BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig2146

Length=805
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KCW66680.1|  hypothetical protein EUGRSUZ_F00453                     228   6e-68   Eucalyptus grandis [rose gum]
ref|XP_010060129.1|  PREDICTED: CBL-interacting serine/threonine-...    228   7e-68   Eucalyptus grandis [rose gum]
gb|KDO81283.1|  hypothetical protein CISIN_1g022444mg                   221   9e-68   Citrus sinensis [apfelsine]
ref|XP_010060127.1|  PREDICTED: CBL-interacting serine/threonine-...    228   9e-68   Eucalyptus grandis [rose gum]
gb|KCW66679.1|  hypothetical protein EUGRSUZ_F00453                     228   1e-67   Eucalyptus grandis [rose gum]
ref|XP_010060128.1|  PREDICTED: CBL-interacting serine/threonine-...    228   1e-67   Eucalyptus grandis [rose gum]
ref|XP_007018318.1|  CBL-interacting protein kinase 8 isoform 4         224   1e-67   
ref|XP_003526526.1|  PREDICTED: CBL-interacting serine/threonine-...    227   3e-67   Glycine max [soybeans]
ref|XP_004238031.1|  PREDICTED: CBL-interacting serine/threonine-...    226   5e-67   Solanum lycopersicum
ref|XP_004490474.1|  PREDICTED: CBL-interacting serine/threonine-...    224   5e-67   
ref|XP_009615545.1|  PREDICTED: CBL-interacting serine/threonine-...    225   6e-67   Nicotiana tomentosiformis
gb|KDO81282.1|  hypothetical protein CISIN_1g022444mg                   221   6e-67   Citrus sinensis [apfelsine]
ref|XP_006364978.1|  PREDICTED: CBL-interacting serine/threonine-...    226   7e-67   Solanum tuberosum [potatoes]
ref|XP_009615544.1|  PREDICTED: CBL-interacting serine/threonine-...    226   9e-67   Nicotiana tomentosiformis
gb|EPS71316.1|  hypothetical protein M569_03446                         217   1e-66   Genlisea aurea
ref|XP_009790125.1|  PREDICTED: CBL-interacting serine/threonine-...    224   1e-66   Nicotiana sylvestris
ref|XP_002527344.1|  CBL-interacting serine/threonine-protein kin...    225   1e-66   Ricinus communis
gb|KEH28131.1|  CBL-interacting kinase                                  223   1e-66   Medicago truncatula
ref|XP_007018317.1|  CBL-interacting protein kinase 8 isoform 3         224   1e-66   
ref|XP_012068077.1|  PREDICTED: CBL-interacting serine/threonine-...    225   1e-66   Jatropha curcas
ref|XP_009615543.1|  PREDICTED: CBL-interacting serine/threonine-...    225   1e-66   Nicotiana tomentosiformis
ref|XP_011074289.1|  PREDICTED: CBL-interacting serine/threonine-...    225   2e-66   Sesamum indicum [beniseed]
ref|XP_004490472.1|  PREDICTED: CBL-interacting serine/threonine-...    224   2e-66   Cicer arietinum [garbanzo]
ref|XP_007018315.1|  CBL-interacting protein kinase 8 isoform 1         224   2e-66   
ref|XP_008352722.1|  PREDICTED: CBL-interacting serine/threonine-...    224   2e-66   Malus domestica [apple tree]
ref|XP_007018316.1|  CBL-interacting protein kinase 8 isoform 2         224   2e-66   
ref|XP_008352723.1|  PREDICTED: CBL-interacting serine/threonine-...    224   2e-66   Malus domestica [apple tree]
ref|XP_009790122.1|  PREDICTED: CBL-interacting serine/threonine-...    225   2e-66   Nicotiana sylvestris
ref|XP_009790124.1|  PREDICTED: CBL-interacting serine/threonine-...    224   2e-66   Nicotiana sylvestris
ref|XP_009790121.1|  PREDICTED: CBL-interacting serine/threonine-...    225   3e-66   Nicotiana sylvestris
ref|XP_009790123.1|  PREDICTED: CBL-interacting serine/threonine-...    224   3e-66   Nicotiana sylvestris
gb|KEH28132.1|  CBL-interacting kinase                                  223   3e-66   Medicago truncatula
gb|KHN08228.1|  CBL-interacting serine/threonine-protein kinase 8       223   3e-66   Glycine soja [wild soybean]
ref|XP_003519209.1|  PREDICTED: CBL-interacting serine/threonine-...    224   4e-66   Glycine max [soybeans]
ref|XP_004287407.1|  PREDICTED: CBL-interacting serine/threonine-...    224   4e-66   Fragaria vesca subsp. vesca
ref|XP_003522743.1|  PREDICTED: CBL-interacting serine/threonine-...    224   4e-66   Glycine max [soybeans]
ref|XP_007137664.1|  hypothetical protein PHAVU_009G145400g             224   5e-66   Phaseolus vulgaris [French bean]
ref|XP_007137665.1|  hypothetical protein PHAVU_009G145400g             223   5e-66   Phaseolus vulgaris [French bean]
gb|AFK34091.1|  unknown                                                 223   5e-66   Lotus japonicus
ref|XP_009366378.1|  PREDICTED: CBL-interacting serine/threonine-...    223   6e-66   Pyrus x bretschneideri [bai li]
ref|XP_008357566.1|  PREDICTED: CBL-interacting serine/threonine-...    223   6e-66   
ref|XP_008357565.1|  PREDICTED: CBL-interacting serine/threonine-...    223   6e-66   
ref|XP_008378623.1|  PREDICTED: CBL-interacting serine/threonine-...    223   6e-66   
ref|XP_008378622.1|  PREDICTED: CBL-interacting serine/threonine-...    223   7e-66   
ref|XP_009366377.1|  PREDICTED: CBL-interacting serine/threonine-...    223   7e-66   Pyrus x bretschneideri [bai li]
gb|AES98330.2|  CBL-interacting kinase                                  223   7e-66   Medicago truncatula
ref|XP_006433759.1|  hypothetical protein CICLE_v10001147mg             223   8e-66   Citrus clementina [clementine]
ref|XP_008219188.1|  PREDICTED: CBL-interacting serine/threonine-...    223   1e-65   Prunus mume [ume]
gb|EYU36430.1|  hypothetical protein MIMGU_mgv1a006373mg                223   1e-65   Erythranthe guttata [common monkey flower]
gb|KJB64073.1|  hypothetical protein B456_010G032200                    222   1e-65   Gossypium raimondii
ref|XP_008219189.1|  PREDICTED: CBL-interacting serine/threonine-...    223   1e-65   Prunus mume [ume]
ref|XP_003615372.1|  CBL-interacting protein kinase                     223   1e-65   
ref|XP_009396330.1|  PREDICTED: CBL-interacting protein kinase 8 ...    220   1e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007227712.1|  hypothetical protein PRUPE_ppa005163mg             223   2e-65   
ref|XP_006386453.1|  hypothetical protein POPTR_0002s10970g             221   2e-65   
gb|KHG16968.1|  CBL-interacting serine/threonine-protein kinase 8       222   2e-65   Gossypium arboreum [tree cotton]
gb|KJB64072.1|  hypothetical protein B456_010G032200                    222   2e-65   Gossypium raimondii
ref|XP_011016974.1|  PREDICTED: CBL-interacting serine/threonine-...    222   2e-65   Populus euphratica
ref|XP_002301109.2|  hypothetical protein POPTR_0002s10970g             222   2e-65   Populus trichocarpa [western balsam poplar]
gb|AFO10125.1|  CIPK                                                    222   3e-65   Gossypium aridum
gb|KHG19822.1|  CBL-interacting serine/threonine-protein kinase 8       221   5e-65   Gossypium arboreum [tree cotton]
gb|KJB58803.1|  hypothetical protein B456_009G226900                    221   5e-65   Gossypium raimondii
gb|KJB58806.1|  hypothetical protein B456_009G226900                    221   5e-65   Gossypium raimondii
gb|KJB58804.1|  hypothetical protein B456_009G226900                    220   6e-65   Gossypium raimondii
ref|XP_010254634.1|  PREDICTED: CBL-interacting serine/threonine-...    221   7e-65   Nelumbo nucifera [Indian lotus]
ref|XP_009396329.1|  PREDICTED: CBL-interacting protein kinase 8 ...    220   7e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009396326.1|  PREDICTED: CBL-interacting protein kinase 8 ...    220   7e-65   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP00953.1|  unnamed protein product                                220   1e-64   Coffea canephora [robusta coffee]
ref|XP_006472400.1|  PREDICTED: CBL-interacting serine/threonine-...    220   1e-64   Citrus sinensis [apfelsine]
ref|XP_004148410.1|  PREDICTED: CBL-interacting serine/threonine-...    219   3e-64   Cucumis sativus [cucumbers]
ref|XP_008444962.1|  PREDICTED: CBL-interacting serine/threonine-...    219   4e-64   Cucumis melo [Oriental melon]
dbj|BAD95890.1|  Ser/Thr protein kinase                                 218   5e-64   Lotus japonicus
ref|XP_010664075.1|  PREDICTED: CBL-interacting serine/threonine-...    218   8e-64   Vitis vinifera
emb|CBI19308.3|  unnamed protein product                                218   1e-63   Vitis vinifera
ref|XP_007141302.1|  hypothetical protein PHAVU_008G184400g             217   1e-63   Phaseolus vulgaris [French bean]
