTNEL+  DKAAV 
Sbjct  251   GSPLTRICQVIVAAFKKLGQQVPDDKSLLYETTDVESNIKGSRKLEHTNELKCLDKAAVE  310

Query  1118  EESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEGM  1297
              ES  +  K   +PWRLCTVTQVEELKS++RLLP+WA+ I F+TVY QMGT F+ Q   M
Sbjct  311   TES--DRIKDLPNPWRLCTVTQVEELKSVVRLLPVWASLIAFATVYSQMGTMFVLQGNTM  368

Query  1298  NTYVG-TFKXPXASLGV  1345
             + ++G  FK P ASL +
Sbjct  369   DQHIGPKFKIPSASLSL  385



>gb|KHN42300.1| Peptide transporter PTR1 [Glycine soja]
Length=576

 Score =   513 bits (1322),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 242/384 (63%), Positives = 300/384 (78%), Gaps = 5/384 (1%)
 Frame = +2

Query  197   MEQSKAMEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMI  376
             +++S    ED +YT+DGT+D   +PA KKKTGNWKAC FILGNEC ERLAYYGMS+NL+ 
Sbjct  4     VKKSHDEAEDSLYTEDGTVDIYKKPAIKKKTGNWKACRFILGNECCERLAYYGMSTNLVN  63

Query  377   YFQTRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMT  556
             Y QTR +Q   +A+ N+S WSGTCYI PL+GAFLAD+Y+GRYWTIA+FS IYV+GM+L+T
Sbjct  64    YLQTRFHQGNATAATNVSTWSGTCYITPLLGAFLADSYMGRYWTIASFSTIYVIGMSLLT  123

Query  557   LSATVPGISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEK  736
              SA  PG+ P+C A + C  T   T  CFIALYL+ALGTGGIKPCVSS+GADQFD+ D+ 
Sbjct  124   FSAIAPGLKPSCGA-NGCYPTSGQTTACFIALYLIALGTGGIKPCVSSFGADQFDENDDF  182

Query  737   ERKHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRL  916
             ERK KSSFFNWFYFSIN+G+L+A+S++VWIQ +V WGWGFGVP VAM +A+TFFF G++ 
Sbjct  183   ERKKKSSFFNWFYFSINIGSLIASSVLVWIQMNVGWGWGFGVPTVAMVIAITFFFIGSKW  242

Query  917   YRYQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRF  1096
             YR Q PGGSP TR+ QV+VA+ RK +++VP +KSLL+ET  +ESNI+GSRKL HTNEL+ 
Sbjct  243   YRLQLPGGSPLTRICQVIVAASRKARLQVPDNKSLLYETADVESNIKGSRKLGHTNELKC  302

Query  1097  FDKAAVVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQF  1276
              DKAA+  ES   D     + WRLCTVTQVEELKSII LLP+WAT I F+TVY QM T F
Sbjct  303   LDKAAIETES---DHTNWPNSWRLCTVTQVEELKSIIHLLPVWATMIAFATVYSQMSTMF  359

Query  1277  ISQAEGMNTYVGT-FKXPXASLGV  1345
             + Q   M+ ++G  F  P ASL +
Sbjct  360   VLQGNKMDQHIGQHFTIPSASLSL  383



>ref|XP_003516940.1| PREDICTED: peptide transporter PTR1-like isoform X1 [Glycine 
max]
 ref|XP_006573342.1| PREDICTED: peptide transporter PTR1-like isoform X2 [Glycine 
max]
Length=576

 Score =   513 bits (1322),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 243/382 (64%), Positives = 299/382 (78%), Gaps = 5/382 (1%)
 Frame = +2

Query  203   QSKAMEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYF  382
             +S  + ED +YT+DGT+D   +PA KKKTGNWKAC FILGNEC ERLAYYGMS+NL+ Y 
Sbjct  6     KSHDVGEDSLYTEDGTVDIYKKPAIKKKTGNWKACRFILGNECCERLAYYGMSTNLVNYL  65

Query  383   QTRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLS  562
             QTR +Q   +A+ N+S WSGTCYI PL+GAFLAD+Y+GRYWTIA+FS IYV+GM+L+T S
Sbjct  66    QTRFHQGNATAATNVSTWSGTCYITPLLGAFLADSYMGRYWTIASFSTIYVIGMSLLTFS  125

Query  563   ATVPGISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKER  742
             A  PG+ P+C A + C  T   T  CFIALYL+ALGTGGIKPCVSS+GADQFD+ D+ ER
Sbjct  126   AIAPGLKPSCGA-NGCYPTSGQTTACFIALYLIALGTGGIKPCVSSFGADQFDENDDFER  184

Query  743   KHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYR  922
             K KSSFFNWFYFSIN+G+L+A+S++VWIQ +V WGWGFGVP VAM +AVTFFF G++ YR
Sbjct  185   KKKSSFFNWFYFSINIGSLIASSVLVWIQMNVGWGWGFGVPTVAMVIAVTFFFIGSKWYR  244

Query  923   YQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFD  1102
              Q PGGSP TR+ QV+VA+ RK +++VP +KSLL+ET  +ESNI+GSRKL HTNEL+  D
Sbjct  245   LQLPGGSPLTRICQVIVAASRKARLQVPDNKSLLYETADVESNIKGSRKLGHTNELKCLD  304

Query  1103  KAAVVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFIS  1282
             KAA+  ES   D     + WRLCTVTQVEELKSII LLP+WAT I F+TVY QM T F+ 
Sbjct  305   KAAIETES---DHTNWPNSWRLCTVTQVEELKSIIHLLPVWATMIAFATVYSQMSTMFVL  361

Query  1283  QAEGMNTYVGT-FKXPXASLGV  1345
             Q   M+ ++G  F  P ASL +
Sbjct  362   QGNKMDQHIGQHFTIPSASLSL  383



>ref|XP_011003661.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like isoform X2 [Populus 
euphratica]
Length=569

 Score =   513 bits (1321),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 254/378 (67%), Positives = 309/378 (82%), Gaps = 5/378 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M E D YT +GT+D +  PA+KKKTGNWK+C FILGNEC ERLAYYGMS+NL+ Y   RL
Sbjct  1     MAEAD-YTNNGTVDIKGNPADKKKTGNWKSCRFILGNECCERLAYYGMSTNLVNYLGDRL  59

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             NQ   +A+ N++NWSGTCY+ PL+GAFLAD+YLGRYWTIA+F IIY++GMTL+TLSA+V 
Sbjct  60    NQGNVAAANNVTNWSGTCYVTPLIGAFLADSYLGRYWTIASFVIIYIVGMTLLTLSASVT  119

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+ P+C   D C  T   TA CF+ALY++ALGTGGIKPCVSS+GADQFD+TDE ER+ KS
Sbjct  120   GLKPSC-NKDSCYPTTGQTAACFVALYMIALGTGGIKPCVSSFGADQFDETDETEREKKS  178

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFY SIN+GALVA+S++VWIQ +V WGWGFGVPAV MA+AV FFF G++LYR QKP
Sbjct  179   SFFNWFYLSINIGALVASSVLVWIQMNVGWGWGFGVPAVVMAVAVVFFFLGSKLYRIQKP  238

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QV+VAS RK  V+VP+DKSLL+ETV  ES IQGSRKL HTN+ +FFDKAAV
Sbjct  239   GGSPITRIVQVIVASFRKSNVQVPADKSLLYETVEEESQIQGSRKLEHTNKFKFFDKAAV  298

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               ++ D++ KG  SPWRLCTVTQVEELKSIIRLLP+WA+GI+FSTVY QM T F+ Q   
Sbjct  299   --KTQDDNIKGLTSPWRLCTVTQVEELKSIIRLLPVWASGIVFSTVYSQMSTMFVLQGNT  356

Query  1295  MNTYVGT-FKXPXASLGV  1345
             M+ ++G  F+ P ASL +
Sbjct  357   MDQHLGPHFQIPSASLSL  374



>ref|XP_010262762.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Nelumbo nucifera]
 ref|XP_010262763.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Nelumbo nucifera]
 ref|XP_010262764.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Nelumbo nucifera]
Length=568

 Score =   513 bits (1320),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 254/378 (67%), Positives = 304/378 (80%), Gaps = 4/378 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M EDD+YTKDG+ D   +PA ++ TGNWKAC FILGNEC ERLAYYGMS+NL+ Y Q RL
Sbjct  1     MAEDDIYTKDGSTDIHKKPAIRRTTGNWKACFFILGNECCERLAYYGMSTNLVNYLQIRL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             NQS  +AS N++NW+GTCYI PLVGAFLADAYLGRYWTIA+FSIIY +GMTL+TLSA+VP
Sbjct  61    NQSNVTASNNVTNWAGTCYITPLVGAFLADAYLGRYWTIASFSIIYFLGMTLLTLSASVP  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+ P+C     C  TG  + +CF+ALYL+ALGTGGIKPCVSS+GADQFD+ DE E+K KS
Sbjct  121   GLKPSCDGM-VCHPTGSQSVICFLALYLIALGTGGIKPCVSSFGADQFDENDEDEKKKKS  179

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFN+FYFSIN+GAL+A+S++VWIQ +V WGWGFG+PAVAMA+AV  FFSGTRLYR+Q P
Sbjct  180   SFFNFFYFSINIGALIASSVLVWIQMNVGWGWGFGIPAVAMAIAVMSFFSGTRLYRHQNP  239

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGS  TR+ QV+VAS RK K K+P D +LL+ET G ES I GSRKL HT  +RF DKAAV
Sbjct  240   GGSALTRICQVLVASFRKIKEKIPDDGNLLYETTGAESAIIGSRKLDHTKGMRFLDKAAV  299

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               E+  +  K SV PWRLCTVTQVEELKSIIRLLPIWA+GI FSTVY Q+ T F+ Q   
Sbjct  300   --ETQTDKIKASVDPWRLCTVTQVEELKSIIRLLPIWASGIAFSTVYSQISTMFVLQGNT  357

Query  1295  MNTYVGT-FKXPXASLGV  1345
             M+ ++G  F+ P ASL +
Sbjct  358   MDPHMGPHFQIPSASLSI  375



>ref|XP_004506789.1| PREDICTED: peptide transporter PTR1-like isoform X1 [Cicer arietinum]
 ref|XP_004506790.1| PREDICTED: peptide transporter PTR1-like isoform X2 [Cicer arietinum]
 ref|XP_004506791.1| PREDICTED: peptide transporter PTR1-like isoform X3 [Cicer arietinum]
Length=578

 Score =   513 bits (1320),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 240/386 (62%), Positives = 296/386 (77%), Gaps = 4/386 (1%)
 Frame = +2

Query  191   QMMEQSKAMEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNL  370
              + ++ + +E D  YT+DGT+D   +PANKKKTGNWKAC FILGNEC ERLAYYGMS+NL
Sbjct  3     DITKKYEVVERDGSYTEDGTIDIHKKPANKKKTGNWKACSFILGNECCERLAYYGMSTNL  62

Query  371   MIYFQTRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTL  550
             + Y Q    Q   +A+  ++ WSGTCY+ PL+GAFLAD+Y GRYWTIA FS IYV+GM L
Sbjct  63    VNYLQDHYGQGNATAANTVTTWSGTCYLTPLLGAFLADSYFGRYWTIAGFSCIYVLGMAL  122

Query  551   MTLSATVPGISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTD  730
             +T SA  PG+ P+C A + C  T   TA C+IALYL+ALGTGGIKPCVSS+GADQFD+ D
Sbjct  123   LTFSAVAPGLIPSCDA-NGCKPTSGQTAACYIALYLIALGTGGIKPCVSSFGADQFDEND  181

Query  731   EKERKHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGT  910
             + ERK KSSFFNWFYFSIN+GAL+A+S++VWIQ +V WGWGFGVP VAM +A+ FFF G+
Sbjct  182   QTERKKKSSFFNWFYFSINIGALIASSVLVWIQMNVGWGWGFGVPGVAMVIAIIFFFIGS  241

Query  911   RLYRYQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNEL  1090
             + YR Q PGGSP TR+ QV VA+ +K  ++VP DKSLL+ET   ESNI+GSRKL HTNE+
Sbjct  242   QWYRLQVPGGSPLTRICQVTVAAFKKLGLQVPDDKSLLYETADAESNIKGSRKLEHTNEM  301

Query  1091  RFFDKAAVVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGT  1270
             +  DKAAV  ES  +  K   +PWRLCTVTQVEELKSIIRLLP+WA+ I F+TVY QMGT
Sbjct  302   KCLDKAAVETES--DRSKAVPNPWRLCTVTQVEELKSIIRLLPVWASMIAFATVYSQMGT  359

Query  1271  QFISQAEGMNTYVGT-FKXPXASLGV  1345
              F+ Q   M+ ++G  FK P ASL +
Sbjct  360   MFVLQGNTMDQHIGPHFKIPSASLSL  385



>ref|XP_009374284.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like isoform X2 [Pyrus 
x bretschneideri]
Length=541

 Score =   510 bits (1313),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 249/345 (72%), Positives = 284/345 (82%), Gaps = 4/345 (1%)
 Frame = +2

Query  317   LGNECSERLAYYGMSSNLMIYFQTRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLG  496
              GNEC ERLAYYGMSSN +IYF+T+LNQ++  A+KN SNWSGTCY+ PL+GAFLADAYLG
Sbjct  6     FGNECCERLAYYGMSSNRVIYFKTQLNQTSAVAAKNNSNWSGTCYLTPLLGAFLADAYLG  65

Query  497   RYWTIATFSIIYVMGMTLMTLSATVPGISPTCIAHDKCTATGRDTAVCFIALYLVALGTG  676
             RY TIA+FSIIY +GMTL+T+SA+VPG+ PTC++ D C A G  TA  FIALYL+ALGTG
Sbjct  66    RYKTIASFSIIYFIGMTLLTMSASVPGMKPTCVSKDDCHANGGQTAATFIALYLIALGTG  125

Query  677   GIKPCVSSYGADQFDDTDEKERKHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGF  856
             GIKPCVSSYGADQFDD DE E+KHK+SFFNWFYFSINVGAL+A+S++VWIQ +V WGWGF
Sbjct  126   GIKPCVSSYGADQFDDDDEVEKKHKASFFNWFYFSINVGALIASSVLVWIQDNVGWGWGF  185

Query  857   GVPAVAMALAVTFFFSGTRLYRYQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETV  1036
             GVPAVAMA+AV  FFSGTRLYR QKPGGSP TR+ QVVVAS+RK KVKVP DKSLL+ET 
Sbjct  186   GVPAVAMAIAVLSFFSGTRLYRNQKPGGSPVTRIIQVVVASVRKYKVKVPEDKSLLYETA  245

Query  1037  GLESNIQGSRKLSHTNELRFFDKAAVVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLL  1216
               ES+IQGSRKL HTNE RFFDKAAV  E  D++ K S SPWRL TVTQVEELKSIIRLL
Sbjct  246   DAESSIQGSRKLDHTNEFRFFDKAAV--EVQDDNIKDSKSPWRLTTVTQVEELKSIIRLL  303

Query  1217  PIWATGIIFSTVYGQMGTQFISQAEGMNTYVG--TFKXPXASLGV  1345
             PIWA GIIF+    QM   F+ Q   M+  VG  +FK P ASL V
Sbjct  304   PIWAAGIIFAAACNQMSNFFVLQGTLMDVRVGHSSFKIPAASLIV  348



>ref|XP_006363053.1| PREDICTED: peptide transporter PTR1-like [Solanum tuberosum]
Length=566

 Score =   509 bits (1312),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 244/378 (65%), Positives = 292/378 (77%), Gaps = 5/378 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M  DD YTKDGT+D   +PANKKKTG WKACP+ILG+E  ERLAYYGMS+NL+ Y   RL
Sbjct  1     MNSDDDYTKDGTVDIYKKPANKKKTGTWKACPYILGDEACERLAYYGMSTNLVNYIHKRL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             N    ++SK ++NWSGTCY+ PL+GAFLADAYLGRYWTIA FS +Y++GMTL+TLSA+V 
Sbjct  61    NLGVAASSKAVNNWSGTCYVTPLIGAFLADAYLGRYWTIAGFSFLYIIGMTLLTLSASVK  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             GI P    +  C  T       F+++YL+A GTGGIKPCVSS+GADQFDD DE E+K KS
Sbjct  121   GIRPC--NNGTCNPTSSQKTAFFVSIYLIAFGTGGIKPCVSSFGADQFDDNDENEKKKKS  178

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFY SINVGAL+A+S +V+IQ +V WG GFGVPAVAMA+A+ FFFSGTRLYR Q P
Sbjct  179   SFFNWFYLSINVGALIASSALVYIQSNVGWGLGFGVPAVAMAIALVFFFSGTRLYRLQPP  238

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
              GSP TR+ QV VAS+RK  VK P D++LL+ET   ES I  SRKL H++E RFFDKAAV
Sbjct  239   AGSPLTRIVQVFVASIRKCHVKTPHDETLLYETADTESIIVASRKLEHSDEFRFFDKAAV  298

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               ES  +   GSV+PWRLCTVTQVEE+KSIIRLLPIWATGI+FS VYGQM T F++Q   
Sbjct  299   EGES--DKVNGSVNPWRLCTVTQVEEVKSIIRLLPIWATGIVFSCVYGQMSTMFVNQGNI  356

Query  1295  MNTYVGT-FKXPXASLGV  1345
             M+ Y+G  F+ P A L +
Sbjct  357   MDNYIGPHFRIPSACLSI  374



>ref|XP_006848110.2| PREDICTED: protein NRT1/ PTR FAMILY 8.1 isoform X1 [Amborella 
trichopoda]
Length=567

 Score =   509 bits (1310),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 243/378 (64%), Positives = 299/378 (79%), Gaps = 5/378 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M +  +YT+DGT+D+  +PA K KTG W+ACPFILGNE  ERLAYYGMS+NL+ Y + RL
Sbjct  1     MSDPAIYTQDGTVDHTGKPAIKAKTGTWRACPFILGNEGCERLAYYGMSTNLVNYMKYRL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             +QS   A+ N++NW+GTCYIMPL+GAF+ADA+LGRY  IA FS IYV+GMTL+TLSA+V 
Sbjct  61    HQSNAVAANNVTNWTGTCYIMPLLGAFVADAFLGRYRVIAVFSAIYVVGMTLLTLSASVG  120

Query  575   GISPTCIAHD-KCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHK  751
             G+ PTC  HD +C A     AV F++LYL+ALGTGGIKPCV S+GADQFDD DE E+K K
Sbjct  121   GLRPTC--HDNQCHANDGQVAVFFMSLYLIALGTGGIKPCVLSFGADQFDDADEYEKKKK  178

Query  752   SSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQK  931
             SSFFNWFY SIN+GAL+A+SL+VWIQ+++ WGWGFG+P VAMA+A+  F +GTRLYR QK
Sbjct  179   SSFFNWFYLSINIGALIASSLLVWIQENIGWGWGFGIPTVAMAIAIISFLAGTRLYRNQK  238

Query  932   PGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAA  1111
             PGGSP TR+ QV+VAS+RK +V VPSDKSLL+ET   ES I GSRKL  T+E  FFDKAA
Sbjct  239   PGGSPLTRIAQVLVASIRKSRVLVPSDKSLLYETAEEESAIPGSRKLESTDEFTFFDKAA  298

Query  1112  VVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAE  1291
             V  E+  +  K    PW+LC+VTQVEE KSIIR+LPIWATGIIF+TVY QM T FI Q +
Sbjct  299   VETEA--DKIKTHPDPWKLCSVTQVEEWKSIIRILPIWATGIIFATVYSQMSTMFILQGD  356

Query  1292  GMNTYVGTFKXPXASLGV  1345
              M+  VG+FK P A+L +
Sbjct  357   KMDRRVGSFKIPAAALSL  374



>ref|XP_010676231.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010676232.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010676233.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010676234.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Beta vulgaris subsp. 
vulgaris]
Length=558

 Score =   508 bits (1307),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 247/375 (66%), Positives = 298/375 (79%), Gaps = 16/375 (4%)
 Frame = +2

Query  224   DDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQS  403
             DD   +DGT++   +PA+KKKTGNWKAC FILGNEC ERLAYYGMS+NL+ YF  R++Q 
Sbjct  6     DDSIVQDGTVNIHGQPADKKKTGNWKACYFILGNECCERLAYYGMSTNLVNYFIERMHQG  65

Query  404   TTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPGIS  583
               +A+KN++NWSGTCYIMPL+GAFLADAYLGRYW IA FS+IYV+GMTL+T+SA+V    
Sbjct  66    NATAAKNVNNWSGTCYIMPLLGAFLADAYLGRYWVIAIFSMIYVIGMTLLTVSASV----  121

Query  584   PTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSFF  763
                       A     AV F+ALYL+ALGTGGIKPCVSS+GADQFD+TDEKER+ KSSFF
Sbjct  122   ---------NALKNSVAVAFVALYLIALGTGGIKPCVSSFGADQFDETDEKEREKKSSFF  172

Query  764   NWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKPGGS  943
             NWFYFSINVGAL+A+S++VWIQ +V WGWGFGVPAVAMA+AV  FFSG+ LYR QKPGGS
Sbjct  173   NWFYFSINVGALIASSVLVWIQTNVGWGWGFGVPAVAMAIAVVSFFSGSVLYRLQKPGGS  232

Query  944   PFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAVVEE  1123
             P TR+ QV+VAS RK  VKVP+DK++L+ET    SNI GSRKL HT++LR FDKAAV   
Sbjct  233   PLTRIAQVLVASFRKINVKVPADKTILYETPDDGSNIVGSRKLEHTDKLRCFDKAAVPTG  292

Query  1124  SLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEGMNT  1303
             S  +D KG+ + WRLCTVTQVEELK+II++LPIWATGI+FS VY QM T F+ Q   M+ 
Sbjct  293   S--DDIKGTPNSWRLCTVTQVEELKAIIKILPIWATGIVFSAVYSQMSTMFVLQGNTMDQ  350

Query  1304  YVGT-FKXPXASLGV  1345
             ++G  FK P ASL +
Sbjct  351   HIGPHFKIPSASLSL  365



>emb|CDY10485.1| BnaCnng03860D [Brassica napus]
Length=567

 Score =   508 bits (1307),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 238/375 (63%), Positives = 295/375 (79%), Gaps = 3/375 (1%)
 Frame = +2

Query  224   DDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQS  403
             D  YT+DGTLD   +PANK KTG WKAC FIL  EC ERLAYYGMS+NL+ Y +  L+  
Sbjct  2     DSEYTQDGTLDIHKKPANKNKTGTWKACRFILVTECCERLAYYGMSTNLVNYIEKHLSMG  61

Query  404   TTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPGIS  583
               +AS +++NWSGTCY  PL+GAFLADAYLGRYWTIA+F +IY+ GMTL+TLSA+VPG++
Sbjct  62    NVAASNSVTNWSGTCYATPLIGAFLADAYLGRYWTIASFVVIYICGMTLLTLSASVPGLT  121

Query  584   PTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSFF  763
             PTC   + C AT    A+ F+ALYL+ALGTGGIKPCVSS+GADQFDDTDE+E++ KSSFF
Sbjct  122   PTCHG-ENCHATEFQIAITFVALYLIALGTGGIKPCVSSFGADQFDDTDEEEKESKSSFF  180

Query  764   NWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKPGGS  943
             NWFYF INVGA+ A+S++VWIQ +V WGWGFGVP VAMA+AV  FF+G++ YR QKPGGS
Sbjct  181   NWFYFVINVGAMFASSVLVWIQMNVGWGWGFGVPTVAMAVAVLLFFAGSKFYRLQKPGGS  240

Query  944   PFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAVVEE  1123
             P TR+ QV+VAS RK KV+VP D +LL+E    ES+IQGSRKL HT +L FFDKAAV  E
Sbjct  241   PITRMLQVIVASFRKSKVRVPEDAALLYEIHDAESSIQGSRKLEHTPKLTFFDKAAVETE  300

Query  1124  SLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEGMNT  1303
             + DE+K+ + S W+LCTVTQVEELK++I LLP+WA+GI+F+ VY QM T F+ Q   M+ 
Sbjct  301   T-DENKEAAKSGWKLCTVTQVEELKALISLLPVWASGIVFAAVYSQMSTVFVLQGNTMDQ  359

Query  1304  YVG-TFKXPXASLGV  1345
              +G  F  P ASL +
Sbjct  360   SMGPNFTIPSASLAL  374



>ref|XP_009122828.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2 [Brassica rapa]
 emb|CDY40315.1| BnaA10g27530D [Brassica napus]
Length=567

 Score =   508 bits (1307),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 238/375 (63%), Positives = 295/375 (79%), Gaps = 3/375 (1%)
 Frame = +2

Query  224   DDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQS  403
             D  YT+DGTLD   +PANK KTG WKAC FIL  EC ERLAYYGMS+NL+ Y +  L+  
Sbjct  2     DSEYTQDGTLDIHKKPANKNKTGTWKACRFILVTECCERLAYYGMSTNLVNYIEKHLSMG  61

Query  404   TTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPGIS  583
               +AS +++NWSGTCY  PL+GAFLADAYLGRYWTIA+F +IY+ GMTL+TLSA+VPG++
Sbjct  62    NVAASNSVTNWSGTCYATPLIGAFLADAYLGRYWTIASFVVIYICGMTLLTLSASVPGLT  121

Query  584   PTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSFF  763
             PTC   + C AT    A+ F+ALYL+ALGTGGIKPCVSS+GADQFDDTDE+E++ KSSFF
Sbjct  122   PTCHG-ENCHATEFQIAITFVALYLIALGTGGIKPCVSSFGADQFDDTDEEEKESKSSFF  180

Query  764   NWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKPGGS  943
             NWFYF INVGA+ A+S++VWIQ +V WGWGFGVP VAMA+AV  FF+G++ YR QKPGGS
Sbjct  181   NWFYFVINVGAMFASSVLVWIQMNVGWGWGFGVPTVAMAVAVLLFFAGSKFYRLQKPGGS  240

Query  944   PFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAVVEE  1123
             P TR+ QV+VAS RK KV+VP D +LL+E    ES+IQGSRKL HT +L FFDKAAV  E
Sbjct  241   PITRMLQVIVASFRKSKVRVPEDAALLYEIHDAESSIQGSRKLEHTPKLTFFDKAAVETE  300

Query  1124  SLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEGMNT  1303
             + DE+K+ + S W+LCTVTQVEELK++I LLP+WA+GI+F+ VY QM T F+ Q   M+ 
Sbjct  301   T-DENKEAAKSGWKLCTVTQVEELKALISLLPVWASGIVFAAVYSQMSTVFVLQGNTMDQ  359

Query  1304  YVG-TFKXPXASLGV  1345
              +G  F  P ASL +
Sbjct  360   SMGPNFTIPSASLAL  374



>gb|ERN09691.1| hypothetical protein AMTR_s00029p00215100 [Amborella trichopoda]
Length=600

 Score =   508 bits (1309),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 243/378 (64%), Positives = 299/378 (79%), Gaps = 5/378 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M +  +YT+DGT+D+  +PA K KTG W+ACPFILGNE  ERLAYYGMS+NL+ Y + RL
Sbjct  34    MSDPAIYTQDGTVDHTGKPAIKAKTGTWRACPFILGNEGCERLAYYGMSTNLVNYMKYRL  93

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             +QS   A+ N++NW+GTCYIMPL+GAF+ADA+LGRY  IA FS IYV+GMTL+TLSA+V 
Sbjct  94    HQSNAVAANNVTNWTGTCYIMPLLGAFVADAFLGRYRVIAVFSAIYVVGMTLLTLSASVG  153

Query  575   GISPTCIAHD-KCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHK  751
             G+ PTC  HD +C A     AV F++LYL+ALGTGGIKPCV S+GADQFDD DE E+K K
Sbjct  154   GLRPTC--HDNQCHANDGQVAVFFMSLYLIALGTGGIKPCVLSFGADQFDDADEYEKKKK  211

Query  752   SSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQK  931
             SSFFNWFY SIN+GAL+A+SL+VWIQ+++ WGWGFG+P VAMA+A+  F +GTRLYR QK
Sbjct  212   SSFFNWFYLSINIGALIASSLLVWIQENIGWGWGFGIPTVAMAIAIISFLAGTRLYRNQK  271

Query  932   PGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAA  1111
             PGGSP TR+ QV+VAS+RK +V VPSDKSLL+ET   ES I GSRKL  T+E  FFDKAA
Sbjct  272   PGGSPLTRIAQVLVASIRKSRVLVPSDKSLLYETAEEESAIPGSRKLESTDEFTFFDKAA  331

Query  1112  VVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAE  1291
             V  E+  +  K    PW+LC+VTQVEE KSIIR+LPIWATGIIF+TVY QM T FI Q +
Sbjct  332   VETEA--DKIKTHPDPWKLCSVTQVEEWKSIIRILPIWATGIIFATVYSQMSTMFILQGD  389

Query  1292  GMNTYVGTFKXPXASLGV  1345
              M+  VG+FK P A+L +
Sbjct  390   KMDRRVGSFKIPAAALSL  407



>ref|XP_011466488.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like [Fragaria vesca 
subsp. vesca]
Length=563

 Score =   507 bits (1305),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 240/379 (63%), Positives = 299/379 (79%), Gaps = 9/379 (2%)
 Frame = +2

Query  212   AMEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTR  391
             A+ EDD YT DGT+D R  PANK+KTGNWKAC FILGNEC ERLAYYGMS+NL+ Y Q +
Sbjct  2     ALAEDD-YTNDGTVDIRKNPANKRKTGNWKACRFILGNECCERLAYYGMSTNLVNYLQKQ  60

Query  392   LNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATV  571
             L+    +A+ N++NWSGTCY+ PL+GAFLADAYLGRYWTIA FSIIYV GM  ++L+A++
Sbjct  61    LSMGNAAAANNVTNWSGTCYVTPLLGAFLADAYLGRYWTIAIFSIIYVFGMGFLSLTASI  120

Query  572   PGISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHK  751
              G+ P+C     C AT    A CF+ALY++ALGTGGIKPCVSS+GADQFD+TD+ E++ K
Sbjct  121   NGLKPSC-DSSGCHATSSQIAACFVALYMIALGTGGIKPCVSSFGADQFDETDDTEKEKK  179

Query  752   SSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQK  931
             SSFFNWFY SINVGA++A+S++V+IQ +V W WGFG+PAVAMA+AV FFF G+ LYR QK
Sbjct  180   SSFFNWFYMSINVGAMIASSVLVYIQMNVGWDWGFGIPAVAMAIAVVFFFVGSSLYRLQK  239

Query  932   PGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAA  1111
             PGGSP TR+ QV+VAS R   VKVP DKSLL+ET   ES+IQGSRKL HT++L FFDKAA
Sbjct  240   PGGSPITRIIQVIVASCRNFNVKVPDDKSLLYETRDAESSIQGSRKLEHTDKLSFFDKAA  299

Query  1112  VVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAE  1291
             V      ED K   +PW++CTVTQVEELK++IRLLP+WA+GI+F+ VY QM T F+ Q  
Sbjct  300   V------EDLKSLENPWKVCTVTQVEELKAVIRLLPVWASGIVFAAVYSQMSTMFVLQGN  353

Query  1292  GMNTYVG-TFKXPXASLGV  1345
              ++ ++G  FK P ASL +
Sbjct  354   TLDQHMGPNFKIPSASLSL  372



>ref|XP_009116102.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1 [Brassica rapa]
Length=570

 Score =   505 bits (1301),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 237/378 (63%), Positives = 286/378 (76%), Gaps = 2/378 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             MEE DVYT+DGT+D    PANKK TGNWKAC FIL N C ER AYYGMS NL+ Y ++RL
Sbjct  1     MEESDVYTEDGTVDIHKNPANKKTTGNWKACRFILVNVCCERFAYYGMSKNLVDYLKSRL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             NQ   +A+ N++NW GTCYI PL+GAFLADAYLGRYWTIATF  IYV G+TL+TLSA+VP
Sbjct  61    NQGNATAANNVTNWFGTCYITPLIGAFLADAYLGRYWTIATFVFIYVFGLTLLTLSASVP  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+ P     D C  +   TAV F+ALY++ALG GGI+PCVSS+GADQFD+ DE E+  KS
Sbjct  121   GLKPGNCNSDTCHPSSDQTAVFFVALYMIALGIGGIEPCVSSFGADQFDENDEAEKLKKS  180

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFS NVGA VA ++I WIQ ++ WGWGFGVP VAM +AV FFFSG+R YR Q+P
Sbjct  181   SFFNWFYFSANVGAFVATTVISWIQMNIGWGWGFGVPTVAMVIAVMFFFSGSRYYRLQRP  240

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
              G+P TR+FQV+VA+LRK  V+VP DKS L E     SNI GSRKL HT+ L+FFDKAAV
Sbjct  241   QGNPLTRIFQVIVAALRKMSVEVPEDKSQLFEIADDASNITGSRKLEHTDNLKFFDKAAV  300

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               +S D    G V+PWRLC+VTQVEELK II LLP WA+GI+F+TVY Q+ T F+ Q   
Sbjct  301   ESQS-DSINDGEVNPWRLCSVTQVEELKCIITLLPFWASGIVFATVYSQLNTLFVLQGNT  359

Query  1295  MNTYVGT-FKXPXASLGV  1345
             M+ ++G  F+ P  SL +
Sbjct  360   MDQHMGKHFEIPSDSLSL  377



>gb|KJB55777.1| hypothetical protein B456_009G093900 [Gossypium raimondii]
Length=544

 Score =   504 bits (1299),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 236/344 (69%), Positives = 286/344 (83%), Gaps = 4/344 (1%)
 Frame = +2

Query  320   GNECSERLAYYGMSSNLMIYFQTRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGR  499
             GNE  ERLAYYGMS+NL++YF+ +LNQ ++ A+ N  NW GTCYI P++GAFLAD+YLGR
Sbjct  10    GNEVCERLAYYGMSTNLVLYFKHQLNQHSSVAATNNQNWGGTCYITPIIGAFLADSYLGR  69

Query  500   YWTIATFSIIYVMGMTLMTLSATVPGISPTCIAHDKCTATGRDTAVCFIALYLVALGTGG  679
             YWTIA FSI+Y++GMTL+ LSA+V GI P C A D C  T   +A+ F+ALYL+ALGTGG
Sbjct  70    YWTIACFSIVYIIGMTLLALSASVRGIRPRCYAEDNCNPTEVQSAMTFLALYLIALGTGG  129

Query  680   IKPCVSSYGADQFDDTDEKERKHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFG  859
             IKPCVSSYGADQFDDTDEKE+KHKSSFFNWFY SIN+GAL+A S++VW+Q +VSWGWG G
Sbjct  130   IKPCVSSYGADQFDDTDEKEKKHKSSFFNWFYLSINIGALIAGSVLVWVQDNVSWGWGLG  189

Query  860   VPAVAMALAVTFFFSGTRLYRYQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVG  1039
             +PA+AMA+AV FFFSGT LYR Q PGGSP TRLFQV+VAS+RK KV VP++KS+LHET  
Sbjct  190   IPAIAMAIAVCFFFSGTCLYRNQVPGGSPVTRLFQVLVASIRKYKVAVPANKSVLHETAD  249

Query  1040  LESNIQGSRKLSHTNELRFFDKAAVVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLP  1219
              ESNI+GSRK+ HTN+L FFDKAAV  E+  +  KGSV+PWRLCTVTQVEELK+IIRLLP
Sbjct  250   KESNIKGSRKIDHTNDLSFFDKAAVEIET--DQLKGSVNPWRLCTVTQVEELKAIIRLLP  307

Query  1220  IWATGIIFSTVYGQMGTQFISQAEGMNTYVG--TFKXPXASLGV  1345
             +WA+GIIFST+  QMG+ F+ Q E M+T+VG   FK P ASL +
Sbjct  308   VWASGIIFSTICSQMGSLFVLQGERMDTHVGHSNFKIPAASLSI  351



>ref|XP_007016185.1| Peptide transporter 1 [Theobroma cacao]
 gb|EOY33804.1| Peptide transporter 1 [Theobroma cacao]
Length=575

 Score =   505 bits (1301),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 253/409 (62%), Positives = 291/409 (71%), Gaps = 59/409 (14%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M EDD YTKDGT+DYR  PANKKKTG WKACPFI+GNEC ERLAY GMSSNL+ YF+ RL
Sbjct  1     MAEDDFYTKDGTVDYRGNPANKKKTGTWKACPFIIGNECCERLAYNGMSSNLVRYFKHRL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             NQ ++ A++N  NWSGTCYI PL+GAFLADAYLGRYWTIA FSIIYV GMTL+ LSATV 
Sbjct  61    NQHSSVATRNNQNWSGTCYITPLIGAFLADAYLGRYWTIAFFSIIYVFGMTLLALSATVH  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             GI P C A D C  T   +A  F+ALY+VALGTGGIKPCVSSYGADQFDDTDE E+KHKS
Sbjct  121   GIRPRCYAEDNCNPTVTQSAAFFVALYMVALGTGGIKPCVSSYGADQFDDTDEAEKKHKS  180

