BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig2152

Length=887
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP08805.1|  unnamed protein product                                386   2e-127   Coffea canephora [robusta coffee]
ref|XP_009784968.1|  PREDICTED: signal peptide peptidase-like 4         384   7e-127   Nicotiana sylvestris
ref|XP_006339580.1|  PREDICTED: signal peptide peptidase-like 4-l...    384   1e-126   Solanum tuberosum [potatoes]
ref|XP_011093137.1|  PREDICTED: signal peptide peptidase-like 4         383   3e-126   Sesamum indicum [beniseed]
ref|XP_011092478.1|  PREDICTED: signal peptide peptidase-like 4 i...    380   3e-125   Sesamum indicum [beniseed]
ref|XP_004229902.2|  PREDICTED: signal peptide peptidase-like 4         381   8e-125   Solanum lycopersicum
ref|XP_009629841.1|  PREDICTED: signal peptide peptidase-like 4         376   1e-123   Nicotiana tomentosiformis
gb|KDO86182.1|  hypothetical protein CISIN_1g009437mg                   359   9e-120   Citrus sinensis [apfelsine]
gb|AET02050.2|  signal peptide peptidase-like protein                   366   1e-119   Medicago truncatula
ref|XP_003627574.1|  Signal peptide peptidase-like 2B                   367   1e-119   
ref|XP_003552398.1|  PREDICTED: signal peptide peptidase-like 4-like    364   5e-119   Glycine max [soybeans]
gb|KHM99370.1|  Signal peptide peptidase-like 2B                        364   6e-119   Glycine soja [wild soybean]
ref|XP_004510782.1|  PREDICTED: signal peptide peptidase-like 4-l...    363   1e-118   Cicer arietinum [garbanzo]
ref|XP_003521881.1|  PREDICTED: signal peptide peptidase-like 4-like    363   1e-118   Glycine max [soybeans]
gb|KHN42194.1|  Signal peptide peptidase-like 2B                        363   1e-118   Glycine soja [wild soybean]
ref|XP_003534560.1|  PREDICTED: signal peptide peptidase-like 4-like    363   2e-118   Glycine max [soybeans]
ref|XP_007135086.1|  hypothetical protein PHAVU_010G099500g             363   2e-118   Phaseolus vulgaris [French bean]
ref|XP_007139835.1|  hypothetical protein PHAVU_008G062100g             362   3e-118   Phaseolus vulgaris [French bean]
ref|XP_009781592.1|  PREDICTED: signal peptide peptidase-like 4 i...    362   3e-118   Nicotiana sylvestris
ref|XP_003528851.1|  PREDICTED: signal peptide peptidase-like 4-like    362   3e-118   Glycine max [soybeans]
ref|XP_011023314.1|  PREDICTED: signal peptide peptidase-like 4         362   5e-118   Populus euphratica
gb|KDO86181.1|  hypothetical protein CISIN_1g009437mg                   358   7e-118   Citrus sinensis [apfelsine]
ref|XP_009592078.1|  PREDICTED: signal peptide peptidase-like 4 i...    360   2e-117   Nicotiana tomentosiformis
ref|XP_006445026.1|  hypothetical protein CICLE_v10019661mg             358   3e-117   
ref|XP_006364152.1|  PREDICTED: signal peptide peptidase-like 4-like    359   6e-117   Solanum tuberosum [potatoes]
gb|KDO86179.1|  hypothetical protein CISIN_1g009437mg                   358   1e-116   Citrus sinensis [apfelsine]
ref|XP_006445025.1|  hypothetical protein CICLE_v10019661mg             358   1e-116   Citrus clementina [clementine]
gb|KEH23365.1|  signal peptide peptidase-like protein                   353   2e-116   Medicago truncatula
gb|KJB41346.1|  hypothetical protein B456_007G099700                    352   3e-116   Gossypium raimondii
ref|XP_004248045.1|  PREDICTED: signal peptide peptidase-like 4 i...    356   8e-116   Solanum lycopersicum
ref|XP_004492745.1|  PREDICTED: signal peptide peptidase-like 4-like    356   1e-115   Cicer arietinum [garbanzo]
gb|KEH23366.1|  signal peptide peptidase-like protein                   352   4e-115   Medicago truncatula
ref|XP_006375344.1|  hypothetical protein POPTR_0014s08110g             353   6e-115   
gb|KHG08704.1|  Signal peptide peptidase-like 2B                        351   7e-115   Gossypium arboreum [tree cotton]
ref|XP_011036451.1|  PREDICTED: signal peptide peptidase-like 4         353   1e-114   Populus euphratica
gb|KJB41342.1|  hypothetical protein B456_007G099700                    350   2e-114   Gossypium raimondii
ref|XP_006375345.1|  hypothetical protein POPTR_0014s08110g             352   4e-114   Populus trichocarpa [western balsam poplar]
gb|KJB41345.1|  hypothetical protein B456_007G099700                    350   4e-114   Gossypium raimondii
ref|XP_003623971.1|  Signal peptide peptidase-like 2B                   351   1e-113   Medicago truncatula
gb|KJB41338.1|  hypothetical protein B456_007G099700                    351   1e-113   Gossypium raimondii
gb|KJB41343.1|  hypothetical protein B456_007G099700                    350   1e-113   Gossypium raimondii
ref|XP_010544387.1|  PREDICTED: signal peptide peptidase-like 4         349   3e-113   Tarenaya hassleriana [spider flower]
gb|EYU32129.1|  hypothetical protein MIMGU_mgv1a004245mg                348   6e-113   Erythranthe guttata [common monkey flower]
ref|XP_008458226.1|  PREDICTED: signal peptide peptidase-like 4         347   2e-112   Cucumis melo [Oriental melon]
ref|XP_004138500.1|  PREDICTED: signal peptide peptidase-like 4         346   5e-112   Cucumis sativus [cucumbers]
gb|EPS63416.1|  hypothetical protein M569_11364                         343   7e-112   Genlisea aurea
ref|XP_007051789.1|  Signal peptide peptidase-like 4                    344   3e-111   Theobroma cacao [chocolate]
ref|XP_010255329.1|  PREDICTED: signal peptide peptidase-like 4         344   4e-111   Nelumbo nucifera [Indian lotus]
emb|CDY38021.1|  BnaCnng08820D                                          343   9e-111   Brassica napus [oilseed rape]
ref|XP_010087957.1|  Signal peptide peptidase-like 2B                   341   1e-110   
gb|KHG19371.1|  Signal peptide peptidase-like 2B                        342   1e-110   Gossypium arboreum [tree cotton]
ref|XP_002274726.1|  PREDICTED: signal peptide peptidase-like 4         342   2e-110   Vitis vinifera
ref|XP_006418441.1|  hypothetical protein EUTSA_v10007312mg             341   5e-110   Eutrema salsugineum [saltwater cress]
ref|XP_009367843.1|  PREDICTED: signal peptide peptidase-like 4 i...    340   8e-110   Pyrus x bretschneideri [bai li]
gb|KHG15007.1|  Signal peptide peptidase-like 2B                        341   1e-109   Gossypium arboreum [tree cotton]
ref|XP_009367844.1|  PREDICTED: signal peptide peptidase-like 4 i...    340   1e-109   Pyrus x bretschneideri [bai li]
ref|XP_010474771.1|  PREDICTED: signal peptide peptidase-like 4         340   1e-109   Camelina sativa [gold-of-pleasure]
ref|XP_009118826.1|  PREDICTED: signal peptide peptidase-like 4         340   1e-109   Brassica rapa
gb|KJB24745.1|  hypothetical protein B456_004G158800                    339   2e-109   Gossypium raimondii
ref|XP_002889358.1|  peptidase                                          340   2e-109   
gb|KJB09813.1|  hypothetical protein B456_001G169100                    339   2e-109   Gossypium raimondii
ref|XP_008340980.1|  PREDICTED: signal peptide peptidase-like 4 i...    339   4e-109   
ref|XP_010480022.1|  PREDICTED: signal peptide peptidase-like 4 i...    339   4e-109   Camelina sativa [gold-of-pleasure]
ref|XP_008340922.1|  PREDICTED: signal peptide peptidase-like 4 i...    339   4e-109   
gb|KJB24744.1|  hypothetical protein B456_004G158800                    338   7e-109   Gossypium raimondii
gb|KJB24746.1|  hypothetical protein B456_004G158800                    338   8e-109   Gossypium raimondii
ref|XP_002511870.1|  Minor histocompatibility antigen H13, putative     338   1e-108   Ricinus communis
ref|XP_010457099.1|  PREDICTED: signal peptide peptidase-like 4         339   1e-108   Camelina sativa [gold-of-pleasure]
ref|XP_007219545.1|  hypothetical protein PRUPE_ppa003988mg             337   2e-108   Prunus persica
ref|XP_009340097.1|  PREDICTED: signal peptide peptidase-like 4         337   2e-108   Pyrus x bretschneideri [bai li]
gb|KCW78081.1|  hypothetical protein EUGRSUZ_D02301                     331   4e-108   Eucalyptus grandis [rose gum]
ref|XP_008338843.1|  PREDICTED: signal peptide peptidase-like 4         336   4e-108   
ref|XP_010670265.1|  PREDICTED: signal peptide peptidase-like 4         335   8e-108   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006303940.1|  hypothetical protein CARUB_v10008675mg             337   8e-108   
gb|KCW78080.1|  hypothetical protein EUGRSUZ_D02301                     332   8e-108   Eucalyptus grandis [rose gum]
ref|NP_171671.2|  signal peptide peptidase-like 4                       335   1e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004306779.2|  PREDICTED: signal peptide peptidase-like 4         335   2e-107   Fragaria vesca subsp. vesca
ref|XP_002301360.2|  hypothetical protein POPTR_0002s16180g             332   2e-106   
ref|XP_009396168.1|  PREDICTED: signal peptide peptidase-like 4         331   4e-106   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002274996.2|  PREDICTED: signal peptide peptidase-like 2         331   7e-106   Vitis vinifera
ref|XP_009600060.1|  PREDICTED: signal peptide peptidase-like 2         330   1e-105   Nicotiana tomentosiformis
ref|XP_010053719.1|  PREDICTED: signal peptide peptidase-like 4 i...    330   1e-105   Eucalyptus grandis [rose gum]
ref|XP_007209873.1|  hypothetical protein PRUPE_ppa003858mg             329   3e-105   Prunus persica
ref|XP_008232889.1|  PREDICTED: signal peptide peptidase-like 4         328   4e-105   Prunus mume [ume]
ref|XP_011080942.1|  PREDICTED: signal peptide peptidase-like 2         327   1e-104   
ref|XP_009780084.1|  PREDICTED: signal peptide peptidase-like 2         327   1e-104   Nicotiana sylvestris
ref|XP_006339581.1|  PREDICTED: signal peptide peptidase-like 4-l...    326   2e-104   
ref|XP_008437291.1|  PREDICTED: signal peptide peptidase-like 2         326   4e-104   Cucumis melo [Oriental melon]
ref|XP_011022676.1|  PREDICTED: signal peptide peptidase-like 2         326   4e-104   Populus euphratica
emb|CAN62222.1|  hypothetical protein VITISV_022532                     324   5e-104   Vitis vinifera
ref|XP_002303595.2|  protease-associated domain-containing family...    325   7e-104   Populus trichocarpa [western balsam poplar]
ref|XP_004143899.1|  PREDICTED: signal peptide peptidase-like 2 i...    325   9e-104   Cucumis sativus [cucumbers]
gb|KJB52135.1|  hypothetical protein B456_008G247500                    320   9e-104   Gossypium raimondii
ref|XP_010089093.1|  Signal peptide peptidase-like 2B                   325   1e-103   
gb|EPS58628.1|  peptidase                                               320   2e-103   Genlisea aurea
ref|XP_004245597.1|  PREDICTED: signal peptide peptidase-like 2         325   2e-103   Solanum lycopersicum
gb|KJB52136.1|  hypothetical protein B456_008G247500                    320   2e-103   Gossypium raimondii
ref|XP_010053720.1|  PREDICTED: signal peptide peptidase-like 4 i...    324   3e-103   
ref|XP_008238915.1|  PREDICTED: signal peptide peptidase-like 2         324   3e-103   Prunus mume [ume]
ref|XP_012083376.1|  PREDICTED: signal peptide peptidase-like 4 i...    323   7e-103   Jatropha curcas
gb|KDP28619.1|  hypothetical protein JCGZ_14390                         323   7e-103   Jatropha curcas
ref|XP_006439531.1|  hypothetical protein CICLE_v10019598mg             321   7e-103   
gb|AAL14628.1|AF417575_1  growth-on protein GRO11                       321   3e-102   Euphorbia esula [wolf's milk]
ref|XP_002299526.2|  protease-associated domain-containing family...    321   3e-102   
ref|XP_009420460.1|  PREDICTED: signal peptide peptidase-like 5 i...    320   6e-102   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010680813.1|  PREDICTED: signal peptide peptidase-like 2         320   6e-102   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009346748.1|  PREDICTED: signal peptide peptidase-like 2         320   8e-102   Pyrus x bretschneideri [bai li]
ref|XP_006439532.1|  hypothetical protein CICLE_v10019598mg             320   1e-101   Citrus clementina [clementine]
ref|XP_007040267.1|  Signal peptide peptidase-like 2 isoform 4          317   2e-101   
ref|XP_009374989.1|  PREDICTED: signal peptide peptidase-like 2         319   2e-101   Pyrus x bretschneideri [bai li]
ref|XP_006476550.1|  PREDICTED: signal peptide peptidase-like 2-like    318   4e-101   Citrus sinensis [apfelsine]
gb|KJB52138.1|  hypothetical protein B456_008G247500                    318   4e-101   Gossypium raimondii
ref|XP_007040266.1|  Signal peptide peptidase-like 2 isoform 3          317   6e-101   
gb|KJB52134.1|  hypothetical protein B456_008G247500                    318   6e-101   Gossypium raimondii
ref|XP_007040264.1|  Signal peptide peptidase-like 2 isoform 1          317   1e-100   Theobroma cacao [chocolate]
emb|CDX90049.1|  BnaA10g00330D                                          317   2e-100   
ref|XP_010940491.1|  PREDICTED: signal peptide peptidase-like 4         316   2e-100   Elaeis guineensis
ref|XP_008787488.1|  PREDICTED: signal peptide peptidase-like 4         311   2e-100   Phoenix dactylifera
ref|XP_006343972.1|  PREDICTED: signal peptide peptidase-like 2-like    316   3e-100   Solanum tuberosum [potatoes]
gb|KHG06309.1|  Signal peptide peptidase-like 2B                        316   3e-100   Gossypium arboreum [tree cotton]
ref|XP_012086884.1|  PREDICTED: signal peptide peptidase-like 2         316   4e-100   Jatropha curcas
ref|XP_006391728.1|  hypothetical protein EUTSA_v10023402mg             315   5e-100   Eutrema salsugineum [saltwater cress]
ref|XP_009420462.1|  PREDICTED: signal peptide peptidase-like 5 i...    315   5e-100   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK42519.1|  hypothetical protein AALP_AA1G005000                    315   9e-100   Arabis alpina [alpine rockcress]
gb|AAL14629.1|AF417576_1  growth-on protein GRO10                       315   1e-99    Euphorbia esula [wolf's milk]
emb|CDY15163.1|  BnaC05g00420D                                          314   2e-99    Brassica napus [oilseed rape]
emb|CDY45351.1|  BnaA09g12360D                                          313   3e-99    Brassica napus [oilseed rape]
gb|KCW77500.1|  hypothetical protein EUGRSUZ_D01835                     308   5e-99    Eucalyptus grandis [rose gum]
ref|XP_008778907.1|  PREDICTED: signal peptide peptidase-like 4         313   5e-99    Phoenix dactylifera
gb|KCW77499.1|  hypothetical protein EUGRSUZ_D01835                     309   1e-98    Eucalyptus grandis [rose gum]
ref|XP_002509814.1|  Minor histocompatibility antigen H13, putative     311   2e-98    Ricinus communis
ref|XP_009112759.1|  PREDICTED: signal peptide peptidase-like 2         311   3e-98    Brassica rapa
gb|EYU38342.1|  hypothetical protein MIMGU_mgv1a004184mg                311   3e-98    Erythranthe guttata [common monkey flower]
gb|KFK30597.1|  hypothetical protein AALP_AA6G002300                    310   4e-98    Arabis alpina [alpine rockcress]
ref|XP_010418403.1|  PREDICTED: signal peptide peptidase-like 2 i...    310   7e-98    Camelina sativa [gold-of-pleasure]
ref|XP_010418402.1|  PREDICTED: signal peptide peptidase-like 2 i...    310   8e-98    Camelina sativa [gold-of-pleasure]
ref|XP_007158507.1|  hypothetical protein PHAVU_002G158100g             310   1e-97    Phaseolus vulgaris [French bean]
ref|XP_011092489.1|  PREDICTED: signal peptide peptidase-like 4 i...    308   1e-97    
gb|ABN06072.1|  Protease-associated PA; Peptidase A22B, minor his...    308   1e-97    Medicago truncatula
emb|CDY08318.1|  BnaC09g12780D                                          309   1e-97    Brassica napus [oilseed rape]
ref|XP_009119715.1|  PREDICTED: signal peptide peptidase-like 4         309   1e-97    Brassica rapa
ref|XP_010935854.1|  PREDICTED: signal peptide peptidase-like 4 i...    308   2e-97    Elaeis guineensis
gb|AAG52428.1|AC011622_16  unknown protein; 50290-46846                 308   2e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002439083.1|  hypothetical protein SORBIDRAFT_10g031280          308   4e-97    Sorghum bicolor [broomcorn]
ref|XP_006301088.1|  hypothetical protein CARUB_v10021480mg             307   6e-97    Capsella rubella
ref|XP_003538333.1|  PREDICTED: signal peptide peptidase-like 2-like    307   8e-97    Glycine max [soybeans]
ref|XP_002887944.1|  protease-associated domain-containing protein      306   1e-96    
ref|NP_974082.1|  signal peptide peptidase-like 2                       306   1e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003517469.1|  PREDICTED: signal peptide peptidase-like 2-like    306   1e-96    Glycine max [soybeans]
ref|NP_564815.1|  signal peptide peptidase-like 2                       306   1e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010053243.1|  PREDICTED: signal peptide peptidase-like 2         306   2e-96    Eucalyptus grandis [rose gum]
ref|XP_004954446.1|  PREDICTED: signal peptide peptidase-like 4-like    306   2e-96    Setaria italica
ref|XP_010430474.1|  PREDICTED: signal peptide peptidase-like 2         305   3e-96    Camelina sativa [gold-of-pleasure]
ref|XP_010473618.1|  PREDICTED: signal peptide peptidase-like 2         305   5e-96    Camelina sativa [gold-of-pleasure]
ref|NP_001149009.1|  LOC100282629 precursor                             303   2e-95    Zea mays [maize]
ref|XP_004966574.1|  PREDICTED: signal peptide peptidase-like 5-like    303   3e-95    Setaria italica
ref|XP_010545677.1|  PREDICTED: signal peptide peptidase-like 2         301   1e-94    Tarenaya hassleriana [spider flower]
gb|AAM63609.1|  growth-on protein GRO10                                 301   2e-94    Arabidopsis thaliana [mouse-ear cress]
gb|KEH26503.1|  signal peptide peptidase-like protein                   300   6e-94    Medicago truncatula
ref|XP_004298803.1|  PREDICTED: signal peptide peptidase-like 2         299   1e-93    Fragaria vesca subsp. vesca
gb|AFW63934.1|  hypothetical protein ZEAMMB73_184308                    299   1e-93    
gb|KJB20660.1|  hypothetical protein B456_003G158200                    296   3e-93    Gossypium raimondii
gb|KHG25050.1|  Signal peptide peptidase-like 2B                        298   4e-93    Gossypium arboreum [tree cotton]
ref|XP_008679146.1|  PREDICTED: signal peptide peptidase-like 4         299   1e-92    
ref|XP_004506302.1|  PREDICTED: signal peptide peptidase-like 2-like    297   1e-92    
ref|XP_002453071.1|  hypothetical protein SORBIDRAFT_04g037790          296   2e-92    Sorghum bicolor [broomcorn]
gb|ACN30991.1|  unknown                                                 294   2e-92    Zea mays [maize]
gb|KJB20659.1|  hypothetical protein B456_003G158200                    295   3e-92    Gossypium raimondii
ref|XP_003570436.1|  PREDICTED: signal peptide peptidase-like 4         295   4e-92    Brachypodium distachyon [annual false brome]
ref|NP_001058659.1|  Os06g0730900                                       294   1e-91    
ref|XP_011654737.1|  PREDICTED: signal peptide peptidase-like 2 i...    292   3e-91    Cucumis sativus [cucumbers]
gb|KDO76242.1|  hypothetical protein CISIN_1g009071mg                   289   1e-90    Citrus sinensis [apfelsine]
gb|KJB20661.1|  hypothetical protein B456_003G158200                    288   2e-89    Gossypium raimondii
ref|XP_010480029.1|  PREDICTED: signal peptide peptidase-like 4 i...    284   5e-88    
ref|XP_011029294.1|  PREDICTED: LOW QUALITY PROTEIN: signal pepti...    283   2e-87    Populus euphratica
dbj|BAJ96036.1|  predicted protein                                      290   4e-87    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010239116.1|  PREDICTED: signal peptide peptidase-like 5         282   5e-87    Brachypodium distachyon [annual false brome]
ref|XP_006827582.1|  PREDICTED: signal peptide peptidase-like 4         280   2e-86    Amborella trichopoda
dbj|BAJ96967.1|  predicted protein                                      279   6e-86    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001048565.1|  Os02g0823000                                       279   8e-86    
dbj|BAD22919.1|  putative growth-on protein GRO10                       278   9e-86    Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ97624.1|  predicted protein                                      279   1e-85    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EAY88073.1|  hypothetical protein OsI_09503                          278   1e-85    Oryza sativa Indica Group [Indian rice]
dbj|BAK08187.1|  predicted protein                                      278   2e-85    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ98049.1|  predicted protein                                      276   9e-85    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008360707.1|  PREDICTED: signal peptide peptidase-like 2         274   2e-84    
ref|XP_006648148.1|  PREDICTED: signal peptide peptidase-like 4-like    274   6e-84    Oryza brachyantha
emb|CAL25347.1|  d-alanyl-D-alanine endopeptidase/peptidase             260   2e-83    Platanus x hispanica [London plane tree]
ref|XP_010935855.1|  PREDICTED: signal peptide peptidase-like 4 i...    271   5e-83    
gb|ADE76315.1|  unknown                                                 268   1e-81    Picea sitchensis
gb|EMT12022.1|  Signal peptide peptidase-like 2B                        265   2e-80    
gb|KDO76241.1|  hypothetical protein CISIN_1g009071mg                   260   1e-79    Citrus sinensis [apfelsine]
gb|KEH18849.1|  signal peptide peptidase-like protein                   259   3e-79    Medicago truncatula
gb|KJB24747.1|  hypothetical protein B456_004G158800                    259   3e-79    Gossypium raimondii
gb|AAF78405.1|AC009273_11  ESTs gb|AA586244 and gb|T21200 come fr...    239   6e-70    Arabidopsis thaliana [mouse-ear cress]
gb|EMT21395.1|  Signal peptide peptidase-like 2B                        234   7e-69    
gb|AFW69664.2|  hypothetical protein ZEAMMB73_283504                    230   1e-67    
emb|CDP12033.1|  unnamed protein product                                220   2e-67    Coffea canephora [robusta coffee]
ref|XP_001770668.1|  predicted protein                                  229   1e-66    
gb|AFW69666.2|  hypothetical protein ZEAMMB73_283504                    220   8e-65    
gb|AFW69665.2|  hypothetical protein ZEAMMB73_283504                    220   1e-64    
ref|XP_006439530.1|  hypothetical protein CICLE_v10019598mg             216   2e-63    
ref|XP_001768370.1|  predicted protein                                  217   2e-62    
ref|XP_001751321.1|  predicted protein                                  215   2e-61    
ref|XP_002978487.1|  hypothetical protein SELMODRAFT_176891             211   5e-60    
ref|XP_002970408.1|  hypothetical protein SELMODRAFT_93092              211   5e-60    
ref|XP_002982598.1|  hypothetical protein SELMODRAFT_179700             206   7e-58    
ref|XP_002993338.1|  hypothetical protein SELMODRAFT_187400             204   1e-57    Selaginella moellendorffii
gb|ERN11880.1|  hypothetical protein AMTR_s00020p00177780               197   5e-57    Amborella trichopoda
gb|EMS56631.1|  Signal peptide peptidase-like 2B                        197   1e-55    Triticum urartu
ref|XP_006850301.2|  PREDICTED: signal peptide peptidase-like 2         195   3e-54    Amborella trichopoda
gb|ABR16410.1|  unknown                                                 192   6e-53    Picea sitchensis
gb|KEH26504.1|  signal peptide peptidase-like protein                   185   4e-51    Medicago truncatula
ref|XP_010911065.1|  PREDICTED: signal peptide peptidase-like 2         178   4e-51    
ref|XP_001770310.1|  predicted protein                                  186   1e-50    
gb|KHG19074.1|  Signal peptide peptidase-like 2B                        182   2e-50    Gossypium arboreum [tree cotton]
ref|XP_009413504.1|  PREDICTED: signal peptide peptidase-like 2         185   3e-50    Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB41339.1|  hypothetical protein B456_007G099700                    182   3e-50    Gossypium raimondii
ref|XP_006663404.1|  PREDICTED: signal peptide peptidase-like 2-like    184   7e-50    Oryza brachyantha
ref|XP_008811653.1|  PREDICTED: signal peptide peptidase-like 2         184   8e-50    Phoenix dactylifera
tpg|DAA38909.1|  TPA: hypothetical protein ZEAMMB73_606524              183   1e-49    
ref|XP_008667367.1|  PREDICTED: uncharacterized protein LOC100217...    183   1e-49    
ref|XP_002446699.1|  hypothetical protein SORBIDRAFT_06g020770          182   4e-49    Sorghum bicolor [broomcorn]
gb|EMS64986.1|  Signal peptide peptidase-like 2B                        182   5e-49    Triticum urartu
gb|KJB25873.1|  hypothetical protein B456_004G212600                    171   8e-49    Gossypium raimondii
sp|Q53P98.1|SIPL2_ORYSJ  RecName: Full=Signal peptide peptidase-l...    181   1e-48    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004979231.1|  PREDICTED: signal peptide peptidase-like 2-like    179   3e-48    Setaria italica
ref|XP_003568960.1|  PREDICTED: signal peptide peptidase-like 2         176   4e-47    Brachypodium distachyon [annual false brome]
gb|KCW59889.1|  hypothetical protein EUGRSUZ_H02617                     173   7e-46    Eucalyptus grandis [rose gum]
ref|XP_010023580.1|  PREDICTED: signal peptide peptidase-like 2         172   8e-46    Eucalyptus grandis [rose gum]
ref|XP_008222677.1|  PREDICTED: signal peptide peptidase-like 3         172   1e-45    Prunus mume [ume]
ref|XP_003532320.1|  PREDICTED: signal peptide peptidase-like 3-like    171   5e-45    Glycine max [soybeans]
gb|KHN24971.1|  Signal peptide peptidase-like 2B                        171   5e-45    Glycine soja [wild soybean]
ref|XP_009592079.1|  PREDICTED: signal peptide peptidase-like 4 i...    168   5e-45    Nicotiana tomentosiformis
ref|XP_009781593.1|  PREDICTED: signal peptide peptidase-like 4 i...    168   6e-45    Nicotiana sylvestris
emb|CDP10362.1|  unnamed protein product                                170   6e-45    Coffea canephora [robusta coffee]
ref|XP_009339896.1|  PREDICTED: signal peptide peptidase-like 5 i...    170   7e-45    Pyrus x bretschneideri [bai li]
ref|XP_007222318.1|  hypothetical protein PRUPE_ppa003955mg             170   7e-45    Prunus persica
ref|XP_009339895.1|  PREDICTED: signal peptide peptidase-like 5 i...    170   8e-45    Pyrus x bretschneideri [bai li]
gb|EMT00602.1|  Signal peptide peptidase-like 2B                        170   9e-45    
ref|XP_008387696.1|  PREDICTED: signal peptide peptidase-like 5         170   9e-45    Malus domestica [apple tree]
gb|EPS70425.1|  hypothetical protein M569_04337                         159   1e-44    Genlisea aurea
dbj|BAJ93677.1|  predicted protein                                      168   3e-44    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHN12587.1|  Signal peptide peptidase-like 2B                        167   1e-43    Glycine soja [wild soybean]
ref|XP_003552754.1|  PREDICTED: signal peptide peptidase-like 3-like    167   1e-43    Glycine max [soybeans]
ref|XP_007139105.1|  hypothetical protein PHAVU_008G001700g             166   2e-43    Phaseolus vulgaris [French bean]
ref|XP_010326969.1|  PREDICTED: signal peptide peptidase-like 4 i...    164   2e-43    Solanum lycopersicum
ref|XP_008381462.1|  PREDICTED: signal peptide peptidase-like 3         166   2e-43    
dbj|BAE71293.1|  hypothetical protein                                   166   4e-43    Trifolium pratense [peavine clover]
gb|KJB30042.1|  hypothetical protein B456_005G128500                    165   5e-43    Gossypium raimondii
gb|KJB30041.1|  hypothetical protein B456_005G128500                    165   5e-43    Gossypium raimondii
gb|KJB30043.1|  hypothetical protein B456_005G128500                    165   5e-43    Gossypium raimondii
gb|KJB30038.1|  hypothetical protein B456_005G128500                    165   5e-43    Gossypium raimondii
gb|KEH21453.1|  signal peptide peptidase-like protein                   162   2e-42    Medicago truncatula
gb|KEH21455.1|  signal peptide peptidase-like protein                   162   2e-42    Medicago truncatula
gb|KEH21454.1|  signal peptide peptidase-like protein                   162   4e-42    Medicago truncatula
gb|KEH21452.1|  signal peptide peptidase-like protein                   162   5e-42    Medicago truncatula
ref|XP_007139836.1|  hypothetical protein PHAVU_008G062100g             160   6e-42    Phaseolus vulgaris [French bean]
ref|XP_009385471.1|  PREDICTED: signal peptide peptidase-like 2         161   2e-41    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002889569.1|  hypothetical protein ARALYDRAFT_887775             160   2e-41    Arabidopsis lyrata subsp. lyrata
gb|ABK92483.1|  unknown                                                 160   2e-41    Populus trichocarpa [western balsam poplar]
ref|XP_002268575.1|  PREDICTED: signal peptide peptidase-like 2         160   2e-41    Vitis vinifera
ref|XP_002301641.1|  hypothetical protein POPTR_0002s23320g             160   3e-41    Populus trichocarpa [western balsam poplar]
ref|XP_010107210.1|  Signal peptide peptidase-like 2B                   160   3e-41    
ref|XP_006303960.1|  hypothetical protein CARUB_v10008828mg             159   5e-41    
ref|XP_010557058.1|  PREDICTED: signal peptide peptidase-like 5         159   8e-41    Tarenaya hassleriana [spider flower]
gb|KJB52137.1|  hypothetical protein B456_008G247500                    158   1e-40    Gossypium raimondii
ref|XP_006443145.1|  hypothetical protein CICLE_v10019670mg             157   1e-40    
ref|XP_002529686.1|  Minor histocompatibility antigen H13, putative     158   1e-40    
ref|XP_006443146.1|  hypothetical protein CICLE_v10019670mg             157   3e-40    Citrus clementina [clementine]
ref|XP_004515578.1|  PREDICTED: signal peptide peptidase-like 2-like    157   3e-40    Cicer arietinum [garbanzo]
ref|XP_011042779.1|  PREDICTED: signal peptide peptidase-like 3 i...    157   5e-40    Populus euphratica
ref|XP_011042780.1|  PREDICTED: signal peptide peptidase-like 3 i...    157   5e-40    Populus euphratica
gb|KDO50534.1|  hypothetical protein CISIN_1g009527mg                   156   5e-40    Citrus sinensis [apfelsine]
ref|XP_011042778.1|  PREDICTED: signal peptide peptidase-like 3 i...    157   6e-40    Populus euphratica
gb|KDO50533.1|  hypothetical protein CISIN_1g009527mg                   156   6e-40    Citrus sinensis [apfelsine]
gb|KEH23364.1|  signal peptide peptidase-like protein                   154   7e-40    Medicago truncatula
ref|XP_012066255.1|  PREDICTED: signal peptide peptidase-like 5         155   1e-39    Jatropha curcas
ref|XP_006589800.1|  PREDICTED: signal peptide peptidase-like 5-l...    154   1e-39    
ref|XP_003535798.1|  PREDICTED: signal peptide peptidase-like 5-l...    154   4e-39    
ref|XP_006577963.1|  PREDICTED: signal peptide peptidase-like 2-l...    149   5e-39    
ref|XP_006417984.1|  hypothetical protein EUTSA_v10007296mg             154   6e-39    
ref|NP_001045182.1|  Os01g0914700                                       152   2e-38    
ref|XP_006606946.1|  PREDICTED: signal peptide peptidase-like 2-like    152   2e-38    
gb|EEC72022.1|  hypothetical protein OsI_04902                          152   3e-38    
ref|XP_006577961.1|  PREDICTED: signal peptide peptidase-like 2-l...    149   3e-38    
ref|XP_010485342.1|  PREDICTED: signal peptide peptidase-like 5         151   4e-38    
ref|XP_010457682.1|  PREDICTED: signal peptide peptidase-like 5         151   4e-38    
gb|KJB30040.1|  hypothetical protein B456_005G128500                    151   4e-38    
ref|XP_007033978.1|  Signal peptide peptidase family protein, exp...    151   5e-38    
ref|XP_010999996.1|  PREDICTED: signal peptide peptidase-like 3 i...    150   1e-37    
ref|XP_008464341.1|  PREDICTED: signal peptide peptidase-like 5 i...    150   1e-37    
ref|XP_006645218.1|  PREDICTED: signal peptide peptidase-like 3-like    150   1e-37    
gb|KHN30820.1|  Bidirectional sugar transporter SWEET16                 146   1e-37    
ref|XP_008464342.1|  PREDICTED: signal peptide peptidase-like 5 i...    150   1e-37    
ref|XP_010999995.1|  PREDICTED: signal peptide peptidase-like 3 i...    149   2e-37    
ref|XP_006411582.1|  hypothetical protein EUTSA_v10016479mg             149   2e-37    
ref|XP_011656474.1|  PREDICTED: signal peptide peptidase-like 5 i...    149   3e-37    
ref|XP_011656473.1|  PREDICTED: signal peptide peptidase-like 5 i...    149   3e-37    
gb|KFK37150.1|  hypothetical protein AALP_AA4G219600                    148   5e-37    
ref|XP_012083377.1|  PREDICTED: signal peptide peptidase-like 4 i...    146   9e-37    
ref|XP_009383829.1|  PREDICTED: signal peptide peptidase-like 2         147   2e-36    
ref|XP_007142608.1|  hypothetical protein PHAVU_007G001900g             146   2e-36    
ref|NP_001030930.1|  signal peptide peptidase-like 4                    144   3e-36    
emb|CDY63797.1|  BnaA08g31760D                                          145   4e-36    
ref|XP_008800997.1|  PREDICTED: signal peptide peptidase-like 2 i...    145   4e-36    
ref|XP_008800996.1|  PREDICTED: signal peptide peptidase-like 2 i...    145   5e-36    
ref|XP_008800995.1|  PREDICTED: signal peptide peptidase-like 2 i...    145   5e-36    
ref|XP_009111025.1|  PREDICTED: signal peptide peptidase-like 5 i...    144   9e-36    
ref|XP_009111026.1|  PREDICTED: signal peptide peptidase-like 5 i...    144   1e-35    
ref|XP_006581965.1|  PREDICTED: signal peptide peptidase-like 2-l...    139   1e-35    
ref|XP_006581963.1|  PREDICTED: signal peptide peptidase-like 2-l...    139   1e-35    
ref|NP_001117235.1|  signal peptide peptidase-like 5                    144   1e-35    
ref|NP_172073.2|  signal peptide peptidase-like 5                       144   1e-35    
ref|XP_002881886.1|  protease-associated domain-containing protein      144   2e-35    
gb|AFW69667.2|  hypothetical protein ZEAMMB73_283504                    136   2e-35    
ref|XP_006581961.1|  PREDICTED: signal peptide peptidase-like 2-l...    139   2e-35    
ref|XP_006581962.1|  PREDICTED: signal peptide peptidase-like 2-l...    139   2e-35    
ref|XP_006581958.1|  PREDICTED: signal peptide peptidase-like 2-l...    139   2e-35    
ref|XP_006375513.1|  hypothetical protein POPTR_0014s14750g             144   2e-35    
ref|XP_011073830.1|  PREDICTED: signal peptide peptidase-like 3         143   2e-35    
gb|KFK42916.1|  hypothetical protein AALP_AA1G054900                    143   3e-35    
ref|NP_850383.2|  signal peptide peptidase-like 3                       143   3e-35    
ref|XP_006366711.1|  PREDICTED: signal peptide peptidase-like 5-like    142   4e-35    
gb|AAM14939.1|  unknown protein                                         143   4e-35    
ref|XP_010506164.1|  PREDICTED: signal peptide peptidase-like 3         143   4e-35    
ref|XP_006293936.1|  hypothetical protein CARUB_v10022926mg             143   4e-35    
ref|XP_004296701.1|  PREDICTED: signal peptide peptidase-like 3         142   6e-35    
ref|XP_010245343.1|  PREDICTED: signal peptide peptidase-like 2 i...    140   1e-34    
ref|XP_010245342.1|  PREDICTED: signal peptide peptidase-like 2 i...    141   2e-34    
emb|CDX86551.1|  BnaC08g01520D                                          140   2e-34    
ref|XP_010508474.1|  PREDICTED: signal peptide peptidase-like 3         140   2e-34    
emb|CAN80806.1|  hypothetical protein VITISV_023748                     140   2e-34    
ref|XP_009142907.1|  PREDICTED: signal peptide peptidase-like 3         139   6e-34    
ref|XP_006349892.1|  PREDICTED: signal peptide peptidase-like 5-like    139   7e-34    
ref|XP_004497419.1|  PREDICTED: signal peptide peptidase-like 5-l...    138   9e-34    
ref|XP_004497418.1|  PREDICTED: signal peptide peptidase-like 5-l...    138   1e-33    
ref|XP_010517860.1|  PREDICTED: signal peptide peptidase-like 3         138   2e-33    
emb|CDY55505.1|  BnaA05g34420D                                          139   6e-33    
ref|XP_010927593.1|  PREDICTED: signal peptide peptidase-like 2         131   6e-33    
emb|CDY53658.1|  BnaC04g52920D                                          136   8e-33    
ref|XP_010326931.1|  PREDICTED: signal peptide peptidase-like 2         136   9e-33    
ref|XP_011084161.1|  PREDICTED: signal peptide peptidase-like 5         135   1e-32    
gb|KHN37259.1|  Signal peptide peptidase-like 2B                        135   2e-32    
ref|XP_009615110.1|  PREDICTED: signal peptide peptidase-like 3         133   1e-31    
gb|EPS67175.1|  hypothetical protein M569_07601                         132   1e-31    
ref|XP_004252973.1|  PREDICTED: signal peptide peptidase-like 5         131   3e-31    
ref|XP_009627420.1|  PREDICTED: signal peptide peptidase-like 5         131   4e-31    
ref|XP_002456828.1|  hypothetical protein SORBIDRAFT_03g043640          131   4e-31    
tpg|DAA56169.1|  TPA: hypothetical protein ZEAMMB73_340711              131   5e-31    
ref|XP_009791643.1|  PREDICTED: signal peptide peptidase-like 5         131   5e-31    
gb|EPS67149.1|  hypothetical protein M569_07625                         129   6e-31    
gb|KHN27144.1|  Signal peptide peptidase-like 2B                        130   9e-31    
gb|EPS62285.1|  hypothetical protein M569_12504                         129   1e-30    
ref|XP_004971032.1|  PREDICTED: signal peptide peptidase-like 3-like    128   3e-30    
dbj|BAK06733.1|  predicted protein                                      126   2e-29    
gb|EYU32730.1|  hypothetical protein MIMGU_mgv1a004358mg                126   2e-29    
gb|KEH44551.1|  signal peptide peptidase-like protein                   125   3e-29    
ref|XP_010678200.1|  PREDICTED: signal peptide peptidase-like 3 i...    125   4e-29    
emb|CDM85611.1|  unnamed protein product                                125   6e-29    
ref|XP_010678199.1|  PREDICTED: signal peptide peptidase-like 3 i...    124   8e-29    
ref|XP_010481060.1|  PREDICTED: signal peptide peptidase-like 4         120   4e-28    
ref|XP_009786573.1|  PREDICTED: signal peptide peptidase-like 3         121   1e-27    
ref|XP_010525673.1|  PREDICTED: signal peptide peptidase-like 3 i...    122   1e-27    
ref|XP_003564908.1|  PREDICTED: signal peptide peptidase-like 3         120   2e-27    
ref|XP_010525681.1|  PREDICTED: signal peptide peptidase-like 3 i...    120   3e-27    
gb|AFK35256.1|  unknown                                                 113   5e-27    
gb|KHG14688.1|  Signal peptide peptidase-like 2B                        119   1e-26    
emb|CDY30380.1|  BnaA04g24810D                                          118   1e-26    
gb|KJB71830.1|  hypothetical protein B456_011G143700                    117   2e-26    
emb|CDP12034.1|  unnamed protein product                                105   1e-22    
gb|KGN45914.1|  hypothetical protein Csa_6G022260                       100   7e-22    
gb|KJB41340.1|  hypothetical protein B456_007G099700                    102   1e-21    
gb|KHN40955.1|  Signal peptide peptidase-like 2A                      95.9    2e-20    
ref|XP_010664339.1|  PREDICTED: signal peptide peptidase-like 4       93.2    7e-19    
emb|CDY56345.1|  BnaCnng30120D                                        88.6    2e-16    
ref|XP_003592850.1|  hypothetical protein MTR_1g116800                84.3    4e-16    
gb|AAX96394.1|  signal peptide peptidase, putative                    85.1    2e-15    
gb|KDO50535.1|  hypothetical protein CISIN_1g009527mg                 79.3    2e-13    
ref|XP_010910631.1|  PREDICTED: signal peptide peptidase-like 2       71.2    5e-12    
ref|XP_007033979.1|  Signal peptide peptidase family protein, exp...  75.1    7e-12    
ref|XP_007033980.1|  Signal peptide peptidase-like 3 isoform 3        74.7    7e-12    
gb|ELT89507.1|  hypothetical protein CAPTEDRAFT_108818                75.1    7e-12    
emb|CBI35429.3|  unnamed protein product                              71.6    2e-11    
ref|XP_001633099.1|  predicted protein                                70.5    3e-10    
ref|XP_010248029.1|  PREDICTED: signal peptide peptidase-like 2       65.5    7e-10    
ref|XP_004346146.1|  hypothetical protein CAOG_05473                  67.4    1e-09    
gb|EMT32145.1|  Signal peptide peptidase-like 2B                      67.8    2e-09    
ref|XP_004687851.1|  PREDICTED: signal peptide peptidase-like 2A      68.2    2e-09    
ref|XP_007641423.1|  PREDICTED: signal peptide peptidase-like 2B ...  68.2    2e-09    
ref|XP_007641421.1|  PREDICTED: signal peptide peptidase-like 2B ...  68.2    2e-09    
ref|XP_007641424.1|  PREDICTED: signal peptide peptidase-like 2B ...  68.2    2e-09    
ref|XP_004395439.1|  PREDICTED: signal peptide peptidase-like 2B      67.0    4e-09    
ref|XP_011231503.1|  PREDICTED: signal peptide peptidase-like 2B ...  66.2    7e-09    
gb|ERE72409.1|  signal peptide peptidase-like 2B-like protein         66.2    7e-09    
gb|KIY95705.1|  signal peptide peptidase-like 2B                      66.2    7e-09    
gb|EFB22871.1|  hypothetical protein PANDA_015541                     66.2    8e-09    
ref|XP_005587522.1|  PREDICTED: signal peptide peptidase-like 2B      65.9    8e-09    
ref|XP_007614902.1|  PREDICTED: LOW QUALITY PROTEIN: signal pepti...  66.2    8e-09    
ref|XP_011231502.1|  PREDICTED: signal peptide peptidase-like 2B ...  65.9    1e-08    
ref|XP_011231500.1|  PREDICTED: signal peptide peptidase-like 2B ...  65.9    1e-08    
ref|XP_007653881.1|  PREDICTED: signal peptide peptidase-like 2A      65.9    1e-08    
ref|XP_011231501.1|  PREDICTED: signal peptide peptidase-like 2B ...  65.9    1e-08    
ref|XP_008579036.1|  PREDICTED: signal peptide peptidase-like 2B ...  65.9    1e-08    
ref|XP_010744937.1|  PREDICTED: signal peptide peptidase-like 2A ...  65.9    1e-08    
ref|XP_004326544.1|  PREDICTED: LOW QUALITY PROTEIN: signal pepti...  65.9    1e-08    
ref|XP_008579034.1|  PREDICTED: signal peptide peptidase-like 2B ...  65.9    1e-08    
ref|XP_008579035.1|  PREDICTED: signal peptide peptidase-like 2B ...  65.9    1e-08    
ref|XP_010745690.1|  PREDICTED: signal peptide peptidase-like 2A ...  65.5    1e-08    
ref|XP_010746457.1|  PREDICTED: signal peptide peptidase-like 2A ...  65.5    1e-08    
ref|XP_011928689.1|  PREDICTED: signal peptide peptidase-like 2B      65.9    1e-08    
ref|XP_011852871.1|  PREDICTED: signal peptide peptidase-like 2B      65.5    1e-08    
ref|XP_006978324.1|  PREDICTED: signal peptide peptidase-like 2B      65.5    2e-08    
ref|XP_009191371.1|  PREDICTED: signal peptide peptidase-like 2B ...  65.5    2e-08    
ref|XP_009191373.1|  PREDICTED: signal peptide peptidase-like 2B ...  65.1    2e-08    
ref|XP_007992871.1|  PREDICTED: signal peptide peptidase-like 2B ...  65.1    2e-08    
ref|XP_004285895.1|  PREDICTED: signal peptide peptidase-like 2B      65.1    2e-08    
ref|XP_007992873.1|  PREDICTED: signal peptide peptidase-like 2B ...  65.1    2e-08    
ref|XP_008763333.1|  PREDICTED: signal peptide peptidase-like 2B ...  65.1    2e-08    
ref|XP_005819639.1|  hypothetical protein GUITHDRAFT_148481           65.1    2e-08    
ref|XP_008763334.1|  PREDICTED: signal peptide peptidase-like 2B ...  65.1    2e-08    
ref|XP_008763330.1|  PREDICTED: signal peptide peptidase-like 2B ...  65.1    2e-08    
ref|WP_012469777.1|  peptidase S8/S53 subtilisin kexin sedolisin      65.5    2e-08    
ref|XP_008763335.1|  PREDICTED: signal peptide peptidase-like 2B ...  65.1    2e-08    
ref|XP_009191372.1|  PREDICTED: signal peptide peptidase-like 2B ...  65.1    2e-08    
ref|XP_004059749.1|  PREDICTED: signal peptide peptidase-like 2B      65.1    2e-08    
ref|XP_010678201.1|  PREDICTED: signal peptide peptidase-like 3 i...  64.7    2e-08    
ref|XP_008763331.1|  PREDICTED: signal peptide peptidase-like 2B ...  65.1    2e-08    
ref|XP_011748941.1|  PREDICTED: signal peptide peptidase-like 2B      65.1    2e-08    
ref|XP_005633158.1|  PREDICTED: signal peptide peptidase like 2B ...  65.1    2e-08    
ref|XP_008763332.1|  PREDICTED: signal peptide peptidase-like 2B ...  65.1    2e-08    
ref|XP_007992872.1|  PREDICTED: signal peptide peptidase-like 2B ...  65.1    2e-08    
ref|XP_542189.4|  PREDICTED: signal peptide peptidase like 2B iso...  65.1    2e-08    
ref|XP_005633159.1|  PREDICTED: signal peptide peptidase like 2B ...  65.1    2e-08    
ref|XP_003460788.1|  PREDICTED: signal peptide peptidase-like 2B ...  65.1    2e-08    
ref|XP_006241010.1|  PREDICTED: signal peptide peptidase-like 2B ...  65.1    2e-08    
ref|XP_006241009.1|  PREDICTED: signal peptide peptidase-like 2B ...  65.1    2e-08    
ref|XP_001097918.2|  PREDICTED: signal peptide peptidase-like 2B-...  64.7    2e-08    
ref|XP_008763338.1|  PREDICTED: signal peptide peptidase-like 2B ...  65.1    2e-08    
ref|XP_008763336.1|  PREDICTED: signal peptide peptidase-like 2B ...  65.1    2e-08    
dbj|BAJ89830.1|  predicted protein                                    60.5    2e-08    
ref|NP_001014222.1|  signal peptide peptidase-like 2B precursor       64.7    2e-08    
ref|XP_008763337.1|  PREDICTED: signal peptide peptidase-like 2B ...  65.1    2e-08    
ref|XP_006241014.1|  PREDICTED: signal peptide peptidase-like 2B ...  64.7    3e-08    
ref|XP_003819279.1|  PREDICTED: signal peptide peptidase-like 2B ...  64.7    3e-08    
ref|XP_008970838.1|  PREDICTED: signal peptide peptidase-like 2B ...  64.7    3e-08    
ref|XP_004999203.1|  PREDICTED: signal peptide peptidase-like 2B ...  64.3    3e-08    
ref|XP_003819280.1|  PREDICTED: signal peptide peptidase-like 2B ...  64.3    3e-08    
ref|XP_005405961.1|  PREDICTED: signal peptide peptidase-like 2B ...  64.3    3e-08    
ref|XP_005405960.1|  PREDICTED: signal peptide peptidase-like 2B ...  64.3    3e-08    
gb|AAG45441.1|AC005258_1  KIAA1532 protein [Homo sapiens] partial...  62.8    3e-08    
ref|XP_005654759.1|  PREDICTED: signal peptide peptidase-like 2B ...  64.3    4e-08    
ref|XP_006206636.1|  PREDICTED: signal peptide peptidase-like 2B      64.3    4e-08    
dbj|BAE38734.1|  unnamed protein product                              64.3    4e-08    
gb|EMC78910.1|  Signal peptide peptidase-like 2A                      63.9    4e-08    
ref|XP_003123073.1|  PREDICTED: signal peptide peptidase-like 2B ...  64.3    4e-08    
ref|XP_011819445.1|  PREDICTED: signal peptide peptidase-like 2B ...  64.3    4e-08    
ref|XP_007531954.1|  PREDICTED: signal peptide peptidase-like 2A      63.9    4e-08    
ref|XP_004632758.1|  PREDICTED: signal peptide peptidase-like 2B      63.9    4e-08    
ref|XP_010373155.1|  PREDICTED: signal peptide peptidase-like 2B ...  63.9    5e-08    
ref|XP_010373154.1|  PREDICTED: signal peptide peptidase-like 2B ...  63.9    5e-08    
ref|XP_011819446.1|  PREDICTED: signal peptide peptidase-like 2B ...  63.9    5e-08    
ref|XP_010373152.1|  PREDICTED: signal peptide peptidase-like 2B ...  63.9    5e-08    
gb|ETL25766.1|  hypothetical protein L916_20417                       64.3    5e-08    
ref|XP_006514274.1|  PREDICTED: signal peptide peptidase-like 2B ...  63.9    5e-08    
ref|XP_008914784.1|  hypothetical protein PPTG_18414                  63.9    5e-08    
ref|XP_010633179.1|  PREDICTED: signal peptide peptidase-like 2B ...  63.9    5e-08    
ref|XP_011241887.1|  PREDICTED: signal peptide peptidase-like 2B ...  63.9    5e-08    
ref|XP_010633176.1|  PREDICTED: signal peptide peptidase-like 2B ...  63.9    5e-08    
ref|XP_006514278.1|  PREDICTED: signal peptide peptidase-like 2B ...  63.5    6e-08    
ref|XP_006514273.1|  PREDICTED: signal peptide peptidase-like 2B ...  63.5    6e-08    
ref|XP_006514272.1|  PREDICTED: signal peptide peptidase-like 2B ...  63.5    6e-08    
ref|NP_780404.2|  signal peptide peptidase-like 2B precursor          63.5    6e-08    
ref|XP_005083466.1|  PREDICTED: signal peptide peptidase-like 2B      63.5    6e-08    
ref|XP_010633181.1|  PREDICTED: signal peptide peptidase-like 2B ...  63.5    6e-08    
ref|XP_010633180.1|  PREDICTED: signal peptide peptidase-like 2B ...  63.5    6e-08    
gb|ETL78971.1|  hypothetical protein L917_20294                       63.9    6e-08    
ref|XP_010633177.1|  PREDICTED: signal peptide peptidase-like 2B ...  63.5    6e-08    
ref|XP_005654760.1|  PREDICTED: signal peptide peptidase-like 2B ...  63.5    6e-08    
gb|ETI34712.1|  hypothetical protein F443_18881                       63.9    6e-08    
ref|XP_004865933.1|  PREDICTED: signal peptide peptidase-like 2B ...  63.5    7e-08    
gb|ETP29943.1|  hypothetical protein F442_20958                       63.9    7e-08    
dbj|BAE41755.1|  unnamed protein product                              63.5    7e-08    
ref|XP_006514275.1|  PREDICTED: signal peptide peptidase-like 2B ...  63.5    7e-08    
ref|XP_004865931.1|  PREDICTED: signal peptide peptidase-like 2B ...  63.5    7e-08    
ref|XP_006514277.1|  PREDICTED: signal peptide peptidase-like 2B ...  63.2    8e-08    
ref|XP_004865934.1|  PREDICTED: signal peptide peptidase-like 2B ...  63.2    8e-08    
ref|XP_004865932.1|  PREDICTED: signal peptide peptidase-like 2B ...  63.2    8e-08    
ref|XP_008709609.1|  PREDICTED: signal peptide peptidase-like 2B      63.2    9e-08    
gb|ETK72311.1|  hypothetical protein L915_20555                       63.5    9e-08    
ref|XP_009867978.1|  PREDICTED: signal peptide peptidase-like 2A      63.2    9e-08    
gb|ETO60672.1|  hypothetical protein F444_21151                       63.5    9e-08    
ref|XP_010354903.1|  PREDICTED: signal peptide peptidase-like 2A ...  63.2    9e-08    
gb|ETP01802.1|  hypothetical protein F441_21001                       63.5    9e-08    
ref|XP_010354902.1|  PREDICTED: signal peptide peptidase-like 2A ...  63.2    1e-07    
ref|XP_008951409.1|  PREDICTED: signal peptide peptidase-like 2A ...  63.2    1e-07    
ref|XP_009427396.1|  PREDICTED: signal peptide peptidase-like 2A ...  62.8    1e-07    
ref|XP_005858924.1|  PREDICTED: signal peptide peptidase-like 2B-...  62.4    1e-07    
ref|NP_001079884.1|  signal peptide peptidase like 2B                 62.8    1e-07    
ref|XP_011520417.1|  PREDICTED: signal peptide peptidase-like 2A ...  62.8    1e-07    