ref|XP_008778476.1|  PREDICTED: CBL-interacting serine/threonine-...    211   2e-63   
ref|XP_010519151.1|  PREDICTED: CBL-interacting serine/threonine-...    215   7e-63   Tarenaya hassleriana [spider flower]
ref|XP_010519152.1|  PREDICTED: CBL-interacting serine/threonine-...    215   8e-63   
ref|XP_010520824.1|  PREDICTED: CBL-interacting serine/threonine-...    214   1e-62   Tarenaya hassleriana [spider flower]
ref|XP_010671024.1|  PREDICTED: CBL-interacting serine/threonine-...    215   1e-62   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006856630.1|  PREDICTED: CBL-interacting protein kinase 8 ...    215   1e-62   Amborella trichopoda
ref|XP_010671031.1|  PREDICTED: CBL-interacting serine/threonine-...    215   1e-62   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010520822.1|  PREDICTED: CBL-interacting serine/threonine-...    214   1e-62   Tarenaya hassleriana [spider flower]
gb|EMT28938.1|  CBL-interacting protein kinase 8                        205   7e-62   
ref|XP_010924073.1|  PREDICTED: CBL-interacting protein kinase 8 ...    212   8e-62   
ref|XP_010924071.1|  PREDICTED: CBL-interacting protein kinase 8 ...    212   1e-61   Elaeis guineensis
gb|KFK26443.1|  hypothetical protein AALP_AA8G249200                    212   1e-61   Arabis alpina [alpine rockcress]
gb|KHN09031.1|  CBL-interacting serine/threonine-protein kinase 8       213   1e-61   Glycine soja [wild soybean]
ref|XP_010924072.1|  PREDICTED: CBL-interacting protein kinase 8 ...    212   1e-61   Elaeis guineensis
gb|KFK26444.1|  hypothetical protein AALP_AA8G249200                    212   1e-61   Arabis alpina [alpine rockcress]
ref|NP_001291255.1|  CBL-interacting serine/threonine-protein kin...    212   2e-61   Populus euphratica
ref|XP_011017771.1|  PREDICTED: CBL-interacting serine/threonine-...    212   2e-61   Populus euphratica
emb|CDM83002.1|  unnamed protein product                                209   3e-61   Triticum aestivum [Canadian hard winter wheat]
ref|XP_011627891.1|  PREDICTED: CBL-interacting protein kinase 8 ...    210   6e-61   Amborella trichopoda
ref|XP_010250123.1|  PREDICTED: CBL-interacting serine/threonine-...    209   2e-60   Nelumbo nucifera [Indian lotus]
ref|NP_001078442.1|  CBL-interacting serine/threonine-protein kin...    207   6e-60   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001043259.1|  Os01g0536000                                       207   6e-60   
ref|XP_003569165.1|  PREDICTED: CBL-interacting protein kinase 8        207   8e-60   Brachypodium distachyon [annual false brome]
ref|NP_194171.1|  CBL-interacting serine/threonine-protein kinase 8     207   1e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006413437.1|  hypothetical protein EUTSA_v10025204mg             207   1e-59   Eutrema salsugineum [saltwater cress]
ref|XP_002869721.1|  cbl-interacting protein kinase 8                   207   1e-59   Arabidopsis lyrata subsp. lyrata
dbj|BAK07603.1|  predicted protein                                      207   1e-59   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002976133.1|  hypothetical protein SELMODRAFT_175338             207   1e-59   
gb|EYU36431.1|  hypothetical protein MIMGU_mgv1a006373mg                206   1e-59   Erythranthe guttata [common monkey flower]
tpg|DAA52653.1|  TPA: putative CBL-interacting protein kinase fam...    204   1e-59   
gb|AJR22392.1|  CBL-interacting protein kinase 8                        207   2e-59   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002968247.1|  hypothetical protein SELMODRAFT_267186             207   2e-59   
ref|XP_004971907.1|  PREDICTED: CBL-interacting protein kinase 8-...    207   2e-59   
emb|CDY68878.1|  BnaA01g35110D                                          206   3e-59   Brassica napus [oilseed rape]
ref|XP_002324651.1|  CBL-interacting protein kinase 24                  205   4e-59   Populus trichocarpa [western balsam poplar]
gb|AGA37211.1|  CBL-interacting protein kinase 8.1                      206   4e-59   Brassica napus [oilseed rape]
emb|CDP10421.1|  unnamed protein product                                197   5e-59   Coffea canephora [robusta coffee]
tpg|DAA52654.1|  TPA: putative CBL-interacting protein kinase fam...    204   6e-59   
ref|XP_010439044.1|  PREDICTED: CBL-interacting serine/threonine-...    205   7e-59   Camelina sativa [gold-of-pleasure]
ref|XP_010433771.1|  PREDICTED: CBL-interacting serine/threonine-...    205   8e-59   Camelina sativa [gold-of-pleasure]
ref|XP_006283734.1|  hypothetical protein CARUB_v10004806mg             204   8e-59   Capsella rubella
ref|XP_010448567.1|  PREDICTED: CBL-interacting serine/threonine-...    204   8e-59   Camelina sativa [gold-of-pleasure]
gb|AGY49229.1|  CBL-interacting protein kinase 6                        204   1e-58   Physcomitrella patens
ref|XP_009138030.1|  PREDICTED: CBL-interacting serine/threonine-...    204   2e-58   Brassica rapa
ref|NP_001268130.1|  CBL-interacting serine/threonine-protein kin...    202   8e-58   Vitis vinifera
ref|XP_011078405.1|  PREDICTED: CBL-interacting serine/threonine-...    202   8e-58   Sesamum indicum [beniseed]
gb|ABK25058.1|  unknown                                                 202   9e-58   Picea sitchensis
tpg|DAA52657.1|  TPA: LOW QUALITY PROTEIN: putative CBL-interacti...    204   9e-58   
gb|AIZ68215.1|  CBL-interacting protein kinase 09-like protein          201   1e-57   Ornithogalum longebracteatum [sea-onion]
gb|EYU23009.1|  hypothetical protein MIMGU_mgv1a0074942mg               196   2e-57   Erythranthe guttata [common monkey flower]
tpg|DAA59081.1|  TPA: putative CBL-interacting protein kinase fam...    201   2e-57   
ref|NP_001168497.1|  uncharacterized LOC100382276                       201   2e-57   Zea mays [maize]
ref|XP_002308077.2|  CBL-interacting protein kinase 24                  200   3e-57   
gb|ABJ91233.1|  CBL-interacting protein kinase 27                       200   3e-57   Populus trichocarpa [western balsam poplar]
ref|XP_010656044.1|  PREDICTED: CBL-interacting protein kinase 09...    200   4e-57   Vitis vinifera
ref|NP_001268145.1|  CBL-interacting protein kinase 09                  200   4e-57   Vitis vinifera
ref|XP_006645971.1|  PREDICTED: CBL-interacting protein kinase 8-...    199   6e-57   
ref|XP_002524508.1|  CBL-interacting serine/threonine-protein kin...    200   6e-57   Ricinus communis
ref|XP_001776382.1|  predicted protein                                  199   9e-57   
emb|CDY03449.1|  BnaC01g16330D                                          199   1e-56   
ref|XP_004287304.1|  PREDICTED: CBL-interacting serine/threonine-...    198   3e-56   Fragaria vesca subsp. vesca
gb|KDO80232.1|  hypothetical protein CISIN_1g013421mg                   196   4e-56   Citrus sinensis [apfelsine]
ref|XP_010533153.1|  PREDICTED: CBL-interacting serine/threonine-...    197   6e-56   Tarenaya hassleriana [spider flower]
gb|KDO80231.1|  hypothetical protein CISIN_1g013421mg                   196   8e-56   Citrus sinensis [apfelsine]
ref|XP_006450913.1|  hypothetical protein CICLE_v10008418mg             196   8e-56   Citrus clementina [clementine]
ref|XP_007013469.1|  Salt overly sensitive protein 2a isoform 1         196   9e-56   
ref|XP_007013472.1|  Salt overly sensitive protein 2a isoform 4         196   9e-56   
ref|XP_008242780.1|  PREDICTED: CBL-interacting serine/threonine-...    196   1e-55   
ref|XP_006475856.1|  PREDICTED: CBL-interacting serine/threonine-...    196   1e-55   Citrus sinensis [apfelsine]
gb|KDO80230.1|  hypothetical protein CISIN_1g013421mg                   196   1e-55   Citrus sinensis [apfelsine]
ref|XP_011020139.1|  PREDICTED: CBL-interacting serine/threonine-...    194   2e-55   Populus euphratica
ref|XP_011020140.1|  PREDICTED: CBL-interacting serine/threonine-...    194   2e-55   Populus euphratica
ref|XP_010047960.1|  PREDICTED: CBL-interacting serine/threonine-...    196   2e-55   
ref|XP_007202049.1|  hypothetical protein PRUPE_ppa005741mg             196   2e-55   Prunus persica
ref|XP_010047958.1|  PREDICTED: CBL-interacting serine/threonine-...    196   2e-55   
ref|XP_011020138.1|  PREDICTED: CBL-interacting serine/threonine-...    194   2e-55   Populus euphratica