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GAL+A+S++VW+Q +VSWGWGFG+PA+AMA+AVTFFFSGTRLYR QKP
Sbjct  181   SFFNWFYFSINIGALIASSVLVWVQDNVSWGWGFGIPAIAMAVAVTFFFSGTRLYRNQKP  240

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELR-------  1093
             GGSP TRL QV+VAS RK ++ VP+DKSLL+ET   ESNI+GSRK+ HT + R       
Sbjct  241   GGSPLTRLCQVLVASFRKFRLAVPADKSLLYETADAESNIRGSRKIEHTQDFRLSRCSVH  300

Query  1094  -----------------------FFDKAAVVEESLDEDKKGSVSPWRLCTVTQVEELKSI  1204
                                    FFDKAAV  E+  + KKGS                  
Sbjct  301   VGRILSCLLIPCSSSKAAVLIFSFFDKAAV--ETASDHKKGS------------------  340

Query  1205  IRLLPIWATGIIFSTVYGQMGTQFISQAEGMNTYVGT--FKXPXASLGV  1345
                    ATGIIF+ VY QM   F+ Q E MNT+VG   FK P ASL +
Sbjct  341   -------ATGIIFAAVYSQMSNLFVLQGERMNTHVGNSAFKIPPASLSI  382



>ref|XP_002309120.2| proton-dependent oligopeptide transport family protein [Populus 
trichocarpa]
 gb|EEE92643.2| proton-dependent oligopeptide transport family protein [Populus 
trichocarpa]
Length=567

 Score =   504 bits (1298),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 248/378 (66%), Positives = 304/378 (80%), Gaps = 5/378 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M +DD Y+ DGT+D +  PANKKKTGNWKA  FILGNEC ERLAYYGMS+NL+ Y + RL
Sbjct  1     MAQDD-YSNDGTVDIKGNPANKKKTGNWKAGRFILGNECCERLAYYGMSTNLVNYLEDRL  59

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             NQ   +AS N++NWSGTCYI PL+GAFLAD+YLGRYWTIA+F +IY++GMTL+TLSA+VP
Sbjct  60    NQGNVAASNNVTNWSGTCYITPLIGAFLADSYLGRYWTIASFVVIYIIGMTLLTLSASVP  119

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+  +C   D C  T   T   F+ALY +ALGTGGIKPCVSS+GADQFD+TDE ERK KS
Sbjct  120   GLESSC-DKDSCHPTTGQTTAFFVALYFIALGTGGIKPCVSSFGADQFDETDETERKKKS  178

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFY SIN+GAL+A+S++VWIQ +V WGWGFG+PAVAMA+AV FFF G++LYR QKP
Sbjct  179   SFFNWFYLSINIGALIASSVLVWIQMNVGWGWGFGIPAVAMAVAVVFFFLGSKLYRIQKP  238

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QV+VAS RK  V+VP+DKSLL+ET   ES IQGSRKL HT++ +FFDKAAV
Sbjct  239   GGSPITRIVQVIVASFRKYHVQVPADKSLLYETAEEESQIQGSRKLEHTDKFKFFDKAAV  298

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               E+  ++ K   +PWRLCTVTQVEELKSI+RLLP+WA+GI+F+TVY QM   F+ Q   
Sbjct  299   --ETQTDNIKDLTNPWRLCTVTQVEELKSIVRLLPVWASGIVFATVYSQMSIMFVLQGNT  356

Query  1295  MNTYVGT-FKXPXASLGV  1345
             M+ ++G  FK P ASL +
Sbjct  357   MDQHMGPHFKIPSASLSL  374



>ref|XP_010907628.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Elaeis guineensis]
 ref|XP_010907629.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Elaeis guineensis]
Length=601

 Score =   504 bits (1298),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 238/374 (64%), Positives = 291/374 (78%), Gaps = 4/374 (1%)
 Frame = +2

Query  227   DVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQST  406
             D+YTKDGT D    PA +K TGNW+ACP+IL NEC ERLAYYGMSSNL+ Y + RL+Q  
Sbjct  34    DIYTKDGTTDIHGNPAVRKDTGNWRACPYILANECCERLAYYGMSSNLVNYMKYRLHQGN  93

Query  407   TSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPGISP  586
              +A+KN S+W+GTCYIM L+GAFLADAYLGRYWTIA F I+Y+ G+TL+TL+A++PG+ P
Sbjct  94    ATAAKNNSDWTGTCYIMSLLGAFLADAYLGRYWTIAIFVIVYIFGLTLLTLTASIPGLRP  153

Query  587   TCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSFFN  766
              C  +  C  T   +A  F ALYL+ALGTGGIKPCVSS+GADQFD++ E E+K KSSFFN
Sbjct  154   AC-ENGACNPTDAQSAAFFAALYLIALGTGGIKPCVSSFGADQFDESHESEKKRKSSFFN  212

Query  767   WFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKPGGSP  946
             WFYFSIN+GALVA+S++VWIQ +V WG GFG+PAVAMA+AV  FF GT LYR+QKPGGSP
Sbjct  213   WFYFSINIGALVASSVLVWIQDNVGWGLGFGIPAVAMAIAVASFFWGTPLYRHQKPGGSP  272

Query  947   FTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAVVEES  1126
              TR+ QVVVAS RK  VKVP+D SLL+E    ES IQGSRKL HT++ +F DKAAV   +
Sbjct  273   LTRVAQVVVASFRKSGVKVPADNSLLYEISEKESAIQGSRKLEHTDQFKFLDKAAV--RT  330

Query  1127  LDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEGMNTY  1306
              D+   G   PW LCTVTQVEE+KS++R+LPIWATGIIFS VY QM   F+ Q + ++T 
Sbjct  331   RDDKINGPADPWMLCTVTQVEEVKSVVRILPIWATGIIFSAVYSQMSNMFVIQGDTLDTK  390

Query  1307  VGT-FKXPXASLGV  1345
             +G  FK P ASL +
Sbjct  391   MGPHFKIPPASLSM  404



>ref|XP_011094976.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105174539 
[Sesamum indicum]
Length=1141

 Score =   521 bits (1342),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 245/392 (63%), Positives = 307/392 (78%), Gaps = 3/392 (1%)
 Frame = +2

Query  173   LTKIGLQMMEQSKAMEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYY  352
             L  +G ++ E+  A+ EDD+YTKDGT++   +PANK KTG+WKAC FIL  EC ERLAYY
Sbjct  558   LMNLGRKVXEKMAAIGEDDIYTKDGTVNIHKKPANKAKTGSWKACRFILVTECCERLAYY  617

Query  353   GMSSNLMIYFQTRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIY  532
             GMS+NL+ Y +TRL Q   +AS N++NWSGTCYI PL+GAF+AD+YLGR+WTIATF+ IY
Sbjct  618   GMSTNLVNYLKTRLGQGNVTASNNVTNWSGTCYITPLIGAFIADSYLGRFWTIATFATIY  677

Query  533   VMGMTLMTLSATVPGISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGAD  712
             V+GM L+TLS +V G+ P C   + C  T    A  F+A+YL+ALGTGGIKPCVSS+GAD
Sbjct  678   VIGMALLTLSVSVSGLKPEC-NKNGCHPTSLQMATFFVAIYLIALGTGGIKPCVSSFGAD  736

Query  713   QFDDTDEKERKHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVT  892
             QFDD D++E++ KSSFFNWFY SIN+GA++A+S++VWIQ +V W WGFG PAV+MA+AV 
Sbjct  737   QFDDNDKREKRKKSSFFNWFYLSINIGAMIASSVLVWIQMNVGWNWGFGTPAVSMAIAVA  796

Query  893   FFFSGTRLYRYQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKL  1072
             FFFSG+ LYR Q PGGSP TR+FQV+VAS+RK  VKVP+DKSLL+ET   ES+I+GSRKL
Sbjct  797   FFFSGSHLYRLQIPGGSPLTRIFQVLVASIRKYNVKVPTDKSLLYETADAESSIEGSRKL  856

Query  1073  SHTNELRFFDKAAVVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTV  1252
              HT++ R  DKAAV  +S D   +G V+PW LCTVTQVEELKSII LLPIWA+GI+FSTV
Sbjct  857   EHTDKFRCLDKAAVETDS-DNSLEGVVNPWSLCTVTQVEELKSIIGLLPIWASGIVFSTV  915

Query  1253  YGQMGTQFISQAEGMNTYVG-TFKXPXASLGV  1345
               QMGT F+ Q   M+  +G  FK P ASL +
Sbjct  916   SSQMGTMFVLQGNTMDQQMGPNFKIPSASLSL  947


 Score =   516 bits (1328),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 252/382 (66%), Positives = 305/382 (80%), Gaps = 4/382 (1%)
 Frame = +2

Query  206   SKAMEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQ  385
             S  + EDD YTKDGT DYRN PA K++TG WKACP+ILGNEC ERLAYYG+++NL+ Y +
Sbjct  9     SMMVTEDDKYTKDGTTDYRNNPAIKQETGTWKACPYILGNECCERLAYYGINTNLVNYLK  68

Query  386   TRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSA  565
              ++N+S   A  N++NWSGTCY+ PL+GAFLADAYLGRYWTIATFS IYV GMT++TLSA
Sbjct  69    FQMNESNVVAVNNVTNWSGTCYVTPLLGAFLADAYLGRYWTIATFSTIYVFGMTILTLSA  128

Query  566   TVPGISPTCIAHDK-CTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKER  742
             +V G+ P C  ++  C  TG    V +  LYL+ALGTGGIKPCVSS+GADQFDD+DE E+
Sbjct  129   SVHGLKPFCDPNNGGCHPTGLQIGVFYAGLYLIALGTGGIKPCVSSFGADQFDDSDEVEK  188

Query  743   KHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYR  922
             K+KSSFFNWFYFSIN+GALVA++++VWIQ +V WGWGFG+PAVAMA+AV  FFSGTRLYR
Sbjct  189   KNKSSFFNWFYFSINIGALVASTVLVWIQTNVGWGWGFGIPAVAMAIAVVSFFSGTRLYR  248

Query  923   YQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFD  1102
              Q+PGGSP TR+ QVVVAS+RK  V VP DKS L+ET   E  ++GSRKL  T +L FFD
Sbjct  249   NQRPGGSPLTRICQVVVASVRKIGVDVPKDKSALYETAEEEYAVKGSRKLELTKKLSFFD  308

Query  1103  KAAVVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFIS  1282
             KAAV  ES  + + GSV+PWRLCTVTQVEELKSIIRLLPIWATGIIFS VY QMGT F+ 
Sbjct  309   KAAVETES--DARNGSVNPWRLCTVTQVEELKSIIRLLPIWATGIIFSAVYSQMGTLFVL  366

Query  1283  QAEGMNTY-VGTFKXPXASLGV  1345
             Q   M+ + + +F+ P ASL +
Sbjct  367   QGNTMDLHLIRSFEIPSASLSL  388



>ref|XP_004968169.1| PREDICTED: peptide transporter PTR1-like isoform X1 [Setaria 
italica]
 ref|XP_004968170.1| PREDICTED: peptide transporter PTR1-like isoform X2 [Setaria 
italica]
 ref|XP_004968171.1| PREDICTED: peptide transporter PTR1-like isoform X3 [Setaria 
italica]
 ref|XP_004968172.1| PREDICTED: peptide transporter PTR1-like isoform X4 [Setaria 
italica]
Length=578

 Score =   501 bits (1291),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 236/375 (63%), Positives = 296/375 (79%), Gaps = 5/375 (1%)
 Frame = +2

Query  218   EEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  397
             E  D+YT+DGT+D +  PA KK TGNW+ACP+IL NEC ERLAYYGMS+NL+ Y +TRL 
Sbjct  3     EVADMYTQDGTVDIKGNPAVKKGTGNWRACPYILANECCERLAYYGMSTNLVNYMKTRLG  62

Query  398   QSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPG  577
             Q  + A+ N++NWSGTCYI PL+GAFLADAY+GRYWTIA+F IIY++G+ L+T++++V G
Sbjct  63    QGNSIAANNVTNWSGTCYITPLIGAFLADAYMGRYWTIASFMIIYIIGLALLTMASSVKG  122

Query  578   ISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSS  757
             + P+C     C  T   TAV F+ALYL+ALGTGGIKPCVSS+GADQFD+ D KE+K KSS
Sbjct  123   LVPSCDISGTCHPTEPQTAVVFVALYLIALGTGGIKPCVSSFGADQFDENDAKEQKSKSS  182

Query  758   FFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKPG  937
             FFNWFYFSIN+GALVA++++V++Q  V WGWGFG+PAV MA+AV  FF GT LYR+Q+PG
Sbjct  183   FFNWFYFSINIGALVASTVLVYVQTYVGWGWGFGIPAVVMAIAVVSFFIGTPLYRHQRPG  242

Query  938   GSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAVV  1117
             GSP TR+ QV+VAS RK  V VP+DKSLLHET   E  I+GSRKL HT++    DKAA V
Sbjct  243   GSPITRIAQVLVASARKWSVAVPADKSLLHETPDGECGIKGSRKLEHTDQFGCLDKAA-V  301

Query  1118  EESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEGM  1297
             E + D   + + SPWRLCTVTQVEELKS++RLLPIWATGI+F+TVYGQMGT F+ Q   +
Sbjct  302   ETAAD---RTAASPWRLCTVTQVEELKSVVRLLPIWATGIVFATVYGQMGTMFVLQGNTL  358

Query  1298  NTYVG-TFKXPXASL  1339
             +  +G  F  P A+L
Sbjct  359   DQRMGPKFSVPSATL  373



>gb|KHN06246.1| Peptide transporter PTR1 [Glycine soja]
Length=525

 Score =   497 bits (1280),  Expect = 9e-169, Method: Compositional matrix adjust.
 Identities = 237/334 (71%), Positives = 283/334 (85%), Gaps = 6/334 (2%)
 Frame = +2

Query  356   MSSNLMIYFQTRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYV  535
             MS+NL++YF+ RLNQ + +ASKN+SNWSGTCYI PL+GA+LAD+YLGRYWTIA FSIIY 
Sbjct  1     MSTNLVLYFKNRLNQHSATASKNVSNWSGTCYITPLIGAYLADSYLGRYWTIAVFSIIYA  60

Query  536   MGMTLMTLSATVPGISPTCIAH--DKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGA  709
             +GMTL+TLSA+VPGI PTC  H  + C AT  ++AVCF+ALYL+ALGTGGIKPCVSSYGA
Sbjct  61    IGMTLLTLSASVPGIKPTCHGHGDENCRATTLESAVCFLALYLIALGTGGIKPCVSSYGA  120

Query  710   DQFDDTDEKERKHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAV  889
             DQFDDTD  E++ KSSFFNWFYFSIN+GAL+A+SL+VWIQ +V WGWGFG+PAVAMA+AV
Sbjct  121   DQFDDTDSAEKERKSSFFNWFYFSINIGALIASSLLVWIQDNVGWGWGFGIPAVAMAIAV  180

Query  890   TFFFSGTRLYRYQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRK  1069
               FFSGTRLYR QKPGGS  TR+ QVV+AS+RK  V+VP+D+SLL+ET   ES I+GSRK
Sbjct  181   VSFFSGTRLYRNQKPGGSAITRICQVVMASIRKYNVEVPADESLLYETAETESAIKGSRK  240

Query  1070  LSHTNELRFFDKAAVVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFST  1249
             L HTNELRFFDKAAV+ +S  +  K S +PWRLCTVTQVEELKSI+R+LP+WATGIIFST
Sbjct  241   LDHTNELRFFDKAAVLAQS--DKVKESKNPWRLCTVTQVEELKSILRILPVWATGIIFST  298

Query  1250  VYGQMGTQFISQAEGMNTYVG--TFKXPXASLGV  1345
             VYGQM T F+ Q + M+T VG  TFK P ASL +
Sbjct  299   VYGQMSTLFVLQGQTMDTRVGNSTFKIPPASLSI  332



>gb|EYU41851.1| hypothetical protein MIMGU_mgv1a020985mg [Erythranthe guttata]
Length=576

 Score =   498 bits (1283),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 244/378 (65%), Positives = 297/378 (79%), Gaps = 3/378 (1%)
 Frame = +2

Query  218   EEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  397
             +E D YT DGT DYRN PA K++TG WKACP+ILGNEC ERLAYYG+++NL+ Y + ++N
Sbjct  7     DEVDKYTNDGTTDYRNNPAIKQETGTWKACPYILGNECCERLAYYGINTNLVNYLKIQMN  66

Query  398   QSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPG  577
             ++  +A  N++NWSGTCY+ PL+GAFLADAYLGRYWTIATFS IYV GMT++TLSA+V G
Sbjct  67    ENNVAAVNNVTNWSGTCYVTPLLGAFLADAYLGRYWTIATFSTIYVFGMTVLTLSASVNG  126

Query  578   ISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSS  757
             + P C   + C+  G   AV +  +YL+ALGTGGIKPCVSS+GADQFDD+DE E+K KSS
Sbjct  127   LKPICDDKNVCSPNGLQKAVFYTGMYLIALGTGGIKPCVSSFGADQFDDSDESEKKSKSS  186

Query  758   FFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKPG  937
             FFNWFY SIN+GALVAA+++VWIQ +V WGWGFG+PAVAMALAV  FFSGTRLYR Q+PG
Sbjct  187   FFNWFYLSINIGALVAATVLVWIQTNVGWGWGFGIPAVAMALAVVSFFSGTRLYRKQRPG  246

Query  938   GSPFTRLFQVVVASLRKRKVKVPSDKSLLHET-VGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GSP TR+ QV+VAS RK  V VP DK  L+ET    ES I+GSRKL HT +L FFDKAAV
Sbjct  247   GSPLTRICQVIVASFRKVGVDVPKDKFDLYETEEEQESAIKGSRKLEHTEKLSFFDKAAV  306

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               +S D      ++PWR+CTVTQVEELK+II LLPIWATGIIFS VY QMGT F+ Q   
Sbjct  307   ETQS-DRKNGSKINPWRVCTVTQVEELKAIINLLPIWATGIIFSAVYSQMGTLFVLQGNT  365

Query  1295  MNTYV-GTFKXPXASLGV  1345
             MN +V  +F+ P A+L +
Sbjct  366   MNLHVIKSFEIPSATLSL  383



>ref|XP_010326140.1| PREDICTED: uncharacterized protein LOC101268606 [Solanum lycopersicum]
Length=1134

 Score =   516 bits (1328),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 247/379 (65%), Positives = 295/379 (78%), Gaps = 5/379 (1%)
 Frame = +2

Query  212   AMEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTR  391
             +M+ DD YTKDGT+D   RPANKKKTG WKACP+ILG+E  ERLAYYGMS+NL+ Y Q R
Sbjct  568   SMDSDDDYTKDGTMDIYKRPANKKKTGTWKACPYILGDEACERLAYYGMSTNLVNYIQKR  627

Query  392   LNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATV  571
             LN    S+SK ++NWSGTCY+ PL+GAFLADAYLGRYWTIA FS +Y++GMTL+TLSA+V
Sbjct  628   LNLGVASSSKAVNNWSGTCYVTPLIGAFLADAYLGRYWTIAGFSFLYIIGMTLLTLSASV  687

Query  572   PGISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHK  751
              GI P    +  C  T    A  F+++YL+A GTGGIKPCVSS+GADQFDD DE E+K K
Sbjct  688   KGIRPC--NNGTCNPTSSQRAAFFVSIYLIAFGTGGIKPCVSSFGADQFDDNDENEKKKK  745

Query  752   SSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQK  931
             SSFFNWFY SINVGAL+A+S++V+IQ +V WG GFGVPAVAMA+A+ FFFSGTRLYR Q 
Sbjct  746   SSFFNWFYLSINVGALIASSVLVYIQSNVGWGLGFGVPAVAMAIALVFFFSGTRLYRLQP  805

Query  932   PGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAA  1111
             P GSP TR+FQV VA +RK  VK P D +LL+ET   ES I  SRKL H++E RFFDKAA
Sbjct  806   PAGSPLTRIFQVFVAFIRKCHVKTPHDDTLLYETADTESIIVASRKLEHSDEFRFFDKAA  865

Query  1112  VVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAE  1291
             V  ES   D  G V+PWRLCTVTQVEE+KSIIRLLPIWATGI+FS VYGQM T F++Q  
Sbjct  866   VEAESDKVD--GLVNPWRLCTVTQVEEVKSIIRLLPIWATGIVFSCVYGQMSTMFVNQGN  923

Query  1292  GMNTYVGT-FKXPXASLGV  1345
              M+ ++G  F+ P A L +
Sbjct  924   VMDNHIGPHFRIPSACLSI  942


 Score =   513 bits (1322),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 241/377 (64%), Positives = 302/377 (80%), Gaps = 6/377 (2%)
 Frame = +2

Query  218   EEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  397
             E+D+ + KDGT+DY+N PA K +TG W+ACP+ILGNEC ERLAYYG+++NL+ Y + ++N
Sbjct  3     EDDNKFVKDGTVDYKNNPAIKNQTGTWRACPYILGNECCERLAYYGINTNLVNYLKNQMN  62

Query  398   QSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPG  577
             +S+  A  N++NWSGTCY+ PL+GAFLADAYLGR+WTIA FSIIYV GMT++TLSA++ G
Sbjct  63    ESSVVAVNNVTNWSGTCYVTPLLGAFLADAYLGRFWTIAVFSIIYVFGMTVLTLSASIHG  122

Query  578   ISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSS  757
             + P C  ++ C   G    + ++ LYL+ALGTGGIKPCVSS+GADQFDD+DE E+K KSS
Sbjct  123   LKPPCDDNNSCEPKGLQIGIFYLGLYLIALGTGGIKPCVSSFGADQFDDSDETEKKKKSS  182

Query  758   FFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKPG  937
             FFNWFYFSIN+GALVA++++VWIQ +V W WGFG+PAVAMA+AV  FFSGT+LYR QKPG
Sbjct  183   FFNWFYFSINIGALVASTVLVWIQTNVGWSWGFGIPAVAMAIAVVSFFSGTKLYRNQKPG  242

Query  938   GSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAVV  1117
             GSP TR+FQVVVAS RK KVK   D S+L ET   ES +QGSRKL HT +L FFDKAAV 
Sbjct  243   GSPLTRIFQVVVASFRKIKVK---DTSVLFETSDEESLVQGSRKLDHTQQLSFFDKAAVE  299

Query  1118  EESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEGM  1297
              ES  +  KGS++ W LCTVTQVEELKSI+RLLPIWATGIIFS+VY QMGT F+ Q   M
Sbjct  300   TES--DKIKGSINGWSLCTVTQVEELKSILRLLPIWATGIIFSSVYSQMGTLFVLQGNTM  357

Query  1298  NTYV-GTFKXPXASLGV  1345
             + ++  +F+ P ASL +
Sbjct  358   DLHMTKSFEIPSASLSL  374



>gb|KDO53230.1| hypothetical protein CISIN_1g0083672mg [Citrus sinensis]
Length=543

 Score =   496 bits (1277),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 233/347 (67%), Positives = 283/347 (82%), Gaps = 4/347 (1%)
 Frame = +2

Query  308   PFILGNECSERLAYYGMSSNLMIYFQTRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADA  487
             P I GNEC ERLAYYGMS+NL+ Y Q +LNQ   +AS N++NWSGTCYI PL+GAFLAD+
Sbjct  7     PLISGNECCERLAYYGMSTNLVNYLQKQLNQGNVTASNNVTNWSGTCYITPLIGAFLADS  66

Query  488   YLGRYWTIATFSIIYVMGMTLMTLSATVPGISPTCIAHDKCTATGRDTAVCFIALYLVAL  667
             Y+GR+WTIA+FSIIY +GMTL+TL+A+V G+ P+C   D C  TG  TAV F+ALYL+AL
Sbjct  67    YMGRFWTIASFSIIYCLGMTLLTLTASVSGLKPSC-DKDACHPTGAQTAVTFVALYLIAL  125

Query  668   GTGGIKPCVSSYGADQFDDTDEKERKHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWG  847
             GTGGIKPCVSS+GADQFD+TD+ ER+ KSSFFNWFY SIN+GALVA+S++VWIQ +V WG
Sbjct  126   GTGGIKPCVSSFGADQFDETDDGEREKKSSFFNWFYLSINIGALVASSVLVWIQMNVGWG  185

Query  848   WGFGVPAVAMALAVTFFFSGTRLYRYQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLH  1027
             WGFG+PAVAMA+AV FFFSG+RLYR QKPGGSP TR+ QV+VAS RK  V VP+DKSLL+
Sbjct  186   WGFGIPAVAMAIAVVFFFSGSRLYRIQKPGGSPLTRIMQVIVASFRKSNVVVPADKSLLY  245

Query  1028  ETVGLESNIQGSRKLSHTNELRFFDKAAVVEESLDEDKKGSVSPWRLCTVTQVEELKSII  1207
             ET   E NIQGSRKL  T++ +FFDKAAV  E+  +  KGS  PWRLCTVTQVEELK+II
Sbjct  246   ETADEECNIQGSRKLESTSKFKFFDKAAV--ETQTDRVKGSADPWRLCTVTQVEELKAII  303

Query  1208  RLLPIWATGIIFSTVYGQMGTQFISQAEGMNTYVG-TFKXPXASLGV  1345
             RLLP+WA+GI+F+TVY QM T F+ Q   M+ ++G  FK P ASL +
Sbjct  304   RLLPVWASGIVFATVYSQMSTMFVLQGNTMDQHMGPNFKIPSASLSL  350



>ref|XP_004246936.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Solanum lycopersicum]
Length=562

 Score =   496 bits (1278),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 239/376 (64%), Positives = 291/376 (77%), Gaps = 6/376 (2%)
 Frame = +2

Query  224   DDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQS  403
             DDVYTKDGT D    PANKKKTG WKAC FILG E SERLAY+G S+NL+ Y    L  +
Sbjct  5     DDVYTKDGTTDITKAPANKKKTGTWKACFFILGEEISERLAYFGTSTNLVNYLHQMLGLN  64

Query  404   TTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPGIS  583
               +ASK ++N+ GTCY+ PL+GAFLADAYLGRYWTIA FSIIY+MGMTL+T+SA++ GI 
Sbjct  65    NAAASKVVTNFQGTCYVSPLLGAFLADAYLGRYWTIAIFSIIYIMGMTLLTMSASIVGIK  124

Query  584   PTCIAHDK-CTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSF  760
             P+C  HD  C     +    +IA+YL+ALGTGGIKPCVSS+GADQFDD DE E++ KSSF
Sbjct  125   PSC--HDGICHPRELEKTTFYIAIYLIALGTGGIKPCVSSFGADQFDDNDEVEKRKKSSF  182

Query  761   FNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKPGG  940
             FNWFY SI++GAL+A+S++VWIQ  V WGWGFG+PAVAMA+A+ FFF GTR YR Q PGG
Sbjct  183   FNWFYLSISIGALIASSVLVWIQTSVGWGWGFGIPAVAMAIALMFFFVGTRFYRLQTPGG  242

Query  941   SPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAVVE  1120
             SP  R+ QV+VAS+RK  VK P+DKSLL+ET   ESNI+GSRKL+HT++  F DK+AV  
Sbjct  243   SPLIRMLQVLVASMRKWDVKPPADKSLLYETANEESNIKGSRKLTHTDKFSFLDKSAV--  300

Query  1121  ESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEGMN  1300
             E+  +   GSV+PWRLCTVTQVEE+KSIIRLLP+WA  I+F+T Y QM T F+ Q   M+
Sbjct  301   ETARDKVNGSVNPWRLCTVTQVEEIKSIIRLLPVWACCIMFTTAYSQMNTTFVLQGNTMD  360

Query  1301  TYV-GTFKXPXASLGV  1345
              Y+ G FK P ASL V
Sbjct  361   RYMGGNFKIPSASLIV  376



>emb|CDX78212.1| BnaA09g34070D [Brassica napus]
Length=439

 Score =   492 bits (1266),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 234/378 (62%), Positives = 282/378 (75%), Gaps = 17/378 (4%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             MEE DVYT+DGT+D    PANKK TGNWKAC FIL N C ER AYYGMS NL+ Y ++RL
Sbjct  1     MEESDVYTEDGTVDIHKNPANKKTTGNWKACRFILVNVCCERFAYYGMSKNLVDYLKSRL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             NQ   +A+ N++NW GTCYI PL+GAFLADAYLGRYWTIATF  IYV G+TL+TLSA+VP
Sbjct  61    NQGNATAANNVTNWFGTCYITPLIGAFLADAYLGRYWTIATFVFIYVFGLTLLTLSASVP  120

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+ P               AV F+ALY++ALG GGI+PCVSS+GADQFD+ DE E+  KS
Sbjct  121   GLKP---------------AVFFVALYMIALGIGGIEPCVSSFGADQFDENDEAEKLKKS  165

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFS NVGA VA ++I WIQ ++ WGWGFGVP VAM +AV FFFSG+R YR Q+P
Sbjct  166   SFFNWFYFSANVGAFVATTVISWIQMNIGWGWGFGVPTVAMVIAVMFFFSGSRYYRLQRP  225

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
              G+P TR+FQV+VA+LRK  V+VP DKS L E     SNI GSRKL HT+ L+FFDKAAV
Sbjct  226   QGNPLTRIFQVIVAALRKMSVEVPEDKSQLFEIADDASNITGSRKLEHTDNLKFFDKAAV  285

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               +S D    G V+PWRLC+VTQVEELK II LLP WA+GI+F+TVY Q+ T F+ Q   
Sbjct  286   ESQS-DSINDGEVNPWRLCSVTQVEELKCIITLLPFWASGIVFATVYSQLNTLFVLQGNT  344

Query  1295  MNTYVGT-FKXPXASLGV  1345
             M+ ++G  F+ P  SL +
Sbjct  345   MDQHMGKHFEIPSDSLSL  362



>gb|KDO53231.1| hypothetical protein CISIN_1g008792mg [Citrus sinensis]
Length=553

 Score =   496 bits (1277),  Expect = 8e-168, Method: Compositional matrix adjust.
 Identities = 236/376 (63%), Positives = 287/376 (76%), Gaps = 20/376 (5%)
 Frame = +2

Query  221   EDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQ  400
             E+D++T DGT+D+ N+PA KK+TG WKACP+ILGNEC ERLAYYG+++NL+ Y +  LNQ
Sbjct  4     EEDIHTNDGTIDFGNKPAVKKETGTWKACPYILGNECCERLAYYGINTNLVNYLRFELNQ  63

Query  401   STTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPGI  580
                 A  N++NWSGTCY+MPL+GAFLADAYLGRYWTIA+FSIIYV+GMT++T+SA+V G+
Sbjct  64    GNVQAVNNVTNWSGTCYVMPLIGAFLADAYLGRYWTIASFSIIYVIGMTILTMSASVHGL  123

Query  581   SPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSF  760
              P C   + C  TG   AV F+ LYL+ALGTGGIKPCVSS+GADQFDD DE E+K KSSF
Sbjct  124   KPLCDKRNVCHPTGLQIAVFFVGLYLIALGTGGIKPCVSSFGADQFDDYDEAEKKKKSSF  183

Query  761   FNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKPGG  940
             FNWFYFSIN+GALVAAS +VWIQ +V WGWGFG+PAVAMA+AV  FF+G+RLYRYQKPGG
Sbjct  184   FNWFYFSINIGALVAASCLVWIQTNVGWGWGFGIPAVAMAIAVVSFFAGSRLYRYQKPGG  243

Query  941   SPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAVVE  1120
             SP TR+ Q                 SLL+ET   E  + GS KL HT +L F DKAAV  
Sbjct  244   SPLTRICQ-----------------SLLYETADAEFAVIGSHKLDHTKQLSFLDKAAV--  284

Query  1121  ESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEGMN  1300
             E+  +  KGSV+ WRLCTVTQVEE KSIIRLLPIWA GI+FS VY QMGT F+ Q   M+
Sbjct  285   ETPSDCVKGSVNAWRLCTVTQVEEFKSIIRLLPIWAIGIVFSAVYSQMGTLFVLQGNTMD  344

Query  1301  TYV-GTFKXPXASLGV  1345
              ++  +F+ P ASL +
Sbjct  345   LHIDNSFEIPSASLSL  360



>gb|EYU26644.1| hypothetical protein MIMGU_mgv1a003683mg [Erythranthe guttata]
Length=570

 Score =   496 bits (1276),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 245/379 (65%), Positives = 304/379 (80%), Gaps = 5/379 (1%)
 Frame = +2

Query  212   AMEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTR  391
             AMEED +YT+DGT++   +PANK KTGNWKAC FIL  EC ERLAYYGMS+NL+ Y + R
Sbjct  3     AMEED-IYTRDGTVNIHKKPANKTKTGNWKACRFILVTECCERLAYYGMSTNLVNYLKIR  61

Query  392   LNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATV  571
             LN++  SAS  ++NWSGTCY+ PL+GAF+AD++LGRY TIA+F  IYV+GMTL+TLSA+V
Sbjct  62    LNEANASASTIVTNWSGTCYVTPLIGAFIADSFLGRYLTIASFCTIYVLGMTLLTLSASV  121

Query  572   PGISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHK  751
              G+ P C ++  C  T     + F A+YL+A GTGGIKPCVSS+GADQFDD DEKE+K K
Sbjct  122   HGLKPDC-SNGHCHPTASQKGIFFAAIYLIAFGTGGIKPCVSSFGADQFDDNDEKEKKKK  180

Query  752   SSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQK  931
             SSFFNWFY SINVGAL+A+S++VWIQ +V WGWGFGVPAVAMA+AV FFF G+ LYR QK
Sbjct  181   SSFFNWFYLSINVGALIASSVLVWIQMNVGWGWGFGVPAVAMAIAVGFFFFGSSLYRLQK  240

Query  932   PGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAA  1111
             PGGSP TR+ QV+VAS+RK +V++PSDK+LL+ET  + S IQGSRKL HT + RF DKAA
Sbjct  241   PGGSPLTRIAQVLVASVRKYRVEIPSDKTLLYETSDVGSFIQGSRKLVHTEKFRFLDKAA  300

Query  1112  VVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAE  1291
             V  E+ D+  KG+V+PW+LCTVTQVEE KSIIR+LPIWATGI+FS VY QM T FI Q +
Sbjct  301   V--ETEDDSHKGAVNPWKLCTVTQVEEFKSIIRVLPIWATGIVFSAVYSQMNTMFILQGD  358

Query  1292  GMNTYVG-TFKXPXASLGV  1345
              ++ ++G  FK P ASL +
Sbjct  359   TLDQHMGPNFKIPAASLSL  377



>ref|XP_006365609.1| PREDICTED: peptide transporter PTR5-like [Solanum tuberosum]
Length=562

 Score =   495 bits (1275),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 236/375 (63%), Positives = 290/375 (77%), Gaps = 4/375 (1%)
 Frame = +2

Query  224   DDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQS  403
             DDVYTKDGT D    PANKKKTG WKAC FILG E SERLAY+G S+NL+ Y    L  +
Sbjct  5     DDVYTKDGTTDINKAPANKKKTGTWKACFFILGEEISERLAYFGTSANLVNYLHQMLGLN  64

Query  404   TTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPGIS  583
               +ASK ++N+ GTCY+ PL GAFLADAYLGRYWTIA FSIIY+MGMTL+T+SA++ GI 
Sbjct  65    NAAASKVVTNFQGTCYVTPLFGAFLADAYLGRYWTIAIFSIIYIMGMTLLTMSASIVGIK  124

Query  584   PTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSFF  763
             P+C  +  C  T  +    +IA+YL+ALGTGGIKPCVSS+GADQFDD DE E++ KSSFF
Sbjct  125   PSC-HNGICHPTELEKTTFYIAIYLIALGTGGIKPCVSSFGADQFDDNDEVEKRRKSSFF  183

Query  764   NWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKPGGS  943
             NWFY SIN+G+L+A+S++VWIQ  V WGWGFG+PAVAMA+A+ FFF+GTR YR Q PGGS
Sbjct  184   NWFYLSINIGSLIASSVLVWIQTSVGWGWGFGIPAVAMAIALMFFFAGTRFYRLQTPGGS  243

Query  944   PFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAVVEE  1123
             P  R+ QV+VAS+RK  VK P+DKSLL+ET   ES+I GSRKL+HT++  F DK+AV  E
Sbjct  244   PLIRMLQVLVASMRKWDVKPPADKSLLYETANEESSILGSRKLAHTDKFSFLDKSAV--E  301

Query  1124  SLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEGMNT  1303
             +  +   GSV+PWRLCTVTQVEE+KSIIRLLP+WA  I+F+T Y QM T F+ Q   M+ 
Sbjct  302   TTHDKVNGSVNPWRLCTVTQVEEIKSIIRLLPVWACCIMFTTAYSQMNTTFVLQGNTMDR  361