>emb|CDP08805.1| unnamed protein product [Coffea canephora]
Length=542

 Score =   386 bits (992),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 186/245 (76%), Positives = 208/245 (85%), Gaps = 0/245 (0%)
 Frame = +1

Query  148  MELRSTAPYCSVPTAVVLWLLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWING  327
            M+L+  A  C+V T V+  +   S+ V  GDIVH DD APRR GCDNNFVLVKVATWI+G
Sbjct  1    MKLKMRALSCTVSTVVLAVVFLSSSSVFAGDIVHQDDEAPRRPGCDNNFVLVKVATWIDG  60

Query  328  KEEMEFVGVGARFGPTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFT  507
             EEMEFVGVGARFG TLESKEKRA+QTRLALADPPDCCSKP+NKLTGE ILV+RGNCSFT
Sbjct  61   NEEMEFVGVGARFGQTLESKEKRADQTRLALADPPDCCSKPKNKLTGEVILVYRGNCSFT  120

Query  508  TKANVADDAGASAILIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKS  687
            TKANVA+DAGASA+LIINNQTELFKMVCE NETD+DI IPA+MLP DAGQ +   + NKS
Sbjct  121  TKANVAEDAGASAVLIINNQTELFKMVCEPNETDIDIQIPAVMLPIDAGQQLEAVMKNKS  180

Query  688  MVSVQLYSPRRPVVDVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDEYCG  867
             V  QLYSP RP+VDVAEVFLWLMAV TILCASYWSAWTAREAAI+ DKLLKDGSD+Y  
Sbjct  181  AVMAQLYSPHRPLVDVAEVFLWLMAVGTILCASYWSAWTAREAAIEMDKLLKDGSDDYLN  240

Query  868  MEATQ  882
            +E++ 
Sbjct  241  LESSN  245



>ref|XP_009784968.1| PREDICTED: signal peptide peptidase-like 4 [Nicotiana sylvestris]
Length=535

 Score =   384 bits (987),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 186/237 (78%), Positives = 206/237 (87%), Gaps = 1/237 (0%)
 Frame = +1

Query  175  CSVPTAVVLWLLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGV  354
            CS+  A+V+ LL C++LV GGDIVH D VAP R GC+NNFVLVK+  W++G E  EFVGV
Sbjct  5    CSICGAIVV-LLVCTSLVSGGDIVHQDSVAPSRPGCNNNFVLVKIPIWVDGIEVTEFVGV  63

Query  355  GARFGPTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDA  534
            GARFGPTLESKEKRANQTRLA ADPPDCCSKPRN LTGEAILVHRGNCSFTTK NVA+DA
Sbjct  64   GARFGPTLESKEKRANQTRLAFADPPDCCSKPRNTLTGEAILVHRGNCSFTTKTNVAEDA  123

Query  535  GASAILIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSP  714
            GASAILIINNQTELFKMVCE +E DLDIGIPA+MLPQ AG S+I+ + N S VSVQLYSP
Sbjct  124  GASAILIINNQTELFKMVCEPDEPDLDIGIPAVMLPQHAGTSLIQFLGNSSSVSVQLYSP  183

Query  715  RRPVVDVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            +RP VDVAEVFLWLMAVATILCASYWSAW AREAAI+QDKLLKDGS+E  G E ++S
Sbjct  184  KRPTVDVAEVFLWLMAVATILCASYWSAWRAREAAIEQDKLLKDGSNECNGTEVSRS  240



>ref|XP_006339580.1| PREDICTED: signal peptide peptidase-like 4-like isoform X1 [Solanum 
tuberosum]
Length=539

 Score =   384 bits (986),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 186/237 (78%), Positives = 204/237 (86%), Gaps = 0/237 (0%)
 Frame = +1

Query  175  CSVPTAVVLWLLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGV  354
            CS+    V+ L+ C+ LV GGDIVH DD+AP R GC NNFVLVKV  W++G E  EFVGV
Sbjct  8    CSICAVFVVVLVLCTGLVSGGDIVHQDDIAPSRPGCSNNFVLVKVPIWVDGIEVTEFVGV  67

Query  355  GARFGPTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDA  534
            GARFGPTLESKEKRANQTRLA ADPPDCCS PRNKLTGEAILVHRGNCSFTTKANVA+DA
Sbjct  68   GARFGPTLESKEKRANQTRLAFADPPDCCSTPRNKLTGEAILVHRGNCSFTTKANVAEDA  127

Query  535  GASAILIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSP  714
            GASAILIINNQTELFKMVCE +E DLDIGIPAIMLPQ AG S+I+ + N S VSVQLYSP
Sbjct  128  GASAILIINNQTELFKMVCEPHEPDLDIGIPAIMLPQHAGTSLIKFLGNSSSVSVQLYSP  187

Query  715  RRPVVDVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            +RP+VDVAEVFLWLMAVATILCASYWSAW AREAAI+QDKLLKDGS+E    E ++S
Sbjct  188  KRPMVDVAEVFLWLMAVATILCASYWSAWRAREAAIEQDKLLKDGSNECNVTEGSRS  244



>ref|XP_011093137.1| PREDICTED: signal peptide peptidase-like 4 [Sesamum indicum]
Length=540

 Score =   383 bits (983),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 181/238 (76%), Positives = 206/238 (87%), Gaps = 3/238 (1%)
 Frame = +1

Query  148  MELRSTAPYCSVPTAVVLWLLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWING  327
            ME +ST+  CS+    V     C ++V  GDIVH DDVAP+R GCDNNFVLVKV  W++ 
Sbjct  1    MESKSTSLCCSLSALAVF---LCISVVFAGDIVHQDDVAPKRPGCDNNFVLVKVPIWMDE  57

Query  328  KEEMEFVGVGARFGPTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFT  507
            KE MEFVG+GARFGPTLESKEKRANQT++ALADPPDCCSKPRNKLTGEAILVHRGNCSF 
Sbjct  58   KEAMEFVGIGARFGPTLESKEKRANQTKVALADPPDCCSKPRNKLTGEAILVHRGNCSFV  117

Query  508  TKANVADDAGASAILIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKS  687
            TKANVA+ AGASA+LIINNQTELFKMVCE NETD+DIGIP +MLPQDAG  + +++ N S
Sbjct  118  TKANVAEAAGASALLIINNQTELFKMVCEANETDVDIGIPVVMLPQDAGAVLKQSMRNSS  177

Query  688  MVSVQLYSPRRPVVDVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDEY  861
             VS+Q+YSP+RP+VDVAEVFLWLMAV TILCASYWSAW+AREAAI+QDKLLKDGSDEY
Sbjct  178  HVSIQIYSPKRPLVDVAEVFLWLMAVGTILCASYWSAWSAREAAIEQDKLLKDGSDEY  235



>ref|XP_011092478.1| PREDICTED: signal peptide peptidase-like 4 isoform X1 [Sesamum 
indicum]
Length=540

 Score =   380 bits (976),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 182/239 (76%), Positives = 206/239 (86%), Gaps = 5/239 (2%)
 Frame = +1

Query  148  MELRSTAPYC-SVPTAVVLWLLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWIN  324
            MEL++ A YC S   AV+L    CS++V  GDIVH DD+AP+R GCDNNFVLVKV  W++
Sbjct  1    MELKNRALYCFSCAVAVLL----CSSVVFAGDIVHQDDIAPKRPGCDNNFVLVKVPVWVD  56

Query  325  GKEEMEFVGVGARFGPTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSF  504
            GKE MEFVGVGARFGPTLESKEKRANQT++ALADPPDCCSKPRNKLTGE ILV RGNCSF
Sbjct  57   GKEIMEFVGVGARFGPTLESKEKRANQTKVALADPPDCCSKPRNKLTGEVILVQRGNCSF  116

Query  505  TTKANVADDAGASAILIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNK  684
             TK NVA+ AGASA+LIINNQTELFKMVCE NETD++I IP +MLPQDAG S+ + + N 
Sbjct  117  VTKGNVAEAAGASALLIINNQTELFKMVCEANETDVNIHIPVVMLPQDAGASLKQLMTNS  176

Query  685  SMVSVQLYSPRRPVVDVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDEY  861
            S VS+Q+YSPRRP VDVAEVFLWLMAV TILCA+YWSAW+AREAAI+QDKLLKDGSDEY
Sbjct  177  SHVSIQMYSPRRPQVDVAEVFLWLMAVGTILCAAYWSAWSAREAAIEQDKLLKDGSDEY  235



>ref|XP_004229902.2| PREDICTED: signal peptide peptidase-like 4 [Solanum lycopersicum]
Length=596

 Score =   381 bits (978),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 186/242 (77%), Positives = 207/242 (86%), Gaps = 2/242 (1%)
 Frame = +1

Query  133  SVVEVMELRSTAPYCSVPTAVVLWLLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVA  312
             ++  MEL+     CS+    V+ ++ C+ LV GGDIVH DD+AP R GC+NNFVLVKV 
Sbjct  53   GLLNFMELKKLD--CSIFAVFVVVVVLCTGLVSGGDIVHQDDIAPSRPGCNNNFVLVKVP  110

Query  313  TWINGKEEMEFVGVGARFGPTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRG  492
             W++G E  EFVGVGARFGPTLESKEKRANQTRLA ADPPDCCS PRNKLTGEAILVHRG
Sbjct  111  IWVDGIEVTEFVGVGARFGPTLESKEKRANQTRLAFADPPDCCSTPRNKLTGEAILVHRG  170

Query  493  NCSFTTKANVADDAGASAILIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIEN  672
            NCSFTTKANVA+DAGASAILIINNQTELFKMVCE +E DLDIGIPAIMLPQ AG S+I+ 
Sbjct  171  NCSFTTKANVAEDAGASAILIINNQTELFKMVCEPHEPDLDIGIPAIMLPQHAGTSLIKF  230

Query  673  IMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGS  852
            + N S VSVQLYSP+RP+VDVAEVFLWLMAVATILCASYWSAW AREAAI+QDKLLKDGS
Sbjct  231  LGNSSSVSVQLYSPKRPMVDVAEVFLWLMAVATILCASYWSAWRAREAAIEQDKLLKDGS  290

Query  853  DE  858
            +E
Sbjct  291  NE  292



>ref|XP_009629841.1| PREDICTED: signal peptide peptidase-like 4 [Nicotiana tomentosiformis]
Length=535

 Score =   376 bits (966),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 179/223 (80%), Positives = 196/223 (88%), Gaps = 0/223 (0%)
 Frame = +1

Query  217  SALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKR  396
            ++LV GGDIVH D VAP R GC+NNFVLVK+  W++G E  EFVGVGARFGPTLESKEKR
Sbjct  18   TSLVSGGDIVHQDSVAPSRPGCNNNFVLVKIPIWVDGIEVTEFVGVGARFGPTLESKEKR  77

Query  397  ANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTEL  576
            ANQTRLA ADPPDCCSKPRNKLTGEAILVHRGNCSFTTK NVA+DAGASAILIINNQTEL
Sbjct  78   ANQTRLAFADPPDCCSKPRNKLTGEAILVHRGNCSFTTKTNVAEDAGASAILIINNQTEL  137

Query  577  FKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWL  756
            FKMVCE +E DLDIGIPA+MLPQ AG S+I+ + N S VSVQLYSP+RP VDVAEVFLWL
Sbjct  138  FKMVCEPDEPDLDIGIPAVMLPQHAGTSLIQFLGNSSSVSVQLYSPKRPTVDVAEVFLWL  197

Query  757  MAVATILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            MAVATILCASYWSAW AREAAI+QDKL KDGS+E  G E ++S
Sbjct  198  MAVATILCASYWSAWRAREAAIEQDKLFKDGSNECNGTEVSRS  240



>gb|KDO86182.1| hypothetical protein CISIN_1g009437mg [Citrus sinensis]
Length=341

 Score =   359 bits (922),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 172/230 (75%), Positives = 193/230 (84%), Gaps = 0/230 (0%)
 Frame = +1

Query  196  VLWLLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPT  375
            +  L+S   L   GDIVH D+ AP+R GCDNNFVLVKV TW++G E+ E+VGVGARFG T
Sbjct  11   IFILVSSPCLASAGDIVHQDNNAPKRPGCDNNFVLVKVPTWVDGGEDTEYVGVGARFGRT  70

Query  376  LESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILI  555
            LE+KEK A+Q RL LADPPDCCSKP+NKLTGEAILVHRG CSFT KAN A++A ASAILI
Sbjct  71   LEAKEKDASQNRLVLADPPDCCSKPKNKLTGEAILVHRGGCSFTAKANFAEEANASAILI  130

Query  556  INNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDV  735
            INN+TELFKMVCE NETD+DI IPAIMLPQDAG ++ + I N S+VSVQLYSPRRPVVDV
Sbjct  131  INNKTELFKMVCESNETDVDIRIPAIMLPQDAGANLEKLIKNNSVVSVQLYSPRRPVVDV  190

Query  736  AEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            AEVFLWLMAV TILCASYWSAWTARE AI+ DKLLKDGSDE+  ME   S
Sbjct  191  AEVFLWLMAVGTILCASYWSAWTARETAIELDKLLKDGSDEFSNMEGVNS  240



>gb|AET02050.2| signal peptide peptidase-like protein [Medicago truncatula]
Length=541

 Score =   366 bits (939),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 171/219 (78%), Positives = 192/219 (88%), Gaps = 0/219 (0%)
 Frame = +1

Query  205  LLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLES  384
             L   +LV  GDIVHHDDVAP R GC+NNFVLVKV TWI+G E  E+VGVGARFGPTLES
Sbjct  16   FLFSVSLVLAGDIVHHDDVAPTRPGCENNFVLVKVPTWIDGVENAEYVGVGARFGPTLES  75

Query  385  KEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINN  564
            KEK AN TR+ +ADPPDCCSKP+NKLT E ILVHRG CSFTTKAN+AD+AGASAILIIN 
Sbjct  76   KEKHANHTRVVMADPPDCCSKPKNKLTNEIILVHRGKCSFTTKANIADEAGASAILIINY  135

Query  565  QTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEV  744
            +TELFKMVCE+NETD+DIGIPA+MLPQDAG ++  +I N S+VS+QLYSP RP+VDVAEV
Sbjct  136  RTELFKMVCEENETDVDIGIPAVMLPQDAGLNLERHIQNNSIVSIQLYSPLRPLVDVAEV  195

Query  745  FLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDEY  861
            FLWLMAV TILCASYWSAWTAREAAI+Q+KLLKD SDEY
Sbjct  196  FLWLMAVGTILCASYWSAWTAREAAIEQEKLLKDASDEY  234



>ref|XP_003627574.1| Signal peptide peptidase-like 2B [Medicago truncatula]
Length=573

 Score =   367 bits (941),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 171/219 (78%), Positives = 192/219 (88%), Gaps = 0/219 (0%)
 Frame = +1

Query  205  LLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLES  384
             L   +LV  GDIVHHDDVAP R GC+NNFVLVKV TWI+G E  E+VGVGARFGPTLES
Sbjct  16   FLFSVSLVLAGDIVHHDDVAPTRPGCENNFVLVKVPTWIDGVENAEYVGVGARFGPTLES  75

Query  385  KEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINN  564
            KEK AN TR+ +ADPPDCCSKP+NKLT E ILVHRG CSFTTKAN+AD+AGASAILIIN 
Sbjct  76   KEKHANHTRVVMADPPDCCSKPKNKLTNEIILVHRGKCSFTTKANIADEAGASAILIINY  135

Query  565  QTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEV  744
            +TELFKMVCE+NETD+DIGIPA+MLPQDAG ++  +I N S+VS+QLYSP RP+VDVAEV
Sbjct  136  RTELFKMVCEENETDVDIGIPAVMLPQDAGLNLERHIQNNSIVSIQLYSPLRPLVDVAEV  195

Query  745  FLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDEY  861
            FLWLMAV TILCASYWSAWTAREAAI+Q+KLLKD SDEY
Sbjct  196  FLWLMAVGTILCASYWSAWTAREAAIEQEKLLKDASDEY  234



>ref|XP_003552398.1| PREDICTED: signal peptide peptidase-like 4-like [Glycine max]
Length=539

 Score =   364 bits (935),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 170/217 (78%), Positives = 192/217 (88%), Gaps = 0/217 (0%)
 Frame = +1

Query  235  GDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRL  414
            GDIVH D +APRR GCDNNFVLVKV TWI+G E  E+VGVGARFGPTLESKEK AN TR+
Sbjct  25   GDIVHPDSIAPRRPGCDNNFVLVKVPTWIDGVESCEYVGVGARFGPTLESKEKHANHTRV  84

Query  415  ALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCE  594
            A+ADPPDCCSKP+NKLTGE ILVHRG CSFTTKAN+A++AGASAILIIN +TELFKMVCE
Sbjct  85   AIADPPDCCSKPKNKLTGEIILVHRGQCSFTTKANIAEEAGASAILIINYRTELFKMVCE  144

Query  595  KNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATI  774
             NETD+DIGIPA+MLPQDAG+++  +I+N S+VSVQLYSP RP+VDVAEVFLWLMAV TI
Sbjct  145  ANETDVDIGIPAVMLPQDAGENLKNHILNNSVVSVQLYSPLRPLVDVAEVFLWLMAVGTI  204

Query  775  LCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            LCASYWSAWTARE+AI+Q+KLLKD SDEY   E   S
Sbjct  205  LCASYWSAWTARESAIEQEKLLKDASDEYINAENAGS  241



>gb|KHM99370.1| Signal peptide peptidase-like 2B [Glycine soja]
Length=539

 Score =   364 bits (934),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 170/217 (78%), Positives = 192/217 (88%), Gaps = 0/217 (0%)
 Frame = +1

Query  235  GDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRL  414
            GDIVH D +APRR GCDNNFVLVKV TWI+G E  E+VGVGARFGPTLESKEK AN TR+
Sbjct  25   GDIVHPDSIAPRRPGCDNNFVLVKVPTWIDGVESCEYVGVGARFGPTLESKEKHANHTRV  84

Query  415  ALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCE  594
            A+ADPPDCCSKP+NKLTGE ILVHRG CSFTTKAN+A++AGASAILIIN +TELFKMVCE
Sbjct  85   AIADPPDCCSKPKNKLTGEIILVHRGQCSFTTKANIAEEAGASAILIINYRTELFKMVCE  144

Query  595  KNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATI  774
             NETD+DIGIPA+MLPQDAG+++  +I+N S+VSVQLYSP RP+VDVAEVFLWLMAV TI
Sbjct  145  ANETDVDIGIPAVMLPQDAGENLKNHILNNSVVSVQLYSPLRPLVDVAEVFLWLMAVGTI  204

Query  775  LCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            LCASYWSAWTARE+AI+Q+KLLKD SDEY   E   S
Sbjct  205  LCASYWSAWTARESAIEQEKLLKDASDEYINAENAGS  241



>ref|XP_004510782.1| PREDICTED: signal peptide peptidase-like 4-like isoform X1 [Cicer 
arietinum]
Length=536

 Score =   363 bits (933),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 170/219 (78%), Positives = 192/219 (88%), Gaps = 0/219 (0%)
 Frame = +1

Query  205  LLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLES  384
             L   +LV GGDIVHHDDVAP R GC+NNFVLVKV TWI+G E  E+VGVGARFGPTLES
Sbjct  14   FLFTISLVLGGDIVHHDDVAPTRPGCENNFVLVKVPTWIDGVENDEYVGVGARFGPTLES  73

Query  385  KEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINN  564
            KEK AN TR+ +ADPPDCCSKP+NKLT E ILVHRG CSFTTKAN+AD+AGASAI+IIN 
Sbjct  74   KEKHANHTRVVMADPPDCCSKPKNKLTSEIILVHRGKCSFTTKANIADEAGASAIIIINY  133

Query  565  QTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEV  744
            +TELFKMVCE+NETD+DIGIPA+MLPQDAG ++  +I N S+VS+QLYSP RP+VDVAEV
Sbjct  134  RTELFKMVCEENETDVDIGIPAVMLPQDAGLNLERHIKNNSIVSIQLYSPLRPLVDVAEV  193

Query  745  FLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDEY  861
            FLWLMAV TILCASYWSAWTAREAAI+Q+KLLKD  DEY
Sbjct  194  FLWLMAVGTILCASYWSAWTAREAAIEQEKLLKDAPDEY  232



>ref|XP_003521881.1| PREDICTED: signal peptide peptidase-like 4-like [Glycine max]
Length=542

 Score =   363 bits (933),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 170/236 (72%), Positives = 200/236 (85%), Gaps = 0/236 (0%)
 Frame = +1

Query  178  SVPTAVVLWLLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVG  357
            ++ + + ++L     LV GGDIVHHDDVAPRR GC+NNFVLVKV TWI+G E  E+VGVG
Sbjct  6    AIYSVIYVFLFGAVTLVLGGDIVHHDDVAPRRPGCENNFVLVKVPTWIDGVENSEYVGVG  65

Query  358  ARFGPTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAG  537
            ARFGPTLESKEKRAN +R+ +ADPPDCC+KP+N LT E ILVHRG CSFTTKAN+AD+AG
Sbjct  66   ARFGPTLESKEKRANLSRVVMADPPDCCTKPKNMLTNEIILVHRGKCSFTTKANIADEAG  125

Query  538  ASAILIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPR  717
            ASAILIIN +TELFKMVCE+NETD+DIGIPA+MLPQDAG ++  +I NKS VS+QLYSP 
Sbjct  126  ASAILIINYRTELFKMVCEENETDVDIGIPAVMLPQDAGLTLERHIENKSNVSIQLYSPL  185

Query  718  RPVVDVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            RP+VDVAEVFLWLMAV TIL ASYWSAW+AREAAI+Q+KLLKD S++Y   E   S
Sbjct  186  RPLVDVAEVFLWLMAVGTILIASYWSAWSAREAAIEQEKLLKDASEDYVNTENVGS  241



>gb|KHN42194.1| Signal peptide peptidase-like 2B [Glycine soja]
Length=555

 Score =   363 bits (933),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 170/236 (72%), Positives = 200/236 (85%), Gaps = 0/236 (0%)
 Frame = +1

Query  178  SVPTAVVLWLLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVG  357
            ++ + + ++L     LV GGDIVHHDDVAPRR GC+NNFVLVKV TWI+G E  E+VGVG
Sbjct  6    AIYSVIYVFLFGAVTLVLGGDIVHHDDVAPRRPGCENNFVLVKVPTWIDGVENSEYVGVG  65

Query  358  ARFGPTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAG  537
            ARFGPTLESKEKRAN +R+ +ADPPDCC+KP+N LT E ILVHRG CSFTTKAN+AD+AG
Sbjct  66   ARFGPTLESKEKRANLSRVVMADPPDCCTKPKNMLTNEIILVHRGKCSFTTKANIADEAG  125

Query  538  ASAILIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPR  717
            ASAILIIN +TELFKMVCE+NETD+DIGIPA+MLPQDAG ++  +I NKS VS+QLYSP 
Sbjct  126  ASAILIINYRTELFKMVCEENETDVDIGIPAVMLPQDAGLTLERHIENKSNVSIQLYSPL  185

Query  718  RPVVDVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            RP+VDVAEVFLWLMAV TIL ASYWSAW+AREAAI+Q+KLLKD S++Y   E   S
Sbjct  186  RPLVDVAEVFLWLMAVGTILIASYWSAWSAREAAIEQEKLLKDASEDYVNTENVGS  241



>ref|XP_003534560.1| PREDICTED: signal peptide peptidase-like 4-like [Glycine max]
 gb|KHN29351.1| Signal peptide peptidase-like 2B [Glycine soja]
Length=539

 Score =   363 bits (931),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 172/232 (74%), Positives = 195/232 (84%), Gaps = 6/232 (3%)
 Frame = +1

Query  208  LSCSALV------HGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFG  369
            L CS L+        GDIVH D +APRR GCDNNFVLVKV TWI+G E  E+VGVGARFG
Sbjct  10   LCCSVLIVFVTLSSAGDIVHPDSIAPRRPGCDNNFVLVKVPTWIDGVESFEYVGVGARFG  69

Query  370  PTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAI  549
            PTLESKEK AN TR+A+ADPPDCCSKP NKLTGE ILVHRG CSFT KAN+A++AGASAI
Sbjct  70   PTLESKEKHANHTRVAIADPPDCCSKPNNKLTGEIILVHRGQCSFTIKANIAEEAGASAI  129

Query  550  LIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVV  729
            LIIN +TELFKMVCE NETD+DIGIPA+MLPQDAG+++  +I+N S+VSVQLYSP RP+V
Sbjct  130  LIINYRTELFKMVCEANETDVDIGIPAVMLPQDAGENLKNHILNNSVVSVQLYSPLRPLV  189

Query  730  DVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            DVAEVFLWLMAV TILCASYWSAW+ARE+AI+Q+KLLKD SDEY   E   S
Sbjct  190  DVAEVFLWLMAVGTILCASYWSAWSARESAIEQEKLLKDASDEYVNAENAGS  241



>ref|XP_007135086.1| hypothetical protein PHAVU_010G099500g [Phaseolus vulgaris]
 gb|ESW07080.1| hypothetical protein PHAVU_010G099500g [Phaseolus vulgaris]
Length=541

 Score =   363 bits (931),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 170/218 (78%), Positives = 192/218 (88%), Gaps = 0/218 (0%)
 Frame = +1

Query  232  GGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTR  411
            GGDIVHHDDVAP R GCDNNFVLVKV TWI+G E+ E+VGVGARFGPTLESKEKRAN TR
Sbjct  23   GGDIVHHDDVAPIRPGCDNNFVLVKVPTWIDGVEKSEYVGVGARFGPTLESKEKRANLTR  82

Query  412  LALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVC  591
            + +ADPPDCC+KP+NKLT E ILVHRG CSFTTKAN+AD+AGASAILIIN +TELFKMVC
Sbjct  83   VVMADPPDCCTKPKNKLTSEIILVHRGKCSFTTKANIADEAGASAILIINYRTELFKMVC  142

Query  592  EKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVAT  771
            E+NETD+DIGIPA+MLPQDAG ++  +I N S VS+QLYSP RP+VDVAEVFLWLMAV T
Sbjct  143  EENETDVDIGIPAVMLPQDAGLTLERHIKNNSNVSIQLYSPLRPLVDVAEVFLWLMAVGT  202

Query  772  ILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            ILCASYWSAW+AREAAI+Q+KLLKD SD+Y   E   S
Sbjct  203  ILCASYWSAWSAREAAIEQEKLLKDASDDYINTENVGS  240



>ref|XP_007139835.1| hypothetical protein PHAVU_008G062100g [Phaseolus vulgaris]
 gb|ESW11829.1| hypothetical protein PHAVU_008G062100g [Phaseolus vulgaris]
Length=539

 Score =   362 bits (930),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 169/233 (73%), Positives = 200/233 (86%), Gaps = 3/233 (1%)
 Frame = +1

Query  175  CSVPTAVVLWLLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGV  354
            C+V  +V + +++ S     GDIVHHD++AP+R GC+NNFVLVKV TWI+G E  E+VGV
Sbjct  8    CAVFWSVFMMIITFS---FAGDIVHHDNIAPKRPGCENNFVLVKVPTWIDGVENCEYVGV  64

Query  355  GARFGPTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDA  534
            GARFGPTLESKEKRAN TR+A+ADPPDCCS P+NKLTGE ILVHRG CSFTTKAN+A+ A
Sbjct  65   GARFGPTLESKEKRANHTRVAIADPPDCCSLPKNKLTGEIILVHRGQCSFTTKANIAEKA  124

Query  535  GASAILIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSP  714
            GASA+LIIN +TELFKMVCE NETD+DIGIP +MLPQDAG+++  +I+N S+VSVQLYSP
Sbjct  125  GASAMLIINYRTELFKMVCEANETDVDIGIPTVMLPQDAGENLKNHILNNSVVSVQLYSP  184

Query  715  RRPVVDVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDEYCGME  873
             RP+VDVAEVFLWLMAV TILCASYWSAWT RE+AI+Q+KLLKD SDEY   E
Sbjct  185  YRPLVDVAEVFLWLMAVGTILCASYWSAWTVRESAIEQEKLLKDASDEYVNAE  237



>ref|XP_009781592.1| PREDICTED: signal peptide peptidase-like 4 isoform X1 [Nicotiana 
sylvestris]
Length=541

 Score =   362 bits (930),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 183/237 (77%), Positives = 205/237 (86%), Gaps = 1/237 (0%)
 Frame = +1

Query  175  CSVPTAVVLWLLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGV  354
            C +     ++LLS S+ V GGDIVHHDDVAP+R GC+NNFVLVK+ TW++G E  EFVG+
Sbjct  10   CCLCLIFAVFLLS-SSFVIGGDIVHHDDVAPKRPGCNNNFVLVKIPTWVHGNEVTEFVGI  68

Query  355  GARFGPTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDA  534
            GARFGPTLESKEKRANQTRLA ADP DCCSKP+NKLTGEAILVHRGNCSFT KA VA+ A
Sbjct  69   GARFGPTLESKEKRANQTRLAFADPTDCCSKPKNKLTGEAILVHRGNCSFTRKAKVAEAA  128

Query  535  GASAILIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSP  714
            GASAI+IINNQTELFKMVCE +E D+DIGIPA+MLPQDAG S+IE + N S VSVQLYSP
Sbjct  129  GASAIIIINNQTELFKMVCEPDEPDVDIGIPAVMLPQDAGTSLIEFLRNSSAVSVQLYSP  188

Query  715  RRPVVDVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            +RP VDVAEVFLWLMAVATILCASYWSAW+AREAAI+QDK LKDGSD+Y G E T S
Sbjct  189  KRPTVDVAEVFLWLMAVATILCASYWSAWSAREAAIEQDKFLKDGSDDYGGKEVTHS  245



>ref|XP_003528851.1| PREDICTED: signal peptide peptidase-like 4-like [Glycine max]
 gb|KHN26959.1| Signal peptide peptidase-like 2B [Glycine soja]
Length=541

 Score =   362 bits (930),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 170/227 (75%), Positives = 195/227 (86%), Gaps = 0/227 (0%)
 Frame = +1

Query  205  LLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLES  384
             +  + LV GGDIVHHDDVAPRR GC+NNFVLVKV TWI+G E  E+VGVGARFGPTLES
Sbjct  14   FMLAATLVLGGDIVHHDDVAPRRPGCENNFVLVKVPTWIDGVENSEYVGVGARFGPTLES  73

Query  385  KEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINN  564
            KEKRAN +R+ +ADPPDCC+KP+NKLT E ILVHRG CSFTTKAN+AD+AGASAILIIN 
Sbjct  74   KEKRANLSRVVMADPPDCCTKPKNKLTNEIILVHRGKCSFTTKANIADEAGASAILIINY  133

Query  565  QTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEV  744
            +TELFKMVCE+NETD+DIGIPA+MLPQDAG ++  +I N S VS+QLYSP RP+VDVAEV
Sbjct  134  RTELFKMVCEENETDVDIGIPAVMLPQDAGLNLERHIKNNSNVSIQLYSPLRPLVDVAEV  193

Query  745  FLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            FLWLMAV TIL ASYWSAW+AREAAI+Q+KLLKD SD+Y   E   S
Sbjct  194  FLWLMAVGTILIASYWSAWSAREAAIEQEKLLKDASDDYANTENVGS  240



>ref|XP_011023314.1| PREDICTED: signal peptide peptidase-like 4 [Populus euphratica]
 ref|XP_011023315.1| PREDICTED: signal peptide peptidase-like 4 [Populus euphratica]
Length=537

 Score =   362 bits (928),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 173/227 (76%), Positives = 193/227 (85%), Gaps = 0/227 (0%)
 Frame = +1

Query  205  LLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLES  384
            L S   L   GDIVHHDD+AP+R GC+NNFVLVKV TWING E++E+VGVGARFG TLES
Sbjct  14   LASSFCLGSAGDIVHHDDIAPKRPGCENNFVLVKVPTWINGVEDIEYVGVGARFGLTLES  73

Query  385  KEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINN  564
            KEK AN   LALADPPDCCSKP+NKL+GE IL HRGNCSFTTKANVA+DAGASAILIINN
Sbjct  74   KEKHANLFLLALADPPDCCSKPKNKLSGEVILAHRGNCSFTTKANVAEDAGASAILIINN  133

Query  565  QTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEV  744
            QTELFKMVCE NETD+ IGI ++MLPQDAG S+ + + + S V VQLYSPRRPVVDVAEV
Sbjct  134  QTELFKMVCEVNETDVKIGIASVMLPQDAGASLEKYLTSSSSVKVQLYSPRRPVVDVAEV  193

Query  745  FLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            FLWLMAV TILCASYWSAW+AREAAI+QDKLLKDG DE   M+  +S
Sbjct  194  FLWLMAVGTILCASYWSAWSAREAAIEQDKLLKDGLDELIHMDGVRS  240



>gb|KDO86181.1| hypothetical protein CISIN_1g009437mg [Citrus sinensis]
Length=455

 Score =   358 bits (920),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 172/227 (76%), Positives = 192/227 (85%), Gaps = 0/227 (0%)
 Frame = +1

Query  205  LLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLES  384
            L+S   L   GDIVH D+ AP+R GCDNNFVLVKV TW++G E+ E+VGVGARFG TLE+
Sbjct  14   LVSSPCLASAGDIVHQDNNAPKRPGCDNNFVLVKVPTWVDGGEDTEYVGVGARFGRTLEA  73

Query  385  KEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINN  564
            KEK A+Q RL LADPPDCCSKP+NKLTGEAILVHRG CSFT KAN A++A ASAILIINN
Sbjct  74   KEKDASQNRLVLADPPDCCSKPKNKLTGEAILVHRGGCSFTAKANFAEEANASAILIINN  133

Query  565  QTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEV  744
            +TELFKMVCE NETD+DI IPAIMLPQDAG ++ + I N S+VSVQLYSPRRPVVDVAEV
Sbjct  134  KTELFKMVCESNETDVDIRIPAIMLPQDAGANLEKLIKNNSVVSVQLYSPRRPVVDVAEV  193

Query  745  FLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            FLWLMAV TILCASYWSAWTARE AI+ DKLLKDGSDE+  ME   S
Sbjct  194  FLWLMAVGTILCASYWSAWTARETAIELDKLLKDGSDEFSNMEGVNS  240



>ref|XP_009592078.1| PREDICTED: signal peptide peptidase-like 4 isoform X1 [Nicotiana 
tomentosiformis]
Length=540

 Score =   360 bits (924),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 181/238 (76%), Positives = 204/238 (86%), Gaps = 1/238 (0%)
 Frame = +1

Query  172  YCSVPTAVVLWLLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVG  351
            +C       ++LLS S+ V GGDIVHHDDVAP+R GC+NNFVLVK+ TW++G E  EFVG
Sbjct  8    FCCFCLIFAVFLLS-SSFVIGGDIVHHDDVAPKRPGCNNNFVLVKIPTWVHGNEVTEFVG  66

Query  352  VGARFGPTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADD  531
            +GARFGPTLESKEKRANQTRLA ADP DCCS P+NKLTGE+ILVHRGNCSFT KA VA+ 
Sbjct  67   IGARFGPTLESKEKRANQTRLAFADPTDCCSNPKNKLTGESILVHRGNCSFTRKAKVAEA  126

Query  532  AGASAILIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYS  711
            AGASAI+IINNQTELFKMVCE +E D+DIGIPA+MLPQDAG S+IE + N S VSVQLYS
Sbjct  127  AGASAIIIINNQTELFKMVCEPDEPDVDIGIPAVMLPQDAGTSLIEFLRNSSAVSVQLYS  186

Query  712  PRRPVVDVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            P+RP VDVAEVFLWLMAVATILCASYWSAW+AREAAI+QDK LKDGSD+Y G E T S
Sbjct  187  PKRPTVDVAEVFLWLMAVATILCASYWSAWSAREAAIEQDKFLKDGSDDYGGKEVTHS  244



>ref|XP_006445026.1| hypothetical protein CICLE_v10019661mg [Citrus clementina]
 gb|ESR58266.1| hypothetical protein CICLE_v10019661mg [Citrus clementina]
 gb|KDO86180.1| hypothetical protein CISIN_1g009437mg [Citrus sinensis]
Length=497

 Score =   358 bits (919),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 172/227 (76%), Positives = 192/227 (85%), Gaps = 0/227 (0%)
 Frame = +1

Query  205  LLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLES  384
            L+S   L   GDIVH D+ AP+R GCDNNFVLVKV TW++G E+ E+VGVGARFG TLE+
Sbjct  14   LVSSPCLASAGDIVHQDNNAPKRPGCDNNFVLVKVPTWVDGGEDTEYVGVGARFGRTLEA  73

Query  385  KEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINN  564
            KEK A+Q RL LADPPDCCSKP+NKLTGEAILVHRG CSFT KAN A++A ASAILIINN
Sbjct  74   KEKDASQNRLVLADPPDCCSKPKNKLTGEAILVHRGGCSFTAKANFAEEANASAILIINN  133

Query  565  QTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEV  744
            +TELFKMVCE NETD+DI IPAIMLPQDAG ++ + I N S+VSVQLYSPRRPVVDVAEV
Sbjct  134  KTELFKMVCESNETDVDIRIPAIMLPQDAGANLEKLIKNNSVVSVQLYSPRRPVVDVAEV  193

Query  745  FLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            FLWLMAV TILCASYWSAWTARE AI+ DKLLKDGSDE+  ME   S
Sbjct  194  FLWLMAVGTILCASYWSAWTARETAIELDKLLKDGSDEFSNMEGVNS  240



>ref|XP_006364152.1| PREDICTED: signal peptide peptidase-like 4-like [Solanum tuberosum]
Length=542

 Score =   359 bits (921),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 179/237 (76%), Positives = 201/237 (85%), Gaps = 0/237 (0%)
 Frame = +1

Query  175  CSVPTAVVLWLLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGV  354
            C       ++LL+   LV GGDIVH D+VAP R GC+NNFVLVKV TW+NG E  +FVG+
Sbjct  10   CCFCVVFAVFLLNSCFLVIGGDIVHQDNVAPHRPGCNNNFVLVKVPTWVNGNEVTQFVGL  69

Query  355  GARFGPTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDA  534
            GARFGPTLESKEKRANQTRLA ADPPDCCS PRNKLT EAILVHRGNCSFTTKA VA+ A
Sbjct  70   GARFGPTLESKEKRANQTRLAFADPPDCCSMPRNKLTSEAILVHRGNCSFTTKAKVAEAA  129

Query  535  GASAILIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSP  714
            GASAI+IINNQTELFKMVC+  E+D+DIGIPA+MLPQDAG S+IE + N S VSVQ+YSP
Sbjct  130  GASAIIIINNQTELFKMVCDPGESDVDIGIPAVMLPQDAGTSLIEFLRNSSTVSVQMYSP  189

Query  715  RRPVVDVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            +RP VDVAEVFLWLM+V TILCASYWSAW+AREAAI+QDK LKDGSD+Y G E TQS
Sbjct  190  KRPTVDVAEVFLWLMSVVTILCASYWSAWSAREAAIEQDKFLKDGSDDYGGKEVTQS  246



>gb|KDO86179.1| hypothetical protein CISIN_1g009437mg [Citrus sinensis]
Length=525

 Score =   358 bits (918),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 172/227 (76%), Positives = 192/227 (85%), Gaps = 0/227 (0%)
 Frame = +1

Query  205  LLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLES  384
            L+S   L   GDIVH D+ AP+R GCDNNFVLVKV TW++G E+ E+VGVGARFG TLE+
Sbjct  14   LVSSPCLASAGDIVHQDNNAPKRPGCDNNFVLVKVPTWVDGGEDTEYVGVGARFGRTLEA  73

Query  385  KEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINN  564
            KEK A+Q RL LADPPDCCSKP+NKLTGEAILVHRG CSFT KAN A++A ASAILIINN
Sbjct  74   KEKDASQNRLVLADPPDCCSKPKNKLTGEAILVHRGGCSFTAKANFAEEANASAILIINN  133

Query  565  QTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEV  744
            +TELFKMVCE NETD+DI IPAIMLPQDAG ++ + I N S+VSVQLYSPRRPVVDVAEV
Sbjct  134  KTELFKMVCESNETDVDIRIPAIMLPQDAGANLEKLIKNNSVVSVQLYSPRRPVVDVAEV  193

Query  745  FLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            FLWLMAV TILCASYWSAWTARE AI+ DKLLKDGSDE+  ME   S
Sbjct  194  FLWLMAVGTILCASYWSAWTARETAIELDKLLKDGSDEFSNMEGVNS  240



>ref|XP_006445025.1| hypothetical protein CICLE_v10019661mg [Citrus clementina]
 ref|XP_006491110.1| PREDICTED: signal peptide peptidase-like 4-like [Citrus sinensis]
 gb|ESR58265.1| hypothetical protein CICLE_v10019661mg [Citrus clementina]
 gb|KDO86178.1| hypothetical protein CISIN_1g009437mg [Citrus sinensis]
Length=535

 Score =   358 bits (919),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 172/227 (76%), Positives = 192/227 (85%), Gaps = 0/227 (0%)
 Frame = +1

Query  205  LLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLES  384
            L+S   L   GDIVH D+ AP+R GCDNNFVLVKV TW++G E+ E+VGVGARFG TLE+
Sbjct  14   LVSSPCLASAGDIVHQDNNAPKRPGCDNNFVLVKVPTWVDGGEDTEYVGVGARFGRTLEA  73

Query  385  KEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINN  564
            KEK A+Q RL LADPPDCCSKP+NKLTGEAILVHRG CSFT KAN A++A ASAILIINN
Sbjct  74   KEKDASQNRLVLADPPDCCSKPKNKLTGEAILVHRGGCSFTAKANFAEEANASAILIINN  133

Query  565  QTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEV  744
            +TELFKMVCE NETD+DI IPAIMLPQDAG ++ + I N S+VSVQLYSPRRPVVDVAEV
Sbjct  134  KTELFKMVCESNETDVDIRIPAIMLPQDAGANLEKLIKNNSVVSVQLYSPRRPVVDVAEV  193

Query  745  FLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            FLWLMAV TILCASYWSAWTARE AI+ DKLLKDGSDE+  ME   S
Sbjct  194  FLWLMAVGTILCASYWSAWTARETAIELDKLLKDGSDEFSNMEGVNS  240



>gb|KEH23365.1| signal peptide peptidase-like protein [Medicago truncatula]
Length=397

 Score =   353 bits (905),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 170/228 (75%), Positives = 192/228 (84%), Gaps = 4/228 (2%)
 Frame = +1

Query  190  AVVLWLLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFG  369
            +V + LL+ S     GDIVHHD +AP++ GCDNNFVLVKV   I+G E  E+VGVGARFG
Sbjct  11   SVFMLLLTFS---FAGDIVHHDSIAPKKPGCDNNFVLVKVPISIDGVESGEYVGVGARFG  67

Query  370  PTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAI  549
            PTLESKEKRAN TR+A+ADPPDCCSKP+NKLTGE ILVHRG CSFTTKAN+A++AGASAI
Sbjct  68   PTLESKEKRANHTRVAIADPPDCCSKPKNKLTGEIILVHRGQCSFTTKANIAEEAGASAI  127

Query  550  LIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVV  729
            LIINN   LFKMVCE NETD+DIGIPA+MLPQDAG ++   I NKS+VSVQLYSPRRP V
Sbjct  128  LIINNAKGLFKMVCE-NETDIDIGIPAVMLPQDAGVALKNYIQNKSIVSVQLYSPRRPQV  186

Query  730  DVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDEYCGME  873
            DVAEVFLWLMAV TILCASYWSAWTARE  I+Q+KLLKD SDE   +E
Sbjct  187  DVAEVFLWLMAVGTILCASYWSAWTAREGVIEQEKLLKDDSDELLNIE  234



>gb|KJB41346.1| hypothetical protein B456_007G099700 [Gossypium raimondii]
Length=387

 Score =   352 bits (903),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 167/209 (80%), Positives = 184/209 (88%), Gaps = 1/209 (0%)
 Frame = +1

Query  232  GGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTR  411
             GDIVH DDVAP+R GC NNFVLVKV TWING E+ E+VGVGARFGPTLESKEK AN TR
Sbjct  23   AGDIVHQDDVAPKRPGCANNFVLVKVPTWINGLEDNEYVGVGARFGPTLESKEKHANHTR  82

Query  412  LALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVC  591
            LALADPPDCCSKPRN+LTGE ILVHRGNCSFT KANVA++AGASAILIINNQTELFKMVC
Sbjct  83   LALADPPDCCSKPRNQLTGEVILVHRGNCSFTMKANVAEEAGASAILIINNQTELFKMVC  142

Query  592  EKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVAT  771
            E ++ D+DI IPA+MLPQDAG  + + I N +MVSV LYSP+RP VD+AEVFLWLMAV T
Sbjct  143  E-SDADVDIKIPALMLPQDAGSRLEKYISNNTMVSVALYSPKRPAVDIAEVFLWLMAVGT  201

Query  772  ILCASYWSAWTAREAAIQQDKLLKDGSDE  858
            ILCASYWSAWTARE AI+QDKLLKD S+E
Sbjct  202  ILCASYWSAWTAREVAIEQDKLLKDASEE  230



>ref|XP_004248045.1| PREDICTED: signal peptide peptidase-like 4 isoform X1 [Solanum 
lycopersicum]
Length=542

 Score =   356 bits (914),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 180/238 (76%), Positives = 201/238 (84%), Gaps = 3/238 (1%)
 Frame = +1

Query  172  YCSVPTAVVLWLLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVG  351
            +C V   V   LL+   LV GGDIVH D+VAP R GC+NNFVLVKV TW+NG E  +FVG
Sbjct  12   FCVVFAVV---LLNSCVLVIGGDIVHQDNVAPHRPGCNNNFVLVKVPTWVNGNEVTQFVG  68

Query  352  VGARFGPTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADD  531
            +GARFGPTLESKEKRANQTRLA ADPPDCCS PRNKLT EAILVHRGNCSFTTKA VA+ 
Sbjct  69   LGARFGPTLESKEKRANQTRLAFADPPDCCSMPRNKLTSEAILVHRGNCSFTTKAKVAEA  128

Query  532  AGASAILIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYS  711
            AGASAI+IINNQTELFKMVC+  E+D+DIGIPA+MLPQDAG S+IE + N S VSVQ+YS
Sbjct  129  AGASAIIIINNQTELFKMVCDPGESDVDIGIPAVMLPQDAGTSLIEFLRNSSTVSVQMYS  188

Query  712  PRRPVVDVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            P+RP VDVAEVFLWLM+V TILCASYWSAW+AREAAI+QDK LKDGSD+Y G E T S
Sbjct  189  PKRPAVDVAEVFLWLMSVVTILCASYWSAWSAREAAIEQDKFLKDGSDDYGGKEVTHS  246



>ref|XP_004492745.1| PREDICTED: signal peptide peptidase-like 4-like [Cicer arietinum]
Length=545

 Score =   356 bits (913),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 168/228 (74%), Positives = 194/228 (85%), Gaps = 4/228 (2%)
 Frame = +1

Query  190  AVVLWLLSCSALV----HGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVG  357
            AV  + LS   L      GGDIVH D++AP+  GCDNNFVLVK+  WI+G E  E+VGVG
Sbjct  10   AVFFFFLSVFMLFLTMSFGGDIVHPDNIAPKSPGCDNNFVLVKIPIWIDGVESDEYVGVG  69

Query  358  ARFGPTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAG  537
            ARFGPTLESKEKRAN TR+A+ADPPDCCSKP+NKLTGE ILVHRG CSFTTKAN+A++AG
Sbjct  70   ARFGPTLESKEKRANHTRVAIADPPDCCSKPKNKLTGEIILVHRGQCSFTTKANIAEEAG  129

Query  538  ASAILIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPR  717
            ASAILIINN+ ELFKMVCE+NETD+DIGIP++MLPQDAG+++ + I NKS VSVQLYSP 
Sbjct  130  ASAILIINNRAELFKMVCEENETDVDIGIPSVMLPQDAGETLEKYIHNKSTVSVQLYSPL  189

Query  718  RPVVDVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDEY  861
            R  VD+AEVFLWLMAV TILCASYWSAWTARE AI+++KLLKD SDEY
Sbjct  190  RTTVDIAEVFLWLMAVGTILCASYWSAWTAREGAIEREKLLKDDSDEY  237



>gb|KEH23366.1| signal peptide peptidase-like protein [Medicago truncatula]
Length=450

 Score =   352 bits (902),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 171/232 (74%), Positives = 193/232 (83%), Gaps = 4/232 (2%)
 Frame = +1

Query  190  AVVLWLLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFG  369
            +V + LL+ S     GDIVHHD +AP++ GCDNNFVLVKV   I+G E  E+VGVGARFG
Sbjct  11   SVFMLLLTFS---FAGDIVHHDSIAPKKPGCDNNFVLVKVPISIDGVESGEYVGVGARFG  67

Query  370  PTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAI  549
            PTLESKEKRAN TR+A+ADPPDCCSKP+NKLTGE ILVHRG CSFTTKAN+A++AGASAI
Sbjct  68   PTLESKEKRANHTRVAIADPPDCCSKPKNKLTGEIILVHRGQCSFTTKANIAEEAGASAI  127

Query  550  LIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVV  729
            LIINN   LFKMVCE NETD+DIGIPA+MLPQDAG ++   I NKS+VSVQLYSPRRP V
Sbjct  128  LIINNAKGLFKMVCE-NETDIDIGIPAVMLPQDAGVALKNYIQNKSIVSVQLYSPRRPQV  186

Query  730  DVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            DVAEVFLWLMAV TILCASYWSAWTARE  I+Q+KLLKD SDE   +E   S
Sbjct  187  DVAEVFLWLMAVGTILCASYWSAWTAREGVIEQEKLLKDDSDELLNIENAGS  238



>ref|XP_006375344.1| hypothetical protein POPTR_0014s08110g [Populus trichocarpa]
 gb|ERP53141.1| hypothetical protein POPTR_0014s08110g [Populus trichocarpa]
Length=504

 Score =   353 bits (905),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 167/216 (77%), Positives = 189/216 (88%), Gaps = 0/216 (0%)
 Frame = +1

Query  238  DIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRLA  417
            DIVH DDVAP+R GC+NNFVLVKV T+IN  E++E+VGVGARFG TLESKEK AN + LA
Sbjct  25   DIVHQDDVAPKRPGCENNFVLVKVPTYINDVEDIEYVGVGARFGLTLESKEKHANLSTLA  84