ref|XP_011622470.1|  PREDICTED: CBL-interacting serine/threonine-...    194   2e-55   Amborella trichopoda
ref|XP_011020137.1|  PREDICTED: CBL-interacting serine/threonine-...    194   3e-55   Populus euphratica
gb|KCW80000.1|  hypothetical protein EUGRSUZ_C01333                     197   4e-55   Eucalyptus grandis [rose gum]
gb|KCW79999.1|  hypothetical protein EUGRSUZ_C01333                     197   4e-55   Eucalyptus grandis [rose gum]
ref|XP_011020135.1|  PREDICTED: CBL-interacting serine/threonine-...    194   6e-55   Populus euphratica
ref|XP_006842063.1|  PREDICTED: CBL-interacting protein kinase 24...    194   7e-55   Amborella trichopoda
ref|XP_011622468.1|  PREDICTED: CBL-interacting serine/threonine-...    194   7e-55   
ref|XP_012078806.1|  PREDICTED: CBL-interacting protein kinase 24...    194   1e-54   Jatropha curcas
gb|ACQ83515.1|  CBL-interacting protein kinase 08                       194   2e-54   Sorghum bicolor [broomcorn]
gb|KJB64753.1|  hypothetical protein B456_010G063300                    190   2e-54   Gossypium raimondii
ref|XP_006345226.1|  PREDICTED: CBL-interacting serine/threonine-...    192   3e-54   Solanum tuberosum [potatoes]
gb|KJB64754.1|  hypothetical protein B456_010G063300                    191   4e-54   Gossypium raimondii
gb|KJB64759.1|  hypothetical protein B456_010G063300                    191   4e-54   Gossypium raimondii
ref|XP_012078803.1|  PREDICTED: CBL-interacting serine/threonine-...    192   4e-54   Jatropha curcas
ref|NP_001291227.1|  CBL-interacting serine/threonine-protein kin...    192   4e-54   Populus euphratica
ref|XP_010907284.1|  PREDICTED: CBL-interacting protein kinase 24...    190   9e-54   
gb|KJB64755.1|  hypothetical protein B456_010G063300                    190   9e-54   Gossypium raimondii
gb|KJB64749.1|  hypothetical protein B456_010G063300                    191   1e-53   Gossypium raimondii
gb|KJB64756.1|  hypothetical protein B456_010G063300                    190   1e-53   Gossypium raimondii
gb|KJB64758.1|  hypothetical protein B456_010G063300                    191   1e-53   Gossypium raimondii
gb|KJB64751.1|  hypothetical protein B456_010G063300                    191   1e-53   Gossypium raimondii
ref|XP_010907283.1|  PREDICTED: CBL-interacting protein kinase 24...    190   2e-53   Elaeis guineensis
ref|NP_001241229.1|  uncharacterized protein LOC100784566               186   2e-53   Glycine max [soybeans]
ref|XP_008443989.1|  PREDICTED: CBL-interacting serine/threonine-...    190   2e-53   Cucumis melo [Oriental melon]
ref|XP_010907282.1|  PREDICTED: CBL-interacting protein kinase 24...    190   2e-53   Elaeis guineensis
gb|ACN41002.1|  unknown                                                 186   3e-53   Picea sitchensis
ref|NP_001234210.1|  calcineurin B-like interacting protein kinase      190   3e-53   Solanum lycopersicum
ref|XP_009788220.1|  PREDICTED: CBL-interacting serine/threonine-...    190   3e-53   Nicotiana sylvestris
ref|XP_006603707.1|  PREDICTED: uncharacterized protein LOC100784...    186   3e-53   
ref|XP_009607232.1|  PREDICTED: CBL-interacting serine/threonine-...    189   3e-53   Nicotiana tomentosiformis
ref|XP_010450374.1|  PREDICTED: CBL-interacting serine/threonine-...    190   3e-53   Camelina sativa [gold-of-pleasure]
ref|XP_011659824.1|  PREDICTED: CBL-interacting serine/threonine-...    189   4e-53   Cucumis sativus [cucumbers]
ref|XP_010687975.1|  PREDICTED: CBL-interacting serine/threonine-...    190   4e-53   
ref|XP_009607229.1|  PREDICTED: CBL-interacting serine/threonine-...    189   4e-53   Nicotiana tomentosiformis
ref|XP_009625261.1|  PREDICTED: CBL-interacting serine/threonine-...    187   5e-53   Nicotiana tomentosiformis
ref|NP_001280754.1|  son of sevenless homolog 2                         189   5e-53   Malus domestica [apple tree]
ref|XP_008792023.1|  PREDICTED: CBL-interacting protein kinase 24...    188   6e-53   
ref|XP_010687974.1|  PREDICTED: CBL-interacting serine/threonine-...    189   7e-53   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008792021.1|  PREDICTED: CBL-interacting protein kinase 24...    189   7e-53   Phoenix dactylifera
ref|XP_010435433.1|  PREDICTED: CBL-interacting serine/threonine-...    188   1e-52   Camelina sativa [gold-of-pleasure]
ref|XP_009364020.1|  PREDICTED: CBL-interacting serine/threonine-...    188   1e-52   Pyrus x bretschneideri [bai li]
ref|XP_009791398.1|  PREDICTED: CBL-interacting serine/threonine-...    188   2e-52   Nicotiana sylvestris
gb|ADP37983.1|  salt overly sensitive protein 2b                        188   2e-52   Gossypium hirsutum [American cotton]
ref|XP_010440713.1|  PREDICTED: CBL-interacting serine/threonine-...    188   2e-52   Camelina sativa [gold-of-pleasure]
gb|AHW50679.1|  calcineurin B-like interacting protein kinase           187   2e-52   Nicotiana tabacum [American tobacco]
ref|XP_008337394.1|  PREDICTED: CBL-interacting serine/threonine-...    187   2e-52   
ref|XP_006405548.1|  hypothetical protein EUTSA_v10027753mg             188   2e-52   Eutrema salsugineum [saltwater cress]
dbj|BAD95978.1|  Ser/Thr protein kinase                                 187   2e-52   Lotus japonicus
ref|XP_008362901.1|  PREDICTED: CBL-interacting serine/threonine-...    187   3e-52   
ref|XP_009368859.1|  PREDICTED: CBL-interacting serine/threonine-...    187   3e-52   Pyrus x bretschneideri [bai li]
ref|XP_008385538.1|  PREDICTED: CBL-interacting serine/threonine-...    187   3e-52   
gb|KDO66334.1|  hypothetical protein CISIN_1g013407mg                   182   3e-52   Citrus sinensis [apfelsine]
ref|XP_009368863.1|  PREDICTED: CBL-interacting serine/threonine-...    187   3e-52   Pyrus x bretschneideri [bai li]
ref|XP_007015396.1|  CBL-interacting serine/threonine-protein kin...    179   3e-52   
ref|XP_004508487.1|  PREDICTED: CBL-interacting serine/threonine-...    186   5e-52   
gb|KDO66333.1|  hypothetical protein CISIN_1g013407mg                   183   7e-52   Citrus sinensis [apfelsine]
ref|XP_006369417.1|  hypothetical protein POPTR_0001s23030g             181   8e-52   
ref|XP_009368861.1|  PREDICTED: CBL-interacting serine/threonine-...    186   1e-51   Pyrus x bretschneideri [bai li]
ref|XP_003617147.1|  CBL-interacting protein kinase                     183   1e-51   
ref|XP_007141550.1|  hypothetical protein PHAVU_008G205700g             186   1e-51   Phaseolus vulgaris [French bean]
ref|XP_002868418.1|  hypothetical protein ARALYDRAFT_915669             186   2e-51   Arabidopsis lyrata subsp. lyrata
ref|XP_007155013.1|  hypothetical protein PHAVU_003G165700g             185   2e-51   Phaseolus vulgaris [French bean]
emb|CDL67726.1|  Ser/Thr protein kinase                                 185   2e-51   Arachis hypogaea [goober]
ref|XP_006283730.1|  hypothetical protein CARUB_v10004801mg             185   3e-51   
gb|KCW51025.1|  hypothetical protein EUGRSUZ_J00641                     184   3e-51   Eucalyptus grandis [rose gum]
ref|XP_009772992.1|  PREDICTED: CBL-interacting serine/threonine-...    184   3e-51   Nicotiana sylvestris
ref|XP_010541706.1|  PREDICTED: CBL-interacting serine/threonine-...    184   3e-51   Tarenaya hassleriana [spider flower]
ref|XP_010031661.1|  PREDICTED: CBL-interacting protein kinase 32...    184   4e-51   Eucalyptus grandis [rose gum]
ref|XP_006369416.1|  hypothetical protein POPTR_0001s23030g             182   4e-51   
emb|CCH26589.1|  salt overly sensitive 2                                184   4e-51   Arabidopsis thaliana [mouse-ear cress]
pdb|4D28|A  Chain A, Crystal Structure Of The Kinase Domain Of Sn...    184   4e-51   Arabidopsis thaliana [mouse-ear cress]
ref|NP_198391.1|  CBL-interacting serine/threonine-protein kinase 24    184   5e-51   Arabidopsis thaliana [mouse-ear cress]
gb|KDO66332.1|  hypothetical protein CISIN_1g013407mg                   183   5e-51   Citrus sinensis [apfelsine]
gb|KJB35624.1|  hypothetical protein B456_006G121600                    183   5e-51   Gossypium raimondii
gb|KCW51021.1|  hypothetical protein EUGRSUZ_J00641                     184   5e-51   Eucalyptus grandis [rose gum]
ref|XP_007015398.1|  CBL-interacting protein kinase 3 isoform 4         181   5e-51   
ref|XP_004228494.1|  PREDICTED: CBL-interacting serine/threonine-...    184   6e-51   Solanum lycopersicum