Query  1304  YV-GTFKXPXASLGV  1345
             ++ G FK P ASL V
Sbjct  362   HMGGHFKIPSASLTV  376



>ref|NP_001131161.1| uncharacterized protein LOC100192469 [Zea mays]
 ref|XP_008654285.1| PREDICTED: uncharacterized protein LOC100192469 isoform X1 [Zea 
mays]
 ref|XP_008654286.1| PREDICTED: uncharacterized protein LOC100192469 isoform X1 [Zea 
mays]
 ref|XP_008654287.1| PREDICTED: uncharacterized protein LOC100192469 isoform X1 [Zea 
mays]
 ref|XP_008654289.1| PREDICTED: uncharacterized protein LOC100192469 isoform X1 [Zea 
mays]
 ref|XP_008654290.1| PREDICTED: uncharacterized protein LOC100192469 isoform X1 [Zea 
mays]
 ref|XP_008654291.1| PREDICTED: uncharacterized protein LOC100192469 isoform X1 [Zea 
mays]
 ref|XP_008654292.1| PREDICTED: uncharacterized protein LOC100192469 isoform X1 [Zea 
mays]
 ref|XP_008654293.1| PREDICTED: uncharacterized protein LOC100192469 isoform X1 [Zea 
mays]
 ref|XP_008654294.1| PREDICTED: uncharacterized protein LOC100192469 isoform X1 [Zea 
mays]
 gb|ACF79457.1| unknown [Zea mays]
 gb|ACL52512.1| unknown [Zea mays]
 gb|ACL52938.1| unknown [Zea mays]
 gb|ACN28114.1| unknown [Zea mays]
 gb|ACN28705.1| unknown [Zea mays]
 gb|ACN28818.1| unknown [Zea mays]
 gb|ACN28892.1| unknown [Zea mays]
 gb|AFW80023.1| hypothetical protein ZEAMMB73_328254 [Zea mays]
 gb|AFW80024.1| hypothetical protein ZEAMMB73_328254 [Zea mays]
 gb|AFW80025.1| hypothetical protein ZEAMMB73_328254 [Zea mays]
 gb|AFW80026.1| hypothetical protein ZEAMMB73_328254 [Zea mays]
 gb|AFW80027.1| hypothetical protein ZEAMMB73_328254 [Zea mays]
 gb|AFW80028.1| hypothetical protein ZEAMMB73_328254 [Zea mays]
 gb|AFW80029.1| hypothetical protein ZEAMMB73_328254 [Zea mays]
 gb|AFW80030.1| hypothetical protein ZEAMMB73_328254 [Zea mays]
 gb|AFW80031.1| hypothetical protein ZEAMMB73_328254 [Zea mays]
Length=580

 Score =   492 bits (1266),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 231/376 (61%), Positives = 289/376 (77%), Gaps = 6/376 (2%)
 Frame = +2

Query  218   EEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  397
             E +D+YT+DGT+D +  PA KK TGNW+ACP+IL NEC ERLAYYGMS+NL+ Y +TRL 
Sbjct  3     EVEDMYTQDGTVDMKGNPAVKKGTGNWRACPYILANECCERLAYYGMSTNLVNYMKTRLG  62

Query  398   QSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPG  577
             Q  + AS N++NW GTCYI PL+GAF ADAY+GR+WTIA F IIY+ G+ L+T++++V G
Sbjct  63    QVNSVASNNVTNWQGTCYITPLIGAFFADAYMGRFWTIAIFMIIYIFGLALLTMASSVKG  122

Query  578   ISPT-CIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             + PT C   D C  T    AV F+ALYL+ALGTGGIKPCVSS+GADQFD+ DE+E+K KS
Sbjct  123   LVPTSCGDKDVCHPTDAQAAVVFVALYLIALGTGGIKPCVSSFGADQFDENDEREKKSKS  182

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GALVA++++V++Q  V WGWGFG+PAV MA+AV  FF GT LYR+QKP
Sbjct  183   SFFNWFYFSINIGALVASTVLVYVQTHVGWGWGFGIPAVVMAIAVGSFFVGTPLYRHQKP  242

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QV+VA  RK  V VP+DKS LHETV  ES I+GSRKL H+ +L   D+AAV
Sbjct  243   GGSPLTRIAQVLVACARKWNVAVPADKSRLHETVDGESVIEGSRKLEHSEQLACLDRAAV  302

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
             V      +     SPWRLC+VTQVEELKS+IRLLPIWA+GI+F+ VY QM T F+ Q   
Sbjct  303   VT----AEDGAEASPWRLCSVTQVEELKSVIRLLPIWASGIVFAAVYSQMSTMFVLQGNT  358

Query  1295  MNTYVGT-FKXPXASL  1339
             ++  +G  FK P A+L
Sbjct  359   LDQSMGPRFKIPSATL  374



>ref|XP_009392698.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Musa acuminata 
subsp. malaccensis]
Length=580

 Score =   490 bits (1262),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 239/379 (63%), Positives = 297/379 (78%), Gaps = 5/379 (1%)
 Frame = +2

Query  215   MEED-DVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTR  391
             ME++ DVYTKDGT D    P  KK TGNW+ACP+IL NEC ERLAYYGMS+N++ Y +  
Sbjct  1     MEDNKDVYTKDGTTDLHGNPVIKKNTGNWRACPYILANECCERLAYYGMSTNMVNYMKDH  60

Query  392   LNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATV  571
             L+Q   +A+KN +NWSGTCYI PL+GAF+ADAYLGRYWTIA F IIY++G+TL+T++A+V
Sbjct  61    LHQENATAAKNNTNWSGTCYITPLLGAFIADAYLGRYWTIAGFMIIYILGLTLLTMTASV  120

Query  572   PGISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHK  751
              G+ P C  +  C  T   +A  F+ALYL+ALGTGGIKPCVSS+GADQFD++DE E+K K
Sbjct  121   TGLKPPC-QNGVCDPTTAQSAAFFVALYLIALGTGGIKPCVSSFGADQFDESDESEKKRK  179

Query  752   SSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQK  931
             SSFFNWFYFSINVG+LVA+S+IVW+Q +V WGWGFG+PAV MA+AV  FF GT LYR+QK
Sbjct  180   SSFFNWFYFSINVGSLVASSVIVWVQTNVGWGWGFGIPAVVMAVAVASFFFGTPLYRHQK  239

Query  932   PGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAA  1111
             PGGSP TR+ QVVVAS RK   KVP DKSLL+E    ES I+GSRKL HT++ +F DKAA
Sbjct  240   PGGSPLTRIAQVVVASWRKFGAKVPDDKSLLYEITEKESAIRGSRKLDHTDQFKFLDKAA  299

Query  1112  VVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAE  1291
             V  E+  +   G V+PW LCTVTQVEELKSI+RLLP+WA+GI+FS VY QMG  F+ Q +
Sbjct  300   V--ETQADKLTGPVNPWGLCTVTQVEELKSILRLLPVWASGIVFSAVYSQMGNMFVLQGD  357

Query  1292  GMNTYVGT-FKXPXASLGV  1345
              M+ ++G  F+ P ASL +
Sbjct  358   TMDRHMGPHFEVPAASLSM  376



>ref|XP_009405229.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Musa acuminata 
subsp. malaccensis]
Length=577

 Score =   488 bits (1255),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 241/377 (64%), Positives = 305/377 (81%), Gaps = 4/377 (1%)
 Frame = +2

Query  218   EEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  397
             E +D+YTKDGT D    PA KK TGNW+ACP+IL NEC ERLAYYGMS+NL+ Y + RL+
Sbjct  3     EGEDIYTKDGTTDLHGNPAIKKDTGNWRACPYILANECCERLAYYGMSTNLVNYMKDRLH  62

Query  398   QSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPG  577
             Q   +A+ N+++WSGTCY+MPL+GAF+ADAY GRYWTIA+F IIY++G+TL+TL+A+V G
Sbjct  63    QGNATAANNVTDWSGTCYVMPLLGAFIADAYAGRYWTIASFMIIYILGLTLLTLTASVKG  122

Query  578   ISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSS  757
             + PTC +   C  T   TAV F +LYL+AL TGGIKPCVSS+GADQFD+TDE E+K KSS
Sbjct  123   LEPTCHS-GVCDPTRAQTAVVFTSLYLIALATGGIKPCVSSFGADQFDETDESEKKRKSS  181

Query  758   FFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKPG  937
             FFNWFYFSIN+G+LVAAS +VWIQ +V WGWGFG+PAVAMA+AV  FF GT LYR+QKPG
Sbjct  182   FFNWFYFSINIGSLVAASALVWIQTNVGWGWGFGIPAVAMAVAVVSFFLGTPLYRHQKPG  241

Query  938   GSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAVV  1117
             GSP TR+ QV+VASLRK  VK+P++KSLL+E     S I+GSRK+ HT++L+F DKAAV 
Sbjct  242   GSPLTRIAQVMVASLRKSGVKLPANKSLLYEITREYSAIRGSRKMDHTDQLKFLDKAAV-  300

Query  1118  EESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEGM  1297
              ++ ++   G+V+PWRLCTVTQVEELKSI+RLLPIWA+GI+FSTVY QMGT F+ Q   +
Sbjct  301   -QTQEDRINGAVNPWRLCTVTQVEELKSIVRLLPIWASGIVFSTVYSQMGTMFVLQGNTL  359

Query  1298  NTYVGT-FKXPXASLGV  1345
             + ++G  F+ P ASL +
Sbjct  360   DRHMGPRFEIPSASLSI  376



>ref|XP_004504618.1| PREDICTED: peptide transporter PTR2-like [Cicer arietinum]
Length=584

 Score =   488 bits (1255),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 233/385 (61%), Positives = 288/385 (75%), Gaps = 5/385 (1%)
 Frame = +2

Query  194   MMEQSKAM-EEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNL  370
             ++EQ+    EE   YT DG++D++ RP  K+ TGNWKACPFILGNEC ERLAYYG+++NL
Sbjct  10    LLEQALIQDEESKRYTGDGSVDFKGRPVLKQNTGNWKACPFILGNECCERLAYYGIATNL  69

Query  371   MIYFQTRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTL  550
             + Y   +L++   SA++N++ W GTCY+ PL+GA LAD+Y GRYWTIA+FS IY +GM  
Sbjct  70    VTYLTRKLHEGNVSAARNVTTWQGTCYLAPLIGAVLADSYWGRYWTIASFSTIYFLGMCT  129

Query  551   MTLSATVPGISPT-CIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDT  727
             +TLSA+VP + P  C+      AT    AV FI LYL+ALGTGGIKPCVSS+GADQFDDT
Sbjct  130   LTLSASVPALKPAECLGTVCPPATPAQYAVFFIGLYLIALGTGGIKPCVSSFGADQFDDT  189

Query  728   DEKERKHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSG  907
             D +ER  K SFFNWFYFSIN+GALV++S IVWIQ++  WG GFG+PA+ M LA+  FF G
Sbjct  190   DSQERIKKGSFFNWFYFSINIGALVSSSFIVWIQENAGWGLGFGIPALFMGLAIGSFFLG  249

Query  908   TRLYRYQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNE  1087
             T LYR+QKPGGSP TR+ QVV AS RKR + VP D SLL+ET    S I+GSRKL H++E
Sbjct  250   TPLYRFQKPGGSPLTRMCQVVAASFRKRNLAVPEDSSLLYETPDKSSAIEGSRKLEHSDE  309

Query  1088  LRFFDKAAVVEESLDEDKKGSVSP-WRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQM  1264
             LR  D+AAVV ++  E K G  S  WRLCTVTQVEELK +IR+ P+WATGIIFS VY QM
Sbjct  310   LRCLDRAAVVSDA--ERKSGDYSNLWRLCTVTQVEELKILIRMFPVWATGIIFSAVYAQM  367

Query  1265  GTQFISQAEGMNTYVGTFKXPXASL  1339
              T F+ Q   MNT +G+FK P ASL
Sbjct  368   STMFVEQGTMMNTQIGSFKIPPASL  392



>ref|XP_010513957.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3 [Camelina sativa]
Length=584

 Score =   487 bits (1254),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 230/385 (60%), Positives = 288/385 (75%), Gaps = 4/385 (1%)
 Frame = +2

Query  194   MMEQSKAMEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLM  373
             ++E+   ++E  +Y +DG++D+   P  K+KTGNWKACPFILGNEC ERLAYYG++ NL+
Sbjct  11    LIEEGLVLQEAKLYAEDGSVDFNGNPPLKEKTGNWKACPFILGNECCERLAYYGIAGNLI  70

Query  374   IYFQTRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLM  553
              Y  T+L+Q   SA+ N++ W GTCY+ PL+GA LADAY GRYWTIA FS IY +GM+ +
Sbjct  71    TYLTTKLHQGNVSAATNVTTWQGTCYLTPLIGAILADAYWGRYWTIACFSGIYFIGMSAL  130

Query  554   TLSATVPGISPTCIAHDKC-TATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTD  730
             TLSA+VP + P     D C +AT    A+ F  LYL+ALGTGGIKPCVSS+GADQFDDTD
Sbjct  131   TLSASVPALKPAECIGDFCPSATPAQYAMFFGGLYLIALGTGGIKPCVSSFGADQFDDTD  190

Query  731   EKERKHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGT  910
              +ER  K+SFFNWFYFSIN+GALV++SL+VWIQ++  WG GFG+P V M LA+  FF GT
Sbjct  191   SRERVRKASFFNWFYFSINIGALVSSSLLVWIQENRGWGLGFGIPTVFMGLAIASFFFGT  250

Query  911   RLYRYQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNEL  1090
              LYR+QKPGGSP TR+ QVVVAS RK  VKVP D +LL+ET    S I GSRK+ HTN+ 
Sbjct  251   PLYRFQKPGGSPITRISQVVVASFRKSSVKVPEDPTLLYETQDKNSAIAGSRKIEHTNDS  310

Query  1091  RFFDKAAVVEESLDEDKKGSVS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMG  1267
             ++ DKAAV+ E  +E K G  S  WRLCTVTQVEELK +IR+ PIWA+GIIFS VY QM 
Sbjct  311   KYLDKAAVISE--EELKSGDFSNSWRLCTVTQVEELKILIRMFPIWASGIIFSAVYAQMS  368

Query  1268  TQFISQAEGMNTYVGTFKXPXASLG  1342
             T F+ Q   MN  +G+F+ P A+LG
Sbjct  369   TMFVQQGRAMNCKIGSFQLPPAALG  393



>ref|XP_010502212.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3-like [Camelina sativa]
Length=584

 Score =   487 bits (1253),  Expect = 9e-164, Method: Compositional matrix adjust.
 Identities = 230/385 (60%), Positives = 288/385 (75%), Gaps = 4/385 (1%)
 Frame = +2

Query  194   MMEQSKAMEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLM  373
             ++E+   ++E  +Y +DG++D+   P  K+KTGNWKACPFILGNEC ERLAYYG++ NL+
Sbjct  11    LIEEGLILQEAKLYAEDGSVDFNGNPPLKEKTGNWKACPFILGNECCERLAYYGIAGNLI  70

Query  374   IYFQTRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLM  553
              Y  T+L+Q   SA+ N++ W GTCY+ PL+GA LADAY GRYWTIA FS IY +GM+ +
Sbjct  71    TYLTTKLHQGNVSAATNVTTWQGTCYLTPLIGAILADAYWGRYWTIACFSGIYFIGMSAL  130

Query  554   TLSATVPGISPTCIAHDKC-TATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTD  730
             TLSA+VP + P     D C +AT    A+ F  LYL+ALGTGGIKPCVSS+GADQFDDTD
Sbjct  131   TLSASVPALKPAECIGDFCPSATPAQYAMFFGGLYLIALGTGGIKPCVSSFGADQFDDTD  190

Query  731   EKERKHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGT  910
              +ER  K+SFFNWFYFSIN+GALV++SL+VWIQ++  WG GFG+P V M LA+  FF GT
Sbjct  191   SRERVRKASFFNWFYFSINIGALVSSSLLVWIQENRGWGLGFGIPTVFMGLAIASFFFGT  250

Query  911   RLYRYQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNEL  1090
              LYR+QKPGGSP TR+ QVVVAS RK  VKVP D +LL+ET    S I GSRK+ HTN+ 
Sbjct  251   PLYRFQKPGGSPITRISQVVVASFRKSSVKVPEDPTLLYETQDKSSAIAGSRKIEHTNDS  310

Query  1091  RFFDKAAVVEESLDEDKKGSVS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMG  1267
             ++ DKAAV+ E  +E K G  S  WRLCTVTQVEELK +IR+ PIWA+GIIFS VY QM 
Sbjct  311   KYLDKAAVISE--EELKSGDFSNSWRLCTVTQVEELKILIRMFPIWASGIIFSAVYAQMS  368

Query  1268  TQFISQAEGMNTYVGTFKXPXASLG  1342
             T F+ Q   MN  +G+F+ P A+LG
Sbjct  369   TMFVQQGRAMNCKIGSFQLPPAALG  393



>ref|XP_006292510.1| hypothetical protein CARUB_v10018740mg, partial [Capsella rubella]
 gb|EOA25408.1| hypothetical protein CARUB_v10018740mg, partial [Capsella rubella]
Length=576

 Score =   486 bits (1250),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 229/385 (59%), Positives = 287/385 (75%), Gaps = 4/385 (1%)
 Frame = +2

Query  194   MMEQSKAMEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLM  373
              +E+   ++E  +Y +DG++D+   P  K+KTGNWKACPFILGNEC ERLAYYG++ NL+
Sbjct  11    FIEEGLILQEAKLYAEDGSVDFNGNPPLKEKTGNWKACPFILGNECCERLAYYGIAGNLI  70

Query  374   IYFQTRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLM  553
              Y  T+L+Q   +A+ N++ W GTCY+ PL+GA LADAY GRYWTIA FS IY +GM+ +
Sbjct  71    TYLTTKLHQGNVAAATNVTTWQGTCYLTPLIGAVLADAYWGRYWTIACFSGIYFIGMSAL  130

Query  554   TLSATVPGISPTCIAHDKC-TATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTD  730
             TLSA+VP + P     D C +AT    A+ F  LYL+ALGTGGIKPCVSS+GADQFDDTD
Sbjct  131   TLSASVPALKPAECIGDFCPSATPAQYAMFFSGLYLIALGTGGIKPCVSSFGADQFDDTD  190

Query  731   EKERKHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGT  910
              +ER  K+SFFNWFYFSIN+GALV++SL+VWIQ++  WG GFG+P V M LA+  FF GT
Sbjct  191   SRERVRKASFFNWFYFSINIGALVSSSLLVWIQENRGWGLGFGIPTVFMGLAIASFFFGT  250

Query  911   RLYRYQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNEL  1090
              LYR+QKPGGSP TR+ QVVVAS RK  VKVP D +LL+ET    S I GSRK+ HT++ 
Sbjct  251   PLYRFQKPGGSPITRISQVVVASFRKSSVKVPEDPTLLYETQDKNSAIAGSRKIEHTDDC  310

Query  1091  RFFDKAAVVEESLDEDKKGSVS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMG  1267
             ++ DKAAV+ E  DE K G  S  WRLCTVTQVEELK +IR+ PIWA+GIIFS VY QM 
Sbjct  311   KYLDKAAVISE--DESKSGDFSNTWRLCTVTQVEELKILIRMFPIWASGIIFSAVYAQMS  368

Query  1268  TQFISQAEGMNTYVGTFKXPXASLG  1342
             T F+ Q   MN  +G+F+ P A+LG
Sbjct  369   TMFVQQGRAMNCKIGSFQLPPAALG  393



>ref|NP_178313.1| peptide transporter PTR2 [Arabidopsis thaliana]
 sp|P46032.1|PTR2_ARATH RecName: Full=Protein NRT1/ PTR FAMILY 8.3; Short=AtNPF8.3; AltName: 
Full=Histidine-transporting protein; AltName: Full=Peptide 
transporter PTR2 [Arabidopsis thaliana]
 gb|AAK50086.1|AF372946_1 At2g02040/F14H20.11 [Arabidopsis thaliana]
 gb|AAB00858.1| transport protein [Arabidopsis thaliana]
 gb|AAD20096.1| histidine transport protein (PTR2-B) [Arabidopsis thaliana]
 gb|AAN28893.1| At2g02040/F14H20.11 [Arabidopsis thaliana]
 gb|AEC05538.1| peptide transporter PTR2 [Arabidopsis thaliana]
Length=585

 Score =   485 bits (1249),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 229/385 (59%), Positives = 288/385 (75%), Gaps = 4/385 (1%)
 Frame = +2

Query  194   MMEQSKAMEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLM  373
             ++E+   ++E  +Y +DG++D+   P  K+KTGNWKACPFILGNEC ERLAYYG++ NL+
Sbjct  11    LIEEGLILQEVKLYAEDGSVDFNGNPPLKEKTGNWKACPFILGNECCERLAYYGIAGNLI  70

Query  374   IYFQTRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLM  553
              Y  T+L+Q   SA+ N++ W GTCY+ PL+GA LADAY GRYWTIA FS IY +GM+ +
Sbjct  71    TYLTTKLHQGNVSAATNVTTWQGTCYLTPLIGAVLADAYWGRYWTIACFSGIYFIGMSAL  130

Query  554   TLSATVPGISPTCIAHDKC-TATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTD  730
             TLSA+VP + P     D C +AT    A+ F  LYL+ALGTGGIKPCVSS+GADQFDDTD
Sbjct  131   TLSASVPALKPAECIGDFCPSATPAQYAMFFGGLYLIALGTGGIKPCVSSFGADQFDDTD  190

Query  731   EKERKHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGT  910
              +ER  K+SFFNWFYFSIN+GALV++SL+VWIQ++  WG GFG+P V M LA+  FF GT
Sbjct  191   SRERVRKASFFNWFYFSINIGALVSSSLLVWIQENRGWGLGFGIPTVFMGLAIASFFFGT  250

Query  911   RLYRYQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNEL  1090
              LYR+QKPGGSP TR+ QVVVAS RK  VKVP D +LL+ET    S I GSRK+ HT++ 
Sbjct  251   PLYRFQKPGGSPITRISQVVVASFRKSSVKVPEDATLLYETQDKNSAIAGSRKIEHTDDC  310

Query  1091  RFFDKAAVVEESLDEDKKGSVS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMG  1267
             ++ DKAAV+ E  +E K G  S  WRLCTVTQVEELK +IR+ PIWA+GIIFS VY QM 
Sbjct  311   QYLDKAAVISE--EESKSGDYSNSWRLCTVTQVEELKILIRMFPIWASGIIFSAVYAQMS  368

Query  1268  TQFISQAEGMNTYVGTFKXPXASLG  1342
             T F+ Q   MN  +G+F+ P A+LG
Sbjct  369   TMFVQQGRAMNCKIGSFQLPPAALG  393



>ref|XP_010424976.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3-like [Camelina sativa]
Length=584

 Score =   485 bits (1248),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 229/385 (59%), Positives = 287/385 (75%), Gaps = 4/385 (1%)
 Frame = +2

Query  194   MMEQSKAMEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLM  373
             ++E+   ++E  +Y +DG++D+   P  K+KTGNWKACPFILGNEC ERLAYYG++ NL+
Sbjct  11    LIEEGLILQEAKLYAEDGSVDFNGNPPLKEKTGNWKACPFILGNECCERLAYYGIAGNLI  70

Query  374   IYFQTRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLM  553
              Y  T+L+Q   SA+ N++ W GTCY+ PL+GA LADAY GRYWTIA FS IY +GM+ +
Sbjct  71    TYLTTKLHQGNVSAATNVTTWQGTCYLTPLIGAILADAYWGRYWTIACFSGIYFIGMSAL  130

Query  554   TLSATVPGISPTCIAHDKC-TATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTD  730
             TLSA+VP + P     D C +AT    A+ F  LYL+ALGTGGIKPCVSS+GADQFDDTD
Sbjct  131   TLSASVPALKPAECIGDFCPSATPAQYAMFFGGLYLIALGTGGIKPCVSSFGADQFDDTD  190

Query  731   EKERKHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGT  910
              +ER  K+SFFNWFYFSIN+GALV++SL+VWIQ++  WG GFG+P V M LA+  FF GT
Sbjct  191   SRERVRKASFFNWFYFSINIGALVSSSLLVWIQENRGWGLGFGIPTVFMGLAIASFFFGT  250

Query  911   RLYRYQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNEL  1090
              LYR+QKPGGSP TR+ QVVVAS RK  VKVP D +LL+ET    S I GSRK+ HTN+ 
Sbjct  251   PLYRFQKPGGSPITRISQVVVASFRKSSVKVPEDPTLLYETQDKSSAIAGSRKIEHTNDS  310

Query  1091  RFFDKAAVVEESLDEDKKGSVS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMG  1267
             ++ DKAAV+ E  +E K G  S  WRLCTVTQVEELK +IR+ PIW +GIIFS VY QM 
Sbjct  311   KYLDKAAVISE--EELKSGDFSNSWRLCTVTQVEELKILIRMFPIWVSGIIFSAVYAQMS  368

Query  1268  TQFISQAEGMNTYVGTFKXPXASLG  1342
             T F+ Q   MN  +G+F+ P A+LG
Sbjct  369   TMFVQQGRAMNCKIGSFQLPPAALG  393



>gb|EPS69660.1| hypothetical protein M569_05105, partial [Genlisea aurea]
Length=578

 Score =   484 bits (1246),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 235/378 (62%), Positives = 289/378 (76%), Gaps = 2/378 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M EDD YT DGTLD    PA K KTG WKAC FIL  EC ERLAYYGM +NL+ + +TRL
Sbjct  9     MGEDDTYTTDGTLDIHKNPAIKSKTGTWKACRFILVTECCERLAYYGMGTNLVNFLKTRL  68

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
                  +AS +++NWSGTCY  PL+GAFLAD+YLGRYWTI  F IIY++GMTL+TL+A+V 
Sbjct  69    GMGNVAASNSVTNWSGTCYFTPLIGAFLADSYLGRYWTIFNFCIIYILGMTLLTLTASVH  128

Query  575   GISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             G+ P C + + C  T   TA+CF+ALYL+ALGTGGIKPCVSS+GADQFDD DEKE+  K+
Sbjct  129   GLIPRCDS-EGCHPTRFQTAMCFVALYLIALGTGGIKPCVSSFGADQFDDNDEKEKPKKA  187

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFY SINVGAL+A+S++VWIQ +V W WGFG+PA AMA+AV FF  G+R YR+QKP
Sbjct  188   SFFNWFYLSINVGALIASSVLVWIQMNVGWSWGFGIPAAAMAVAVAFFLFGSRRYRFQKP  247

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QVVVAS RK  + VP D+SLL+     ES+I GSRKLSHT++ RF DKAAV
Sbjct  248   GGSPLTRIAQVVVASFRKAGMDVPRDESLLYGNSDKESDIPGSRKLSHTDKFRFLDKAAV  307

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
               +     + G V+PWRLC+VTQVEE KSII +LPIWA+GI+FSTVY QM T F+ Q   
Sbjct  308   ERDGDGAFENGGVNPWRLCSVTQVEEFKSIISILPIWASGILFSTVYSQMNTMFVLQGNT  367

Query  1295  MNTYVG-TFKXPXASLGV  1345
             M+ ++G +F+ P ASL +
Sbjct  368   MDQHMGRSFEIPAASLSL  385



>ref|XP_002875108.1| ATPTR2-B [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51367.1| ATPTR2-B [Arabidopsis lyrata subsp. lyrata]
Length=584

 Score =   484 bits (1245),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 228/385 (59%), Positives = 286/385 (74%), Gaps = 4/385 (1%)
 Frame = +2

Query  194   MMEQSKAMEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLM  373
             ++E+   ++E  +Y +DG++D+   P  K+KTGNWKACPFILGNEC ERLAYYG++ NL+
Sbjct  11    LIEEGLILQEAKLYAEDGSVDFNGNPPLKEKTGNWKACPFILGNECCERLAYYGIAGNLI  70

Query  374   IYFQTRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLM  553
              Y  T+L+Q   SA+ N++ W GTCY+ PL+GA LADAY GRYWTIA FS IY +GM+ +
Sbjct  71    TYLTTKLHQGNVSAATNVTTWQGTCYLTPLIGAVLADAYWGRYWTIACFSGIYFIGMSAL  130

Query  554   TLSATVPGISPTCIAHDKC-TATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTD  730
             TLSA VP + P     D C +AT    A+ F  LYL+ALGTGGIKPCVSS+GADQFDDTD
Sbjct  131   TLSAAVPALKPAECIGDFCPSATPAQYAMFFGGLYLIALGTGGIKPCVSSFGADQFDDTD  190

Query  731   EKERKHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGT  910
              +ER  K+SFFNWFYFSIN+GALV++SL+VWIQ++  WG GFG+P V M LA+  FF GT
Sbjct  191   SRERVRKASFFNWFYFSINIGALVSSSLLVWIQENRGWGLGFGIPTVFMGLAIASFFFGT  250

Query  911   RLYRYQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNEL  1090
              LYR+QKPGGSP TR+ QVVVAS RK  VK+P D  LL+ET    S I GSRK+ HT++ 
Sbjct  251   PLYRFQKPGGSPITRISQVVVASFRKSSVKLPEDPMLLYETQDKNSAIAGSRKIEHTDDC  310

Query  1091  RFFDKAAVVEESLDEDKKGSVS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMG  1267
             ++ DKAAV+ E  +E K G  S  WRLCTVTQVEELK +IR+ PIWA+GIIFS VY QM 
Sbjct  311   KYLDKAAVISE--EESKSGDYSNSWRLCTVTQVEELKILIRMFPIWASGIIFSAVYAQMS  368

Query  1268  TQFISQAEGMNTYVGTFKXPXASLG  1342
             T F+ Q   MN  +G+F+ P A+LG
Sbjct  369   TMFVQQGRAMNCKIGSFQLPPAALG  393



>ref|XP_006395818.1| hypothetical protein EUTSA_v10003893mg [Eutrema salsugineum]
 gb|ACQ90598.1| putative nitrate transporter [Eutrema halophilum]
 gb|ESQ33104.1| hypothetical protein EUTSA_v10003893mg [Eutrema salsugineum]
Length=583

 Score =   483 bits (1243),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 229/385 (59%), Positives = 285/385 (74%), Gaps = 4/385 (1%)
 Frame = +2

Query  194   MMEQSKAMEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLM  373
             ++E+    +E  +Y +DG++D    P  K+KTGNWKACPFILGNEC ERLAYYG++ NL+
Sbjct  10    LIEEGLISQEAKLYAQDGSVDLHGNPPLKEKTGNWKACPFILGNECCERLAYYGIAGNLI  69

Query  374   IYFQTRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLM  553
              Y  T+L+Q   SA+ N++ W GTCY+ PL+GA LADAY GRYWTIA FS IY +GM+ +
Sbjct  70    TYLTTKLHQGNVSAATNVTTWQGTCYLTPLIGAVLADAYWGRYWTIACFSGIYFIGMSAL  129

Query  554   TLSATVPGISPTCIAHDKC-TATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTD  730
             TLSA+VP + P     D C +AT    A+ F  LYL+ALGTGGIKPCVSS+GADQFDDTD
Sbjct  130   TLSASVPALKPAECIGDFCPSATPAQYAMFFSGLYLIALGTGGIKPCVSSFGADQFDDTD  189

Query  731   EKERKHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGT  910
               ER  K+SFFNWFYFSIN+GALV++SL+VWIQ++  WG GFG+P V M LA+  FF GT
Sbjct  190   SGERVRKASFFNWFYFSINIGALVSSSLLVWIQENRGWGLGFGIPTVFMGLAIASFFFGT  249

Query  911   RLYRYQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNEL  1090
              LYR+QKPGGSP TR+ QVVVAS RK  +KVP D +LL+ET    S I GSRK+ HTN+ 
Sbjct  250   PLYRFQKPGGSPITRISQVVVASFRKSSLKVPEDATLLYETQDKNSAIAGSRKIVHTNDC  309

Query  1091  RFFDKAAVVEESLDEDKKGSVS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMG  1267
             ++ DKAAV+ E  +E K G  S  WRLCTVTQVEELK +IR+ PIWA+GIIFS VY QM 
Sbjct  310   QYLDKAAVISE--EESKSGDYSNSWRLCTVTQVEELKILIRMFPIWASGIIFSAVYAQMS  367

Query  1268  TQFISQAEGMNTYVGTFKXPXASLG  1342
             T F+ Q   MN  +G+F+ P A+LG
Sbjct  368   TMFVQQGRAMNCKIGSFQLPPAALG  392



>ref|XP_012072405.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3-like [Jatropha curcas]
 gb|KDP38200.1| hypothetical protein JCGZ_04843 [Jatropha curcas]
Length=585

 Score =   482 bits (1241),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 233/384 (61%), Positives = 288/384 (75%), Gaps = 7/384 (2%)
 Frame = +2

Query  194   MMEQSKAMEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLM  373
             ++E++K+ E   +YT DG++D    PA K+ TGNW+ACPFILGNEC ERLAYYG+S+NL+
Sbjct  15    LLEENKSKE---LYTGDGSVDLHGNPALKQNTGNWRACPFILGNECCERLAYYGISTNLV  71

Query  374   IYFQTRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLM  553
              Y   +L++   SA++N+S W+GTCYI PL+GA LADA  GRYWTIA FS IY +GM  +
Sbjct  72    TYLTNKLHEGNVSAARNVSTWAGTCYITPLIGAVLADACWGRYWTIAAFSTIYFIGMCTL  131

Query  554   TLSATVPGISPTCIAHDKCT-ATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTD  730
             TLSA++P + P   A   C  AT    AV F  LYL+ALGTGGIKPCVSS+GADQFDDTD
Sbjct  132   TLSASIPALKPAECAGSLCPPATPAQYAVFFFGLYLIALGTGGIKPCVSSFGADQFDDTD  191

Query  731   EKERKHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGT  910
              KER  K SFFNWFYFSIN+GALV++SL+V+IQ +  WG GFG+PAV MA+A+  FFSGT
Sbjct  192   PKERVKKGSFFNWFYFSINIGALVSSSLLVYIQDNAGWGLGFGIPAVFMAIAIGSFFSGT  251

Query  911   RLYRYQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNEL  1090
              LYR+Q+PGGSP TR+ QV+VAS  KR ++VP D SLL+ET    S I+GSRKL H+NEL
Sbjct  252   PLYRFQRPGGSPITRMCQVLVASFHKRNMEVPQDSSLLYETPEGISAIEGSRKLEHSNEL  311

Query  1091  RFFDKAAVVEESLDEDKKGSVS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMG  1267
             R  DKAAV+  +  E K G  S PWRLCTVTQVEELK ++R+ PIWATGI+FS VY QM 
Sbjct  312   RCLDKAAVISNA--EAKSGDFSNPWRLCTVTQVEELKILVRMFPIWATGIVFSAVYAQMS  369

Query  1268  TQFISQAEGMNTYVGTFKXPXASL  1339
             T F+ Q   M+T VG+F  P ASL
Sbjct  370   TMFVEQGMLMDTKVGSFTIPPASL  393



>ref|NP_001041994.1| Os01g0142800 [Oryza sativa Japonica Group]
 dbj|BAB16458.1| putative peptide transport protein [Oryza sativa Japonica Group]
 dbj|BAB40113.1| putative peptide transport protein [Oryza sativa Japonica Group]
 dbj|BAF03908.1| Os01g0142800 [Oryza sativa Japonica Group]
 gb|EAY72488.1| hypothetical protein OsI_00345 [Oryza sativa Indica Group]
 gb|EAZ10494.1| hypothetical protein OsJ_00327 [Oryza sativa Japonica Group]
 dbj|BAG86793.1| unnamed protein product [Oryza sativa Japonica Group]
Length=580

 Score =   482 bits (1240),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 228/375 (61%), Positives = 293/375 (78%), Gaps = 4/375 (1%)
 Frame = +2

Query  224   DDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQS  403
             +D+YT+DGT+D +  PA KK TGNW+ACP+IL NEC ERLAYYGMS+NL+ Y +TRL Q 
Sbjct  6     EDIYTQDGTVDVKGNPATKKNTGNWRACPYILANECCERLAYYGMSTNLVNYMKTRLGQE  65

Query  404   TTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPGIS  583
             +  A+ N++NWSGTCYI PL+GAFLADAY+GR+WTIA+F IIY++G+ L+T++++V G+ 
Sbjct  66    SAIAANNVTNWSGTCYITPLLGAFLADAYMGRFWTIASFMIIYILGLALLTMASSVKGLV  125

Query  584   PTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSFF  763
             P C     C  T   T V F+ALYL+ALGTGGIKPCVSS+GADQFD+ DE E++ KSSFF
Sbjct  126   PACDG-GACHPTEAQTGVVFLALYLIALGTGGIKPCVSSFGADQFDENDEGEKRSKSSFF  184