Query  418  LADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCEK  597
            LADPPDCCSKPRNKL+GE IL +RGNCSFT KANVA+DAGASAILIINN+TELFKMVCE 
Sbjct  85   LADPPDCCSKPRNKLSGEVILAYRGNCSFTAKANVAEDAGASAILIINNRTELFKMVCEV  144

Query  598  NETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATIL  777
            NETD+ IGI A+MLPQDAG S+ + + + S V VQLYSPRRPVVDVAEVFLWLMAV TIL
Sbjct  145  NETDVKIGIAAVMLPQDAGASLEKYLTSSSTVKVQLYSPRRPVVDVAEVFLWLMAVGTIL  204

Query  778  CASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            CASYWSAW+AREAAI+QDKLLKDGSDE+  M+  +S
Sbjct  205  CASYWSAWSAREAAIEQDKLLKDGSDEFIDMDGVRS  240



>gb|KHG08704.1| Signal peptide peptidase-like 2B [Gossypium arboreum]
Length=471

 Score =   351 bits (901),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 169/217 (78%), Positives = 187/217 (86%), Gaps = 1/217 (0%)
 Frame = +1

Query  235  GDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRL  414
            GDIVH DDVAP+R GC NNFVLVKV TWING E+ E+VGVGARFGPTLESKEK AN TRL
Sbjct  24   GDIVHQDDVAPKRPGCANNFVLVKVPTWINGLEDNEYVGVGARFGPTLESKEKHANHTRL  83

Query  415  ALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCE  594
            ALADPPDCCSKPRN+LTGE ILVHRGNCSFT KANVA++AGASAILIINNQTELFKMVCE
Sbjct  84   ALADPPDCCSKPRNQLTGEVILVHRGNCSFTMKANVAEEAGASAILIINNQTELFKMVCE  143

Query  595  KNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATI  774
             ++ D+DI IPA+MLPQDAG  + + I N +MVSV LYSP+RP VD+AEVFLWLMAV TI
Sbjct  144  -SDADVDIKIPALMLPQDAGSRLEKYISNNTMVSVALYSPKRPAVDIAEVFLWLMAVGTI  202

Query  775  LCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            LCASYWSAWTARE AI+QDKLLKD S+E   + A  S
Sbjct  203  LCASYWSAWTAREVAIEQDKLLKDASEEILEVGAGSS  239



>ref|XP_011036451.1| PREDICTED: signal peptide peptidase-like 4 [Populus euphratica]
Length=538

 Score =   353 bits (906),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 166/216 (77%), Positives = 189/216 (88%), Gaps = 0/216 (0%)
 Frame = +1

Query  238  DIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRLA  417
            DIVH DDVAP+R GC+NNFVLVKV T+ING E++E+VGVGARFG TLESKEK  N + LA
Sbjct  25   DIVHQDDVAPKRPGCENNFVLVKVPTYINGVEDIEYVGVGARFGLTLESKEKHTNLSTLA  84

Query  418  LADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCEK  597
            LADPPDCCSKPRNKL+GE IL HRGNCSFT KANVA+DAGASAILIINN+TELFKMVCE 
Sbjct  85   LADPPDCCSKPRNKLSGEVILAHRGNCSFTAKANVAEDAGASAILIINNRTELFKMVCEV  144

Query  598  NETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATIL  777
            NETD+ IGI ++MLPQDAG S+ + + + S V VQLYSPRRPVVDVAEVFLWLMAV TIL
Sbjct  145  NETDVKIGIASVMLPQDAGASLEKYLTSSSTVKVQLYSPRRPVVDVAEVFLWLMAVGTIL  204

Query  778  CASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            C+SYWSAW+AREAAI+QDKLLKDGSDE+  M+  +S
Sbjct  205  CSSYWSAWSAREAAIEQDKLLKDGSDEFIDMDGVRS  240



>gb|KJB41342.1| hypothetical protein B456_007G099700 [Gossypium raimondii]
Length=468

 Score =   350 bits (899),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 167/208 (80%), Positives = 184/208 (88%), Gaps = 1/208 (0%)
 Frame = +1

Query  235  GDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRL  414
            GDIVH DDVAP+R GC NNFVLVKV TWING E+ E+VGVGARFGPTLESKEK AN TRL
Sbjct  24   GDIVHQDDVAPKRPGCANNFVLVKVPTWINGLEDNEYVGVGARFGPTLESKEKHANHTRL  83

Query  415  ALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCE  594
            ALADPPDCCSKPRN+LTGE ILVHRGNCSFT KANVA++AGASAILIINNQTELFKMVCE
Sbjct  84   ALADPPDCCSKPRNQLTGEVILVHRGNCSFTMKANVAEEAGASAILIINNQTELFKMVCE  143

Query  595  KNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATI  774
             ++ D+DI IPA+MLPQDAG  + + I N +MVSV LYSP+RP VD+AEVFLWLMAV TI
Sbjct  144  -SDADVDIKIPALMLPQDAGSRLEKYISNNTMVSVALYSPKRPAVDIAEVFLWLMAVGTI  202

Query  775  LCASYWSAWTAREAAIQQDKLLKDGSDE  858
            LCASYWSAWTARE AI+QDKLLKD S+E
Sbjct  203  LCASYWSAWTAREVAIEQDKLLKDASEE  230



>ref|XP_006375345.1| hypothetical protein POPTR_0014s08110g [Populus trichocarpa]
 gb|ERP53142.1| hypothetical protein POPTR_0014s08110g [Populus trichocarpa]
Length=539

 Score =   352 bits (902),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 167/216 (77%), Positives = 189/216 (88%), Gaps = 0/216 (0%)
 Frame = +1

Query  238  DIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRLA  417
            DIVH DDVAP+R GC+NNFVLVKV T+IN  E++E+VGVGARFG TLESKEK AN + LA
Sbjct  25   DIVHQDDVAPKRPGCENNFVLVKVPTYINDVEDIEYVGVGARFGLTLESKEKHANLSTLA  84

Query  418  LADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCEK  597
            LADPPDCCSKPRNKL+GE IL +RGNCSFT KANVA+DAGASAILIINN+TELFKMVCE 
Sbjct  85   LADPPDCCSKPRNKLSGEVILAYRGNCSFTAKANVAEDAGASAILIINNRTELFKMVCEV  144

Query  598  NETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATIL  777
            NETD+ IGI A+MLPQDAG S+ + + + S V VQLYSPRRPVVDVAEVFLWLMAV TIL
Sbjct  145  NETDVKIGIAAVMLPQDAGASLEKYLTSSSTVKVQLYSPRRPVVDVAEVFLWLMAVGTIL  204

Query  778  CASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            CASYWSAW+AREAAI+QDKLLKDGSDE+  M+  +S
Sbjct  205  CASYWSAWSAREAAIEQDKLLKDGSDEFIDMDGVRS  240



>gb|KJB41345.1| hypothetical protein B456_007G099700 [Gossypium raimondii]
Length=507

 Score =   350 bits (899),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 167/208 (80%), Positives = 184/208 (88%), Gaps = 1/208 (0%)
 Frame = +1

Query  235  GDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRL  414
            GDIVH DDVAP+R GC NNFVLVKV TWING E+ E+VGVGARFGPTLESKEK AN TRL
Sbjct  24   GDIVHQDDVAPKRPGCANNFVLVKVPTWINGLEDNEYVGVGARFGPTLESKEKHANHTRL  83

Query  415  ALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCE  594
            ALADPPDCCSKPRN+LTGE ILVHRGNCSFT KANVA++AGASAILIINNQTELFKMVCE
Sbjct  84   ALADPPDCCSKPRNQLTGEVILVHRGNCSFTMKANVAEEAGASAILIINNQTELFKMVCE  143

Query  595  KNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATI  774
             ++ D+DI IPA+MLPQDAG  + + I N +MVSV LYSP+RP VD+AEVFLWLMAV TI
Sbjct  144  -SDADVDIKIPALMLPQDAGSRLEKYISNNTMVSVALYSPKRPAVDIAEVFLWLMAVGTI  202

Query  775  LCASYWSAWTAREAAIQQDKLLKDGSDE  858
            LCASYWSAWTARE AI+QDKLLKD S+E
Sbjct  203  LCASYWSAWTAREVAIEQDKLLKDASEE  230



>ref|XP_003623971.1| Signal peptide peptidase-like 2B [Medicago truncatula]
 gb|AES80189.1| signal peptide peptidase-like protein [Medicago truncatula]
Length=537

 Score =   351 bits (900),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 171/232 (74%), Positives = 193/232 (83%), Gaps = 4/232 (2%)
 Frame = +1

Query  190  AVVLWLLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFG  369
            +V + LL+ S     GDIVHHD +AP++ GCDNNFVLVKV   I+G E  E+VGVGARFG
Sbjct  11   SVFMLLLTFS---FAGDIVHHDSIAPKKPGCDNNFVLVKVPISIDGVESGEYVGVGARFG  67

Query  370  PTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAI  549
            PTLESKEKRAN TR+A+ADPPDCCSKP+NKLTGE ILVHRG CSFTTKAN+A++AGASAI
Sbjct  68   PTLESKEKRANHTRVAIADPPDCCSKPKNKLTGEIILVHRGQCSFTTKANIAEEAGASAI  127

Query  550  LIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVV  729
            LIINN   LFKMVCE NETD+DIGIPA+MLPQDAG ++   I NKS+VSVQLYSPRRP V
Sbjct  128  LIINNAKGLFKMVCE-NETDIDIGIPAVMLPQDAGVALKNYIQNKSIVSVQLYSPRRPQV  186

Query  730  DVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            DVAEVFLWLMAV TILCASYWSAWTARE  I+Q+KLLKD SDE   +E   S
Sbjct  187  DVAEVFLWLMAVGTILCASYWSAWTAREGVIEQEKLLKDDSDELLNIENAGS  238



>gb|KJB41338.1| hypothetical protein B456_007G099700 [Gossypium raimondii]
Length=538

 Score =   351 bits (900),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 167/208 (80%), Positives = 184/208 (88%), Gaps = 1/208 (0%)
 Frame = +1

Query  235  GDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRL  414
            GDIVH DDVAP+R GC NNFVLVKV TWING E+ E+VGVGARFGPTLESKEK AN TRL
Sbjct  24   GDIVHQDDVAPKRPGCANNFVLVKVPTWINGLEDNEYVGVGARFGPTLESKEKHANHTRL  83

Query  415  ALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCE  594
            ALADPPDCCSKPRN+LTGE ILVHRGNCSFT KANVA++AGASAILIINNQTELFKMVCE
Sbjct  84   ALADPPDCCSKPRNQLTGEVILVHRGNCSFTMKANVAEEAGASAILIINNQTELFKMVCE  143

Query  595  KNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATI  774
             ++ D+DI IPA+MLPQDAG  + + I N +MVSV LYSP+RP VD+AEVFLWLMAV TI
Sbjct  144  -SDADVDIKIPALMLPQDAGSRLEKYISNNTMVSVALYSPKRPAVDIAEVFLWLMAVGTI  202

Query  775  LCASYWSAWTAREAAIQQDKLLKDGSDE  858
            LCASYWSAWTARE AI+QDKLLKD S+E
Sbjct  203  LCASYWSAWTAREVAIEQDKLLKDASEE  230



>gb|KJB41343.1| hypothetical protein B456_007G099700 [Gossypium raimondii]
Length=538

 Score =   350 bits (899),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 167/208 (80%), Positives = 184/208 (88%), Gaps = 1/208 (0%)
 Frame = +1

Query  235  GDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRL  414
            GDIVH DDVAP+R GC NNFVLVKV TWING E+ E+VGVGARFGPTLESKEK AN TRL
Sbjct  24   GDIVHQDDVAPKRPGCANNFVLVKVPTWINGLEDNEYVGVGARFGPTLESKEKHANHTRL  83

Query  415  ALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCE  594
            ALADPPDCCSKPRN+LTGE ILVHRGNCSFT KANVA++AGASAILIINNQTELFKMVCE
Sbjct  84   ALADPPDCCSKPRNQLTGEVILVHRGNCSFTMKANVAEEAGASAILIINNQTELFKMVCE  143

Query  595  KNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATI  774
             ++ D+DI IPA+MLPQDAG  + + I N +MVSV LYSP+RP VD+AEVFLWLMAV TI
Sbjct  144  -SDADVDIKIPALMLPQDAGSRLEKYISNNTMVSVALYSPKRPAVDIAEVFLWLMAVGTI  202

Query  775  LCASYWSAWTAREAAIQQDKLLKDGSDE  858
            LCASYWSAWTARE AI+QDKLLKD S+E
Sbjct  203  LCASYWSAWTAREVAIEQDKLLKDASEE  230



>ref|XP_010544387.1| PREDICTED: signal peptide peptidase-like 4 [Tarenaya hassleriana]
Length=539

 Score =   349 bits (896),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 166/227 (73%), Positives = 188/227 (83%), Gaps = 0/227 (0%)
 Frame = +1

Query  205  LLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLES  384
            LL  ++    GDIVHHDD  P+R GCDNNFVLVKV T +NG E +E+VGVGARFGPTLES
Sbjct  16   LLYSASWASAGDIVHHDDTLPKRPGCDNNFVLVKVPTRVNGVEAVEYVGVGARFGPTLES  75

Query  385  KEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINN  564
            KEK A  TRLA+ADPPDCCS+P+NKLTGE ILVHRGNCSFTTKAN+A+ AGASA+LIINN
Sbjct  76   KEKHATLTRLAIADPPDCCSRPKNKLTGEIILVHRGNCSFTTKANIAESAGASAMLIINN  135

Query  565  QTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEV  744
             TELFKMVCE NET+LDI IP +MLP DAG+++   + N   V++QLYSP+RP VDVAEV
Sbjct  136  STELFKMVCEDNETNLDIHIPVVMLPFDAGRNLKSYMNNNDSVTLQLYSPKRPAVDVAEV  195

Query  745  FLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            FLWLMAV TILCASYWSAWTAREAAI+QDKLLKDGSDE      T S
Sbjct  196  FLWLMAVGTILCASYWSAWTAREAAIEQDKLLKDGSDELLQSATTSS  242



>gb|EYU32129.1| hypothetical protein MIMGU_mgv1a004245mg [Erythranthe guttata]
Length=537

 Score =   348 bits (894),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 162/227 (71%), Positives = 189/227 (83%), Gaps = 0/227 (0%)
 Frame = +1

Query  205  LLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLES  384
            LL C ++    DIVH DD+AP+R GCDN+FVLVKV  W+NGKE MEFVGVGARFGP L S
Sbjct  14   LLFCCSIAFADDIVHQDDIAPKRPGCDNDFVLVKVPVWVNGKEIMEFVGVGARFGPNLVS  73

Query  385  KEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINN  564
            KEKRANQT++ LADPPDCCSKP+NKL G+ ILVHRGNCSF TK N+A+ AGASA+LIIN+
Sbjct  74   KEKRANQTKVTLADPPDCCSKPKNKLVGDVILVHRGNCSFVTKGNIAEAAGASALLIINS  133

Query  565  QTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEV  744
            + ELFKMVCE NETD+ I IP +MLP+DAG S+ +N+ N S VS+Q+YSP+RP VDVAEV
Sbjct  134  EKELFKMVCEANETDVSIRIPVVMLPKDAGVSLKQNMANTSNVSIQIYSPQRPEVDVAEV  193

Query  745  FLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            FLWLMAV TILCASYWSAW+AREAAI+QDKLLKDG +EY   E   S
Sbjct  194  FLWLMAVGTILCASYWSAWSAREAAIEQDKLLKDGCEEYVCEENCHS  240



>ref|XP_008458226.1| PREDICTED: signal peptide peptidase-like 4 [Cucumis melo]
Length=539

 Score =   347 bits (891),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 166/217 (76%), Positives = 185/217 (85%), Gaps = 0/217 (0%)
 Frame = +1

Query  235  GDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRL  414
            GDIVH D VAP R GC+NNFVLVKV TW+NG E  E+VGVGARFGP+LESKEK A +TR+
Sbjct  25   GDIVHQDSVAPTRPGCENNFVLVKVPTWVNGVEATEYVGVGARFGPSLESKEKHATRTRV  84

Query  415  ALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCE  594
            ALADPPDCCS PRNKLTGE ILV RGNCSFT KAN+A+ A ASAILIINN  ELFKMVCE
Sbjct  85   ALADPPDCCSMPRNKLTGEVILVLRGNCSFTNKANIAEAANASAILIINNSKELFKMVCE  144

Query  595  KNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATI  774
            +NETD+ IGIPA+MLPQDAG+S+ +++ +   VSVQLYSP RPVVDVAEVFLWLMAV T+
Sbjct  145  ENETDVTIGIPAVMLPQDAGESLQKDLKSNISVSVQLYSPLRPVVDVAEVFLWLMAVGTV  204

Query  775  LCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            L ASYWSAWTARE AI+QDKLLKDGSDE   MEAT S
Sbjct  205  LLASYWSAWTAREVAIEQDKLLKDGSDELLQMEATGS  241



>ref|XP_004138500.1| PREDICTED: signal peptide peptidase-like 4 [Cucumis sativus]
 gb|KGN45662.1| hypothetical protein Csa_6G004530 [Cucumis sativus]
Length=539

 Score =   346 bits (888),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 165/217 (76%), Positives = 185/217 (85%), Gaps = 0/217 (0%)
 Frame = +1

Query  235  GDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRL  414
            GDIVH D VAP R GC+NNFVLVKV TW+NG E  E+VGVGARFGP+LESKEK A +TR+
Sbjct  25   GDIVHQDSVAPTRPGCENNFVLVKVPTWVNGVEATEYVGVGARFGPSLESKEKHATRTRV  84

Query  415  ALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCE  594
            ALADPPDCCS PRNKL GE ILV RGNCSFT+KAN+A+ A ASAILIINN  ELFKMVCE
Sbjct  85   ALADPPDCCSMPRNKLAGEVILVLRGNCSFTSKANIAEGANASAILIINNSKELFKMVCE  144

Query  595  KNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATI  774
            +NETD+ IGIPA+MLPQDAG+S+ +++ +   VSVQLYSP RPVVDVAEVFLWLMAV T+
Sbjct  145  ENETDVTIGIPAVMLPQDAGESLQKDLKSNISVSVQLYSPLRPVVDVAEVFLWLMAVGTV  204

Query  775  LCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            L ASYWSAWTARE AI+QDKLLKDGSDE   MEAT S
Sbjct  205  LLASYWSAWTAREVAIEQDKLLKDGSDELLQMEATGS  241



>gb|EPS63416.1| hypothetical protein M569_11364, partial [Genlisea aurea]
Length=437

 Score =   343 bits (879),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 165/229 (72%), Positives = 195/229 (85%), Gaps = 3/229 (1%)
 Frame = +1

Query  199  LWLLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTL  378
            L LL  S++V  GDIVH DD +P+R GCDNNFVLVKV  WI+G+EEM+FVGVGARFGPTL
Sbjct  1    LVLLVPSSVVFAGDIVHEDDKSPKRPGCDNNFVLVKVPIWIDGEEEMQFVGVGARFGPTL  60

Query  379  ESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILII  558
            ES+EKRANQT +ALADP DCCSKP+NKLTGEAI+VHRGNCSF TKANVA+DAGASA+LII
Sbjct  61   ESQEKRANQTTVALADPLDCCSKPKNKLTGEAIMVHRGNCSFVTKANVAEDAGASALLII  120

Query  559  NNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVA  738
            NNQT+L KMVC+++ETDL IGIP +MLPQDAG+S+  ++   S V++Q+YSP+RP+VDVA
Sbjct  121  NNQTDLLKMVCDEHETDLSIGIPIVMLPQDAGESLKRSMATNSHVAIQIYSPKRPLVDVA  180

Query  739  EVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            EVFLWLMAV+TILCASYWSA +AREAAI+   LLKD SD Y   E   S
Sbjct  181  EVFLWLMAVSTILCASYWSASSAREAAIE---LLKDDSDFYQKKETHNS  226



>ref|XP_007051789.1| Signal peptide peptidase-like 4 [Theobroma cacao]
 gb|EOX95946.1| Signal peptide peptidase-like 4 [Theobroma cacao]
Length=538

 Score =   344 bits (883),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 167/224 (75%), Positives = 193/224 (86%), Gaps = 2/224 (1%)
 Frame = +1

Query  193  VVLWLLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGP  372
            V+L ++  + L   GDIVH D+VAP+R GC NNFVLVKV TWIN  E+ E+VGVGARFGP
Sbjct  10   VILIVVLSAGLGSAGDIVHQDNVAPKRPGCANNFVLVKVPTWINSLEDNEYVGVGARFGP  69

Query  373  TLESKEKRANQTRLALADPPDCCSKPRNKLT-GEAILVHRGNCSFTTKANVADDAGASAI  549
            TLESKEK A++TRLALADPPDCCSKPRN+LT GE ILVHRGNCSFTTKANVA++ GASAI
Sbjct  70   TLESKEKHASRTRLALADPPDCCSKPRNQLTEGEVILVHRGNCSFTTKANVAEEVGASAI  129

Query  550  LIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVV  729
            LIINNQTELFKMVCE ++ D+DI IPA+MLPQDAG ++ + I N +MVSV LYSP+RP V
Sbjct  130  LIINNQTELFKMVCE-SDADVDIQIPAVMLPQDAGSNLEKYINNNTMVSVALYSPKRPAV  188

Query  730  DVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDEY  861
            DVAEVFLWLMAV TILCASYWSAWTARE AI+QDKLLKD S+++
Sbjct  189  DVAEVFLWLMAVGTILCASYWSAWTAREVAIEQDKLLKDASEQF  232



>ref|XP_010255329.1| PREDICTED: signal peptide peptidase-like 4 [Nelumbo nucifera]
Length=538

 Score =   344 bits (882),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 167/243 (69%), Positives = 197/243 (81%), Gaps = 2/243 (1%)
 Frame = +1

Query  148  MELRSTAPYCSVPTAVVLWLLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWING  327
            M+L+    + +  +AVVL  L   A V  GDIVH DD AP++ GC NNFVLVKV TW++G
Sbjct  1    MDLQRVFFWVTCFSAVVL--LWTPASVIAGDIVHQDDEAPKKPGCSNNFVLVKVQTWVDG  58

Query  328  KEEMEFVGVGARFGPTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFT  507
            KE  EFVGVGARFG T+ESKEK ANQT+L+L+DPPDCCS+P+NKL G+ ILVHRGNC+FT
Sbjct  59   KEGNEFVGVGARFGTTMESKEKHANQTKLSLSDPPDCCSQPKNKLIGDVILVHRGNCTFT  118

Query  508  TKANVADDAGASAILIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKS  687
             KANVA  AGASAILIINN+ ELFKMVC+  ETDLDI IPA+MLPQDAG  +  +    S
Sbjct  119  KKANVAQAAGASAILIINNKKELFKMVCDPKETDLDIHIPAVMLPQDAGVILETSFKKNS  178

Query  688  MVSVQLYSPRRPVVDVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDEYCG  867
             V+VQLYSP+RP+VD+AEVFLWLMAV TILCASYWSAW+AREAAI+QDKLLKD SDE+  
Sbjct  179  SVAVQLYSPQRPLVDIAEVFLWLMAVGTILCASYWSAWSAREAAIEQDKLLKDASDEFVN  238

Query  868  MEA  876
            +EA
Sbjct  239  VEA  241



>emb|CDY38021.1| BnaCnng08820D [Brassica napus]
Length=540

 Score =   343 bits (880),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 163/223 (73%), Positives = 187/223 (84%), Gaps = 0/223 (0%)
 Frame = +1

Query  217  SALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKR  396
            ++LV GGDIVHHDD  P+R GC+NNFVLVKV T ++GKE+ EFVGVGARFGPTLESKEK 
Sbjct  22   ASLVCGGDIVHHDDSIPQRPGCNNNFVLVKVPTRVDGKEKEEFVGVGARFGPTLESKEKH  81

Query  397  ANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTEL  576
            A   +LALADPPDCC+ P++KLTGE ILVHRGNCSFTTK  VA+ AGASAILIINN T+L
Sbjct  82   ATLIKLALADPPDCCTTPKSKLTGEVILVHRGNCSFTTKTKVAEAAGASAILIINNSTDL  141

Query  577  FKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWL  756
            FKMVCEK E  LDI IP +MLP DAG+S+ E + + S+V++QLYSP+RP VDVAEVFLWL
Sbjct  142  FKMVCEKGENVLDINIPVVMLPIDAGRSLEETVQSNSIVTLQLYSPKRPAVDVAEVFLWL  201

Query  757  MAVATILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            MAV TILCASYWSAWTARE AI+QDKLLKDGSDE   +  T S
Sbjct  202  MAVGTILCASYWSAWTAREEAIEQDKLLKDGSDELLQVSTTSS  244



>ref|XP_010087957.1| Signal peptide peptidase-like 2B [Morus notabilis]
 gb|EXB30879.1| Signal peptide peptidase-like 2B [Morus notabilis]
Length=476

 Score =   341 bits (874),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 161/232 (69%), Positives = 191/232 (82%), Gaps = 1/232 (0%)
 Frame = +1

Query  193  VVLWLLSCS-ALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFG  369
            VVL +++ S  L   GDIVHHD++AP+R GCDNNFVLVKV TW+NG E  E+VGVGARFG
Sbjct  9    VVLLVMAVSLKLGSAGDIVHHDNIAPKRPGCDNNFVLVKVPTWVNGLETSEYVGVGARFG  68

Query  370  PTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAI  549
            PTLESKE+RAN TR+ LADPPD CS P+  L+GE +LVHRGNCSFTTKAN+A+ A ASA+
Sbjct  69   PTLESKERRANHTRVILADPPDYCSPPKKNLSGEIVLVHRGNCSFTTKANIAETANASAV  128

Query  550  LIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVV  729
            LIIN +TELFKMVCE  ETDL+I IPA+MLPQDAG  + +++ N   VSVQLYSP RP+V
Sbjct  129  LIINYETELFKMVCEDKETDLNISIPAVMLPQDAGTILEDDLKNNFRVSVQLYSPLRPLV  188

Query  730  DVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            D+AEVFLWLMAV TILCASYWSAWT REAA++QDKLLKD S+E    E ++S
Sbjct  189  DIAEVFLWLMAVGTILCASYWSAWTTREAALEQDKLLKDASEETLNAEGSES  240



>gb|KHG19371.1| Signal peptide peptidase-like 2B [Gossypium arboreum]
Length=536

 Score =   342 bits (878),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 163/217 (75%), Positives = 187/217 (86%), Gaps = 1/217 (0%)
 Frame = +1

Query  235  GDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRL  414
            GDIVH D+VAP+R GC NNFVLVKV TWI G E+ E+VGVGARFGPTLESKEK A+ T+L
Sbjct  24   GDIVHIDNVAPKRPGCSNNFVLVKVPTWIEGLEDNEYVGVGARFGPTLESKEKHASHTKL  83

Query  415  ALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCE  594
            ALADPPDCCSKPRNKLTGE ILVHRGNCSFT KANVA++AGASAILIINNQTELFKMVCE
Sbjct  84   ALADPPDCCSKPRNKLTGEVILVHRGNCSFTVKANVAEEAGASAILIINNQTELFKMVCE  143

Query  595  KNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATI  774
             ++ D++I IPA+MLPQDAG  + + I N +MVSV LYSP+RP VD+AEVFLWLMAV TI
Sbjct  144  -SDADVNIKIPAVMLPQDAGSRLEKYITNNTMVSVALYSPKRPAVDIAEVFLWLMAVGTI  202

Query  775  LCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            LCASYWSAWTARE AI+Q+KLLK+ S+E+  + A  S
Sbjct  203  LCASYWSAWTAREVAIEQEKLLKNASEEFLQVGAAGS  239



>ref|XP_002274726.1| PREDICTED: signal peptide peptidase-like 4 [Vitis vinifera]
 emb|CBI40384.3| unnamed protein product [Vitis vinifera]
Length=534

 Score =   342 bits (877),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 158/219 (72%), Positives = 186/219 (85%), Gaps = 0/219 (0%)
 Frame = +1

Query  229  HGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQT  408
              GDIVH DD+AP++ GC+NNFVLVKV TW++ +E  E+VGVGARFGPTLESKEK ANQT
Sbjct  22   FAGDIVHQDDIAPKKPGCENNFVLVKVPTWVDHEEGNEYVGVGARFGPTLESKEKHANQT  81

Query  409  RLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMV  588
             L LADPPDCCS P+NKLTGE ILV+RGNCSFT KA VA++AGASA+LI+NNQTELFKMV
Sbjct  82   TLTLADPPDCCSTPKNKLTGEVILVYRGNCSFTNKAKVAENAGASAVLIVNNQTELFKMV  141

Query  589  CEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVA  768
            CE NET ++I IP +MLPQDAG S+ +++ N S V+VQLYSP+RP+VD+AEVFLWLMAV 
Sbjct  142  CEANETAINISIPVVMLPQDAGASLEKSLKNNSSVAVQLYSPKRPLVDIAEVFLWLMAVG  201

Query  769  TILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            TIL ASYWSAW+AREAA +QDKLLKD SDE+   E T S
Sbjct  202  TILSASYWSAWSAREAANEQDKLLKDASDEFLSTEGTGS  240



>ref|XP_006418441.1| hypothetical protein EUTSA_v10007312mg [Eutrema salsugineum]
 gb|ESQ36794.1| hypothetical protein EUTSA_v10007312mg [Eutrema salsugineum]
Length=538

 Score =   341 bits (875),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 162/232 (70%), Positives = 189/232 (81%), Gaps = 0/232 (0%)
 Frame = +1

Query  190  AVVLWLLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFG  369
             +V  LL  ++LV  GDIVHHD+  P+R GC+NNFVLVKV T ++G E++E+VGVGARFG
Sbjct  11   VLVFGLLYSASLVSAGDIVHHDNSLPQRPGCNNNFVLVKVPTRVDGVEQVEYVGVGARFG  70

Query  370  PTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAI  549
            PTLESKEK A   +LA+ADPPDCCS P NKLTGE ILVHRGNCSFTTK  VA+ AGASAI
Sbjct  71   PTLESKEKHATLIKLAIADPPDCCSTPTNKLTGEVILVHRGNCSFTTKTKVAEAAGASAI  130

Query  550  LIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVV  729
            LIINN T+LFKMVCEK E  LDI IP +MLP DAG+++ E + N S+V++QLYSP+RP V
Sbjct  131  LIINNSTDLFKMVCEKGENVLDITIPVVMLPVDAGRNLEETVKNNSIVTLQLYSPKRPAV  190

Query  730  DVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            DVAEVFLWLMAV TILCASYWSAWTARE A++QDKLLKDGSDE   +  T S
Sbjct  191  DVAEVFLWLMAVGTILCASYWSAWTAREEAVEQDKLLKDGSDEPLQLSTTSS  242



>ref|XP_009367843.1| PREDICTED: signal peptide peptidase-like 4 isoform X1 [Pyrus 
x bretschneideri]
Length=539

 Score =   340 bits (873),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 159/218 (73%), Positives = 183/218 (84%), Gaps = 0/218 (0%)
 Frame = +1

Query  232  GGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTR  411
             GDIVHHDD+AP+R GC+NNFVLVKV TWING E+ E+VGVGARFGPTLESKEK A  TR
Sbjct  23   AGDIVHHDDIAPKRPGCNNNFVLVKVPTWINGIEDAEYVGVGARFGPTLESKEKYATNTR  82

Query  412  LALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVC  591
            + LADPPDCC++P+NKL  E ILVHRGNCSFTTKAN+A+ A ASAILIINN+TEL+KMVC
Sbjct  83   VVLADPPDCCTRPKNKLAKEVILVHRGNCSFTTKANMAEAANASAILIINNRTELYKMVC  142

Query  592  EKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVAT  771
            EK+E D+ IGIPA+MLPQD G     ++MN S VSVQLYSP RP+VD+AEVFLWLMAV T
Sbjct  143  EKDEPDVKIGIPAVMLPQDVGAIFETDLMNNSTVSVQLYSPLRPLVDIAEVFLWLMAVGT  202

Query  772  ILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            IL ASYWSAW+AREAAI+ +KLLKD SD    ME  +S
Sbjct  203  ILFASYWSAWSAREAAIEHEKLLKDASDNSLHMEVDRS  240



>gb|KHG15007.1| Signal peptide peptidase-like 2B [Gossypium arboreum]
Length=553

 Score =   341 bits (874),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 161/215 (75%), Positives = 183/215 (85%), Gaps = 1/215 (0%)
 Frame = +1

Query  217  SALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKR  396
            +  V  GDIVH D+VAP+R GC NNFVLVKV  WI+G E  E+VGVGARFGPTLESKEK 
Sbjct  17   AGFVSAGDIVHQDNVAPKRPGCANNFVLVKVPIWIDGLENTEYVGVGARFGPTLESKEKH  76

Query  397  ANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTEL  576
            AN TRLALADPPDCCSKPRN+LTGE ILVHRGNCSFT KANVA++AGASAILI+NNQTEL
Sbjct  77   ANHTRLALADPPDCCSKPRNQLTGEVILVHRGNCSFTVKANVAEEAGASAILIVNNQTEL  136

Query  577  FKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWL  756
            FKMVCE ++ D++I IPA+MLPQDAG ++   I N + VSV LYSP+RP VD+AEVFLWL
Sbjct  137  FKMVCE-SDADVNIKIPAVMLPQDAGSNLENYINNNTRVSVALYSPKRPAVDIAEVFLWL  195

Query  757  MAVATILCASYWSAWTAREAAIQQDKLLKDGSDEY  861
            MAV TIL ASYWSAWTARE AI+QDKLLKD S+E+
Sbjct  196  MAVGTILLASYWSAWTAREVAIEQDKLLKDASEEF  230



>ref|XP_009367844.1| PREDICTED: signal peptide peptidase-like 4 isoform X2 [Pyrus 
x bretschneideri]
Length=537

 Score =   340 bits (872),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 159/218 (73%), Positives = 183/218 (84%), Gaps = 0/218 (0%)
 Frame = +1

Query  232  GGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTR  411
             GDIVHHDD+AP+R GC+NNFVLVKV TWING E+ E+VGVGARFGPTLESKEK A  TR
Sbjct  23   AGDIVHHDDIAPKRPGCNNNFVLVKVPTWINGIEDAEYVGVGARFGPTLESKEKYATNTR  82

Query  412  LALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVC  591
            + LADPPDCC++P+NKL  E ILVHRGNCSFTTKAN+A+ A ASAILIINN+TEL+KMVC
Sbjct  83   VVLADPPDCCTRPKNKLAKEVILVHRGNCSFTTKANMAEAANASAILIINNRTELYKMVC  142

Query  592  EKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVAT  771
            EK+E D+ IGIPA+MLPQD G     ++MN S VSVQLYSP RP+VD+AEVFLWLMAV T
Sbjct  143  EKDEPDVKIGIPAVMLPQDVGAIFETDLMNNSTVSVQLYSPLRPLVDIAEVFLWLMAVGT  202

Query  772  ILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            IL ASYWSAW+AREAAI+ +KLLKD SD    ME  +S
Sbjct  203  ILFASYWSAWSAREAAIEHEKLLKDASDNSLHMEVDRS  240



>ref|XP_010474771.1| PREDICTED: signal peptide peptidase-like 4 [Camelina sativa]
Length=541

 Score =   340 bits (873),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 161/227 (71%), Positives = 183/227 (81%), Gaps = 0/227 (0%)
 Frame = +1

Query  205  LLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLES  384
            LL  ++LV  GDIVHHDD  P+R GC+NNFVLVKV T +NG E ME+VGVGARFGPTLES
Sbjct  17   LLYSASLVSAGDIVHHDDSLPQRPGCNNNFVLVKVPTRVNGTEYMEYVGVGARFGPTLES  76

Query  385  KEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINN  564
            KEK A   +LA+ADPPDCCS P+NKLTGE ILVHRG CSFTTK  +A+ AGASAILIINN
Sbjct  77   KEKHATLIKLAIADPPDCCSTPKNKLTGEVILVHRGKCSFTTKTKIAEAAGASAILIINN  136

Query  565  QTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEV  744
             T+LFKMVCEK E  LDI IP +MLP DAG+S+   + + S V++QLYSP+RP VDVAEV
Sbjct  137  STDLFKMVCEKGENVLDITIPVVMLPVDAGRSLENIVQSNSTVTLQLYSPKRPAVDVAEV  196

Query  745  FLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            FLWLMAV TILCASYWSAWT RE AI+QDKLLKDGSDE   +  T S
Sbjct  197  FLWLMAVGTILCASYWSAWTVREEAIEQDKLLKDGSDELLQLSTTSS  243



>ref|XP_009118826.1| PREDICTED: signal peptide peptidase-like 4 [Brassica rapa]
Length=539

 Score =   340 bits (872),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 162/223 (73%), Positives = 185/223 (83%), Gaps = 0/223 (0%)
 Frame = +1

Query  217  SALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKR  396
            ++LV GGDIVHHDD  P+R GC+NNFVLVKV T ++GKE+ EFVGVGARFGPTLESKEK 
Sbjct  21   ASLVCGGDIVHHDDSIPQRPGCNNNFVLVKVPTRVDGKEKEEFVGVGARFGPTLESKEKH  80

Query  397  ANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTEL  576
            A   +LALADPP CC+ P++KLTGE ILVHRGNCSFTTK  VA+ AGASAILIINN T+L
Sbjct  81   ATLIKLALADPPHCCTTPKSKLTGEVILVHRGNCSFTTKTKVAEAAGASAILIINNSTDL  140

Query  577  FKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWL  756
            FKMVCEK E  LDI IP +MLP DAG+S+ E + + S+V++QLYSP+RP VDVAEVFLWL
Sbjct  141  FKMVCEKGENVLDINIPVVMLPIDAGRSLEETVQSNSIVTLQLYSPKRPAVDVAEVFLWL  200

Query  757  MAVATILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            MAV TILCASYWSAWTARE AI QDKLLKDGSDE   +  T S
Sbjct  201  MAVGTILCASYWSAWTAREEAIAQDKLLKDGSDELLQVSTTSS  243



>gb|KJB24745.1| hypothetical protein B456_004G158800 [Gossypium raimondii]
Length=511

 Score =   339 bits (869),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 182/215 (85%), Gaps = 1/215 (0%)
 Frame = +1

Query  217  SALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKR  396
            +  V  GDIVH D+VAP+R GC NNFVLVKV  WI+G E  E+VGVGARFGPT+ESKEK 
Sbjct  17   AGFVSAGDIVHQDNVAPKRPGCANNFVLVKVPIWIDGLENTEYVGVGARFGPTMESKEKH  76

Query  397  ANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTEL  576
            AN TRLALADPPDCCSKPRN+LTGE ILVHRGNCSFT KANVA++AGASAILIINNQTEL
Sbjct  77   ANHTRLALADPPDCCSKPRNQLTGEVILVHRGNCSFTVKANVAEEAGASAILIINNQTEL  136

Query  577  FKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWL  756
            FKMVCE ++ D++I IPA+MLPQDAG ++   I N + VSV  YSP+RP VD+AEVFLWL
Sbjct  137  FKMVCE-SDADVNIKIPAVMLPQDAGSNLENYINNNTRVSVAFYSPKRPAVDIAEVFLWL  195

Query  757  MAVATILCASYWSAWTAREAAIQQDKLLKDGSDEY  861
            MAV TIL ASYWSAWTA+E AI+QDKLLKD S+E+
Sbjct  196  MAVGTILLASYWSAWTAKEVAIEQDKLLKDASEEF  230



>ref|XP_002889358.1| peptidase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65617.1| peptidase [Arabidopsis lyrata subsp. lyrata]
Length=540

 Score =   340 bits (872),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 161/227 (71%), Positives = 183/227 (81%), Gaps = 0/227 (0%)
 Frame = +1

Query  205  LLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLES  384
            LL  ++ V  GDIVHHDD  P+R GC+NNFVLVKV T +NG E  EFVGVGARFGPTLES
Sbjct  17   LLYSASFVSAGDIVHHDDSLPQRPGCNNNFVLVKVPTRVNGSEYTEFVGVGARFGPTLES  76

Query  385  KEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINN  564
            KEK A   +LA+ADPPDCCS P+NKLTGE ILVHRG CSFTTK  VA+ AGASAILIINN
Sbjct  77   KEKHATLIKLAIADPPDCCSTPKNKLTGEVILVHRGKCSFTTKTKVAEAAGASAILIINN  136

Query  565  QTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEV  744
             T+LFKMVCEK E  LDI IP +MLP DAG+S+ + + + S+V++QLYSP+RP VDVAEV
Sbjct  137  STDLFKMVCEKGENVLDITIPVVMLPVDAGRSLEDIVKSNSLVTLQLYSPKRPAVDVAEV  196

Query  745  FLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            FLWLMAV TILCASYWSAWT RE AI+QDKLLKDGSDE   +  T S
Sbjct  197  FLWLMAVGTILCASYWSAWTVREEAIEQDKLLKDGSDELLQLSTTSS  243



>gb|KJB09813.1| hypothetical protein B456_001G169100 [Gossypium raimondii]
 gb|KJB09814.1| hypothetical protein B456_001G169100 [Gossypium raimondii]
Length=538

 Score =   339 bits (870),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 162/217 (75%), Positives = 185/217 (85%), Gaps = 1/217 (0%)
 Frame = +1

Query  235  GDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRL  414
            GDIVH D+VAP+R GC NNFVLVKV TW+ G E+ E+VGVGARFGPTLESKEK A+ T L
Sbjct  24   GDIVHIDNVAPKRPGCSNNFVLVKVPTWVEGLEDNEYVGVGARFGPTLESKEKHASHTEL  83

Query  415  ALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCE  594
            ALADPPDCCSKPRNKLTGE ILV RGNCSFT KANVA++AGASAILIINNQTELFKMVCE
Sbjct  84   ALADPPDCCSKPRNKLTGEVILVQRGNCSFTVKANVAEEAGASAILIINNQTELFKMVCE  143

Query  595  KNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATI  774
             ++ D++I IPA+MLPQDAG  + + I N +MVSV LYSP+RP VD+AEVFLWLMAV TI
Sbjct  144  -SDADVNIKIPAVMLPQDAGSRLEKYITNTTMVSVALYSPKRPAVDIAEVFLWLMAVGTI  202

Query  775  LCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            LCASYWSAWTARE AI+Q+KLLKD S+E+  + A  S
Sbjct  203  LCASYWSAWTAREVAIEQEKLLKDASEEFLQVGAAGS  239



>ref|XP_008340980.1| PREDICTED: signal peptide peptidase-like 4 isoform X2 [Malus 
domestica]
Length=537

 Score =   339 bits (869),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 158/218 (72%), Positives = 184/218 (84%), Gaps = 0/218 (0%)
 Frame = +1

Query  232  GGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTR  411
             GDIVHHDD+AP+R GC+NNFVLVKV  WING E+ E+VGVGARFGPTLESKEK A  T 
Sbjct  23   AGDIVHHDDIAPKRPGCNNNFVLVKVPXWINGIEDAEYVGVGARFGPTLESKEKYATNTX  82

Query  412  LALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVC  591
            + LADPPDCC++P+NKLT E ILVHRGNCSFTTKAN+A+ A ASAILIINN+TEL+KMVC
Sbjct  83   VVLADPPDCCTQPKNKLTKEVILVHRGNCSFTTKANMAEAANASAILIINNRTELYKMVC  142

Query  592  EKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVAT  771
            EK+E D++IGIPA+MLPQD G     ++ N SMVSVQLYSP RP+VD+AEVFLWLMAV T
Sbjct  143  EKDEPDVEIGIPAVMLPQDVGAIFETDLKNNSMVSVQLYSPLRPLVDIAEVFLWLMAVGT  202

Query  772  ILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            IL ASYWSAW+AREAAI+ +KLLKD SD+   ME  +S
Sbjct  203  ILFASYWSAWSAREAAIEHEKLLKDASDDSLHMEVDRS  240



>ref|XP_010480022.1| PREDICTED: signal peptide peptidase-like 4 isoform X1 [Camelina 
sativa]
Length=541

 Score =   339 bits (869),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 160/227 (70%), Positives = 183/227 (81%), Gaps = 0/227 (0%)
 Frame = +1

Query  205  LLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLES  384
            LL  ++LV  GDIVHHDD  P+R GC+NNFVLVKV T +NG E ME+VGVGARFGPTLES
Sbjct  17   LLYSASLVSAGDIVHHDDSLPQRPGCNNNFVLVKVPTRVNGTEYMEYVGVGARFGPTLES  76

Query  385  KEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINN  564
            KEK A   +LA+ADPPDCCS P+NKLTGE ILVHRG CSFTTK  +A+ AGASAILIINN
Sbjct  77   KEKHATLIKLAIADPPDCCSTPKNKLTGEVILVHRGKCSFTTKTKIAEAAGASAILIINN  136

Query  565  QTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEV  744
             T+LFKMVCEK E  LDI IP +MLP DAG+S+   + + + V++QLYSP+RP VDVAEV
Sbjct  137  STDLFKMVCEKGENVLDITIPVVMLPVDAGRSLENIVQSNNTVTLQLYSPKRPAVDVAEV  196

Query  745  FLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            FLWLMAV TILCASYWSAWT RE AI+QDKLLKDGSDE   +  T S
Sbjct  197  FLWLMAVGTILCASYWSAWTVREEAIEQDKLLKDGSDELLQLSTTSS  243



>ref|XP_008340922.1| PREDICTED: signal peptide peptidase-like 4 isoform X1 [Malus 
domestica]
Length=539

 Score =   339 bits (869),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 158/218 (72%), Positives = 184/218 (84%), Gaps = 0/218 (0%)
 Frame = +1

Query  232  GGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTR  411
             GDIVHHDD+AP+R GC+NNFVLVKV  WING E+ E+VGVGARFGPTLESKEK A  T 
Sbjct  23   AGDIVHHDDIAPKRPGCNNNFVLVKVPXWINGIEDAEYVGVGARFGPTLESKEKYATNTX  82

Query  412  LALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVC  591
            + LADPPDCC++P+NKLT E ILVHRGNCSFTTKAN+A+ A ASAILIINN+TEL+KMVC
Sbjct  83   VVLADPPDCCTQPKNKLTKEVILVHRGNCSFTTKANMAEAANASAILIINNRTELYKMVC  142

Query  592  EKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVAT  771
            EK+E D++IGIPA+MLPQD G     ++ N SMVSVQLYSP RP+VD+AEVFLWLMAV T
Sbjct  143  EKDEPDVEIGIPAVMLPQDVGAIFETDLKNNSMVSVQLYSPLRPLVDIAEVFLWLMAVGT  202

Query  772  ILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            IL ASYWSAW+AREAAI+ +KLLKD SD+   ME  +S
Sbjct  203  ILFASYWSAWSAREAAIEHEKLLKDASDDSLHMEVDRS  240



>gb|KJB24744.1| hypothetical protein B456_004G158800 [Gossypium raimondii]
Length=537

 Score =   338 bits (867),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 182/215 (85%), Gaps = 1/215 (0%)
 Frame = +1

Query  217  SALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKR  396
            +  V  GDIVH D+VAP+R GC NNFVLVKV  WI+G E  E+VGVGARFGPT+ESKEK 
Sbjct  17   AGFVSAGDIVHQDNVAPKRPGCANNFVLVKVPIWIDGLENTEYVGVGARFGPTMESKEKH  76

Query  397  ANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTEL  576
            AN TRLALADPPDCCSKPRN+LTGE ILVHRGNCSFT KANVA++AGASAILIINNQTEL
Sbjct  77   ANHTRLALADPPDCCSKPRNQLTGEVILVHRGNCSFTVKANVAEEAGASAILIINNQTEL  136

Query  577  FKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWL  756
            FKMVCE ++ D++I IPA+MLPQDAG ++   I N + VSV  YSP+RP VD+AEVFLWL
Sbjct  137  FKMVCE-SDADVNIKIPAVMLPQDAGSNLENYINNNTRVSVAFYSPKRPAVDIAEVFLWL  195

Query  757  MAVATILCASYWSAWTAREAAIQQDKLLKDGSDEY  861
            MAV TIL ASYWSAWTA+E AI+QDKLLKD S+E+
Sbjct  196  MAVGTILLASYWSAWTAKEVAIEQDKLLKDASEEF  230



>gb|KJB24746.1| hypothetical protein B456_004G158800 [Gossypium raimondii]
Length=535

 Score =   338 bits (867),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 182/215 (85%), Gaps = 1/215 (0%)
 Frame = +1

Query  217  SALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKR  396
            +  V  GDIVH D+VAP+R GC NNFVLVKV  WI+G E  E+VGVGARFGPT+ESKEK 
Sbjct  17   AGFVSAGDIVHQDNVAPKRPGCANNFVLVKVPIWIDGLENTEYVGVGARFGPTMESKEKH  76

Query  397  ANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTEL  576
            AN TRLALADPPDCCSKPRN+LTGE ILVHRGNCSFT KANVA++AGASAILIINNQTEL
Sbjct  77   ANHTRLALADPPDCCSKPRNQLTGEVILVHRGNCSFTVKANVAEEAGASAILIINNQTEL  136

Query  577  FKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWL  756
            FKMVCE ++ D++I IPA+MLPQDAG ++   I N + VSV  YSP+RP VD+AEVFLWL
Sbjct  137  FKMVCE-SDADVNIKIPAVMLPQDAGSNLENYINNNTRVSVAFYSPKRPAVDIAEVFLWL  195

Query  757  MAVATILCASYWSAWTAREAAIQQDKLLKDGSDEY  861
            MAV TIL ASYWSAWTA+E AI+QDKLLKD S+E+
Sbjct  196  MAVGTILLASYWSAWTAKEVAIEQDKLLKDASEEF  230



>ref|XP_002511870.1| Minor histocompatibility antigen H13, putative [Ricinus communis]
 gb|EEF50539.1| Minor histocompatibility antigen H13, putative [Ricinus communis]
Length=538

 Score =   338 bits (866),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 159/216 (74%), Positives = 184/216 (85%), Gaps = 0/216 (0%)
 Frame = +1

Query  238  DIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRLA  417
            DIVHHDDVAP+R GC+N+FVLVKVATW++G E +E+VGVGARFGPTLESKEKRAN+TRL 
Sbjct  25   DIVHHDDVAPKRPGCNNDFVLVKVATWVDGIENIEYVGVGARFGPTLESKEKRANKTRLV  84

Query  418  LADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCEK  597
            LADPPD C  P+NKL  + ILV RGNCSFTTK+N+A++A ASAILIIN +TELFKMVCE 
Sbjct  85   LADPPDLCILPKNKLNRDVILVRRGNCSFTTKSNIAEEANASAILIINYRTELFKMVCEA  144

Query  598  NETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATIL  777
            NE D+ IGIPA+MLPQDAG S+   + N S VSVQLYSP+RP+VDVAEVFLWLMAV TIL
Sbjct  145  NEADVIIGIPAVMLPQDAGASLEHYVKNSSTVSVQLYSPQRPLVDVAEVFLWLMAVGTIL  204

Query  778  CASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
             ASYWSAW+ARE AI+QDKLLKDGSD++   E   S
Sbjct  205  GASYWSAWSAREVAIEQDKLLKDGSDDFQQTEGVPS  240



>ref|XP_010457099.1| PREDICTED: signal peptide peptidase-like 4 [Camelina sativa]
Length=577

 Score =   339 bits (869),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 172/267 (64%), Positives = 197/267 (74%), Gaps = 5/267 (2%)
 Frame = +1

Query  91   PPFL--HLLKRRDF*GSVVEVMELRSTAPYCSVPTAVVLWLLSCSALVHGGDIVHHDDVA  264
            PPFL         F  SV  +M L  T    S  + V   LL  ++LV  GDIVHHDD  
Sbjct  16   PPFLTASSSSSSSFYDSVEPIMILWKT---LSCFSFVFGLLLYSASLVSAGDIVHHDDSL  72

Query  265  PRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRLALADPPDCCS  444
            P+R GC+NNFVLVKV T +NG E ME+VGVGARFGPTLESKEK A   +LA+ADPPDCCS
Sbjct  73   PQRPGCNNNFVLVKVPTRVNGTEYMEYVGVGARFGPTLESKEKHATLIKLAIADPPDCCS  132

Query  445  KPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCEKNETDLDIGI  624
             P+NKLTGE ILVHRG CSFTTK  +A+ AGASAILIINN T+LFKMVCEK E  LDI I
Sbjct  133  TPKNKLTGEVILVHRGKCSFTTKTKIAEAAGASAILIINNSTDLFKMVCEKGENVLDITI  192

Query  625  PAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATILCASYWSAWT  804
            P +MLP DAG+S+   + + + V++QLYSP+RP VDVAEVFLWLMAV TILCASYWSAWT
Sbjct  193  PVVMLPVDAGRSLENIVKSNNTVTLQLYSPKRPAVDVAEVFLWLMAVGTILCASYWSAWT  252