ref|XP_010050019.1|  PREDICTED: CBL-interacting serine/threonine-...    184   6e-51   Eucalyptus grandis [rose gum]
ref|XP_006574419.1|  PREDICTED: uncharacterized protein LOC100794...    184   6e-51   Glycine max [soybeans]
ref|XP_006470418.1|  PREDICTED: CBL-interacting serine/threonine-...    184   6e-51   Citrus sinensis [apfelsine]
gb|KJB35620.1|  hypothetical protein B456_006G121600                    183   7e-51   Gossypium raimondii
ref|XP_003617145.1|  CBL-interacting protein kinase                     184   7e-51   Medicago truncatula
ref|XP_003617146.1|  CBL-interacting protein kinase                     183   7e-51   
gb|KJB35622.1|  hypothetical protein B456_006G121600                    183   7e-51   Gossypium raimondii
gb|KDO66326.1|  hypothetical protein CISIN_1g013407mg                   184   7e-51   Citrus sinensis [apfelsine]
gb|KJB09268.1|  hypothetical protein B456_001G132200                    181   8e-51   Gossypium raimondii
gb|KJB35615.1|  hypothetical protein B456_006G121600                    183   9e-51   Gossypium raimondii
ref|XP_009768708.1|  PREDICTED: CBL-interacting serine/threonine-...    183   1e-50   Nicotiana sylvestris
ref|XP_004250885.1|  PREDICTED: CBL-interacting serine/threonine-...    183   1e-50   Solanum lycopersicum
ref|XP_009768703.1|  PREDICTED: CBL-interacting serine/threonine-...    183   1e-50   Nicotiana sylvestris
ref|XP_010251746.1|  PREDICTED: CBL-interacting protein kinase 32       183   1e-50   Nelumbo nucifera [Indian lotus]
dbj|BAD95889.1|  Ser/Thr protein kinase                                 183   1e-50   Lotus japonicus
ref|XP_011080462.1|  PREDICTED: CBL-interacting serine/threonine-...    183   1e-50   Sesamum indicum [beniseed]
ref|XP_003549757.1|  PREDICTED: CBL-interacting protein kinase 24...    183   1e-50   Glycine max [soybeans]
gb|AGA37205.1|  CBL-interacting protein kinase 24.1                     183   1e-50   Brassica napus [oilseed rape]
ref|XP_006356369.1|  PREDICTED: CBL-interacting serine/threonine-...    182   2e-50   Solanum tuberosum [potatoes]
ref|XP_003577877.1|  PREDICTED: CBL-interacting protein kinase 32       182   2e-50   Brachypodium distachyon [annual false brome]
ref|XP_011080461.1|  PREDICTED: CBL-interacting serine/threonine-...    183   2e-50   Sesamum indicum [beniseed]
ref|XP_006446408.1|  hypothetical protein CICLE_v10015272mg             182   2e-50   Citrus clementina [clementine]
ref|XP_008242781.1|  PREDICTED: LOW QUALITY PROTEIN: CBL-interact...    178   2e-50   Prunus mume [ume]
ref|XP_009139958.1|  PREDICTED: CBL-interacting serine/threonine-...    182   2e-50   Brassica rapa
ref|XP_006594268.1|  PREDICTED: CBL-interacting protein kinase 24...    182   3e-50   Glycine max [soybeans]
ref|XP_002532581.1|  CBL-interacting serine/threonine-protein kin...    182   3e-50   
ref|XP_003542672.1|  PREDICTED: CBL-interacting protein kinase 24...    182   3e-50   Glycine max [soybeans]
gb|KHN47144.1|  CBL-interacting protein kinase 24                       182   3e-50   Glycine soja [wild soybean]
emb|CAN70422.1|  hypothetical protein VITISV_010092                     182   3e-50   Vitis vinifera
ref|XP_006369414.1|  hypothetical protein POPTR_0001s23030g             182   3e-50   
ref|XP_009592366.1|  PREDICTED: CBL-interacting serine/threonine-...    182   3e-50   Nicotiana tomentosiformis
ref|NP_001268179.1|  CBL-interacting protein kinase 18                  182   3e-50   Vitis vinifera
gb|ABG21866.1|  CIPK-like protein 1, putative, expressed                179   4e-50   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006362750.1|  PREDICTED: CBL-interacting serine/threonine-...    181   4e-50   Solanum tuberosum [potatoes]
ref|XP_007015397.1|  CBL-interacting protein kinase 3 isoform 3         181   4e-50   Theobroma cacao [chocolate]
gb|KEH32123.1|  CBL-interacting kinase                                  180   4e-50   Medicago truncatula
ref|XP_011008376.1|  PREDICTED: CBL-interacting protein kinase 32...    181   5e-50   Populus euphratica
ref|XP_011008381.1|  PREDICTED: CBL-interacting protein kinase 32...    181   5e-50   Populus euphratica
ref|XP_004977459.1|  PREDICTED: CBL-interacting protein kinase 32...    181   5e-50   Setaria italica
gb|KHN26015.1|  CBL-interacting serine/threonine-protein kinase 3       181   5e-50   Glycine soja [wild soybean]
emb|CDP09658.1|  unnamed protein product                                181   6e-50   Coffea canephora [robusta coffee]
ref|XP_007015399.1|  CBL-interacting serine/threonine-protein kin...    181   6e-50   
gb|EMS64096.1|  CBL-interacting protein kinase 32                       181   6e-50   Triticum urartu
gb|ABM66448.1|  SOS2-like protein                                       181   6e-50   Brassica juncea [brown mustard]
ref|XP_007015395.1|  CBL-interacting serine/threonine-protein kin...    181   6e-50   
ref|XP_004491203.1|  PREDICTED: CBL-interacting serine/threonine-...    181   7e-50   Cicer arietinum [garbanzo]
ref|XP_001776846.1|  predicted protein                                  181   8e-50   
gb|KHG02542.1|  CBL-interacting serine/threonine-protein kinase 3       181   8e-50   Gossypium arboreum [tree cotton]
gb|KJB09263.1|  hypothetical protein B456_001G132200                    181   8e-50   Gossypium raimondii
gb|KJB09262.1|  hypothetical protein B456_001G132200                    180   8e-50   Gossypium raimondii
ref|XP_012075972.1|  PREDICTED: CBL-interacting serine/threonine-...    181   9e-50   
ref|NP_001242682.1|  uncharacterized protein LOC100794566               180   9e-50   
ref|NP_850092.1|  CBL-interacting serine/threonine-protein kinase 3     179   9e-50   
gb|KJB09267.1|  hypothetical protein B456_001G132200                    181   1e-49   
gb|AGY49230.1|  CBL-interacting protein kinase 7                        181   1e-49   
gb|KDO75405.1|  hypothetical protein CISIN_1g019360mg                   178   1e-49   
ref|XP_004491202.1|  PREDICTED: CBL-interacting serine/threonine-...    181   1e-49   
ref|XP_010521589.1|  PREDICTED: CBL-interacting serine/threonine-...    180   1e-49   
ref|XP_004978441.1|  PREDICTED: CBL-interacting protein kinase 32...    180   1e-49   
gb|AES91544.2|  CBL-interacting kinase                                  180   1e-49   
ref|NP_850093.1|  CBL-interacting serine/threonine-protein kinase 3     179   1e-49   
ref|XP_009610559.1|  PREDICTED: CBL-interacting serine/threonine-...    180   1e-49   
gb|AES91543.2|  CBL-interacting kinase                                  180   1e-49   
ref|XP_009610556.1|  PREDICTED: CBL-interacting serine/threonine-...    180   1e-49   
ref|XP_004978440.1|  PREDICTED: CBL-interacting protein kinase 32...    180   1e-49   
ref|XP_008449851.1|  PREDICTED: CBL-interacting serine/threonine-...    180   2e-49   
emb|CDY36813.1|  BnaC04g32060D                                          180   2e-49   
gb|KCW87273.1|  hypothetical protein EUGRSUZ_B03773                     179   2e-49   
dbj|BAF74756.1|  CBL-interacting protein kinase                         180   2e-49   
ref|XP_004978437.1|  PREDICTED: CBL-interacting protein kinase 32...    181   2e-49   
ref|XP_010093797.1|  CBL-interacting serine/threonine-protein kin...    180   2e-49   
ref|XP_004978439.1|  PREDICTED: CBL-interacting protein kinase 32...    180   2e-49   
emb|CBX25233.1|  hypothetical_protein                                   179   2e-49   
ref|NP_001066079.1|  Os12g0132200                                       179   2e-49   
gb|EAY82177.1|  hypothetical protein OsI_37378                          179   2e-49   
ref|XP_006662710.1|  PREDICTED: CBL-interacting protein kinase 32...    179   2e-49   
ref|XP_004978435.1|  PREDICTED: CBL-interacting protein kinase 32...    181   3e-49   
ref|XP_010045116.1|  PREDICTED: CBL-interacting serine/threonine-...    179   3e-49   
ref|XP_011459450.1|  PREDICTED: CBL-interacting serine/threonine-...    177   3e-49   
gb|EAZ19557.1|  hypothetical protein OsJ_35128                          180   3e-49   
ref|XP_006663790.1|  PREDICTED: CBL-interacting protein kinase 32...    179   3e-49   
ref|NP_001031427.1|  CBL-interacting serine/threonine-protein kin...    179   3e-49   
ref|XP_004978438.1|  PREDICTED: CBL-interacting protein kinase 32...    180   3e-49   