Query  764   NWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKPGGS  943
             NWFYFSIN+GALVA+S++V++Q  V WGWGFG+PAV MA+AV  FF GT LYR+Q+PGGS
Sbjct  185   NWFYFSINIGALVASSVLVYVQTHVGWGWGFGIPAVVMAVAVASFFVGTPLYRHQRPGGS  244

Query  944   PFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAVVEE  1123
             P TR+ QV+VAS RK  V+VP+D S LHET+  ES I+GSRKL HT +    D+AAV  E
Sbjct  245   PLTRIAQVLVASARKWGVEVPADGSRLHETLDRESGIEGSRKLEHTGQFACLDRAAV--E  302

Query  1124  SLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEGMNT  1303
             + ++    + S WRLCTVTQVEELKS++RLLPIWA+GI+F+TVYGQM T F+ Q   ++ 
Sbjct  303   TPEDRSAANASAWRLCTVTQVEELKSVVRLLPIWASGIVFATVYGQMSTMFVLQGNTLDA  362

Query  1304  YVGT-FKXPXASLGV  1345
              +G  F  P ASL +
Sbjct  363   SMGPHFSIPAASLSI  377



>dbj|BAG91734.1| unnamed protein product [Oryza sativa Japonica Group]
Length=581

 Score =   481 bits (1239),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 228/375 (61%), Positives = 293/375 (78%), Gaps = 4/375 (1%)
 Frame = +2

Query  224   DDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQS  403
             +D+YT+DGT+D +  PA KK TGNW+ACP+IL NEC ERLAYYGMS+NL+ Y +TRL Q 
Sbjct  6     EDIYTQDGTVDVKGNPATKKNTGNWRACPYILANECCERLAYYGMSTNLVNYMKTRLGQE  65

Query  404   TTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPGIS  583
             +  A+ N++NWSGTCYI PL+GAFLADAY+GR+WTIA+F IIY++G+ L+T++++V G+ 
Sbjct  66    SAIAANNVTNWSGTCYITPLLGAFLADAYMGRFWTIASFMIIYILGLALLTMASSVKGLV  125

Query  584   PTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSFF  763
             P C     C  T   T V F+ALYL+ALGTGGIKPCVSS+GADQFD+ DE E++ KSSFF
Sbjct  126   PACDG-GACHPTEAQTGVVFLALYLIALGTGGIKPCVSSFGADQFDENDEGEKRSKSSFF  184

Query  764   NWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKPGGS  943
             NWFYFSIN+GALVA+S++V++Q  V WGWGFG+PAV MA+AV  FF GT LYR+Q+PGGS
Sbjct  185   NWFYFSINIGALVASSVLVYVQTHVGWGWGFGIPAVVMAVAVASFFVGTPLYRHQRPGGS  244

Query  944   PFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAVVEE  1123
             P TR+ QV+VAS RK  V+VP+D S LHET+  ES I+GSRKL HT +    D+AAV  E
Sbjct  245   PLTRIAQVLVASARKWGVEVPADGSRLHETLDRESGIEGSRKLEHTGQFACLDRAAV--E  302

Query  1124  SLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEGMNT  1303
             + ++    + S WRLCTVTQVEELKS++RLLPIWA+GI+F+TVYGQM T F+ Q   ++ 
Sbjct  303   TPEDRSAANASAWRLCTVTQVEELKSVVRLLPIWASGIVFATVYGQMSTMFVLQGNTLDA  362

Query  1304  YVGT-FKXPXASLGV  1345
              +G  F  P ASL +
Sbjct  363   SMGPHFSIPAASLSI  377



>gb|AAP44102.1| peptide transporter 1 [Vicia faba]
Length=584

 Score =   481 bits (1237),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 228/377 (60%), Positives = 284/377 (75%), Gaps = 5/377 (1%)
 Frame = +2

Query  218   EEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLM-IYFQTRL  394
             EE  +YT DG++D++ RP  KK TGNWKACPFILGNEC ERLAYYG+++NL+      +L
Sbjct  19    EESKLYTGDGSVDFKGRPVLKKNTGNWKACPFILGNECCERLAYYGIATNLVKPILLAKL  78

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             ++   SA++N++ W GTCY+ PL+GA LAD+Y GRYWTIA FS+IY +GM  +TLSA++P
Sbjct  79    HEGNVSAARNVTTWQGTCYLAPLIGAVLADSYWGRYWTIAIFSMIYFIGMGTLTLSASIP  138

Query  575   GISPT-CIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHK  751
              + P  C+      AT    AV FI LYL+ALGTGGIKPCVSS+GADQFDDTD +ER  K
Sbjct  139   ALKPAECLGAVCPPATPAQYAVFFIGLYLIALGTGGIKPCVSSFGADQFDDTDSRERVKK  198

Query  752   SSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQK  931
              SFFNWFYFSIN+GAL+++S IVWIQ++  WG GFG+PA+ M LA+  FF GT LYR+QK
Sbjct  199   GSFFNWFYFSINIGALISSSFIVWIQENAGWGLGFGIPALFMGLAIGSFFLGTPLYRFQK  258

Query  932   PGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAA  1111
             PGGSP TR+ QVV AS RKR + VP D SLL+ET    S I+GSRKL H++ELR  D+AA
Sbjct  259   PGGSPLTRMCQVVAASFRKRNLTVPEDSSLLYETPDKSSAIEGSRKLQHSDELRCLDRAA  318

Query  1112  VVEESLDEDKKGSVSP-WRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQA  1288
             V+ +  DE K+G  S  WRLCTVTQVEELK +IR+ P+WATGI+FS VY QM T F+ Q 
Sbjct  319   VISD--DERKRGDYSNLWRLCTVTQVEELKILIRMFPVWATGIVFSAVYAQMSTMFVEQG  376

Query  1289  EGMNTYVGTFKXPXASL  1339
               M+T VG+FK P ASL
Sbjct  377   TMMDTSVGSFKIPAASL  393



>emb|CDY03084.1| BnaC07g21430D [Brassica napus]
Length=585

 Score =   479 bits (1234),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 227/385 (59%), Positives = 286/385 (74%), Gaps = 4/385 (1%)
 Frame = +2

Query  194   MMEQSKAMEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLM  373
             ++E+    +E  +Y +DG++D    P  K+KTGNWKACPFILGNEC ERLAYYG++ NL+
Sbjct  10    LIEEGLISQEPKLYAQDGSVDLHGNPPLKEKTGNWKACPFILGNECCERLAYYGIAGNLI  69

Query  374   IYFQTRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLM  553
              Y  T+L+Q   SA++N++ W GTCY+ PL+GA LADAY GRYWTIA FS IY +GM+ +
Sbjct  70    TYLTTKLHQGNVSAARNVTTWQGTCYLTPLIGAVLADAYWGRYWTIACFSGIYFIGMSAL  129

Query  554   TLSATVPGISPT-CIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTD  730
             TLSA+VP + P  CI     +AT    A+ F  LYL+ALGTGGIKPCVSS+GADQFDDTD
Sbjct  130   TLSASVPALKPAECIGGFCPSATPAQYAMFFGGLYLIALGTGGIKPCVSSFGADQFDDTD  189

Query  731   EKERKHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGT  910
              +ER  K+SFFNWFYFSIN+GALV++SL+VWIQ++  WG GFG+P V M LA+  FF GT
Sbjct  190   SRERVKKASFFNWFYFSINIGALVSSSLLVWIQENRGWGLGFGIPTVFMGLAIASFFFGT  249

Query  911   RLYRYQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNEL  1090
              LYR+QKPGGSP TR+ QVVVAS RK  +KVP D  LL+ET    S I GSRK+ HT++ 
Sbjct  250   PLYRFQKPGGSPITRISQVVVASFRKSTLKVPEDAMLLYETQDKNSAIAGSRKIEHTDDC  309

Query  1091  RFFDKAAVVEESLDEDKKGSVS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMG  1267
             ++ DKAAV+ E  +E K G  S  WRLCTVTQVEELK +IR+ PIWA+GIIFS VY QM 
Sbjct  310   QYLDKAAVISE--EESKAGDFSNSWRLCTVTQVEELKILIRMFPIWASGIIFSAVYAQMS  367

Query  1268  TQFISQAEGMNTYVGTFKXPXASLG  1342
             T F+ Q   M+  +G+F+ P A+LG
Sbjct  368   TMFVQQGRAMDCKIGSFQLPPAALG  392



>ref|XP_007045395.1| Peptide transporter 2 isoform 1 [Theobroma cacao]
 gb|EOY01227.1| Peptide transporter 2 isoform 1 [Theobroma cacao]
Length=584

 Score =   479 bits (1233),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 225/376 (60%), Positives = 284/376 (76%), Gaps = 4/376 (1%)
 Frame = +2

Query  218   EEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  397
             E   +YT DG++D+  +P  K+ TGNWKACPFILGNEC ERLAYYG+++NL+ Y   +L+
Sbjct  19    ESSGLYTGDGSVDFDGKPVLKQNTGNWKACPFILGNECCERLAYYGIATNLVTYLTKKLH  78

Query  398   QSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPG  577
             +   SA++N++ W GTCY+ PL+GA LADAY GRYWTIATFS IY +GM  +TLSA++P 
Sbjct  79    EGNVSAARNVTTWQGTCYLTPLIGAVLADAYWGRYWTIATFSTIYFIGMCTLTLSASIPA  138

Query  578   ISPT-CIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             + P  C+     +AT    AV F+ LYL+ALGTGGIKPCVSS+GADQFDDTD KER  K 
Sbjct  139   LKPAECVDSICPSATPAQYAVFFLGLYLIALGTGGIKPCVSSFGADQFDDTDPKERVKKG  198

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GAL+++SL+VWIQ +  WG GFG+PA+ M LA+  FFSGT LYR+Q+P
Sbjct  199   SFFNWFYFSINIGALISSSLLVWIQDNAGWGLGFGIPALFMGLAIASFFSGTPLYRFQRP  258

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QV+VAS RK  +KVP D SLL+ET    S I+GSRKL H++EL+  DKAA+
Sbjct  259   GGSPITRMCQVLVASFRKWNLKVPEDSSLLYETGDKHSAIEGSRKLEHSDELKCLDKAAI  318

Query  1115  VEESLDEDKKGSVS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAE  1291
             + ++  E K G  S PWRLCTVTQVEE K +IR+ PIWATGI+FS VY QM T F+ Q  
Sbjct  319   LTDA--EIKSGDFSNPWRLCTVTQVEEFKILIRMFPIWATGIVFSAVYAQMSTMFVEQGM  376

Query  1292  GMNTYVGTFKXPXASL  1339
              M+T +G+F  P ASL
Sbjct  377   VMDTSIGSFTIPPASL  392



>ref|XP_010554363.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3 isoform X1 [Tarenaya 
hassleriana]
Length=583

 Score =   478 bits (1231),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 225/385 (58%), Positives = 281/385 (73%), Gaps = 4/385 (1%)
 Frame = +2

Query  194   MMEQSKAMEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLM  373
             +++ S   ++  +Y +DG++D    P  K+KTGNWKACPFILGNEC ERLAYYG++ NL+
Sbjct  10    LLDDSLVEDQPKLYAEDGSVDINGNPPLKQKTGNWKACPFILGNECCERLAYYGIAGNLI  69

Query  374   IYFQTRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLM  553
              Y   +L++   SA++N++ W GTCYI PL+GA LADAY GRYWTI  FS IY +GM  +
Sbjct  70    TYLTFKLHEGNVSAARNVTTWQGTCYITPLIGAILADAYWGRYWTIGCFSAIYFVGMAAL  129

Query  554   TLSATVPGISPT-CIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTD  730
             TLSA+VP + P  C+      AT    AV F  LYL+ALGTGGIKPCVSS+GADQFDDTD
Sbjct  130   TLSASVPALKPAECVGALCPPATSAQYAVFFFGLYLIALGTGGIKPCVSSFGADQFDDTD  189

Query  731   EKERKHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGT  910
              +ER  K+SFFNWFYFSIN+GALV++SL+VWIQ++  WG GFG+P V M LA+  FF GT
Sbjct  190   SRERVKKASFFNWFYFSINIGALVSSSLLVWIQENCGWGLGFGIPTVFMGLAIVSFFFGT  249

Query  911   RLYRYQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNEL  1090
             RLYR+QKPGGSP TR+ QV+VAS  K  + VP D SLL+ET    S I GSRK+ HT + 
Sbjct  250   RLYRFQKPGGSPITRVCQVLVASFHKLNLNVPEDNSLLYETQDKNSAIAGSRKIEHTEDY  309

Query  1091  RFFDKAAVVEESLDEDKKGSVS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMG  1267
             +  DKAAV+ E  DE K G  S PWRLCTVTQVEELK +IR+ PIWA+GI+FS VY QM 
Sbjct  310   KCLDKAAVLSE--DEVKSGDFSNPWRLCTVTQVEELKILIRMFPIWASGILFSAVYAQMS  367

Query  1268  TQFISQAEGMNTYVGTFKXPXASLG  1342
             T F+ Q   MN  +G+F+ P A+LG
Sbjct  368   TMFVQQGRSMNCKIGSFELPPATLG  392



>ref|XP_006643742.1| PREDICTED: peptide transporter PTR1-like [Oryza brachyantha]
Length=582

 Score =   478 bits (1231),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 232/378 (61%), Positives = 290/378 (77%), Gaps = 4/378 (1%)
 Frame = +2

Query  218   EEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  397
             E  D+YT+DGT+D +  PA KK TGNW+ACP+IL NEC ERLAYYGMS+NL+ Y +TRL 
Sbjct  3     EVADMYTQDGTVDVKGNPAEKKSTGNWRACPYILANECCERLAYYGMSTNLVNYMKTRLG  62

Query  398   QSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPG  577
             Q +  A+ N++NWSGTCYI PL+GAFLADAY+GR+WTIA+F IIY++G+ L+T++++V G
Sbjct  63    QESAIAANNVTNWSGTCYITPLIGAFLADAYMGRFWTIASFMIIYILGLALLTMASSVRG  122

Query  578   ISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSS  757
             + P C     C  T   T V F+ALYL+ALGTGGIKPCVSS+GADQFD+ DE E++ KSS
Sbjct  123   LVPACDG-GTCHPTEAQTGVVFLALYLIALGTGGIKPCVSSFGADQFDENDEGEKRSKSS  181

Query  758   FFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKPG  937
             FFNWFYFSIN+GALVA+S++V++Q  V WGWGFG+PAV MA+AV  FF GT LYR+Q+PG
Sbjct  182   FFNWFYFSINIGALVASSVLVYVQTHVGWGWGFGIPAVVMAVAVVSFFVGTPLYRHQRPG  241

Query  938   GSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAVV  1117
             GSP TR+ QV+VAS RK  V VP+DKS LHETV  ES I+GSRKL HT +    D+AA V
Sbjct  242   GSPVTRIAQVLVASARKWGVAVPADKSRLHETVDKESGIEGSRKLEHTEQFACLDRAA-V  300

Query  1118  EESLDEDKKGSVSPWRLCTVTQVEELK-SIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
             E   D       SPWRLCTVTQVEELK S++R LPIWA+GI+F+TVYGQM T F+ Q   
Sbjct  301   ETPEDRAAGAGRSPWRLCTVTQVEELKSSVVRRLPIWASGIVFATVYGQMSTMFVLQGNT  360

Query  1295  MNTYVGT-FKXPXASLGV  1345
             ++  +G  F  P ASL +
Sbjct  361   LDASMGPHFSIPAASLSI  378



>emb|CAA54634.1| oligopeptide transporter 1-1 [Arabidopsis thaliana]
 prf||2014244A His transporter
Length=586

 Score =   478 bits (1231),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 228/386 (59%), Positives = 287/386 (74%), Gaps = 5/386 (1%)
 Frame = +2

Query  194   MMEQSKAMEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLM  373
             ++E+   ++E  +Y +DG++D+   P  K+KTGNWKACPFILGNEC ERLAYYG++ NL+
Sbjct  11    LIEEGLILQEVKLYAEDGSVDFNGNPPLKEKTGNWKACPFILGNECCERLAYYGIAGNLI  70

Query  374   IYFQTRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLM  553
              Y  T+L+Q   SA+ N++ W GTCY+ PL+GA LADAY GRYWTIA FS IY +GM+ +
Sbjct  71    TYLTTKLHQGNVSAATNVTTWQGTCYLTPLIGAVLADAYWGRYWTIACFSGIYFIGMSAL  130

Query  554   TLSATVPGISPTCIAHDKC-TATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTD  730
             TLSA+VP + P     D C +AT    A+ F  LYL+ALGTGGIKPCVSS+GADQFDDTD
Sbjct  131   TLSASVPALKPAECIGDFCPSATPAQYAMFFGGLYLIALGTGGIKPCVSSFGADQFDDTD  190

Query  731   EKERKHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGT  910
              +ER  K+SFFNWFYFSIN+GALV++SL+VWIQ++  WG GFG+P V M LA+  FF GT
Sbjct  191   SRERVRKASFFNWFYFSINIGALVSSSLLVWIQENRGWGLGFGIPTVFMGLAIASFFFGT  250

Query  911   RLYRYQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNEL  1090
              LYR+QKPGGSP TR+ QVVVAS RK  VKVP D +LL+ET    S I GSRK+ HT++ 
Sbjct  251   PLYRFQKPGGSPITRISQVVVASFRKSSVKVPEDATLLYETQDKNSAIAGSRKIEHTDDC  310

Query  1091  RFFDKAAVVEESLDEDKKGSVS-PWR-LCTVTQVEELKSIIRLLPIWATGIIFSTVYGQM  1264
             ++ DKAAV+ E  +E K G  S  W  LCTVTQVEELK +IR+ PIWA+GIIFS VY QM
Sbjct  311   QYLDKAAVISE--EESKSGDYSNSWEDLCTVTQVEELKILIRMFPIWASGIIFSAVYAQM  368

Query  1265  GTQFISQAEGMNTYVGTFKXPXASLG  1342
              T F+ Q   MN  +G+F+ P A+LG
Sbjct  369   STMFVQQGRAMNCKIGSFQLPPAALG  394



>ref|XP_010554364.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3 isoform X2 [Tarenaya 
hassleriana]
Length=583

 Score =   478 bits (1231),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 225/385 (58%), Positives = 281/385 (73%), Gaps = 4/385 (1%)
 Frame = +2

Query  194   MMEQSKAMEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLM  373
             +++ S   ++  +Y +DG++D    P  K+KTGNWKACPFILGNEC ERLAYYG++ NL+
Sbjct  10    LLDDSLVEDQPKLYAEDGSVDINGNPPLKQKTGNWKACPFILGNECCERLAYYGIAGNLI  69

Query  374   IYFQTRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLM  553
              Y   +L++   SA++N++ W GTCYI PL+GA LADAY GRYWTI  FS IY +GM  +
Sbjct  70    TYLTFKLHEGNVSAARNVTTWQGTCYITPLIGAILADAYWGRYWTIGCFSAIYFVGMAAL  129

Query  554   TLSATVPGISPT-CIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTD  730
             TLSA+VP + P  C+      AT    AV F  LYL+ALGTGGIKPCVSS+GADQFDDTD
Sbjct  130   TLSASVPALKPAECVGALCPPATSAQYAVFFFGLYLIALGTGGIKPCVSSFGADQFDDTD  189

Query  731   EKERKHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGT  910
              +ER  K+SFFNWFYFSIN+GALV++SL+VWIQ++  WG GFG+P V M LA+  FF GT
Sbjct  190   SRERVKKASFFNWFYFSINIGALVSSSLLVWIQENCGWGLGFGIPTVFMGLAIVSFFFGT  249

Query  911   RLYRYQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNEL  1090
             RLYR+QKPGGSP TR+ QV+VAS  K  + VP D SLL+ET    S I GSRK+ HT + 
Sbjct  250   RLYRFQKPGGSPITRVCQVLVASFHKLNLNVPEDNSLLYETQDKNSAIAGSRKIEHTEDY  309

Query  1091  RFFDKAAVVEESLDEDKKGSVS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMG  1267
             +  DKAAV+ E  DE K G  S PWRLCTVTQVEELK +IR+ PIWA+GI+FS VY QM 
Sbjct  310   KCLDKAAVLSE--DEVKSGDFSNPWRLCTVTQVEELKILIRMFPIWASGILFSAVYAQMS  367

Query  1268  TQFISQAEGMNTYVGTFKXPXASLG  1342
             T F+ Q   MN  +G+F+ P A+LG
Sbjct  368   TMFVQQGRSMNCKIGSFELPPATLG  392



>ref|XP_008346431.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like [Malus domestica]
Length=321

 Score =   468 bits (1204),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 212/298 (71%), Positives = 252/298 (85%), Gaps = 0/298 (0%)
 Frame = +2

Query  203   QSKAMEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYF  382
             ++   EE++VYTKDGT+D+R  PA +  TG WKACPFILGNEC ERLAYYGMSSNL+IYF
Sbjct  9     KAAVAEENNVYTKDGTVDFRGNPAKRNXTGTWKACPFILGNECCERLAYYGMSSNLVIYF  68

Query  383   QTRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLS  562
             +++LNQ++ +A+KN SNW GTCY+ PL+GA LAD+YLGRY TIA+FS+IY++GMTL+T+S
Sbjct  69    KSQLNQTSAAAAKNNSNWGGTCYLTPLLGALLADSYLGRYKTIASFSLIYIIGMTLLTMS  128

Query  563   ATVPGISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKER  742
             A+VPG+ PTC++ D C   G  TA  FIALYL+ALGTGGIKPCVSSYGADQFDD DE E+
Sbjct  129   ASVPGMKPTCVSKDVCHTNGGQTAATFIALYLIALGTGGIKPCVSSYGADQFDDDDEVEK  188

Query  743   KHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYR  922
             KHK SFFNWFYFSINVGAL+A S++VWIQ +V WGWGFGVPAVAMA+AV  FFSGTRLYR
Sbjct  189   KHKGSFFNWFYFSINVGALIAXSVLVWIQDNVGWGWGFGVPAVAMAIAVLSFFSGTRLYR  248

Query  923   YQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRF  1096
              QKPGGSP TR+ QV+VAS+R  KVKVP DKSLL+ET   ES+IQGSRKL HTNE  F
Sbjct  249   NQKPGGSPLTRIIQVIVASIRNYKVKVPEDKSLLYETADAESSIQGSRKLDHTNEFSF  306



>gb|KHG06441.1| Peptide transporter PTR2 -like protein [Gossypium arboreum]
Length=584

 Score =   477 bits (1228),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 224/376 (60%), Positives = 279/376 (74%), Gaps = 4/376 (1%)
 Frame = +2

Query  218   EEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  397
             E   +YT DG++D+   P  K+ TGNWKACPFILGNEC ERLAYYG+++NL+ Y   +L+
Sbjct  19    ENSGLYTGDGSVDFNGNPVLKQNTGNWKACPFILGNECCERLAYYGIATNLVSYLTKKLH  78

Query  398   QSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPG  577
             +   SA++N++ W GTCY+ PL+GA LADAY GRYWTIA FS IY +GM  +TLSA++P 
Sbjct  79    EGNASAARNVTTWQGTCYVTPLIGAVLADAYWGRYWTIAAFSTIYFIGMCTLTLSASIPA  138

Query  578   ISPT-CIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             + P  C+     +AT     V F  LYL+ALGTGGIKPCVSS+GADQFDDTD KER  K 
Sbjct  139   LKPAECVGSICPSATPAQYVVFFFGLYLIALGTGGIKPCVSSFGADQFDDTDPKERVKKG  198

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GAL+++SLIVWIQ +  WG GFG+PA+ M LA+  FFSGT LYR+Q+P
Sbjct  199   SFFNWFYFSINIGALISSSLIVWIQDNAGWGLGFGIPALFMGLAIGSFFSGTSLYRFQRP  258

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QV+VA+   R +KVP D SLL+ET    S I+GSRKL H+ EL+  DKAA+
Sbjct  259   GGSPITRMCQVLVAAFHNRNLKVPEDSSLLYETGDNHSAIEGSRKLEHSEELKCLDKAAI  318

Query  1115  VEESLDEDKKGSVS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAE  1291
             V ++  E K G  S PWRLCTVTQVEELK +IR+ PIWATGI+FS VY QM T F+ Q  
Sbjct  319   VTDA--ETKSGDFSNPWRLCTVTQVEELKILIRMFPIWATGIVFSAVYAQMSTMFVEQGM  376

Query  1292  GMNTYVGTFKXPXASL  1339
              M+T +G+F  P ASL
Sbjct  377   MMDTKIGSFTIPPASL  392



>ref|XP_002521890.1| peptide transporter, putative [Ricinus communis]
 gb|EEF40526.1| peptide transporter, putative [Ricinus communis]
Length=585

 Score =   477 bits (1228),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 225/384 (59%), Positives = 291/384 (76%), Gaps = 7/384 (2%)
 Frame = +2

Query  194   MMEQSKAMEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLM  373
             ++E++K+   + +YT DG++D +  P  K+KTGNWKACPFILG EC ERLAYYG+++NL+
Sbjct  15    LLEENKS---NGLYTGDGSVDLKGNPVLKQKTGNWKACPFILGTECCERLAYYGIATNLV  71

Query  374   IYFQTRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLM  553
              Y   +L++   +A++N++ W+GTCYI PL+GA LADAY GRYWTIA FS IY +GM  +
Sbjct  72    TYLTNKLHEGNVAAARNVTTWAGTCYIAPLIGAVLADAYWGRYWTIAAFSTIYFIGMCTL  131

Query  554   TLSATVPGISPT-CIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTD  730
             TLSA+VP + P  C+     +A+    AV F  LYL+ALGTGGIKPCVSS+GADQFDDTD
Sbjct  132   TLSASVPALKPVECVGPLCPSASPAQYAVFFFGLYLIALGTGGIKPCVSSFGADQFDDTD  191

Query  731   EKERKHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGT  910
              KER  K SFFNWFYFSIN+GALV++SL+V+IQ +  WG GFG+PA+ M +A+  FF+GT
Sbjct  192   RKERVKKGSFFNWFYFSINIGALVSSSLLVYIQDNAGWGLGFGIPALFMGIAIASFFAGT  251

Query  911   RLYRYQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNEL  1090
              LYR+QKPGGSP TR+ QV+VAS  K  ++VPSD SLL+ET   +S I+GSRK+ H+NEL
Sbjct  252   PLYRFQKPGGSPITRMCQVLVASFHKWNLEVPSDSSLLYETQDGQSAIEGSRKMEHSNEL  311

Query  1091  RFFDKAAVVEESLDEDKKGSVS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMG  1267
             +  DKAAV+ E+  E K G  S PWRLCTVTQVEELK ++R+ PIWATGI+FS VY QM 
Sbjct  312   KCLDKAAVISET--EAKTGDFSNPWRLCTVTQVEELKILVRMFPIWATGIVFSAVYAQMS  369

Query  1268  TQFISQAEGMNTYVGTFKXPXASL  1339
             T F+ Q   M+T +G+F  P ASL
Sbjct  370   TMFVEQGMLMDTTIGSFTIPPASL  393



>emb|CAN80199.1| hypothetical protein VITISV_030909 [Vitis vinifera]
Length=551

 Score =   476 bits (1224),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 225/376 (60%), Positives = 279/376 (74%), Gaps = 4/376 (1%)
 Frame = +2

Query  218   EEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  397
             E  D++T DG++D   +P  +  TGNW+ACPFILG EC ERLAYYG+++NL+ Y  ++L+
Sbjct  21    ENSDLHTGDGSVDIHGKPVLRSNTGNWRACPFILGTECCERLAYYGIATNLVTYLTSKLH  80

Query  398   QSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPG  577
             +   SA++N++ W GTCY+ PL+GA LADAY GRYWTIA FS IY +GM  +TLSATVP 
Sbjct  81    EGNVSAARNVTTWQGTCYLTPLIGAVLADAYCGRYWTIAAFSTIYFIGMCTLTLSATVPA  140

Query  578   ISPT-CIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
               P  C+      AT    AV F  LYL+ALGTGGIKPCVSS+GADQFDDTD KER  K 
Sbjct  141   FKPADCVGSVCPPATTAQYAVFFFGLYLIALGTGGIKPCVSSFGADQFDDTDPKERVKKG  200

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GALV++S +VWIQ +  WG GFG+PA+ M +A+  FFSGT LYR+QKP
Sbjct  201   SFFNWFYFSINIGALVSSSFLVWIQDNAGWGLGFGIPALFMGIAIASFFSGTPLYRFQKP  260

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QV+VAS RK K++VP D +LL+ET    S I+GSRKL H+NEL+  DKAAV
Sbjct  261   GGSPITRMCQVLVASFRKWKLEVPKDSNLLYETPDKNSAIEGSRKLEHSNELKCLDKAAV  320

Query  1115  VEESLDEDKKGSVS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAE  1291
             + ++  E K G  S PW LCTVTQVEELK +IR+ PIWATGI+FS VY QM T F+ Q  
Sbjct  321   ISDA--EIKSGDFSNPWNLCTVTQVEELKILIRMFPIWATGIVFSAVYAQMSTMFVEQGM  378

Query  1292  GMNTYVGTFKXPXASL  1339
              M+T VG+F  P ASL
Sbjct  379   VMDTTVGSFTIPPASL  394



>gb|KHG27963.1| Peptide transporter PTR2 -like protein [Gossypium arboreum]
Length=584

 Score =   477 bits (1227),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 223/376 (59%), Positives = 279/376 (74%), Gaps = 4/376 (1%)
 Frame = +2

Query  218   EEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  397
             E   +YT DG++D+   P  K+ TGNW+ACPFILGNEC ERLAYYG+++NL+ Y   +L+
Sbjct  19    ESSGLYTGDGSVDFNGNPILKQNTGNWRACPFILGNECCERLAYYGIATNLVSYLTKKLH  78

Query  398   QSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPG  577
             +   SA++N++ W GTCY+ PL+GA LADAY GRYWTIA FS IY  GM  +TLSA++P 
Sbjct  79    EGNVSAARNVTTWQGTCYLTPLIGAVLADAYWGRYWTIAAFSTIYFFGMCTLTLSASIPA  138

Query  578   ISPT-CIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             + P  C+     +AT    AV F  LYL+ALGTGGIKPCVSS+GADQFDDTD  ER  K 
Sbjct  139   LKPAECVGSICPSATPAQYAVFFFGLYLIALGTGGIKPCVSSFGADQFDDTDPNERVKKG  198

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GAL+++SL+VWIQ +  WG GFG+PA+ M LA+  FFSGT LYR+Q+P
Sbjct  199   SFFNWFYFSINIGALISSSLLVWIQDNAGWGLGFGIPALFMGLAIGSFFSGTALYRFQRP  258

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+FQV+VA+  KR +KVP D +LL+ET    S I+GSRKL H+ EL+  DKAA+
Sbjct  259   GGSPITRMFQVLVAAFHKRSLKVPEDSTLLYETGDKHSAIEGSRKLEHSEELKCLDKAAI  318

Query  1115  VEESLDEDKKGSVS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAE  1291
             V +   E K G  S PWRLCTVTQVEELK +IR+ PIWATGI+FS VY QM T F+ Q  
Sbjct  319   VTDV--ETKSGDFSNPWRLCTVTQVEELKILIRMFPIWATGIVFSAVYAQMSTMFVEQGM  376

Query  1292  GMNTYVGTFKXPXASL  1339
              M+T +G+F  P ASL
Sbjct  377   MMDTKIGSFTIPPASL  392



>gb|KFK33424.1| hypothetical protein AALP_AA5G011300 [Arabis alpina]
Length=584

 Score =   477 bits (1227),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 226/385 (59%), Positives = 284/385 (74%), Gaps = 4/385 (1%)
 Frame = +2

Query  194   MMEQSKAMEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLM  373
             ++EQ    +E  +Y +DG++D    P  KKKTGNWKACPFILGNEC ERLAYYG++ NL+
Sbjct  11    LIEQGLISQEVKLYAEDGSVDIHGNPPLKKKTGNWKACPFILGNECCERLAYYGIAGNLI  70

Query  374   IYFQTRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLM  553
              Y  T+L+Q   +A+ N++ W GTCY+ PL+GA LADAY GRYWTIA FS IY +GM+ +
Sbjct  71    TYLTTKLHQGNVAAATNVTTWQGTCYLTPLIGAVLADAYWGRYWTIAVFSGIYFIGMSAL  130

Query  554   TLSATVPGISPT-CIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTD  730
             TLSA+V  + P  CI     +AT    A+ F  LYL+ALGTGGIKPCVSS+GADQFDDTD
Sbjct  131   TLSASVSALKPAECIGEFCPSATPAQYAMFFGGLYLIALGTGGIKPCVSSFGADQFDDTD  190

Query  731   EKERKHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGT  910
              +ER  K+SFFNWFYFSIN+GALV++SL+VWIQ++  WG GFG+P V M LA+  FF GT
Sbjct  191   SRERVRKASFFNWFYFSINIGALVSSSLLVWIQENRGWGLGFGIPTVFMGLAIVSFFFGT  250

Query  911   RLYRYQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNEL  1090
              LYR+QKPGGSP TR+ QVVVAS RK  V+VP D +LL+ET    S I GSRK+ HT+  
Sbjct  251   PLYRFQKPGGSPITRISQVVVASFRKSTVEVPEDATLLYETQDKNSAIAGSRKIEHTDNC  310

Query  1091  RFFDKAAVVEESLDEDKKGSVS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMG  1267
             ++ DKAAV+ E  +E K G  S  WRLCTVTQVEELK +IR+ PIWA+GI+FS VY QM 
Sbjct  311   QYLDKAAVISE--EESKSGDFSNSWRLCTVTQVEELKILIRMFPIWASGIVFSAVYAQMS  368

Query  1268  TQFISQAEGMNTYVGTFKXPXASLG  1342
             T F+ Q   M+  +G+F+ P A+LG
Sbjct  369   TMFVQQGRAMDCKIGSFQLPPAALG  393



>ref|XP_009114212.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3 [Brassica rapa]
 emb|CDY04114.1| BnaA09g18920D [Brassica napus]
Length=584

 Score =   477 bits (1227),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 226/385 (59%), Positives = 284/385 (74%), Gaps = 4/385 (1%)
 Frame = +2

Query  194   MMEQSKAMEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLM  373
             ++EQ    +   +Y +DG++D    P  K KTGNWKACPFILGNEC ERLAYYG++ NL+
Sbjct  11    LIEQGLISQAPKLYAEDGSVDLHGNPPLKAKTGNWKACPFILGNECCERLAYYGIAGNLI  70

Query  374   IYFQTRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLM  553
              Y  T+L+Q   SA+ N++ W GTCY+ PL+GA LADAY GRYWTIA FS IY +GM+ +
Sbjct  71    TYLTTKLHQGNVSAATNVTTWQGTCYLTPLIGAVLADAYWGRYWTIACFSGIYFIGMSAL  130

Query  554   TLSATVPGISPT-CIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTD  730
             TLSA+VP + P  CI     +AT    A+ F  LYL+ALGTGGIKPCVSS+GADQFDDTD
Sbjct  131   TLSASVPALKPAECIGTYCPSATPAQYAMFFSGLYLIALGTGGIKPCVSSFGADQFDDTD  190

Query  731   EKERKHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGT  910
              +ER  K+SFFNWFYFSIN+GALV++SL+VWIQ++  WG GFG+P V M LA+  FF GT
Sbjct  191   SRERVRKASFFNWFYFSINIGALVSSSLLVWIQENRGWGLGFGIPTVFMGLAIVSFFFGT  250

Query  911   RLYRYQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNEL  1090
              LYR+QKPGGSP TR+ QVVVAS RK  +KVP D +LL+ET    S I GSRK+ HT++ 
Sbjct  251   PLYRFQKPGGSPITRISQVVVASFRKSTLKVPEDAALLYETQDKNSAIAGSRKIEHTDDC  310

Query  1091  RFFDKAAVVEESLDEDKKGSVS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMG  1267
             ++ DKAAV+ +  +E K G  S  WRLCTVTQVEELK +IR+ PIWA+GIIFS VY QM 
Sbjct  311   KYLDKAAVISD--EESKSGDFSNSWRLCTVTQVEELKILIRMFPIWASGIIFSAVYAQMS  368

Query  1268  TQFISQAEGMNTYVGTFKXPXASLG  1342
             T F+ Q   M+  +G+F+ P A+LG
Sbjct  369   TMFVQQGRAMDCKIGSFQLPPAALG  393



>ref|XP_004504617.1| PREDICTED: peptide transporter PTR2-like [Cicer arietinum]
Length=586

 Score =   476 bits (1226),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 229/376 (61%), Positives = 282/376 (75%), Gaps = 4/376 (1%)
 Frame = +2

Query  218   EEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  397
             EE   YT DG++D++ RP  K+ TGNWKACPFILGNEC ERLAYYG++ NL+ Y   +L+
Sbjct  21    EEKRQYTGDGSVDFKGRPVLKQNTGNWKACPFILGNECCERLAYYGIAKNLVTYLTHKLH  80