Query  805  AREAAIQQDKLLKDGSDEYCGMEATQS  885
             RE AI+QDKLLKDGSDE   +  T S
Sbjct  253  VREEAIEQDKLLKDGSDELLQLSTTSS  279



>ref|XP_007219545.1| hypothetical protein PRUPE_ppa003988mg [Prunus persica]
 gb|EMJ20744.1| hypothetical protein PRUPE_ppa003988mg [Prunus persica]
Length=536

 Score =   337 bits (865),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 157/218 (72%), Positives = 182/218 (83%), Gaps = 0/218 (0%)
 Frame = +1

Query  232  GGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTR  411
             GDIVHHD++AP+R GC+NNFVLVKV TW+NG E+ E+VGVGARFGPTLESKEK A   R
Sbjct  23   AGDIVHHDNIAPKRPGCENNFVLVKVPTWVNGVEDSEYVGVGARFGPTLESKEKHATNMR  82

Query  412  LALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVC  591
            + LADPPDCCS P NKL+ + ILVHRGNCSFT KAN+A+ A ASAILIINN+TELFKMVC
Sbjct  83   VVLADPPDCCSTPNNKLSQDVILVHRGNCSFTRKANIAEAANASAILIINNRTELFKMVC  142

Query  592  EKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVAT  771
            E +E D+ IGIPA+MLPQD G  +  ++MNKS VSVQLYSP RPVVD+AEVFLWLMAV T
Sbjct  143  EDDEPDVQIGIPAVMLPQDVGAILENDLMNKSKVSVQLYSPLRPVVDIAEVFLWLMAVGT  202

Query  772  ILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            I+ ASYWSAW+AREAAI+ DKLLKD SD+   ME  +S
Sbjct  203  IIFASYWSAWSAREAAIEHDKLLKDASDDSLHMEVDRS  240



>ref|XP_009340097.1| PREDICTED: signal peptide peptidase-like 4 [Pyrus x bretschneideri]
Length=537

 Score =   337 bits (865),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 158/217 (73%), Positives = 182/217 (84%), Gaps = 0/217 (0%)
 Frame = +1

Query  235  GDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRL  414
            GDIVHHD++AP+R GCDNNFVLVKV TWING E+ E+VGVGARFGPTLESKEK A  TR+
Sbjct  24   GDIVHHDNIAPKRPGCDNNFVLVKVPTWINGLEDAEYVGVGARFGPTLESKEKHATNTRV  83

Query  415  ALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCE  594
             LADPPDCCS P+ KLT E ILVHRGNCSFTTKAN+A+ A ASAILIINN+TELFKMVCE
Sbjct  84   VLADPPDCCSLPKKKLTKEVILVHRGNCSFTTKANMAEAANASAILIINNRTELFKMVCE  143

Query  595  KNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATI  774
             +E D++IGIPA+MLPQD G     ++ N SMVSVQLYSP RP+VD+AEVFLWLMAV TI
Sbjct  144  NDEPDVEIGIPAVMLPQDVGAIFETDLKNGSMVSVQLYSPLRPLVDIAEVFLWLMAVGTI  203

Query  775  LCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            L ASYWS W+AREAAI+ +KLLKD SD+   +E  +S
Sbjct  204  LFASYWSVWSAREAAIEHEKLLKDASDDSLPIEVDRS  240



>gb|KCW78081.1| hypothetical protein EUGRSUZ_D02301 [Eucalyptus grandis]
Length=382

 Score =   331 bits (849),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 159/231 (69%), Positives = 192/231 (83%), Gaps = 3/231 (1%)
 Frame = +1

Query  202  WLL-SCSAL--VHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGP  372
            WLL +C +L  V  GDIVH DDVAP+RAGC+NNFVLVKV TW+NG E++E+VGVGARFG 
Sbjct  13   WLLVACLSLRPVFSGDIVHQDDVAPKRAGCENNFVLVKVPTWLNGVEDIEYVGVGARFGL  72

Query  373  TLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAIL  552
            TLESKEK AN T++ +ADPPD C++P+ KL GE ++V RGNCSFTTK+N+A+DA A+AIL
Sbjct  73   TLESKEKHANNTKVVIADPPDFCTRPKEKLKGEVVVVQRGNCSFTTKSNIAEDANATAIL  132

Query  553  IINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVD  732
            IINN TELFKMVCE N+TD+ IGIPA+MLPQDAG ++ + I   + VSVQLYSP+RP+VD
Sbjct  133  IINNGTELFKMVCEVNQTDVKIGIPAVMLPQDAGANLEKLIKTYTNVSVQLYSPQRPLVD  192

Query  733  VAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            VAEVFLWLMAV TILCASYWSA +AREAAI+ +KLLKD SDE   +E   S
Sbjct  193  VAEVFLWLMAVGTILCASYWSARSAREAAIEHEKLLKDASDELGEIEGIGS  243



>ref|XP_008338843.1| PREDICTED: signal peptide peptidase-like 4 [Malus domestica]
Length=535

 Score =   336 bits (862),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 157/217 (72%), Positives = 183/217 (84%), Gaps = 0/217 (0%)
 Frame = +1

Query  235  GDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRL  414
            GDIVHHD++AP+R GC+N+FVLVKV TWING E+ E+VGVGARFGPTLESKEK A  TR+
Sbjct  24   GDIVHHDNIAPKRPGCENDFVLVKVPTWINGXEDAEYVGVGARFGPTLESKEKHATNTRV  83

Query  415  ALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCE  594
             LADPPDCCS P+NKL  E ILVHRGNCSFTTKAN+A+ A ASAILIINN+TELFKMVCE
Sbjct  84   VLADPPDCCSLPKNKLAKEVILVHRGNCSFTTKANMAEAANASAILIINNRTELFKMVCE  143

Query  595  KNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATI  774
             +E D++IGIPA+MLPQD G     ++ N SMVSVQLYSP RP+VD+AEVFLWLMAV TI
Sbjct  144  NDEPDVEIGIPAVMLPQDVGXIFETDLKNNSMVSVQLYSPLRPLVDIAEVFLWLMAVGTI  203

Query  775  LCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            L ASYWSAW+AREAAI+ +KLLKD SD+   +E  +S
Sbjct  204  LFASYWSAWSAREAAIEHEKLLKDASDDSLPIEVDRS  240



>ref|XP_010670265.1| PREDICTED: signal peptide peptidase-like 4 [Beta vulgaris subsp. 
vulgaris]
Length=536

 Score =   335 bits (860),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 157/211 (74%), Positives = 183/211 (87%), Gaps = 1/211 (0%)
 Frame = +1

Query  226  VHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQ  405
            V+GGDIVH DD AP++ GC+NNFVLVKV TW++G E+ E+VG+GARFGPTLESKEK ANQ
Sbjct  22   VYGGDIVHEDDTAPKKPGCENNFVLVKVPTWVDGFEDSEYVGIGARFGPTLESKEKHANQ  81

Query  406  TRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKM  585
            TRLA+ADPPDCCS P+NKLTGEAILV+RGNCSFTTK N+A+DAGASAILI+NN TELFKM
Sbjct  82   TRLAIADPPDCCSPPKNKLTGEAILVYRGNCSFTTKTNIAEDAGASAILIVNNSTELFKM  141

Query  586  VCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAV  765
            VCE ++ D +I IPA+MLP  AG+ + + + N S V VQLYSP+RP VDVAEVFLWLMAV
Sbjct  142  VCE-DDADTNIRIPAVMLPIYAGEVLEDLLSNNSRVYVQLYSPKRPAVDVAEVFLWLMAV  200

Query  766  ATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
             TILCASYWSAW AREAAI+ DK+LKD SDE
Sbjct  201  GTILCASYWSAWNAREAAIEHDKILKDASDE  231



>ref|XP_006303940.1| hypothetical protein CARUB_v10008675mg, partial [Capsella rubella]
 gb|EOA36838.1| hypothetical protein CARUB_v10008675mg, partial [Capsella rubella]
Length=583

 Score =   337 bits (864),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 159/227 (70%), Positives = 182/227 (80%), Gaps = 1/227 (0%)
 Frame = +1

Query  205  LLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLES  384
            LL  ++ V  GDIVHHDD  P+R GC+NNFVLVKV T +NG E MEFVGVGARFGPTLES
Sbjct  61   LLYSASFVSAGDIVHHDDSLPQRPGCNNNFVLVKVPTRVNGTESMEFVGVGARFGPTLES  120

Query  385  KEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINN  564
            KEK A   +LA+ADPPDCC+ P+NKLTGE ILVHRG CSFT K  +A+ AGASAILIINN
Sbjct  121  KEKHATLIKLAIADPPDCCTTPKNKLTGEVILVHRGKCSFTAKTKIAEAAGASAILIINN  180

Query  565  QTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEV  744
             T+LFKMVCEK E  LDI IP +MLP DAG+S+ E ++  S V++QLYSP+RP VDVAEV
Sbjct  181  STDLFKMVCEKGENVLDITIPVVMLPVDAGRSL-ETVVKTSTVTLQLYSPKRPAVDVAEV  239

Query  745  FLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            FLWLMAV TILCASYWSAWT +E AI+QDKLLKDGSDE   +  T S
Sbjct  240  FLWLMAVGTILCASYWSAWTVKEEAIEQDKLLKDGSDELLQLSTTSS  286



>gb|KCW78080.1| hypothetical protein EUGRSUZ_D02301 [Eucalyptus grandis]
Length=432

 Score =   332 bits (851),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 159/231 (69%), Positives = 192/231 (83%), Gaps = 3/231 (1%)
 Frame = +1

Query  202  WLL-SCSAL--VHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGP  372
            WLL +C +L  V  GDIVH DDVAP+RAGC+NNFVLVKV TW+NG E++E+VGVGARFG 
Sbjct  13   WLLVACLSLRPVFSGDIVHQDDVAPKRAGCENNFVLVKVPTWLNGVEDIEYVGVGARFGL  72

Query  373  TLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAIL  552
            TLESKEK AN T++ +ADPPD C++P+ KL GE ++V RGNCSFTTK+N+A+DA A+AIL
Sbjct  73   TLESKEKHANNTKVVIADPPDFCTRPKEKLKGEVVVVQRGNCSFTTKSNIAEDANATAIL  132

Query  553  IINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVD  732
            IINN TELFKMVCE N+TD+ IGIPA+MLPQDAG ++ + I   + VSVQLYSP+RP+VD
Sbjct  133  IINNGTELFKMVCEVNQTDVKIGIPAVMLPQDAGANLEKLIKTYTNVSVQLYSPQRPLVD  192

Query  733  VAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            VAEVFLWLMAV TILCASYWSA +AREAAI+ +KLLKD SDE   +E   S
Sbjct  193  VAEVFLWLMAVGTILCASYWSARSAREAAIEHEKLLKDASDELGEIEGIGS  243



>ref|NP_171671.2| signal peptide peptidase-like 4 [Arabidopsis thaliana]
 sp|Q0WMJ8.1|SIPL4_ARATH RecName: Full=Signal peptide peptidase-like 4; Short=AtSPPL4; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAF01653.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE27317.1| signal peptide peptidase-like 4 [Arabidopsis thaliana]
Length=540

 Score =   335 bits (859),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 159/227 (70%), Positives = 182/227 (80%), Gaps = 0/227 (0%)
 Frame = +1

Query  205  LLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLES  384
            LL  ++ V  GDIVHHDD  P+R GC+NNFVLVKV T +NG E  E+VGVGARFGPTLES
Sbjct  17   LLYSASFVCAGDIVHHDDSLPQRPGCNNNFVLVKVPTRVNGSEYTEYVGVGARFGPTLES  76

Query  385  KEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINN  564
            KEK A   +LA+ADPPDCCS P+NKLTGE ILVHRG CSFTTK  VA+ AGASAILIINN
Sbjct  77   KEKHATLIKLAIADPPDCCSTPKNKLTGEVILVHRGKCSFTTKTKVAEAAGASAILIINN  136

Query  565  QTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEV  744
             T+LFKMVCEK E  LDI IP +MLP DAG+S+   + + ++V++QLYSP+RP VDVAEV
Sbjct  137  STDLFKMVCEKGENVLDITIPVVMLPVDAGRSLENIVKSNAIVTLQLYSPKRPAVDVAEV  196

Query  745  FLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            FLWLMAV TILCASYWSAWT RE AI+QDKLLKDGSDE   +  T S
Sbjct  197  FLWLMAVGTILCASYWSAWTVREEAIEQDKLLKDGSDELLQLSTTSS  243



>ref|XP_004306779.2| PREDICTED: signal peptide peptidase-like 4 [Fragaria vesca subsp. 
vesca]
Length=547

 Score =   335 bits (858),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 158/220 (72%), Positives = 186/220 (85%), Gaps = 2/220 (1%)
 Frame = +1

Query  220  ALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRA  399
            +L   GDIVHHDD+AP+R GC+N+FVLVKV TWI+G E  E+VGVGARFGPTLESKEKRA
Sbjct  26   SLSSAGDIVHHDDIAPKRPGCENDFVLVKVPTWIDGVEANEYVGVGARFGPTLESKEKRA  85

Query  400  NQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELF  579
            N TR+ LADPPDCC+KP+NKL  + ILVHRGNCSFTTKAN+A+ A ASAILIINN+ ELF
Sbjct  86   NHTRVVLADPPDCCTKPKNKLAHDVILVHRGNCSFTTKANMAESANASAILIINNRPELF  145

Query  580  KMVCEKNETDLDIGIPAIMLPQDAGQSMIENIM-NKSMVSVQLYSPRRPVVDVAEVFLWL  756
            KMVCE +E D++IGIPA+MLP   G+ ++EN++ N S VSVQLYSP RP+VD+AEVFLWL
Sbjct  146  KMVCEDDEPDIEIGIPAVMLPNKIGE-ILENVLTNHSTVSVQLYSPLRPLVDIAEVFLWL  204

Query  757  MAVATILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEA  876
            MAV TI+ ASYWSAWTAREA+I+ DKLLKD SDE   ME 
Sbjct  205  MAVGTIIFASYWSAWTAREASIEHDKLLKDASDESSHMEG  244



>ref|XP_002301360.2| hypothetical protein POPTR_0002s16180g [Populus trichocarpa]
 gb|EEE80633.2| hypothetical protein POPTR_0002s16180g [Populus trichocarpa]
Length=528

 Score =   332 bits (850),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 165/227 (73%), Positives = 183/227 (81%), Gaps = 9/227 (4%)
 Frame = +1

Query  205  LLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLES  384
            L S   L   GDIVHHDDVAP+R GC+NNFVLVKV TWING E++E+VGVGARFG TLES
Sbjct  14   LASSFCLGSAGDIVHHDDVAPKRPGCENNFVLVKVPTWINGVEDIEYVGVGARFGLTLES  73

Query  385  KEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINN  564
            KEK AN   LALADPPDC          E IL HRGNCSFTTKANVA+DAGASAILIINN
Sbjct  74   KEKHANLFILALADPPDCW---------EIILAHRGNCSFTTKANVAEDAGASAILIINN  124

Query  565  QTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEV  744
            +TELFKMVCE NETD+ IGI ++MLPQDAG S+ + + + S V VQLYSPRRPVVDVAEV
Sbjct  125  RTELFKMVCEVNETDVKIGIASVMLPQDAGASLEKYLTSSSSVKVQLYSPRRPVVDVAEV  184

Query  745  FLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            FLWLMAV TILCASYWSAW+AREAAI+QDKLLKDG DE   M+  +S
Sbjct  185  FLWLMAVGTILCASYWSAWSAREAAIEQDKLLKDGLDELIHMDGVRS  231



>ref|XP_009396168.1| PREDICTED: signal peptide peptidase-like 4 [Musa acuminata subsp. 
malaccensis]
Length=531

 Score =   331 bits (848),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 159/232 (69%), Positives = 185/232 (80%), Gaps = 1/232 (0%)
 Frame = +1

Query  190  AVVLWLLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFG  369
            A+VL LL+    VHGGDIVH DD AP+  GC NNFVLVKV TWIN  E+ EFVGVGARFG
Sbjct  9    ALVLVLLT-PGFVHGGDIVHEDDEAPKLPGCSNNFVLVKVQTWINNTEDNEFVGVGARFG  67

Query  370  PTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAI  549
            PT+ SKEK AN+TRL L+DPPDCC+ P  KL G+ +LVHRG+C FTTKA VA+ AGASAI
Sbjct  68   PTIVSKEKHANRTRLTLSDPPDCCTAPTKKLAGDVLLVHRGHCKFTTKAKVAEAAGASAI  127

Query  550  LIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVV  729
            LIINN  EL+KMVC++NETDL+I IPA+MLPQDAG S+  ++ +   VSVQLYSP RP+V
Sbjct  128  LIINNHKELYKMVCDRNETDLNIKIPAVMLPQDAGASLESSLKHGFSVSVQLYSPDRPLV  187

Query  730  DVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            D AEVFLWLMA+ TILCASYWSAW+AREA I+ +KLLKD  DE   ME T S
Sbjct  188  DTAEVFLWLMAIGTILCASYWSAWSAREALIEHEKLLKDAPDELLNMENTGS  239



>ref|XP_002274996.2| PREDICTED: signal peptide peptidase-like 2 [Vitis vinifera]
 emb|CBI34660.3| unnamed protein product [Vitis vinifera]
Length=548

 Score =   331 bits (848),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 158/229 (69%), Positives = 188/229 (82%), Gaps = 1/229 (0%)
 Frame = +1

Query  175  CSVPTAVVLWLLSC-SALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVG  351
            C V  A  + L  C S+ V  GDIVH DD AP++ GC+N+FVLVKV TW++G E+ EFVG
Sbjct  7    CCVILAFAVVLFVCFSSSVTAGDIVHDDDDAPKKPGCENDFVLVKVQTWVDGVEDAEFVG  66

Query  352  VGARFGPTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADD  531
            VGARFGP + SKEK A+Q+ L L+DPPDCC+ PR +L  + I+VHRGNC FTTKANVA+ 
Sbjct  67   VGARFGPKIVSKEKNAHQSHLTLSDPPDCCTAPRKQLARDVIMVHRGNCRFTTKANVAEA  126

Query  532  AGASAILIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYS  711
            AGASA+LIINNQ EL+KMVCE +ETDLDI IPA+MLPQ+AG S+ + + N S VSVQLYS
Sbjct  127  AGASAVLIINNQKELYKMVCEPDETDLDIKIPAVMLPQEAGASLEKMLRNSSSVSVQLYS  186

Query  712  PRRPVVDVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
            PRRP+VD+AEVFLWLMAV TILCASYWSAW+AREAAI+QDKLLKD SDE
Sbjct  187  PRRPLVDIAEVFLWLMAVGTILCASYWSAWSAREAAIEQDKLLKDASDE  235



>ref|XP_009600060.1| PREDICTED: signal peptide peptidase-like 2 [Nicotiana tomentosiformis]
Length=543

 Score =   330 bits (846),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 154/222 (69%), Positives = 185/222 (83%), Gaps = 0/222 (0%)
 Frame = +1

Query  193  VVLWLLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGP  372
            V+ + L+C A V  GDIVHHDD+AP++ GC+N+FVLVKV TWI+GKE+ EFVGVGARFG 
Sbjct  14   VLFFSLNCPAKVTAGDIVHHDDLAPKKPGCENDFVLVKVQTWIDGKEDAEFVGVGARFGT  73

Query  373  TLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAIL  552
            T+ SKEK A QT L L+DP DCC  PR KL GE I+V RG+C FTTKAN A+ AGASAIL
Sbjct  74   TIVSKEKNAQQTPLTLSDPRDCCKPPRKKLAGEVIMVDRGHCKFTTKANNAEAAGASAIL  133

Query  553  IINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVD  732
            I+NNQ EL+KMVC+  ETDLDI IPA+MLPQDAG ++ + ++N+S V+VQLYSPRRPVVD
Sbjct  134  IVNNQKELYKMVCDPEETDLDIHIPAVMLPQDAGATLDKMLLNRSSVTVQLYSPRRPVVD  193

Query  733  VAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
            +AEVFLWLMAV TILC SYW+AW+AREAAI+ DKLLKD S+E
Sbjct  194  IAEVFLWLMAVGTILCGSYWAAWSAREAAIEHDKLLKDASEE  235



>ref|XP_010053719.1| PREDICTED: signal peptide peptidase-like 4 isoform X1 [Eucalyptus 
grandis]
 gb|KCW78079.1| hypothetical protein EUGRSUZ_D02301 [Eucalyptus grandis]
Length=539

 Score =   330 bits (846),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 159/231 (69%), Positives = 192/231 (83%), Gaps = 3/231 (1%)
 Frame = +1

Query  202  WLL-SCSAL--VHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGP  372
            WLL +C +L  V  GDIVH DDVAP+RAGC+NNFVLVKV TW+NG E++E+VGVGARFG 
Sbjct  13   WLLVACLSLRPVFSGDIVHQDDVAPKRAGCENNFVLVKVPTWLNGVEDIEYVGVGARFGL  72

Query  373  TLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAIL  552
            TLESKEK AN T++ +ADPPD C++P+ KL GE ++V RGNCSFTTK+N+A+DA A+AIL
Sbjct  73   TLESKEKHANNTKVVIADPPDFCTRPKEKLKGEVVVVQRGNCSFTTKSNIAEDANATAIL  132

Query  553  IINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVD  732
            IINN TELFKMVCE N+TD+ IGIPA+MLPQDAG ++ + I   + VSVQLYSP+RP+VD
Sbjct  133  IINNGTELFKMVCEVNQTDVKIGIPAVMLPQDAGANLEKLIKTYTNVSVQLYSPQRPLVD  192

Query  733  VAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            VAEVFLWLMAV TILCASYWSA +AREAAI+ +KLLKD SDE   +E   S
Sbjct  193  VAEVFLWLMAVGTILCASYWSARSAREAAIEHEKLLKDASDELGEIEGIGS  243



>ref|XP_007209873.1| hypothetical protein PRUPE_ppa003858mg [Prunus persica]
 gb|EMJ11072.1| hypothetical protein PRUPE_ppa003858mg [Prunus persica]
Length=544

 Score =   329 bits (843),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 154/226 (68%), Positives = 190/226 (84%), Gaps = 0/226 (0%)
 Frame = +1

Query  181  VPTAVVLWLLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGA  360
            V  + ++ L+S  + V  GDIVH DD AP++ GC+NNFVLVKV TW++G E  EFVGVGA
Sbjct  10   VFVSALILLVSEPSSVTAGDIVHDDDSAPKKPGCENNFVLVKVQTWVDGVEANEFVGVGA  69

Query  361  RFGPTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGA  540
            RFG T+ESKEK+A QTRL L++P DCC+KP+NKL G+ I+V RG+C FTTKAN+A +A A
Sbjct  70   RFGTTIESKEKKAQQTRLILSNPRDCCNKPKNKLAGDVIMVDRGHCKFTTKANIAQEANA  129

Query  541  SAILIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRR  720
            SA+LI+NNQ EL+KMVCE +ET LDI IPA+MLPQDAG ++ + +MN S+VSVQLYSP+R
Sbjct  130  SAVLIVNNQKELYKMVCEPDETALDIHIPAVMLPQDAGATLEKMLMNNSLVSVQLYSPQR  189

Query  721  PVVDVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
            PVVD+AEVFLWLMAV TILCASYWSAW+AREA+I+QDKLLKD SDE
Sbjct  190  PVVDIAEVFLWLMAVGTILCASYWSAWSAREASIEQDKLLKDASDE  235



>ref|XP_008232889.1| PREDICTED: signal peptide peptidase-like 4 [Prunus mume]
Length=535

 Score =   328 bits (842),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 155/218 (71%), Positives = 181/218 (83%), Gaps = 1/218 (0%)
 Frame = +1

Query  232  GGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTR  411
             GDIVHHD++AP+R GC+NNFVLVKV TW+NG E+ E+VGVGARFGPTLESKEK A  TR
Sbjct  23   AGDIVHHDNIAPKRPGCENNFVLVKVPTWVNGVEDNEYVGVGARFGPTLESKEKHATNTR  82

Query  412  LALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVC  591
            + LADPPDCCS P+ KL+ E IL HRGNCSFT KAN+A+ A ASAILIINN+TELFKMVC
Sbjct  83   VVLADPPDCCS-PQKKLSQEVILAHRGNCSFTAKANIAEGANASAILIINNRTELFKMVC  141

Query  592  EKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVAT  771
            E +E D++I IPA+MLPQD G  +  ++MNK  VSVQLYSP RPVVD+AEVFLWLMAV T
Sbjct  142  EDDEPDVEIDIPAVMLPQDVGAILENDLMNKFKVSVQLYSPLRPVVDIAEVFLWLMAVGT  201

Query  772  ILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            I+ ASYWSAW+AREAAI+ DKLLKD SD+   ME  +S
Sbjct  202  IIFASYWSAWSAREAAIEHDKLLKDASDDSLHMEVDRS  239



>ref|XP_011080942.1| PREDICTED: signal peptide peptidase-like 2 [Sesamum indicum]
Length=542

 Score =   327 bits (839),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 158/237 (67%), Positives = 188/237 (79%), Gaps = 1/237 (0%)
 Frame = +1

Query  148  MELRSTAPYCSVPTAVVLWLLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWING  327
            M  R       V  A+++WL S +  V  GDIVH DD AP++ GC+N+FVLVKV TW+NG
Sbjct  1    MGFRRIWSLICVGAALLVWLSSPTG-VTAGDIVHDDDSAPKKPGCENDFVLVKVQTWVNG  59

Query  328  KEEMEFVGVGARFGPTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFT  507
             E+ EFVGVGARFG T+ SKEK ANQ+RL+L+DP DCC   + K  G+ I+V RGNC FT
Sbjct  60   VEDEEFVGVGARFGTTIVSKEKNANQSRLSLSDPRDCCGPAKKKFAGDVIMVDRGNCKFT  119

Query  508  TKANVADDAGASAILIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKS  687
            TKAN A+ AGASA+LIINNQ EL+KMVCE +ETDLDI IPA+MLPQDAG ++ + + N S
Sbjct  120  TKANFAEAAGASAVLIINNQRELYKMVCEPDETDLDIHIPAVMLPQDAGATLEKMLSNGS  179

Query  688  MVSVQLYSPRRPVVDVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
             VSVQLYSPRRPVVD+AEVFLWLMAV TILCASYWSAW+AREAAI+QDKLLKD +DE
Sbjct  180  SVSVQLYSPRRPVVDIAEVFLWLMAVGTILCASYWSAWSAREAAIEQDKLLKDATDE  236



>ref|XP_009780084.1| PREDICTED: signal peptide peptidase-like 2 [Nicotiana sylvestris]
Length=546

 Score =   327 bits (839),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 155/235 (66%), Positives = 188/235 (80%), Gaps = 0/235 (0%)
 Frame = +1

Query  154  LRSTAPYCSVPTAVVLWLLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKE  333
            +R  +    +   V+ + L+  A V  GDIVHHDD+AP++ GC+N+FVLVKV TWI+GKE
Sbjct  1    MRIISSLICIYGLVLFFSLNYPAKVTAGDIVHHDDLAPKKPGCENDFVLVKVQTWIDGKE  60

Query  334  EMEFVGVGARFGPTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTK  513
            + EFVGVGARFG T+ SKEK A QT L L+DP DCC  PR KL GE I+V RG+C FTTK
Sbjct  61   DAEFVGVGARFGTTIVSKEKNAQQTPLTLSDPRDCCKPPRKKLAGEVIMVDRGHCKFTTK  120

Query  514  ANVADDAGASAILIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMV  693
            AN A+ AGASAILI+NNQ EL+KMVC+  ETDLDI IPAIMLPQDAG ++ + ++N+S V
Sbjct  121  ANNAEAAGASAILIVNNQKELYKMVCDPEETDLDIHIPAIMLPQDAGATLDKMLLNRSSV  180

Query  694  SVQLYSPRRPVVDVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
            +VQLYSPRRPVVD+AEVFLWLMAV TILC SYW+AW+AREAAI+ DKLLKD S+E
Sbjct  181  TVQLYSPRRPVVDIAEVFLWLMAVGTILCGSYWAAWSAREAAIEHDKLLKDASEE  235



>ref|XP_006339581.1| PREDICTED: signal peptide peptidase-like 4-like isoform X2 [Solanum 
tuberosum]
Length=515

 Score =   326 bits (835),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 164/237 (69%), Positives = 181/237 (76%), Gaps = 24/237 (10%)
 Frame = +1

Query  175  CSVPTAVVLWLLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGV  354
            CS+    V+ L+ C+ LV GGDIVH DD+AP R GC NNFVLVKV  W++G E  EFVGV
Sbjct  8    CSICAVFVVVLVLCTGLVSGGDIVHQDDIAPSRPGCSNNFVLVKVPIWVDGIEVTEFVGV  67

Query  355  GARFGPTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDA  534
            GARFGPTLESKEKRANQTRLA ADPPDCCS PRNKLTGEAILVHRGNCSFTTKANVA+DA
Sbjct  68   GARFGPTLESKEKRANQTRLAFADPPDCCSTPRNKLTGEAILVHRGNCSFTTKANVAEDA  127

Query  535  GASAILIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSP  714
            GASAILIINNQTELFKMVCE +E DLDIGIPAIMLPQ AG S+I+ + N S         
Sbjct  128  GASAILIINNQTELFKMVCEPHEPDLDIGIPAIMLPQHAGTSLIKFLGNSS---------  178

Query  715  RRPVVDVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
                           +VATILCASYWSAW AREAAI+QDKLLKDGS+E    E ++S
Sbjct  179  ---------------SVATILCASYWSAWRAREAAIEQDKLLKDGSNECNVTEGSRS  220



>ref|XP_008437291.1| PREDICTED: signal peptide peptidase-like 2 [Cucumis melo]
 ref|XP_008437292.1| PREDICTED: signal peptide peptidase-like 2 [Cucumis melo]
Length=545

 Score =   326 bits (836),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 154/224 (69%), Positives = 191/224 (85%), Gaps = 1/224 (0%)
 Frame = +1

Query  187  TAVVLWLLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARF  366
            +A+VL LL   + V  GDIVHHDD+ P++ GC+N+F+LVKV TWI+GKE  EFVGVGARF
Sbjct  14   SALVL-LLMFPSHVTSGDIVHHDDLTPKKPGCENDFILVKVQTWIDGKEASEFVGVGARF  72

Query  367  GPTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASA  546
            G T+ SKEK ANQTRL LA+P DCCS P+NKL+G+ I+V RG+C FTTKAN+A+ AGASA
Sbjct  73   GATIVSKEKNANQTRLVLANPRDCCSVPKNKLSGDIIMVDRGHCKFTTKANIAEAAGASA  132

Query  547  ILIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPV  726
            ILI+NNQ EL+KMVC+ +ETDL+I IPA+MLPQDAG S+ + +++ S VSVQLYSP RP 
Sbjct  133  ILIVNNQKELYKMVCDPDETDLNIHIPAVMLPQDAGTSLEKMLISNSSVSVQLYSPLRPP  192

Query  727  VDVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
            VD+AEVFLWLMAV TILC+S+WSAW+AREAAI+QDKLLKDG+D+
Sbjct  193  VDIAEVFLWLMAVGTILCSSFWSAWSAREAAIEQDKLLKDGADD  236



>ref|XP_011022676.1| PREDICTED: signal peptide peptidase-like 2 [Populus euphratica]
Length=541

 Score =   326 bits (835),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 157/237 (66%), Positives = 190/237 (80%), Gaps = 2/237 (1%)
 Frame = +1

Query  148  MELRSTAPYCSVPTAVVLWLLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWING  327
            M+L+      +V   + L L   S  V  GDIVH D++AP++ GC+N+FVLVKV TW++G
Sbjct  1    MDLQKLCLVITVTAVISLALYPSS--VTAGDIVHDDNLAPKKPGCENDFVLVKVQTWVDG  58

Query  328  KEEMEFVGVGARFGPTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFT  507
             E+ EFVGVGARFG T+ SKEK ANQ RL L+DP DCCS P++KL G+ I+VHRG+C FT
Sbjct  59   VEDAEFVGVGARFGTTIVSKEKNANQIRLTLSDPLDCCSAPKHKLDGDVIMVHRGHCKFT  118

Query  508  TKANVADDAGASAILIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKS  687
            TKAN A+ AGASA+LIINNQ EL+KMVCE +ETDLDI IPA+MLPQDAG S+ + ++  S
Sbjct  119  TKANNAEAAGASALLIINNQKELYKMVCEPDETDLDIHIPAVMLPQDAGSSLEKMLLTNS  178

Query  688  MVSVQLYSPRRPVVDVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
             VSVQLYSPRRP+VD+AEVFLWLMAV TILCASYWSAW+AREAAI+QDKLLKD  DE
Sbjct  179  SVSVQLYSPRRPLVDIAEVFLWLMAVGTILCASYWSAWSAREAAIEQDKLLKDAVDE  235



>emb|CAN62222.1| hypothetical protein VITISV_022532 [Vitis vinifera]
Length=489

 Score =   324 bits (831),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 151/219 (69%), Positives = 183/219 (84%), Gaps = 2/219 (1%)
 Frame = +1

Query  229  HGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQT  408
              GDIVH DD+AP++ GC+NNFVLVKV TW++ +E  E+VGVGARFGPTLESKEK ANQT
Sbjct  22   FAGDIVHQDDIAPKKPGCENNFVLVKVPTWVDHEEGNEYVGVGARFGPTLESKEKHANQT  81

Query  409  RLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMV  588
             L LADPPDCCS P+NK+  ++  ++RGNCSFT KA VA++AGASA+LI+NNQTELFKMV
Sbjct  82   TLTLADPPDCCSTPKNKV--KSSWLYRGNCSFTNKAKVAENAGASAVLIVNNQTELFKMV  139

Query  589  CEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVA  768
            CE NET ++I IP +MLPQDAG S+ +++ N S V+VQLYSP+RP+VD+AEVFLWLMAV 
Sbjct  140  CEANETAINISIPVVMLPQDAGASLEKSLKNNSSVAVQLYSPKRPLVDIAEVFLWLMAVG  199

Query  769  TILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            TIL ASYWSAW+AREAA +QDKLLKD SDE+   E T S
Sbjct  200  TILSASYWSAWSAREAANEQDKLLKDASDEFLSTEGTGS  238



>ref|XP_002303595.2| protease-associated domain-containing family protein [Populus 
trichocarpa]
 gb|EEE78574.2| protease-associated domain-containing family protein [Populus 
trichocarpa]
Length=539

 Score =   325 bits (834),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 151/211 (72%), Positives = 180/211 (85%), Gaps = 0/211 (0%)
 Frame = +1

Query  226  VHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQ  405
            V  GDIVH D++AP++ GC+N+FVLVKV TW++G E+ EFVGVGARFG T+ SKEK ANQ
Sbjct  23   VTAGDIVHDDNLAPKKPGCENDFVLVKVQTWVDGVEDAEFVGVGARFGTTIVSKEKNANQ  82

Query  406  TRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKM  585
             RL L+DP DCCS P++KL G+ I+VHRG+C FTTKAN A+ AGASA+LIINNQ EL+KM
Sbjct  83   IRLTLSDPLDCCSAPKHKLDGDVIMVHRGHCKFTTKANNAEAAGASALLIINNQKELYKM  142

Query  586  VCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAV  765
            VCE +ETDLDI IPA+MLPQDAG S+ + ++  S VSVQLYSPRRP+VD+AEVFLWLMAV
Sbjct  143  VCEPDETDLDIHIPAVMLPQDAGSSLEKMLLTNSSVSVQLYSPRRPLVDIAEVFLWLMAV  202

Query  766  ATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
             TILCASYWSAW+AREAAI+QDKLLKD  DE
Sbjct  203  GTILCASYWSAWSAREAAIEQDKLLKDAVDE  233



>ref|XP_004143899.1| PREDICTED: signal peptide peptidase-like 2 isoform X1 [Cucumis 
sativus]
 gb|KGN50088.1| hypothetical protein Csa_5G153030 [Cucumis sativus]
Length=545

 Score =   325 bits (834),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 154/223 (69%), Positives = 190/223 (85%), Gaps = 1/223 (0%)
 Frame = +1

Query  190  AVVLWLLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFG  369
            A+VL L+  S  V  GDIVHHDD+ P++ GC+N+F+LVKV TWI+GKE  EFVGVGARFG
Sbjct  15   ALVLLLIFPSH-VTAGDIVHHDDLTPKKPGCENDFILVKVQTWIDGKEASEFVGVGARFG  73

Query  370  PTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAI  549
             T+ SKEK ANQTRL LA+P DCCS P+NKL+G+ I+V RG+C FTTKAN+A+ AGASAI
Sbjct  74   ATIVSKEKNANQTRLVLANPRDCCSVPKNKLSGDIIMVDRGHCKFTTKANIAEAAGASAI  133

Query  550  LIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVV  729
            LI+NNQ EL+KMVC+ +ETDL+I IPA+MLPQDAG S+ + +++ S VSVQLYSP RP V
Sbjct  134  LIVNNQKELYKMVCDPDETDLNIHIPAVMLPQDAGTSLEKMLISNSSVSVQLYSPLRPPV  193

Query  730  DVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
            D+AEVFLWLMAV TILC+S+WSAW+AREAAI+QDKLLKDG+D+
Sbjct  194  DIAEVFLWLMAVGTILCSSFWSAWSAREAAIEQDKLLKDGADD  236



>gb|KJB52135.1| hypothetical protein B456_008G247500 [Gossypium raimondii]
Length=371

 Score =   320 bits (819),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 156/230 (68%), Positives = 182/230 (79%), Gaps = 1/230 (0%)
 Frame = +1

Query  172  YCSVPTAVVLWLLSCSAL-VHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFV  348
            +C V     L  L C    V  GDIVH DD+AP++ GC+N+FVLVKV TWI+G E+ EFV
Sbjct  6    FCRVFLITALISLVCQVCSVTAGDIVHDDDLAPKKPGCENDFVLVKVQTWIDGIEDAEFV  65

Query  349  GVGARFGPTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVAD  528
            GVGARFG T+ SKEK ANQ RL L+DP DCCS P+NKL  + I+V RG+C FTTKAN A 
Sbjct  66   GVGARFGTTIVSKEKNANQRRLILSDPRDCCSAPKNKLANDVIMVDRGHCKFTTKANYAQ  125

Query  529  DAGASAILIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLY  708
             A ASAILIINNQ EL+KMVCE +ETDLDI IPA+MLPQDAG S+ + +++ S VSVQLY
Sbjct  126  AAHASAILIINNQKELYKMVCEPDETDLDIHIPAVMLPQDAGTSLEKMLISNSSVSVQLY  185

Query  709  SPRRPVVDVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
            SP RP+VD+AEVFLWLMAV TILCASYWSAW+AREAAI+QDKLLKD  DE
Sbjct  186  SPTRPLVDIAEVFLWLMAVGTILCASYWSAWSAREAAIEQDKLLKDALDE  235



>ref|XP_010089093.1| Signal peptide peptidase-like 2B [Morus notabilis]
 gb|EXB37340.1| Signal peptide peptidase-like 2B [Morus notabilis]
Length=543

 Score =   325 bits (832),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 154/224 (69%), Positives = 184/224 (82%), Gaps = 0/224 (0%)
 Frame = +1

Query  187  TAVVLWLLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARF  366
             +V++ L+  S  V  GDIVH DD AP++ GC+N+FVLVKV TWI+G E  E VGVGARF
Sbjct  12   VSVLMLLVYASCSVKAGDIVHDDDKAPKKPGCENDFVLVKVQTWIDGVESSELVGVGARF  71

Query  367  GPTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASA  546
            G  + SKEK ANQTRL L+DP DCCSKP+ KL G+ I+V RG C FTTKANVA+ AGASA
Sbjct  72   GTAIVSKEKNANQTRLTLSDPRDCCSKPKKKLAGDVIMVDRGKCKFTTKANVAEAAGASA  131

Query  547  ILIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPV  726
            +LIINNQ EL+KMVC+ +ETDLDI IP++MLPQ+AG S+ + +MN S V VQLYSPRRPV
Sbjct  132  MLIINNQKELYKMVCDPDETDLDIHIPSVMLPQEAGVSLEKMLMNSSSVFVQLYSPRRPV  191

Query  727  VDVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
            VD+AEVFLWLMAV TILCASYWSAW+AREAAI+ DKLLKDG+D+
Sbjct  192  VDIAEVFLWLMAVGTILCASYWSAWSAREAAIEHDKLLKDGADD  235



>gb|EPS58628.1| peptidase, partial [Genlisea aurea]
Length=401

 Score =   320 bits (820),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 147/209 (70%), Positives = 175/209 (84%), Gaps = 0/209 (0%)
 Frame = +1

Query  217  SALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKR  396
            S  V  GDIVH DD  P+R GCDNNFVL+KV  W++G+EEM+FVGVGARFGPTLES+EKR
Sbjct  10   SITVFAGDIVHVDDKGPKRPGCDNNFVLIKVPVWVDGEEEMQFVGVGARFGPTLESQEKR  69

Query  397  ANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTEL  576
            A++  +ALADPPDCCS P+ KL GEAILVHRGNCSF TKANVA++AGASA++IINNQT+L
Sbjct  70   ADRITVALADPPDCCSNPKKKLIGEAILVHRGNCSFVTKANVAEEAGASAVIIINNQTDL  129

Query  577  FKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWL  756
             KMVC  NE DL IGIP +MLPQDAG+S+   +   S VS+Q+YSP+RP+ DVAEVFLWL
Sbjct  130  MKMVCNANEMDLTIGIPVVMLPQDAGESLKSFMAMSSRVSIQIYSPKRPLFDVAEVFLWL  189

Query  757  MAVATILCASYWSAWTAREAAIQQDKLLK  843
            MAV TI+CASYWSA TAR+ AI+ +KLLK
Sbjct  190  MAVGTIICASYWSALTARKEAIELEKLLK  218



>ref|XP_004245597.1| PREDICTED: signal peptide peptidase-like 2 [Solanum lycopersicum]
Length=544

 Score =   325 bits (832),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 152/218 (70%), Positives = 183/218 (84%), Gaps = 0/218 (0%)
 Frame = +1

Query  205  LLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLES  384
            LL+  A+V  GDIVH DD+AP++ GC+N+FVLVKV TWING+E+ EFVGVGARFG T+ S
Sbjct  16   LLNFPAIVTAGDIVHDDDLAPKKPGCENDFVLVKVQTWINGEEDAEFVGVGARFGTTIVS  75

Query  385  KEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINN  564
            KEK A QT L L+DP DCC  PR KL+GE ++V RG+C FTTKAN A+ AGASAILI+NN
Sbjct  76   KEKNAQQTPLTLSDPRDCCKPPRKKLSGEVVMVDRGHCKFTTKANNAEAAGASAILIVNN  135

Query  565  QTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEV  744
            Q EL+KMVC+  ETDLDI IPA+MLPQDAG ++ + ++N S V+VQLYSP+RPVVD+AEV
Sbjct  136  QKELYKMVCDPGETDLDIHIPAVMLPQDAGITLNKMLLNGSSVTVQLYSPKRPVVDIAEV  195

Query  745  FLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
            FLWLMAV TILC SYWSAW+AREAAI+QDKLLKD S+E
Sbjct  196  FLWLMAVGTILCGSYWSAWSAREAAIEQDKLLKDASEE  233



>gb|KJB52136.1| hypothetical protein B456_008G247500 [Gossypium raimondii]
Length=402

 Score =   320 bits (819),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 156/230 (68%), Positives = 182/230 (79%), Gaps = 1/230 (0%)
 Frame = +1

Query  172  YCSVPTAVVLWLLSCSAL-VHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFV  348
            +C V     L  L C    V  GDIVH DD+AP++ GC+N+FVLVKV TWI+G E+ EFV
Sbjct  6    FCRVFLITALISLVCQVCSVTAGDIVHDDDLAPKKPGCENDFVLVKVQTWIDGIEDAEFV  65

Query  349  GVGARFGPTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVAD  528
            GVGARFG T+ SKEK ANQ RL L+DP DCCS P+NKL  + I+V RG+C FTTKAN A 
Sbjct  66   GVGARFGTTIVSKEKNANQRRLILSDPRDCCSAPKNKLANDVIMVDRGHCKFTTKANYAQ  125

Query  529  DAGASAILIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLY  708
             A ASAILIINNQ EL+KMVCE +ETDLDI IPA+MLPQDAG S+ + +++ S VSVQLY
Sbjct  126  AAHASAILIINNQKELYKMVCEPDETDLDIHIPAVMLPQDAGTSLEKMLISNSSVSVQLY  185

Query  709  SPRRPVVDVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
            SP RP+VD+AEVFLWLMAV TILCASYWSAW+AREAAI+QDKLLKD  DE
Sbjct  186  SPTRPLVDIAEVFLWLMAVGTILCASYWSAWSAREAAIEQDKLLKDALDE  235



>ref|XP_010053720.1| PREDICTED: signal peptide peptidase-like 4 isoform X2 [Eucalyptus 
grandis]
Length=537

 Score =   324 bits (830),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 158/231 (68%), Positives = 191/231 (83%), Gaps = 5/231 (2%)
 Frame = +1

Query  202  WLL-SCSAL--VHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGP  372
            WLL +C +L  V  GDIVH DDVAP+RAGC+NNFVLVKV TW+NG E++E+VGVGARFG 
Sbjct  13   WLLVACLSLRPVFSGDIVHQDDVAPKRAGCENNFVLVKVPTWLNGVEDIEYVGVGARFGL  72

Query  373  TLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAIL  552
            TLESKEK AN T++ +ADPPD C++P+ KL GE ++V RGNCSFTTK+N+A+DA A+AIL
Sbjct  73   TLESKEKHANNTKVVIADPPDFCTRPKEKLKGEVVVVQRGNCSFTTKSNIAEDANATAIL  132

Query  553  IINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVD  732
            IINN  ELFKMVCE N+TD+ IGIPA+MLPQDAG ++ + I   + VSVQLYSP+RP+VD
Sbjct  133  IINN--ELFKMVCEVNQTDVKIGIPAVMLPQDAGANLEKLIKTYTNVSVQLYSPQRPLVD  190

Query  733  VAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            VAEVFLWLMAV TILCASYWSA +AREAAI+ +KLLKD SDE   +E   S
Sbjct  191  VAEVFLWLMAVGTILCASYWSARSAREAAIEHEKLLKDASDELGEIEGIGS  241



>ref|XP_008238915.1| PREDICTED: signal peptide peptidase-like 2 [Prunus mume]
Length=544

 Score =   324 bits (830),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 152/226 (67%), Positives = 188/226 (83%), Gaps = 0/226 (0%)
 Frame = +1

Query  181  VPTAVVLWLLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGA  360
            V  + ++ L+S  + V  GDIVH DD AP++ GC+NNFVLVKV TW++G E  EFVGVGA
Sbjct  10   VFVSALILLVSKPSSVTAGDIVHDDDSAPKKPGCENNFVLVKVQTWVDGVEANEFVGVGA  69

Query  361  RFGPTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGA  540
            RFG T+ESKEK+A QTRL L++P DCC+K +NKL G+ I+V RG+C FTTKAN+A +A A
Sbjct  70   RFGTTIESKEKKAQQTRLILSNPRDCCNKTKNKLAGDVIMVDRGHCKFTTKANIAQEANA  129

Query  541  SAILIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRR  720
            SA+LI+NNQ EL+KMVCE +ET LDI IPA+MLPQDAG ++ + +M  S+VSVQLYSP+R
Sbjct  130  SAVLIVNNQKELYKMVCEPDETALDIHIPAVMLPQDAGATLEKMLMKNSLVSVQLYSPQR  189

Query  721  PVVDVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
            PVVD+AEVFLWLMAV TILCASYWSAW+AREA+I+QDKLLKD SDE
Sbjct  190  PVVDIAEVFLWLMAVGTILCASYWSAWSAREASIEQDKLLKDASDE  235



>ref|XP_012083376.1| PREDICTED: signal peptide peptidase-like 4 isoform X1 [Jatropha 
curcas]
Length=542

 Score =   323 bits (828),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 152/209 (73%), Positives = 178/209 (85%), Gaps = 0/209 (0%)
 Frame = +1

Query  235  GDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRL  414
            GDIVH DDVAP+R GCDNNFVLVKV T ++G E +E+VGVGARFG +LESKEK AN+TRL
Sbjct  24   GDIVHQDDVAPKRPGCDNNFVLVKVPTSVDGVENIEYVGVGARFGRSLESKEKNANKTRL  83

Query  415  ALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCE  594
             LADPPD C  P+ KL  + ILVHRGNCSFTTK+N+A++A ASAILIIN +TELFKMVCE
Sbjct  84   VLADPPDLCRPPKKKLQRDVILVHRGNCSFTTKSNIAEEANASAILIINYRTELFKMVCE  143

Query  595  KNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATI  774
             +ETD+ IGIPA+MLPQDAG S+   + N S V VQLYSP+RP+VDVAEVFLWLMAV TI
Sbjct  144  ASETDVSIGIPAVMLPQDAGASLESYLKNSSAVFVQLYSPQRPLVDVAEVFLWLMAVGTI  203

Query  775  LCASYWSAWTAREAAIQQDKLLKDGSDEY  861
            L ASYWSAW+ARE AI+QDKLLKDGS+++
Sbjct  204  LGASYWSAWSAREVAIEQDKLLKDGSEDF  232



>gb|KDP28619.1| hypothetical protein JCGZ_14390 [Jatropha curcas]
Length=542

 Score =   323 bits (827),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 152/209 (73%), Positives = 178/209 (85%), Gaps = 0/209 (0%)
 Frame = +1

Query  235  GDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRL  414
            GDIVH DDVAP+R GCDNNFVLVKV T ++G E +E+VGVGARFG +LESKEK AN+TRL
Sbjct  24   GDIVHQDDVAPKRPGCDNNFVLVKVPTSVDGVENIEYVGVGARFGRSLESKEKNANKTRL  83

Query  415  ALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCE  594
             LADPPD C  P+ KL  + ILVHRGNCSFTTK+N+A++A ASAILIIN +TELFKMVCE
Sbjct  84   VLADPPDLCRPPKKKLQRDVILVHRGNCSFTTKSNIAEEANASAILIINYRTELFKMVCE  143

Query  595  KNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATI  774
             +ETD+ IGIPA+MLPQDAG S+   + N S V VQLYSP+RP+VDVAEVFLWLMAV TI
Sbjct  144  ASETDVSIGIPAVMLPQDAGASLESYLKNSSAVFVQLYSPQRPLVDVAEVFLWLMAVGTI  203

Query  775  LCASYWSAWTAREAAIQQDKLLKDGSDEY  861
            L ASYWSAW+ARE AI+QDKLLKDGS+++
Sbjct  204  LGASYWSAWSAREVAIEQDKLLKDGSEDF  232



>ref|XP_006439531.1| hypothetical protein CICLE_v10019598mg [Citrus clementina]
 gb|ESR52771.1| hypothetical protein CICLE_v10019598mg [Citrus clementina]
 gb|KDO76239.1| hypothetical protein CISIN_1g009071mg [Citrus sinensis]
 gb|KDO76240.1| hypothetical protein CISIN_1g009071mg [Citrus sinensis]
Length=475

 Score =   321 bits (822),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 155/225 (69%), Positives = 183/225 (81%), Gaps = 1/225 (0%)
 Frame = +1

Query  184  PTAVVLWLLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGAR  363
            P AVV  L+   A V  GDIVH DD+AP++ GC+N+FVLVKV TWI+G E  EFVGVGAR
Sbjct  12   PVAVVS-LVCYPASVTAGDIVHDDDLAPKKPGCENDFVLVKVQTWIDGIENEEFVGVGAR  70

Query  364  FGPTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGAS  543
            FG T+ SKEK ANQ  L L+ P DCCS P++K  G+ I+V RGNC FTTKAN+A+ AGAS
Sbjct  71   FGTTIVSKEKNANQIHLTLSHPRDCCSMPKHKYAGDVIMVDRGNCKFTTKANIAEAAGAS  130

Query  544  AILIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRP  723
            A+LIINNQ EL+KMVC+ +ETDLDI IPA+M+PQDAG S+ + ++N S VSVQLYSPRRP
Sbjct  131  ALLIINNQKELYKMVCDPDETDLDIHIPAVMMPQDAGASLEKMLLNTSSVSVQLYSPRRP  190

Query  724  VVDVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
            VVDVAEVFLWLMAV TILCASYWSAW+ARE AI+Q+KLLKD  DE
Sbjct  191  VVDVAEVFLWLMAVGTILCASYWSAWSARETAIEQEKLLKDAVDE  235