emb|CAA73068.1|  serine/threonine kinase                                179   3e-49   
ref|NP_850094.1|  CBL-interacting serine/threonine-protein kinase 3     179   3e-49   
ref|XP_002442701.1|  hypothetical protein SORBIDRAFT_08g001430          179   3e-49   
ref|XP_004978433.1|  PREDICTED: CBL-interacting protein kinase 32...    181   3e-49   
ref|XP_008231493.1|  PREDICTED: LOW QUALITY PROTEIN: CBL-interact...    179   3e-49   
ref|NP_850095.2|  CBL-interacting serine/threonine-protein kinase 3     179   3e-49   
ref|XP_004149656.1|  PREDICTED: CBL-interacting serine/threonine-...    179   4e-49   
gb|ABK96457.1|  unknown                                                 175   4e-49   
ref|XP_004978436.1|  PREDICTED: CBL-interacting protein kinase 32...    180   4e-49   
ref|XP_004978434.1|  PREDICTED: CBL-interacting protein kinase 32...    180   4e-49   
ref|XP_010045112.1|  PREDICTED: CBL-interacting serine/threonine-...    179   5e-49   
ref|XP_004978432.1|  PREDICTED: CBL-interacting protein kinase 32...    181   5e-49   
ref|XP_010655435.1|  PREDICTED: CBL-interacting protein kinase 04...    178   5e-49   
ref|XP_009410447.1|  PREDICTED: CBL-interacting protein kinase 32...    178   5e-49   
ref|XP_002880865.1|  cbl-interacting protein kinase 3                   179   5e-49   
ref|XP_009410446.1|  PREDICTED: CBL-interacting protein kinase 32...    179   5e-49   
ref|XP_006408599.1|  hypothetical protein EUTSA_v10001987mg             179   5e-49   
ref|XP_010417840.1|  PREDICTED: CBL-interacting serine/threonine-...    179   5e-49   
ref|XP_010655434.1|  PREDICTED: CBL-interacting protein kinase 04...    178   5e-49   
ref|XP_010275075.1|  PREDICTED: CBL-interacting serine/threonine-...    177   5e-49   
gb|KHG08503.1|  CBL-interacting serine/threonine-protein kinase 3       179   5e-49   
gb|KJB55426.1|  hypothetical protein B456_009G076400                    179   6e-49   
ref|XP_003609347.1|  CBL-interacting protein kinase                     180   6e-49   
gb|KJB55429.1|  hypothetical protein B456_009G076400                    178   6e-49   
ref|XP_003609346.1|  CBL-interacting protein kinase                     180   6e-49   
ref|XP_007207461.1|  hypothetical protein PRUPE_ppa005881mg             178   7e-49   
ref|XP_010655433.1|  PREDICTED: CBL-interacting protein kinase 04...    179   7e-49   
ref|NP_001268217.1|  CBL-interacting protein kinase 04                  179   7e-49   
ref|XP_009410444.1|  PREDICTED: CBL-interacting protein kinase 32...    178   7e-49   
gb|AGA37207.1|  CBL-interacting protein kinase 3.1                      178   7e-49   
ref|XP_011653539.1|  PREDICTED: CBL-interacting serine/threonine-...    179   8e-49   
ref|XP_011459448.1|  PREDICTED: CBL-interacting serine/threonine-...    178   8e-49   
ref|XP_009140753.1|  PREDICTED: CBL-interacting serine/threonine-...    178   8e-49   
gb|AJR22389.1|  CBL-interacting protein kinase 32                       178   8e-49   
ref|XP_009384345.1|  PREDICTED: CBL-interacting protein kinase 32...    178   9e-49   
gb|EEC67609.1|  hypothetical protein OsI_34988                          178   9e-49   
ref|XP_006832895.1|  PREDICTED: CBL-interacting protein kinase 32...    178   9e-49   
sp|Q2RAX3.1|CIPKX_ORYSJ  RecName: Full=CBL-interacting protein ki...    178   9e-49   
ref|XP_008371787.1|  PREDICTED: CBL-interacting protein kinase 23...    171   1e-48   
ref|XP_002986060.1|  hypothetical protein SELMODRAFT_234951             178   1e-48   
gb|EYU33398.1|  hypothetical protein MIMGU_mgv1a005956mg                177   1e-48   
gb|AGY49228.1|  CBL-interacting protein kinase 1                        178   1e-48   
gb|EPS68520.1|  hypothetical protein M569_06245                         177   1e-48   
ref|XP_006836344.1|  PREDICTED: CBL-interacting protein kinase 23       178   1e-48   
ref|XP_002989628.1|  hypothetical protein SELMODRAFT_269551             177   1e-48   
ref|XP_011620409.1|  PREDICTED: CBL-interacting protein kinase 32...    177   1e-48   
ref|XP_008362460.1|  PREDICTED: LOW QUALITY PROTEIN: CBL-interact...    177   2e-48   
ref|XP_006468060.1|  PREDICTED: CBL-interacting serine/threonine-...    177   2e-48   
ref|XP_010275074.1|  PREDICTED: CBL-interacting serine/threonine-...    176   2e-48   
ref|XP_012072157.1|  PREDICTED: CBL-interacting serine/threonine-...    177   2e-48   
ref|XP_009347018.1|  PREDICTED: CBL-interacting serine/threonine-...    177   2e-48   
ref|XP_006448996.1|  hypothetical protein CICLE_v10015157mg             177   2e-48   
ref|XP_012083118.1|  PREDICTED: CBL-interacting serine/threonine-...    177   2e-48   
ref|XP_010275073.1|  PREDICTED: CBL-interacting serine/threonine-...    176   2e-48   
gb|EYU33397.1|  hypothetical protein MIMGU_mgv1a005956mg                177   3e-48   
gb|ACQ83503.1|  CBL-interacting protein kinase 03                       177   3e-48   
ref|XP_006449000.1|  hypothetical protein CICLE_v10015157mg             177   3e-48   
ref|XP_010275072.1|  PREDICTED: CBL-interacting serine/threonine-...    177   3e-48   
gb|AFQ00706.1|  CBL-interacting protein kinase 3                        178   3e-48   
ref|XP_010275070.1|  PREDICTED: CBL-interacting serine/threonine-...    177   3e-48   
ref|XP_010922116.1|  PREDICTED: CBL-interacting protein kinase 32...    176   3e-48   
ref|XP_008786806.1|  PREDICTED: CBL-interacting protein kinase 32...    176   3e-48   
ref|XP_009398323.1|  PREDICTED: CBL-interacting protein kinase 23...    176   4e-48   
gb|AIZ68216.1|  CBL-interacting protein kinase 32 isoform X3            176   4e-48   
ref|XP_006449001.1|  hypothetical protein CICLE_v10015157mg             176   5e-48   
gb|EPS71153.1|  hypothetical protein M569_03606                         171   5e-48   
ref|XP_010922113.1|  PREDICTED: CBL-interacting protein kinase 32...    176   7e-48   
ref|XP_010456619.1|  PREDICTED: CBL-interacting serine/threonine-...    171   7e-48   
ref|XP_010510834.1|  PREDICTED: CBL-interacting serine/threonine-...    176   7e-48   
ref|XP_011090186.1|  PREDICTED: CBL-interacting serine/threonine-...    176   7e-48   
gb|ABJ91230.1|  CBL-interacting protein kinase 24                       176   7e-48   
ref|XP_011020231.1|  PREDICTED: CBL-interacting serine/threonine-...    176   8e-48   
ref|XP_009391622.1|  PREDICTED: CBL-interacting protein kinase 32...    176   8e-48   
ref|XP_006381089.1|  hypothetical protein POPTR_0006s06160g             176   9e-48   
ref|NP_001291234.1|  CBL-interacting serine/threonine-protein kin...    176   9e-48   
ref|XP_008676594.1|  PREDICTED: uncharacterized protein LOC100193...    175   1e-47   
ref|XP_002532976.1|  CBL-interacting serine/threonine-protein kin...    176   1e-47   
ref|XP_010275897.1|  PREDICTED: CBL-interacting serine/threonine-...    173   1e-47   
ref|XP_011042034.1|  PREDICTED: CBL-interacting protein kinase 32...    174   1e-47   
ref|XP_008786805.1|  PREDICTED: CBL-interacting protein kinase 32...    176   1e-47   
ref|XP_011042033.1|  PREDICTED: CBL-interacting protein kinase 32...    175   1e-47   
ref|XP_002314239.1|  CBL-interacting protein kinase 3                   175   1e-47   
ref|XP_009397401.1|  PREDICTED: CBL-interacting protein kinase 23...    175   1e-47   
ref|XP_001775132.1|  predicted protein                                  175   1e-47   
ref|XP_011042029.1|  PREDICTED: CBL-interacting protein kinase 32...    175   2e-47   
emb|CAA73067.1|  serine/threonine kinase                                175   2e-47   
ref|XP_008786804.1|  PREDICTED: CBL-interacting protein kinase 32...    176   2e-47   
ref|XP_008794482.1|  PREDICTED: CBL-interacting protein kinase 23...    175   2e-47   
ref|XP_008794481.1|  PREDICTED: CBL-interacting protein kinase 23...    175   2e-47   
ref|XP_008439598.1|  PREDICTED: CBL-interacting serine/threonine-...    174   2e-47   
ref|XP_008439597.1|  PREDICTED: CBL-interacting serine/threonine-...    174   2e-47   
ref|XP_010919144.1|  PREDICTED: CBL-interacting protein kinase 9-...    173   3e-47   
ref|XP_010275896.1|  PREDICTED: CBL-interacting serine/threonine-...    173   3e-47   
ref|XP_010275895.1|  PREDICTED: CBL-interacting protein kinase 23...    174   3e-47   