Query  398   QSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPG  577
             Q   SA++N++ W GTCY+ PLVGA LAD+Y GRYWTIA FS IY +GM  +TLSA+VPG
Sbjct  81    QGNVSAARNVTTWQGTCYLTPLVGAVLADSYWGRYWTIAVFSAIYFIGMCTLTLSASVPG  140

Query  578   ISPT-CIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             + P  C+     +AT    A  F  LYL+ALGTGGIKPCVSS+GADQFDDTD +ER  K 
Sbjct  141   LKPAECLGSVCPSATPVQYAAFFFGLYLIALGTGGIKPCVSSFGADQFDDTDPQERITKG  200

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GALV+++ IVWIQ+ V WG GFG+ A+ M LA+  FF GT LYR+QKP
Sbjct  201   SFFNWFYFSINIGALVSSTFIVWIQEHVGWGIGFGIXALFMGLAIRCFFLGTPLYRFQKP  260

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+FQVVVAS RKR + VP D SLL+ET    S I GSRKL H++ELR  D+AAV
Sbjct  261   GGSPITRMFQVVVASFRKRHLVVPEDSSLLYETPDKRSAIIGSRKLEHSDELRCLDRAAV  320

Query  1115  VEESLDEDKKGSVSP-WRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAE  1291
             V ++  E K G  S  WRLCTVTQVEELK++IR+LPIWA+GI+F++VY Q+ T F+ Q  
Sbjct  321   VSDA--ERKSGDHSNLWRLCTVTQVEELKTLIRMLPIWASGIVFNSVYAQLSTMFVEQGT  378

Query  1292  GMNTYVGTFKXPXASL  1339
              M T +G+F  P ASL
Sbjct  379   MMETSIGSFNIPPASL  394



>ref|XP_009101283.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3 [Brassica rapa]
Length=585

 Score =   476 bits (1226),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 225/385 (58%), Positives = 285/385 (74%), Gaps = 4/385 (1%)
 Frame = +2

Query  194   MMEQSKAMEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLM  373
             ++E+    +E  +Y +DG++D    P  K+KTGNWKACPFILGNEC ERLAYYG++ NL+
Sbjct  10    LIEEGLISQEPKLYAQDGSVDLHGNPPLKEKTGNWKACPFILGNECCERLAYYGIAGNLI  69

Query  374   IYFQTRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLM  553
              Y  T+L+Q   SA++N++ W GTCY+ PL+GA LADAY GRYWTIA FS IY +GM+ +
Sbjct  70    TYLTTKLHQGNVSAARNVTTWQGTCYLTPLIGAVLADAYWGRYWTIACFSGIYFIGMSAL  129

Query  554   TLSATVPGISPT-CIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTD  730
             TLSA+VP + P  CI     +AT    A+ F  LYL+ALGTGGIKPCVSS+GADQFDDTD
Sbjct  130   TLSASVPALKPAECIGTFCPSATPAQYAMFFGGLYLIALGTGGIKPCVSSFGADQFDDTD  189

Query  731   EKERKHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGT  910
              +ER  K+SFFNWFYFSIN+GALV++SL+VWIQ++  WG GFG+P V M LA+  FF GT
Sbjct  190   SRERVKKASFFNWFYFSINIGALVSSSLLVWIQENRGWGLGFGIPTVFMGLAIASFFFGT  249

Query  911   RLYRYQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNEL  1090
              LYR+QKPGGSP TR+ QVVVAS RK  + VP D  LL+ET    S I GSRK+ HT++ 
Sbjct  250   PLYRFQKPGGSPITRISQVVVASFRKSTLTVPEDAMLLYETQDKNSAIAGSRKIEHTDDC  309

Query  1091  RFFDKAAVVEESLDEDKKGSVS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMG  1267
             ++ DKAAV+ E  +E + G  S  WRLCTVTQVEELK +IR+ PIWA+GIIFS VY QM 
Sbjct  310   QYLDKAAVISE--EESRAGDFSNSWRLCTVTQVEELKILIRMFPIWASGIIFSAVYAQMS  367

Query  1268  TQFISQAEGMNTYVGTFKXPXASLG  1342
             T F+ Q   M+  +G+F+ P A+LG
Sbjct  368   TMFVQQGRAMDCKIGSFQLPPAALG  392



>gb|KJB77816.1| hypothetical protein B456_012G159000 [Gossypium raimondii]
 gb|KJB77817.1| hypothetical protein B456_012G159000 [Gossypium raimondii]
 gb|KJB77818.1| hypothetical protein B456_012G159000 [Gossypium raimondii]
Length=584

 Score =   476 bits (1226),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 223/376 (59%), Positives = 279/376 (74%), Gaps = 4/376 (1%)
 Frame = +2

Query  218   EEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  397
             E   +YT DG++D+   P  K+ TGNWKACPFILGNEC ERLAYYG+++NL+ Y   +L+
Sbjct  19    ENSGLYTGDGSVDFNGNPVLKQNTGNWKACPFILGNECCERLAYYGIATNLVSYLTKKLH  78

Query  398   QSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPG  577
             +   SA++N++ W GTCY+ PL+GA LADAY GRYWTIA FS IY +GM  +TLSA++P 
Sbjct  79    EGNASAARNVTTWQGTCYVTPLIGAVLADAYWGRYWTIAAFSTIYFIGMCTLTLSASIPA  138

Query  578   ISPT-CIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             + P  C+     +AT     V F  LYL+ALGTGGIKPCVSS+GADQFDDTD KER  K 
Sbjct  139   LKPAECVGSICPSATPAQYVVFFFGLYLIALGTGGIKPCVSSFGADQFDDTDPKERVKKG  198

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GAL+++SL+VWIQ +  WG GFG+PA+ M LA+  FFSGT LYR+Q+P
Sbjct  199   SFFNWFYFSINIGALISSSLLVWIQDNAGWGLGFGIPALFMGLAIGSFFSGTSLYRFQRP  258

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QV+VA+  KR +KVP D SLL+ET    S I+GSRKL H+ EL+  D AA+
Sbjct  259   GGSPITRMCQVMVAAFHKRNLKVPEDSSLLYETGDNHSAIEGSRKLEHSEELKCLDNAAI  318

Query  1115  VEESLDEDKKGSVS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAE  1291
             V ++  E K G  S PWRLCTVTQVEELK +IR+ PIWATGI+FS VY QM T F+ Q  
Sbjct  319   VTDA--ETKSGDFSNPWRLCTVTQVEELKILIRMFPIWATGIVFSAVYAQMSTMFVEQGM  376

Query  1292  GMNTYVGTFKXPXASL  1339
              M+T +G+F  P ASL
Sbjct  377   MMDTKIGSFTIPPASL  392



>ref|NP_001233998.2| oligopeptide transporter 1 [Solanum lycopersicum]
Length=585

 Score =   476 bits (1225),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 227/388 (59%), Positives = 287/388 (74%), Gaps = 6/388 (2%)
 Frame = +2

Query  188   LQMMEQSKAMEEDD--VYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMS  361
             + ++E    +E+++  +YT+DG++D +  P  K +TGNW+ACPFILGNEC ERLAYYG++
Sbjct  8     IPLLEDGGLLEDENSGLYTRDGSVDIKGNPVLKSETGNWRACPFILGNECCERLAYYGIA  67

Query  362   SNLMIYFQTRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMG  541
             +NL+ Y   +L++   SA++N++ W GTCYI PL+GA LADAY GRYWTIATFS IY +G
Sbjct  68    ANLVTYLTKKLHEGNVSAARNVTTWQGTCYITPLIGAVLADAYWGRYWTIATFSTIYFIG  127

Query  542   MTLMTLSATVPGISPT-CIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQF  718
             M  +TLSA+VP   P  C+     +A+    A+ F  LYL+ALGTGGIKPCVSS+GADQF
Sbjct  128   MCTLTLSASVPAFKPPQCVGSVCPSASPAQYAIFFFGLYLIALGTGGIKPCVSSFGADQF  187

Query  719   DDTDEKERKHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFF  898
             DDTD KER  K SFFNWFYFSIN+GAL+++SLIVWIQ++  WG GFG+PAV M +A+  F
Sbjct  188   DDTDPKERVKKGSFFNWFYFSINIGALISSSLIVWIQENAGWGLGFGIPAVFMGIAIASF  247

Query  899   FSGTRLYRYQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSH  1078
             F GT LYR+QKPGGSP TR+ QV+VA   K  + VP D +LL+ET    S I+GSRKL H
Sbjct  248   FFGTPLYRFQKPGGSPLTRMCQVLVAVFHKWNLSVPDDSTLLYETPDKSSAIEGSRKLLH  307

Query  1079  TNELRFFDKAAVVEESLDEDKKGSVS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVY  1255
             T+ELR  DKAAVV +  +E   G  S  WRLCTVTQVEELK +IR+ PIWATGI+FS VY
Sbjct  308   TDELRCLDKAAVVSD--NELTTGDYSNAWRLCTVTQVEELKILIRMFPIWATGIVFSAVY  365

Query  1256  GQMGTQFISQAEGMNTYVGTFKXPXASL  1339
              QM T F+ Q   M+T VG+FK P ASL
Sbjct  366   AQMSTMFVEQGMVMDTAVGSFKIPAASL  393



>ref|XP_003524837.1| PREDICTED: peptide transporter PTR2-like [Glycine max]
 gb|KHN25956.1| Peptide transporter PTR2 [Glycine soja]
Length=584

 Score =   476 bits (1225),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 231/388 (60%), Positives = 286/388 (74%), Gaps = 7/388 (2%)
 Frame = +2

Query  191   QMMEQSKAMEEDD---VYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMS  361
             Q+    +A+ +DD    YT DG++D++ RP  K+ TGNWKACPFILGNEC ERLAYYG++
Sbjct  7     QLSLAEEALLQDDESKQYTGDGSVDFKGRPVLKRNTGNWKACPFILGNECCERLAYYGIA  66

Query  362   SNLMIYFQTRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMG  541
             +NL+ Y   +L++   SA++N++ W GTCY+ PL+GA LADAY GRYWTIA FS IY +G
Sbjct  67    TNLVTYLTQKLHEGNVSAARNVTTWQGTCYLAPLIGAVLADAYWGRYWTIAIFSTIYFIG  126

Query  542   MTLMTLSATVPGISPT-CIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQF  718
             M  +TLSA+VP + P  C+      AT    AV F  LYL+ALGTGGIKPCVSS+GADQF
Sbjct  127   MGTLTLSASVPALKPAECLGPACPPATPAQYAVFFFGLYLIALGTGGIKPCVSSFGADQF  186

Query  719   DDTDEKERKHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFF  898
             DDTD  ER  K SFFNWFYFSIN+GALV+++ IVWIQ++  WG GFG+PA+ MALA+  F
Sbjct  187   DDTDPGERIKKGSFFNWFYFSINIGALVSSTFIVWIQENAGWGLGFGIPALFMALAIGSF  246

Query  899   FSGTRLYRYQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSH  1078
             F GT LYR+QKPGGSP TR+ QVVVAS+RKR + VP D SLL+ET    S I+GSRKL H
Sbjct  247   FLGTPLYRFQKPGGSPITRMCQVVVASVRKRNLVVPEDSSLLYETPDKSSAIEGSRKLEH  306

Query  1079  TNELRFFDKAAVVEESLDEDKKGSVS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVY  1255
             ++EL+  D+AAV   S  E K G  S  WRLCTVTQVEELK +IR+ P+WAT I+F+ VY
Sbjct  307   SDELKCLDRAAVA--SAAESKSGDYSNKWRLCTVTQVEELKILIRMFPVWATVIVFAAVY  364

Query  1256  GQMGTQFISQAEGMNTYVGTFKXPXASL  1339
              QM T F+ Q   MNT VG+FK P ASL
Sbjct  365   AQMSTLFVEQGTMMNTNVGSFKIPPASL  392



>emb|CDY17446.1| BnaC09g20910D [Brassica napus]
Length=584

 Score =   476 bits (1225),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 225/385 (58%), Positives = 284/385 (74%), Gaps = 4/385 (1%)
 Frame = +2

Query  194   MMEQSKAMEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLM  373
             ++EQ    +   +Y +DG++D    P  K KTGNWKACPFILGNEC ERLAYYG++ NL+
Sbjct  11    LIEQGLISQAPKLYAEDGSVDLHGNPPLKAKTGNWKACPFILGNECCERLAYYGIAGNLI  70

Query  374   IYFQTRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLM  553
              Y  T+L+Q   SA+ N++ W GTCY+ PL+GA LADAY GRYWTIA FS IY +GM+ +
Sbjct  71    TYLTTKLHQGNVSAATNVTTWQGTCYLTPLIGAVLADAYWGRYWTIACFSGIYFIGMSAL  130

Query  554   TLSATVPGISPT-CIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTD  730
             TLSA+VP + P  C+     +AT    A+ F  LYL+ALGTGGIKPCVSS+GADQFDDTD
Sbjct  131   TLSASVPALKPAECLGTFCPSATPAQYAMFFSGLYLIALGTGGIKPCVSSFGADQFDDTD  190

Query  731   EKERKHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGT  910
              +ER  K+SFFNWFYFSIN+GALV++SL+VWIQ++  WG GFG+P V M LA+  FF GT
Sbjct  191   SRERVRKASFFNWFYFSINIGALVSSSLLVWIQENRGWGLGFGIPTVFMGLAIVSFFFGT  250

Query  911   RLYRYQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNEL  1090
              LYR+QKPGGSP TR+ QVVVAS RK  +KVP D +LL+ET    S I GSRK+ HT++ 
Sbjct  251   PLYRFQKPGGSPITRISQVVVASFRKSTLKVPEDAALLYETQDKNSAIAGSRKIEHTDDC  310

Query  1091  RFFDKAAVVEESLDEDKKGSVS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMG  1267
             ++ DKAAV+ +  +E K G  S  WRLCTVTQVEELK +IR+ PIWA+GIIFS VY QM 
Sbjct  311   KYLDKAAVISD--EESKSGDFSNSWRLCTVTQVEELKILIRMFPIWASGIIFSAVYAQMS  368

Query  1268  TQFISQAEGMNTYVGTFKXPXASLG  1342
             T F+ Q   M+  +G+F+ P A+LG
Sbjct  369   TMFVQQGRAMDCKIGSFQLPPAALG  393



>ref|XP_006365835.1| PREDICTED: peptide transporter PTR2-like [Solanum tuberosum]
Length=585

 Score =   476 bits (1224),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 227/388 (59%), Positives = 287/388 (74%), Gaps = 6/388 (2%)
 Frame = +2

Query  188   LQMMEQSKAMEEDD--VYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMS  361
             + ++E    +E++   +YT+DG++D +  P  K +TGNW+ACPFILGNEC ERLAYYG++
Sbjct  8     IPLLEDGGLLEDESSGLYTRDGSVDIKGNPVLKSETGNWRACPFILGNECCERLAYYGIA  67

Query  362   SNLMIYFQTRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMG  541
             +NL+ Y   +L++   SA++N++ W GTCYI PL+GA LADAY GRYWTIATFS IY +G
Sbjct  68    ANLVTYLTRKLHEGNVSAARNVTTWQGTCYITPLIGAVLADAYWGRYWTIATFSTIYFIG  127

Query  542   MTLMTLSATVPGISPT-CIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQF  718
             M  +TLSA+VP   P  C+     +A+    A+ F  LYL+ALGTGGIKPCVSS+GADQF
Sbjct  128   MCTLTLSASVPAFKPPECVGSVCPSASPAQYAIFFFGLYLIALGTGGIKPCVSSFGADQF  187

Query  719   DDTDEKERKHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFF  898
             DDTD KER  K SFFNWFYFSIN+GAL+++SLIVWIQ++  WG GFG+PAV M +A+  F
Sbjct  188   DDTDPKERVKKGSFFNWFYFSINIGALISSSLIVWIQENAGWGLGFGIPAVFMGIAIASF  247

Query  899   FSGTRLYRYQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSH  1078
             F GT LYR+QKPGGSP TR+ QV+VA+  K  + VP D +LL+ET    S I+GSRKL H
Sbjct  248   FFGTPLYRFQKPGGSPLTRMCQVLVAAFHKWNLSVPDDSALLYETPDKSSAIEGSRKLLH  307

Query  1079  TNELRFFDKAAVVEESLDEDKKGSVS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVY  1255
             T+ELR  DKAAVV ++  E   G  S  WRLCTVTQVEELK +IR+ PIWATGI+FS VY
Sbjct  308   TDELRCLDKAAVVSDT--ELNTGDYSNAWRLCTVTQVEELKILIRMFPIWATGIVFSAVY  365

Query  1256  GQMGTQFISQAEGMNTYVGTFKXPXASL  1339
              QM T F+ Q   M+T VG+FK P ASL
Sbjct  366   AQMSTMFVEQGMVMDTAVGSFKIPAASL  393



>gb|KJB15302.1| hypothetical protein B456_002G169800 [Gossypium raimondii]
 gb|KJB15303.1| hypothetical protein B456_002G169800 [Gossypium raimondii]
 gb|KJB15304.1| hypothetical protein B456_002G169800 [Gossypium raimondii]
Length=584

 Score =   475 bits (1223),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 223/376 (59%), Positives = 279/376 (74%), Gaps = 4/376 (1%)
 Frame = +2

Query  218   EEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  397
             E + +YT DG++D+   P  K+ TGNW+ACPFILGNEC ERLAYYG+++NL+ Y   +L+
Sbjct  19    ESNGLYTGDGSVDFNGNPVLKQSTGNWRACPFILGNECCERLAYYGIAANLVSYLTNKLH  78

Query  398   QSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPG  577
             +   SA++N++ W GTCY+ PL+GA LADAY GRYWTIA FS IY  GM  +TLSA++P 
Sbjct  79    EGNVSAARNVTTWQGTCYLTPLIGAVLADAYWGRYWTIAAFSTIYFFGMCTLTLSASIPA  138

Query  578   ISPT-CIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             + P  C+     +AT    AV F  LYL+ALGTGGIKPCVSS+GADQFDDTD  ER  K 
Sbjct  139   LKPAECVGSICPSATPAQYAVFFFGLYLIALGTGGIKPCVSSFGADQFDDTDPNERVKKG  198

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GALV++SL+VWIQ +  WG GFG+PA+ M LA+  FFSGT LYR+Q+P
Sbjct  199   SFFNWFYFSINIGALVSSSLLVWIQDNAGWGIGFGIPALFMGLAIGSFFSGTALYRFQRP  258

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QV+VA+  KR +KVP D +LL+ET    S I+GSRKL H+ EL+  DKAA+
Sbjct  259   GGSPLTRMCQVLVAAFHKRSLKVPEDSTLLYETGDKHSAIEGSRKLEHSEELKCLDKAAI  318

Query  1115  VEESLDEDKKGSVS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAE  1291
             V +   E K G  S PWRLCTVTQVEELK +IR+ PIWATGI+FS VY QM T F+ Q  
Sbjct  319   VTDV--ETKSGGFSNPWRLCTVTQVEELKILIRMFPIWATGIVFSAVYAQMSTMFVEQGM  376

Query  1292  GMNTYVGTFKXPXASL  1339
              M+T +G+F  P ASL
Sbjct  377   MMDTKIGSFTIPPASL  392



>gb|AAC32034.1| peptide transporter [Hordeum vulgare subsp. vulgare]
Length=579

 Score =   475 bits (1223),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 225/374 (60%), Positives = 287/374 (77%), Gaps = 5/374 (1%)
 Frame = +2

Query  227   DVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQST  406
             ++YT+DGT+D +  PA KK TGNW+ACP+IL NEC ERLAYYGMS+NL+ + + R+  + 
Sbjct  7     EMYTQDGTVDIKGNPALKKDTGNWRACPYILANECCERLAYYGMSTNLVNFMKDRMGMAN  66

Query  407   TSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPGISP  586
              +A+ N++NW GTCYI PL+GAFLADAYLGR+WTIA+F IIY+ G+ L+T++ +V G+ P
Sbjct  67    AAAANNVTNWGGTCYITPLIGAFLADAYLGRFWTIASFMIIYIFGLGLLTMATSVHGLVP  126

Query  587   TCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSFFN  766
              C +   C  T   +A  FIALYL+ALGTGGIKPCVSS+GADQFD+ D+ ERK KSSFFN
Sbjct  127   ACASKGVCDPTPGQSAAVFIALYLIALGTGGIKPCVSSFGADQFDEHDDVERKSKSSFFN  186

Query  767   WFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKPGGSP  946
             WFYFSIN+GALVA+S++V++Q  V W WGFG+PAV MA+AV  FF GT LYR+Q+PGGSP
Sbjct  187   WFYFSINIGALVASSVLVYVQTHVGWSWGFGIPAVVMAIAVGSFFVGTSLYRHQRPGGSP  246

Query  947   FTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAVVEES  1126
              TR+ QV+VA+ RK  V V  D S L+ET   ES I+GSRKL HT + RF DKAAV  E+
Sbjct  247   LTRIAQVLVAATRKLGVAV--DGSALYETADKESGIEGSRKLEHTRQFRFLDKAAV--ET  302

Query  1127  LDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEGMNTY  1306
               +    + SPWRLCTVTQVEELKS++RLLPIWA+GI+F+TVYGQM T F+ Q   ++  
Sbjct  303   HADRTAAAPSPWRLCTVTQVEELKSVVRLLPIWASGIVFATVYGQMSTMFVLQGNTLDAS  362

Query  1307  VG-TFKXPXASLGV  1345
             +G  FK P ASL +
Sbjct  363   MGPKFKIPSASLSI  376



>ref|XP_008787880.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3-like [Phoenix dactylifera]
Length=585

 Score =   475 bits (1223),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 227/394 (58%), Positives = 283/394 (72%), Gaps = 9/394 (2%)
 Frame = +2

Query  182   IGLQMMEQSKAME-------EDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSER  340
             +G Q  EQ   +E       E+  YT DG++D    P  K  TGNW+ACPFILGNEC ER
Sbjct  1     MGSQEEEQRSLLEDGLLTENENGPYTGDGSVDIHGNPVLKDCTGNWRACPFILGNECCER  60

Query  341   LAYYGMSSNLMIYFQTRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATF  520
             LAYYG+S+NL+ Y    L++   SA++N++ W GTCY+ PL+GA LADAY GRYWTIA F
Sbjct  61    LAYYGISANLVSYLTKNLHEGNASAARNVTTWQGTCYLTPLIGAILADAYWGRYWTIAVF  120

Query  521   SIIYVMGMTLMTLSATVPGISP-TCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVS  697
             S IY +GM  +TLSA+VP   P +C+      A+    AV F+ LYL+ALGTGGIKPCVS
Sbjct  121   STIYFLGMGTLTLSASVPAFKPPSCVGPVCPGASAAQYAVFFLGLYLIALGTGGIKPCVS  180

Query  698   SYGADQFDDTDEKERKHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAM  877
             S+GADQFDDTD KER  K+SFFNWFYFSIN+GAL+++S +VW+Q +  WG GFG+P + M
Sbjct  181   SFGADQFDDTDPKERVKKASFFNWFYFSINIGALISSSFLVWVQDNCGWGLGFGIPTLFM  240

Query  878   ALAVTFFFSGTRLYRYQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQ  1057
              LA+  FFSGT LYR+Q+PGGSP TR+ QVVVASLRK KV+VP D SLL+E     S I+
Sbjct  241   GLAIISFFSGTSLYRFQRPGGSPITRMCQVVVASLRKWKVEVPHDSSLLYELTAKASAIE  300

Query  1058  GSRKLSHTNELRFFDKAAVVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGI  1237
             GSRKL H+NEL F DKAA V E  DE  +   +PWRLCTVTQVEELK ++R+ PIWAT I
Sbjct  301   GSRKLEHSNELIFLDKAATVSE-FDEKTESFFNPWRLCTVTQVEELKILVRMFPIWATTI  359

Query  1238  IFSTVYGQMGTQFISQAEGMNTYVGTFKXPXASL  1339
             +FS VY Q+ T F+ Q   ++T +G+F  P ASL
Sbjct  360   VFSAVYAQISTMFVEQGMVLDTTIGSFTIPPASL  393



>dbj|BAJ95903.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89261.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=579

 Score =   475 bits (1222),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 225/374 (60%), Positives = 287/374 (77%), Gaps = 5/374 (1%)
 Frame = +2

Query  227   DVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQST  406
             ++YT+DGT+D +  PA KK TGNW+ACP+IL NEC ERLAYYGMS+NL+ + + R+  + 
Sbjct  7     EMYTQDGTVDIKGNPALKKDTGNWRACPYILANECCERLAYYGMSTNLVNFMKDRMGMAN  66

Query  407   TSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPGISP  586
              +A+ N++NW GTCYI PL+GAFLADAYLGR+WTIA+F IIY+ G+ L+T++ +V G+ P
Sbjct  67    AAAANNVTNWGGTCYITPLIGAFLADAYLGRFWTIASFMIIYIFGLGLLTMATSVHGLVP  126

Query  587   TCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSFFN  766
              C +   C  T   +A  FIALYL+ALGTGGIKPCVSS+GADQFD+ D+ ERK KSSFFN
Sbjct  127   ACASKGVCDPTPGQSAAVFIALYLIALGTGGIKPCVSSFGADQFDEHDDVERKSKSSFFN  186

Query  767   WFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKPGGSP  946
             WFYFSIN+GALVA+S++V++Q  V W WGFG+PAV MA+AV  FF GT LYR+Q+PGGSP
Sbjct  187   WFYFSINIGALVASSVLVYVQTHVGWSWGFGIPAVVMAIAVGSFFVGTPLYRHQRPGGSP  246

Query  947   FTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAVVEES  1126
              TR+ QV+VA+ RK  V V  D S L+ET   ES I+GSRKL HT + RF DKAAV  E+
Sbjct  247   LTRIAQVLVAATRKLGVAV--DGSALYETADKESGIEGSRKLEHTRQFRFLDKAAV--ET  302

Query  1127  LDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEGMNTY  1306
               +    + SPWRLCTVTQVEELKS++RLLPIWA+GI+F+TVYGQM T F+ Q   ++  
Sbjct  303   QADRTAAAPSPWRLCTVTQVEELKSVVRLLPIWASGIVFATVYGQMSTMFVLQGNTLDAS  362

Query  1307  VG-TFKXPXASLGV  1345
             +G  FK P ASL +
Sbjct  363   MGPKFKIPSASLSI  376



>ref|XP_009591011.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3-like [Nicotiana tomentosiformis]
Length=584

 Score =   474 bits (1221),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 225/376 (60%), Positives = 280/376 (74%), Gaps = 4/376 (1%)
 Frame = +2

Query  218   EEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  397
             E   +YT DG++D +  P  K +TGNW+ACPFILGNEC ERLAYYG+++NL+ Y  T+L+
Sbjct  19    ENSGLYTGDGSVDIKGNPVLKSETGNWRACPFILGNECCERLAYYGIATNLVTYLTTKLH  78

Query  398   QSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPG  577
             +   SA++N++ W+GTCY+ PL+GA LADAY GRYWTIATFS IY +GM  +TLSA+VP 
Sbjct  79    EGNVSAARNVTTWAGTCYLTPLIGAVLADAYWGRYWTIATFSTIYFIGMCTLTLSASVPA  138

Query  578   ISPTCIAHDKC-TATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
               P       C  AT     + F+ LYL+ALGTGGIKPCVSS+GADQFDDTD KER  K 
Sbjct  139   FKPPECMDSVCPAATPAQYVILFLGLYLIALGTGGIKPCVSSFGADQFDDTDPKERVKKG  198

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GAL+++SLIVWIQ++  WG GFG+PA+ M +A+  FF GT LYR+QKP
Sbjct  199   SFFNWFYFSINIGALISSSLIVWIQENAGWGLGFGIPALFMGIAIASFFFGTPLYRFQKP  258

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QV+VA+  K  + VP D +LL+ET    S I+GSRKL HT+ELR  DKAAV
Sbjct  259   GGSPLTRMCQVLVAAFHKWNLSVPEDSTLLYETPDKSSAIEGSRKLLHTDELRCLDKAAV  318

Query  1115  VEESLDEDKKGSVS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAE  1291
             V ++  E K G  S  WRLCTVTQVEELK +IR+ PIWATGI+FS VY QM T F+ Q  
Sbjct  319   VSDA--ELKTGDYSNTWRLCTVTQVEELKILIRMFPIWATGIVFSAVYAQMSTMFVEQGS  376

Query  1292  GMNTYVGTFKXPXASL  1339
              M+T +G+FK P ASL
Sbjct  377   VMDTTIGSFKIPAASL  392



>ref|XP_002285274.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3-like [Vitis vinifera]
Length=586

 Score =   474 bits (1221),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 224/376 (60%), Positives = 279/376 (74%), Gaps = 4/376 (1%)
 Frame = +2

Query  218   EEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  397
             E  D++T DG++D   +P  +  TGNW+ACPFILG EC ERLAYYG+++NL+ Y  ++L+
Sbjct  21    ENSDLHTGDGSVDIHGKPVLRSNTGNWRACPFILGTECCERLAYYGIATNLVTYLTSKLH  80

Query  398   QSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPG  577
             +   SA++N++ W GTCY+ PL+GA LADAY GRYWTIA FS IY +GM  +TLSATVP 
Sbjct  81    EGNVSAARNVTTWQGTCYLTPLIGAVLADAYCGRYWTIAAFSTIYFIGMCTLTLSATVPA  140

Query  578   ISPT-CIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
               P  C+      AT    AV F  LYL+ALGTGGIKPCVSS+GADQFDDTD KER  K 
Sbjct  141   FKPADCVGSVCPPATTAQYAVFFFGLYLIALGTGGIKPCVSSFGADQFDDTDPKERVKKG  200

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GALV++S +VWIQ +  WG GFG+PA+ M +A+  FFSGT LYR+QKP
Sbjct  201   SFFNWFYFSINIGALVSSSFLVWIQDNAGWGLGFGIPALFMGIAIASFFSGTPLYRFQKP  260

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QV+VAS RK K++VP D +LL+ET    S I+GSRKL H+NEL+  DKAAV
Sbjct  261   GGSPITRMCQVLVASFRKWKLEVPKDSNLLYETPDKNSAIEGSRKLEHSNELKCLDKAAV  320

Query  1115  VEESLDEDKKGSVS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAE  1291
             + ++  E K G  S PW LCTVTQVEELK +IR+ PIWATGI+FS VY QM T F+ Q  
Sbjct  321   ISDA--EIKSGDFSNPWNLCTVTQVEELKILIRMFPIWATGIVFSAVYAQMSTMFVEQGM  378

Query  1292  GMNTYVGTFKXPXASL  1339
              M+T +G+F  P ASL
Sbjct  379   VMDTNIGSFTIPPASL  394



>gb|AAD01600.1| LeOPT1 [Solanum lycopersicum]
Length=580

 Score =   474 bits (1219),  Expect = 9e-159, Method: Compositional matrix adjust.
 Identities = 226/376 (60%), Positives = 279/376 (74%), Gaps = 4/376 (1%)
 Frame = +2

Query  218   EEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  397
             E   +YT+DG++D +  P  K +TGNW+ACPFILGNEC ERLAYYG+++NL+ Y   +L+
Sbjct  15    ENSGLYTRDGSVDIKGNPVLKSETGNWRACPFILGNECCERLAYYGIAANLVTYLTKKLH  74

Query  398   QSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPG  577
             +   SA++N++ W GTCYI PL+GA LADAY GRYWTIATFS IY +GM  +TLSA+VP 
Sbjct  75    EGNVSAARNVTTWQGTCYITPLIGAVLADAYWGRYWTIATFSTIYFIGMCTLTLSASVPA  134

Query  578   ISP-TCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
               P  C+     +A+    A+ F  LYL+ALGTGGIKPCVSS+GADQFDDTD KER  K 
Sbjct  135   FKPPQCVGSVCPSASPAQYAIFFFGLYLIALGTGGIKPCVSSFGADQFDDTDPKERVKKG  194

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GAL+++SLIVWIQ++  WG GFG+PAV M +A+  FF GT LYR+QKP
Sbjct  195   SFFNWFYFSINIGALISSSLIVWIQENAGWGLGFGIPAVFMGIAIASFFFGTPLYRFQKP  254

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QV+VA   K  + VP D +LL+ET    S I+GSRKL HT+ELR  DKAAV
Sbjct  255   GGSPLTRMCQVLVAVFHKWNLSVPDDSTLLYETPDKSSAIEGSRKLLHTDELRCLDKAAV  314

Query  1115  VEESLDEDKKGSVS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAE  1291
             V +  +E   G  S  WRLCTVTQVEELK +IR+ PIWATGI+FS VY QM T F+ Q  
Sbjct  315   VSD--NELTTGDYSNAWRLCTVTQVEELKILIRMFPIWATGIVFSAVYAQMSTMFVEQGM  372

Query  1292  GMNTYVGTFKXPXASL  1339
              M+T VG+FK P ASL
Sbjct  373   VMDTAVGSFKIPAASL  388



>ref|XP_010043898.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3 [Eucalyptus grandis]
 gb|KCW85918.1| hypothetical protein EUGRSUZ_B02629 [Eucalyptus grandis]
Length=584

 Score =   474 bits (1219),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 222/376 (59%), Positives = 282/376 (75%), Gaps = 4/376 (1%)
 Frame = +2

Query  218   EEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  397
             + + +YT DG++D + +P  K  TGNW+ACPFILG EC ERLAYYG+++NL+ Y   +L+
Sbjct  19    QSNGLYTGDGSVDVKGKPVLKSNTGNWRACPFILGTECCERLAYYGIATNLVTYLTNKLH  78

Query  398   QSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPG  577
             +   SA+ N++ W GTCY+ PL+GA LADA  GRYWTIA FS IY +GM  +TLSATVPG
Sbjct  79    EGNVSAATNVTTWQGTCYLTPLIGAILADACWGRYWTIAAFSTIYFIGMCTLTLSATVPG  138

Query  578   ISPTCIAHDKC-TATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             + P       C +AT    AV F+ LYL+ALGTGGIKPCVSS+GADQFDDTD +ER  K 
Sbjct  139   LKPAECVDSVCPSATAAQYAVFFLGLYLIALGTGGIKPCVSSFGADQFDDTDSRERVKKG  198

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GALV+++LIVWIQ+++ WG GFG+PAV M +A+  FFSGT LYR+QKP
Sbjct  199   SFFNWFYFSINIGALVSSTLIVWIQENMGWGLGFGIPAVFMGVAIASFFSGTPLYRFQKP  258

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QV++A+  K  V+VP D SLL+ET    S I+GSRK+ H++EL+  DKAAV
Sbjct  259   GGSPITRMCQVLIAAFHKWSVEVPEDSSLLYETQEKNSAIEGSRKIEHSDELKCLDKAAV  318

Query  1115  VEESLDEDKKGSVS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAE  1291
             V ++  + K G  S  WRLCTVTQVEELK +IR+ PIWATGI+FS VY QM T F+ Q E
Sbjct  319   VTDA--DTKSGDFSNAWRLCTVTQVEELKILIRMFPIWATGIVFSAVYAQMSTMFVEQGE  376

Query  1292  GMNTYVGTFKXPXASL  1339
              M+T +G+F  P ASL
Sbjct  377   MMDTSIGSFTIPAASL  392



>ref|XP_007158832.1| hypothetical protein PHAVU_002G185700g [Phaseolus vulgaris]
 gb|ESW30826.1| hypothetical protein PHAVU_002G185700g [Phaseolus vulgaris]
Length=584

 Score =   474 bits (1219),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 224/376 (60%), Positives = 281/376 (75%), Gaps = 4/376 (1%)
 Frame = +2

Query  218   EEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  397
             EE  +YT DG++D++ RP  KK TGNWKACPFILGNEC ERLAYYG+++NL+ Y   +L+
Sbjct  19    EERKLYTGDGSVDFKGRPVLKKSTGNWKACPFILGNECCERLAYYGIATNLVTYLTQKLH  78

Query  398   QSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPG  577
             Q   SA++N++ W GTCY+ PL+GA LADAY GRYWTIA FS+IYV+GM  +TLSA+VP 
Sbjct  79    QGNVSAARNVTTWQGTCYLTPLIGAVLADAYWGRYWTIAVFSMIYVIGMGTLTLSASVPV  138

Query  578   ISPT-CIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
               P  C+      AT    A+ F  LYL+ALGTGGIKPCVSS+GADQFDDTD  ER  K 
Sbjct  139   FKPAECLGASCPPATPAQYALFFFGLYLIALGTGGIKPCVSSFGADQFDDTDSGERIKKG  198

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GA V+++ IVWIQ++  WG GFG+PA+ M LA+  FF GT LYR+QKP
Sbjct  199   SFFNWFYFSINIGAFVSSTFIVWIQENAGWGLGFGIPALFMTLAIGSFFLGTPLYRFQKP  258