>gb|AAL14628.1|AF417575_1 growth-on protein GRO11 [Euphorbia esula]
Length=538

 Score =   321 bits (823),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 153/217 (71%), Positives = 178/217 (82%), Gaps = 0/217 (0%)
 Frame = +1

Query  235  GDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRL  414
            GDIVH DD +P+R GCDNNFVLVKV TW++G E++E+VGVGARFG TLE+KEK AN+T+L
Sbjct  24   GDIVHQDDKSPKRPGCDNNFVLVKVPTWVDGVEDIEYVGVGARFGRTLEAKEKDANKTKL  83

Query  415  ALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCE  594
             LADPPD C  P+ KL  + ILVHRGNCSFTTKA +A+ A ASAILIIN +TEL KMVCE
Sbjct  84   VLADPPDLCQPPKFKLNRDVILVHRGNCSFTTKAKIAELANASAILIINTETELLKMVCE  143

Query  595  KNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATI  774
             NETD+ I IPA+MLPQDAG S+ + + N S VSVQLYSP RP+VDVAEVFLWLMAV TI
Sbjct  144  ANETDVHIQIPAVMLPQDAGGSLRDYMQNSSQVSVQLYSPERPLVDVAEVFLWLMAVGTI  203

Query  775  LCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            L ASYWSAW+ARE AI+QDKLLKDGSD++   E   S
Sbjct  204  LGASYWSAWSAREIAIEQDKLLKDGSDDFTHGEGVPS  240



>ref|XP_002299526.2| protease-associated domain-containing family protein [Populus 
trichocarpa]
 gb|EEE84331.2| protease-associated domain-containing family protein [Populus 
trichocarpa]
Length=541

 Score =   321 bits (823),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 155/229 (68%), Positives = 187/229 (82%), Gaps = 1/229 (0%)
 Frame = +1

Query  175  CSVPTAVVLWLLSCS-ALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVG  351
            CS+ T   + LL C  + V  GDIVH D++AP++ GC+N+FVLVKV TW+ G+E+ EFVG
Sbjct  7    CSIITITGVILLVCHPSSVTAGDIVHDDNLAPKKPGCENDFVLVKVQTWVGGEEDAEFVG  66

Query  352  VGARFGPTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADD  531
            VGARFG T+ SKEK ANQ RL L+DP DCCS P++KL  + I+VHRG+C FTTKAN A+ 
Sbjct  67   VGARFGTTIVSKEKNANQIRLTLSDPRDCCSAPKHKLDRDVIMVHRGHCKFTTKANNAEA  126

Query  532  AGASAILIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYS  711
            AGASA+LIINNQ EL+KMVCE +ETDLDI IPAI+LPQDAG S+ + ++  + VSVQLYS
Sbjct  127  AGASAVLIINNQKELYKMVCEPDETDLDIHIPAIILPQDAGASLEKMLLTNTSVSVQLYS  186

Query  712  PRRPVVDVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
            P+RP+VDVAEVFLWLMAV TILCASYWSAWTAREAA +QDKLLKD  DE
Sbjct  187  PKRPLVDVAEVFLWLMAVGTILCASYWSAWTAREAAAEQDKLLKDAVDE  235



>ref|XP_009420460.1| PREDICTED: signal peptide peptidase-like 5 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=532

 Score =   320 bits (820),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 148/231 (64%), Positives = 187/231 (81%), Gaps = 2/231 (1%)
 Frame = +1

Query  193  VVLWLLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGP  372
            ++LWL+    L + GDIVH DD AP+  GC N+F+LVKV TWIN +E+ EFVGVGARFG 
Sbjct  11   MLLWLIP--GLTYAGDIVHEDDKAPKLPGCSNHFILVKVQTWINNEEDSEFVGVGARFGT  68

Query  373  TLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAIL  552
            T+++KEK A++T L+L+DP DCC+ P+ K+ G+ +LVHRG C FTTKA VA+ AGASA+L
Sbjct  69   TIQTKEKYASRTPLSLSDPSDCCTAPKEKIAGDILLVHRGRCKFTTKAKVAEAAGASALL  128

Query  553  IINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVD  732
            IINN+ EL+KMVCE+NETDLDI IPA+MLP DAG S+  ++ + + +SVQLYSP RP+VD
Sbjct  129  IINNRKELYKMVCERNETDLDINIPAVMLPHDAGVSLERSLKSGASLSVQLYSPDRPLVD  188

Query  733  VAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
             AEVFLWLMAV TILCASYWSAW+AREA+I+Q+KLLKD  DE+  ME T S
Sbjct  189  TAEVFLWLMAVGTILCASYWSAWSAREASIEQEKLLKDAPDEFLKMETTGS  239



>ref|XP_010680813.1| PREDICTED: signal peptide peptidase-like 2 [Beta vulgaris subsp. 
vulgaris]
Length=535

 Score =   320 bits (820),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 151/224 (67%), Positives = 186/224 (83%), Gaps = 2/224 (1%)
 Frame = +1

Query  193  VVLWLLSCSALV--HGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARF  366
            V L+L  C+ +V    GDIVHHDD  P++ GC+N+F+LVKV TWI+GKE++EFVGVGARF
Sbjct  6    VRLFLFLCALIVSVKAGDIVHHDDKVPKKPGCENDFILVKVQTWIDGKEDVEFVGVGARF  65

Query  367  GPTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASA  546
            G  + SKEK AN +RL L+DP DCCS+PRNKL G+ I+VHRG+C FTTKANVA+ AGASA
Sbjct  66   GTRIVSKEKNANYSRLTLSDPRDCCSQPRNKLAGDVIMVHRGHCRFTTKANVAEAAGASA  125

Query  547  ILIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPV  726
            +LIIN+Q EL+KMVCE +ET LDI IPA+MLPQDAG+++ + ++N S VSVQLYSPRRPV
Sbjct  126  VLIINDQNELYKMVCEPDETALDIHIPALMLPQDAGRTLEKMLLNSSSVSVQLYSPRRPV  185

Query  727  VDVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
            VD+AEVFLWLMAV TILCAS+WSA  AREAA + + LLKD SD+
Sbjct  186  VDIAEVFLWLMAVGTILCASFWSASGAREAAAEHENLLKDASDD  229



>ref|XP_009346748.1| PREDICTED: signal peptide peptidase-like 2 [Pyrus x bretschneideri]
Length=543

 Score =   320 bits (820),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 150/224 (67%), Positives = 183/224 (82%), Gaps = 0/224 (0%)
 Frame = +1

Query  187  TAVVLWLLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARF  366
            +A+ + L+   + V  GDIVH DD AP++ GC+NNFVLVKV TWI+G E  EFVGVGARF
Sbjct  13   SALTVLLVGNPSYVTAGDIVHDDDSAPKKPGCENNFVLVKVQTWIDGVEANEFVGVGARF  72

Query  367  GPTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASA  546
            G T+ SKEK A QTRL L+DP DCCSKP+ KLTG+ I+V RG C FTTKAN+A  A ASA
Sbjct  73   GTTIVSKEKNAQQTRLVLSDPRDCCSKPKKKLTGDVIMVDRGQCKFTTKANIAQAANASA  132

Query  547  ILIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPV  726
            +LIINNQ EL+KMVCE +ET LDI IP +MLPQDAG ++ + +M+ S+VSVQLYSP+RPV
Sbjct  133  VLIINNQKELYKMVCEPDETALDIHIPTVMLPQDAGSTLEKMLMSNSLVSVQLYSPKRPV  192

Query  727  VDVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
            VD+AEVFLWLMAV TILCAS+WSAW+AREAAI+ ++LLKD +DE
Sbjct  193  VDIAEVFLWLMAVGTILCASFWSAWSAREAAIEHERLLKDAADE  236



>ref|XP_006439532.1| hypothetical protein CICLE_v10019598mg [Citrus clementina]
 gb|ESR52772.1| hypothetical protein CICLE_v10019598mg [Citrus clementina]
 gb|KDO76238.1| hypothetical protein CISIN_1g009071mg [Citrus sinensis]
Length=544

 Score =   320 bits (820),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 155/225 (69%), Positives = 183/225 (81%), Gaps = 1/225 (0%)
 Frame = +1

Query  184  PTAVVLWLLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGAR  363
            P AVV  L+   A V  GDIVH DD+AP++ GC+N+FVLVKV TWI+G E  EFVGVGAR
Sbjct  12   PVAVVS-LVCYPASVTAGDIVHDDDLAPKKPGCENDFVLVKVQTWIDGIENEEFVGVGAR  70

Query  364  FGPTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGAS  543
            FG T+ SKEK ANQ  L L+ P DCCS P++K  G+ I+V RGNC FTTKAN+A+ AGAS
Sbjct  71   FGTTIVSKEKNANQIHLTLSHPRDCCSMPKHKYAGDVIMVDRGNCKFTTKANIAEAAGAS  130

Query  544  AILIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRP  723
            A+LIINNQ EL+KMVC+ +ETDLDI IPA+M+PQDAG S+ + ++N S VSVQLYSPRRP
Sbjct  131  ALLIINNQKELYKMVCDPDETDLDIHIPAVMMPQDAGASLEKMLLNTSSVSVQLYSPRRP  190

Query  724  VVDVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
            VVDVAEVFLWLMAV TILCASYWSAW+ARE AI+Q+KLLKD  DE
Sbjct  191  VVDVAEVFLWLMAVGTILCASYWSAWSARETAIEQEKLLKDAVDE  235



>ref|XP_007040267.1| Signal peptide peptidase-like 2 isoform 4 [Theobroma cacao]
 gb|EOY24768.1| Signal peptide peptidase-like 2 isoform 4 [Theobroma cacao]
Length=479

 Score =   317 bits (813),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 157/237 (66%), Positives = 184/237 (78%), Gaps = 2/237 (1%)
 Frame = +1

Query  148  MELRSTAPYCSVPTAVVLWLLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWING  327
            M+LRS      V   + L    CS  V  GDIVH DD AP++ GC+N+FVLVKV TW+NG
Sbjct  1    MDLRSLCRVIFVTALISLVCQPCS--VTAGDIVHDDDSAPKKPGCENDFVLVKVQTWVNG  58

Query  328  KEEMEFVGVGARFGPTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFT  507
             E+ EFVGVGARFG T+ SKEK ANQ RL L+DP DCCS P+NKL  + I+V RGNC FT
Sbjct  59   IEDAEFVGVGARFGTTIVSKEKNANQRRLILSDPRDCCSPPKNKLANDVIMVDRGNCKFT  118

Query  508  TKANVADDAGASAILIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKS  687
            TKAN A+ A ASA+LIINNQ EL+KMVCE +ETDLDI IPA+MLPQDAG S+ + + + +
Sbjct  119  TKANNAEAAHASAVLIINNQKELYKMVCEPDETDLDIQIPAVMLPQDAGASLEKMLTSNA  178

Query  688  MVSVQLYSPRRPVVDVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
             V VQLYSP+RP+VD+AEVFLWLMAV TILCASYWSAW AREAAI+QDKLLKD  DE
Sbjct  179  SVLVQLYSPKRPLVDIAEVFLWLMAVGTILCASYWSAWNAREAAIEQDKLLKDALDE  235



>ref|XP_009374989.1| PREDICTED: signal peptide peptidase-like 2 [Pyrus x bretschneideri]
Length=543

 Score =   319 bits (818),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 148/211 (70%), Positives = 176/211 (83%), Gaps = 0/211 (0%)
 Frame = +1

Query  226  VHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQ  405
            V  GDIVH DD AP++ GC+NNFVLVKV TWI+G E  EFVGVGARFG T+ SKEK A Q
Sbjct  26   VTAGDIVHDDDSAPKKPGCENNFVLVKVQTWIDGVEANEFVGVGARFGTTIVSKEKNAQQ  85

Query  406  TRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKM  585
            TRL L+DP DCCSKP+ KLTG+ I+V RG C FTTKAN+A  A ASA+LIINNQ EL+KM
Sbjct  86   TRLVLSDPRDCCSKPKKKLTGDVIMVDRGQCKFTTKANIAQAANASAVLIINNQKELYKM  145

Query  586  VCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAV  765
            VCE +ET LDI IP +MLPQDAG ++ + +M+ S+VSVQLYSP+RPVVD+AEVFLWLMAV
Sbjct  146  VCEPDETALDIHIPTVMLPQDAGSTLEKMLMSNSLVSVQLYSPKRPVVDIAEVFLWLMAV  205

Query  766  ATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
             TILCAS+WSAW+AREAAI+ ++LLKD +DE
Sbjct  206  GTILCASFWSAWSAREAAIEHERLLKDAADE  236



>ref|XP_006476550.1| PREDICTED: signal peptide peptidase-like 2-like [Citrus sinensis]
Length=544

 Score =   318 bits (816),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 154/225 (68%), Positives = 183/225 (81%), Gaps = 1/225 (0%)
 Frame = +1

Query  184  PTAVVLWLLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGAR  363
            P AVV  L+   A V  GDIVH DD+AP++ GC+N+FVLVKV TWI+G E  EFVGVGAR
Sbjct  12   PVAVVS-LVCYPASVTAGDIVHDDDLAPKKPGCENDFVLVKVQTWIDGIENEEFVGVGAR  70

Query  364  FGPTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGAS  543
            FG T+ SKEK ANQ  L L+ P DCCS P++K  G+ I+V RGNC FTTKAN+A+ AGAS
Sbjct  71   FGTTIVSKEKNANQIHLTLSHPRDCCSMPKHKYAGDVIMVDRGNCKFTTKANIAEAAGAS  130

Query  544  AILIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRP  723
            A+LIINNQ EL+KMVC+ +ETDLDI IPA+M+PQDAG S+ + ++N S VSVQLYSPRRP
Sbjct  131  ALLIINNQKELYKMVCDPDETDLDIHIPAVMMPQDAGASLEKMLLNTSSVSVQLYSPRRP  190

Query  724  VVDVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
            VVDVAEVFLWLMAV TILCASYWSAW+AR+ AI+Q+KLLKD  DE
Sbjct  191  VVDVAEVFLWLMAVGTILCASYWSAWSARDTAIEQEKLLKDAVDE  235



>gb|KJB52138.1| hypothetical protein B456_008G247500 [Gossypium raimondii]
Length=529

 Score =   318 bits (814),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 156/230 (68%), Positives = 182/230 (79%), Gaps = 1/230 (0%)
 Frame = +1

Query  172  YCSVPTAVVLWLLSCSAL-VHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFV  348
            +C V     L  L C    V  GDIVH DD+AP++ GC+N+FVLVKV TWI+G E+ EFV
Sbjct  6    FCRVFLITALISLVCQVCSVTAGDIVHDDDLAPKKPGCENDFVLVKVQTWIDGIEDAEFV  65

Query  349  GVGARFGPTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVAD  528
            GVGARFG T+ SKEK ANQ RL L+DP DCCS P+NKL  + I+V RG+C FTTKAN A 
Sbjct  66   GVGARFGTTIVSKEKNANQRRLILSDPRDCCSAPKNKLANDVIMVDRGHCKFTTKANYAQ  125

Query  529  DAGASAILIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLY  708
             A ASAILIINNQ EL+KMVCE +ETDLDI IPA+MLPQDAG S+ + +++ S VSVQLY
Sbjct  126  AAHASAILIINNQKELYKMVCEPDETDLDIHIPAVMLPQDAGTSLEKMLISNSSVSVQLY  185

Query  709  SPRRPVVDVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
            SP RP+VD+AEVFLWLMAV TILCASYWSAW+AREAAI+QDKLLKD  DE
Sbjct  186  SPTRPLVDIAEVFLWLMAVGTILCASYWSAWSAREAAIEQDKLLKDALDE  235



>ref|XP_007040266.1| Signal peptide peptidase-like 2 isoform 3 [Theobroma cacao]
 gb|EOY24767.1| Signal peptide peptidase-like 2 isoform 3 [Theobroma cacao]
Length=504

 Score =   317 bits (812),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 157/237 (66%), Positives = 184/237 (78%), Gaps = 2/237 (1%)
 Frame = +1

Query  148  MELRSTAPYCSVPTAVVLWLLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWING  327
            M+LRS      V   + L    CS  V  GDIVH DD AP++ GC+N+FVLVKV TW+NG
Sbjct  1    MDLRSLCRVIFVTALISLVCQPCS--VTAGDIVHDDDSAPKKPGCENDFVLVKVQTWVNG  58

Query  328  KEEMEFVGVGARFGPTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFT  507
             E+ EFVGVGARFG T+ SKEK ANQ RL L+DP DCCS P+NKL  + I+V RGNC FT
Sbjct  59   IEDAEFVGVGARFGTTIVSKEKNANQRRLILSDPRDCCSPPKNKLANDVIMVDRGNCKFT  118

Query  508  TKANVADDAGASAILIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKS  687
            TKAN A+ A ASA+LIINNQ EL+KMVCE +ETDLDI IPA+MLPQDAG S+ + + + +
Sbjct  119  TKANNAEAAHASAVLIINNQKELYKMVCEPDETDLDIQIPAVMLPQDAGASLEKMLTSNA  178

Query  688  MVSVQLYSPRRPVVDVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
             V VQLYSP+RP+VD+AEVFLWLMAV TILCASYWSAW AREAAI+QDKLLKD  DE
Sbjct  179  SVLVQLYSPKRPLVDIAEVFLWLMAVGTILCASYWSAWNAREAAIEQDKLLKDALDE  235



>gb|KJB52134.1| hypothetical protein B456_008G247500 [Gossypium raimondii]
Length=547

 Score =   318 bits (815),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 156/230 (68%), Positives = 182/230 (79%), Gaps = 1/230 (0%)
 Frame = +1

Query  172  YCSVPTAVVLWLLSCSAL-VHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFV  348
            +C V     L  L C    V  GDIVH DD+AP++ GC+N+FVLVKV TWI+G E+ EFV
Sbjct  6    FCRVFLITALISLVCQVCSVTAGDIVHDDDLAPKKPGCENDFVLVKVQTWIDGIEDAEFV  65

Query  349  GVGARFGPTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVAD  528
            GVGARFG T+ SKEK ANQ RL L+DP DCCS P+NKL  + I+V RG+C FTTKAN A 
Sbjct  66   GVGARFGTTIVSKEKNANQRRLILSDPRDCCSAPKNKLANDVIMVDRGHCKFTTKANYAQ  125

Query  529  DAGASAILIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLY  708
             A ASAILIINNQ EL+KMVCE +ETDLDI IPA+MLPQDAG S+ + +++ S VSVQLY
Sbjct  126  AAHASAILIINNQKELYKMVCEPDETDLDIHIPAVMLPQDAGTSLEKMLISNSSVSVQLY  185

Query  709  SPRRPVVDVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
            SP RP+VD+AEVFLWLMAV TILCASYWSAW+AREAAI+QDKLLKD  DE
Sbjct  186  SPTRPLVDIAEVFLWLMAVGTILCASYWSAWSAREAAIEQDKLLKDALDE  235



>ref|XP_007040264.1| Signal peptide peptidase-like 2 isoform 1 [Theobroma cacao]
 ref|XP_007040265.1| Signal peptide peptidase-like 2 isoform 1 [Theobroma cacao]
 gb|EOY24765.1| Signal peptide peptidase-like 2 isoform 1 [Theobroma cacao]
 gb|EOY24766.1| Signal peptide peptidase-like 2 isoform 1 [Theobroma cacao]
Length=546

 Score =   317 bits (813),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 157/237 (66%), Positives = 184/237 (78%), Gaps = 2/237 (1%)
 Frame = +1

Query  148  MELRSTAPYCSVPTAVVLWLLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWING  327
            M+LRS      V   + L    CS  V  GDIVH DD AP++ GC+N+FVLVKV TW+NG
Sbjct  1    MDLRSLCRVIFVTALISLVCQPCS--VTAGDIVHDDDSAPKKPGCENDFVLVKVQTWVNG  58

Query  328  KEEMEFVGVGARFGPTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFT  507
             E+ EFVGVGARFG T+ SKEK ANQ RL L+DP DCCS P+NKL  + I+V RGNC FT
Sbjct  59   IEDAEFVGVGARFGTTIVSKEKNANQRRLILSDPRDCCSPPKNKLANDVIMVDRGNCKFT  118

Query  508  TKANVADDAGASAILIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKS  687
            TKAN A+ A ASA+LIINNQ EL+KMVCE +ETDLDI IPA+MLPQDAG S+ + + + +
Sbjct  119  TKANNAEAAHASAVLIINNQKELYKMVCEPDETDLDIQIPAVMLPQDAGASLEKMLTSNA  178

Query  688  MVSVQLYSPRRPVVDVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
             V VQLYSP+RP+VD+AEVFLWLMAV TILCASYWSAW AREAAI+QDKLLKD  DE
Sbjct  179  SVLVQLYSPKRPLVDIAEVFLWLMAVGTILCASYWSAWNAREAAIEQDKLLKDALDE  235



>emb|CDX90049.1| BnaA10g00330D [Brassica napus]
Length=540

 Score =   317 bits (811),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 164/229 (72%), Positives = 183/229 (80%), Gaps = 1/229 (0%)
 Frame = +1

Query  202  WLLSCSA-LVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTL  378
            WL   SA LV GGDIVHHDD  P R GC+NNFVLVKV T +NGKE+ E+VGVGARFGPTL
Sbjct  16   WLYVYSASLVSGGDIVHHDDSLPNRPGCNNNFVLVKVPTRVNGKEKEEYVGVGARFGPTL  75

Query  379  ESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILII  558
            ESKEK A   RLA+ADPPDCC+ P+ KLTGE ILVHRGNCSFTTK  VA+ AGASAI+II
Sbjct  76   ESKEKHATLIRLAVADPPDCCTTPKFKLTGEVILVHRGNCSFTTKTKVAEAAGASAIIII  135

Query  559  NNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVA  738
            NN T+LFKMVCEK E  LDI IP +MLP DAG S+ + +     V++QLYSP+RP VDVA
Sbjct  136  NNSTDLFKMVCEKGEDVLDINIPVVMLPLDAGSSLQKFVDANDTVTLQLYSPKRPAVDVA  195

Query  739  EVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            EVFLWLMAV TILCASYWSAWTARE AI+QDKLLKDGSDE   +  T S
Sbjct  196  EVFLWLMAVGTILCASYWSAWTAREEAIEQDKLLKDGSDELLQVSTTSS  244



>ref|XP_010940491.1| PREDICTED: signal peptide peptidase-like 4 [Elaeis guineensis]
Length=534

 Score =   316 bits (810),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 149/222 (67%), Positives = 179/222 (81%), Gaps = 0/222 (0%)
 Frame = +1

Query  220  ALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRA  399
             LV GGDIVH DD AP+  GC NNFVLVKV TWIN KE+ EFVGVGARFG T+ESKEK A
Sbjct  21   GLVLGGDIVHEDDEAPKLPGCSNNFVLVKVQTWINNKEDAEFVGVGARFGTTIESKEKHA  80

Query  400  NQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELF  579
            N+TRL L+DPPDCC   + KL G+ +LV RGNC+FTTKA VA+ AGASAILI+NN+ EL+
Sbjct  81   NRTRLLLSDPPDCCRTLKKKLAGDVLLVQRGNCTFTTKAKVAEAAGASAILIVNNRKELY  140

Query  580  KMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLM  759
            KMVC++NET+L I I A+MLP DAG S+  ++ + + V+VQLYSP RP+VD AEVFLWLM
Sbjct  141  KMVCDRNETNLKINISAVMLPHDAGVSLESSVRSGASVAVQLYSPDRPLVDTAEVFLWLM  200

Query  760  AVATILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            AV TILCASYWSAW+AREA+I+ +KL+KD  DE   MEAT +
Sbjct  201  AVGTILCASYWSAWSAREASIEYEKLIKDAPDEILNMEATGT  242



>ref|XP_008787488.1| PREDICTED: signal peptide peptidase-like 4 [Phoenix dactylifera]
Length=372

 Score =   311 bits (796),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 144/220 (65%), Positives = 176/220 (80%), Gaps = 0/220 (0%)
 Frame = +1

Query  220  ALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRA  399
             LV GGDIVH D+ AP+  GC NNFVLVKV TWIN +E+ EFVGVGARFG T+ESKEK A
Sbjct  21   GLVLGGDIVHEDERAPKIPGCSNNFVLVKVQTWINNREDAEFVGVGARFGTTIESKEKYA  80

Query  400  NQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELF  579
            N+TRL+++DPPDCC+  + KL G+ +LVHRG+C FTTKA VA+ AGASAILIIN   EL+
Sbjct  81   NRTRLSVSDPPDCCTTLKKKLAGDVLLVHRGHCKFTTKAKVAEAAGASAILIINTHKELY  140

Query  580  KMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLM  759
            KMVC+ NETDL+I I ++MLPQDAG S+  +I + +  +VQLYSP RP+ D AEVFLWLM
Sbjct  141  KMVCDPNETDLNISISSVMLPQDAGASLESSIKSGASAAVQLYSPDRPLADTAEVFLWLM  200

Query  760  AVATILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEAT  879
            AV TILCASYWSAW++REA+I+ +KL+KD  DE   ME T
Sbjct  201  AVGTILCASYWSAWSSREASIEYEKLIKDAPDEILNMETT  240



>ref|XP_006343972.1| PREDICTED: signal peptide peptidase-like 2-like [Solanum tuberosum]
Length=544

 Score =   316 bits (810),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 149/218 (68%), Positives = 182/218 (83%), Gaps = 0/218 (0%)
 Frame = +1

Query  205  LLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLES  384
            LL+  A+V  GDIVH DD+AP++ GC+N+FVLVKV TWING+E+ EFVGVGARFG T+ S
Sbjct  16   LLNFPAIVTAGDIVHDDDLAPKKPGCENDFVLVKVQTWINGEEDAEFVGVGARFGTTIVS  75

Query  385  KEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINN  564
            KEK A QT L L+DP DCC  PR KL+GE ++V RG+C FTTKAN A+ AGASAILI+NN
Sbjct  76   KEKNAQQTPLTLSDPRDCCKPPRKKLSGEVVMVDRGHCKFTTKANNAEAAGASAILIVNN  135

Query  565  QTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEV  744
            + EL+KMVC+  ETDLDI IPA+MLPQDAG ++ + ++N S V+VQLYSP+RPVVD+AEV
Sbjct  136  EKELYKMVCDPGETDLDIHIPAVMLPQDAGITLNKMLLNGSSVTVQLYSPKRPVVDIAEV  195

Query  745  FLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
            FLWLMAV TILC SYWSA +AREAAI+QDKLLKD S++
Sbjct  196  FLWLMAVGTILCGSYWSAGSAREAAIEQDKLLKDASEK  233



>gb|KHG06309.1| Signal peptide peptidase-like 2B [Gossypium arboreum]
Length=547

 Score =   316 bits (810),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 155/230 (67%), Positives = 182/230 (79%), Gaps = 1/230 (0%)
 Frame = +1

Query  172  YCSVPTAVVLWLLSCSAL-VHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFV  348
            +C V     L  L C    V  GDIVH DD+AP++ GC+N+FVLVKV TW++G E+ EFV
Sbjct  6    FCRVFLITALISLVCQVCSVTAGDIVHDDDLAPKKPGCENDFVLVKVQTWVDGIEDAEFV  65

Query  349  GVGARFGPTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVAD  528
            GVGARFG T+ SKEK ANQ RL L+DP DCCS P+NKL  + I+V RG+C FTTKAN A 
Sbjct  66   GVGARFGTTIVSKEKNANQRRLILSDPRDCCSAPKNKLANDVIMVDRGHCKFTTKANHAQ  125

Query  529  DAGASAILIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLY  708
             A ASAILIINNQ EL+KMVCE +ETDLDI IPA+MLPQDAG S+ + +++ S VSVQLY
Sbjct  126  AAHASAILIINNQKELYKMVCEPDETDLDIHIPAVMLPQDAGTSLEKMLISNSSVSVQLY  185

Query  709  SPRRPVVDVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
            SP RP+VD+AEVFLWLMAV TILCASYWSAW+AREAAI+QDKLLKD  DE
Sbjct  186  SPTRPLVDIAEVFLWLMAVGTILCASYWSAWSAREAAIEQDKLLKDALDE  235



>ref|XP_012086884.1| PREDICTED: signal peptide peptidase-like 2 [Jatropha curcas]
 gb|KDP25425.1| hypothetical protein JCGZ_20581 [Jatropha curcas]
Length=544

 Score =   316 bits (809),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 150/221 (68%), Positives = 180/221 (81%), Gaps = 0/221 (0%)
 Frame = +1

Query  196  VLWLLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPT  375
            V+ L+   + V  GDIVH DD AP++ GC+N+FVLVKV TW+NG E+ EFVGVGARFG T
Sbjct  15   VISLVYYPSTVTAGDIVHDDDSAPKKPGCENDFVLVKVQTWVNGIEDAEFVGVGARFGTT  74

Query  376  LESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILI  555
            + SKEK A+QTRL L+DP DCC+KP+ KL  + I+V RG C FT KAN A+ AGASA+LI
Sbjct  75   IVSKEKNAHQTRLTLSDPRDCCTKPKKKLDKDIIMVDRGKCKFTVKANNAEAAGASAVLI  134

Query  556  INNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDV  735
            INNQ EL+KMVCE +ETDLDI IPA+MLPQDAG S+ + ++  S VSVQLYSPRRP+VD+
Sbjct  135  INNQKELYKMVCEPDETDLDIQIPAVMLPQDAGASLEKMLLTNSSVSVQLYSPRRPLVDI  194

Query  736  AEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
            AEVFLWLMAV TILCASYWSAW+AREAAI+ +KLLKD  DE
Sbjct  195  AEVFLWLMAVVTILCASYWSAWSAREAAIEHEKLLKDAVDE  235



>ref|XP_006391728.1| hypothetical protein EUTSA_v10023402mg [Eutrema salsugineum]
 gb|ESQ29014.1| hypothetical protein EUTSA_v10023402mg [Eutrema salsugineum]
Length=540

 Score =   315 bits (808),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 148/218 (68%), Positives = 178/218 (82%), Gaps = 0/218 (0%)
 Frame = +1

Query  205  LLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLES  384
            L+S  + V  GDIVHHDD+AP++ GC+N+FVLVKV TW+NG E+ EFVGVGARFG  + S
Sbjct  18   LVSLLSTVTAGDIVHHDDLAPKKPGCENDFVLVKVQTWVNGVEDAEFVGVGARFGRRIVS  77

Query  385  KEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINN  564
            KEK ANQT +  A+P DCCS  + KL+G+ ++V RGNC FT KAN A+ AGASA+LIINN
Sbjct  78   KEKNANQTHIVFANPRDCCSPLKTKLSGDVVIVDRGNCRFTAKANNAEAAGASALLIINN  137

Query  565  QTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEV  744
            Q EL+KMVCE +ETDLDI IPA+MLPQDAG ++ + + N S VSVQLYSP+RP VDVAEV
Sbjct  138  QKELYKMVCEPDETDLDITIPAVMLPQDAGATLEKMLTNSSEVSVQLYSPKRPAVDVAEV  197

Query  745  FLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
            FLWLMA+ TILCASYWSAW+AREAAI+ DKLLKD  DE
Sbjct  198  FLWLMAIGTILCASYWSAWSAREAAIEHDKLLKDAIDE  235



>ref|XP_009420462.1| PREDICTED: signal peptide peptidase-like 5 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=530

 Score =   315 bits (807),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 148/231 (64%), Positives = 186/231 (81%), Gaps = 4/231 (2%)
 Frame = +1

Query  193  VVLWLLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGP  372
            ++LWL+    L + GDIVH DD AP+  GC N+F+LVKV TWIN +E+ EFVGVGARFG 
Sbjct  11   MLLWLIP--GLTYAGDIVHEDDKAPKLPGCSNHFILVKVQTWINNEEDSEFVGVGARFGT  68

Query  373  TLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAIL  552
            T+++KEK A++T L+L+DP DCC+ P+ K+ G+ +LVHRG C FTTKA VA+ AGASA+L
Sbjct  69   TIQTKEKYASRTPLSLSDPSDCCTAPKEKIAGDILLVHRGRCKFTTKAKVAEAAGASALL  128

Query  553  IINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVD  732
            IINNQ  L+KMVCE+NETDLDI IPA+MLP DAG S+  ++ + + +SVQLYSP RP+VD
Sbjct  129  IINNQ--LYKMVCERNETDLDINIPAVMLPHDAGVSLERSLKSGASLSVQLYSPDRPLVD  186

Query  733  VAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
             AEVFLWLMAV TILCASYWSAW+AREA+I+Q+KLLKD  DE+  ME T S
Sbjct  187  TAEVFLWLMAVGTILCASYWSAWSAREASIEQEKLLKDAPDEFLKMETTGS  237



>gb|KFK42519.1| hypothetical protein AALP_AA1G005000 [Arabis alpina]
Length=537

 Score =   315 bits (806),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 159/227 (70%), Positives = 184/227 (81%), Gaps = 1/227 (0%)
 Frame = +1

Query  205  LLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLES  384
            LL  ++ V  GDIVHHDD  P+R GC+NNFVLVKV T +NG E +E+VGVGARFGPTLES
Sbjct  16   LLYRTSFVSAGDIVHHDDSLPQRPGCNNNFVLVKVPTRVNGSEYVEYVGVGARFGPTLES  75

Query  385  KEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINN  564
            KEK A   +LA+ADPPDCCS P+NKLTGE ILVHRG CSFTTK  VA+ AGASAI+IINN
Sbjct  76   KEKHATLIKLAIADPPDCCSTPKNKLTGEVILVHRGKCSFTTKTKVAEAAGASAIIIINN  135

Query  565  QTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEV  744
             T+LFKMVCEK E  LDI IP +MLP DAG+ + E+I++ S V++QLYSP+RP VDVAEV
Sbjct  136  STDLFKMVCEKGENVLDITIPVVMLPVDAGRDL-ESIVSNSTVTLQLYSPKRPAVDVAEV  194

Query  745  FLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            FLWLMAV TILCASYWSAWT RE AI+QDKLLKDGSDE   +  + S
Sbjct  195  FLWLMAVGTILCASYWSAWTVREEAIEQDKLLKDGSDELLQLSTSSS  241



>gb|AAL14629.1|AF417576_1 growth-on protein GRO10 [Euphorbia esula]
Length=537

 Score =   315 bits (806),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 146/211 (69%), Positives = 174/211 (82%), Gaps = 0/211 (0%)
 Frame = +1

Query  226  VHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQ  405
            V  GDIVH D  AP++ GC+N+FVLVKV TW+NG+E+ EFVGVGARFG T+ SKEK ANQ
Sbjct  22   VIAGDIVHDDASAPKKPGCENDFVLVKVQTWVNGEEDAEFVGVGARFGTTIVSKEKNANQ  81

Query  406  TRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKM  585
            TRL L+DP DCCS P+ K  GE I+V RGNC FT KAN A+ AGA+A+LIINNQ EL+KM
Sbjct  82   TRLTLSDPRDCCSPPKRKFAGEIIMVDRGNCKFTAKANYAEAAGATAVLIINNQKELYKM  141

Query  586  VCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAV  765
            VC+ +ETDLDI IPA+MLPQDAG S+ + +++ + VSVQLYSPRRP+VD+AEVFLWLMAV
Sbjct  142  VCDPDETDLDIKIPAVMLPQDAGASLEKMLLSNASVSVQLYSPRRPLVDIAEVFLWLMAV  201

Query  766  ATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
             TILCASYWSAW+ REA I+ DKLLKD  DE
Sbjct  202  ITILCASYWSAWSTREAVIEHDKLLKDALDE  232



>emb|CDY15163.1| BnaC05g00420D [Brassica napus]
Length=540

 Score =   314 bits (804),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 164/232 (71%), Positives = 184/232 (79%), Gaps = 1/232 (0%)
 Frame = +1

Query  193  VVLWLLSCSA-LVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFG  369
            V+ WL   SA LV GGDIVHHDD  P R GC+NNFVLVKV T +NGKE+ E+VGVGARFG
Sbjct  13   VLGWLYVYSASLVSGGDIVHHDDSLPNRPGCNNNFVLVKVPTRVNGKEKEEYVGVGARFG  72

Query  370  PTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAI  549
            PTLESKEK A    LA+ADPPDCC+ P+ KLTGE ILVHRGNCSFTTK  VA+ AGASAI
Sbjct  73   PTLESKEKHATLINLAVADPPDCCTTPKFKLTGEVILVHRGNCSFTTKTKVAEAAGASAI  132

Query  550  LIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVV  729
            +IINN T+LFKMVCEK E  LDI IP +MLP DAG S+ + +     V++QLYSP+RP V
Sbjct  133  IIINNSTDLFKMVCEKGEDVLDINIPVVMLPLDAGSSLQKFVDANDTVTLQLYSPKRPAV  192

Query  730  DVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            DVAEVFLWLMAV TILCASYWSAWTARE AI+QDKLLKDGSDE   +  T S
Sbjct  193  DVAEVFLWLMAVGTILCASYWSAWTAREEAIEQDKLLKDGSDELLQVSTTSS  244



>emb|CDY45351.1| BnaA09g12360D [Brassica napus]
Length=539

 Score =   313 bits (803),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 148/218 (68%), Positives = 177/218 (81%), Gaps = 0/218 (0%)
 Frame = +1

Query  205  LLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLES  384
            L+S  + V  GDIVH DD+AP++ GC+N+FVLVKV TWI+G E+ EFVGVGARFG  + S
Sbjct  18   LVSLLSTVTAGDIVHQDDLAPKKPGCENDFVLVKVQTWIDGTEDAEFVGVGARFGRRIVS  77

Query  385  KEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINN  564
            KEK ANQT +  A+P DCCS  + KL G+ ++V RGNC FT KAN A+ AGASA+LIINN
Sbjct  78   KEKNANQTHVVFANPRDCCSPLKTKLIGDVVIVDRGNCRFTAKANNAEAAGASALLIINN  137

Query  565  QTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEV  744
            Q EL+KMVCE +ETDLDI IPA+MLPQDAG ++ + ++N S VSVQLYSPRRP VDVAEV
Sbjct  138  QKELYKMVCEPDETDLDIQIPAVMLPQDAGATLEKMLINSSKVSVQLYSPRRPAVDVAEV  197

Query  745  FLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
            FLWLMA+ TILCASYWSAW+AREAAI+ DKLLKD  DE
Sbjct  198  FLWLMAIGTILCASYWSAWSAREAAIEHDKLLKDAIDE  235



>gb|KCW77500.1| hypothetical protein EUGRSUZ_D01835 [Eucalyptus grandis]
Length=377

 Score =   308 bits (788),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 152/238 (64%), Positives = 184/238 (77%), Gaps = 3/238 (1%)
 Frame = +1

Query  148  MELRSTAPYCSVPTAVVLWLLSCSAL-VHGGDIVHHDDVAPRRAGCDNNFVLVKVATWIN  324
            MELR    + ++  A V+WL +C       GDI   D+ AP++ GC+N FVLVKV TW+N
Sbjct  1    MELRGVW-WRAISVAAVIWLAACGPRPAAAGDIAQDDENAPKKPGCNNQFVLVKVQTWVN  59

Query  325  GKEEMEFVGVGARFGPTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSF  504
            G E  EFVGV ARFG  + SKEK A+Q+ L L+DP DCC +P NKLTG+ I+V RGNC+F
Sbjct  60   GLESREFVGVSARFGVPIVSKEKNADQSPLTLSDPRDCC-RPPNKLTGDVIMVDRGNCTF  118

Query  505  TTKANVADDAGASAILIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNK  684
            TTKAN A+ A ASAILI+NNQ EL+KMVC+  ETDLDI IPA+MLPQDAG S+++ +MN 
Sbjct  119  TTKANNAELADASAILIVNNQKELYKMVCDPEETDLDIKIPAVMLPQDAGSSLVKMLMNG  178

Query  685  SMVSVQLYSPRRPVVDVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
            S VSVQLYSP RP+VD+AEVFLWLMAV TILCASYWSAW+AREAA++QDKL KD  DE
Sbjct  179  SSVSVQLYSPTRPLVDIAEVFLWLMAVGTILCASYWSAWSAREAALEQDKLTKDAVDE  236



>ref|XP_008778907.1| PREDICTED: signal peptide peptidase-like 4 [Phoenix dactylifera]
Length=534

 Score =   313 bits (801),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 154/232 (66%), Positives = 183/232 (79%), Gaps = 4/232 (2%)
 Frame = +1

Query  196  VLW-LLSCS---ALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGAR  363
            VLW LL  S    LV GGDIVH DD AP+  GC NNFVLVKV TW+N +E+ EFVGVGAR
Sbjct  9    VLWALLVISVLPGLVLGGDIVHEDDKAPKLPGCSNNFVLVKVQTWVNNREDAEFVGVGAR  68

Query  364  FGPTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGAS  543
            FG T+ESKEK AN+TRL+ +DP DCC+  + KL G+ +LV RGNC FTTKA VA+ AGAS
Sbjct  69   FGTTIESKEKHANRTRLSASDPFDCCTTLKKKLAGDVLLVQRGNCRFTTKAKVAEAAGAS  128

Query  544  AILIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRP  723
            AILIINN+ EL+KMVC+ NET+L+I I A+MLPQDAG S+  +I + + V+VQLYSP RP
Sbjct  129  AILIINNRKELYKMVCDPNETELNISISAVMLPQDAGASLENSITSGASVAVQLYSPDRP  188

Query  724  VVDVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEAT  879
            +VD AEVFLWLMAV TILCASYWSAW+AREA+I+ +KLLKD  DE   ME T
Sbjct  189  LVDTAEVFLWLMAVGTILCASYWSAWSAREASIEYEKLLKDAPDEILNMETT  240



>gb|KCW77499.1| hypothetical protein EUGRSUZ_D01835 [Eucalyptus grandis]
Length=439

 Score =   309 bits (791),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/238 (64%), Positives = 184/238 (77%), Gaps = 3/238 (1%)
 Frame = +1

Query  148  MELRSTAPYCSVPTAVVLWLLSCSAL-VHGGDIVHHDDVAPRRAGCDNNFVLVKVATWIN  324
            MELR    + ++  A V+WL +C       GDI   D+ AP++ GC+N FVLVKV TW+N
Sbjct  1    MELRGVW-WRAISVAAVIWLAACGPRPAAAGDIAQDDENAPKKPGCNNQFVLVKVQTWVN  59

Query  325  GKEEMEFVGVGARFGPTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSF  504
            G E  EFVGV ARFG  + SKEK A+Q+ L L+DP DCC +P NKLTG+ I+V RGNC+F
Sbjct  60   GLESREFVGVSARFGVPIVSKEKNADQSPLTLSDPRDCC-RPPNKLTGDVIMVDRGNCTF  118

Query  505  TTKANVADDAGASAILIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNK  684
            TTKAN A+ A ASAILI+NNQ EL+KMVC+  ETDLDI IPA+MLPQDAG S+++ +MN 
Sbjct  119  TTKANNAELADASAILIVNNQKELYKMVCDPEETDLDIKIPAVMLPQDAGSSLVKMLMNG  178

Query  685  SMVSVQLYSPRRPVVDVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
            S VSVQLYSP RP+VD+AEVFLWLMAV TILCASYWSAW+AREAA++QDKL KD  DE
Sbjct  179  SSVSVQLYSPTRPLVDIAEVFLWLMAVGTILCASYWSAWSAREAALEQDKLTKDAVDE  236



>ref|XP_002509814.1| Minor histocompatibility antigen H13, putative [Ricinus communis]
 gb|EEF51201.1| Minor histocompatibility antigen H13, putative [Ricinus communis]
Length=542

 Score =   311 bits (798),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 146/211 (69%), Positives = 174/211 (82%), Gaps = 0/211 (0%)
 Frame = +1

Query  226  VHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQ  405
            V  GDIVH DD+AP++ GC+N+FVLVKV TW++G E+ EFVGVGARFG  + SKEK ANQ
Sbjct  23   VTAGDIVHDDDLAPKKPGCENDFVLVKVQTWVDGVEDAEFVGVGARFGTAIVSKEKNANQ  82

Query  406  TRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKM  585
            T L L+DP DCC+ P+ K   + I+V RG C FTTKAN A+ AGASA+LIINNQ EL+KM
Sbjct  83   THLTLSDPRDCCTAPKKKFERDVIMVDRGQCKFTTKANNAEAAGASAVLIINNQKELYKM  142

Query  586  VCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAV  765
            VCE +ETDLDI IPA+MLPQDAG S+ + + + + VSVQLYSPRRP+VD+AEVFLWLMAV
Sbjct  143  VCEPDETDLDIHIPAVMLPQDAGASLEKMLSSNASVSVQLYSPRRPLVDIAEVFLWLMAV  202

Query  766  ATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
             TILCASYWSAW+AREAAI+QDKLLKD  DE
Sbjct  203  VTILCASYWSAWSAREAAIEQDKLLKDAVDE  233



>ref|XP_009112759.1| PREDICTED: signal peptide peptidase-like 2 [Brassica rapa]
Length=539

 Score =   311 bits (796),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 146/211 (69%), Positives = 173/211 (82%), Gaps = 0/211 (0%)
 Frame = +1

Query  226  VHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQ  405
            V  GDIVH DD+AP++ GC+N+FVLVKV TWI+G E+ EFVGVGARFG  + SKEK ANQ
Sbjct  25   VTAGDIVHQDDLAPKKPGCENDFVLVKVQTWIDGTEDAEFVGVGARFGRRIVSKEKNANQ  84

Query  406  TRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKM  585
            T +  A+P DCCS  + KL G+ ++V RGNC FT KAN A+ AGASA+LIINNQ EL+KM
Sbjct  85   THVVFANPRDCCSPLKTKLIGDVVIVDRGNCRFTAKANNAEAAGASALLIINNQKELYKM  144

Query  586  VCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAV  765
            VCE +ETDLDI IPA+MLPQDAG ++ + ++N S VSVQLYSPRRP VDVAEVFLWLMA+
Sbjct  145  VCEPDETDLDIQIPAVMLPQDAGATLEKMLINSSKVSVQLYSPRRPAVDVAEVFLWLMAI  204

Query  766  ATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
             TILCASYWSAW+AREAAI+ DKLLKD  DE
Sbjct  205  GTILCASYWSAWSAREAAIEHDKLLKDAIDE  235



>gb|EYU38342.1| hypothetical protein MIMGU_mgv1a004184mg [Erythranthe guttata]
Length=540

 Score =   311 bits (796),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 150/223 (67%), Positives = 179/223 (80%), Gaps = 3/223 (1%)
 Frame = +1

Query  190  AVVLWLLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFG  369
            A +L LLS +  V+ GDIVH D++AP++ GC+N+FVLVKV TW++G E+ EFVGVGARFG
Sbjct  15   AGLLILLSNTGRVYAGDIVHDDNLAPKKPGCENDFVLVKVQTWVDGIEDEEFVGVGARFG  74

Query  370  PTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAI  549
             T+ SKEK ANQT L L+DP DCC     K  G+ ++V RGNC FTTKAN A  AGASA+
Sbjct  75   TTIVSKEKNANQTHLFLSDPRDCCGPANKKFDGDILMVDRGNCKFTTKANFAQAAGASAV  134

Query  550  LIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVV  729
            LIINN+ EL+KMVCE +ETDLDI IPA+MLPQDAG ++ + + N   VSVQLYSPRRPVV
Sbjct  135  LIINNEKELYKMVCEPDETDLDIHIPAVMLPQDAGATLEKMLSN---VSVQLYSPRRPVV  191

Query  730  DVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
            D+AEVFLWLMAV TILCASYWSAW+AREAAI+QDK LKD  DE
Sbjct  192  DIAEVFLWLMAVGTILCASYWSAWSAREAAIEQDKFLKDAPDE  234



>gb|KFK30597.1| hypothetical protein AALP_AA6G002300 [Arabis alpina]
Length=532

 Score =   310 bits (795),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 147/211 (70%), Positives = 172/211 (82%), Gaps = 0/211 (0%)
 Frame = +1

Query  226  VHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQ  405
            V  GDIVH DD+AP++ GC+N+FVLVKV TWI+G EE+EFVGVGARFG  + SKEK ANQ
Sbjct  18   VLAGDIVHQDDLAPKKPGCENDFVLVKVQTWIDGNEEVEFVGVGARFGRRIVSKEKNANQ  77

Query  406  TRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKM  585
            TRL  A+P D CS  +NKL+G+ ++V RGNC FT KAN A+ AGASA+LIINNQ EL+KM
Sbjct  78   TRLFFANPRDSCSPLKNKLSGDVVIVERGNCKFTAKANHAEAAGASALLIINNQKELYKM  137

Query  586  VCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAV  765
            VCE +ETDLDI IP +MLPQDAG ++   + N S VS QLYSPRRP VDVAEVFLWLMA+
Sbjct  138  VCEPDETDLDIQIPVVMLPQDAGATLQLMLANSSKVSAQLYSPRRPAVDVAEVFLWLMAI  197

Query  766  ATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
             TILCASYWSAW+AREAAI+ DKLLKD  DE
Sbjct  198  GTILCASYWSAWSAREAAIEYDKLLKDAIDE  228



>ref|XP_010418403.1| PREDICTED: signal peptide peptidase-like 2 isoform X2 [Camelina 
sativa]
 ref|XP_010418404.1| PREDICTED: signal peptide peptidase-like 2 isoform X3 [Camelina 
sativa]
Length=540

 Score =   310 bits (794),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 145/211 (69%), Positives = 171/211 (81%), Gaps = 0/211 (0%)
 Frame = +1

Query  226  VHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQ  405
            V  GDIVH DD+AP++ GC+N+FVLVKV TW++G E +EFVGVGARFG  + SKEK ANQ
Sbjct  26   VTAGDIVHQDDLAPKKPGCENDFVLVKVQTWVDGVESVEFVGVGARFGRRIVSKEKNANQ  85

Query  406  TRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKM  585
            T L  A+PPD C+  +NKL+G+ ++V RGNC FT KAN A+ AGASA+LIINNQ EL+KM
Sbjct  86   THLVFANPPDSCTPLKNKLSGDVVIVERGNCRFTAKANNAEAAGASALLIINNQKELYKM  145

Query  586  VCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAV  765
            VCE +ETDLDI IPA+MLPQDAG ++   + N S VS QLYSPRRP VDVAEVFLWLMA+
Sbjct  146  VCEPDETDLDIQIPAVMLPQDAGATLQTMLANSSKVSAQLYSPRRPAVDVAEVFLWLMAI  205

Query  766  ATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
             TILCASYWSAW+AREAAI  DKLLKD  DE
Sbjct  206  GTILCASYWSAWSAREAAIDHDKLLKDAIDE  236



>ref|XP_010418402.1| PREDICTED: signal peptide peptidase-like 2 isoform X1 [Camelina 
sativa]
Length=540

 Score =   310 bits (793),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 145/211 (69%), Positives = 171/211 (81%), Gaps = 0/211 (0%)
 Frame = +1

Query  226  VHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQ  405
            V  GDIVH DD+AP++ GC+N+FVLVKV TW++G E +EFVGVGARFG  + SKEK ANQ
Sbjct  26   VTAGDIVHQDDLAPKKPGCENDFVLVKVQTWVDGVESVEFVGVGARFGRRIVSKEKNANQ  85

Query  406  TRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKM  585
            T L  A+PPD C+  +NKL+G+ ++V RGNC FT KAN A+ AGASA+LIINNQ EL+KM
Sbjct  86   THLVFANPPDSCTPLKNKLSGDVVIVERGNCRFTAKANNAEAAGASALLIINNQKELYKM  145

Query  586  VCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAV  765
            VCE +ETDLDI IPA+MLPQDAG ++   + N S VS QLYSPRRP VDVAEVFLWLMA+
Sbjct  146  VCEPDETDLDIQIPAVMLPQDAGATLQTMLANSSKVSAQLYSPRRPAVDVAEVFLWLMAI  205

Query  766  ATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
             TILCASYWSAW+AREAAI  DKLLKD  DE
Sbjct  206  GTILCASYWSAWSAREAAIDHDKLLKDAIDE  236



>ref|XP_007158507.1| hypothetical protein PHAVU_002G158100g [Phaseolus vulgaris]
 gb|ESW30501.1| hypothetical protein PHAVU_002G158100g [Phaseolus vulgaris]
Length=543

 Score =   310 bits (793),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 151/224 (67%), Positives = 178/224 (79%), Gaps = 1/224 (0%)
 Frame = +1

Query  187  TAVVLWLLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARF  366
            +AV+L LL  +  V  GDIVH DD  P++ GC N FVLVKV TW+NG E+ EFVGVGARF
Sbjct  13   SAVIL-LLRDAPSVLAGDIVHDDDSTPKKPGCANQFVLVKVQTWVNGVEDAEFVGVGARF  71