tpg|DAA59182.1|  TPA: putative CBL-interacting protein kinase fam...    173   3e-47   
ref|XP_010275894.1|  PREDICTED: CBL-interacting serine/threonine-...    174   3e-47   
emb|CBX24385.1|  hypothetical_protein                                   173   3e-47   
ref|XP_010251868.1|  PREDICTED: CBL-interacting serine/threonine-...    173   4e-47   
ref|XP_011096616.1|  PREDICTED: CBL-interacting protein kinase 23       174   4e-47   
ref|XP_008444632.1|  PREDICTED: CBL-interacting serine/threonine-...    174   4e-47   
ref|XP_004134573.1|  PREDICTED: CBL-interacting serine/threonine-...    174   4e-47   
ref|XP_010919143.1|  PREDICTED: CBL-interacting protein kinase 9-...    173   4e-47   
ref|XP_006846572.1|  PREDICTED: CBL-interacting serine/threonine-...    174   4e-47   
ref|XP_008672844.1|  PREDICTED: LOC100281727 isoform X3                 173   4e-47   
ref|XP_010922115.1|  PREDICTED: CBL-interacting protein kinase 32...    176   4e-47   
ref|XP_006361546.1|  PREDICTED: CBL-interacting serine/threonine-...    174   4e-47   
gb|AIZ68217.1|  CBL-interacting protein kinase 23-like protein          174   5e-47   
ref|XP_006361547.1|  PREDICTED: CBL-interacting serine/threonine-...    174   5e-47   
ref|XP_010919140.1|  PREDICTED: CBL-interacting protein kinase 9-...    173   5e-47   
ref|XP_006444750.1|  hypothetical protein CICLE_v10020168mg             172   5e-47   
ref|XP_010687109.1|  PREDICTED: CBL-interacting serine/threonine-...    174   5e-47   
ref|XP_006287769.1|  hypothetical protein CARUB_v10000979mg             173   5e-47   
ref|XP_009610094.1|  PREDICTED: CBL-interacting serine/threonine-...    174   5e-47   
tpg|DAA59184.1|  TPA: putative CBL-interacting protein kinase fam...    173   5e-47   
emb|CDX92400.1|  BnaA10g14390D                                          173   6e-47   
ref|XP_009120713.1|  PREDICTED: CBL-interacting serine/threonine-...    173   6e-47   
ref|XP_011085229.1|  PREDICTED: CBL-interacting serine/threonine-...    174   6e-47   
ref|XP_009120712.1|  PREDICTED: CBL-interacting serine/threonine-...    173   6e-47   
ref|XP_006400691.1|  hypothetical protein EUTSA_v10013527mg             173   6e-47   
ref|XP_009610096.1|  PREDICTED: CBL-interacting serine/threonine-...    173   6e-47   
gb|AGA37206.1|  CBL-interacting protein kinase 26.1                     173   6e-47   
ref|NP_001148119.1|  LOC100281727                                       173   6e-47   
ref|XP_008672843.1|  PREDICTED: LOC100281727 isoform X2                 173   7e-47   
ref|XP_010251862.1|  PREDICTED: CBL-interacting serine/threonine-...    173   7e-47   
ref|XP_008811953.1|  PREDICTED: CBL-interacting protein kinase 32...    173   7e-47   
emb|CDY16600.1|  BnaC09g36730D                                          173   7e-47   
ref|XP_010538259.1|  PREDICTED: CBL-interacting serine/threonine-...    173   8e-47   
gb|KDO86589.1|  hypothetical protein CISIN_1g012228mg                   172   1e-46   
ref|XP_004145226.1|  PREDICTED: CBL-interacting serine/threonine-...    173   1e-46   
ref|XP_006444751.1|  hypothetical protein CICLE_v10020168mg             172   1e-46   
ref|XP_006491351.1|  PREDICTED: CBL-interacting serine/threonine-...    172   2e-46   
ref|XP_010493242.1|  PREDICTED: CBL-interacting serine/threonine-...    172   2e-46   
ref|XP_010420969.1|  PREDICTED: CBL-interacting serine/threonine-...    172   2e-46   
ref|XP_004231542.1|  PREDICTED: CBL-interacting serine/threonine-...    172   2e-46   
ref|XP_004231541.1|  PREDICTED: CBL-interacting serine/threonine-...    172   2e-46   
ref|XP_009787738.1|  PREDICTED: CBL-interacting serine/threonine-...    172   2e-46   
ref|XP_009787739.1|  PREDICTED: CBL-interacting serine/threonine-...    172   2e-46   
ref|XP_010420967.1|  PREDICTED: CBL-interacting serine/threonine-...    172   2e-46   
ref|NP_850861.2|  CBL-interacting serine/threonine-protein kinase 26    172   2e-46   
gb|KDO86586.1|  hypothetical protein CISIN_1g012228mg                   172   2e-46   
ref|XP_008811951.1|  PREDICTED: CBL-interacting protein kinase 32...    173   2e-46   
ref|XP_010052037.1|  PREDICTED: CBL-interacting serine/threonine-...    172   3e-46   
gb|AAO73884.1|  NAF specific protein kinase family                      172   3e-46   
ref|XP_006657117.1|  PREDICTED: CBL-interacting protein kinase 24...    172   3e-46   
gb|EPS70454.1|  hypothetical protein M569_04293                         172   3e-46   
gb|KDO86588.1|  hypothetical protein CISIN_1g012228mg                   172   3e-46   
emb|CDP17468.1|  unnamed protein product                                171   3e-46   
gb|ACD76983.1|  CBL-interacting protein kinase 23                       171   3e-46   
gb|EEC81522.1|  hypothetical protein OsI_24914                          171   3e-46   
ref|NP_001058901.1|  Os07g0150700                                       171   3e-46   
ref|XP_010933949.1|  PREDICTED: CBL-interacting protein kinase 9-...    170   4e-46   
ref|XP_010549503.1|  PREDICTED: CBL-interacting serine/threonine-...    171   4e-46   
gb|KCW75891.1|  hypothetical protein EUGRSUZ_D00272                     171   4e-46   
ref|XP_004965931.1|  PREDICTED: CBL-interacting protein kinase 24...    171   5e-46   
gb|AJL33748.1|  CBL-interacting protein kinase 23                       171   5e-46   
ref|XP_002974573.1|  hypothetical protein SELMODRAFT_232364             171   5e-46   
gb|ACN29035.1|  unknown                                                 171   5e-46   
ref|XP_002461461.1|  hypothetical protein SORBIDRAFT_02g003030          171   5e-46   
ref|XP_010689489.1|  PREDICTED: CBL-interacting protein kinase 32...    170   5e-46   
ref|XP_002963272.1|  hypothetical protein SELMODRAFT_79434              171   6e-46   
ref|XP_008784843.1|  PREDICTED: CBL-interacting protein kinase 23...    171   6e-46   
gb|KHN26167.1|  CBL-interacting serine/threonine-protein kinase 8       170   6e-46   
ref|XP_004965932.1|  PREDICTED: CBL-interacting protein kinase 24...    171   6e-46   
ref|XP_002529974.1|  ATP binding protein, putative                      168   7e-46   
ref|XP_007025003.1|  CBL-interacting serine/threonine-protein kin...    168   7e-46   
ref|XP_001754736.1|  predicted protein                                  170   7e-46   
ref|XP_004293511.1|  PREDICTED: CBL-interacting serine/threonine-...    171   8e-46   
ref|XP_006415491.1|  hypothetical protein EUTSA_v10007518mg             171   8e-46   
ref|XP_010933947.1|  PREDICTED: CBL-interacting protein kinase 9-...    170   1e-45   
ref|XP_010689488.1|  PREDICTED: CBL-interacting protein kinase 32...    169   1e-45   
gb|KJB66955.1|  hypothetical protein B456_010G168100                    169   1e-45   
ref|XP_009380407.1|  PREDICTED: CBL-interacting protein kinase 24       169   1e-45   
ref|XP_007213911.1|  hypothetical protein PRUPE_ppa005492mg             170   1e-45   
ref|XP_010689487.1|  PREDICTED: CBL-interacting protein kinase 32...    169   1e-45   
ref|XP_008225519.1|  PREDICTED: CBL-interacting serine/threonine-...    170   1e-45   
ref|XP_006386640.1|  hypothetical protein POPTR_0002s17840g             166   1e-45   
emb|CDY26276.1|  BnaA09g26270D                                          170   1e-45   
emb|CDY63182.1|  BnaCnng41590D                                          170   2e-45   
ref|XP_006657449.1|  PREDICTED: CBL-interacting protein kinase 23...    169   2e-45   
ref|XP_009115173.1|  PREDICTED: CBL-interacting serine/threonine-...    170   2e-45   
gb|KJB66957.1|  hypothetical protein B456_010G168100                    170   2e-45   
ref|XP_006389416.1|  CBL-interacting protein kinase 23                  170   2e-45   
gb|KJB66956.1|  hypothetical protein B456_010G168100                    169   2e-45   
gb|KJB66954.1|  hypothetical protein B456_010G168100                    170   2e-45   
pdb|4CZU|A  Chain A, Crystal Structure Of The Kinase Domain Of Sn...    169   2e-45   
pdb|4CZT|A  Chain A, Crystal Structure Of The Kinase Domain Of Sn...    169   2e-45   
ref|XP_006389415.1|  hypothetical protein POPTR_0025s00500g             170   2e-45   
ref|XP_010940873.1|  PREDICTED: CBL-interacting protein kinase 23...    169   2e-45   
ref|XP_010940882.1|  PREDICTED: CBL-interacting protein kinase 23...    169   2e-45   