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QVVVA+ RKR + VP D SLL+ET    S I+GSRKL H++EL+  D+AAV
Sbjct  259   GGSPITRMCQVVVAATRKRNLVVPEDSSLLYETPDNSSAIKGSRKLEHSDELKCLDRAAV  318

Query  1115  VEESLDEDKKGSVS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAE  1291
             V ++  E K G  S  WR+C+VTQVEELK +IR+ PIW+TGI+F+ VY QM T F+ Q  
Sbjct  319   VSDA--ESKTGDYSNKWRICSVTQVEELKILIRMFPIWSTGIVFAAVYAQMSTLFVEQGT  376

Query  1292  GMNTYVGTFKXPXASL  1339
              M T +G+F+ P ASL
Sbjct  377   MMKTNLGSFRIPPASL  392



>ref|XP_003531124.1| PREDICTED: peptide transporter PTR2-like [Glycine max]
 gb|KHN28899.1| Peptide transporter PTR2 [Glycine soja]
Length=584

 Score =   474 bits (1219),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 225/376 (60%), Positives = 282/376 (75%), Gaps = 4/376 (1%)
 Frame = +2

Query  218   EEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  397
             +E   YT DG++D++ RP  K+ TGNWKACPFILGNEC ERLAYYG+++NL+ Y   +L+
Sbjct  19    DESKQYTGDGSVDFKGRPVLKRNTGNWKACPFILGNECCERLAYYGIATNLVTYLTQKLH  78

Query  398   QSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPG  577
             +   SA++N++ W GTCY+ PL+GA LADAY GRYWTIA FS IY +GM  +TLSA+VP 
Sbjct  79    EGNVSAARNVTTWQGTCYLAPLIGAVLADAYWGRYWTIAIFSTIYFIGMGTLTLSASVPA  138

Query  578   ISPT-CIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             + P  C+      AT    AV F  LYL+ALGTGGIKPCVSS+GADQFDDTD +ER  K 
Sbjct  139   LKPAECLGTACPPATPAQYAVFFFGLYLIALGTGGIKPCVSSFGADQFDDTDPQERIKKG  198

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GALV+++ IVWIQ++  WG GFG+PA+ MALA+  FF GT LYR+QKP
Sbjct  199   SFFNWFYFSINIGALVSSTFIVWIQENAGWGLGFGIPALFMALAIGSFFLGTPLYRFQKP  258

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QVVVAS+ KR + VP D +LL+ET    S I+GSRKL H++EL+  D+AAV
Sbjct  259   GGSPITRMCQVVVASVWKRNLVVPEDSNLLYETPDKSSAIEGSRKLGHSDELKCLDRAAV  318

Query  1115  VEESLDEDKKGSVS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAE  1291
             V ++  E K G  S  WRLCTVTQVEELK +IR+ P+WATGI+F+ VY QM T F+ Q  
Sbjct  319   VSDA--ESKSGDYSNQWRLCTVTQVEELKILIRMFPVWATGIVFAAVYAQMSTLFVEQGT  376

Query  1292  GMNTYVGTFKXPXASL  1339
              MNT  G+F+ P ASL
Sbjct  377   MMNTNFGSFRIPPASL  392



>ref|XP_012072525.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3-like [Jatropha curcas]
Length=584

 Score =   473 bits (1218),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 229/384 (60%), Positives = 286/384 (74%), Gaps = 7/384 (2%)
 Frame = +2

Query  194   MMEQSKAMEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLM  373
             ++E++K+ E   +YT DG++D    PA K+ TGNW+ACPFILGNEC ERLAYYG+S+NL+
Sbjct  14    LLEENKSKE---LYTGDGSVDLHGNPALKQNTGNWRACPFILGNECCERLAYYGISTNLV  70

Query  374   IYFQTRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLM  553
              Y   +L++   SA++N+S W+GTCYI PL+GA LADA  GRYWTIA FS IY +GM  +
Sbjct  71    TYLTNKLHEGNVSAARNVSTWAGTCYITPLIGAVLADACWGRYWTIAAFSTIYFIGMCTL  130

Query  554   TLSATVPGISPTCIAHDKCT-ATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTD  730
             TLSA++P + P   A   C  AT    AV F  LYL+ALGTGGI+PCV+S+GADQFDDTD
Sbjct  131   TLSASIPALKPAECAGSLCPPATPAQYAVFFFCLYLIALGTGGIRPCVASFGADQFDDTD  190

Query  731   EKERKHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGT  910
              KER  K SFFNWFYFSIN+GALV++SL+V+IQ +  WG GFG+PAV MA+A+  FFSGT
Sbjct  191   PKERVKKGSFFNWFYFSINIGALVSSSLLVYIQDNAGWGLGFGIPAVFMAIAIGSFFSGT  250

Query  911   RLYRYQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNEL  1090
              LYR+Q+PGGSP TR+ QV+VAS  KR ++VP D SLL+ET    S I+GSRKL H+NEL
Sbjct  251   PLYRFQRPGGSPITRMCQVLVASFHKRNMEVPQDSSLLYETPEGISAIEGSRKLEHSNEL  310

Query  1091  RFFDKAAVVEESLDEDKKGSVS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMG  1267
             +  DKAAV+     E K G  S PWRLCTVTQVEELK + R+ PIWATGI+FS V+ QM 
Sbjct  311   KCLDKAAVISNV--EAKSGDFSNPWRLCTVTQVEELKILERMFPIWATGIVFSAVHAQMS  368

Query  1268  TQFISQAEGMNTYVGTFKXPXASL  1339
             T F+ Q   M+T VG+F  P ASL
Sbjct  369   TMFVEQGMLMDTKVGSFAIPPASL  392



>gb|AIL30501.1| oligopeptide transporter 1 [Nicotiana tabacum]
Length=584

 Score =   473 bits (1218),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 225/376 (60%), Positives = 279/376 (74%), Gaps = 4/376 (1%)
 Frame = +2

Query  218   EEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  397
             E   +YT DG++D +  P  K +TGNW+ACPFILGNEC ERLAYYG+++NL+ Y  T+L+
Sbjct  19    ENSGLYTGDGSVDIKGNPVLKSETGNWRACPFILGNECCERLAYYGIATNLVTYLTTKLH  78

Query  398   QSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPG  577
             +   SA++N++ W+GTCY+ PL+GA LADAY GRYWTIATFS IY +GM  +TLSA+VP 
Sbjct  79    EGNVSAARNVTTWAGTCYLTPLIGAVLADAYWGRYWTIATFSTIYFIGMCTLTLSASVPA  138

Query  578   ISPTCIAHDKC-TATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
               P       C  AT     + F+ LYL+ALGTGGIKPCVSS+GADQFDDTD KER  K 
Sbjct  139   FKPPECMDSVCPAATPAQYVILFLGLYLIALGTGGIKPCVSSFGADQFDDTDPKERVKKG  198

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GAL+++SLIVWIQ++  WG GFG+PA+ M +A+  FF GT LYR+QKP
Sbjct  199   SFFNWFYFSINIGALISSSLIVWIQENAGWGLGFGIPALFMGIAIASFFFGTPLYRFQKP  258

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QV+VA+  K  + VP D +LL+ET    S I+GSRKL HT+ELR  DKAAV
Sbjct  259   GGSPLTRMCQVLVAAFHKWNLSVPEDSTLLYETPDKSSAIEGSRKLLHTDELRCLDKAAV  318

Query  1115  VEESLDEDKKGSVS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAE  1291
             V +   E K G  S  WRLCTVTQVEELK +IR+ PIWATGI+FS VY QM T F+ Q  
Sbjct  319   VSDV--ELKTGDYSNTWRLCTVTQVEELKILIRMFPIWATGIVFSAVYAQMSTMFVEQGS  376

Query  1292  GMNTYVGTFKXPXASL  1339
              M+T +G+FK P ASL
Sbjct  377   VMDTAIGSFKIPAASL  392



>ref|XP_002992551.1| hypothetical protein SELMODRAFT_448814 [Selaginella moellendorffii]
 gb|EFJ06357.1| hypothetical protein SELMODRAFT_448814 [Selaginella moellendorffii]
Length=589

 Score =   473 bits (1217),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 214/384 (56%), Positives = 289/384 (75%), Gaps = 7/384 (2%)
 Frame = +2

Query  197   MEQSKAMEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMI  376
             +E  + +E++   TKDGT+D++N PA+++ TG WKACP+ILGNEC ERLAYYGMS NL++
Sbjct  15    LENGEDLEKESFITKDGTVDWKNNPADRRTTGGWKACPYILGNECCERLAYYGMSINLVV  74

Query  377   YFQTRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMT  556
             +   +L+Q   +AS N++NWSGTC I PL+GAFLADAYLGRYWTIA FS +Y +GM L+T
Sbjct  75    FLTDKLHQHNATASTNVTNWSGTCDITPLIGAFLADAYLGRYWTIAAFSSVYFVGMVLLT  134

Query  557   LSATVPGISPTCIAHDKCT-ATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDE  733
             LSA+VP + P     D C  A+       ++ALYLVALGTGGIKPCVS++GADQFDD D 
Sbjct  135   LSASVPSLKPPSCVGDVCPGASPGQIGSFYLALYLVALGTGGIKPCVSTFGADQFDDEDP  194

Query  734   KERKHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTR  913
              E+K+ + FFNWFYFSINVGA++A++ +V+IQQ V+W WGFG+PA AM +A+  FF G++
Sbjct  195   SEKKYMTVFFNWFYFSINVGAMIASTFLVYIQQSVNWAWGFGIPAAAMGIAIVSFFIGSK  254

Query  914   LYRYQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELR  1093
              YR+QKPGGSP TR+ QV+VA++R  ++++P+D+++L+E  G  S I+GSRK+ HT E  
Sbjct  255   QYRHQKPGGSPLTRIAQVIVAAIRNWRLRLPADETMLYEVDGKASAIEGSRKIQHTAEYS  314

Query  1094  FFDKAAVVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQ  1273
             F DKAA+      EDK    + W LCTVTQVEE+K ++R++PIWA+ I+FSTVY QM T 
Sbjct  315   FLDKAAI------EDKSRPTTKWNLCTVTQVEEVKILLRIVPIWASVIVFSTVYAQMSTL  368

Query  1274  FISQAEGMNTYVGTFKXPXASLGV  1345
             F+ Q   M+  +GTFK P ASL +
Sbjct  369   FVVQGLKMDYILGTFKVPSASLSM  392



>emb|CDP05420.1| unnamed protein product [Coffea canephora]
Length=631

 Score =   474 bits (1221),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 223/376 (59%), Positives = 282/376 (75%), Gaps = 4/376 (1%)
 Frame = +2

Query  218   EEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  397
             E + +YT+DG++D   +P  K  TGNW+ACPFILG EC ERLAYYG+++NL+ Y   +++
Sbjct  66    ESNGLYTRDGSVDINGKPVLKSNTGNWRACPFILGTECCERLAYYGIATNLVTYLTKKMH  125

Query  398   QSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPG  577
             +   SA++N++ W GTCY+ PL+GA +ADAY GRYWTIATFS IY +GM  ++LSA+VP 
Sbjct  126   EGNVSAARNVTTWQGTCYLTPLIGAVVADAYWGRYWTIATFSTIYFIGMCTLSLSASVPA  185

Query  578   ISPTCIAHDKC-TATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
               P       C +AT    A+ FI LYL+ALGTGGIKPCVSS+GADQFDDTD KER  K 
Sbjct  186   FRPVECVDSVCPSATSAQYAILFIGLYLIALGTGGIKPCVSSFGADQFDDTDPKERAKKG  245

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFS+N+GA V++SLIVWIQ +  WG GFG+PAV MA+A+  FFSGT LYR+QKP
Sbjct  246   SFFNWFYFSVNIGAFVSSSLIVWIQDNAGWGLGFGIPAVFMAIAIVSFFSGTPLYRFQKP  305

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QV+VAS RK  + VP D +LL+ET    S I+GSRKL HT+EL+  DKAAV
Sbjct  306   GGSPITRMCQVLVASCRKWGLPVPEDSNLLYETQDEFSAIEGSRKLFHTDELKCLDKAAV  365

Query  1115  VEESLDEDKKGSVS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAE  1291
             + E+  E K G +S PW++CTVTQVEELK +IR+ PIWATGI+FS VY QM T F+ Q  
Sbjct  366   ISEA--EIKTGDLSNPWKICTVTQVEELKILIRMFPIWATGIVFSAVYAQMSTMFVEQGT  423

Query  1292  GMNTYVGTFKXPXASL  1339
              M+T +G+F  P ASL
Sbjct  424   MMDTSIGSFTIPAASL  439



>ref|XP_010246838.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3-like [Nelumbo nucifera]
Length=579

 Score =   472 bits (1215),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 220/370 (59%), Positives = 278/370 (75%), Gaps = 2/370 (1%)
 Frame = +2

Query  233   YTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQSTTS  412
             YT DG++D    PA K KTGNW+ACPFILGNECSERLAYYG+++NL+ Y   +L++   S
Sbjct  19    YTGDGSVDINGDPALKHKTGNWRACPFILGNECSERLAYYGIATNLVTYLTNKLHEGNAS  78

Query  413   ASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPGISP-T  589
             A++N++ W GTCY+ PL+GA LADAY GRY TIA FS IY +GM  +TLSA++P + P +
Sbjct  79    AARNVTTWQGTCYLAPLIGAVLADAYWGRYRTIAVFSTIYFIGMCTLTLSASIPALKPPS  138

Query  590   CIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSFFNW  769
             C+      AT    A+ F  LYL+ALGTGGIKPCVSS+GADQFDDTD +ER  K SFFNW
Sbjct  139   CVGSFCPVATPAQYAIFFFGLYLIALGTGGIKPCVSSFGADQFDDTDRRERVKKGSFFNW  198

Query  770   FYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKPGGSPF  949
             FYFSIN+GAL+++SL+VW+Q ++ WG GFG+P V M LA+  F SGT LYR+QKPGGSP 
Sbjct  199   FYFSINIGALISSSLLVWVQDNLGWGLGFGIPTVFMGLAIISFLSGTSLYRFQKPGGSPL  258

Query  950   TRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAVVEESL  1129
             TR+ QVVVASLRK  +++P D SLL+E     S I+GSRKL H++EL+F DKAA+V + L
Sbjct  259   TRICQVVVASLRKWNLELPRDSSLLYELPNKTSAIEGSRKLEHSDELKFLDKAALVTD-L  317

Query  1130  DEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEGMNTYV  1309
             +    G   PWRLC+VTQVEELK +IR+ PIWATGI+FS VY QM T F+ Q   M+T +
Sbjct  318   ESKNDGFSDPWRLCSVTQVEELKILIRMFPIWATGIVFSAVYAQMSTMFVEQGMVMDTTI  377

Query  1310  GTFKXPXASL  1339
             G+F  P ASL
Sbjct  378   GSFTIPPASL  387



>ref|XP_009803584.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009803585.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3-like isoform X2 [Nicotiana 
sylvestris]
Length=584

 Score =   472 bits (1215),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 224/376 (60%), Positives = 278/376 (74%), Gaps = 4/376 (1%)
 Frame = +2

Query  218   EEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  397
             E   +YT DG++D +  P  K +TGNW+ACPFILGNEC ERLAYYG+++NL+ Y  T+ +
Sbjct  19    ENSGLYTGDGSVDIKGNPVLKSETGNWRACPFILGNECCERLAYYGIATNLVTYLTTKFH  78

Query  398   QSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPG  577
             +   SA++N++ W+GTCY+ PL+GA LADAY GRYWTIATFS IY +GM  +TLSA+VP 
Sbjct  79    EGNVSAARNVTTWAGTCYLTPLIGAVLADAYWGRYWTIATFSTIYFIGMCTLTLSASVPA  138

Query  578   ISPTCIAHDKC-TATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
               P       C  AT     + F+ LYL+ALGTGGIKPCVSS+GADQFDDTD KER  K 
Sbjct  139   FKPPECMDSVCPAATPAQYVILFLGLYLIALGTGGIKPCVSSFGADQFDDTDPKERVKKG  198

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GAL+++SLIVWIQ++  WG GFG+PA+ M +A+  FF GT LYR+QKP
Sbjct  199   SFFNWFYFSINIGALISSSLIVWIQENAGWGLGFGIPALFMGIAIASFFFGTPLYRFQKP  258

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QV+VA+  K  + VP D +LL+ET    S I+GSRKL HT+ELR  DKAAV
Sbjct  259   GGSPLTRMCQVLVAAFHKWNLSVPEDSTLLYETPDKSSAIEGSRKLLHTDELRCLDKAAV  318

Query  1115  VEESLDEDKKGSVS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAE  1291
             V +   E K G  S  WRLCTVTQVEELK +IR+ PIWATGI+FS VY QM T F+ Q  
Sbjct  319   VSDV--ELKTGDYSNTWRLCTVTQVEELKILIRMFPIWATGIVFSAVYAQMSTMFVEQGS  376

Query  1292  GMNTYVGTFKXPXASL  1339
              M+T +G+FK P ASL
Sbjct  377   VMDTAIGSFKIPAASL  392



>emb|CDY17619.1| BnaA06g34380D [Brassica napus]
Length=657

 Score =   474 bits (1221),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 226/378 (60%), Positives = 281/378 (74%), Gaps = 4/378 (1%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             M E  +Y +DG++D    P  K+KTGNWKACPFILGNEC ERLAYYG++ NL+ Y  T+L
Sbjct  89    MFEPKLYAQDGSVDLHGNPPLKEKTGNWKACPFILGNECCERLAYYGIAGNLITYLTTKL  148

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             +Q   SA++N++ W GTCY+ PL+GA LADAY GRYWTIA FS IY +GM+ +TLSA+VP
Sbjct  149   HQGNVSAARNVTTWQGTCYLTPLIGAVLADAYWGRYWTIACFSGIYFIGMSALTLSASVP  208

Query  575   GISPT-CIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHK  751
              + P  CI     +AT    A+ F  LYL+ALGTGGIKPCVSS+GADQFDDTD +ER  K
Sbjct  209   ALKPAECIGTFCPSATPAQYAMFFGGLYLIALGTGGIKPCVSSFGADQFDDTDSRERVKK  268

Query  752   SSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQK  931
             +SFFNWFYFSIN+GALV++SL+VWIQ++  WG GFG+P V M LA+  FF GT LYR+QK
Sbjct  269   ASFFNWFYFSINIGALVSSSLLVWIQENRGWGLGFGIPTVFMGLAIASFFFGTPLYRFQK  328

Query  932   PGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAA  1111
             PGGSP TR+ QVVVAS RK  + VP D  LL+ET    S I GSRK+ HT++ ++ DKAA
Sbjct  329   PGGSPITRISQVVVASFRKSTLTVPEDAMLLYETQDKNSAIAGSRKIEHTDDCQYLDKAA  388

Query  1112  VVEESLDEDKKGSVS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQA  1288
             V+ E  +E K G  S  WRLCTVTQVEELK +IR+ PIWA+GIIFS VY QM T F+ Q 
Sbjct  389   VISE--EESKTGDFSNSWRLCTVTQVEELKILIRMFPIWASGIIFSAVYAQMSTMFVQQG  446

Query  1289  EGMNTYVGTFKXPXASLG  1342
               M+  +G+F+ P A+LG
Sbjct  447   RAMDCKIGSFQLPPAALG  464



>ref|XP_003568460.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like [Brachypodium distachyon]
 ref|XP_010230444.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like [Brachypodium distachyon]
Length=595

 Score =   473 bits (1216),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 222/378 (59%), Positives = 287/378 (76%), Gaps = 6/378 (2%)
 Frame = +2

Query  227   DVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQST  406
             ++YT+DGT+D +  PA K+ TGNW+ACP+IL NEC ERLAYYGMS+NL+ + + RL    
Sbjct  8     EMYTQDGTVDLKGNPALKENTGNWRACPYILANECCERLAYYGMSTNLVNFMKDRLGMEN  67

Query  407   TSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPGISP  586
               A+ +++NWSGTCYI PL+GAFLADAYLGR+WTIA+F IIY++G+ L+T++ +V G+ P
Sbjct  68    ALAANSVTNWSGTCYITPLIGAFLADAYLGRFWTIASFMIIYILGLGLLTMATSVHGLVP  127

Query  587   TCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSFFN  766
             TC     C+ T   TA  F+ALYL+ALGTGGIKPCVSS+GADQFD+ D  ER+ KSSFFN
Sbjct  128   TCTG-GTCSPTSGQTAAVFVALYLIALGTGGIKPCVSSFGADQFDEHDALERRSKSSFFN  186

Query  767   WFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKPGGSP  946
             WFYFSIN+GALVA+S++V++Q  V W WGFG+PAV MA+AV  FF GT LYR+Q+PGGSP
Sbjct  187   WFYFSINIGALVASSVLVYVQTHVGWSWGFGIPAVVMAIAVGSFFVGTPLYRHQRPGGSP  246

Query  947   FTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV----  1114
              TR+ QV+VA+ RK  + +P D S LHET   ES I+GSRKL HT +  F D+AA+    
Sbjct  247   LTRVAQVLVAAARKWSLPLPEDPSALHETADKESGIEGSRKLEHTPQFAFLDRAAIETDS  306

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
              ++S       + S WRLCTVTQVEELKS++RLLPIWA+GI+F+TVYGQMGT F+ Q   
Sbjct  307   DKKSASSSPAPASSSWRLCTVTQVEELKSVVRLLPIWASGIVFATVYGQMGTLFVLQGNT  366

Query  1295  MNTYVGT-FKXPXASLGV  1345
             ++  +G  FK P ASL +
Sbjct  367   LDASMGPHFKIPSASLSI  384



>ref|XP_010939960.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3-like [Elaeis guineensis]
Length=585

 Score =   472 bits (1214),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 226/394 (57%), Positives = 284/394 (72%), Gaps = 9/394 (2%)
 Frame = +2

Query  182   IGLQMMEQSKAME-------EDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSER  340
             +G Q  EQ   +E       E + YT DG++D    P  K  TGNW+ACPFILGNEC ER
Sbjct  1     MGSQEEEQRSLLEDGFLSENEKEPYTGDGSIDIHGNPVLKDCTGNWRACPFILGNECCER  60

Query  341   LAYYGMSSNLMIYFQTRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATF  520
             LAYYG+S+NL+ Y   +L++   SA++N++ W GTCY+ PLVGA LADAY GRYWTIA F
Sbjct  61    LAYYGISTNLVSYLTKKLHEGNASAARNVTTWQGTCYLTPLVGAILADAYWGRYWTIAVF  120

Query  521   SIIYVMGMTLMTLSATVPGISP-TCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVS  697
             S IY +GM  +TLSA+VP   P +C+      A+    AV F+ LYL+ALGTGGIKPCVS
Sbjct  121   STIYFLGMGTLTLSASVPAFKPPSCVGPVCPEASAAQYAVFFLGLYLIALGTGGIKPCVS  180

Query  698   SYGADQFDDTDEKERKHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAM  877
             S+GADQFDDTD KE+  K+SFFNWFYFSIN+GAL+++S +VW+Q +  WG GFG+P + M
Sbjct  181   SFGADQFDDTDPKEKVKKASFFNWFYFSINIGALISSSFLVWVQDNCGWGLGFGIPTLFM  240

Query  878   ALAVTFFFSGTRLYRYQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQ  1057
              LA+  FF GT LYR+Q+PGGSP TR+ QVVVASLRK KV+VP D SLL+E     S I+
Sbjct  241   GLAIISFFLGTSLYRFQRPGGSPITRVCQVVVASLRKWKVEVPHDSSLLYELTDKTSAIE  300

Query  1058  GSRKLSHTNELRFFDKAAVVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGI  1237
             GSRKL H++EL F DKAA V E LDE  +   +PWRLCTVTQVEELK ++R+ PIWAT I
Sbjct  301   GSRKLEHSDELIFLDKAATVSE-LDEKTESFSNPWRLCTVTQVEELKILVRMFPIWATTI  359

Query  1238  IFSTVYGQMGTQFISQAEGMNTYVGTFKXPXASL  1339
             +FS VY Q+ T F+ Q   ++T +G+F  P ASL
Sbjct  360   VFSAVYAQISTMFVEQGMVLDTTIGSFTIPPASL  393



>gb|ABK24723.1| unknown [Picea sitchensis]
Length=594

 Score =   472 bits (1215),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 224/377 (59%), Positives = 284/377 (75%), Gaps = 5/377 (1%)
 Frame = +2

Query  224   DDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQS  403
             +D YT DG++D+  RP+ K+ TGNW+ACPFILGNEC ERLAYYG+++NL+ Y   RL+Q 
Sbjct  29    EDEYTGDGSVDFWGRPSVKENTGNWRACPFILGNECCERLAYYGINTNLVTYLTKRLHQG  88

Query  404   TTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPGIS  583
               +A+K+++ W+GTCY+ PL GA LADAY GRYWTIA FS IY +GM  +TLSA+V  + 
Sbjct  89    NAAAAKSVTTWAGTCYLTPLFGAVLADAYWGRYWTIAAFSTIYFIGMATLTLSASVSSLK  148

Query  584   P-TCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSF  760
             P +CI  D  TA      V F+ LYL+ALGTGGIKPCVSS+GADQFDDTD KE+K K SF
Sbjct  149   PPSCIGSDCPTANLAQYGVFFLGLYLIALGTGGIKPCVSSFGADQFDDTDPKEKKKKGSF  208

Query  761   FNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKPGG  940
             FNWFYFSINVGALV++S++VW+Q +V WGWGFG+P + M LA+  FFSGT LYR QKPGG
Sbjct  209   FNWFYFSINVGALVSSSVLVWVQDNVGWGWGFGIPTLFMGLAIGSFFSGTPLYRLQKPGG  268

Query  941   SPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAVVE  1120
             SP TR+ QVVVASLRK +  VP D S L+E     S IQGSRKL HT+E +  DK+A++ 
Sbjct  269   SPVTRMCQVVVASLRKLRKTVPLDHSHLYEVQDRNSAIQGSRKLEHTDEFKCLDKSAIIT  328

Query  1121  ESLDEDKKGSVS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEGM  1297
             +  D+ +KG  S PWRLCTVTQVEE+K ++R+ PIWATGI+F+ VY Q+ T F+ Q   +
Sbjct  329   D--DDVRKGGFSNPWRLCTVTQVEEMKILLRMFPIWATGIVFAAVYSQISTMFVEQGMTL  386

Query  1298  NTYVGT-FKXPXASLGV  1345
             +T +G+ F  P ASL V
Sbjct  387   DTSIGSRFHIPPASLSV  403



>gb|ADQ43190.1| peptide transporter [Schrenkiella parvula]
Length=581

 Score =   471 bits (1212),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 227/385 (59%), Positives = 286/385 (74%), Gaps = 6/385 (2%)
 Frame = +2

Query  194   MMEQSKAMEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLM  373
             ++E+   ++E  +Y +DG++D    P  K+KTGNWKACPFIL NEC ERLAYYG++ NL+
Sbjct  10    LIEEGFILQEAKLYAEDGSVDLHGNPPLKEKTGNWKACPFIL-NECCERLAYYGIAGNLI  68

Query  374   IYFQTRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLM  553
              Y  T+L+Q   SA+ N++ W GTCY+ PL+GA LADAY GRYWTIA FS IY +GM+ +
Sbjct  69    TYLTTKLHQGNVSAATNVTTWQGTCYLTPLIGAVLADAYWGRYWTIACFSGIYFIGMSAL  128

Query  554   TLSATVPGISPT-CIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTD  730
             TLSA+VP + P  CI     +AT    A+ F  LYL+ALGTGGIKPCVSS+GADQFDDTD
Sbjct  129   TLSASVPALKPAECIGEFCPSATPAQYAMFFGGLYLIALGTGGIKPCVSSFGADQFDDTD  188

Query  731   EKERKHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGT  910
              +ER  K+SFFNWFYFSIN+GALV++SL+VWIQ++  WG GFG+P V M LA+  FF GT
Sbjct  189   SRERVRKASFFNWFYFSINIGALVSSSLLVWIQENRGWGLGFGIPTVFMGLAIASFFFGT  248

Query  911   RLYRYQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNEL  1090
              LYR+QKPGGSP TR+ QV+VAS RK  +KVP D +LL+ET    S I GSRK+ HT++ 
Sbjct  249   PLYRFQKPGGSPITRISQVLVASFRKSTLKVPEDVTLLYETQDKNSAIAGSRKIKHTDDC  308

Query  1091  RFFDKAAVVEESLDEDKKGSVS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMG  1267
              + DKAAVV E  +E K G +S  WRLCTVTQVEELK +IR+ PIWA+GIIFS VY QM 
Sbjct  309   -YLDKAAVVSE--EESKSGDLSNSWRLCTVTQVEELKILIRMFPIWASGIIFSAVYAQMS  365

Query  1268  TQFISQAEGMNTYVGTFKXPXASLG  1342
             T F+ Q   MN  +G+F+ P A+LG
Sbjct  366   TMFVQQGRAMNCKIGSFQLPPAALG  390



>ref|XP_002992575.1| hypothetical protein SELMODRAFT_135536, partial [Selaginella 
moellendorffii]
 gb|EFJ06381.1| hypothetical protein SELMODRAFT_135536, partial [Selaginella 
moellendorffii]
Length=574

 Score =   471 bits (1211),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 213/383 (56%), Positives = 289/383 (75%), Gaps = 7/383 (2%)
 Frame = +2

Query  200   EQSKAMEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIY  379
             E  + +E++   TKDGT+D+++ PA+++ TG WKACP+ILGNEC ERLAYYG+S NL+++
Sbjct  1     ENGEDLEKESFITKDGTVDWKHNPADRRTTGGWKACPYILGNECCERLAYYGISMNLVVF  60

Query  380   FQTRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTL  559
                +L+Q   +AS N++NWSGT YI PL+GAFLADAYLGRYWTIA FS +Y +GM L+TL
Sbjct  61    LTDKLHQHNATASTNVTNWSGTAYITPLIGAFLADAYLGRYWTIAAFSSVYFVGMVLLTL  120

Query  560   SATVPGISPTCIAHDKCT-ATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEK  736
             SA+VP + P     D C  A+       ++ALYLVALGTGGIKPCVSS+GADQFDD D  
Sbjct  121   SASVPSLKPPSCVGDVCPGASPGQIGSFYLALYLVALGTGGIKPCVSSFGADQFDDEDPS  180

Query  737   ERKHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRL  916
             E+K+K+ FFNWFYFSINVGA++A++ +V+IQQ V+W WGFG+PA AM +A+  FF+G++ 
Sbjct  181   EKKYKTVFFNWFYFSINVGAMIASTFLVYIQQSVNWAWGFGIPAAAMGIAIVSFFTGSKK  240

Query  917   YRYQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRF  1096
             YR+QKPGGSP TR+ QV+VA++R  ++++P+D+++L+E     S I+GSRK+ HT E  F
Sbjct  241   YRHQKPGGSPLTRIAQVIVAAIRNWRLRLPADETMLYEVDEKASAIEGSRKIQHTAEYSF  300

Query  1097  FDKAAVVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQF  1276
              DKAAV      ED+    + W LCTVTQVEE+K ++R++PIWA+ I+FSTVY QM T F
Sbjct  301   LDKAAV------EDRSRPTTTWNLCTVTQVEEVKILLRIVPIWASAIVFSTVYAQMSTLF  354

Query  1277  ISQAEGMNTYVGTFKXPXASLGV  1345
             + Q   M+  +GTFK P ASL +
Sbjct  355   VVQGLKMDYILGTFKVPSASLSM  377



>ref|XP_007222295.1| hypothetical protein PRUPE_ppa003339mg [Prunus persica]
 gb|EMJ23494.1| hypothetical protein PRUPE_ppa003339mg [Prunus persica]
Length=584

 Score =   471 bits (1211),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 225/391 (58%), Positives = 286/391 (73%), Gaps = 12/391 (3%)
 Frame = +2

Query  197   MEQSKAMEEDDV--------YTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYY  352
             +E+ +++ ED +        YT DG++D   +P  K+ TGNW+ACPFILG EC ERLA+Y
Sbjct  4     LEEERSLLEDGLIQDETNGLYTGDGSVDITGKPVLKQSTGNWRACPFILGTECCERLAFY  63

Query  353   GMSSNLMIYFQTRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIY  532
             G+S+NL+ Y   +L++   SA++N++ WSGTCY+ PL+GA LADAY GRYWTIA FS IY
Sbjct  64    GISTNLVTYLTHKLHEGNVSAARNVTTWSGTCYLTPLIGAVLADAYWGRYWTIAIFSTIY  123

Query  533   VMGMTLMTLSATVPGISPTCIAHDKC-TATGRDTAVCFIALYLVALGTGGIKPCVSSYGA  709
              +GM  +TLSA+VP + P       C +A+     V F  LYL+ALGTGGIKPCVSS+GA
Sbjct  124   FIGMCTLTLSASVPALKPPQCVDSVCPSASPAQYGVFFFGLYLIALGTGGIKPCVSSFGA  183

Query  710   DQFDDTDEKERKHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAV  889
             DQFDDTD +ER  K SFFNWFYFSIN+GALV+++LIVW+Q +  WG GFG+PA+ M +A+
Sbjct  184   DQFDDTDSRERVKKGSFFNWFYFSINIGALVSSTLIVWVQDNAGWGLGFGIPALFMGIAI  243

Query  890   TFFFSGTRLYRYQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRK  1069
               FFSGT LYR+QKPGGSP TR+ QV+VAS RK  + VP D SLL+ET    S I+GSRK
Sbjct  244   VSFFSGTPLYRFQKPGGSPLTRMCQVLVASFRKWNLDVPRDSSLLYETRDKGSAIKGSRK  303

Query  1070  LSHTNELRFFDKAAVVEESLDEDKKGSVS-PWRLCTVTQVEELKSIIRLLPIWATGIIFS  1246
             L H++EL   DKAAV+ E+  E K G+ S PWR+CTVTQVEELK +IR+ PIWATGI+FS
Sbjct  304   LEHSDELNCLDKAAVISET--ETKTGNFSNPWRICTVTQVEELKILIRMFPIWATGIVFS  361

Query  1247  TVYGQMGTQFISQAEGMNTYVGTFKXPXASL  1339
              VY QM T F+ Q   M+T VG+F  P ASL
Sbjct  362   AVYAQMATMFVEQGMMMDTSVGSFTIPPASL  392



>ref|XP_004149470.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3-like [Cucumis sativus]
 gb|KGN49752.1| hypothetical protein Csa_5G106020 [Cucumis sativus]
Length=586

 Score =   471 bits (1211),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 220/376 (59%), Positives = 277/376 (74%), Gaps = 4/376 (1%)
 Frame = +2

Query  218   EEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  397
             E   +YT DG++D+   P  K+ TGNWKACPFILGNE  ERLAYYG+S+NL+ Y   +L+
Sbjct  19    ESSTLYTGDGSVDFHGNPVLKQNTGNWKACPFILGNEGCERLAYYGISTNLVTYLTNKLH  78

Query  398   QSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPG  577
             Q   SA++N++ W GTCY+ PL+GA LADAY GRYWTIA FS IY +GM  +TLSA+VP 
Sbjct  79    QGNVSAARNVTTWQGTCYLTPLIGAILADAYWGRYWTIAAFSTIYFIGMCTLTLSASVPA  138

Query  578   ISPT-CIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             + P  C+      A+     V F+ LYL+ALGTGGIKPCVSS+GADQFDDTD  ER  K 
Sbjct  139   LKPAECVGFMCPPASAAQYMVFFLGLYLIALGTGGIKPCVSSFGADQFDDTDPAERVKKG  198

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GAL+++S +VWIQ +  WG GFG+PAV M LA+  FFSGT+LYR+QKP
Sbjct  199   SFFNWFYFSINIGALISSSFLVWIQDNAGWGLGFGIPAVFMGLAIVSFFSGTKLYRFQKP  258

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QV+VAS  KR + VPSD +LL+E     S I+GSRKL H++ELR  DKAAV
Sbjct  259   GGSPITRMCQVLVASFHKRNLTVPSDSNLLYEVQDKSSAIEGSRKLEHSDELRCLDKAAV  318

Query  1115  VEESLDEDKKGSVS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAE  1291
             + ++  E K G  S PWRLCTVTQ+EE K +IR+ PIWATGI+F+ VY QM T F+ Q  
Sbjct  319   ISDA--ELKSGDFSDPWRLCTVTQIEEFKILIRMFPIWATGIVFAAVYAQMSTLFVEQGT  376

Query  1292  GMNTYVGTFKXPXASL  1339
              ++  +G+F+ P ASL
Sbjct  377   MLDKTIGSFRIPPASL  392



>ref|XP_006346628.1| PREDICTED: peptide transporter PTR2-like [Solanum tuberosum]
Length=585

 Score =   471 bits (1211),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 225/378 (60%), Positives = 283/378 (75%), Gaps = 4/378 (1%)
 Frame = +2