Query  367  GPTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASA  546
            G  + SKEK A  TRL L+DP DCCS P+NKL G+ I+V RGNC+FT KAN A +A ASA
Sbjct  72   GRAIVSKEKNARHTRLILSDPRDCCSPPKNKLVGDVIMVDRGNCTFTRKANTAQNANASA  131

Query  547  ILIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPV  726
            ILIINNQ EL+KMVC+ +ETDL+I IPA+MLP DAG  + + + + S VSVQLYSPRRP 
Sbjct  132  ILIINNQKELYKMVCDPDETDLNIHIPAVMLPLDAGTRLEKMLTSTSSVSVQLYSPRRPS  191

Query  727  VDVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
            VD+AEVFLW+MAV TILCASYWSAWTARE+AI+QDKLLKD SDE
Sbjct  192  VDIAEVFLWMMAVLTILCASYWSAWTARESAIEQDKLLKDASDE  235



>ref|XP_011092489.1| PREDICTED: signal peptide peptidase-like 4 isoform X2 [Sesamum 
indicum]
Length=480

 Score =   308 bits (788),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 144/175 (82%), Positives = 159/175 (91%), Gaps = 0/175 (0%)
 Frame = +1

Query  337  MEFVGVGARFGPTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKA  516
            MEFVGVGARFGPTLESKEKRANQT++ALADPPDCCSKPRNKLTGE ILV RGNCSF TK 
Sbjct  1    MEFVGVGARFGPTLESKEKRANQTKVALADPPDCCSKPRNKLTGEVILVQRGNCSFVTKG  60

Query  517  NVADDAGASAILIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVS  696
            NVA+ AGASA+LIINNQTELFKMVCE NETD++I IP +MLPQDAG S+ + + N S VS
Sbjct  61   NVAEAAGASALLIINNQTELFKMVCEANETDVNIHIPVVMLPQDAGASLKQLMTNSSHVS  120

Query  697  VQLYSPRRPVVDVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDEY  861
            +Q+YSPRRP VDVAEVFLWLMAV TILCA+YWSAW+AREAAI+QDKLLKDGSDEY
Sbjct  121  IQMYSPRRPQVDVAEVFLWLMAVGTILCAAYWSAWSAREAAIEQDKLLKDGSDEY  175



>gb|ABN06072.1| Protease-associated PA; Peptidase A22B, minor histocompatibility 
antigen H13 [Medicago truncatula]
Length=492

 Score =   308 bits (789),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 150/196 (77%), Positives = 167/196 (85%), Gaps = 1/196 (1%)
 Frame = +1

Query  298  LVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAI  477
            +VKV   I+G E  E+VGVGARFGPTLESKEKRAN TR+A+ADPPDCCSKP+NKLTGE I
Sbjct  1    MVKVPISIDGVESGEYVGVGARFGPTLESKEKRANHTRVAIADPPDCCSKPKNKLTGEII  60

Query  478  LVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQ  657
            LVHRG CSFTTKAN+A++AGASAILIINN   LFKMVCE NETD+DIGIPA+MLPQDAG 
Sbjct  61   LVHRGQCSFTTKANIAEEAGASAILIINNAKGLFKMVCE-NETDIDIGIPAVMLPQDAGV  119

Query  658  SMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKL  837
            ++   I NKS+VSVQLYSPRRP VDVAEVFLWLMAV TILCASYWSAWTARE  I+Q+KL
Sbjct  120  ALKNYIQNKSIVSVQLYSPRRPQVDVAEVFLWLMAVGTILCASYWSAWTAREGVIEQEKL  179

Query  838  LKDGSDEYCGMEATQS  885
            LKD SDE   +E   S
Sbjct  180  LKDDSDELLNIENAGS  195



>emb|CDY08318.1| BnaC09g12780D [Brassica napus]
Length=539

 Score =   309 bits (792),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 146/218 (67%), Positives = 175/218 (80%), Gaps = 0/218 (0%)
 Frame = +1

Query  205  LLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLES  384
            L+S    V  GDIVH DD+AP++ GC+N+FVLVKV TWI+G E+ EFVGVGARFG  + S
Sbjct  18   LVSLLYTVTAGDIVHQDDLAPKKPGCENDFVLVKVQTWIDGTEDAEFVGVGARFGRRIVS  77

Query  385  KEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINN  564
            KEK ANQT +  A+P DCCS  + KL G+ ++V RGNC FT KAN A+ AGASA+LIINN
Sbjct  78   KEKNANQTHVVFANPRDCCSPLKTKLIGDVVIVDRGNCRFTAKANNAEAAGASALLIINN  137

Query  565  QTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEV  744
            Q EL+KMVCE +ETDLDI IPA++LPQDAG ++ + ++N S VSVQLYSPRRP VDVAEV
Sbjct  138  QKELYKMVCEPDETDLDIQIPAVLLPQDAGATLEKMLINSSKVSVQLYSPRRPAVDVAEV  197

Query  745  FLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
            FLWLMA+ TILCASYWSAW+ARE AI+ DKLLKD  DE
Sbjct  198  FLWLMAIGTILCASYWSAWSAREPAIEHDKLLKDAIDE  235



>ref|XP_009119715.1| PREDICTED: signal peptide peptidase-like 4 [Brassica rapa]
Length=540

 Score =   309 bits (792),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 161/229 (70%), Positives = 181/229 (79%), Gaps = 1/229 (0%)
 Frame = +1

Query  202  WLLSCSA-LVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTL  378
            WL   SA LV GGDIVHHDD  P R GC+NNFVLVKV T +NGKE+ E+VGVGARFGPTL
Sbjct  16   WLYVYSASLVSGGDIVHHDDSLPNRPGCNNNFVLVKVPTRVNGKEKEEYVGVGARFGPTL  75

Query  379  ESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILII  558
            ESKEK A   +LA+ADP D C+ P+ KLTGE ILVHRGNCSFTTK  VA+ AGASAI+II
Sbjct  76   ESKEKHATLIKLAVADPSDSCTTPKFKLTGEVILVHRGNCSFTTKTKVAEAAGASAIIII  135

Query  559  NNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVA  738
            NN T+LFKMVCEK E  LDI IP +MLP DAG S+ + +     V++QLYSP+RP VDVA
Sbjct  136  NNSTDLFKMVCEKGEDVLDINIPVVMLPLDAGSSLQKFVDGNDTVTLQLYSPKRPAVDVA  195

Query  739  EVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            EVFLWLMAV TILCASYWSAWTARE AI+QDKLLKDGSDE   +  T S
Sbjct  196  EVFLWLMAVGTILCASYWSAWTAREEAIEQDKLLKDGSDELLQVSTTSS  244



>ref|XP_010935854.1| PREDICTED: signal peptide peptidase-like 4 isoform X1 [Elaeis 
guineensis]
Length=531

 Score =   308 bits (790),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 146/222 (66%), Positives = 177/222 (80%), Gaps = 0/222 (0%)
 Frame = +1

Query  220  ALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRA  399
             LV GGDIVH DD AP+  GC NNFVLVKV TWIN  E+ EFVGVGARFG T+E+KEK A
Sbjct  18   GLVRGGDIVHEDDKAPKVPGCSNNFVLVKVQTWINNIEDDEFVGVGARFGTTIEAKEKYA  77

Query  400  NQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELF  579
            N+TR+ L+DP DCC+  + KL G+ +LVHRG+C FTTKA VA+ AGASAILIINN+ EL+
Sbjct  78   NRTRVFLSDPADCCTTLKKKLAGDILLVHRGHCKFTTKAKVAEAAGASAILIINNRKELY  137

Query  580  KMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLM  759
            KMVC+ NETDL+I I A+MLPQDAG S+  ++ + + V+VQLYSP RP+VD AEVFLWLM
Sbjct  138  KMVCDPNETDLNISISAVMLPQDAGASLDSSVKSGASVAVQLYSPDRPLVDTAEVFLWLM  197

Query  760  AVATILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            AV TILCASYWSAW+AREA+I+ +KL+KD  DE    E T +
Sbjct  198  AVGTILCASYWSAWSAREASIEYEKLIKDAPDEMLNTETTGT  239



>gb|AAG52428.1|AC011622_16 unknown protein; 50290-46846 [Arabidopsis thaliana]
Length=519

 Score =   308 bits (789),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/211 (69%), Positives = 171/211 (81%), Gaps = 0/211 (0%)
 Frame = +1

Query  226  VHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQ  405
            V  GDIVH D++AP++ GC+N+FVLVKV TWI+G E  EFVGVGARFG  + SKEK ANQ
Sbjct  25   VTAGDIVHQDNLAPKKPGCENDFVLVKVQTWIDGVENEEFVGVGARFGKRIVSKEKNANQ  84

Query  406  TRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKM  585
            T L  A+P D C+  +NKL+G+ ++V RGNC FT KAN A+ AGASA+LIINNQ EL+KM
Sbjct  85   THLVFANPRDSCTPLKNKLSGDVVIVERGNCRFTAKANNAEAAGASALLIINNQKELYKM  144

Query  586  VCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAV  765
            VCE +ETDLDI IPA+MLPQDAG S+ + + N S VS QLYSPRRP VDVAEVFLWLMA+
Sbjct  145  VCEPDETDLDIQIPAVMLPQDAGASLQKMLANSSKVSAQLYSPRRPAVDVAEVFLWLMAI  204

Query  766  ATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
             TILCASYWSAW+AREAAI+ DKLLKD  DE
Sbjct  205  GTILCASYWSAWSAREAAIEHDKLLKDAIDE  235



>ref|XP_002439083.1| hypothetical protein SORBIDRAFT_10g031280 [Sorghum bicolor]
 gb|EER90450.1| hypothetical protein SORBIDRAFT_10g031280 [Sorghum bicolor]
Length=536

 Score =   308 bits (788),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 143/218 (66%), Positives = 177/218 (81%), Gaps = 0/218 (0%)
 Frame = +1

Query  232  GGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTR  411
            GGDIVHHDD AP+  GC+N+F+LVKV +W+NGKE+ EFVGVGARFGP + SKEK AN+T+
Sbjct  21   GGDIVHHDDEAPKIPGCNNDFILVKVQSWVNGKEDGEFVGVGARFGPKIVSKEKHANRTK  80

Query  412  LALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVC  591
            L LADP DCCS P++K++G+ +LV RG C FT KA  A+ AGASAI+IIN+  EL+KMVC
Sbjct  81   LTLADPMDCCSPPKHKVSGDVLLVQRGKCKFTKKAKFAEAAGASAIVIINHVHELYKMVC  140

Query  592  EKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVAT  771
            EKNETDLDI IPA++LP+DAG ++   + + + VSVQLYSP RPVVD AEVFLWLMAV T
Sbjct  141  EKNETDLDINIPAVLLPKDAGSALHTLLTDGNAVSVQLYSPDRPVVDTAEVFLWLMAVGT  200

Query  772  ILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            +L ASYWSAW+AREA I+Q+KLLKDG +    +EA  S
Sbjct  201  VLGASYWSAWSAREAVIEQEKLLKDGHESLLNVEAGGS  238



>ref|XP_006301088.1| hypothetical protein CARUB_v10021480mg [Capsella rubella]
 gb|EOA33986.1| hypothetical protein CARUB_v10021480mg [Capsella rubella]
Length=539

 Score =   307 bits (787),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 145/211 (69%), Positives = 170/211 (81%), Gaps = 0/211 (0%)
 Frame = +1

Query  226  VHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQ  405
            V  GDIVH DD+AP++ GC+N+FVLVKV TW++G E +EFVGVGARFG  + SKEK ANQ
Sbjct  25   VTAGDIVHQDDLAPKKPGCENDFVLVKVQTWVDGAENVEFVGVGARFGRRIVSKEKNANQ  84

Query  406  TRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKM  585
            T L  A+P D C+  +NKL+G+ ++V RGNC FT KAN A+ AGASA+LIINNQ EL+KM
Sbjct  85   THLVFANPRDSCTPLKNKLSGDVVIVERGNCRFTAKANNAEAAGASALLIINNQKELYKM  144

Query  586  VCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAV  765
            VCE +ETDLDI IPA+MLPQDAG S+   + N S VS QLYSPRRP VDVAEVFLWLMA+
Sbjct  145  VCEPDETDLDIQIPAVMLPQDAGASLQTMLANSSKVSAQLYSPRRPAVDVAEVFLWLMAI  204

Query  766  ATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
             TILCASYWSAW+AREAAI  DKLLKD  DE
Sbjct  205  GTILCASYWSAWSAREAAIDHDKLLKDAIDE  235



>ref|XP_003538333.1| PREDICTED: signal peptide peptidase-like 2-like [Glycine max]
 gb|KHN35026.1| Signal peptide peptidase-like 2B [Glycine soja]
Length=543

 Score =   307 bits (787),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 143/208 (69%), Positives = 168/208 (81%), Gaps = 0/208 (0%)
 Frame = +1

Query  235  GDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRL  414
            GDIVH DD  P++ GC+N FVLVKV TW+NG E++EFVGVGARFG  + SKEK A  TRL
Sbjct  28   GDIVHDDDSTPKKPGCENQFVLVKVQTWVNGVEDVEFVGVGARFGRAIVSKEKNAKHTRL  87

Query  415  ALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCE  594
             L+DP DCC  P+NK+ G+ I+V RGNC+FT KAN+A +A ASAILIINNQ EL+KMVCE
Sbjct  88   ILSDPRDCCIPPKNKIVGDVIMVDRGNCTFTKKANIAQNANASAILIINNQKELYKMVCE  147

Query  595  KNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATI  774
             +ETDL+I IPA+MLP DAG  + + +   S VSVQLYSP RP VD+AEVFLW+MAV TI
Sbjct  148  PDETDLNIHIPAVMLPLDAGTRLEKMLTTTSSVSVQLYSPFRPAVDIAEVFLWMMAVLTI  207

Query  775  LCASYWSAWTAREAAIQQDKLLKDGSDE  858
            LCASYWSAWT REAAI+QDKLLKD SDE
Sbjct  208  LCASYWSAWTTREAAIEQDKLLKDASDE  235



>ref|XP_002887944.1| protease-associated domain-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH64203.1| protease-associated domain-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=540

 Score =   306 bits (785),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/211 (69%), Positives = 171/211 (81%), Gaps = 0/211 (0%)
 Frame = +1

Query  226  VHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQ  405
            V  GDIVH D++AP++ GC+N+FVLVKV TWI+G E  EFVGVGARFG  + SKEK ANQ
Sbjct  25   VTAGDIVHQDNLAPKKPGCENDFVLVKVQTWIDGVENEEFVGVGARFGRRIVSKEKNANQ  84

Query  406  TRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKM  585
            T L  A+P D C+  +NKL+GE ++V RGNC FT KAN A+ AG+SA+LIINNQ EL+KM
Sbjct  85   THLVFANPRDSCTPLKNKLSGEVVIVERGNCRFTAKANNAEAAGSSALLIINNQKELYKM  144

Query  586  VCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAV  765
            VCE +ETDLDI IPA+MLPQDAG S+ + + N S VS QLYSPRRP VDVAEVFLWLMA+
Sbjct  145  VCEPDETDLDIQIPAVMLPQDAGASLQKMLANSSKVSAQLYSPRRPAVDVAEVFLWLMAI  204

Query  766  ATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
             TILCASYWSAW+AREAAI+ DKLLKD  DE
Sbjct  205  GTILCASYWSAWSAREAAIEHDKLLKDAIDE  235



>ref|NP_974082.1| signal peptide peptidase-like 2 [Arabidopsis thaliana]
 gb|AEE34133.1| signal peptide peptidase-like 2 [Arabidopsis thaliana]
Length=540

 Score =   306 bits (785),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/211 (69%), Positives = 171/211 (81%), Gaps = 0/211 (0%)
 Frame = +1

Query  226  VHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQ  405
            V  GDIVH D++AP++ GC+N+FVLVKV TWI+G E  EFVGVGARFG  + SKEK ANQ
Sbjct  25   VTAGDIVHQDNLAPKKPGCENDFVLVKVQTWIDGVENEEFVGVGARFGKRIVSKEKNANQ  84

Query  406  TRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKM  585
            T L  A+P D C+  +NKL+G+ ++V RGNC FT KAN A+ AGASA+LIINNQ EL+KM
Sbjct  85   THLVFANPRDSCTPLKNKLSGDVVIVERGNCRFTAKANNAEAAGASALLIINNQKELYKM  144

Query  586  VCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAV  765
            VCE +ETDLDI IPA+MLPQDAG S+ + + N S VS QLYSPRRP VDVAEVFLWLMA+
Sbjct  145  VCEPDETDLDIQIPAVMLPQDAGASLQKMLANSSKVSAQLYSPRRPAVDVAEVFLWLMAI  204

Query  766  ATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
             TILCASYWSAW+AREAAI+ DKLLKD  DE
Sbjct  205  GTILCASYWSAWSAREAAIEHDKLLKDAIDE  235



>ref|XP_003517469.1| PREDICTED: signal peptide peptidase-like 2-like [Glycine max]
 gb|KHN25696.1| Signal peptide peptidase-like 2B [Glycine soja]
Length=543

 Score =   306 bits (785),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/208 (69%), Positives = 168/208 (81%), Gaps = 0/208 (0%)
 Frame = +1

Query  235  GDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRL  414
            GDIVH DD  P++ GC+N FVLVKV TW+NG E++EFVGVGARFG  + SKEK A  TRL
Sbjct  28   GDIVHDDDSTPKKPGCENQFVLVKVQTWVNGVEDVEFVGVGARFGRAIVSKEKNAKHTRL  87

Query  415  ALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCE  594
             L+DP DCC  P+NK+ G+ I+V RGNC+FT KAN+A +A ASAILIINNQ EL+KMVCE
Sbjct  88   ILSDPRDCCIPPKNKIVGDVIMVDRGNCTFTKKANIAQNANASAILIINNQKELYKMVCE  147

Query  595  KNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATI  774
             +ETDL+I IPA+MLP DAG  + + +   S VSVQLYSP RP VDVAEVFLW+MAV TI
Sbjct  148  PDETDLNIHIPAVMLPLDAGTRLEKMLTTTSSVSVQLYSPLRPAVDVAEVFLWMMAVLTI  207

Query  775  LCASYWSAWTAREAAIQQDKLLKDGSDE  858
            LCASYWSAWT REAAI+QDKLLKD SDE
Sbjct  208  LCASYWSAWTTREAAIEQDKLLKDASDE  235



>ref|NP_564815.1| signal peptide peptidase-like 2 [Arabidopsis thaliana]
 sp|Q8W469.1|SIPL2_ARATH RecName: Full=Signal peptide peptidase-like 2; Short=AtSPPL2; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAL32885.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP68334.1| At1g63690 [Arabidopsis thaliana]
 gb|AEE34134.1| signal peptide peptidase-like 2 [Arabidopsis thaliana]
Length=540

 Score =   306 bits (785),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/211 (69%), Positives = 171/211 (81%), Gaps = 0/211 (0%)
 Frame = +1

Query  226  VHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQ  405
            V  GDIVH D++AP++ GC+N+FVLVKV TWI+G E  EFVGVGARFG  + SKEK ANQ
Sbjct  25   VTAGDIVHQDNLAPKKPGCENDFVLVKVQTWIDGVENEEFVGVGARFGKRIVSKEKNANQ  84

Query  406  TRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKM  585
            T L  A+P D C+  +NKL+G+ ++V RGNC FT KAN A+ AGASA+LIINNQ EL+KM
Sbjct  85   THLVFANPRDSCTPLKNKLSGDVVIVERGNCRFTAKANNAEAAGASALLIINNQKELYKM  144

Query  586  VCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAV  765
            VCE +ETDLDI IPA+MLPQDAG S+ + + N S VS QLYSPRRP VDVAEVFLWLMA+
Sbjct  145  VCEPDETDLDIQIPAVMLPQDAGASLQKMLANSSKVSAQLYSPRRPAVDVAEVFLWLMAI  204

Query  766  ATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
             TILCASYWSAW+AREAAI+ DKLLKD  DE
Sbjct  205  GTILCASYWSAWSAREAAIEHDKLLKDAIDE  235



>ref|XP_010053243.1| PREDICTED: signal peptide peptidase-like 2 [Eucalyptus grandis]
 gb|KCW77498.1| hypothetical protein EUGRSUZ_D01835 [Eucalyptus grandis]
Length=545

 Score =   306 bits (785),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 152/238 (64%), Positives = 184/238 (77%), Gaps = 3/238 (1%)
 Frame = +1

Query  148  MELRSTAPYCSVPTAVVLWLLSCSAL-VHGGDIVHHDDVAPRRAGCDNNFVLVKVATWIN  324
            MELR    + ++  A V+WL +C       GDI   D+ AP++ GC+N FVLVKV TW+N
Sbjct  1    MELRGVW-WRAISVAAVIWLAACGPRPAAAGDIAQDDENAPKKPGCNNQFVLVKVQTWVN  59

Query  325  GKEEMEFVGVGARFGPTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSF  504
            G E  EFVGV ARFG  + SKEK A+Q+ L L+DP DCC +P NKLTG+ I+V RGNC+F
Sbjct  60   GLESREFVGVSARFGVPIVSKEKNADQSPLTLSDPRDCC-RPPNKLTGDVIMVDRGNCTF  118

Query  505  TTKANVADDAGASAILIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNK  684
            TTKAN A+ A ASAILI+NNQ EL+KMVC+  ETDLDI IPA+MLPQDAG S+++ +MN 
Sbjct  119  TTKANNAELADASAILIVNNQKELYKMVCDPEETDLDIKIPAVMLPQDAGSSLVKMLMNG  178

Query  685  SMVSVQLYSPRRPVVDVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
            S VSVQLYSP RP+VD+AEVFLWLMAV TILCASYWSAW+AREAA++QDKL KD  DE
Sbjct  179  SSVSVQLYSPTRPLVDIAEVFLWLMAVGTILCASYWSAWSAREAALEQDKLTKDAVDE  236



>ref|XP_004954446.1| PREDICTED: signal peptide peptidase-like 4-like [Setaria italica]
Length=541

 Score =   306 bits (785),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 144/216 (67%), Positives = 178/216 (82%), Gaps = 1/216 (0%)
 Frame = +1

Query  238  DIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRLA  417
            DIVH DD AP+  GC+N+FVLVKV TW+N +E+ EFVGVGARFGP +ESKEK AN+TRL 
Sbjct  23   DIVHQDDEAPKIPGCNNDFVLVKVQTWVNKREKDEFVGVGARFGPKIESKEKHANRTRLL  82

Query  418  LADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCEK  597
            LADP DCC+ P+ K+ G+ +LV RGNC FTTKA VA+ AGASAI+IIN++ EL+KMVCE+
Sbjct  83   LADPSDCCTPPKEKVAGDILLVERGNCKFTTKAKVAESAGASAIIIINDKHELYKMVCER  142

Query  598  NETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATIL  777
            NETDLDIGIPA++LP+DAG  + +++++   V VQLYSP RP+VD AEVFLWLMAV TIL
Sbjct  143  NETDLDIGIPAVLLPKDAGTKL-QSLLSSGEVLVQLYSPDRPLVDTAEVFLWLMAVGTIL  201

Query  778  CASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            CASYWSAW+AREA I+Q+KLLKDG +    +EA  S
Sbjct  202  CASYWSAWSAREADIEQEKLLKDGHEIPPNLEAGGS  237



>ref|XP_010430474.1| PREDICTED: signal peptide peptidase-like 2 [Camelina sativa]
Length=541

 Score =   305 bits (782),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 144/211 (68%), Positives = 171/211 (81%), Gaps = 0/211 (0%)
 Frame = +1

Query  226  VHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQ  405
            V  GDIVH D++AP++ GC+N+FVLVKV TW++G E +EFVGVGARFG  + SKEK ANQ
Sbjct  27   VTAGDIVHQDNLAPKKPGCENDFVLVKVQTWVDGVENVEFVGVGARFGRRIVSKEKNANQ  86

Query  406  TRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKM  585
            T L  A+P D C+  +NKL+G+ ++V RGNC FT KAN A+ AGASA+LIINNQ EL+KM
Sbjct  87   THLVFANPRDSCTPLKNKLSGDVVIVERGNCRFTAKANNAEAAGASALLIINNQKELYKM  146

Query  586  VCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAV  765
            VCE +ETDLDI IPA+MLPQDAG ++   + N S VSVQLYSPRRP VDVAEVFLWLMA+
Sbjct  147  VCEPDETDLDIQIPAVMLPQDAGATLQTMLANSSKVSVQLYSPRRPAVDVAEVFLWLMAI  206

Query  766  ATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
             TILCASYWSAW+AREAAI  DKLLKD  DE
Sbjct  207  GTILCASYWSAWSAREAAIDHDKLLKDAIDE  237



>ref|XP_010473618.1| PREDICTED: signal peptide peptidase-like 2 [Camelina sativa]
Length=540

 Score =   305 bits (781),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 144/211 (68%), Positives = 170/211 (81%), Gaps = 0/211 (0%)
 Frame = +1

Query  226  VHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQ  405
            V  GDIVH DD+AP++ GC+N+FVLVKV TW++G E +EFVGVGARFG  + SKEK ANQ
Sbjct  26   VTAGDIVHQDDLAPKKPGCENDFVLVKVQTWVDGVENVEFVGVGARFGRRIVSKEKNANQ  85

Query  406  TRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKM  585
            T L  A+P D C+  +NKL+G+ ++V RGNC FT KAN A+ AGASA+LIINNQ EL+KM
Sbjct  86   THLVFANPRDSCTPLKNKLSGDVVIVERGNCRFTAKANNAEAAGASALLIINNQKELYKM  145

Query  586  VCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAV  765
            VCE +ETDLDI IPA+MLPQDAG ++   + N S VS QLYSPRRP VDVAEVFLWLMA+
Sbjct  146  VCEPDETDLDIQIPAVMLPQDAGVTLQTMLANSSKVSAQLYSPRRPAVDVAEVFLWLMAI  205

Query  766  ATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
             TILCASYWSAW+AREAAI  DKLLKD  DE
Sbjct  206  GTILCASYWSAWSAREAAIDHDKLLKDAIDE  236



>ref|NP_001149009.1| LOC100282629 precursor [Zea mays]
 gb|ACF86425.1| unknown [Zea mays]
 gb|ACG33797.1| signal peptide peptidase-like 2B [Zea mays]
Length=536

 Score =   303 bits (777),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 142/216 (66%), Positives = 173/216 (80%), Gaps = 0/216 (0%)
 Frame = +1

Query  238  DIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRLA  417
            DIVHHDD AP+  GC N+F+LVKV +W+NGKE  EFVGVGARFGP + SKEK AN+T+L 
Sbjct  23   DIVHHDDEAPKIPGCSNDFILVKVQSWVNGKEGGEFVGVGARFGPKIVSKEKHANRTKLT  82

Query  418  LADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCEK  597
            LADP DCCS P++K+ G+ +LV RG C FT KA  A+ AGASAI+IIN+  EL+KMVCEK
Sbjct  83   LADPMDCCSPPKHKVPGDVLLVQRGKCKFTKKAKFAEAAGASAIVIINHVHELYKMVCEK  142

Query  598  NETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATIL  777
            NETDLDI IPA++LP+DAG ++   + N + VSVQLYSP RPVVD AEVFLWLMAV T+L
Sbjct  143  NETDLDINIPAVLLPKDAGSALHTLLTNGNTVSVQLYSPDRPVVDTAEVFLWLMAVGTVL  202

Query  778  CASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
             ASYWSAW+AREA I+Q+KLLKDG ++   +EA  S
Sbjct  203  GASYWSAWSAREAVIEQEKLLKDGHEDLLNVEARGS  238



>ref|XP_004966574.1| PREDICTED: signal peptide peptidase-like 5-like [Setaria italica]
Length=536

 Score =   303 bits (776),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 142/218 (65%), Positives = 175/218 (80%), Gaps = 0/218 (0%)
 Frame = +1

Query  232  GGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTR  411
            GGDIVHHDD AP+  GC+N+F+LVKV +W+NGKE  EFVGVGARFGP + SKEK AN+ +
Sbjct  21   GGDIVHHDDEAPKIPGCNNDFILVKVQSWVNGKEGDEFVGVGARFGPKIVSKEKHANRPK  80

Query  412  LALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVC  591
            L LADP DCCS P++K++G+ +LV RG C FT KA  A+ AGASAI+IIN+  EL+KMVC
Sbjct  81   LTLADPIDCCSPPKHKVSGDVLLVQRGKCKFTKKAKFAEAAGASAIVIINHVHELYKMVC  140

Query  592  EKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVAT  771
            EKNETDLDI IPA++LP+DAG ++   + + + VSVQLYSP RPVVD AEVFLWLMAV T
Sbjct  141  EKNETDLDIHIPAVLLPKDAGSALHTLLTSGNAVSVQLYSPDRPVVDTAEVFLWLMAVGT  200

Query  772  ILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            +L ASYWSAW+AREA I+Q+KLLKDG +    +EA  S
Sbjct  201  VLGASYWSAWSAREAVIEQEKLLKDGHEGLLNVEAGGS  238



>ref|XP_010545677.1| PREDICTED: signal peptide peptidase-like 2 [Tarenaya hassleriana]
Length=545

 Score =   301 bits (772),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/211 (67%), Positives = 171/211 (81%), Gaps = 0/211 (0%)
 Frame = +1

Query  226  VHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQ  405
            V  GDI+H D++AP++ GC+N+FVLVKV TW++G E+ EFVGVGARFG  + SKEK ANQ
Sbjct  25   VSAGDIIHEDNLAPKKPGCENDFVLVKVQTWVDGIEDEEFVGVGARFGKPIVSKEKNANQ  84

Query  406  TRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKM  585
              L L+DP DCCS   NKL+G+ ++V RGNC FT KAN A+ AGASA+LIINNQ EL+KM
Sbjct  85   IHLVLSDPRDCCSPTNNKLSGDVVMVDRGNCKFTAKANNAEAAGASAVLIINNQKELYKM  144

Query  586  VCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAV  765
            VCE +E DLDI IPA++LPQDAG ++ + + N S VSVQLYSP+RP VD+AEVFLWLMAV
Sbjct  145  VCEPDENDLDIKIPAVLLPQDAGSTLEKMLTNSSKVSVQLYSPKRPAVDIAEVFLWLMAV  204

Query  766  ATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
             TILCASYWSA +AREAAI+ DKLLKD  DE
Sbjct  205  GTILCASYWSAQSAREAAIEHDKLLKDAVDE  235



>gb|AAM63609.1| growth-on protein GRO10 [Arabidopsis thaliana]
Length=540

 Score =   301 bits (770),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 144/211 (68%), Positives = 170/211 (81%), Gaps = 0/211 (0%)
 Frame = +1

Query  226  VHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQ  405
            V  GDIVH D++AP++ GC+N+FVLVKV TWI+G E  EFVGVGARFG  + SKEK ANQ
Sbjct  25   VTAGDIVHQDNLAPKKPGCENDFVLVKVQTWIDGVENEEFVGVGARFGKRIVSKEKNANQ  84

Query  406  TRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKM  585
            T L  A+P D C+  +NKL+G+ ++V RGNC FT KAN A+ AGASA+LIINNQ EL+KM
Sbjct  85   THLVFANPRDSCTPLKNKLSGDVVIVERGNCRFTAKANNAEAAGASALLIINNQKELYKM  144

Query  586  VCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAV  765
            VCE +ETDLDI IPA+MLPQDAG S+ + + N S VS QLYSPRRP VDVAEVFL LMA+
Sbjct  145  VCEPDETDLDIQIPAVMLPQDAGASLQKMLANSSKVSAQLYSPRRPAVDVAEVFLCLMAI  204

Query  766  ATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
             TILCASYWSAW+AREAAI+ DKLLKD  DE
Sbjct  205  GTILCASYWSAWSAREAAIEHDKLLKDAIDE  235



>gb|KEH26503.1| signal peptide peptidase-like protein [Medicago truncatula]
Length=543

 Score =   300 bits (768),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 144/211 (68%), Positives = 168/211 (80%), Gaps = 1/211 (0%)
 Frame = +1

Query  226  VHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQ  405
            V  GDIVH DD  P++ GC+N FVLVKV TW+NG E+ EFVGVGARFG T+ SKEK A Q
Sbjct  26   VLAGDIVH-DDSTPKKPGCENQFVLVKVQTWVNGVEDAEFVGVGARFGRTIVSKEKNARQ  84

Query  406  TRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKM  585
            TRL L+DP DCCS P NK+ G+ I+V RGNC+FT KAN A +A ASAILIINNQ EL+KM
Sbjct  85   TRLVLSDPRDCCSPPMNKIVGDVIMVDRGNCTFTKKANSAQNANASAILIINNQKELYKM  144

Query  586  VCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAV  765
            VC+ +ETDL I IPA+MLP DAG  +   + + S VSVQLYSP+RP VD+AEVFLWLMAV
Sbjct  145  VCDPDETDLSIHIPAVMLPLDAGTKLENMLKSTSSVSVQLYSPQRPTVDIAEVFLWLMAV  204

Query  766  ATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
             TILCASYWSAW AREAA++ DKLL+D SDE
Sbjct  205  LTILCASYWSAWRAREAAVEYDKLLRDVSDE  235



>ref|XP_004298803.1| PREDICTED: signal peptide peptidase-like 2 [Fragaria vesca subsp. 
vesca]
 ref|XP_011463895.1| PREDICTED: signal peptide peptidase-like 2 [Fragaria vesca subsp. 
vesca]
Length=543

 Score =   299 bits (766),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 152/229 (66%), Positives = 182/229 (79%), Gaps = 1/229 (0%)
 Frame = +1

Query  175  CSVPTAVVLWLLSCS-ALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVG  351
            C +     L LL C+ + V  GDIVH D  AP++ GC+N+FVLVKV TW++G E  EFVG
Sbjct  7    CGLVFVSALILLGCNHSSVEAGDIVHDDASAPKKPGCENDFVLVKVQTWVDGVEASEFVG  66

Query  352  VGARFGPTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADD  531
            VGARFG T+ESKEK+ANQTRL L++P DCCS P NK   + I+V RGNC FTTKAN A+ 
Sbjct  67   VGARFGRTIESKEKKANQTRLILSNPRDCCSPPENKFARDVIVVDRGNCKFTTKANNAEA  126

Query  532  AGASAILIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYS  711
            A ASAILIINNQ EL+KMVCE +ET LDI IPA+MLPQDAG ++   +M+ S+VSVQLYS
Sbjct  127  ANASAILIINNQKELYKMVCEPDETALDIHIPAVMLPQDAGTTLENMLMSNSVVSVQLYS  186

Query  712  PRRPVVDVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
            P+RPVVD+AEVFLWLMAV TILCASYWSAW+AREAAI+ + LLKD +DE
Sbjct  187  PQRPVVDIAEVFLWLMAVGTILCASYWSAWSAREAAIEHENLLKDAADE  235



>gb|AFW63934.1| hypothetical protein ZEAMMB73_184308 [Zea mays]
Length=545

 Score =   299 bits (766),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 142/208 (68%), Positives = 170/208 (82%), Gaps = 1/208 (0%)
 Frame = +1

Query  232  GGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTR  411
            GGDIVH DD AP+  GC N+FVLVKV TWIN K++ EFVGVGARFGP +ESKEK AN T 
Sbjct  24   GGDIVHQDDEAPKIPGCSNDFVLVKVQTWINKKDKDEFVGVGARFGPKIESKEKHANWTN  83

Query  412  LALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVC  591
            L LADP DCC+ PR K+ G+ +LV RGNC FTTKA VA+ AGASAI+IIN++ EL+KMVC
Sbjct  84   LLLADPSDCCTPPREKVAGDILLVERGNCKFTTKAKVAESAGASAIIIINDKHELYKMVC  143

Query  592  EKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVAT  771
            E NET+LDIGI A++LP+DAG S+ +  ++   V V+LYSP RP+VD AEVFLWLMAV T
Sbjct  144  ETNETNLDIGIHAVLLPKDAGSSL-QRSLSSGEVLVELYSPDRPLVDTAEVFLWLMAVGT  202

Query  772  ILCASYWSAWTAREAAIQQDKLLKDGSD  855
            ILCASYWSAW+AREA I+Q+KLLKDG +
Sbjct  203  ILCASYWSAWSAREADIEQEKLLKDGRE  230



>gb|KJB20660.1| hypothetical protein B456_003G158200 [Gossypium raimondii]
Length=478

 Score =   296 bits (757),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 152/237 (64%), Positives = 181/237 (76%), Gaps = 2/237 (1%)
 Frame = +1

Query  148  MELRSTAPYCSVPTAVVLWLLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWING  327
            M+L+S      V   + L    CS  V  GDIVH DD AP++ GC+N+FVLVKV TW+NG
Sbjct  1    MDLQSLCKVILVSALISLVCHPCS--VTAGDIVHDDDSAPKKPGCENDFVLVKVQTWVNG  58

Query  328  KEEMEFVGVGARFGPTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFT  507
             E+ EFVGVGARFG  + SKEK ANQ RL L+DP DCCS P+NKL  + I+V RG+C FT
Sbjct  59   IEDAEFVGVGARFGTAIVSKEKNANQRRLVLSDPRDCCSHPKNKLDNDVIMVDRGHCKFT  118

Query  508  TKANVADDAGASAILIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKS  687
            TKAN A  A ASA+LIINNQ EL+KMVC+ +ETDLDI IP +MLPQDAG S+ + + + S
Sbjct  119  TKANNAQAANASALLIINNQKELYKMVCDPDETDLDIHIPTVMLPQDAGVSLEKMLTSNS  178

Query  688  MVSVQLYSPRRPVVDVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
             VSVQLYSP+RP+VD+AEVFLWLMAV TILCASYWSAW+AREA I+ DKLLKD  DE
Sbjct  179  SVSVQLYSPKRPLVDIAEVFLWLMAVGTILCASYWSAWSAREAVIEHDKLLKDPLDE  235



>gb|KHG25050.1| Signal peptide peptidase-like 2B [Gossypium arboreum]
Length=546

 Score =   298 bits (762),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 153/237 (65%), Positives = 182/237 (77%), Gaps = 2/237 (1%)
 Frame = +1

Query  148  MELRSTAPYCSVPTAVVLWLLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWING  327
            M+L+S      V   + L    CS  V  GDIVH DD AP++ GC+N+FVLVKV TW+NG
Sbjct  1    MDLQSLCKVILVSALISLVCHPCS--VTAGDIVHDDDSAPKKPGCENDFVLVKVQTWVNG  58

Query  328  KEEMEFVGVGARFGPTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFT  507
             E+ EFVGVGARFG  + SKEK ANQ RL L+DP DCCS P+NKL  + I+V RG+C FT
Sbjct  59   IEDAEFVGVGARFGTAIVSKEKNANQRRLVLSDPRDCCSHPKNKLDNDVIMVDRGHCKFT  118

Query  508  TKANVADDAGASAILIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKS  687
            TKAN A  A ASA+LIINNQ EL+KMVC+ +ETDLDI IP +MLPQDAG S+ + + + S
Sbjct  119  TKANNAQAANASALLIINNQKELYKMVCDPDETDLDIHIPTVMLPQDAGVSLEKMLTSNS  178

Query  688  MVSVQLYSPRRPVVDVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
             VSVQLYSP+RP+VD+AEVFLWLMAV TILCASYWSAW+AREAAI+ DKLLKD  DE
Sbjct  179  SVSVQLYSPKRPLVDIAEVFLWLMAVGTILCASYWSAWSAREAAIEHDKLLKDALDE  235



>ref|XP_008679146.1| PREDICTED: signal peptide peptidase-like 4 [Zea mays]
Length=619

 Score =   299 bits (765),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 142/208 (68%), Positives = 170/208 (82%), Gaps = 1/208 (0%)
 Frame = +1

Query  232  GGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTR  411
            GGDIVH DD AP+  GC N+FVLVKV TWIN K++ EFVGVGARFGP +ESKEK AN T 
Sbjct  98   GGDIVHQDDEAPKIPGCSNDFVLVKVQTWINKKDKDEFVGVGARFGPKIESKEKHANWTN  157

Query  412  LALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVC  591
            L LADP DCC+ PR K+ G+ +LV RGNC FTTKA VA+ AGASAI+IIN++ EL+KMVC
Sbjct  158  LLLADPSDCCTPPREKVAGDILLVERGNCKFTTKAKVAESAGASAIIIINDKHELYKMVC  217

Query  592  EKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVAT  771
            E NET+LDIGI A++LP+DAG S+ +  ++   V V+LYSP RP+VD AEVFLWLMAV T
Sbjct  218  ETNETNLDIGIHAVLLPKDAGSSL-QRSLSSGEVLVELYSPDRPLVDTAEVFLWLMAVGT  276

Query  772  ILCASYWSAWTAREAAIQQDKLLKDGSD  855
            ILCASYWSAW+AREA I+Q+KLLKDG +
Sbjct  277  ILCASYWSAWSAREADIEQEKLLKDGRE  304



>ref|XP_004506302.1| PREDICTED: signal peptide peptidase-like 2-like [Cicer arietinum]
Length=570

 Score =   297 bits (760),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 145/218 (67%), Positives = 170/218 (78%), Gaps = 1/218 (0%)
 Frame = +1

Query  205  LLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLES  384
            LLS    V  GDIVH DD  P++ GC+N FVLVKV TW+NG E+ EFVGVGARFG T+ S
Sbjct  22   LLSQVPSVLAGDIVH-DDSTPKKPGCENQFVLVKVQTWVNGLEDAEFVGVGARFGRTIVS  80

Query  385  KEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINN  564
            KEK A  T L L+DP DCCS P NK+ G+ I+V RGNC+FT KAN A +A ASAILIINN
Sbjct  81   KEKNARHTPLILSDPRDCCSPPMNKIAGDVIMVDRGNCTFTKKANSAQNANASAILIINN  140

Query  565  QTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEV  744
            Q EL+KMVC+ +ETD +I IPA+MLPQDAG  + + +M+ S VSVQLYSPRRP VD+AEV
Sbjct  141  QKELYKMVCDPDETDYNIHIPAVMLPQDAGTKLEKMLMSTSSVSVQLYSPRRPTVDIAEV  200

Query  745  FLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
            FLWLMAV T+ CAS WSAW AREAA++QDKLLKD S E
Sbjct  201  FLWLMAVLTVFCASCWSAWRAREAAVEQDKLLKDASAE  238



>ref|XP_002453071.1| hypothetical protein SORBIDRAFT_04g037790 [Sorghum bicolor]
 gb|EES06047.1| hypothetical protein SORBIDRAFT_04g037790 [Sorghum bicolor]
Length=547

 Score =   296 bits (758),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 142/218 (65%), Positives = 174/218 (80%), Gaps = 1/218 (0%)
 Frame = +1

Query  232  GGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTR  411
            GGDI H DD AP+  GC N+FVLVKV TWIN K+++EFVGVGARFGP +ESKEK++N T 
Sbjct  24   GGDIRHQDDDAPKIPGCSNDFVLVKVRTWINQKDKIEFVGVGARFGPKIESKEKQSNWTN  83

Query  412  LALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVC  591
            L L D  DCC+ P+ K+ G+ +LV RGNC+FTTKA VA+ AGASAI+IIN++ EL+KMVC
Sbjct  84   LLLPDTSDCCTPPKEKVAGDILLVERGNCTFTTKARVAESAGASAIIIINDKQELYKMVC  143

Query  592  EKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVAT  771
            E NET+LDIGIPA++LP+DAG S+ E  ++   V V+LYSP RP+VD AEVFLWLMAV T
Sbjct  144  ETNETNLDIGIPAVLLPKDAGSSL-ERSLSSGEVLVELYSPDRPLVDTAEVFLWLMAVGT  202

Query  772  ILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            ILCASYWSAW+AREA I+Q+KLLKDG +     EA  S
Sbjct  203  ILCASYWSAWSAREADIEQEKLLKDGHEVPPNFEAGGS  240



>gb|ACN30991.1| unknown [Zea mays]
Length=475

 Score =   294 bits (752),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/202 (68%), Positives = 165/202 (82%), Gaps = 0/202 (0%)
 Frame = +1

Query  238  DIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRLA  417
            DIVHHDD AP+  GC N+F+LVKV +W+NGKE  EFVGVGARFGP + SKEK AN+T+L 
Sbjct  23   DIVHHDDEAPKIPGCSNDFILVKVQSWVNGKEGGEFVGVGARFGPKIVSKEKHANRTKLT  82

Query  418  LADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCEK  597
            LADP DCCS P++K+ G+ +LV RG C FT KA  A+ AGASAI+IIN+  EL+KMVCEK
Sbjct  83   LADPMDCCSPPKHKVPGDVLLVQRGKCKFTKKAKFAEAAGASAIVIINHVHELYKMVCEK  142

Query  598  NETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATIL  777
            NETDLDI IPA++LP+DAG ++   + N + VSVQLYSP RPVVD AEVFLWLMAV T+L
Sbjct  143  NETDLDINIPAVLLPKDAGSALHTLLTNGNTVSVQLYSPDRPVVDTAEVFLWLMAVGTVL  202

Query  778  CASYWSAWTAREAAIQQDKLLK  843
             ASYWSAW+AREA I+Q+KLLK
Sbjct  203  GASYWSAWSAREAVIEQEKLLK  224



>gb|KJB20659.1| hypothetical protein B456_003G158200 [Gossypium raimondii]
Length=546

 Score =   295 bits (756),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 152/237 (64%), Positives = 181/237 (76%), Gaps = 2/237 (1%)
 Frame = +1

Query  148  MELRSTAPYCSVPTAVVLWLLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWING  327
            M+L+S      V   + L    CS  V  GDIVH DD AP++ GC+N+FVLVKV TW+NG
Sbjct  1    MDLQSLCKVILVSALISLVCHPCS--VTAGDIVHDDDSAPKKPGCENDFVLVKVQTWVNG  58

Query  328  KEEMEFVGVGARFGPTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFT  507
             E+ EFVGVGARFG  + SKEK ANQ RL L+DP DCCS P+NKL  + I+V RG+C FT
Sbjct  59   IEDAEFVGVGARFGTAIVSKEKNANQRRLVLSDPRDCCSHPKNKLDNDVIMVDRGHCKFT  118

Query  508  TKANVADDAGASAILIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKS  687
            TKAN A  A ASA+LIINNQ EL+KMVC+ +ETDLDI IP +MLPQDAG S+ + + + S
Sbjct  119  TKANNAQAANASALLIINNQKELYKMVCDPDETDLDIHIPTVMLPQDAGVSLEKMLTSNS  178

Query  688  MVSVQLYSPRRPVVDVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
             VSVQLYSP+RP+VD+AEVFLWLMAV TILCASYWSAW+AREA I+ DKLLKD  DE
Sbjct  179  SVSVQLYSPKRPLVDIAEVFLWLMAVGTILCASYWSAWSAREAVIEHDKLLKDPLDE  235



>ref|XP_003570436.1| PREDICTED: signal peptide peptidase-like 4 [Brachypodium distachyon]
Length=546

 Score =   295 bits (755),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 138/216 (64%), Positives = 172/216 (80%), Gaps = 1/216 (0%)
 Frame = +1

Query  238  DIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRLA  417
            DIVH DD AP+  GC N+F+LVKV TW+N +E  EFVGVGARFGP +ESKEK AN+T L 
Sbjct  29   DIVHQDDDAPKIPGCSNDFMLVKVQTWVNNRETDEFVGVGARFGPIIESKEKHANRTGLL  88

Query  418  LADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCEK  597
             ADP DCC+  + K+ G+ +LV RG C FTTK  +A+DAGASAI+I+NN+ EL+KMVC+K
Sbjct  89   QADPFDCCAPLKEKVAGDVLLVRRGGCRFTTKTKIAEDAGASAIIIMNNRHELYKMVCDK  148

Query  598  NETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATIL  777
            NETDLDI IPA++LPQDAG ++++ +++   VSVQLYSP RP+VD AEVFLWLMAV TIL
Sbjct  149  NETDLDINIPAVLLPQDAG-TILQGLLSLGQVSVQLYSPDRPLVDTAEVFLWLMAVGTIL  207

Query  778  CASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            CASYWSAW+ARE+ I+Q+KLLKDG +     EA  S
Sbjct  208  CASYWSAWSARESVIEQEKLLKDGHETSVNFEAGGS  243



>ref|NP_001058659.1| Os06g0730900 [Oryza sativa Japonica Group]
 sp|Q5Z413.1|SIPL5_ORYSJ RecName: Full=Signal peptide peptidase-like 5; Short=OsSPPL5; 
Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAD62128.1| putative growth-on protein GRO10 [Oryza sativa Japonica Group]
 dbj|BAD62487.1| putative growth-on protein GRO10 [Oryza sativa Japonica Group]
 dbj|BAF20573.1| Os06g0730900 [Oryza sativa Japonica Group]
 dbj|BAG88222.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89399.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC81358.1| hypothetical protein OsI_24551 [Oryza sativa Indica Group]
 gb|EEE66404.1| hypothetical protein OsJ_22746 [Oryza sativa Japonica Group]
Length=542

 Score =   294 bits (752),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/216 (63%), Positives = 170/216 (79%), Gaps = 0/216 (0%)
 Frame = +1

Query  238  DIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRLA  417
            DIVHHDD AP+  GC N+F+LVKV +W+NGKE+ E+VGVGARFGP + SKEK AN+TRL 
Sbjct  25   DIVHHDDEAPKIPGCSNDFILVKVQSWVNGKEDDEYVGVGARFGPQIVSKEKHANRTRLM  84

Query  418  LADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCEK  597
            LADP DCC+ P+ K++G+ +LV RG C FT KA  A+ AGAS I+IIN+  EL+KMVCEK
Sbjct  85   LADPIDCCTSPKEKVSGDILLVQRGKCKFTKKAKFAEAAGASGIIIINHVHELYKMVCEK  144

Query  598  NETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATIL  777
            NETDLDI IPA++LP+DAG ++   + + + VSVQ YSP RPVVD AEVFLWLMAV T+L
Sbjct  145  NETDLDINIPAVLLPRDAGFALHTVLTSGNSVSVQQYSPDRPVVDTAEVFLWLMAVGTVL  204

Query  778  CASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            CASYWSAW+AREA  +Q+KLLKDG +    +E   S
Sbjct  205  CASYWSAWSAREALCEQEKLLKDGREVLLNVENGSS  240



>ref|XP_011654737.1| PREDICTED: signal peptide peptidase-like 2 isoform X2 [Cucumis 
sativus]
Length=514

 Score =   292 bits (748),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 167/191 (87%), Gaps = 0/191 (0%)
 Frame = +1

Query  286  NNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRLALADPPDCCSKPRNKLT  465
            ++F+LVKV TWI+GKE  EFVGVGARFG T+ SKEK ANQTRL LA+P DCCS P+NKL+
Sbjct  15   SSFILVKVQTWIDGKEASEFVGVGARFGATIVSKEKNANQTRLVLANPRDCCSVPKNKLS  74

Query  466  GEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCEKNETDLDIGIPAIMLPQ  645
            G+ I+V RG+C FTTKAN+A+ AGASAILI+NNQ EL+KMVC+ +ETDL+I IPA+MLPQ
Sbjct  75   GDIIMVDRGHCKFTTKANIAEAAGASAILIVNNQKELYKMVCDPDETDLNIHIPAVMLPQ  134

Query  646  DAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATILCASYWSAWTAREAAIQ  825
            DAG S+ + +++ S VSVQLYSP RP VD+AEVFLWLMAV TILC+S+WSAW+AREAAI+
Sbjct  135  DAGTSLEKMLISNSSVSVQLYSPLRPPVDIAEVFLWLMAVGTILCSSFWSAWSAREAAIE  194

Query  826  QDKLLKDGSDE  858
            QDKLLKDG+D+
Sbjct  195  QDKLLKDGADD  205



>gb|KDO76242.1| hypothetical protein CISIN_1g009071mg [Citrus sinensis]
Length=461

 Score =   289 bits (739),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 145/225 (64%), Positives = 170/225 (76%), Gaps = 15/225 (7%)
 Frame = +1

Query  184  PTAVVLWLLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGAR  363
            P AVV  L+   A V  GDIVH DD+AP++ GC+N+FVLVKV TWI+G E  EFVGVGAR
Sbjct  12   PVAVVS-LVCYPASVTAGDIVHDDDLAPKKPGCENDFVLVKVQTWIDGIENEEFVGVGAR  70

Query  364  FGPTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGAS  543
            FG T+ SKEK ANQ  L L+ P DCCS P++K  G+ I+V RGNC FTTKAN+A+ AGAS
Sbjct  71   FGTTIVSKEKNANQIHLTLSHPRDCCSMPKHKYAGDVIMVDRGNCKFTTKANIAEAAGAS  130

Query  544  AILIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRP  723
            A+LIINNQ               DI IPA+M+PQDAG S+ + ++N S VSVQLYSPRRP
Sbjct  131  ALLIINNQK--------------DIHIPAVMMPQDAGASLEKMLLNTSSVSVQLYSPRRP  176