>gb|KCW66680.1| hypothetical protein EUGRSUZ_F00453 [Eucalyptus grandis]
Length=444

 Score =   228 bits (582),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 111/117 (95%), Positives = 115/117 (98%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRS+IIKHKMVDQIKREISI
Sbjct  1    MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSSIIKHKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEV+ASRTKIYIILEFITGGELFDKI+HHGRL EAE+RRYF QLI
Sbjct  61   MKLVRHPYVVRLHEVLASRTKIYIILEFITGGELFDKIVHHGRLSEAEARRYFQQLI  117



>ref|XP_010060129.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
isoform X3 [Eucalyptus grandis]
 gb|KCW66681.1| hypothetical protein EUGRSUZ_F00453 [Eucalyptus grandis]
Length=446

 Score =   228 bits (582),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 111/117 (95%), Positives = 115/117 (98%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRS+IIKHKMVDQIKREISI
Sbjct  1    MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSSIIKHKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEV+ASRTKIYIILEFITGGELFDKI+HHGRL EAE+RRYF QLI
Sbjct  61   MKLVRHPYVVRLHEVLASRTKIYIILEFITGGELFDKIVHHGRLSEAEARRYFQQLI  117



>gb|KDO81283.1| hypothetical protein CISIN_1g022444mg [Citrus sinensis]
 gb|KDO81284.1| hypothetical protein CISIN_1g022444mg [Citrus sinensis]
Length=218

 Score =   221 bits (563),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 108/117 (92%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKV+DRSAIIKHKM DQIKREISI
Sbjct  1    MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVLDRSAIIKHKMADQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHP VVRLHEV+ASRTKIYIILEFITGGELFDKI+HHGRL E+E+RRYF QLI
Sbjct  61   MKLVRHPCVVRLHEVLASRTKIYIILEFITGGELFDKIVHHGRLSESEARRYFQQLI  117



>ref|XP_010060127.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
isoform X1 [Eucalyptus grandis]
 gb|KCW66682.1| hypothetical protein EUGRSUZ_F00453 [Eucalyptus grandis]
Length=455

 Score =   228 bits (582),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 111/117 (95%), Positives = 115/117 (98%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRS+IIKHKMVDQIKREISI
Sbjct  1    MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSSIIKHKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEV+ASRTKIYIILEFITGGELFDKI+HHGRL EAE+RRYF QLI
Sbjct  61   MKLVRHPYVVRLHEVLASRTKIYIILEFITGGELFDKIVHHGRLSEAEARRYFQQLI  117



>gb|KCW66679.1| hypothetical protein EUGRSUZ_F00453 [Eucalyptus grandis]
Length=452

 Score =   228 bits (581),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/117 (95%), Positives = 115/117 (98%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRS+IIKHKMVDQIKREISI
Sbjct  1    MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSSIIKHKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEV+ASRTKIYIILEFITGGELFDKI+HHGRL EAE+RRYF QLI
Sbjct  61   MKLVRHPYVVRLHEVLASRTKIYIILEFITGGELFDKIVHHGRLSEAEARRYFQQLI  117



>ref|XP_010060128.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
isoform X2 [Eucalyptus grandis]
Length=453

 Score =   228 bits (581),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/117 (95%), Positives = 115/117 (98%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRS+IIKHKMVDQIKREISI
Sbjct  1    MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSSIIKHKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEV+ASRTKIYIILEFITGGELFDKI+HHGRL EAE+RRYF QLI
Sbjct  61   MKLVRHPYVVRLHEVLASRTKIYIILEFITGGELFDKIVHHGRLSEAEARRYFQQLI  117



>ref|XP_007018318.1| CBL-interacting protein kinase 8 isoform 4 [Theobroma cacao]
 gb|EOY15543.1| CBL-interacting protein kinase 8 isoform 4 [Theobroma cacao]
Length=324

 Score =   224 bits (571),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 109/117 (93%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYE+GRTIGEGTFAKVKFAQNTETGESVAMKV+DRS IIKHKMVDQIKREISI
Sbjct  1    MVVRKVGKYEIGRTIGEGTFAKVKFAQNTETGESVAMKVLDRSTIIKHKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKI+H+GRL EAE+RRYF QLI
Sbjct  61   MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIVHNGRLSEAEARRYFQQLI  117



>ref|XP_003526526.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8-like 
isoform X1 [Glycine max]
Length=446

 Score =   227 bits (578),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 110/117 (94%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYE+GRTIGEGTFAKVKFAQNTETGESVAMKV+DRS IIKHKMVDQIKREISI
Sbjct  1    MVVRKVGKYEIGRTIGEGTFAKVKFAQNTETGESVAMKVLDRSTIIKHKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEV+ASRTKIYIILEFITGGELFDKIIHHGRL EA+SRRYF QLI
Sbjct  61   MKLVRHPYVVRLHEVLASRTKIYIILEFITGGELFDKIIHHGRLSEADSRRYFQQLI  117



>ref|XP_004238031.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
[Solanum lycopersicum]
Length=447

 Score =   226 bits (576),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 110/117 (94%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKV+DRS IIKHKMVDQIK+EISI
Sbjct  1    MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVLDRSTIIKHKMVDQIKQEISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEVIA+RTKIYIILEFITGGELFDKI+HHGRL EAESRRYF QLI
Sbjct  61   MKLVRHPYVVRLHEVIATRTKIYIILEFITGGELFDKIVHHGRLSEAESRRYFQQLI  117



>ref|XP_004490474.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8-like 
isoform X3 [Cicer arietinum]
Length=373

 Score =   224 bits (571),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 107/117 (91%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MV+RKVGKYE+GRTIGEGTFAKVKFAQNTETGESVAMKV+DRS IIKHKM DQIKREISI
Sbjct  1    MVLRKVGKYEIGRTIGEGTFAKVKFAQNTETGESVAMKVLDRSTIIKHKMADQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEV+ASRTKIYIILEFITGGELFDKI+HHGRL EAESR+YF QLI
Sbjct  61   MKLVRHPYVVRLHEVLASRTKIYIILEFITGGELFDKIVHHGRLNEAESRKYFQQLI  117



>ref|XP_009615545.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
isoform X3 [Nicotiana tomentosiformis]
Length=407

 Score =   225 bits (573),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 109/117 (93%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MV+RK+GKYEVGRTIGEGTFAKVKFAQNTETGESVAMKV+DRS IIKHKMVDQIKREISI
Sbjct  1    MVIRKLGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVLDRSTIIKHKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEVIA+RTKIYIILEFITGGELFDKI+HHGRL EAESRRYF QLI
Sbjct  61   MKLVRHPYVVRLHEVIATRTKIYIILEFITGGELFDKIVHHGRLSEAESRRYFQQLI  117



>gb|KDO81282.1| hypothetical protein CISIN_1g022444mg [Citrus sinensis]
Length=297

 Score =   221 bits (564),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 108/117 (92%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKV+DRSAIIKHKM DQIKREISI
Sbjct  1    MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVLDRSAIIKHKMADQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHP VVRLHEV+ASRTKIYIILEFITGGELFDKI+HHGRL E+E+RRYF QLI
Sbjct  61   MKLVRHPCVVRLHEVLASRTKIYIILEFITGGELFDKIVHHGRLSESEARRYFQQLI  117



>ref|XP_006364978.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8-like 
isoform X1 [Solanum tuberosum]
Length=447