Query  218   EEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  397
             E+  +YT+DG++D    P  K +TGNW+ACPFILGNEC ERLA+YG+S NL+ Y   +L+
Sbjct  20    EDSGLYTRDGSVDINGNPVLKSETGNWRACPFILGNECCERLAFYGISVNLVTYLTKKLH  79

Query  398   QSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPG  577
             +   SA++N++ W GTCY+MPL+GA LADAY GRY TIATFSIIY +GM  +TLSA+VP 
Sbjct  80    EGNVSAARNVTTWQGTCYLMPLIGAVLADAYWGRYRTIATFSIIYFVGMCTLTLSASVPD  139

Query  578   ISPT-CIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
               P  C+     +AT    A+ F  LYL+ALGTGGIKPCVS++GADQFDDTD KER  K 
Sbjct  140   FKPPECVGSVCPSATPAQYAIFFSGLYLIALGTGGIKPCVSAFGADQFDDTDPKERVKKG  199

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GAL++++LIVWIQ++  WG GFG+PAV M++A+  FF GT LYR+QKP
Sbjct  200   SFFNWFYFSINIGALISSTLIVWIQENAGWGLGFGIPAVFMSIAIASFFFGTPLYRFQKP  259

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QV+VA+  K  + VP D +LL+ET    S I+GSRKL HT+ELR  DKAAV
Sbjct  260   GGSPLTRMCQVLVAAFHKWNLSVPHDSTLLYETPDKSSAIEGSRKLLHTDELRCLDKAAV  319

Query  1115  VEESLDEDKKGSVS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAE  1291
             V ++  E K G  S  WRLCTVTQVEELK +IR+ PIWATGI+FS VY QM T F+ Q  
Sbjct  320   VSDT--ECKTGDYSNAWRLCTVTQVEELKILIRMFPIWATGIVFSAVYAQMATLFVEQGT  377

Query  1292  GMNTYVGTFKXPXASLGV  1345
              M+T +GTF+ P ASL +
Sbjct  378   VMDTAIGTFRIPPASLSL  395



>ref|XP_011070505.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3-like [Sesamum indicum]
Length=587

 Score =   471 bits (1211),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 225/381 (59%), Positives = 279/381 (73%), Gaps = 4/381 (1%)
 Frame = +2

Query  203   QSKAMEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYF  382
             +S     D +YT DG++D +  P  K  TGNW+ACPFILG EC ERLAYYG+++NL+ Y 
Sbjct  17    ESGNESNDGLYTGDGSVDIKGNPVLKSNTGNWRACPFILGTECCERLAYYGIATNLVSYL  76

Query  383   QTRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLS  562
               +L++    A++N++ W GTCY+ PL+GA LADAY GRYWTIA FS IY +GM  +TLS
Sbjct  77    TKKLHEGNVPAARNVTTWQGTCYLTPLIGAVLADAYWGRYWTIAAFSTIYFIGMCTLTLS  136

Query  563   ATVPGISPT-CIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKE  739
             ATVP   P  C+     +AT    A+ F  LYL+ALGTGGIKPCVSS+GADQFDDTD  E
Sbjct  137   ATVPSFKPPECVDSICPSATPAQYAIFFFGLYLIALGTGGIKPCVSSFGADQFDDTDSAE  196

Query  740   RKHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLY  919
             R  K SFFNWFYFSIN+GALV++SLIVWIQ +  WG GFG+PA+ M +A+  FFSGT LY
Sbjct  197   RVKKGSFFNWFYFSINIGALVSSSLIVWIQDNAGWGLGFGIPALFMGIAIASFFSGTPLY  256

Query  920   RYQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFF  1099
             R+Q+PGGSP TR+ QVVVAS RK  + VPSD SLL+ET    S I+GSRKL HT+EL+  
Sbjct  257   RFQRPGGSPVTRMCQVVVASCRKWNLAVPSDSSLLYETPDKHSAIEGSRKLLHTDELKCL  316

Query  1100  DKAAVVEESLDEDKKGSVS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQF  1276
             DKAA + ++  E K+G  S PW+LCTVTQVEELK +IR+ PIWATGI+FS VY QM T F
Sbjct  317   DKAATIADA--EAKRGDYSDPWKLCTVTQVEELKILIRMFPIWATGIVFSAVYAQMSTMF  374

Query  1277  ISQAEGMNTYVGTFKXPXASL  1339
             + Q   M+T +G+F  P ASL
Sbjct  375   VEQGMVMDTSIGSFTIPAASL  395



>gb|KDP38199.1| hypothetical protein JCGZ_04842 [Jatropha curcas]
Length=586

 Score =   470 bits (1210),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 226/376 (60%), Positives = 280/376 (74%), Gaps = 4/376 (1%)
 Frame = +2

Query  218   EEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  397
             +  ++YT DG++D    PA K+ TGNW+ACPFILGNEC ERLAYYG+S+NL+ Y   +L+
Sbjct  21    KSKELYTGDGSVDLHGNPALKQNTGNWRACPFILGNECCERLAYYGISTNLVTYLTNKLH  80

Query  398   QSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPG  577
             +   SA++N+S W+GTCYI PL+GA LADA  GRYWTIA FS IY +GM  +TLSA++P 
Sbjct  81    EGNVSAARNVSTWAGTCYITPLIGAVLADACWGRYWTIAAFSTIYFIGMCTLTLSASIPA  140

Query  578   ISPTCIAHDKCT-ATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             + P   A   C  AT    AV F  LYL+ALGTGGI+PCV+S+GADQFDDTD KER  K 
Sbjct  141   LKPAECAGSLCPPATPAQYAVFFFCLYLIALGTGGIRPCVASFGADQFDDTDPKERVKKG  200

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GALV++SL+V+IQ +  WG GFG+PAV MA+A+  FFSGT LYR+Q+P
Sbjct  201   SFFNWFYFSINIGALVSSSLLVYIQDNAGWGLGFGIPAVFMAIAIGSFFSGTPLYRFQRP  260

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QV+VAS  KR ++VP D SLL+ET    S I+GSRKL H+NEL+  DKAAV
Sbjct  261   GGSPITRMCQVLVASFHKRNMEVPQDSSLLYETPEGISAIEGSRKLEHSNELKCLDKAAV  320

Query  1115  VEESLDEDKKGSVS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAE  1291
             +     E K G  S PWRLCTVTQVEELK + R+ PIWATGI+FS V+ QM T F+ Q  
Sbjct  321   ISNV--EAKSGDFSNPWRLCTVTQVEELKILERMFPIWATGIVFSAVHAQMSTMFVEQGM  378

Query  1292  GMNTYVGTFKXPXASL  1339
              M+T VG+F  P ASL
Sbjct  379   LMDTKVGSFAIPPASL  394



>ref|XP_004297798.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3-like [Fragaria vesca 
subsp. vesca]
 ref|XP_011463501.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3-like [Fragaria vesca 
subsp. vesca]
 ref|XP_011463502.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3-like [Fragaria vesca 
subsp. vesca]
 ref|XP_011463503.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3-like [Fragaria vesca 
subsp. vesca]
Length=584

 Score =   469 bits (1208),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 221/376 (59%), Positives = 279/376 (74%), Gaps = 4/376 (1%)
 Frame = +2

Query  218   EEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  397
             E + +YT DG++D    P  K+ TGNW+ACPFILG EC ERLAYYG+++NL+ Y  ++L+
Sbjct  19    EGNGLYTGDGSVDIEGNPVLKQNTGNWRACPFILGTECCERLAYYGIATNLVTYLTSKLH  78

Query  398   QSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPG  577
             +   +A++N++ W GTCY+ PL+GA LADAY GRYWTIA FS IY +GM  +TLSAT+P 
Sbjct  79    EGNVAAARNVTTWQGTCYLTPLIGAVLADAYWGRYWTIAVFSTIYFLGMCTLTLSATLPA  138

Query  578   -ISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
              I P C+      A+    AV F  LYL+ALGTGGIKPCVSS+GADQFDDTD +ER  K 
Sbjct  139   LIPPECVGSSCPAASTSQYAVFFFGLYLIALGTGGIKPCVSSFGADQFDDTDARERVKKG  198

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GAL+++S IV+IQ +  WG GFG+PA+ MA+A+  FFSGT LYR+Q+P
Sbjct  199   SFFNWFYFSINIGALISSSFIVYIQDNAGWGLGFGIPALFMAVAIASFFSGTPLYRFQRP  258

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QV+VAS RK  + VP D SLL+ET    S I+GSRKL H++EL+  DKAAV
Sbjct  259   GGSPLTRMCQVLVASFRKWNLNVPEDSSLLYETEDKVSAIEGSRKLEHSDELKCLDKAAV  318

Query  1115  VEESLDEDKKGSVS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAE  1291
             + E+  E K G  S PWRLCTVTQVEE K +IR+ PIWATGI+FS VY QM T F+ Q  
Sbjct  319   ISEA--EVKTGEFSNPWRLCTVTQVEEFKILIRMFPIWATGIVFSAVYAQMSTMFVEQGT  376

Query  1292  GMNTYVGTFKXPXASL  1339
              M+T +G+F  P ASL
Sbjct  377   MMDTSIGSFTIPPASL  392



>ref|XP_008466783.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3 isoform X2 [Cucumis melo]
Length=586

 Score =   469 bits (1208),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 219/376 (58%), Positives = 278/376 (74%), Gaps = 4/376 (1%)
 Frame = +2

Query  218   EEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  397
             E + ++T DG++D+   P  K+ TGNWKACPFILGNE  ERLAYYG+S+NL+ Y   +L+
Sbjct  19    ESNALFTGDGSVDFHGNPVLKQNTGNWKACPFILGNEGCERLAYYGISTNLVTYLTNKLH  78

Query  398   QSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPG  577
             Q   SA++N++ W GTCY+ PL+GA LADAY GRYWTIA FS IY +GM  +TLSA+VP 
Sbjct  79    QGNVSAARNVTTWQGTCYLTPLIGAILADAYWGRYWTIAAFSTIYFIGMCTLTLSASVPA  138

Query  578   ISPT-CIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             + P  C+      A+     V F+ LYL+ALGTGGIKPCVSS+GADQFDDTD  ER  K 
Sbjct  139   LKPAECVGFMCPPASAAQYMVFFLGLYLIALGTGGIKPCVSSFGADQFDDTDPAERVKKG  198

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GAL+++S +VWIQ +  WG GFG+PAV M LA+  FFSGT+LYR+QKP
Sbjct  199   SFFNWFYFSINIGALISSSFLVWIQDNAGWGLGFGIPAVFMGLAIVSFFSGTKLYRFQKP  258

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QV+VAS  KR ++VP D +LL+E     S I+GSRKL H++ELR  DKAAV
Sbjct  259   GGSPITRMCQVLVASFHKRNLRVPGDSNLLYEVQDKSSAIEGSRKLEHSDELRCLDKAAV  318

Query  1115  VEESLDEDKKGSVS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAE  1291
             + ++  E K G  S PWRLCTVTQVEE K +IR+ PIWATGI+F+ VY QM T F+ Q  
Sbjct  319   ISDA--ELKSGDYSNPWRLCTVTQVEEFKILIRMFPIWATGIVFAAVYAQMSTLFVEQGT  376

Query  1292  GMNTYVGTFKXPXASL  1339
              ++  +G+F+ P ASL
Sbjct  377   MLDKTIGSFRIPPASL  392



>ref|XP_008466778.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3 isoform X1 [Cucumis melo]
Length=587

 Score =   469 bits (1208),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 219/376 (58%), Positives = 278/376 (74%), Gaps = 4/376 (1%)
 Frame = +2

Query  218   EEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  397
             E + ++T DG++D+   P  K+ TGNWKACPFILGNE  ERLAYYG+S+NL+ Y   +L+
Sbjct  20    ESNALFTGDGSVDFHGNPVLKQNTGNWKACPFILGNEGCERLAYYGISTNLVTYLTNKLH  79

Query  398   QSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPG  577
             Q   SA++N++ W GTCY+ PL+GA LADAY GRYWTIA FS IY +GM  +TLSA+VP 
Sbjct  80    QGNVSAARNVTTWQGTCYLTPLIGAILADAYWGRYWTIAAFSTIYFIGMCTLTLSASVPA  139

Query  578   ISPT-CIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             + P  C+      A+     V F+ LYL+ALGTGGIKPCVSS+GADQFDDTD  ER  K 
Sbjct  140   LKPAECVGFMCPPASAAQYMVFFLGLYLIALGTGGIKPCVSSFGADQFDDTDPAERVKKG  199

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GAL+++S +VWIQ +  WG GFG+PAV M LA+  FFSGT+LYR+QKP
Sbjct  200   SFFNWFYFSINIGALISSSFLVWIQDNAGWGLGFGIPAVFMGLAIVSFFSGTKLYRFQKP  259

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QV+VAS  KR ++VP D +LL+E     S I+GSRKL H++ELR  DKAAV
Sbjct  260   GGSPITRMCQVLVASFHKRNLRVPGDSNLLYEVQDKSSAIEGSRKLEHSDELRCLDKAAV  319

Query  1115  VEESLDEDKKGSVS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAE  1291
             + ++  E K G  S PWRLCTVTQVEE K +IR+ PIWATGI+F+ VY QM T F+ Q  
Sbjct  320   ISDA--ELKSGDYSNPWRLCTVTQVEEFKILIRMFPIWATGIVFAAVYAQMSTLFVEQGT  377

Query  1292  GMNTYVGTFKXPXASL  1339
              ++  +G+F+ P ASL
Sbjct  378   MLDKTIGSFRIPPASL  393



>ref|XP_002972518.1| hypothetical protein SELMODRAFT_97812, partial [Selaginella moellendorffii]
 gb|EFJ26604.1| hypothetical protein SELMODRAFT_97812, partial [Selaginella moellendorffii]
Length=569

 Score =   468 bits (1205),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 212/378 (56%), Positives = 287/378 (76%), Gaps = 7/378 (2%)
 Frame = +2

Query  215   MEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRL  394
             +E++   TKDGT+D+++ PA+++ TG WKACP+ILGNEC ERLAYYG+S NL+++   +L
Sbjct  1     LEKESFITKDGTVDWKHNPADRRTTGGWKACPYILGNECCERLAYYGISMNLVVFLTDKL  60

Query  395   NQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVP  574
             +Q   +AS N++NWSGT YI PL+GAFLADAYLGRYWTIA FS +Y +GM L+TLSA+VP
Sbjct  61    HQHNATASTNVTNWSGTAYITPLIGAFLADAYLGRYWTIAAFSSVYFVGMVLLTLSASVP  120

Query  575   GISPTCIAHDKCT-ATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHK  751
              + P     D C  A+       ++ALYLVALGTGGIKPCVSS+GADQFDD D  E+K+K
Sbjct  121   SLKPPSCVGDVCPGASPGQIGSFYLALYLVALGTGGIKPCVSSFGADQFDDEDPSEKKYK  180

Query  752   SSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQK  931
             + FFNWFYFSINVGA++A++ +V+IQQ V+W WGFG+PA AM +A+  FF+G++ YR+QK
Sbjct  181   TVFFNWFYFSINVGAMIASTFLVYIQQSVNWAWGFGIPAAAMGIAIVSFFTGSKKYRHQK  240

Query  932   PGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAA  1111
             PGGSP TR+ QV+VA++R  ++++P+D+++L+E     S I+GSRK+ HT E  F DKAA
Sbjct  241   PGGSPLTRIAQVIVAAIRNWRLRLPADETMLYEVDEKASAIEGSRKIQHTAEYSFLDKAA  300

Query  1112  VVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAE  1291
             V      ED+    + W LCTVTQVEE+K ++R++PIWA+ I+FSTVY QM T F+ Q  
Sbjct  301   V------EDRSRPTTTWNLCTVTQVEEVKILLRIVPIWASAIVFSTVYAQMSTLFVVQGL  354

Query  1292  GMNTYVGTFKXPXASLGV  1345
              M+  +GTFK P ASL +
Sbjct  355   KMDYILGTFKVPSASLSM  372



>ref|XP_010066525.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3-like [Eucalyptus grandis]
 gb|KCW64432.1| hypothetical protein EUGRSUZ_G02047 [Eucalyptus grandis]
Length=581

 Score =   469 bits (1206),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 220/375 (59%), Positives = 277/375 (74%), Gaps = 5/375 (1%)
 Frame = +2

Query  218   EEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  397
             +++ +YT DG++D    P  K  TGNW+ACPFILG EC ERLAYYG+++NL+ Y    ++
Sbjct  19    KQNGLYTGDGSVDVNGNPVLKSNTGNWRACPFILGTECCERLAYYGIATNLVSYLTNNMH  78

Query  398   QSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPG  577
             +   SA++N++ W+GTCY+ PL+GA +ADAY GRYWTIA FS IY  GM  +TLSATVP 
Sbjct  79    EGNVSAARNVTTWAGTCYLAPLIGAVVADAYWGRYWTIAAFSTIYFFGMCTLTLSATVPA  138

Query  578   ISPT-CIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
               P  C+     T T    AV F  LYL+ALGTGGIKPCVSS+GADQFDDTD +ER  K 
Sbjct  139   FKPVECVGSLCPTTTPAQYAVFFFGLYLIALGTGGIKPCVSSFGADQFDDTDPRERMKKG  198

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GAL+++SL+VWIQ++  WGWGFG+PA+ M +A+  FFSGT LYR+Q+P
Sbjct  199   SFFNWFYFSINIGALISSSLLVWIQENAGWGWGFGIPALFMGIAIASFFSGTPLYRFQRP  258

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QV+VAS RK  +KVP D SLL+E     S I+GSRKL HT+EL+  DKAAV
Sbjct  259   GGSPITRMCQVLVASFRKWNIKVPEDGSLLYEMQ--NSAIEGSRKLEHTDELKCLDKAAV  316

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
             + ++  E K G  + W LCTVTQVEELK +IR+ PIWATGI+FS VY QM T F+ Q   
Sbjct  317   LSDA--EAKSGEYNSWNLCTVTQVEELKILIRMFPIWATGIVFSAVYAQMSTMFVEQGMM  374

Query  1295  MNTYVGTFKXPXASL  1339
             M+T VG+F  P ASL
Sbjct  375   MDTTVGSFAIPPASL  389



>ref|XP_009351619.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3-like [Pyrus x bretschneideri]
Length=585

 Score =   468 bits (1203),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 222/376 (59%), Positives = 277/376 (74%), Gaps = 4/376 (1%)
 Frame = +2

Query  218   EEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  397
             E D  YT DG++D +  P  K+ TGNW+ACPFILG EC ERLAYYG+++NL+ Y   +L+
Sbjct  20    EGDGRYTGDGSVDIKGNPVLKQNTGNWRACPFILGTECCERLAYYGIATNLVTYLTHKLH  79

Query  398   QSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPG  577
             +   SA++N++ WSGTCY+ PL+GA LADAY GRYWTIA FSIIY +GM  +TLSA VP 
Sbjct  80    EGNVSAARNVTTWSGTCYLTPLIGAVLADAYWGRYWTIAVFSIIYFIGMGTLTLSAAVPA  139

Query  578   ISPTCIAHDKC-TATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             + P       C +A+     V F+ LYL+ALGTGGIKPCVSS+GADQFDDTD+ ER  K 
Sbjct  140   LKPPQCVDSVCPSASPAQYGVFFLGLYLIALGTGGIKPCVSSFGADQFDDTDKMERVKKG  199

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GAL+++SLIVW+Q +  WG GFG+P + M +A+  FFSGT LYR+QKP
Sbjct  200   SFFNWFYFSINIGALISSSLIVWVQDNAGWGLGFGIPTLFMGIAIFSFFSGTPLYRFQKP  259

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QV+VA+ RK  + VP D SLL+ET    S I+GSRKL H++EL   DKAAV
Sbjct  260   GGSPVTRMCQVLVATFRKWNLDVPKDSSLLYETQDKVSAIKGSRKLEHSDELTCLDKAAV  319

Query  1115  VEESLDEDKKGSVS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAE  1291
             + E+  E K G  S PWR+CTVTQVEELK +IR+ PIWATGI+FS VY QM T F+ Q  
Sbjct  320   ISET--ETKTGDFSNPWRVCTVTQVEELKILIRMFPIWATGIVFSAVYAQMSTMFVEQGT  377

Query  1292  GMNTYVGTFKXPXASL  1339
              M+T +G F  P ASL
Sbjct  378   MMDTSIGAFTIPPASL  393



>ref|XP_004972110.1| PREDICTED: peptide transporter PTR1-like [Setaria italica]
Length=584

 Score =   467 bits (1202),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 231/371 (62%), Positives = 282/371 (76%), Gaps = 3/371 (1%)
 Frame = +2

Query  236   TKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQSTTSA  415
             T DGT D+  +PA + KTG W+ACPFILGNEC ERLAYYGMSSNL+ Y   RL+Q   +A
Sbjct  19    TLDGTTDHSGKPAVRSKTGTWRACPFILGNECCERLAYYGMSSNLVNYMIDRLHQGNAAA  78

Query  416   SKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPGISPTCI  595
             + N+SNWSGTCY+MPL+GAFLADAYLGRY TIA F  +Y++G+TL+T+SA VPG+ P   
Sbjct  79    ANNVSNWSGTCYMMPLLGAFLADAYLGRYRTIAAFMGLYIVGLTLLTMSAAVPGLRPPDA  138

Query  596   AHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSFFNWFY  775
             A    TA    +A  F ALYL+A+GTGGIKPCVSS+GADQFDD D +E + KSSFFNWFY
Sbjct  139   AGAAPTAG--QSAAFFAALYLIAVGTGGIKPCVSSFGADQFDDADPRESQSKSSFFNWFY  196

Query  776   FSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKPGGSPFTR  955
              SIN+GALVA+S++VWIQ +V WGWGFG+PAVAMA AV  F  G+RLYR+Q+PGGSP TR
Sbjct  197   TSINIGALVASSVLVWIQMNVGWGWGFGIPAVAMAAAVASFLLGSRLYRHQRPGGSPLTR  256

Query  956   LFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAVVEESLDE  1135
             + QVVVA+ RKRK  VP+D SLLHE     S IQGSRKL HT + R+ D+AAV+ E  D 
Sbjct  257   MLQVVVAAWRKRKSPVPADPSLLHEAPASASAIQGSRKLEHTEQFRWLDRAAVLTEEDDT  316

Query  1136  DKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEGMNTYVG-  1312
                   +PW+LCTVTQVEELKS++RLLP+WATGI+ S VY QM T F+ Q   ++  VG 
Sbjct  317   MNNEKSNPWQLCTVTQVEELKSVVRLLPVWATGIVVSAVYSQMSTMFVLQGNTLDPSVGS  376

Query  1313  TFKXPXASLGV  1345
             +FK P ASL +
Sbjct  377   SFKIPSASLSI  387



>ref|XP_006448044.1| hypothetical protein CICLE_v10014643mg [Citrus clementina]
 gb|ESR61284.1| hypothetical protein CICLE_v10014643mg [Citrus clementina]
Length=607

 Score =   468 bits (1203),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 220/372 (59%), Positives = 278/372 (75%), Gaps = 4/372 (1%)
 Frame = +2

Query  230   VYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQSTT  409
             +YT DG++D   +P  K+ TGNW+ACPFILG EC ERLAYYG+++NL+ Y   +L++   
Sbjct  46    LYTGDGSVDISGKPVLKQNTGNWRACPFILGTECCERLAYYGIATNLVSYLTHKLHEGNV  105

Query  410   SASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPGISPT  589
             SA++N++ W GTCY+ PL+GA LADAY GRYWTIA FS IY +GM  +TLSA++P + P 
Sbjct  106   SAARNVTTWQGTCYLTPLIGAVLADAYWGRYWTIAAFSTIYFIGMCTLTLSASIPALKPA  165

Query  590   -CIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSFFN  766
              C+     +AT    AV F  LYL+ALGTGGIKPCVSS+GADQFDDTD  ER  K SFFN
Sbjct  166   ECVGALCPSATPAQYAVFFFGLYLIALGTGGIKPCVSSFGADQFDDTDSNERVKKGSFFN  225

Query  767   WFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKPGGSP  946
             WFYFSIN+GAL+++SLIVWIQ +  WG GFG+PA+ M  A+  FFSGT LYR+Q+PGGSP
Sbjct  226   WFYFSINIGALISSSLIVWIQDNAGWGLGFGIPALFMGFAIASFFSGTSLYRFQRPGGSP  285

Query  947   FTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAVVEES  1126
              TR+ QV+VAS RK  ++VP+D +LL+ET    S I+GSRK+ H++ELR  DKAAVV ++
Sbjct  286   ITRMCQVLVASFRKWNLEVPNDSTLLYETQDKASAIEGSRKIEHSDELRCLDKAAVVSDA  345

Query  1127  LDEDKKGSVS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEGMNT  1303
               E K G  S PW LCTVTQVEELK +IR+ PIWATGI+FS VY QM T F+ Q   M+T
Sbjct  346   --EIKSGDFSNPWILCTVTQVEELKILIRMFPIWATGIVFSAVYAQMSTLFVEQGMVMDT  403

Query  1304  YVGTFKXPXASL  1339
              +G+F  P ASL
Sbjct  404   SIGSFTIPPASL  415



>ref|XP_002972318.1| hypothetical protein SELMODRAFT_441824 [Selaginella moellendorffii]
 gb|EFJ26404.1| hypothetical protein SELMODRAFT_441824 [Selaginella moellendorffii]
Length=591

 Score =   466 bits (1200),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 213/381 (56%), Positives = 287/381 (75%), Gaps = 7/381 (2%)
 Frame = +2

Query  206   SKAMEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQ  385
             S  +E++   TKDGT+D++N PA+++ TG WKACP+ILGNEC ERLAYYGMS NL+++  
Sbjct  20    SGDLEKESFITKDGTVDWKNNPADRRTTGGWKACPYILGNECCERLAYYGMSINLVVFLT  79

Query  386   TRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSA  565
              +L+Q   +AS N++NWSGTC I PL+GAFLADAYLGRYWTIA FS +Y +GM L+TLSA
Sbjct  80    DKLHQHNATASTNVTNWSGTCDITPLIGAFLADAYLGRYWTIAAFSSVYFVGMVLLTLSA  139

Query  566   TVPGISPTCIAHDKCT-ATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKER  742
             +VP + P     D C  A+       ++ALYLVALGTGGIKPCVSS+GADQFDD D  E+
Sbjct  140   SVPSLKPPSCVGDVCPGASPGQIGSFYLALYLVALGTGGIKPCVSSFGADQFDDEDLSEK  199

Query  743   KHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYR  922
             K+ + FFNWFYFSINVGA++A++ +V+IQQ V+W WGFG+PA AM +A+  FF G++ YR
Sbjct  200   KYMTVFFNWFYFSINVGAMIASTFLVYIQQSVNWAWGFGIPAAAMGIAIVGFFIGSKQYR  259

Query  923   YQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFD  1102
             +QKPGGSP TR+ QV+VA++R  ++++P+D+++L+E  G  S I+GSRK+ HT E  F D
Sbjct  260   HQKPGGSPLTRIAQVIVAAIRNWRLRLPADETMLYEVDGKASAIEGSRKIQHTAEYSFLD  319

Query  1103  KAAVVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFIS  1282
             KAA+      E++    + W LCTVTQVEE+K ++R++PIWA+ I+FSTVY QM T F+ 
Sbjct  320   KAAI------ENQSRPTTKWNLCTVTQVEEVKILLRIVPIWASVIVFSTVYAQMSTLFVV  373

Query  1283  QAEGMNTYVGTFKXPXASLGV  1345
             Q   M+  +GTFK P ASL +
Sbjct  374   QGLKMDYILGTFKVPSASLSM  394



>gb|EMT20656.1| Peptide transporter PTR5 [Aegilops tauschii]
Length=586

 Score =   466 bits (1200),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 222/373 (60%), Positives = 278/373 (75%), Gaps = 5/373 (1%)
 Frame = +2

Query  224   DDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQS  403
             D +YT+DGT+D +   A K  TGNW+ACP+IL NEC ERLAYYGMS+NL  +    +  +
Sbjct  7     DTIYTQDGTVDIKGNQAVKSNTGNWRACPYILANECCERLAYYGMSANLSNFMLDNMGMN  66

Query  404   TTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPGIS  583
              + A+  +SNW+GTCY  PL+GAFLADAYLGR+WTIA+F IIYV+G+ L+T++A+V G+ 
Sbjct  67    KSDAANTVSNWTGTCYAAPLIGAFLADAYLGRFWTIASFVIIYVIGLGLLTVAASVKGLV  126

Query  584   PTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSFF  763
             PTC A   C  T   TA  F+ LYLVALGTGGIKPCVSS+GADQFD+ DE ER+ KSSFF
Sbjct  127   PTCAAKGVCNPTAGQTAAVFVGLYLVALGTGGIKPCVSSFGADQFDEHDESERRSKSSFF  186

Query  764   NWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKPGGS  943
             NWFY SIN+GALVA+S++V +Q    WGWGFG+PAV MA+AV  FF GT LYR+Q+PGGS
Sbjct  187   NWFYLSINIGALVASSVLVNVQVRYGWGWGFGIPAVVMAIAVGSFFVGTPLYRHQRPGGS  246

Query  944   PFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAVVEE  1123
             P TR+ QV+VA+   RK+ VP D S L+ET   ES I+GSRKL HT + RF DKAAV  E
Sbjct  247   PLTRIAQVLVAA--TRKLSVPVDGSALYETTERESGIEGSRKLEHTEQFRFLDKAAV--E  302

Query  1124  SLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEGMNT  1303
             +  +    + S WRLCTVTQVEELKS++RLLPIWA+GI+F+ VYGQM T F+ Q   ++ 
Sbjct  303   TPADRTATAPSAWRLCTVTQVEELKSVVRLLPIWASGIVFAAVYGQMNTVFVFQGNTLDK  362

Query  1304  YVGT-FKXPXASL  1339
              +G  F  P ASL
Sbjct  363   RMGAHFSIPSASL  375



>gb|AAF20002.1|AF213936_1 amino acid/peptide transporter [Prunus dulcis]
Length=559

 Score =   465 bits (1196),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 223/391 (57%), Positives = 283/391 (72%), Gaps = 12/391 (3%)
 Frame = +2

Query  197   MEQSKAMEEDDV--------YTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYY  352
             +E+ +++ ED +        YT DG++D   +P  K+ TGNW ACPFILG EC ERLA+Y
Sbjct  4     LEEERSLLEDGLIQDETNGLYTGDGSVDITGKPVLKQSTGNWXACPFILGTECCERLAFY  63

Query  353   GMSSNLMIYFQTRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIY  532
             G+S+NL+ Y   +L++   SA++N++ WSGTCY+ PL+GA LADAY GRYWTIA FS IY
Sbjct  64    GISTNLVTYLTHKLHEGNVSAARNVTTWSGTCYLTPLIGAVLADAYWGRYWTIAIFSTIY  123

Query  533   VMGMTLMTLSATVPGISPTCIAHDKC-TATGRDTAVCFIALYLVALGTGGIKPCVSSYGA  709
              +GM  +T+SA+VP + P       C +A+     V F  LYL+AL TGGIKPCVSS+GA
Sbjct  124   FIGMCTLTISASVPALKPPQCVDSVCPSASPAQYGVFFFGLYLIALRTGGIKPCVSSFGA  183

Query  710   DQFDDTDEKERKHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAV  889
             DQFDDTD +ER  K SFFNWFYFSIN+GALV+++LIVW+Q +  WG GFG+PA+ M +A+
Sbjct  184   DQFDDTDSRERVKKGSFFNWFYFSINIGALVSSTLIVWVQDNAGWGLGFGIPALFMGIAI  243

Query  890   TFFFSGTRLYRYQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRK  1069
               FFSGT LYR+QKPGGSP TR+ QV+VAS RK  + VP D SLL+ET    S I+GSRK
Sbjct  244   VSFFSGTPLYRFQKPGGSPLTRMCQVLVASFRKWNLDVPRDSSLLYETQDKGSAIKGSRK  303

Query  1070  LSHTNELRFFDKAAVVEESLDEDKKGSVS-PWRLCTVTQVEELKSIIRLLPIWATGIIFS  1246
             L H++EL   DKAAV+ E+  E K G  S PWR+CTVTQVEELK +IR+ PIWATGI+FS
Sbjct  304   LEHSDELNCLDKAAVISET--ETKTGDFSNPWRICTVTQVEELKILIRMFPIWATGIVFS  361

Query  1247  TVYGQMGTQFISQAEGMNTYVGTFKXPXASL  1339
              VY QM T F+ Q   M+T VG+F  P ASL
Sbjct  362   AVYAQMATMFVEQGMMMDTSVGSFTIPPASL  392



>ref|XP_004252286.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3-like isoform X1 [Solanum 
lycopersicum]
Length=585

 Score =   466 bits (1198),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 220/378 (58%), Positives = 284/378 (75%), Gaps = 4/378 (1%)
 Frame = +2

Query  218   EEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  397
             E+  +YT+DG++D    P  K +TGNW+ACPFILGNEC ERLA+YG+S NL+ Y   +L+
Sbjct  20    EDSGMYTRDGSVDINGNPVLKSETGNWRACPFILGNECCERLAFYGISVNLVTYLTKKLH  79

Query  398   QSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPG  577
             +   SA++N++ W GTCY+MPL+GA LADAY GRY TIATFSIIY +GM  +TLSA++  
Sbjct  80    EGNVSAARNVTTWQGTCYLMPLIGAVLADAYWGRYRTIATFSIIYFVGMCTLTLSASILA  139

Query  578   ISP-TCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
               P  C+     +AT    A+ F  LYL+A+GTGGIKPCVS++GADQFDDTD KER  K 
Sbjct  140   FKPPECVGSVCPSATPAQYAIFFSGLYLIAVGTGGIKPCVSAFGADQFDDTDPKERVKKG  199

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GAL++++LIVWIQ++  WG GFG+PA+ M++A+  FF GT LYR+QKP
Sbjct  200   SFFNWFYFSINIGALISSTLIVWIQENDGWGLGFGIPALFMSIAIASFFLGTPLYRFQKP  259

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR++QV+VA+  KR + VP D +LL+ET    S I+GSRKL HT+ELR  DKAAV
Sbjct  260   GGSPLTRMYQVLVAAFHKRNLSVPDDSTLLYETPDKSSAIEGSRKLLHTDELRCLDKAAV  319

Query  1115  VEESLDEDKKGSVS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAE  1291
             V ++  E   G  S  WRLCTVTQVEELK +IR+ PIWATGI+FS+VY QM T F+ Q  
Sbjct  320   VSDT--ECIAGDYSNAWRLCTVTQVEELKILIRMFPIWATGIVFSSVYAQMATLFVEQGT  377

Query  1292  GMNTYVGTFKXPXASLGV  1345
              M+T +G+F+ P ASL +
Sbjct  378   VMDTAIGSFRIPPASLSL  395



>ref|XP_006492274.1| PREDICTED: peptide transporter PTR2-like [Citrus sinensis]
Length=584

 Score =   466 bits (1198),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 220/376 (59%), Positives = 279/376 (74%), Gaps = 4/376 (1%)
 Frame = +2

Query  218   EEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  397
             +   +YT DG++D   +P  K+ TGNW+ACPFILG EC ERLAYYG+++NL+ Y   +L+
Sbjct  19    KSSGLYTGDGSVDISGKPVLKQNTGNWRACPFILGTECCERLAYYGIATNLVSYLTHKLH  78

Query  398   QSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPG  577
             +   SA++N++ W GTCY+ PL+GA LADAY GRYWTIA FS IY +GM  +TLSA++P 
Sbjct  79    EGNVSAARNVTTWQGTCYLTPLIGAVLADAYWGRYWTIAAFSTIYFIGMCTLTLSASIPA  138

Query  578   ISPT-CIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             + P  C+     +AT    AV F  LYL+ALGTGGIKPCVSS+GADQFDDTD  ER  K 
Sbjct  139   LKPAECVGALCPSATPAQYAVFFFGLYLIALGTGGIKPCVSSFGADQFDDTDSNERVKKG  198

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GAL+++SLIVWIQ +  WG GFG+PA+ M  A+  FFSGT LYR+Q+P
Sbjct  199   SFFNWFYFSINIGALISSSLIVWIQDNAGWGLGFGIPALFMGFAIASFFSGTSLYRFQRP  258

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QV+VAS RK  ++VP+D +LL+ET    S I+GSRK+ H++ELR  DKAAV
Sbjct  259   GGSPITRMCQVLVASFRKWNLEVPNDSTLLYETQDKASAIEGSRKIEHSDELRCLDKAAV  318

Query  1115  VEESLDEDKKGSVS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAE  1291
             V ++  E K G  S PW LCTVTQVEELK +IR+ PIWATGI+FS VY QM T F+ Q  
Sbjct  319   VSDA--EIKSGDFSNPWILCTVTQVEELKILIRMFPIWATGIVFSAVYAQMSTLFVEQGM  376