Query  724  VVDVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
            VVDVAEVFLWLMAV TILCASYWSAW+ARE AI+Q+KLLKD  DE
Sbjct  177  VVDVAEVFLWLMAVGTILCASYWSAWSARETAIEQEKLLKDAVDE  221



>gb|KJB20661.1| hypothetical protein B456_003G158200 [Gossypium raimondii]
Length=542

 Score =   288 bits (738),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 151/237 (64%), Positives = 180/237 (76%), Gaps = 6/237 (3%)
 Frame = +1

Query  148  MELRSTAPYCSVPTAVVLWLLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWING  327
            M+L+S      V   + L    CS  V  GDIVH DD AP++ GC+N+FVLVKV TW+NG
Sbjct  1    MDLQSLCKVILVSALISLVCHPCS--VTAGDIVHDDDSAPKKPGCENDFVLVKVQTWVNG  58

Query  328  KEEMEFVGVGARFGPTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFT  507
             E+ EFVGVGARFG  + SKEK ANQ RL L+DP DCCS P+NKL  + I+V RG+C FT
Sbjct  59   IEDAEFVGVGARFGTAIVSKEKNANQRRLVLSDPRDCCSHPKNKLDNDVIMVDRGHCKFT  118

Query  508  TKANVADDAGASAILIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKS  687
            TKAN A  A ASA+LIINNQ EL+KMVC+ +ETDLDI IP +MLPQDAG S+ E ++   
Sbjct  119  TKANNAQAANASALLIINNQKELYKMVCDPDETDLDIHIPTVMLPQDAGVSL-EKMLT--  175

Query  688  MVSVQLYSPRRPVVDVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
             +SVQLYSP+RP+VD+AEVFLWLMAV TILCASYWSAW+AREA I+ DKLLKD  DE
Sbjct  176  -MSVQLYSPKRPLVDIAEVFLWLMAVGTILCASYWSAWSAREAVIEHDKLLKDPLDE  231



>ref|XP_010480029.1| PREDICTED: signal peptide peptidase-like 4 isoform X2 [Camelina 
sativa]
Length=516

 Score =   284 bits (726),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 142/227 (63%), Positives = 161/227 (71%), Gaps = 25/227 (11%)
 Frame = +1

Query  205  LLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLES  384
            LL  ++LV  GDIVHHDD  P+R GC+NNFVLVKV T +NG E ME+VGVGARFGPTLES
Sbjct  17   LLYSASLVSAGDIVHHDDSLPQRPGCNNNFVLVKVPTRVNGTEYMEYVGVGARFGPTLES  76

Query  385  KEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINN  564
            KEK A   +LA+ADPPDCCS P+NKLTGE ILVHRG CSFTTK  +A+ AGASAILIINN
Sbjct  77   KEKHATLIKLAIADPPDCCSTPKNKLTGEVILVHRGKCSFTTKTKIAEAAGASAILIINN  136

Query  565  QTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEV  744
             T+LFKMVCEK E  LDI IP +MLP DAG+S+ ENI+  +                   
Sbjct  137  STDLFKMVCEKGENVLDITIPVVMLPVDAGRSL-ENIVQSN-------------------  176

Query  745  FLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
                    TILCASYWSAWT RE AI+QDKLLKDGSDE   +  T S
Sbjct  177  -----NTGTILCASYWSAWTVREEAIEQDKLLKDGSDELLQLSTTSS  218



>ref|XP_011029294.1| PREDICTED: LOW QUALITY PROTEIN: signal peptide peptidase-like 
2 [Populus euphratica]
Length=523

 Score =   283 bits (723),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 158/190 (83%), Gaps = 0/190 (0%)
 Frame = +1

Query  289  NFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRLALADPPDCCSKPRNKLTG  468
             F  VKV TW+ G+E+ EFVGVGARFG T+ SKEK ANQ RL L+DP DCCS P++KL  
Sbjct  25   RFYGVKVQTWVGGEEDAEFVGVGARFGTTIVSKEKNANQIRLTLSDPRDCCSAPKHKLDR  84

Query  469  EAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCEKNETDLDIGIPAIMLPQD  648
            + I+VHRG+C FTTKAN A+ AGASA+L+INNQ EL+KMVCE +ETDLDI IPAI+LPQD
Sbjct  85   DVIMVHRGHCKFTTKANNAEAAGASAVLVINNQKELYKMVCEPDETDLDIHIPAIILPQD  144

Query  649  AGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATILCASYWSAWTAREAAIQQ  828
            AG S+ + ++  + VSVQLYSP+RP+VDVAEVFLWLM VATILCASYWSAWTAREAA +Q
Sbjct  145  AGASLEKMLLTNTSVSVQLYSPKRPLVDVAEVFLWLMVVATILCASYWSAWTAREAAAEQ  204

Query  829  DKLLKDGSDE  858
            DKLLKD  DE
Sbjct  205  DKLLKDAVDE  214



>dbj|BAJ96036.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=891

 Score =   290 bits (742),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 137/216 (63%), Positives = 173/216 (80%), Gaps = 1/216 (0%)
 Frame = +1

Query  238  DIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRLA  417
            DIVH DD AP+  GC N+F+LVKV TW+  +E  EFVGVGARF P +ESKEK AN+T L 
Sbjct  29   DIVHQDDDAPKIPGCSNDFMLVKVQTWVKNRETDEFVGVGARFDPIIESKEKHANRTGLL  88

Query  418  LADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCEK  597
            LA+P DCC+  + K+ GE +LV RG+C FTTKA VA+DAGASAI+I+NN+ EL+KMVC++
Sbjct  89   LANPFDCCTPLKEKVAGEVLLVQRGDCKFTTKAKVAEDAGASAIVILNNRHELYKMVCDQ  148

Query  598  NETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATIL  777
            NETDLDI IPA++LP+DAG ++++ +++   VSVQLYSP RP+VD AEVFLWLMAV TIL
Sbjct  149  NETDLDINIPAVLLPKDAG-TILQGLLSLGKVSVQLYSPDRPLVDTAEVFLWLMAVGTIL  207

Query  778  CASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
             ASYWSAW+AREA I+Q+KLLKDG +    +EA  S
Sbjct  208  GASYWSAWSAREALIEQEKLLKDGHESSVNIEAEGS  243



>ref|XP_010239116.1| PREDICTED: signal peptide peptidase-like 5 [Brachypodium distachyon]
Length=548

 Score =   282 bits (721),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 134/214 (63%), Positives = 162/214 (76%), Gaps = 0/214 (0%)
 Frame = +1

Query  235  GDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRL  414
            GDIVH DD  P+  GC N+FVLVKV +WINGKE  E+VGVGARFGP + SKEK AN+T L
Sbjct  22   GDIVHQDDQVPKIPGCSNDFVLVKVQSWINGKEGDEYVGVGARFGPKIVSKEKHANRTIL  81

Query  415  ALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCE  594
             LA+P DCC+  + K++G  +LV RG C FT KA +A+ AGAS +LIIN+  EL+KMVCE
Sbjct  82   TLAEPIDCCTPQKYKVSGGVLLVQRGKCKFTKKAKLAEAAGASGMLIINHGHELYKMVCE  141

Query  595  KNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATI  774
            KNET+LDI IPA++LP DAG  +   +     VSVQLYSP RPVVD AEVFLWLMAV T+
Sbjct  142  KNETELDIHIPAVLLPNDAGVDLHSFLTTGKSVSVQLYSPDRPVVDTAEVFLWLMAVGTV  201

Query  775  LCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEA  876
            LCASYWSAW+AREA  +Q+KLLKDG +    +E 
Sbjct  202  LCASYWSAWSAREAVSEQEKLLKDGHEVSLNVEG  235



>ref|XP_006827582.1| PREDICTED: signal peptide peptidase-like 4 [Amborella trichopoda]
 gb|ERM94998.1| hypothetical protein AMTR_s00009p00232070 [Amborella trichopoda]
Length=531

 Score =   280 bits (717),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 141/233 (61%), Positives = 178/233 (76%), Gaps = 2/233 (1%)
 Frame = +1

Query  175  CSVPTAVVLWLLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGV  354
            C V  A V+   +  + +  GDIVH D+ AP++ GC+N FVLVKV TW+N K   EFVGV
Sbjct  6    CWVSLAFVV--FAIPSFIQCGDIVHDDEDAPKQPGCENKFVLVKVQTWVNNKTGNEFVGV  63

Query  355  GARFGPTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDA  534
             ARFG  +ESKEK ANQT L+L+DP D CS P+NKLTG+A+LVHRGNC+FT KA VA  A
Sbjct  64   SARFGTPMESKEKHANQTHLSLSDPRDSCSTPKNKLTGDAVLVHRGNCTFTMKAKVAQAA  123

Query  535  GASAILIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSP  714
            GA+AIL++N++ EL+KMVC+ NET+L I IPA+MLP  AG S+ +++ + + V+VQLYSP
Sbjct  124  GAAAILVVNDKEELYKMVCQDNETNLHISIPAVMLPSKAGLSLEKSLSSGASVTVQLYSP  183

Query  715  RRPVVDVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDEYCGME  873
             RPVVD AEVFLWLMAV TILCASYWS W+A+EAAI+ DKLLKD  +    M+
Sbjct  184  DRPVVDTAEVFLWLMAVGTILCASYWSGWSAKEAAIEHDKLLKDAPESLHDMD  236



>dbj|BAJ96967.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=554

 Score =   279 bits (714),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 133/205 (65%), Positives = 160/205 (78%), Gaps = 1/205 (0%)
 Frame = +1

Query  238  DIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRLA  417
            DIVH DD AP+  GC N+FVLVKV +W+ G E  EFVGVGARFGP + SKEK+A +  L 
Sbjct  23   DIVHQDDQAPKIPGCSNDFVLVKVQSWVGGHEGEEFVGVGARFGPKIVSKEKQATREPLT  82

Query  418  LADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCEK  597
            LADP   C+ P+ KL+G  +LV RG C FT KA +A+ AGAS ILIIN+ TEL+KMVCEK
Sbjct  83   LADPIHACAPPKTKLSGGVLLVERGKCKFTKKAKLAEAAGASGILIINSGTELYKMVCEK  142

Query  598  NETDLDIGIPAIMLPQDAGQSMIENIM-NKSMVSVQLYSPRRPVVDVAEVFLWLMAVATI  774
            NET+LDI IPA++LP+DAGQ++   +  N S V V+LYSP RPVVD AEVFLWLMAV T+
Sbjct  143  NETELDIHIPAVLLPKDAGQALRSLLTANTSSVGVELYSPDRPVVDTAEVFLWLMAVGTV  202

Query  775  LCASYWSAWTAREAAIQQDKLLKDG  849
            LCASYWSAW+AREA  +Q+KLLKDG
Sbjct  203  LCASYWSAWSAREAVAEQEKLLKDG  227



>ref|NP_001048565.1| Os02g0823000 [Oryza sativa Japonica Group]
 sp|Q0DWA9.1|SIPL4_ORYSJ RecName: Full=Signal peptide peptidase-like 4; Short=OsSPPL4; 
Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAF10479.1| Os02g0823000 [Oryza sativa Japonica Group]
 dbj|BAH00778.1| unnamed protein product [Oryza sativa Japonica Group]
Length=545

 Score =   279 bits (713),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 141/216 (65%), Positives = 171/216 (79%), Gaps = 1/216 (0%)
 Frame = +1

Query  238  DIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRLA  417
            DIVH DD AP+  GC N+FVLVKV TW+N +E+ EFVGVGARFGPT+ESKEK AN+T L 
Sbjct  27   DIVHQDDEAPKIPGCSNDFVLVKVQTWVNNREDGEFVGVGARFGPTIESKEKHANRTGLL  86

Query  418  LADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCEK  597
            LADP DCC  P  K+ G+ +LV RGNC FT KA  A+ AGASAI+IIN+  EL+KMVC++
Sbjct  87   LADPIDCCDPPTQKVAGDVLLVQRGNCKFTKKAKNAEAAGASAIIIINHVHELYKMVCDR  146

Query  598  NETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATIL  777
            NETDLDI IPA++LP+DAG  + + ++ +  VSVQLYSP RP+VD AEVFLWLMAV TIL
Sbjct  147  NETDLDINIPAVLLPKDAGNDL-QKLLTRGKVSVQLYSPDRPLVDTAEVFLWLMAVGTIL  205

Query  778  CASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            CASYWSAW+AREA I+Q+KLLKDG +    +EA  S
Sbjct  206  CASYWSAWSAREAVIEQEKLLKDGHESSLNLEAGGS  241



>dbj|BAD22919.1| putative growth-on protein GRO10 [Oryza sativa Japonica Group]
 gb|EEE58070.1| hypothetical protein OsJ_08929 [Oryza sativa Japonica Group]
Length=538

 Score =   278 bits (712),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 141/216 (65%), Positives = 171/216 (79%), Gaps = 1/216 (0%)
 Frame = +1

Query  238  DIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRLA  417
            DIVH DD AP+  GC N+FVLVKV TW+N +E+ EFVGVGARFGPT+ESKEK AN+T L 
Sbjct  20   DIVHQDDEAPKIPGCSNDFVLVKVQTWVNNREDGEFVGVGARFGPTIESKEKHANRTGLL  79

Query  418  LADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCEK  597
            LADP DCC  P  K+ G+ +LV RGNC FT KA  A+ AGASAI+IIN+  EL+KMVC++
Sbjct  80   LADPIDCCDPPTQKVAGDVLLVQRGNCKFTKKAKNAEAAGASAIIIINHVHELYKMVCDR  139

Query  598  NETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATIL  777
            NETDLDI IPA++LP+DAG  + + ++ +  VSVQLYSP RP+VD AEVFLWLMAV TIL
Sbjct  140  NETDLDINIPAVLLPKDAGNDL-QKLLTRGKVSVQLYSPDRPLVDTAEVFLWLMAVGTIL  198

Query  778  CASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            CASYWSAW+AREA I+Q+KLLKDG +    +EA  S
Sbjct  199  CASYWSAWSAREAVIEQEKLLKDGHESSLNLEAGGS  234



>dbj|BAJ97624.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=554

 Score =   279 bits (713),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/205 (65%), Positives = 160/205 (78%), Gaps = 1/205 (0%)
 Frame = +1

Query  238  DIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRLA  417
            DIVH DD AP+  GC N+FVLVKV +W+ G E  EFVGVGARFGP + SKEK+A +  L 
Sbjct  23   DIVHQDDQAPKIPGCSNDFVLVKVQSWVGGHEGEEFVGVGARFGPKIVSKEKQAAREPLT  82

Query  418  LADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCEK  597
            LADP   C+ P+ KL+G  +LV RG C FT KA +A+ AGAS ILIIN+ TEL+KMVCEK
Sbjct  83   LADPIHACAPPKTKLSGGVLLVERGKCKFTKKAKLAEAAGASGILIINSGTELYKMVCEK  142

Query  598  NETDLDIGIPAIMLPQDAGQSMIENIM-NKSMVSVQLYSPRRPVVDVAEVFLWLMAVATI  774
            NET+LDI IPA++LP+DAGQ++   +  N S V V+LYSP RPVVD AEVFLWLMAV T+
Sbjct  143  NETELDIHIPAVLLPKDAGQALRSLLTANTSSVGVELYSPDRPVVDTAEVFLWLMAVGTV  202

Query  775  LCASYWSAWTAREAAIQQDKLLKDG  849
            LCASYWSAW+AREA  +Q+KLLKDG
Sbjct  203  LCASYWSAWSAREAVAEQEKLLKDG  227



>gb|EAY88073.1| hypothetical protein OsI_09503 [Oryza sativa Indica Group]
Length=541

 Score =   278 bits (711),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 141/216 (65%), Positives = 171/216 (79%), Gaps = 1/216 (0%)
 Frame = +1

Query  238  DIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRLA  417
            DIVH DD AP+  GC N+FVLVKV TW+N +E+ EFVGVGARFGPT+ESKEK AN+T L 
Sbjct  20   DIVHQDDEAPKIPGCSNDFVLVKVQTWVNNREDGEFVGVGARFGPTIESKEKHANRTGLL  79

Query  418  LADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCEK  597
            LADP DCC  P  K+ G+ +LV RGNC FT KA  A+ AGASAI+IIN+  EL+KMVC++
Sbjct  80   LADPIDCCDPPTQKVAGDVLLVQRGNCKFTKKAKNAEAAGASAIIIINHVHELYKMVCDR  139

Query  598  NETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATIL  777
            NETDLDI IPA++LP+DAG  + + ++ +  VSVQLYSP RP+VD AEVFLWLMAV TIL
Sbjct  140  NETDLDINIPAVLLPKDAGNDL-QKLLTRGKVSVQLYSPDRPLVDTAEVFLWLMAVGTIL  198

Query  778  CASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            CASYWSAW+AREA I+Q+KLLKDG +    +EA  S
Sbjct  199  CASYWSAWSAREAVIEQEKLLKDGHESSLNLEAGGS  234



>dbj|BAK08187.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=554

 Score =   278 bits (712),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 133/205 (65%), Positives = 159/205 (78%), Gaps = 1/205 (0%)
 Frame = +1

Query  238  DIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRLA  417
            DIVH DD AP+  GC N+FVLVKV +W+ G E  EFVGVGARFGP + SKEK+A +  L 
Sbjct  23   DIVHQDDQAPKIPGCSNDFVLVKVQSWVGGHEGEEFVGVGARFGPKIVSKEKQATREPLT  82

Query  418  LADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCEK  597
            LADP   C+ P+ KL+G  +LV RG C FT KA +A+ AGAS ILIIN+ TEL+KMVCEK
Sbjct  83   LADPIHACAPPKTKLSGGVLLVERGKCKFTKKAKLAEAAGASGILIINSGTELYKMVCEK  142

Query  598  NETDLDIGIPAIMLPQDAGQSMIENIM-NKSMVSVQLYSPRRPVVDVAEVFLWLMAVATI  774
            NET+LDI IPA++LP+DAGQ++   +  N S V V+LYSP RPVVD AEVFLWLMAV T+
Sbjct  143  NETELDIHIPAVLLPKDAGQALRSLLTANTSSVGVELYSPDRPVVDTAEVFLWLMAVGTV  202

Query  775  LCASYWSAWTAREAAIQQDKLLKDG  849
            LCASYWSAW AREA  +Q+KLLKDG
Sbjct  203  LCASYWSAWGAREAVAEQEKLLKDG  227



>dbj|BAJ98049.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=554

 Score =   276 bits (707),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 132/205 (64%), Positives = 159/205 (78%), Gaps = 1/205 (0%)
 Frame = +1

Query  238  DIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRLA  417
            DIVH DD AP+  GC N+FVLVKV +W+ G E  EFVGVGARFGP + SKEK+A +  L 
Sbjct  23   DIVHQDDQAPKIPGCSNDFVLVKVQSWVGGHEGEEFVGVGARFGPKIVSKEKQATREPLT  82

Query  418  LADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCEK  597
            LADP   C+ P+ KL+G  +LV RG C FT KA +A+ AGAS ILIIN+ TEL+KMVCEK
Sbjct  83   LADPIHACAPPKTKLSGGVLLVERGKCKFTKKAKLAEAAGASGILIINSGTELYKMVCEK  142

Query  598  NETDLDIGIPAIMLPQDAGQSMIENIM-NKSMVSVQLYSPRRPVVDVAEVFLWLMAVATI  774
            NET+LDI IPA++LP+DAGQ++   +  N S V V+LYSP RPVVD AEVFLWLMAV T+
Sbjct  143  NETELDIHIPAVLLPKDAGQALRSLLTANTSSVGVELYSPDRPVVDTAEVFLWLMAVGTV  202

Query  775  LCASYWSAWTAREAAIQQDKLLKDG  849
            LCASYWSAW+AREA  +Q+KL KDG
Sbjct  203  LCASYWSAWSAREAVAEQEKLSKDG  227



>ref|XP_008360707.1| PREDICTED: signal peptide peptidase-like 2 [Malus domestica]
 ref|XP_008367436.1| PREDICTED: signal peptide peptidase-like 2 [Malus domestica]
Length=511

 Score =   274 bits (701),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 154/186 (83%), Gaps = 0/186 (0%)
 Frame = +1

Query  301  VKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAIL  480
            VKV TW++G E  EFVGVGARFG T+ SKEK A QTRL L+DP D CSKP+ KL G+ I+
Sbjct  12   VKVQTWVDGVEANEFVGVGARFGTTIASKEKNAQQTRLILSDPRDSCSKPKKKLAGDVIM  71

Query  481  VHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQS  660
            V RG+C FTTKAN+A  A ASA+LIINNQ EL+KMVCE +ET LDI IPA+MLP DAG +
Sbjct  72   VDRGHCKFTTKANIAQAANASAVLIINNQKELYKMVCEPDETALDIHIPAVMLPHDAGST  131

Query  661  MIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLL  840
            +   +M+ S+VSVQLYSP+RPVVD+AEVFLWLMAV TILCAS+WSAW+AREAAI+ ++LL
Sbjct  132  LENMLMSNSLVSVQLYSPKRPVVDIAEVFLWLMAVGTILCASFWSAWSAREAAIEHERLL  191

Query  841  KDGSDE  858
            KD +DE
Sbjct  192  KDAADE  197



>ref|XP_006648148.1| PREDICTED: signal peptide peptidase-like 4-like [Oryza brachyantha]
Length=544

 Score =   274 bits (700),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 140/216 (65%), Positives = 167/216 (77%), Gaps = 1/216 (0%)
 Frame = +1

Query  238  DIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRLA  417
            DIVH DD AP+  GC N+FVLVKV TW+N +E+ EFVGVGARFGPT+ESKEK AN+T L 
Sbjct  27   DIVHQDDEAPKIPGCSNDFVLVKVQTWVNNREDGEFVGVGARFGPTIESKEKHANRTGLL  86

Query  418  LADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCEK  597
            LADP DCC  P  K+ G+ +LV RG C FT KA  A+ AGASAI+IIN+  EL+KMVC++
Sbjct  87   LADPFDCCEPPTQKVAGDVLLVQRGKCKFTKKAKNAEAAGASAIIIINHVHELYKMVCDR  146

Query  598  NETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATIL  777
            NETDLDI IPA++LP+DAG  M + ++    VSVQLYSP RP+VD AEVFLWLMAV TIL
Sbjct  147  NETDLDINIPAVLLPKDAGNDM-QQLLKSGKVSVQLYSPDRPLVDTAEVFLWLMAVGTIL  205

Query  778  CASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            CASYWSAW+AREA  +Q+KLLKDG +     EA  S
Sbjct  206  CASYWSAWSAREAVTEQEKLLKDGHESSLNFEAGGS  241



>emb|CAL25347.1| d-alanyl-D-alanine endopeptidase/peptidase [Platanus x acerifolia]
Length=169

 Score =   260 bits (665),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 140/163 (86%), Gaps = 0/163 (0%)
 Frame = +1

Query  247  HHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRLALAD  426
            H DDVAP++ GC NNFVLVKV TW++GKE  EFVGVGARFG T+ESKEK+AN T+LAL+D
Sbjct  1    HQDDVAPKKPGCANNFVLVKVETWVDGKEGHEFVGVGARFGTTMESKEKKANHTKLALSD  60

Query  427  PPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCEKNET  606
            PPDCCS P+NKL+GE ILVHRGNC FTTKANVA  AGASAILIINNQ ELFKMVCE+NET
Sbjct  61   PPDCCSTPKNKLSGEVILVHRGNCKFTTKANVAQAAGASAILIINNQKELFKMVCERNET  120

Query  607  DLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDV  735
             L+I IPA+MLPQDAG S+ +++ + S VSVQLYSP R +VD+
Sbjct  121  ILNISIPAVMLPQDAGASLEKSLRSNSSVSVQLYSPERSLVDI  163



>ref|XP_010935855.1| PREDICTED: signal peptide peptidase-like 4 isoform X2 [Elaeis 
guineensis]
 ref|XP_010935857.1| PREDICTED: signal peptide peptidase-like 4 isoform X2 [Elaeis 
guineensis]
 ref|XP_010935858.1| PREDICTED: signal peptide peptidase-like 4 isoform X2 [Elaeis 
guineensis]
Length=524

 Score =   271 bits (692),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 159/201 (79%), Gaps = 0/201 (0%)
 Frame = +1

Query  283  DNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRLALADPPDCCSKPRNKL  462
            DN    VKV TWIN  E+ EFVGVGARFG T+E+KEK AN+TR+ L+DP DCC+  + KL
Sbjct  32   DNFIAKVKVQTWINNIEDDEFVGVGARFGTTIEAKEKYANRTRVFLSDPADCCTTLKKKL  91

Query  463  TGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCEKNETDLDIGIPAIMLP  642
             G+ +LVHRG+C FTTKA VA+ AGASAILIINN+ EL+KMVC+ NETDL+I I A+MLP
Sbjct  92   AGDILLVHRGHCKFTTKAKVAEAAGASAILIINNRKELYKMVCDPNETDLNISISAVMLP  151

Query  643  QDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATILCASYWSAWTAREAAI  822
            QDAG S+  ++ + + V+VQLYSP RP+VD AEVFLWLMAV TILCASYWSAW+AREA+I
Sbjct  152  QDAGASLDSSVKSGASVAVQLYSPDRPLVDTAEVFLWLMAVGTILCASYWSAWSAREASI  211

Query  823  QQDKLLKDGSDEYCGMEATQS  885
            + +KL+KD  DE    E T +
Sbjct  212  EYEKLIKDAPDEMLNTETTGT  232



>gb|ADE76315.1| unknown [Picea sitchensis]
Length=537

 Score =   268 bits (684),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 134/239 (56%), Positives = 171/239 (72%), Gaps = 4/239 (2%)
 Frame = +1

Query  145  VMELRSTAPYCSVPTAVVLWLLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWIN  324
            +M+LR    +C    A ++ L S   L   GDIVH DD+AP++ GC+N FVLVK+ TWIN
Sbjct  1    MMDLRLR--FCGFAIACLILLFSQHGLC--GDIVHDDDIAPKQPGCENKFVLVKIQTWIN  56

Query  325  GKEEMEFVGVGARFGPTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSF  504
            G++  E+VGV ARFG  + SKEK AN++RL LA+P D C+    KLTG+A LVHRGNC+F
Sbjct  57   GRKGEEYVGVSARFGAPVVSKEKDANKSRLVLANPYDSCTNLTEKLTGDAALVHRGNCTF  116

Query  505  TTKANVADDAGASAILIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNK  684
            TTKA VA  AGA AIL++N++ EL+KMVC K +   DI IPA+MLP+ AG S  + +   
Sbjct  117  TTKAKVAQAAGAVAILVVNDKEELYKMVCAKEDPASDIKIPAVMLPKTAGASFKKRLKAG  176

Query  685  SMVSVQLYSPRRPVVDVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDEY  861
              V V +YSP RP+VD+AEVFLWLMAV TILCAS+WSAW+AREA  +  K LKD SD +
Sbjct  177  GSVGVVIYSPDRPLVDIAEVFLWLMAVGTILCASFWSAWSAREACNEHCKSLKDDSDAF  235



>gb|EMT12022.1| Signal peptide peptidase-like 2B [Aegilops tauschii]
Length=532

 Score =   265 bits (676),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/195 (64%), Positives = 158/195 (81%), Gaps = 1/195 (1%)
 Frame = +1

Query  301  VKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAIL  480
            VKV TW+  +E  EFVGVGARFGP +ESKEK AN+T L +ADP DCC+  + K+ GE +L
Sbjct  34   VKVQTWVKNRETDEFVGVGARFGPIIESKEKHANRTGLLIADPFDCCTPLKEKVAGEVLL  93

Query  481  VHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQS  660
            V RG+C FTTKA VA+DAGASAI+I+NN+ EL+KMVC++NETDLDI IPA++LP+DAG +
Sbjct  94   VQRGDCKFTTKAKVAEDAGASAIIILNNRHELYKMVCDQNETDLDINIPAVLLPKDAG-T  152

Query  661  MIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLL  840
            +++ +++   VSVQLYSP RP+VD AEVFLWLMAV TIL ASYWSAW+AREA I+Q+KLL
Sbjct  153  ILQGLLSLGKVSVQLYSPDRPLVDTAEVFLWLMAVGTILGASYWSAWSAREALIEQEKLL  212

Query  841  KDGSDEYCGMEATQS  885
            KDG +    +EA  S
Sbjct  213  KDGHESSVNIEAEGS  227



>gb|KDO76241.1| hypothetical protein CISIN_1g009071mg [Citrus sinensis]
Length=451

 Score =   260 bits (664),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 131/225 (58%), Positives = 160/225 (71%), Gaps = 25/225 (11%)
 Frame = +1

Query  184  PTAVVLWLLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGAR  363
            P AVV  L+   A V  GDIVH DD+AP++ GC+N+FVLVKV TWI+G E  EFVGVGAR
Sbjct  12   PVAVVS-LVCYPASVTAGDIVHDDDLAPKKPGCENDFVLVKVQTWIDGIENEEFVGVGAR  70

Query  364  FGPTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGAS  543
            FG T+ SKEK ANQ  L L+ P DCCS P++K  G+ I+V RGNC FTTKAN+A+ AGAS
Sbjct  71   FGTTIVSKEKNANQIHLTLSHPRDCCSMPKHKYAGDVIMVDRGNCKFTTKANIAEAAGAS  130

Query  544  AILIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRP  723
            A+LIINNQ EL+KMVC+ +ETDLDI IPA+M+PQDAG S+ + ++N S            
Sbjct  131  ALLIINNQKELYKMVCDPDETDLDIHIPAVMMPQDAGASLEKMLLNTS------------  178

Query  724  VVDVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
                        +V TILCASYWSAW+ARE AI+Q+KLLKD  DE
Sbjct  179  ------------SVGTILCASYWSAWSARETAIEQEKLLKDAVDE  211



>gb|KEH18849.1| signal peptide peptidase-like protein [Medicago truncatula]
Length=455

 Score =   259 bits (662),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = +1

Query  418  LADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCEK  597
            +ADPPDCCSKP+NKLT E ILVHRG CSFTTKAN+AD+AGASAILIIN +TELFKMVCE+
Sbjct  1    MADPPDCCSKPKNKLTNEIILVHRGKCSFTTKANIADEAGASAILIINYRTELFKMVCEE  60

Query  598  NETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATIL  777
            NETD+DIGIPA+MLPQDAG ++  +I N S+VS+QLYSP RP+VDVAEVFLWLMAV TIL
Sbjct  61   NETDVDIGIPAVMLPQDAGLNLERHIQNNSIVSIQLYSPLRPLVDVAEVFLWLMAVGTIL  120

Query  778  CASYWSAWTAREAAIQQDKLLKDGSDEY  861
            CASYWSAWTAREAAI+Q+KLLKD SDEY
Sbjct  121  CASYWSAWTAREAAIEQEKLLKDASDEY  148



>gb|KJB24747.1| hypothetical protein B456_004G158800 [Gossypium raimondii]
Length=468

 Score =   259 bits (663),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 141/162 (87%), Gaps = 1/162 (1%)
 Frame = +1

Query  376  LESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILI  555
            +ESKEK AN TRLALADPPDCCSKPRN+LTGE ILVHRGNCSFT KANVA++AGASAILI
Sbjct  1    MESKEKHANHTRLALADPPDCCSKPRNQLTGEVILVHRGNCSFTVKANVAEEAGASAILI  60

Query  556  INNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDV  735
            INNQTELFKMVCE ++ D++I IPA+MLPQDAG ++   I N + VSV  YSP+RP VD+
Sbjct  61   INNQTELFKMVCE-SDADVNIKIPAVMLPQDAGSNLENYINNNTRVSVAFYSPKRPAVDI  119

Query  736  AEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDEY  861
            AEVFLWLMAV TIL ASYWSAWTA+E AI+QDKLLKD S+E+
Sbjct  120  AEVFLWLMAVGTILLASYWSAWTAKEVAIEQDKLLKDASEEF  161



>gb|AAF78405.1|AC009273_11 ESTs gb|AA586244 and gb|T21200 come from this gene [Arabidopsis 
thaliana]
Length=613

 Score =   239 bits (610),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 120/219 (55%), Positives = 149/219 (68%), Gaps = 6/219 (3%)
 Frame = +1

Query  205  LLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLES  384
            LL  ++ V  GDIVHHDD  P+R GC+NNFVLVKV T +NG E  E+VGVGARFGPTLES
Sbjct  17   LLYSASFVCAGDIVHHDDSLPQRPGCNNNFVLVKVPTRVNGSEYTEYVGVGARFGPTLES  76

Query  385  KEKRANQTRLALADPPDCCSKPRNKLTGEAILVHR----GNCSFTTKANVADDAGASAIL  552
            KEK A   +LA+ADPPDCCS P+NK+     LV       +C      +       S + 
Sbjct  77   KEKHATLIKLAIADPPDCCSTPKNKVKFPFWLVSLVLIFPSCVIPVSLSFGSLQERSFLF  136

Query  553  IINNQT--ELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPV  726
            I+ N       +++ +  E  LDI IP +MLP DAG+S+   + + ++V++QLYSP+RP 
Sbjct  137  IVVNAVLPPKLRLLKQLGENVLDITIPVVMLPVDAGRSLENIVKSNAIVTLQLYSPKRPA  196

Query  727  VDVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLK  843
            VDVAEVFLWLMAV TILCASYWSAWT RE AI+QDKLLK
Sbjct  197  VDVAEVFLWLMAVGTILCASYWSAWTVREEAIEQDKLLK  235



>gb|EMT21395.1| Signal peptide peptidase-like 2B [Aegilops tauschii]
Length=549

 Score =   234 bits (598),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 122/228 (54%), Positives = 149/228 (65%), Gaps = 33/228 (14%)
 Frame = +1

Query  301  VKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRLALADPPDCCSKPRNKL------  462
            VKV +W+ G E  EFVGVGARFGP + SKEK+A +  L LADP   C+ P+NK+      
Sbjct  12   VKVQSWVGGNEGDEFVGVGARFGPKIVSKEKQATREPLTLADPIHACAPPKNKVPKLFFQ  71

Query  463  --------------------------TGEAILVHRGNCSFTTKANVADDAGASAILIINN  564
                                      +G  +LV RG C FT KA +A+ AGAS ILIIN+
Sbjct  72   SQANPRLARLLLSDDSSSGIPLVYLVSGGVLLVERGKCKFTKKAKLAEAAGASGILIINS  131

Query  565  QTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIM-NKSMVSVQLYSPRRPVVDVAE  741
             TEL+KMVCEKNET+LDI IPA++LP+DAGQ++   +  N S V VQLYSP RPVVD AE
Sbjct  132  GTELYKMVCEKNETELDIHIPAVLLPKDAGQALRSLLTANTSSVGVQLYSPDRPVVDTAE  191

Query  742  VFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            VFLWLMAV T+LCASYWSAW+AREA  +Q+KLLKDG +    +E   S
Sbjct  192  VFLWLMAVGTVLCASYWSAWSAREAVTEQEKLLKDGHEVSLTVEGGGS  239



>gb|AFW69664.2| hypothetical protein ZEAMMB73_283504 [Zea mays]
Length=486

 Score =   230 bits (586),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 109/168 (65%), Positives = 134/168 (80%), Gaps = 0/168 (0%)
 Frame = +1

Query  382  SKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIIN  561
            SKEK AN+T+L LADP DCCS P++K+ G+ +LV RG C FT KA  A+ AGASAI+IIN
Sbjct  21   SKEKHANRTKLTLADPMDCCSPPKHKVPGDVLLVQRGKCKFTKKAKFAEAAGASAIVIIN  80

Query  562  NQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAE  741
            +  EL+KMVCEKNETDLDI IPA++LP+DAG ++   + N + VSVQLYSP RPVVD AE
Sbjct  81   HVHELYKMVCEKNETDLDINIPAVLLPKDAGSALHTLLTNGNTVSVQLYSPDRPVVDTAE  140

Query  742  VFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            VFLWLMAV T+L ASYWSAW+AREA I+Q+KLLKDG ++   +EA  S
Sbjct  141  VFLWLMAVGTVLGASYWSAWSAREAVIEQEKLLKDGHEDLLNVEARGS  188



>emb|CDP12033.1| unnamed protein product [Coffea canephora]
Length=186

 Score =   220 bits (560),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 128/166 (77%), Gaps = 0/166 (0%)
 Frame = +1

Query  190  AVVLWLLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFG  369
            A+V+ + S  A V  GDIVH DD+AP++ GC+N+FVLVK+ TW++G E  EFVGVGARFG
Sbjct  14   AIVVVVFSSPAEVTAGDIVHEDDLAPKKPGCENDFVLVKIQTWVDGIENAEFVGVGARFG  73

Query  370  PTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAI  549
             T+ SKEK A QT L  ++P DCCS   NKL G+ I+V RG C FTTKAN+A+ AGASA+
Sbjct  74   TTIVSKEKNAQQTHLTRSNPRDCCSPSINKLAGDVIMVDRGKCKFTTKANIAEAAGASAV  133

Query  550  LIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKS  687
            LIINNQ EL+KMVCE NETDLDI IPA+MLPQDAG S+ + + N S
Sbjct  134  LIINNQKELYKMVCEPNETDLDIKIPAVMLPQDAGASLEKMLSNSS  179



>ref|XP_001770668.1| predicted protein [Physcomitrella patens]
 gb|EDQ64492.1| predicted protein [Physcomitrella patens]
Length=553

 Score =   229 bits (583),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/208 (50%), Positives = 147/208 (71%), Gaps = 0/208 (0%)
 Frame = +1

Query  238  DIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRLA  417
            DI+H D   P++ GC+N+FVLVKV TW++G E  E VGV ARFG ++ ++ +  N   LA
Sbjct  37   DIMHDDADTPKQPGCENSFVLVKVRTWMDGVETTELVGVSARFGESISNRAQEINALPLA  96

Query  418  LADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCEK  597
            +  P   C+     LTG A LV RG+C+FT KA +A  AGA A+++IN++ EL+KMVC+ 
Sbjct  97   VPSPATLCNMSSLLLTGRAALVRRGDCTFTKKARMAQAAGAKALIVINDKEELYKMVCDD  156

Query  598  NETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATIL  777
            N T LDI IP++MLPQ AG ++   ++    V + +YSP+RPVVD++E+FLWLMAV T+L
Sbjct  157  NGTFLDIQIPSVMLPQSAGDTLEAGLLRDESVKILMYSPKRPVVDISEIFLWLMAVGTVL  216

Query  778  CASYWSAWTAREAAIQQDKLLKDGSDEY  861
             AS+WSAWTA+EAA +  + +KDG D Y
Sbjct  217  GASFWSAWTAKEAAQEHYRSMKDGGDSY  244



>gb|AFW69666.2| hypothetical protein ZEAMMB73_283504 [Zea mays]
Length=412

 Score =   220 bits (561),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 126/154 (82%), Gaps = 0/154 (0%)
 Frame = +1

Query  382  SKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIIN  561
            SKEK AN+T+L LADP DCCS P++K+ G+ +LV RG C FT KA  A+ AGASAI+IIN
Sbjct  21   SKEKHANRTKLTLADPMDCCSPPKHKVPGDVLLVQRGKCKFTKKAKFAEAAGASAIVIIN  80

Query  562  NQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAE  741
            +  EL+KMVCEKNETDLDI IPA++LP+DAG ++   + N + VSVQLYSP RPVVD AE
Sbjct  81   HVHELYKMVCEKNETDLDINIPAVLLPKDAGSALHTLLTNGNTVSVQLYSPDRPVVDTAE  140

Query  742  VFLWLMAVATILCASYWSAWTAREAAIQQDKLLK  843
            VFLWLMAV T+L ASYWSAW+AREA I+Q+KLLK
Sbjct  141  VFLWLMAVGTVLGASYWSAWSAREAVIEQEKLLK  174



>gb|AFW69665.2| hypothetical protein ZEAMMB73_283504 [Zea mays]
Length=425

 Score =   220 bits (561),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 126/154 (82%), Gaps = 0/154 (0%)
 Frame = +1

Query  382  SKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIIN  561
            SKEK AN+T+L LADP DCCS P++K+ G+ +LV RG C FT KA  A+ AGASAI+IIN
Sbjct  21   SKEKHANRTKLTLADPMDCCSPPKHKVPGDVLLVQRGKCKFTKKAKFAEAAGASAIVIIN  80

Query  562  NQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAE  741
            +  EL+KMVCEKNETDLDI IPA++LP+DAG ++   + N + VSVQLYSP RPVVD AE
Sbjct  81   HVHELYKMVCEKNETDLDINIPAVLLPKDAGSALHTLLTNGNTVSVQLYSPDRPVVDTAE  140

Query  742  VFLWLMAVATILCASYWSAWTAREAAIQQDKLLK  843
            VFLWLMAV T+L ASYWSAW+AREA I+Q+KLLK
Sbjct  141  VFLWLMAVGTVLGASYWSAWSAREAVIEQEKLLK  174



>ref|XP_006439530.1| hypothetical protein CICLE_v10019598mg [Citrus clementina]
 gb|ESR52770.1| hypothetical protein CICLE_v10019598mg [Citrus clementina]
 gb|KDO76243.1| hypothetical protein CISIN_1g009071mg [Citrus sinensis]
Length=378

 Score =   216 bits (550),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/137 (73%), Positives = 119/137 (87%), Gaps = 0/137 (0%)
 Frame = +1

Query  448  PRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCEKNETDLDIGIP  627
            P++K  G+ I+V RGNC FTTKAN+A+ AGASA+LIINNQ EL+KMVC+ +ETDLDI IP
Sbjct  2    PKHKYAGDVIMVDRGNCKFTTKANIAEAAGASALLIINNQKELYKMVCDPDETDLDIHIP  61

Query  628  AIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATILCASYWSAWTA  807
            A+M+PQDAG S+ + ++N S VSVQLYSPRRPVVDVAEVFLWLMAV TILCASYWSAW+A
Sbjct  62   AVMMPQDAGASLEKMLLNTSSVSVQLYSPRRPVVDVAEVFLWLMAVGTILCASYWSAWSA  121

Query  808  REAAIQQDKLLKDGSDE  858
            RE AI+Q+KLLKD  DE
Sbjct  122  RETAIEQEKLLKDAVDE  138



>ref|XP_001768370.1| predicted protein [Physcomitrella patens]
 gb|EDQ66732.1| predicted protein [Physcomitrella patens]
Length=521

 Score =   217 bits (553),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 109/203 (54%), Positives = 140/203 (69%), Gaps = 1/203 (0%)
 Frame = +1

Query  238  DIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRLA  417
            DI H D +AP + GC N+FVLVKV  WI G EE E VGVGA+FG  +   E+  +   LA
Sbjct  19   DIEHDDAMAPSQPGCSNSFVLVKVRNWIAGLEEPEVVGVGAKFGELITDFEQD-HSAPLA  77

Query  418  LADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCEK  597
              DP D C+     L G   LV RGNC FTTKA VA  AGA A+L++N++ EL+KMVC +
Sbjct  78   KLDPEDACTDSIKPLQGYTALVRRGNCEFTTKARVAQKAGAVALLVVNDKQELYKMVCSE  137

Query  598  NETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATIL  777
            N T  DI IP++MLP+ AG ++ + +     V V +YSPRR +VD+AEVFLWLMAV TIL
Sbjct  138  NSTFTDITIPSVMLPKAAGNNLEDALNLGKEVRVVMYSPRRTLVDIAEVFLWLMAVGTIL  197

Query  778  CASYWSAWTAREAAIQQDKLLKD  846
             AS+WSAWTA+EAA + ++L+KD
Sbjct  198  SASFWSAWTAKEAAQEHNRLMKD  220



>ref|XP_001751321.1| predicted protein [Physcomitrella patens]
 gb|EDQ83638.1| predicted protein [Physcomitrella patens]
Length=552

 Score =   215 bits (548),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 141/203 (69%), Gaps = 0/203 (0%)
 Frame = +1

Query  238  DIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRLA  417
            DIVH D +AP + GC N+FVLVK+ TWI G+E+ E VGV ARFG  +   E+      L+
Sbjct  37   DIVHDDTLAPSQPGCSNSFVLVKIRTWIKGEEDSEIVGVSARFGKLIADHEQGKTSVPLS  96

Query  418  LADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCEK  597
              DP D C+     L G   LV RGNC+FTTKA  A  AGA A+L++N++ EL+KM+C +
Sbjct  97   KLDPEDGCTDSIKPLQGFTALVERGNCTFTTKARTAQKAGAVALLVVNDKQELYKMICSE  156

Query  598  NETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATIL  777
            N+T  DI IP+++LP+ AG+ + E + + + V V  YSP+R +VD+AEVFLWLMA+ TIL
Sbjct  157  NDTFHDIIIPSVLLPKAAGEHLEEALDSNNEVRVLHYSPKRTMVDIAEVFLWLMALGTIL  216

Query  778  CASYWSAWTAREAAIQQDKLLKD  846
             AS+WSAWTA+E+A +  + LKD
Sbjct  217  SASFWSAWTAKESAQEHYRRLKD  239



>ref|XP_002978487.1| hypothetical protein SELMODRAFT_176891 [Selaginella moellendorffii]
 gb|EFJ20473.1| hypothetical protein SELMODRAFT_176891 [Selaginella moellendorffii]
Length=549

 Score =   211 bits (538),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 110/216 (51%), Positives = 140/216 (65%), Gaps = 3/216 (1%)
 Frame = +1

Query  214  CSALVHGGD--IVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESK  387
            C A   GGD  + H D+ AP+  GCDNNF LVKV  WI+  E  E+VG+ ARFG + ++ 
Sbjct  28   CGATGGGGDNDVSHDDEDAPKHLGCDNNFELVKVRNWIDAVESKEYVGISARFGASFKTL  87

Query  388  EKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQ  567
             +  +   LAL D PD C     + +G A LV RG CSFTTKA VA  AGA A+L+ N++
Sbjct  88   GREEHFLPLALLDSPDGCVNTSQRASGAA-LVQRGGCSFTTKARVAQSAGAVALLVFNDR  146

Query  568  TELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVF  747
             EL+KMVC  N+T LDI IP  +LP  AG S+   +     V V + SP RP+VDVAEV 
Sbjct  147  EELYKMVCYDNDTSLDIKIPTAILPMSAGNSLQSALEANKKVRVIMDSPGRPLVDVAEVC  206

Query  748  LWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSD  855
            LWL+A+ TILCAS+WSAW A+EAA ++ K LKD  D
Sbjct  207  LWLIAMGTILCASFWSAWEAKEAAHERCKRLKDAPD  242



>ref|XP_002970408.1| hypothetical protein SELMODRAFT_93092 [Selaginella moellendorffii]
 gb|EFJ28538.1| hypothetical protein SELMODRAFT_93092 [Selaginella moellendorffii]
Length=549

 Score =   211 bits (537),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 110/216 (51%), Positives = 140/216 (65%), Gaps = 3/216 (1%)
 Frame = +1

Query  214  CSALVHGGD--IVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESK  387
            C A   GGD  + H D+ AP+  GCDNNF LVKV  WI+  E  E+VG+ ARFG + ++ 
Sbjct  28   CGATGGGGDNDVSHDDEDAPKHLGCDNNFELVKVRNWIDAVESKEYVGISARFGASFKTL  87

Query  388  EKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQ  567
             +  +   LAL D PD C     + +G A LV RG CSFTTKA VA  AGA A+L+ N++
Sbjct  88   GREEHFLPLALLDSPDGCVNTSQRASGAA-LVQRGGCSFTTKARVAQSAGAVALLVFNDR  146

Query  568  TELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVF  747
             EL+KMVC  N+T LDI IP  +LP  AG S+   +     V V + SP RP+VDVAEV 
Sbjct  147  EELYKMVCYDNDTSLDIKIPTAILPMSAGNSLQSALEANKKVRVIMDSPGRPLVDVAEVC  206

Query  748  LWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSD  855
            LWL+A+ TILCAS+WSAW A+EAA ++ K LKD  D
Sbjct  207  LWLIAMGTILCASFWSAWEAKEAAHERCKRLKDAPD  242



>ref|XP_002982598.1| hypothetical protein SELMODRAFT_179700 [Selaginella moellendorffii]
 gb|EFJ16351.1| hypothetical protein SELMODRAFT_179700 [Selaginella moellendorffii]
Length=552

 Score =   206 bits (523),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 103/207 (50%), Positives = 141/207 (68%), Gaps = 2/207 (1%)
 Frame = +1

Query  238  DIVHHDDV-APRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRL  414
            D + +DDV AP+  GCDN FVLVK+  WI+     ++VG+ ARFG  + ++  +A+ T L
Sbjct  40   DEISYDDVDAPKHPGCDNKFVLVKIRNWIDNVPASDYVGITARFGGPVAARADKAHVTSL  99

Query  415  ALADPPDCCSKPRN-KLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVC  591
            + ADP DCCS P   K  G  +L  RGNC+FTTKA +A  AGASA+LI N++ EL+KMVC
Sbjct  100  SRADPIDCCSNPGGVKHAGNVLLAERGNCTFTTKARIAQQAGASAVLITNDREELYKMVC  159

Query  592  EKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVAT  771
             +N+T  DI IPAIM+P+ AG+S+   + +   V + LYSP RPVVD+ E+FLW +AVAT
Sbjct  160  FENDTFADITIPAIMIPRSAGESLESALQSSQNVKLLLYSPVRPVVDLGELFLWCLAVAT  219

Query  772  ILCASYWSAWTAREAAIQQDKLLKDGS  852
            ++ AS WSA TA +    + K LK+ S
Sbjct  220  VIGASLWSACTANDVGSGRYKRLKEAS  246



>ref|XP_002993338.1| hypothetical protein SELMODRAFT_187400 [Selaginella moellendorffii]
 gb|EFJ05600.1| hypothetical protein SELMODRAFT_187400 [Selaginella moellendorffii]
Length=539

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 103/207 (50%), Positives = 141/207 (68%), Gaps = 2/207 (1%)
 Frame = +1

Query  238  DIVHHDDV-APRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRL  414
            D + +DDV AP+  GCDN FVLVK+  WI+     ++VG+ ARFG  + ++  +A+ T L
Sbjct  27   DEISYDDVDAPKHPGCDNKFVLVKIRNWIDNVPASDYVGITARFGGPVAARADKAHVTSL  86

Query  415  ALADPPDCCSKPRN-KLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVC  591
            + ADP DCCS P   K  G  +L  RGNC+FTTKA +A  AGASA+LI N++ EL+KMVC
Sbjct  87   SRADPIDCCSNPGGVKHAGNILLAERGNCTFTTKARIAQQAGASAVLISNDREELYKMVC  146

Query  592  EKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVAT  771
             +N+T  DI IPAIM+P+ AG+S+   + +   V + LYSP RPVVD+ E+FLW +AVAT
Sbjct  147  FENDTFADITIPAIMIPRSAGESLESALQSSQSVKLLLYSPVRPVVDLGELFLWCLAVAT  206

Query  772  ILCASYWSAWTAREAAIQQDKLLKDGS  852
            ++ AS WSA TA +    + K LK+ S
Sbjct  207  VIGASLWSACTANDVGSGRYKRLKEAS  233



>gb|ERN11880.1| hypothetical protein AMTR_s00020p00177780 [Amborella trichopoda]
Length=305

 Score =   197 bits (501),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 94/204 (46%), Positives = 130/204 (64%), Gaps = 1/204 (0%)
 Frame = +1

Query  202  WLLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLE  381
            WLL  S L    D+   DD  P+  GCDN F LVKV  W+NG E+   VG+ ARFG +L 
Sbjct  14   WLLLIS-LSFADDVSRDDDFTPKSPGCDNKFQLVKVKNWVNGVEDTSIVGLSARFGSSLP  72

Query  382  SKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIIN  561
            S    A +    LA+P +CC+   +KL     L  RG+C+FTTKA VA   GA+ +LI+N
Sbjct  73   SHASEARKRPAVLANPVNCCTNSSSKLVNSMALSKRGDCAFTTKAQVAQYEGAAGLLIMN  132

Query  562  NQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAE  741
            ++ +L+KMVC +N+T L+I IP IM+P+ AG ++  ++     V + LYSP RP+VD +E
Sbjct  133  DEEDLYKMVCTENDTSLNITIPIIMIPKSAGDNLQGHLAAGHKVDILLYSPNRPIVDFSE  192

Query  742  VFLWLMAVATILCASYWSAWTARE  813
            +FLW+MAV TI+CAS WS +   E
Sbjct  193  IFLWMMAVGTIVCASLWSEFVTCE  216



>gb|EMS56631.1| Signal peptide peptidase-like 2B [Triticum urartu]
Length=460

 Score =   197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 122/151 (81%), Gaps = 1/151 (1%)
 Frame = +1