Query  1292  GMNTYVGTFKXPXASL  1339
              M+T +G+F  P ASL
Sbjct  377   VMDTSIGSFTIPPASL  392



>ref|XP_011021701.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3-like [Populus euphratica]
Length=584

 Score =   465 bits (1196),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 220/376 (59%), Positives = 280/376 (74%), Gaps = 4/376 (1%)
 Frame = +2

Query  218   EEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  397
             E + +YT DG++D +  P  K+KTGNWKACPFILG EC ERLAYYG+++NL+ Y  ++L+
Sbjct  20    ESNGLYTGDGSVDIKGNPILKQKTGNWKACPFILGTECCERLAYYGIATNLVTYLTSKLH  79

Query  398   QSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPG  577
             +   SA++N++ WSGTCY+ PL+GA LAD   GRYWTIA FS IY +GM  +TLSA++P 
Sbjct  80    EGNVSAARNVTTWSGTCYLTPLIGAVLADTCWGRYWTIAAFSSIYFIGMCALTLSASIPA  139

Query  578   ISPT-CIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             + P  C+      AT    AV F  LYL+ALGTGGIKPCVSS+GADQFDDTD KER  K 
Sbjct  140   LKPAECVGSLCPPATPAQYAVFFFGLYLIALGTGGIKPCVSSFGADQFDDTDSKERVKKG  199

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GAL+++S +V+IQ +  WG GFG+PA+ M +A+  FFSGT LYR+Q+P
Sbjct  200   SFFNWFYFSINIGALISSSFLVYIQDNAGWGLGFGIPALFMGIAIASFFSGTPLYRFQRP  259

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QV+VAS  K  ++VP D SLL+ET    S I+GSRKL H++EL+  DKAAV
Sbjct  260   GGSPITRMCQVLVASFHKWNLEVPLDSSLLYETPDKHSAIEGSRKLEHSDELKCLDKAAV  319

Query  1115  VEESLDEDKKGSV-SPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAE  1291
             + E+  E K G   +PWRLCTVTQVEELK +IR+ PIWATGI+FS VY QM T F+ Q  
Sbjct  320   LSEA--EMKSGDFPNPWRLCTVTQVEELKILIRMFPIWATGIVFSAVYAQMSTMFVEQGM  377

Query  1292  GMNTYVGTFKXPXASL  1339
              M+T +G+F  P ASL
Sbjct  378   LMDTTIGSFTIPPASL  393



>ref|NP_001146682.1| hypothetical protein [Zea mays]
 gb|ACL54513.1| unknown [Zea mays]
 gb|ACL54519.1| unknown [Zea mays]
 tpg|DAA51061.1| TPA: hypothetical protein ZEAMMB73_156096 [Zea mays]
Length=587

 Score =   465 bits (1196),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 222/385 (58%), Positives = 278/385 (72%), Gaps = 5/385 (1%)
 Frame = +2

Query  197   MEQSKAMEEDD---VYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSN  367
             +EQ     E+    VYT DG++D+   P  K++TG WKACPFILGNEC ERLAYYG+S+N
Sbjct  12    LEQGLLDPEESNQVVYTGDGSVDFSGNPVVKERTGRWKACPFILGNECCERLAYYGISTN  71

Query  368   LMIYFQTRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMT  547
             L+ Y   +L+    SA+ +++ WSGTCY+ PL+GA LADAY GRYWTIATFS +Y +GMT
Sbjct  72    LVTYLTKKLHAGNASAASSVTTWSGTCYLTPLIGAILADAYWGRYWTIATFSTVYFIGMT  131

Query  548   LMTLSATVPGISPTCIAHDKCTATGR-DTAVCFIALYLVALGTGGIKPCVSSYGADQFDD  724
             L+TLSA+VP + P       C A       V F+ LYL+ALGTGGIKPCVSS+GADQFDD
Sbjct  132   LLTLSASVPMLMPPSCEGSFCPAASPFQYTVFFLGLYLIALGTGGIKPCVSSFGADQFDD  191

Query  725   TDEKERKHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFS  904
             TD  ER  K SFFNWFYFSIN+GAL+++S +VW+Q +V WG GFG+P V M LA+  FFS
Sbjct  192   TDPAERIQKGSFFNWFYFSINIGALISSSFLVWVQDNVGWGLGFGIPTVFMGLAIISFFS  251

Query  905   GTRLYRYQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTN  1084
             GT LYR+QKPGGSP TR+ QV+VASLRK  V VP D SLL+E     S I+GSR++ HT+
Sbjct  252   GTSLYRFQKPGGSPITRVCQVIVASLRKWNVPVPEDSSLLYELPNGVSTIEGSRQIEHTD  311

Query  1085  ELRFFDKAAVVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQM  1264
             ELR  DKAA V E +D       +PWR+CTVTQVEELK ++R+ P+WAT I+FS VY QM
Sbjct  312   ELRCLDKAATVTE-VDVKTADFNNPWRICTVTQVEELKILVRMFPVWATTIVFSAVYAQM  370

Query  1265  GTQFISQAEGMNTYVGTFKXPXASL  1339
              T F+ Q   ++  +G+FK P ASL
Sbjct  371   STMFVEQGMVLDPSLGSFKIPPASL  395



>gb|EMT00809.1| Peptide transporter PTR5 [Aegilops tauschii]
Length=612

 Score =   465 bits (1197),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 220/384 (57%), Positives = 281/384 (73%), Gaps = 4/384 (1%)
 Frame = +2

Query  197   MEQSKAMEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMI  376
             M +  A     +YT+DGT+D +   A K  TGNW+ACP+IL NEC ERLAYYGMS+NL  
Sbjct  1     MGEVGAESAGMIYTQDGTVDIKGNRAVKSNTGNWRACPYILANECCERLAYYGMSANLGN  60

Query  377   YFQTRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMT  556
             +    +  + T+A+ +++NW GTCY   L+GAFLADAYLGR+WTIA+F  IY++G+ L+T
Sbjct  61    FMLDNMGMNNTTAANSVTNWGGTCYATTLIGAFLADAYLGRFWTIASFVTIYIIGLGLLT  120

Query  557   LSATVPGISPTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEK  736
             ++A+V  + PTC A   C  T   TA  F+ LYLVALGTGGIKPCVSS+GADQFD+ D+ 
Sbjct  121   VAASVKALVPTCAAKGVCDPTAGQTAAVFVGLYLVALGTGGIKPCVSSFGADQFDENDDG  180

Query  737   ERKHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRL  916
             ER+ KSSFFNWFY SIN+GALVA+S++V++Q+   WGWGFG+PAV MA+AV  FF GT L
Sbjct  181   ERRSKSSFFNWFYLSINIGALVASSVMVYVQEHYGWGWGFGIPAVVMAIAVGSFFVGTPL  240

Query  917   YRYQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRF  1096
             YR+Q+PGGSP TR+ QV+VA+    K+ VP D S L+ET+  ES I+GSRKL HT + RF
Sbjct  241   YRHQRPGGSPLTRIAQVLVAA--TYKLSVPDDGSALYETMDKESGIKGSRKLEHTEQFRF  298

Query  1097  FDKAAVVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQF  1276
              DKAA VE   D+      SPWRLCTVTQVEELKS++RLLPIWA+GI+F+ VYGQM T F
Sbjct  299   LDKAA-VETQADKSSVSPASPWRLCTVTQVEELKSVVRLLPIWASGIVFAAVYGQMSTMF  357

Query  1277  ISQAEGMNTYVGT-FKXPXASLGV  1345
             + Q   ++  +G  F  P ASL V
Sbjct  358   VFQGNTLDKRMGAHFSIPSASLSV  381



>ref|XP_008389126.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3-like, partial [Malus 
domestica]
Length=611

 Score =   465 bits (1197),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 220/376 (59%), Positives = 279/376 (74%), Gaps = 4/376 (1%)
 Frame = +2

Query  218   EEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  397
             E D +YT DG++D +     K+ TGNW+ACPFILG EC ERLAYYG+++NL+ Y   +L+
Sbjct  46    EGDGLYTGDGSVDIKGNRVLKQNTGNWRACPFILGTECCERLAYYGIATNLVTYLTNKLH  105

Query  398   QSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPG  577
             +   SA++N++ WSGTCY+ PL+GA LADAY GRYWTIA FS IY +GM  +TLSA+VP 
Sbjct  106   EGNVSAARNVTTWSGTCYLTPLIGAVLADAYWGRYWTIAVFSTIYFIGMGTLTLSASVPA  165

Query  578   ISPTCIAHDKC-TATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             + P       C +A+    AV F+ LYL+ALGTGGIKPCVS +GADQFDDTD+ ER  K 
Sbjct  166   LKPPECVDSVCPSASPAQYAVFFVGLYLIALGTGGIKPCVSPFGADQFDDTDKTERVKKG  225

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GAL+++SL+VW+Q +  WG GFG+P + M +A+  FFSGT LYR+QKP
Sbjct  226   SFFNWFYFSINIGALISSSLLVWVQDNAGWGLGFGIPTLFMGIAIFSFFSGTPLYRFQKP  285

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QV+VAS RK  + VP D SLL+ET   +S I+GSRKL H++EL   DKAAV
Sbjct  286   GGSPVTRMCQVLVASFRKWNLDVPKDSSLLYETPDKDSAIKGSRKLEHSDELTCLDKAAV  345

Query  1115  VEESLDEDKKGSVS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAE  1291
             + E+  E K G  S PWR+CTVTQVEELK +IR+ PIWATGI+FS VY QM T F+ Q  
Sbjct  346   ISET--ETKXGDFSNPWRVCTVTQVEELKILIRMFPIWATGIVFSAVYAQMSTMFVEQGT  403

Query  1292  GMNTYVGTFKXPXASL  1339
              M+T +G+F  P ASL
Sbjct  404   MMDTSIGSFTIPPASL  419



>gb|EYU30228.1| hypothetical protein MIMGU_mgv1a003438mg [Erythranthe guttata]
Length=585

 Score =   464 bits (1195),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 221/376 (59%), Positives = 275/376 (73%), Gaps = 4/376 (1%)
 Frame = +2

Query  218   EEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  397
             E + +YT DG++D +  P  K  TGNW+ACPFILG EC ERLAYYG+++NL+ Y   +LN
Sbjct  20    ESNGLYTGDGSVDIKGNPVLKSNTGNWRACPFILGTECCERLAYYGIATNLVSYLTKKLN  79

Query  398   QSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPG  577
             Q   SA++N++ W GTCY+ PL+GA LADAY GRYWTIA FS +Y +GM  +TLSAT+P 
Sbjct  80    QGNVSAARNVTTWQGTCYLTPLIGAVLADAYWGRYWTIAAFSTLYFIGMGTLTLSATIPI  139

Query  578   ISP-TCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
               P  CI     +AT    AV F  LYL+ALGTGGIKPCVSS+GADQFDDTD  ER  K 
Sbjct  140   FKPPECIDSVCPSATPAQYAVFFFGLYLIALGTGGIKPCVSSFGADQFDDTDSAERVKKG  199

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GALV++SLIVWIQ +  WG GFG+PA+ M +A+  FFSGT LYR+QKP
Sbjct  200   SFFNWFYFSINIGALVSSSLIVWIQDNAGWGLGFGIPALFMGIAIASFFSGTPLYRFQKP  259

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QV+VAS RK  + +P+D +LL+ET    S I+GSRKL HT+EL+  D+AA+
Sbjct  260   GGSPLTRMCQVLVASCRKWNLAIPNDSTLLYETQDKSSAIEGSRKLLHTDELQCLDRAAI  319

Query  1115  VEESLDEDKKGSVS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAE  1291
             + +   E K G  S PW+LCTVTQ+EELK +IR+ PIWATGI+FS VY QM T F+ Q  
Sbjct  320   ISD--HETKTGDYSNPWKLCTVTQIEELKILIRMFPIWATGIVFSAVYAQMSTMFVEQGM  377

Query  1292  GMNTYVGTFKXPXASL  1339
              M+T  G    P ASL
Sbjct  378   VMDTSAGPITIPAASL  393



>ref|XP_010680056.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3-like [Beta vulgaris subsp. 
vulgaris]
Length=583

 Score =   464 bits (1194),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 221/384 (58%), Positives = 279/384 (73%), Gaps = 4/384 (1%)
 Frame = +2

Query  194   MMEQSKAMEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLM  373
             ++E        + YT DG++D +     K KTGNW+ACPFILG EC ERLAYYG+++NL+
Sbjct  10    LLEDGHLQGNGEQYTGDGSVDLQGNRVLKSKTGNWRACPFILGTECCERLAYYGIATNLV  69

Query  374   IYFQTRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLM  553
              Y   +L++   SA++N++ WSGTCY+ PL+GA LADAY GRYWTIA FS IY +GM  +
Sbjct  70    SYLTGKLHEGNVSAARNVTTWSGTCYLTPLLGAVLADAYWGRYWTIAVFSTIYFIGMCTL  129

Query  554   TLSATVPGISPT-CIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTD  730
             TLSA+VP   P  C+      AT     V F+ LYL+ALGTGGIKPCVSS+GADQFDDTD
Sbjct  130   TLSASVPAFKPPECVDSFCPAATPPQYGVFFLGLYLIALGTGGIKPCVSSFGADQFDDTD  189

Query  731   EKERKHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGT  910
               ER  K SFFNWFYFSIN+GA V+++LIVW+Q++  WG GFG+PA+ M +A+  FFSGT
Sbjct  190   PSERVKKGSFFNWFYFSINIGAFVSSTLIVWMQENAGWGIGFGIPALFMGIAIASFFSGT  249

Query  911   RLYRYQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNEL  1090
              LYR+Q+PGGSP TR+ QVV+AS RK K+ VP D SLL+ET    S I+GSRKL HT+EL
Sbjct  250   PLYRFQRPGGSPLTRMGQVVIASFRKCKLDVPQDSSLLYETPDKHSAIEGSRKLEHTDEL  309

Query  1091  RFFDKAAVVEESLDEDKKGSVS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMG  1267
             +  DKAAVV ++  + K G  S PWRLCTVTQVEELK +IR+ PIWATGI+F+ VY QM 
Sbjct  310   KCLDKAAVVSDA--DMKSGDFSNPWRLCTVTQVEELKILIRMFPIWATGIVFAAVYAQMS  367

Query  1268  TQFISQAEGMNTYVGTFKXPXASL  1339
             T F+ Q   M+  +G+F  P ASL
Sbjct  368   TMFVEQGTVMDRRIGSFTIPAASL  391



>gb|ACL52627.1| unknown [Zea mays]
Length=587

 Score =   463 bits (1191),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 221/385 (57%), Positives = 278/385 (72%), Gaps = 5/385 (1%)
 Frame = +2

Query  197   MEQSKAMEEDD---VYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSN  367
             +EQ     E+    VYT DG++D+   P  K++TG WKACPFILGNEC E+LAYYG+S+N
Sbjct  12    LEQGLLDPEESNQVVYTGDGSVDFSGNPVVKERTGRWKACPFILGNECCEQLAYYGISTN  71

Query  368   LMIYFQTRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMT  547
             L+ Y   +L+    SA+ +++ WSGTCY+ PL+GA LADAY GRYWTIATFS +Y +GMT
Sbjct  72    LVTYLTKKLHAGNASAASSVTTWSGTCYLTPLIGAILADAYWGRYWTIATFSTVYFIGMT  131

Query  548   LMTLSATVPGISPTCIAHDKCTATGR-DTAVCFIALYLVALGTGGIKPCVSSYGADQFDD  724
             L+TLSA+VP + P       C A       V F+ LYL+ALGTGGIKPCVSS+GADQFDD
Sbjct  132   LLTLSASVPMLMPPSCEGSFCPAASPFQYTVFFLGLYLIALGTGGIKPCVSSFGADQFDD  191

Query  725   TDEKERKHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFS  904
             TD  ER  K SFFNWFYFSIN+GAL+++S +VW+Q +V WG GFG+P V M LA+  FFS
Sbjct  192   TDPAERIQKGSFFNWFYFSINIGALISSSFLVWVQDNVGWGLGFGIPTVFMGLAIISFFS  251

Query  905   GTRLYRYQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTN  1084
             GT LYR+QKPGGSP TR+ QV+VASLRK  V VP D SLL+E     S I+GSR++ HT+
Sbjct  252   GTSLYRFQKPGGSPITRVCQVIVASLRKWNVPVPEDSSLLYELPNGVSTIEGSRQIEHTD  311

Query  1085  ELRFFDKAAVVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQM  1264
             ELR  DKAA V E +D       +PWR+CTVTQVEELK ++R+ P+WAT I+FS VY QM
Sbjct  312   ELRCLDKAATVTE-VDVKTADFNNPWRICTVTQVEELKILVRMFPVWATTIVFSAVYAQM  370

Query  1265  GTQFISQAEGMNTYVGTFKXPXASL  1339
              T F+ Q   ++  +G+FK P ASL
Sbjct  371   STMFVEQGMVLDPSLGSFKIPPASL  395



>ref|XP_010937011.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3-like [Elaeis guineensis]
Length=587

 Score =   463 bits (1191),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 218/380 (57%), Positives = 274/380 (72%), Gaps = 2/380 (1%)
 Frame = +2

Query  206   SKAMEEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQ  385
             S+    +  YT DG++D    P  K  TGNW+ACPFILG EC ERLAYYG+++NL+ Y  
Sbjct  18    SEENRNNGPYTGDGSVDIHGHPVVKNGTGNWRACPFILGTECCERLAYYGIATNLVTYLT  77

Query  386   TRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSA  565
              +L++   SA++N++ W GTCYI PL+GA LADAY GRYWTIA FS IY +GM  +TLSA
Sbjct  78    GKLHEGNVSAARNVTTWQGTCYITPLIGAILADAYWGRYWTIAVFSTIYFIGMGTLTLSA  137

Query  566   TVPGISPTCIAHDKC-TATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKER  742
             +VPG  P+      C  A     A+ F+ LYL+ALGTGGIKPCVSS+GADQFDDTD  ER
Sbjct  138   SVPGFRPSSCVKSVCPEANPAQYAIFFLGLYLIALGTGGIKPCVSSFGADQFDDTDSAER  197

Query  743   KHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYR  922
               K SFFNWFYFS+N+GAL+++S +VW+Q +  WG GFG+P + MALA+  FFSGT LYR
Sbjct  198   VKKGSFFNWFYFSVNIGALISSSFLVWVQDNYGWGLGFGIPTLFMALAIISFFSGTTLYR  257

Query  923   YQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFD  1102
             +QKPGGSP TR+ QV VASLRK K+ VP D SLL+E     S I+GSRKL HT+EL+F D
Sbjct  258   FQKPGGSPITRVCQVAVASLRKWKLDVPYDSSLLYELPEKTSAIEGSRKLEHTDELKFLD  317

Query  1103  KAAVVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFIS  1282
             KAA V + LD   +   +PWRLCTVTQVEELK ++R+ PIWAT I+FS VY Q+ T F+ 
Sbjct  318   KAATVSD-LDLKTESFSNPWRLCTVTQVEELKILVRMFPIWATTIVFSAVYAQISTMFVE  376

Query  1283  QAEGMNTYVGTFKXPXASLG  1342
             Q   ++T +G+F  P ASL 
Sbjct  377   QGMVLDTTIGSFTIPPASLA  396



>ref|XP_002315835.1| Peptide transporter PTR2-B family protein [Populus trichocarpa]
 gb|EEF02006.1| Peptide transporter PTR2-B family protein [Populus trichocarpa]
Length=584

 Score =   462 bits (1190),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 220/376 (59%), Positives = 278/376 (74%), Gaps = 4/376 (1%)
 Frame = +2

Query  218   EEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  397
             E + +YT DG++D    P  K+KTGNWKACPFILG EC ERLAYYG+++NL+ Y   +L+
Sbjct  20    ESNGLYTGDGSVDINGNPVLKQKTGNWKACPFILGTECCERLAYYGIATNLVTYLTKKLH  79

Query  398   QSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPG  577
             +   SA++N++ WSGTCY+ PL+GA LAD   GRYWTIA FS IY +GM  +TLSA++P 
Sbjct  80    EGNVSAARNVTTWSGTCYLTPLIGAVLADTCWGRYWTIAAFSSIYFIGMCALTLSASIPA  139

Query  578   ISPT-CIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             + P  C+      AT    AV F  LYL+ALGTGGIKPCVSS+GADQFDDTD KER  K 
Sbjct  140   LKPAECVGSLCPPATPAQYAVFFFGLYLIALGTGGIKPCVSSFGADQFDDTDPKERVKKG  199

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GAL+++S +V+IQ +  WG GFG+PA+ M +A+  FFSGT LYR+Q+P
Sbjct  200   SFFNWFYFSINIGALISSSFLVYIQDNAGWGLGFGIPALFMGIAIASFFSGTPLYRFQRP  259

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QV+VAS  K  ++VP D SLL+ET    S I+GSRKL H++EL+  DKAAV
Sbjct  260   GGSPITRMCQVLVASFHKWNLEVPLDSSLLYETQDKHSAIEGSRKLVHSDELKCLDKAAV  319

Query  1115  VEESLDEDKKGSV-SPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAE  1291
             + E+  E K G   +PWRLCTVTQVEELK +IR+ PIWATGI+FS VY QM T F+ Q  
Sbjct  320   LSEA--EMKSGDFPNPWRLCTVTQVEELKILIRMFPIWATGIVFSAVYAQMSTMFVEQGM  377

Query  1292  GMNTYVGTFKXPXASL  1339
              M+T +G+F  P ASL
Sbjct  378   LMDTTIGSFTIPPASL  393



>ref|XP_004981956.1| PREDICTED: peptide transporter PTR2-like [Setaria italica]
Length=588

 Score =   462 bits (1190),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 221/395 (56%), Positives = 282/395 (71%), Gaps = 11/395 (3%)
 Frame = +2

Query  185   GLQMMEQSKAMEE---------DDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSE  337
             G +  E++ A+E+           +YT DG++D++  P  K++TG WKACPFILGNEC E
Sbjct  3     GAECGEEAAALEQGLLAPEEPNQLIYTGDGSVDFKGNPVVKERTGRWKACPFILGNECCE  62

Query  338   RLAYYGMSSNLMIYFQTRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIAT  517
             RLAYYG+S+NL+ Y   +L+    SA+ N++ W GTCY+ PL+GA LADAY GRYWTIAT
Sbjct  63    RLAYYGISTNLVTYLTKKLHDGNASAASNVTTWQGTCYLTPLIGAILADAYWGRYWTIAT  122

Query  518   FSIIYVMGMTLMTLSATVPGISPTCIAHDKCT-ATGRDTAVCFIALYLVALGTGGIKPCV  694
             FS IY +GM ++TLSA+VP + P       C  A+     V F+ LYL+ALGTGGIKPCV
Sbjct  123   FSTIYFIGMGILTLSASVPMLMPPSCEGSICPPASPLQYTVFFLGLYLIALGTGGIKPCV  182

Query  695   SSYGADQFDDTDEKERKHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVA  874
             SS+GADQFDDTD  ER  K SFFNWFYFSIN+GAL+++S +VW+Q +V WG GFG+P V 
Sbjct  183   SSFGADQFDDTDPAERIQKGSFFNWFYFSINIGALISSSFLVWVQDNVGWGLGFGIPTVF  242

Query  875   MALAVTFFFSGTRLYRYQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNI  1054
             M LA+  FFSGT +YR+QKPGGSP TR+ QVVVASLRK  V VP D SLL+E     S I
Sbjct  243   MGLAIISFFSGTSIYRFQKPGGSPITRVCQVVVASLRKWNVHVPEDSSLLYELPDGVSAI  302

Query  1055  QGSRKLSHTNELRFFDKAAVVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATG  1234
             +GSR+L HT+ELR  DKAA + + +D       +PWR+CTVTQVEELK ++R+ PIWAT 
Sbjct  303   EGSRQLEHTDELRCLDKAATITD-VDVKTADLTNPWRICTVTQVEELKILLRMFPIWATT  361

Query  1235  IIFSTVYGQMGTQFISQAEGMNTYVGTFKXPXASL  1339
             I+FS VY QM T F+ Q   ++  +G+FK P ASL
Sbjct  362   IVFSAVYAQMSTMFVEQGMVLDPSLGSFKVPPASL  396



>ref|XP_010276263.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3-like [Nelumbo nucifera]
 ref|XP_010276264.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3-like [Nelumbo nucifera]
Length=585

 Score =   462 bits (1189),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 222/370 (60%), Positives = 269/370 (73%), Gaps = 2/370 (1%)
 Frame = +2

Query  233   YTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQSTTS  412
             YT DG++D    P  K  TGNW+ACPFILG EC ERLAYYG+++NL+ Y   +L++   S
Sbjct  25    YTGDGSVDINGNPVLKHNTGNWRACPFILGTECCERLAYYGIATNLVTYLTNKLHEGNAS  84

Query  413   ASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPGISP-T  589
             A++N++ W GTCY+ PL+GA LADAY GRYWTIA FS IY +GM  +TLSA+VP   P  
Sbjct  85    AARNVTTWQGTCYLAPLIGAVLADAYWGRYWTIAVFSTIYFIGMGTLTLSASVPVFKPPA  144

Query  590   CIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSFFNW  769
             C+      AT    AV F  LYL+ALGTGGIKPCVSS+GADQFDDTD +ER  K SFFNW
Sbjct  145   CVGSICPAATPAQYAVFFFGLYLIALGTGGIKPCVSSFGADQFDDTDTRERVKKGSFFNW  204

Query  770   FYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKPGGSPF  949
             FYFSIN+GALV++S +VWIQ +  WG GFG+P + M LA+  FFSGT LYR+QKPGGSP 
Sbjct  205   FYFSINIGALVSSSFLVWIQDNAGWGLGFGIPTLFMGLAIISFFSGTPLYRFQKPGGSPI  264

Query  950   TRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAVVEESL  1129
             TR+ QVVVASLRK  VKVP D SLL+E     S I GSRKL H+NEL+  DKA+VV +  
Sbjct  265   TRMCQVVVASLRKWNVKVPHDSSLLYELPDKTSAIAGSRKLEHSNELKCLDKASVVTDHE  324

Query  1130  DEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEGMNTYV  1309
              E    S + W+LCTVTQVEELK +IR+ PIWATGI+FS VY QM T F+ Q   M+T +
Sbjct  325   SESDDFS-NRWKLCTVTQVEELKILIRMFPIWATGIVFSAVYAQMSTMFVEQGMVMDTSI  383

Query  1310  GTFKXPXASL  1339
             G+F  P ASL
Sbjct  384   GSFTIPPASL  393



>gb|KJB77820.1| hypothetical protein B456_012G159200 [Gossypium raimondii]
Length=573

 Score =   462 bits (1188),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 217/374 (58%), Positives = 275/374 (74%), Gaps = 4/374 (1%)
 Frame = +2

Query  218   EEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  397
             E   +YT DG++D+   P  K+ TGNWKAC FILGNEC ERLAYYG+++NL+ Y   +L+
Sbjct  19    ENSGLYTGDGSVDFNGNPVLKQNTGNWKACLFILGNECCERLAYYGIATNLVSYLTKKLH  78

Query  398   QSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPG  577
             +   +A++N++ W GTCY+ PL+GA LADAY GRYWTIA FS IY +GM  +TLSA++P 
Sbjct  79    EGNATAARNVTTWQGTCYVTPLIGAVLADAYWGRYWTIAAFSTIYFIGMCTLTLSASIPA  138

Query  578   ISPT-CIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
             + P  C+     +AT     V F  LYL+ALGTGGIKPCVSS+GADQFDDTD KER  K 
Sbjct  139   LKPAECVGSICPSATPAQYVVFFFGLYLIALGTGGIKPCVSSFGADQFDDTDPKERVKKG  198

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GAL+++SL+VWIQ +  WG GFG+ A+ M LA+  FFSGT LYR+Q+P
Sbjct  199   SFFNWFYFSINIGALISSSLLVWIQDNAGWGLGFGISALFMGLAIGSFFSGTSLYRFQRP  258

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP TR+ QV+VA+  KR +KVP D SLL+ET    S I+GSRKL H+ EL+  D AA+
Sbjct  259   GGSPITRMCQVMVAAFHKRNLKVPEDSSLLYETGDNHSAIEGSRKLEHSEELKCLDNAAI  318

Query  1115  VEESLDEDKKGSVS-PWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAE  1291
             V ++  + K G  S PWRLCTVTQVEELK +IR+ PIWATGI+FS VY QM T F+ Q  
Sbjct  319   VIDA--KTKSGDFSNPWRLCTVTQVEELKILIRMFPIWATGIVFSAVYAQMSTMFVEQGM  376

Query  1292  GMNTYVGTFKXPXA  1333
              M+T +G+F  P A
Sbjct  377   MMDTKIGSFTIPPA  390



>ref|XP_009419340.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3-like [Musa acuminata 
subsp. malaccensis]
Length=586

 Score =   462 bits (1189),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 215/375 (57%), Positives = 270/375 (72%), Gaps = 2/375 (1%)
 Frame = +2

Query  218   EEDDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLN  397
             E    YT DG++D    P  K  TGNW+ACPFILGNEC ERLAYYG+++NL+ Y + +L+
Sbjct  21    ENQGQYTGDGSVDIHGNPVLKNSTGNWRACPFILGNECCERLAYYGIATNLVTYLKNKLH  80

Query  398   QSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPG  577
             +   SA++N++ W GTCYI PL+GA LADAY GRYWTIA FS IY +GM  +TLSA+VP 
Sbjct  81    EGNASAARNVTTWQGTCYITPLLGAILADAYWGRYWTIAVFSTIYFVGMATLTLSASVPA  140

Query  578   ISPTCIAHDKC-TATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKS  754
               P+      C  A+    A+ F  LYL+ALGTGGIKPCVSS+GADQFDDTD +ER  K 
Sbjct  141   FKPSPCVESVCPEASAVQYAIFFFGLYLIALGTGGIKPCVSSFGADQFDDTDPRERMKKG  200

Query  755   SFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKP  934
             SFFNWFYFSIN+GAL+++S +VW+Q +  WG GFG+P + M LA+  FF GT LYR+QKP
Sbjct  201   SFFNWFYFSINIGALISSSFLVWVQDNCGWGLGFGIPTLFMGLAIISFFFGTPLYRFQKP  260

Query  935   GGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAV  1114
             GGSP  R+ QVVVAS RK KV VP D  LL+E     S I+GSRKL HT+E++F DKAA 
Sbjct  261   GGSPLIRMCQVVVASFRKWKVDVPHDSCLLYEVPEKASAIKGSRKLEHTDEIKFLDKAAT  320

Query  1115  VEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEG  1294
             V + LD   +   +PWRLCTVTQVEELK ++R+ P+WAT I+FS VY Q+ T F+ Q   
Sbjct  321   VTD-LDTKTESFSNPWRLCTVTQVEELKILVRMFPVWATTIVFSAVYAQISTMFVEQGMV  379

Query  1295  MNTYVGTFKXPXASL  1339
             M+T +G+F  P ASL
Sbjct  380   MDTSIGSFTIPPASL  394



>ref|XP_002463973.1| hypothetical protein SORBIDRAFT_01g009900 [Sorghum bicolor]
 gb|EER90971.1| hypothetical protein SORBIDRAFT_01g009900 [Sorghum bicolor]
Length=587

 Score =   461 bits (1186),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 220/388 (57%), Positives = 278/388 (72%), Gaps = 4/388 (1%)
 Frame = +2

Query  185   GLQMMEQSKAMEEDD--VYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGM  358
              + + E   A EE +  VYT DG++D+   P  K+ TG WKACPFILGNEC ERLAYYG+
Sbjct  9     AVALEEGLLAPEESNQVVYTGDGSVDFSGNPVVKETTGRWKACPFILGNECCERLAYYGI  68

Query  359   SSNLMIYFQTRLNQSTTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVM  538
             S+NL+ Y   +L+    SA+ N++ W GTCY+ PL+GA LADAY GRYWTIATFS +Y +
Sbjct  69    STNLVTYLTKKLHAGNASAASNVTTWQGTCYLTPLIGAILADAYWGRYWTIATFSTVYFI  128

Query  539   GMTLMTLSATVPGISPTCIAHDKCT-ATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQ  715
             GM+++TLSA+VP + P       C  A+     V F+ LYL+ALGTGGIKPCVSS+GADQ
Sbjct  129   GMSILTLSASVPMLMPPSCEGSFCPQASPFQYTVFFLGLYLIALGTGGIKPCVSSFGADQ  188

Query  716   FDDTDEKERKHKSSFFNWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTF  895
             FDDTD  ER  K SFFNWFYFSIN+GAL+++S +VW+Q +V WG GFG+P V M LA+  
Sbjct  189   FDDTDPAERIQKGSFFNWFYFSINIGALISSSFLVWVQDNVGWGLGFGIPTVFMGLAIIS  248

Query  896   FFSGTRLYRYQKPGGSPFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLS  1075
             FFSGT LYR+QKPGGSP TR+ QV+VASLRK  V  P D SLL+E     S I+GSR++ 
Sbjct  249   FFSGTSLYRFQKPGGSPITRVCQVIVASLRKWNVPAPEDSSLLYELPNGVSTIEGSRQIE  308

Query  1076  HTNELRFFDKAAVVEESLDEDKKGSVSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVY  1255
             HT+ELR  DKAA V E +D       +PWR+CTVTQVEELK ++R+ P+WAT I+FS VY
Sbjct  309   HTDELRCLDKAATVTE-VDVKMADFSNPWRICTVTQVEELKILVRMFPVWATTIVFSAVY  367

Query  1256  GQMGTQFISQAEGMNTYVGTFKXPXASL  1339
              QM T F+ Q   ++  +G+FK P ASL
Sbjct  368   AQMSTMFVEQGMVLDPSLGSFKIPPASL  395



>ref|XP_001769410.1| predicted protein [Physcomitrella patens]
 gb|EDQ65779.1| predicted protein [Physcomitrella patens]
Length=591

 Score =   461 bits (1185),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 216/375 (58%), Positives = 279/375 (74%), Gaps = 5/375 (1%)
 Frame = +2

Query  224   DDVYTKDGTLDYRNRPANKKKTGNWKACPFILGNECSERLAYYGMSSNLMIYFQTRLNQS  403
             D  Y +DGT+D R  P  K  TG WKACP+ILGNEC ERLAYYG+++NL+ Y    L+Q+
Sbjct  9     DSEYPQDGTVDLRGNPVLKANTGGWKACPYILGNECCERLAYYGIATNLVTYLSHELHQN  68

Query  404   TTSASKNLSNWSGTCYIMPLVGAFLADAYLGRYWTIATFSIIYVMGMTLMTLSATVPGIS  583
              ++A+ N++NWSGTCYI  L+GAFLADAYLGR+WTI  FSIIY +GM L+TLSA +P + 
Sbjct  69    PSTAANNVTNWSGTCYITTLIGAFLADAYLGRFWTIVVFSIIYFLGMVLLTLSAALPSLK  128

Query  584   PTCIAHDKCTATGRDTAVCFIALYLVALGTGGIKPCVSSYGADQFDDTDEKERKHKSSFF  763
             P   + +   A+    AV ++ALYL+ALGTGGIKPCVSS+GADQFD+ D KE+K KSSFF
Sbjct  129   PP--SGEGVVASSTQLAVFYLALYLIALGTGGIKPCVSSFGADQFDENDVKEKKRKSSFF  186

Query  764   NWFYFSINVGALVAASLIVWIQQDVSWGWGFGVPAVAMALAVTFFFSGTRLYRYQKPGGS  943
             NWFYF+IN+GAL+A+S +V+IQ++V WGWGFG+PAVAM +A+  F  G+ LYR+QKPGGS
Sbjct  187   NWFYFTINIGALIASSALVYIQENVGWGWGFGIPAVAMGIAIVSFLIGSPLYRHQKPGGS  246

Query  944   PFTRLFQVVVASLRKRKVKVPSDKSLLHETVGLESNIQGSRKLSHTNELRFFDKAAVVEE  1123
             P TR+ QV+VA+ RK  +KV  +   L+E    ES I+GSRKL HT E RF DKAA+   
Sbjct  247   PITRIAQVLVAATRKLSMKVQPNGKHLYEADDKESGIEGSRKLEHTEEFRFLDKAAIPRG  306

Query  1124  SLDEDKKGS-VSPWRLCTVTQVEELKSIIRLLPIWATGIIFSTVYGQMGTQFISQAEGMN  1300
               DE+ +G+  S WRL +VTQVEE+K ++RLLPIWA+GI+F+TVY QM T F+ Q   MN
Sbjct  307   --DEELQGTRPSGWRLTSVTQVEEVKIVMRLLPIWASGIVFATVYSQMSTMFVQQGALMN  364

Query  1301  TYVGTFKXPXASLGV  1345
               +G    P ASL +
Sbjct  365   VSMGKANIPSASLSI  379



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3954485672510