Query  433  DCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCEKNETDL  612
            +  S P  ++ GE +LV RG+C FTTKA VA+DAGASAI+I+NN+ EL+KMVC++NETDL
Sbjct  6    NFVSSPCYQVAGEVLLVQRGDCKFTTKAKVAEDAGASAIIILNNRHELYKMVCDQNETDL  65

Query  613  DIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATILCASYW  792
            DI IPA++LP+DAG ++++ +++   VSVQLYSP RP+VD AEVFLWLMAV TIL ASYW
Sbjct  66   DINIPAVLLPKDAG-TILQGLLSLGKVSVQLYSPDRPLVDTAEVFLWLMAVGTILGASYW  124

Query  793  SAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            SAW+AREA I+Q+KLLKDG +    +EA  S
Sbjct  125  SAWSAREALIEQEKLLKDGHESSVNIEAEGS  155



>ref|XP_006850301.2| PREDICTED: signal peptide peptidase-like 2 [Amborella trichopoda]
Length=531

 Score =   195 bits (496),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 94/204 (46%), Positives = 130/204 (64%), Gaps = 1/204 (0%)
 Frame = +1

Query  202  WLLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLE  381
            WLL  S L    D+   DD  P+  GCDN F LVKV  W+NG E+   VG+ ARFG +L 
Sbjct  14   WLLLIS-LSFADDVSRDDDFTPKSPGCDNKFQLVKVKNWVNGVEDTSIVGLSARFGSSLP  72

Query  382  SKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIIN  561
            S    A +    LA+P +CC+   +KL     L  RG+C+FTTKA VA   GA+ +LI+N
Sbjct  73   SHASEARKRPAVLANPVNCCTNSSSKLVNSMALSKRGDCAFTTKAQVAQYEGAAGLLIMN  132

Query  562  NQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAE  741
            ++ +L+KMVC +N+T L+I IP IM+P+ AG ++  ++     V + LYSP RP+VD +E
Sbjct  133  DEEDLYKMVCTENDTSLNITIPIIMIPKSAGDNLQGHLAAGHKVDILLYSPNRPIVDFSE  192

Query  742  VFLWLMAVATILCASYWSAWTARE  813
            +FLW+MAV TI+CAS WS +   E
Sbjct  193  IFLWMMAVGTIVCASLWSEFVTCE  216



>gb|ABR16410.1| unknown [Picea sitchensis]
Length=539

 Score =   192 bits (488),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 86/192 (45%), Positives = 125/192 (65%), Gaps = 0/192 (0%)
 Frame = +1

Query  238  DIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRLA  417
            +I H D  AP+  GC N F LVKV  WI+G E    VG+ ARFG ++ + E  A++  + 
Sbjct  29   EISHDDSSAPKSPGCKNIFQLVKVKNWIDGVEGTSMVGLSARFGTSVPTNEDEAHRMTVV  88

Query  418  LADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCEK  597
              +P +CC     +L+G A L  RGNC+FT KAN+A   GA A+L++N++ +LFKMVC  
Sbjct  89   ETNPLNCCENSSTQLSGYAALSKRGNCTFTMKANIAQAGGAVALLVMNDKEDLFKMVCSG  148

Query  598  NETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATIL  777
            N+T  DI IP +M+P+ AG+S+ +++     V + LYSP RP +D +E+F+W+MAV TI+
Sbjct  149  NDTFFDIKIPVVMIPKSAGESLQDHLSTGQKVDLLLYSPNRPFIDFSEIFMWMMAVGTIV  208

Query  778  CASYWSAWTARE  813
            CAS WS +   E
Sbjct  209  CASLWSKFIGNE  220



>gb|KEH26504.1| signal peptide peptidase-like protein [Medicago truncatula]
Length=435

 Score =   185 bits (470),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +1

Query  478  LVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQ  657
            +V RGNC+FT KAN A +A ASAILIINNQ EL+KMVC+ +ETDL I IPA+MLP DAG 
Sbjct  1    MVDRGNCTFTKKANSAQNANASAILIINNQKELYKMVCDPDETDLSIHIPAVMLPLDAGT  60

Query  658  SMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKL  837
             +   + + S VSVQLYSP+RP VD+AEVFLWLMAV TILCASYWSAW AREAA++ DKL
Sbjct  61   KLENMLKSTSSVSVQLYSPQRPTVDIAEVFLWLMAVLTILCASYWSAWRAREAAVEYDKL  120

Query  838  LKDGSDE  858
            L+D SDE
Sbjct  121  LRDVSDE  127



>ref|XP_010911065.1| PREDICTED: signal peptide peptidase-like 2, partial [Elaeis guineensis]
Length=192

 Score =   178 bits (451),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 83/178 (47%), Positives = 117/178 (66%), Gaps = 0/178 (0%)
 Frame = +1

Query  280  CDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRLALADPPDCCSKPRNK  459
            C+N F LVK+  W+NG E+   VG+ ARFG +L      A +T  ALA+P +CC+   +K
Sbjct  1    CNNKFQLVKIKKWVNGTEDTGIVGLSARFGASLPGHASEAIKTAAALANPFNCCTNLSSK  60

Query  460  LTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCEKNETDLDIGIPAIML  639
            LT    L  RGNC+FT KA VA   GA+ +L+IN+  +L+KMVC +N+T L++ IP +M+
Sbjct  61   LTSSIALAKRGNCTFTAKAKVAQAGGAAGLLVINDNEDLYKMVCNENDTSLNVTIPVVMI  120

Query  640  PQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATILCASYWSAWTARE  813
            P+ AG+++ +++ N   V V LYSP RPVVD +   LWLMAV TI+ AS W  + A E
Sbjct  121  PKSAGENLRKSLANGERVDVLLYSPNRPVVDFSATLLWLMAVFTIVIASIWPEYIACE  178



>ref|XP_001770310.1| predicted protein [Physcomitrella patens]
 gb|EDQ64800.1| predicted protein [Physcomitrella patens]
Length=547

 Score =   186 bits (472),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 93/220 (42%), Positives = 139/220 (63%), Gaps = 2/220 (1%)
 Frame = +1

Query  196  VLWLLSCSA-LVHGGDIVHHDDV-APRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFG  369
            +L L++ SA L  G   + HDD+  P + GCDN+FVLVK+  W+N  E  E VGV ARFG
Sbjct  14   ILLLVALSAHLCRGDSSITHDDLNTPSQPGCDNSFVLVKIRNWMNDVEVTELVGVSARFG  73

Query  370  PTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAI  549
              +       +   LA+      C+     L G A LV RG C+FT  A  A  AGA+A+
Sbjct  74   EKISDINVALDAIPLAMPSLVSSCNTSSIPLNGHAALVRRGECTFTRMARTAQAAGANAL  133

Query  550  LIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVV  729
            +++N++ EL KMVC +N T  DI IP++++P+ AG  +   ++    V + +YSP+RP++
Sbjct  134  IVVNDKEELCKMVCSENGTFTDIQIPSVLVPKSAGDILEAGLLRGETVKILMYSPKRPII  193

Query  730  DVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDG  849
            D++E+FLWLMAV T++ AS+WSA TA+EAA++  + +K G
Sbjct  194  DISEIFLWLMAVGTVVGASFWSALTAKEAALEHYRSIKGG  233



>gb|KHG19074.1| Signal peptide peptidase-like 2B [Gossypium arboreum]
Length=407

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 106/211 (50%), Positives = 128/211 (61%), Gaps = 50/211 (24%)
 Frame = +1

Query  226  VHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQ  405
            V  GDIVH D++AP++ G  +N          NG EE E+VGVG RFG T+ SKEK ANQ
Sbjct  25   VIAGDIVHDDNLAPKKPGQSSNLG--------NGIEESEYVGVGTRFGTTIVSKEKNANQ  76

Query  406  TRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKM  585
              L L+DP DCCS P+NK                  AN A  A ASA+LIINNQ EL+KM
Sbjct  77   RCLILSDPRDCCSHPKNK------------------ANNAQAAHASAVLIINNQKELYKM  118

Query  586  VCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAV  765
                                DAG S+ E ++    +SVQLYSP+RP+VD+AEVFLWLMA+
Sbjct  119  --------------------DAGASL-EKMLT---MSVQLYSPKRPLVDIAEVFLWLMAI  154

Query  766  ATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
              I+ ASYWSAW+AR AAI+QDKLLKD  DE
Sbjct  155  GIIIGASYWSAWSARGAAIEQDKLLKDALDE  185



>ref|XP_009413504.1| PREDICTED: signal peptide peptidase-like 2 [Musa acuminata subsp. 
malaccensis]
Length=543

 Score =   185 bits (470),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/192 (44%), Positives = 122/192 (64%), Gaps = 0/192 (0%)
 Frame = +1

Query  238  DIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRLA  417
            +I H DD APR   C+N F LVK+  W+NG +    VG+ ARFG ++      A +    
Sbjct  35   EITHEDDDAPRSPNCNNKFQLVKIENWVNGTQGTSIVGLSARFGTSVPRLASDAQKNSAL  94

Query  418  LADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCEK  597
            L +P +CC+   +KLT    L  RG+C+FT KA VA   GA+ +L+IN+  +L+KMVC +
Sbjct  95   LTNPLNCCANLTSKLTNSVALAKRGDCTFTAKAKVAQLGGAAGLLVINDNEDLYKMVCTE  154

Query  598  NETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATIL  777
            N+T L++ IP +M+P+ AG  + + +++   V V LYSP RPVVD++  FLWLMAV TI+
Sbjct  155  NDTSLNLTIPVVMIPKSAGDYLKDTLISGQRVEVLLYSPNRPVVDLSATFLWLMAVGTIV  214

Query  778  CASYWSAWTARE  813
            CAS W+   A E
Sbjct  215  CASLWAEIIAGE  226



>gb|KJB41339.1| hypothetical protein B456_007G099700 [Gossypium raimondii]
 gb|KJB41344.1| hypothetical protein B456_007G099700 [Gossypium raimondii]
Length=424

 Score =   182 bits (463),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 102/116 (88%), Gaps = 1/116 (1%)
 Frame = +1

Query  511  KANVADDAGASAILIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSM  690
            KANVA++AGASAILIINNQTELFKMVCE ++ D+DI IPA+MLPQDAG  + + I N +M
Sbjct  2    KANVAEEAGASAILIINNQTELFKMVCE-SDADVDIKIPALMLPQDAGSRLEKYISNNTM  60

Query  691  VSVQLYSPRRPVVDVAEVFLWLMAVATILCASYWSAWTAREAAIQQDKLLKDGSDE  858
            VSV LYSP+RP VD+AEVFLWLMAV TILCASYWSAWTARE AI+QDKLLKD S+E
Sbjct  61   VSVALYSPKRPAVDIAEVFLWLMAVGTILCASYWSAWTAREVAIEQDKLLKDASEE  116



>ref|XP_006663404.1| PREDICTED: signal peptide peptidase-like 2-like [Oryza brachyantha]
Length=534

 Score =   184 bits (466),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 89/200 (45%), Positives = 126/200 (63%), Gaps = 2/200 (1%)
 Frame = +1

Query  265  PRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRLALADPPDCCS  444
            P   GC N F LVKV  W+NG E    VG+ ARFG ++     +A +T   LA+P DCCS
Sbjct  39   PPSPGCSNKFQLVKVKNWVNGTEGTTVVGLSARFGASIPRDIHKAQKTFAVLANPLDCCS  98

Query  445  KPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCEKNETDLDIGI  624
               +KLT    +  RG C+FT KA +A   GA+ +L+IN+  EL+KMVC  N+T ++I I
Sbjct  99   NSTSKLTNYIAIAQRGECAFTAKAKIAQAGGAAGLLVINDNEELYKMVCSDNDTSINITI  158

Query  625  PAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATILCASYWSAWT  804
            P +M+PQ AG++M   + + + + VQLYSP RPVVD++  FLW+MA+ TI+CAS W+ + 
Sbjct  159  PVVMIPQAAGKNMKGLLDHGAWLEVQLYSPNRPVVDLSACFLWIMAIGTIVCASLWTEFV  218

Query  805  AREAAIQQDKLL--KDGSDE  858
            A E   ++   L  KDG + 
Sbjct  219  ACEQVDERYNQLTRKDGPNS  238



>ref|XP_008811653.1| PREDICTED: signal peptide peptidase-like 2 [Phoenix dactylifera]
Length=540

 Score =   184 bits (466),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 86/190 (45%), Positives = 120/190 (63%), Gaps = 0/190 (0%)
 Frame = +1

Query  238  DIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRLA  417
            D  H D  AP+   C+N F LVK+  W+NG E    VG+ ARFG +L S    A +T   
Sbjct  33   DTSHDDAEAPKSPACNNKFQLVKIKKWVNGTEGTSIVGLSARFGASLPSHASEAIKTSAV  92

Query  418  LADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCEK  597
            L +P +CC+   +KLT    L  RG+C+FT KA VA   GA+ +L+IN+  +L+KMVC +
Sbjct  93   LTNPFNCCTNVSSKLTSSIALAKRGDCTFTAKAKVAQAGGAAGLLVINDNEDLYKMVCNE  152

Query  598  NETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATIL  777
            N+T L++ IP +M+P+ AG+++ ++  N   V V LYSP RPVVD +  FLWLMAV TI+
Sbjct  153  NDTSLNVTIPVVMIPKSAGENLRKSFDNGERVEVLLYSPNRPVVDFSATFLWLMAVFTIV  212

Query  778  CASYWSAWTA  807
             AS W  + A
Sbjct  213  IASIWPEYIA  222



>tpg|DAA38909.1| TPA: hypothetical protein ZEAMMB73_606524 [Zea mays]
Length=534

 Score =   183 bits (465),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/198 (44%), Positives = 125/198 (63%), Gaps = 2/198 (1%)
 Frame = +1

Query  268  RRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRLALADPPDCCSK  447
            R  GC N F LVKV  W+NG E   FVG+ A+FG  L      A ++   L++P DCCS 
Sbjct  40   RTPGCSNKFQLVKVKNWVNGTEGTTFVGLSAKFGAPLPRDIHEAKKSFAVLSNPIDCCSN  99

Query  448  PRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCEKNETDLDIGIP  627
              +KLT    +  RG C+FT KAN+A  +G++ +L+IN+  EL+KMVC +N+T +++ IP
Sbjct  100  LTSKLTSSVAIATRGECAFTEKANIAQASGSTGLLVINDNEELYKMVCGENDTSINVTIP  159

Query  628  AIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATILCASYWSAWTA  807
             +M+PQ AG+ +   + + + V VQLYSP RP VD++  FLW+MAV TI+CAS W+ +  
Sbjct  160  VVMIPQSAGKKLKNLLHHGASVEVQLYSPNRPTVDLSACFLWIMAVGTIVCASLWTEFVT  219

Query  808  REAAIQQDKLL--KDGSD  855
             E   ++   L  KDG D
Sbjct  220  CEQVDERYNQLTRKDGPD  237



>ref|XP_008667367.1| PREDICTED: uncharacterized protein LOC100217036 isoform X1 [Zea 
mays]
 gb|ACL54604.1| unknown [Zea mays]
 tpg|DAA38910.1| TPA: hypothetical protein ZEAMMB73_606524 [Zea mays]
Length=534

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/198 (44%), Positives = 125/198 (63%), Gaps = 2/198 (1%)
 Frame = +1

Query  268  RRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRLALADPPDCCSK  447
            R  GC N F LVKV  W+NG E   FVG+ A+FG  L      A ++   L++P DCCS 
Sbjct  40   RTPGCSNKFQLVKVKNWVNGTEGTTFVGLSAKFGAPLPRDIHEAKKSFAVLSNPIDCCSN  99

Query  448  PRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCEKNETDLDIGIP  627
              +KLT    +  RG C+FT KAN+A  +G++ +L+IN+  EL+KMVC +N+T +++ IP
Sbjct  100  LTSKLTSSVAIATRGECAFTEKANIAQASGSTGLLVINDNEELYKMVCGENDTSINVTIP  159

Query  628  AIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATILCASYWSAWTA  807
             +M+PQ AG+ +   + + + V VQLYSP RP VD++  FLW+MAV TI+CAS W+ +  
Sbjct  160  VVMIPQSAGKKLKNLLHHGASVEVQLYSPNRPTVDLSACFLWIMAVGTIVCASLWTEFVT  219

Query  808  REAAIQQDKLL--KDGSD  855
             E   ++   L  KDG D
Sbjct  220  CEQVDERYNQLTRKDGPD  237



>ref|XP_002446699.1| hypothetical protein SORBIDRAFT_06g020770 [Sorghum bicolor]
 gb|EES11027.1| hypothetical protein SORBIDRAFT_06g020770 [Sorghum bicolor]
Length=534

 Score =   182 bits (461),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 89/198 (45%), Positives = 122/198 (62%), Gaps = 2/198 (1%)
 Frame = +1

Query  268  RRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRLALADPPDCCSK  447
            R  GC N F LVKV  W+NG E    VG+ A+FG  L      A ++   LA+P DCCS 
Sbjct  40   RTPGCSNKFQLVKVKNWVNGTEGTTVVGLSAKFGAPLPRDIHEAKKSFAVLANPIDCCSN  99

Query  448  PRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCEKNETDLDIGIP  627
              +KLT    L  RG C+FT KAN A   GA+ +L+IN+  EL+KMVC +N+T +++ IP
Sbjct  100  LTSKLTSSVALATRGECAFTEKANTAQAGGATGLLVINDNEELYKMVCGENDTSINVTIP  159

Query  628  AIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATILCASYWSAWTA  807
             +M+PQ AG+ +   + + + V VQLYSP RP VD++  FLW+MAV TI+CAS W+ +  
Sbjct  160  VVMIPQSAGKMLKNFLHHGASVEVQLYSPNRPTVDLSACFLWIMAVGTIVCASLWTEFVT  219

Query  808  REAAIQQDKLL--KDGSD  855
             E   ++   L  KDG D
Sbjct  220  CEQVDERYNQLTRKDGPD  237



>gb|EMS64986.1| Signal peptide peptidase-like 2B [Triticum urartu]
Length=605

 Score =   182 bits (463),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 93/191 (49%), Positives = 120/191 (63%), Gaps = 30/191 (16%)
 Frame = +1

Query  235  GDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRL  414
            GDIVH DD AP+  GC+N+FVLVKV +W+ G E  EFVGVGARFGP + SKEK+A +  L
Sbjct  22   GDIVHQDDQAPKIPGCNNDFVLVKVQSWVGGNEGDEFVGVGARFGPKIVSKEKQATREPL  81

Query  415  ALADPPDCCSKPRNK------------------------------LTGEAILVHRGNCSF  504
             LADP   C+ P+NK                              ++G  +LV RG C F
Sbjct  82   TLADPIHACAPPKNKVLLFSHDSSSGISLGRVCIYLSSLIRVLQLVSGGVLLVERGKCKF  141

Query  505  TTKANVADDAGASAILIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNK  684
            T KA +A+ AGAS ILIIN+ TEL+KMVCEKNET+LDI IPA++LP+DAGQ++   +   
Sbjct  142  TKKAKLAEAAGASGILIINSVTELYKMVCEKNETELDIHIPAVLLPKDAGQALRSLLTAN  201

Query  685  SMVSVQLYSPR  717
            +  ++   SPR
Sbjct  202  TSSAILSRSPR  212



>gb|KJB25873.1| hypothetical protein B456_004G212600 [Gossypium raimondii]
Length=152

 Score =   171 bits (433),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 100/128 (78%), Gaps = 0/128 (0%)
 Frame = +1

Query  226  VHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQ  405
            V  GDIVH D++AP++ GC+N+FVLVKV TW+N  E+ E+VGVGARFG T+ SKEK ANQ
Sbjct  25   VIAGDIVHDDNLAPKKPGCENDFVLVKVQTWVNCIEDSEYVGVGARFGTTIVSKEKNANQ  84

Query  406  TRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKM  585
              L L+DP DCC+ P+NKL  + I+V RG+C FTTKAN A  A  SA+LIINNQ EL+KM
Sbjct  85   RCLILSDPRDCCNHPKNKLANDFIMVDRGHCKFTTKANNAQVAHTSAVLIINNQKELYKM  144

Query  586  VCEKNETD  609
            VCE +ETD
Sbjct  145  VCEPDETD  152



>sp|Q53P98.1|SIPL2_ORYSJ RecName: Full=Signal peptide peptidase-like 2; Short=OsSPPL2; 
Flags: Precursor [Oryza sativa Japonica Group]
 gb|AAX92993.1| signal peptide peptidase, putative [Oryza sativa Japonica Group]
 gb|ABA93124.1| signal peptide peptidase family protein, expressed [Oryza sativa 
Japonica Group]
 gb|ABG22469.1| signal peptide peptidase family protein, expressed [Oryza sativa 
Japonica Group]
 gb|EEC68091.1| hypothetical protein OsI_35966 [Oryza sativa Indica Group]
 gb|EEE52048.1| hypothetical protein OsJ_33780 [Oryza sativa Japonica Group]
Length=534

 Score =   181 bits (458),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 88/200 (44%), Positives = 122/200 (61%), Gaps = 2/200 (1%)
 Frame = +1

Query  265  PRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRLALADPPDCCS  444
            P   GC N F LVKV  W+NG E    VG+ ARFG ++      A +T   LA+P DCCS
Sbjct  39   PPSPGCSNKFQLVKVKNWVNGTEGTIVVGLSARFGASVPRDIHEAQKTFAVLANPLDCCS  98

Query  445  KPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCEKNETDLDIGI  624
               +KLT    +  RG C+FT KA +A   GA  +L+IN+  EL+KMVC  N+T +++ I
Sbjct  99   NSTSKLTNYIAIAQRGECAFTAKAKIAQTGGAVGLLVINDNEELYKMVCSDNDTSINVTI  158

Query  625  PAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATILCASYWSAWT  804
            P +M+PQ AG+ M   +   + + VQLYSP RPVVD++  FLW+MA+ TI+CAS W+ + 
Sbjct  159  PVVMIPQSAGKKMKGLLDQGARLEVQLYSPNRPVVDLSACFLWIMAIGTIVCASLWTEFV  218

Query  805  AREAAIQQDKLL--KDGSDE  858
            A E   ++   L  KDG + 
Sbjct  219  ACEQVDERYNQLTRKDGPNS  238



>ref|XP_004979231.1| PREDICTED: signal peptide peptidase-like 2-like [Setaria italica]
Length=534

 Score =   179 bits (455),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 89/199 (45%), Positives = 124/199 (62%), Gaps = 2/199 (1%)
 Frame = +1

Query  265  PRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRLALADPPDCCS  444
            PR  GC N F LVKV  W+NG E    VG+ ARFG +L      A ++   LA+P DCCS
Sbjct  39   PRTPGCSNKFQLVKVKNWVNGTEGATVVGLSARFGASLPRDMHEAQKSFAVLANPFDCCS  98

Query  445  KPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCEKNETDLDIGI  624
               +KLT    L  RG C+FT KA  A   GA  +L+IN+  EL+KMVC +N+T +++ +
Sbjct  99   NLTSKLTNSVALATRGECAFTAKAKTAQAGGAVGLLVINDNEELYKMVCSENDTSINVTM  158

Query  625  PAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATILCASYWSAWT  804
            P +M+PQ AG+ + + + + + V VQLYSP RPVV+++  FL +MAV TI+CAS WS + 
Sbjct  159  PVVMIPQSAGKKLKDFLDHGASVEVQLYSPSRPVVELSACFLLIMAVGTIVCASLWSEFV  218

Query  805  AREAAIQQDKLL--KDGSD  855
            A E   ++   L  KDG +
Sbjct  219  ACEQVDERYNQLTRKDGPN  237



>ref|XP_003568960.1| PREDICTED: signal peptide peptidase-like 2 [Brachypodium distachyon]
Length=530

 Score =   176 bits (446),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 92/200 (46%), Positives = 127/200 (64%), Gaps = 2/200 (1%)
 Frame = +1

Query  265  PRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRLALADPPDCCS  444
            P   GC N F LVKV  W+NG E    VG+ ARFG +L      A +T   LA+P DCCS
Sbjct  37   PPSPGCSNKFQLVKVKNWVNGTEGTTVVGLSARFGASLPRNVHEAQKTFSMLANPLDCCS  96

Query  445  KPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCEKNETDLDIGI  624
               +K+T    L  RG C+FT KAN A   GA+ +L+IN+  EL+KMVC +N+T +D+ I
Sbjct  97   NLTSKVTNSIALATRGECAFTAKANNAQAGGAAGLLVINDSEELYKMVCSENDTSIDVTI  156

Query  625  PAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATILCASYWSAWT  804
            P +M+PQ AG+++ + +   ++V VQLYSP RPVVD++  FLW+MAV TI+C+S WS + 
Sbjct  157  PVVMIPQSAGKNLKDFLDQGAIVEVQLYSPNRPVVDLSACFLWIMAVGTIVCSSLWSEFV  216

Query  805  AREAAIQQDKLL--KDGSDE  858
            A E   ++   L  KDG + 
Sbjct  217  ACEQVDERYNQLTRKDGPNS  236



>gb|KCW59889.1| hypothetical protein EUGRSUZ_H02617 [Eucalyptus grandis]
Length=538

 Score =   173 bits (438),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 85/192 (44%), Positives = 121/192 (63%), Gaps = 1/192 (1%)
 Frame = +1

Query  238  DIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRLA  417
            D  + D  AP  A C N+F LVKV +W+NG +     G+ ARFG  L S  ++  +  L 
Sbjct  30   DTSYDDKDAPSSASCRNDFQLVKVKSWVNGSKGKTLNGLSARFGALLPSDAEKGVKLSLV  89

Query  418  LADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCEK  597
            L++P +CCS    +L G   L  RG+C FT KA +A    A+ +L+IN+  ELF+MVC K
Sbjct  90   LSNPANCCSNSSTELKGSIALATRGDCDFTAKAEIAQLESAAGLLVINDDDELFEMVCPK  149

Query  598  NETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATIL  777
            N T ++I IP IM+ + AG S +++++    V + L+SP RP+VD + VFLW+MAV TI+
Sbjct  150  NGTAINISIPVIMITKSAG-STLKSMLVDGRVEILLHSPNRPLVDFSVVFLWMMAVGTIV  208

Query  778  CASYWSAWTARE  813
            CAS WS +TA E
Sbjct  209  CASLWSDFTAAE  220



>ref|XP_010023580.1| PREDICTED: signal peptide peptidase-like 2 [Eucalyptus grandis]
 gb|KCW59890.1| hypothetical protein EUGRSUZ_H02617 [Eucalyptus grandis]
Length=537

 Score =   172 bits (437),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 85/192 (44%), Positives = 121/192 (63%), Gaps = 1/192 (1%)
 Frame = +1

Query  238  DIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRLA  417
            D  + D  AP  A C N+F LVKV +W+NG +     G+ ARFG  L S  ++  +  L 
Sbjct  30   DTSYDDKDAPSSASCRNDFQLVKVKSWVNGSKGKTLNGLSARFGALLPSDAEKGVKLSLV  89

Query  418  LADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCEK  597
            L++P +CCS    +L G   L  RG+C FT KA +A    A+ +L+IN+  ELF+MVC K
Sbjct  90   LSNPANCCSNSSTELKGSIALATRGDCDFTAKAEIAQLESAAGLLVINDDDELFEMVCPK  149

Query  598  NETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATIL  777
            N T ++I IP IM+ + AG S +++++    V + L+SP RP+VD + VFLW+MAV TI+
Sbjct  150  NGTAINISIPVIMITKSAG-STLKSMLVDGRVEILLHSPNRPLVDFSVVFLWMMAVGTIV  208

Query  778  CASYWSAWTARE  813
            CAS WS +TA E
Sbjct  209  CASLWSDFTAAE  220



>ref|XP_008222677.1| PREDICTED: signal peptide peptidase-like 3 [Prunus mume]
Length=538

 Score =   172 bits (436),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/205 (40%), Positives = 130/205 (63%), Gaps = 0/205 (0%)
 Frame = +1

Query  205  LLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLES  384
            L++ S    G D+V   D  P+   C+N +++ KV  W+NG+E   F G GA+FG  L S
Sbjct  14   LIALSLARGGNDMVLDTDSTPKTPSCNNPYLMAKVRNWVNGREAETFEGAGAKFGALLPS  73

Query  385  KEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINN  564
            K++ A +  + +++P + C+   +KL+G   L  RG+C F+ KA +A+  GA A+++IN+
Sbjct  74   KKENAVKLPVVISNPLNGCNTSSSKLSGAIALSARGDCEFSVKAKIAESGGAKALVVIND  133

Query  565  QTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEV  744
               L KM C ++ T L+I I  +M+P+  G+++ ++I +   V + LYSP+RPVVD + V
Sbjct  134  DEGLAKMACPEDSTSLNISIFVVMIPKSNGEALKKSIQDGKKVELLLYSPKRPVVDFSVV  193

Query  745  FLWLMAVATILCASYWSAWTAREAA  819
            FLWLMAV TI+ AS+WS  TA E +
Sbjct  194  FLWLMAVGTIIVASFWSKITAPEKS  218



>ref|XP_003532320.1| PREDICTED: signal peptide peptidase-like 3-like [Glycine max]
Length=530

 Score =   171 bits (432),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 82/185 (44%), Positives = 118/185 (64%), Gaps = 1/185 (1%)
 Frame = +1

Query  265  PRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRLALADPPDCCS  444
            P+   C+N F LVKV  W++G+E   + GV ARFG  L  K   + +T    ADP DCCS
Sbjct  31   PKSESCNNPFQLVKVENWVDGEEGHIYNGVSARFGSVLPEKPDNSVKTPAIFADPLDCCS  90

Query  445  KPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCEKNETDLDIGI  624
               ++L+G   L  RG C FT KA+ A   GA+A+L+IN+  +LF+MVC  N T+ +I I
Sbjct  91   NSTSRLSGSVALCVRGGCDFTVKADFAQSVGATAMLVINDAQDLFEMVCS-NSTEANISI  149

Query  625  PAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATILCASYWSAWT  804
            P +M+ + AGQS+ +++ + S V + LY+P RP+VD +  FLWLM++ TI+CAS WS  T
Sbjct  150  PVVMITKSAGQSLNKSLTSGSKVEILLYAPPRPLVDFSVAFLWLMSIGTIVCASLWSDLT  209

Query  805  AREAA  819
              E +
Sbjct  210  TPEKS  214



>gb|KHN24971.1| Signal peptide peptidase-like 2B [Glycine soja]
Length=530

 Score =   171 bits (432),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 82/185 (44%), Positives = 118/185 (64%), Gaps = 1/185 (1%)
 Frame = +1

Query  265  PRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRLALADPPDCCS  444
            P+   C+N F LVKV  W++G+E   + GV ARFG  L  K   + +T    ADP DCCS
Sbjct  31   PKSESCNNPFQLVKVENWVDGEEGHIYNGVSARFGSVLPEKPDNSVKTPAIFADPLDCCS  90

Query  445  KPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCEKNETDLDIGI  624
               ++L+G   L  RG C FT KA+ A   GA+A+L+IN+  +LF+MVC  N T+ +I I
Sbjct  91   NSTSRLSGSVALCVRGGCDFTVKADFAQSVGATAMLVINDAQDLFEMVCS-NSTEANISI  149

Query  625  PAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATILCASYWSAWT  804
            P +M+ + AGQS+ +++ + S V + LY+P RP+VD +  FLWLM++ TI+CAS WS  T
Sbjct  150  PVVMITKSAGQSLNKSLTSGSKVEILLYAPPRPLVDFSVAFLWLMSIGTIVCASLWSDLT  209

Query  805  AREAA  819
              E +
Sbjct  210  TPEKS  214



>ref|XP_009592079.1| PREDICTED: signal peptide peptidase-like 4 isoform X2 [Nicotiana 
tomentosiformis]
Length=397

 Score =   168 bits (425),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +1

Query  583  MVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMA  762
            MVCE +E D+DIGIPA+MLPQDAG S+IE + N S VSVQLYSP+RP VDVAEVFLWLMA
Sbjct  1    MVCEPDEPDVDIGIPAVMLPQDAGTSLIEFLRNSSAVSVQLYSPKRPTVDVAEVFLWLMA  60

Query  763  VATILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            VATILCASYWSAW+AREAAI+QDK LKDGSD+Y G E T S
Sbjct  61   VATILCASYWSAWSAREAAIEQDKFLKDGSDDYGGKEVTHS  101



>ref|XP_009781593.1| PREDICTED: signal peptide peptidase-like 4 isoform X2 [Nicotiana 
sylvestris]
Length=397

 Score =   168 bits (425),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +1

Query  583  MVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMA  762
            MVCE +E D+DIGIPA+MLPQDAG S+IE + N S VSVQLYSP+RP VDVAEVFLWLMA
Sbjct  1    MVCEPDEPDVDIGIPAVMLPQDAGTSLIEFLRNSSAVSVQLYSPKRPTVDVAEVFLWLMA  60

Query  763  VATILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            VATILCASYWSAW+AREAAI+QDK LKDGSD+Y G E T S
Sbjct  61   VATILCASYWSAWSAREAAIEQDKFLKDGSDDYGGKEVTHS  101



>emb|CDP10362.1| unnamed protein product [Coffea canephora]
Length=542

 Score =   170 bits (431),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 80/203 (39%), Positives = 126/203 (62%), Gaps = 0/203 (0%)
 Frame = +1

Query  205  LLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLES  384
            LL CS++    DI      A   + C+N + LVKV +W+NG E+    G+ A FG  L +
Sbjct  20   LLFCSSIAEADDISRPSPNALNSSSCNNPYRLVKVKSWVNGDEDETLSGISASFGSLLPT  79

Query  385  KEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINN  564
            + ++ ++    +++P   C+   +KL+G  +L  RG+C FTTKA VA   GA+ +LIIN+
Sbjct  80   EAEKGSKLPAVVSNPLSGCTSSTSKLSGSIVLAFRGDCDFTTKAEVAQAQGAAGLLIIND  139

Query  565  QTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEV  744
              +L +M C + +T+L+I IP +M+ +  G+ + +++     V + LYSP RP+VD + V
Sbjct  140  AEDLIEMGCSEKDTNLNITIPVVMISKSGGEVLKQSMSGGHSVEILLYSPNRPIVDFSVV  199

Query  745  FLWLMAVATILCASYWSAWTARE  813
            FLWLMAV T++CAS WS +TA E
Sbjct  200  FLWLMAVGTLVCASLWSEFTASE  222



>ref|XP_009339896.1| PREDICTED: signal peptide peptidase-like 5 isoform X2 [Pyrus 
x bretschneideri]
Length=536

 Score =   170 bits (431),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 88/208 (42%), Positives = 128/208 (62%), Gaps = 1/208 (0%)
 Frame = +1

Query  193  VVLWLLSCSALVHG-GDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFG  369
            V L+ L   +L  G  D+V   D  P    C N +++ KV  W+NG E     G GA+FG
Sbjct  11   VFLFSLIALSLARGEKDMVLDVDSPPDTPSCSNPYLMAKVKNWVNGHEGETIEGAGAKFG  70

Query  370  PTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAI  549
              L SKE++A +  + +++P + CS   +KL+G   L  RG+C F+ KA VA   GA A+
Sbjct  71   ALLPSKEEKAVKLPVVISNPLNGCSASSSKLSGAIALSTRGDCDFSIKAEVAQSGGAKAL  130

Query  550  LIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVV  729
            ++INN+ +L KM C  N T L+I I  +M+P+  G+++ ++I +   V + LYSP+RPVV
Sbjct  131  VVINNEEDLAKMACPDNSTSLNISIFVVMVPKSDGEALKKSIEDGKKVELLLYSPKRPVV  190

Query  730  DVAEVFLWLMAVATILCASYWSAWTARE  813
            D + VFLWLMAV TI+ AS+WS  TA E
Sbjct  191  DYSVVFLWLMAVGTIIVASFWSKITAPE  218



>ref|XP_007222318.1| hypothetical protein PRUPE_ppa003955mg [Prunus persica]
 gb|EMJ23517.1| hypothetical protein PRUPE_ppa003955mg [Prunus persica]
Length=538

 Score =   170 bits (431),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 81/196 (41%), Positives = 124/196 (63%), Gaps = 0/196 (0%)
 Frame = +1

Query  232  GGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTR  411
            G D+V   D  P+   C+N +++ KV  W+NG+E   F G GA+FG  L S+++ A +  
Sbjct  23   GNDMVLDTDSTPKTPSCNNPYLMAKVRNWVNGREAETFEGAGAKFGALLPSEKENAVKLP  82

Query  412  LALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVC  591
            + +++P + C+   +KL+G   L  RG+C F+ KA VA   GA A+++IN+   L KM C
Sbjct  83   VVISNPLNGCNASSSKLSGAIALSARGDCEFSVKAKVAQSGGAKALVVINDDEGLAKMAC  142

Query  592  EKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVAT  771
             ++ T L+I I  +M+P+  G+S+  +I +   V + LYSP+RPVVD + VFLWLMAV T
Sbjct  143  PEDSTSLNISIFVVMIPKSNGESLKNSIQDGKKVELLLYSPKRPVVDFSVVFLWLMAVGT  202

Query  772  ILCASYWSAWTAREAA  819
            I+ AS+WS  TA E +
Sbjct  203  IIVASFWSKITAPEKS  218



>ref|XP_009339895.1| PREDICTED: signal peptide peptidase-like 5 isoform X1 [Pyrus 
x bretschneideri]
Length=538

 Score =   170 bits (431),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 88/208 (42%), Positives = 128/208 (62%), Gaps = 1/208 (0%)
 Frame = +1

Query  193  VVLWLLSCSALVHG-GDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFG  369
            V L+ L   +L  G  D+V   D  P    C N +++ KV  W+NG E     G GA+FG
Sbjct  11   VFLFSLIALSLARGEKDMVLDVDSPPDTPSCSNPYLMAKVKNWVNGHEGETIEGAGAKFG  70

Query  370  PTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAI  549
              L SKE++A +  + +++P + CS   +KL+G   L  RG+C F+ KA VA   GA A+
Sbjct  71   ALLPSKEEKAVKLPVVISNPLNGCSASSSKLSGAIALSTRGDCDFSIKAEVAQSGGAKAL  130

Query  550  LIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVV  729
            ++INN+ +L KM C  N T L+I I  +M+P+  G+++ ++I +   V + LYSP+RPVV
Sbjct  131  VVINNEEDLAKMACPDNSTSLNISIFVVMVPKSDGEALKKSIEDGKKVELLLYSPKRPVV  190

Query  730  DVAEVFLWLMAVATILCASYWSAWTARE  813
            D + VFLWLMAV TI+ AS+WS  TA E
Sbjct  191  DYSVVFLWLMAVGTIIVASFWSKITAPE  218



>gb|EMT00602.1| Signal peptide peptidase-like 2B [Aegilops tauschii]
Length=563

 Score =   170 bits (431),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 92/202 (46%), Positives = 122/202 (60%), Gaps = 0/202 (0%)
 Frame = +1

Query  277  GCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRLALADPPDCCSKPRN  456
            GC+N F LVKV  W+NG +    VG+ ARFG  L      A++T  AL  PPD CS   +
Sbjct  45   GCNNKFQLVKVKNWVNGTQGTTVVGLSARFGSPLPRTINEAHRTFAALTSPPDLCSNSTS  104

Query  457  KLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCEKNETDLDIGIPAIM  636
            KLT    LV RG C FT KA  A  AGA+ ++IIN+  EL+KMVC  N+T L++ IP +M
Sbjct  105  KLTNSIALVARGGCPFTAKAEFAQAAGAAGLVIINDDEELYKMVCGDNDTSLNVTIPVVM  164

Query  637  LPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATILCASYWSAWTAREA  816
            +P  AG+++ + + + + V +QLYSP RPVVD++  FLWLMAV TI+CAS WS + A E 
Sbjct  165  VPHSAGKNLKDLLDHGARVEMQLYSPNRPVVDLSACFLWLMAVGTIVCASLWSEFVACEQ  224

Query  817  AIQQDKLLKDGSDEYCGMEATQ  882
              +    L        G   TQ
Sbjct  225  IDEHYNQLTRQPGPNSGTNNTQ  246



>ref|XP_008387696.1| PREDICTED: signal peptide peptidase-like 5 [Malus domestica]
Length=540

 Score =   170 bits (430),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 83/194 (43%), Positives = 122/194 (63%), Gaps = 0/194 (0%)
 Frame = +1

Query  238  DIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRLA  417
            D+V   D  P    C+N +++ KV  W+NG E     G GA+FG  L SKE++A +  + 
Sbjct  29   DMVLDVDSTPDTPSCNNPYLMAKVKNWVNGHEGETIEGAGAKFGALLPSKEEKAVKLPVV  88

Query  418  LADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCEK  597
            +++P + CS   +KL+G   L  RG+C F+ KA VA   GA A+++INN  EL KM C  
Sbjct  89   ISNPLNGCSASSSKLSGAIALSTRGDCDFSVKAKVAQSGGAKALVVINNDEELAKMACPD  148

Query  598  NETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATIL  777
            N T L+I I  +M+P+  G+++ ++I +   V + LYSP+RPVVD + VFLWLMAV TI+
Sbjct  149  NSTSLNISIFVVMVPKSDGEALKKSIEDGKKVELLLYSPKRPVVDYSVVFLWLMAVGTII  208

Query  778  CASYWSAWTAREAA  819
             AS+WS  TA + +
Sbjct  209  VASFWSKITAPDKS  222



>gb|EPS70425.1| hypothetical protein M569_04337, partial [Genlisea aurea]
Length=114

 Score =   159 bits (401),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 89/111 (80%), Gaps = 0/111 (0%)
 Frame = +1

Query  238  DIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRLA  417
            DIVH DD  PRR GC+NNFVLVK+  W+ GKE  EFVG+ ARFG T E+KEKR++QTR++
Sbjct  4    DIVHRDDATPRRPGCENNFVLVKIPVWVEGKEVHEFVGMNARFGITTETKEKRSDQTRVS  63

Query  418  LADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQT  570
            L++P DCCS P N+++GE ILVHRG CSF  KA +A+ AGAS +LIIN++T
Sbjct  64   LSEPSDCCSIPTNQISGEVILVHRGGCSFLQKAQMAEAAGASGLLIINSET  114



>dbj|BAJ93677.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=534

 Score =   168 bits (426),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 93/209 (44%), Positives = 124/209 (59%), Gaps = 3/209 (1%)
 Frame = +1

Query  256  DVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRLALADPPD  435
            D +P   GC N F LVKV  W+NG E M  VG+ ARFG TL      A +    L +P D
Sbjct  40   DASP---GCSNKFQLVKVKNWVNGSEGMTVVGLSARFGATLPRTVNEAQRASAVLTNPLD  96

Query  436  CCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCEKNETDLD  615
            CCS   +KLT    L  RG C FT KA  A  AGA+ ++IIN+  EL+KMVC  N+T ++
Sbjct  97   CCSNITSKLTNSIALATRGGCPFTAKAEFAQAAGAAGLIIINDDEELYKMVCGDNDTSIN  156

Query  616  IGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATILCASYWS  795
            + IP IM+P  AG+++  ++ + + V +QLYSP RPVVD++  FL +MAV TI+CAS WS
Sbjct  157  VTIPVIMIPHSAGKNLKYSLDHGARVEMQLYSPSRPVVDLSACFLLIMAVGTIVCASLWS  216

Query  796  AWTAREAAIQQDKLLKDGSDEYCGMEATQ  882
             + A E   +Q   L        G  +TQ
Sbjct  217  EFVACEQIDEQYNQLTRQPGPNSGTNSTQ  245



>gb|KHN12587.1| Signal peptide peptidase-like 2B [Glycine soja]
Length=530

 Score =   167 bits (422),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 82/185 (44%), Positives = 116/185 (63%), Gaps = 1/185 (1%)
 Frame = +1

Query  265  PRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRLALADPPDCCS  444
            P+   C+N F LVKV +W++G+E     GV ARFG  L  K  ++ +T    A+P DCCS
Sbjct  31   PKSESCNNPFQLVKVESWVDGEEGHVHNGVSARFGSVLPDKPDKSVRTPAIFANPIDCCS  90

Query  445  KPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCEKNETDLDIGI  624
               +KL+G   L  RG C FT KA  A    A+AIL+IN+  +LF+MVC  N ++ +I I
Sbjct  91   NSTSKLSGSVALCVRGGCDFTVKAYFAQSGAATAILVINDSQDLFEMVCS-NSSEANISI  149

Query  625  PAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATILCASYWSAWT  804
            P +M+ + AGQS+ ++  + S V + LY+P RP+VD +  FLWLM+V TI+CAS WS  T
Sbjct  150  PVVMIAKSAGQSLNKSFTSGSKVEILLYAPPRPLVDFSVAFLWLMSVGTIVCASLWSDLT  209

Query  805  AREAA  819
              E +
Sbjct  210  TPEKS  214



>ref|XP_003552754.1| PREDICTED: signal peptide peptidase-like 3-like [Glycine max]
Length=530

 Score =   167 bits (422),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 82/185 (44%), Positives = 116/185 (63%), Gaps = 1/185 (1%)
 Frame = +1

Query  265  PRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRLALADPPDCCS  444
            P+   C+N F LVKV +W++G+E     GV ARFG  L  K  ++ +T    A+P DCCS
Sbjct  31   PKSESCNNPFQLVKVESWVDGEEGHVHNGVSARFGSVLPDKPDKSVRTPAIFANPIDCCS  90

Query  445  KPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCEKNETDLDIGI  624
               +KL+G   L  RG C FT KA  A    A+AIL+IN+  +LF+MVC  N ++ +I I
Sbjct  91   NSTSKLSGSVALCVRGGCDFTVKAYFAQSGAATAILVINDSQDLFEMVCS-NSSEANISI  149

Query  625  PAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATILCASYWSAWT  804
            P +M+ + AGQS+ ++  + S V + LY+P RP+VD +  FLWLM+V TI+CAS WS  T
Sbjct  150  PVVMIAKSAGQSLNKSFTSGSKVEILLYAPPRPLVDFSVAFLWLMSVGTIVCASLWSDLT  209

Query  805  AREAA  819
              E +
Sbjct  210  TPEKS  214



>ref|XP_007139105.1| hypothetical protein PHAVU_008G001700g [Phaseolus vulgaris]
 gb|ESW11099.1| hypothetical protein PHAVU_008G001700g [Phaseolus vulgaris]
Length=532

 Score =   166 bits (421),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/196 (42%), Positives = 119/196 (61%), Gaps = 1/196 (1%)
 Frame = +1

Query  232  GGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTR  411
            G D    D  AP+   C+N F LVKV  WI+G E   + GV ARFG  L  K + + +T 
Sbjct  24   GDDAKRDDQRAPKSQSCNNPFQLVKVENWIDGVEGRIYNGVTARFGTLLPQKPENSVRTP  83

Query  412  LALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVC  591
               ++P DCCS   +KL+G   L  RG C FT KA  A   GA+ +L+IN+  +LF+MVC
Sbjct  84   AIFSNPVDCCSNSTSKLSGSVALCMRGGCDFTVKAEFAQSGGATGMLVINDAEDLFEMVC  143

Query  592  EKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVAT  771
              N ++ +I IP +M+ + AG+ + +++++   V + LY+P RP+VD +  FLWLM+V T
Sbjct  144  S-NSSEANISIPVVMITKSAGEGLNKSLISGRKVEILLYAPPRPLVDFSVAFLWLMSVGT  202

Query  772  ILCASYWSAWTAREAA  819
            I+CAS WS  T  E +
Sbjct  203  IVCASLWSDLTTPEKS  218



>ref|XP_010326969.1| PREDICTED: signal peptide peptidase-like 4 isoform X2 [Solanum 
lycopersicum]
Length=397

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 87/101 (86%), Gaps = 0/101 (0%)
 Frame = +1

Query  583  MVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMA  762
            MVC+  E+D+DIGIPA+MLPQDAG S+IE + N S VSVQ+YSP+RP VDVAEVFLWLM+
Sbjct  1    MVCDPGESDVDIGIPAVMLPQDAGTSLIEFLRNSSTVSVQMYSPKRPAVDVAEVFLWLMS  60

Query  763  VATILCASYWSAWTAREAAIQQDKLLKDGSDEYCGMEATQS  885
            V TILCASYWSAW+AREAAI+QDK LKDGSD+Y G E T S
Sbjct  61   VVTILCASYWSAWSAREAAIEQDKFLKDGSDDYGGKEVTHS  101



>ref|XP_008381462.1| PREDICTED: signal peptide peptidase-like 3 [Malus domestica]
Length=538

 Score =   166 bits (420),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/192 (42%), Positives = 121/192 (63%), Gaps = 0/192 (0%)
 Frame = +1

Query  238  DIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRLA  417
            D+V   D  P    C+N +++ KV  W+NG++     G GA+FG  L SKE++A +  + 
Sbjct  27   DMVLDVDSTPSTPSCNNPYLMAKVKNWVNGRKGETIQGAGAKFGALLPSKEEKAVRLPVV  86

Query  418  LADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCEK  597
            +++P + CS   +KL G   L  RG+C F+ KA VA   GA A+L++NN+ EL KM C  
Sbjct  87   ISNPLNGCSVSSSKLFGAIALSTRGDCDFSVKAEVAQSGGAKALLVLNNEEELAKMGCPD  146

Query  598  NETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATIL  777
            N T L+I I  +M+P+  G+++ ++I +   V + LYSP+RPVVD + +FLWLMA+ TI+
Sbjct  147  NSTSLNISIFVVMVPKSDGEALKKSIEDGKKVELLLYSPKRPVVDYSVMFLWLMAIGTII  206

Query  778  CASYWSAWTARE  813
             AS+W   TA E
Sbjct  207  IASFWLKITAPE  218



>dbj|BAE71293.1| hypothetical protein [Trifolium pratense]
Length=537

 Score =   166 bits (419),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 80/192 (42%), Positives = 119/192 (62%), Gaps = 1/192 (1%)
 Frame = +1

Query  238  DIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGARFGPTLESKEKRANQTRLA  417
            D+   DD AP+   C+N F LVKV  W++G E +   G+ ARFG +L  K   + +TR+ 
Sbjct  29   DVKRDDDRAPKSKSCNNPFQLVKVKNWVDGDEAITHSGMTARFGSSLPEKADNSVRTRVL  88

Query  418  LADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGASAILIINNQTELFKMVCEK  597
             ++P DCCS   ++L+    L  RG C F  KA +A   GA+A+LIIN+Q +L +MVC  
Sbjct  89   FSNPTDCCSPSTSQLSDSVALCVRGGCDFQIKATIAQSGGATAVLIINDQEDLVEMVCS-  147

Query  598  NETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRRPVVDVAEVFLWLMAVATIL  777
            + T+ +I IP +M+ + AG+++  ++     V V LY+P RP+VD +  FLWL++V TI+
Sbjct  148  DTTEANISIPVVMITKSAGEALNASLTTGKRVEVLLYAPPRPLVDFSVAFLWLVSVGTIV  207

Query  778  CASYWSAWTARE  813
            CAS WS  T  E
Sbjct  208  CASLWSDITTPE  219



>gb|KJB30042.1| hypothetical protein B456_005G128500 [Gossypium raimondii]
Length=534

 Score =   165 bits (418),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 85/211 (40%), Positives = 124/211 (59%), Gaps = 2/211 (1%)
 Frame = +1

Query  181  VPTAVVLWLLSCSALVHGGDIVHHDDVAPRRAGCDNNFVLVKVATWINGKEEMEFVGVGA  360
            V   ++L + S  A+V   D    DD  P    C+N F LVKV  W++G E  +  G+ A
Sbjct  13   VSFPLLLLVTSSFAVVATADGASQDD-GPELPACNNPFKLVKVKIWVDGVEGEDLSGITA  71

Query  361  RFGPTLESKEKRANQTRLALADPPDCCSKPRNKLTGEAILVHRGNCSFTTKANVADDAGA  540
             FG +L  +  ++++     ++P + CS   +KLTG   L  RG+C F TKA VA   GA
Sbjct  72   SFGASLPEEANKSSKLPTVFSNPLNGCSNSSSKLTGSVALSIRGDCDFVTKAKVAQSGGA  131

Query  541  SAILIINNQTELFKMVCEKNETDLDIGIPAIMLPQDAGQSMIENIMNKSMVSVQLYSPRR  720
            SA+L+IN+  EL+KMVC +N+T L+I IP +M+P+ AG + I   M +  V   LY+P R
Sbjct  132  SALLVINDNEELYKMVCSENDTSLNISIPVVMIPKSAGDA-INKSMEEKHVEFLLYAPTR  190

Query  721  PVVDVAEVFLWLMAVATILCASYWSAWTARE  813
            P+VD + +FLW +AV TI+ AS W  +   E
Sbjct  191  PIVDFSVIFLWALAVGTIVTASLWQEFGTSE  221



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2018536237851