 Score =   226 bits (575),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 110/117 (94%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKV+DRS IIKHKMVDQIK+EISI
Sbjct  1    MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVLDRSTIIKHKMVDQIKQEISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEVIA+RTKIYIILEFITGGELFDKI+HHGRL EAESRRYF QLI
Sbjct  61   MKLVRHPYVVRLHEVIATRTKIYIILEFITGGELFDKIVHHGRLSEAESRRYFQQLI  117



>ref|XP_009615544.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
isoform X2 [Nicotiana tomentosiformis]
Length=447

 Score =   226 bits (575),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 109/117 (93%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MV+RK+GKYEVGRTIGEGTFAKVKFAQNTETGESVAMKV+DRS IIKHKMVDQIKREISI
Sbjct  1    MVIRKLGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVLDRSTIIKHKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEVIA+RTKIYIILEFITGGELFDKI+HHGRL EAESRRYF QLI
Sbjct  61   MKLVRHPYVVRLHEVIATRTKIYIILEFITGGELFDKIVHHGRLSEAESRRYFQQLI  117



>gb|EPS71316.1| hypothetical protein M569_03446, partial [Genlisea aurea]
Length=184

 Score =   217 bits (552),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/117 (92%), Positives = 112/117 (96%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKV+DRS IIKHKMVDQIKREISI
Sbjct  1    MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVLDRSTIIKHKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MK VRHPYVVRLHEVIASRTKIYIILEFITGGELFDKI+ +GRL E+ESRRYF QLI
Sbjct  61   MKRVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIVQNGRLSESESRRYFQQLI  117



>ref|XP_009790125.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
isoform X5 [Nicotiana sylvestris]
Length=424

 Score =   224 bits (572),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/117 (92%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MV+RK+GKYEVGRTIGEGTFAKVKFAQNTETGESVAMKV+DR+ IIKHKMVDQIKREISI
Sbjct  1    MVIRKLGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVLDRTTIIKHKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEVIA+RTKIYIILEFITGGELFDKI+HHGRL EAESRRYF QLI
Sbjct  61   MKLVRHPYVVRLHEVIATRTKIYIILEFITGGELFDKIVHHGRLSEAESRRYFQQLI  117



>ref|XP_002527344.1| CBL-interacting serine/threonine-protein kinase, putative [Ricinus 
communis]
 gb|EEF35016.1| CBL-interacting serine/threonine-protein kinase, putative [Ricinus 
communis]
Length=446

 Score =   225 bits (574),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/117 (92%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKV+DR+ IIKHKM+DQIKREISI
Sbjct  1    MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVLDRTTIIKHKMIDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEV+ASRTKIYIILEFITGGELFDKI+HHGRL EAE+RRYF QLI
Sbjct  61   MKLVRHPYVVRLHEVLASRTKIYIILEFITGGELFDKIVHHGRLSEAEARRYFQQLI  117



>gb|KEH28131.1| CBL-interacting kinase [Medicago truncatula]
Length=373

 Score =   223 bits (568),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/117 (91%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MV+RKVGKYE+GRTIGEGTFAKVKFAQNTETGESVAMK++DRS IIKHKM DQIKREISI
Sbjct  1    MVLRKVGKYEIGRTIGEGTFAKVKFAQNTETGESVAMKILDRSTIIKHKMADQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEV+ASRTKIYIILEFITGGELFDKI+HHGRL EAE+RRYF QLI
Sbjct  61   MKLVRHPYVVRLHEVLASRTKIYIILEFITGGELFDKIVHHGRLSEAEARRYFQQLI  117



>ref|XP_007018317.1| CBL-interacting protein kinase 8 isoform 3 [Theobroma cacao]
 gb|EOY15542.1| CBL-interacting protein kinase 8 isoform 3 [Theobroma cacao]
Length=397

 Score =   224 bits (570),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 109/117 (93%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYE+GRTIGEGTFAKVKFAQNTETGESVAMKV+DRS IIKHKMVDQIKREISI
Sbjct  1    MVVRKVGKYEIGRTIGEGTFAKVKFAQNTETGESVAMKVLDRSTIIKHKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKI+H+GRL EAE+RRYF QLI
Sbjct  61   MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIVHNGRLSEAEARRYFQQLI  117



>ref|XP_012068077.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
[Jatropha curcas]
 gb|KDP41522.1| hypothetical protein JCGZ_15929 [Jatropha curcas]
Length=446

 Score =   225 bits (573),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 109/117 (93%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKV+DRS IIKHKMV+QIKREISI
Sbjct  1    MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVLDRSTIIKHKMVEQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEV+ASRTKIYIILEFITGGELFDKI+HHGRL EAE+RRYF QLI
Sbjct  61   MKLVRHPYVVRLHEVLASRTKIYIILEFITGGELFDKIVHHGRLSEAEARRYFQQLI  117



>ref|XP_009615543.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
isoform X1 [Nicotiana tomentosiformis]
Length=454

 Score =   225 bits (574),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 109/117 (93%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MV+RK+GKYEVGRTIGEGTFAKVKFAQNTETGESVAMKV+DRS IIKHKMVDQIKREISI
Sbjct  1    MVIRKLGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVLDRSTIIKHKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEVIA+RTKIYIILEFITGGELFDKI+HHGRL EAESRRYF QLI
Sbjct  61   MKLVRHPYVVRLHEVIATRTKIYIILEFITGGELFDKIVHHGRLSEAESRRYFQQLI  117



>ref|XP_011074289.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
[Sesamum indicum]
Length=446

 Score =   225 bits (573),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/117 (94%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKV+DRS IIKHKMVDQIKREISI
Sbjct  1    MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVLDRSTIIKHKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MK VRHPYVVRLHEVIASRTKIYIILEFITGGELFDKI+HHGRL E+ESRRYF QLI
Sbjct  61   MKRVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIVHHGRLSESESRRYFQQLI  117



>ref|XP_004490472.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8-like 
isoform X1 [Cicer arietinum]
Length=446

 Score =   224 bits (572),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/117 (91%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MV+RKVGKYE+GRTIGEGTFAKVKFAQNTETGESVAMKV+DRS IIKHKM DQIKREISI
Sbjct  1    MVLRKVGKYEIGRTIGEGTFAKVKFAQNTETGESVAMKVLDRSTIIKHKMADQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEV+ASRTKIYIILEFITGGELFDKI+HHGRL EAESR+YF QLI
Sbjct  61   MKLVRHPYVVRLHEVLASRTKIYIILEFITGGELFDKIVHHGRLNEAESRKYFQQLI  117



>ref|XP_007018315.1| CBL-interacting protein kinase 8 isoform 1 [Theobroma cacao]
 gb|EOY15540.1| CBL-interacting protein kinase 8 isoform 1 [Theobroma cacao]
Length=446

 Score =   224 bits (572),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/117 (93%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYE+GRTIGEGTFAKVKFAQNTETGESVAMKV+DRS IIKHKMVDQIKREISI
Sbjct  1    MVVRKVGKYEIGRTIGEGTFAKVKFAQNTETGESVAMKVLDRSTIIKHKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKI+H+GRL EAE+RRYF QLI
Sbjct  61   MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIVHNGRLSEAEARRYFQQLI  117



>ref|XP_008352722.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8-like 
isoform X1 [Malus domestica]
Length=449

 Score =   224 bits (572),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/117 (93%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKV+DR+ IIKHKMVDQIKREISI
Sbjct  1    MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVLDRTTIIKHKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEV+ASRTKIYIILEFITGGELFDKI+HHGRL E ESRRYF QLI
Sbjct  61   MKLVRHPYVVRLHEVLASRTKIYIILEFITGGELFDKIVHHGRLSEGESRRYFQQLI  117



>ref|XP_007018316.1| CBL-interacting protein kinase 8 isoform 2 [Theobroma cacao]
 gb|EOY15541.1| CBL-interacting protein kinase 8 isoform 2 [Theobroma cacao]
Length=449

 Score =   224 bits (572),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/117 (93%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYE+GRTIGEGTFAKVKFAQNTETGESVAMKV+DRS IIKHKMVDQIKREISI
Sbjct  1    MVVRKVGKYEIGRTIGEGTFAKVKFAQNTETGESVAMKVLDRSTIIKHKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKI+H+GRL EAE+RRYF QLI
Sbjct  61   MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIVHNGRLSEAEARRYFQQLI  117



>ref|XP_008352723.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8-like 
isoform X2 [Malus domestica]
Length=448

 Score =   224 bits (572),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/117 (93%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKV+DR+ IIKHKMVDQIKREISI
Sbjct  1    MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVLDRTTIIKHKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEV+ASRTKIYIILEFITGGELFDKI+HHGRL E ESRRYF QLI
Sbjct  61   MKLVRHPYVVRLHEVLASRTKIYIILEFITGGELFDKIVHHGRLSEGESRRYFQQLI  117



>ref|XP_009790122.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
isoform X2 [Nicotiana sylvestris]
Length=464

 Score =   225 bits (573),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/117 (92%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MV+RK+GKYEVGRTIGEGTFAKVKFAQNTETGESVAMKV+DR+ IIKHKMVDQIKREISI
Sbjct  1    MVIRKLGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVLDRTTIIKHKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEVIA+RTKIYIILEFITGGELFDKI+HHGRL EAESRRYF QLI
Sbjct  61   MKLVRHPYVVRLHEVIATRTKIYIILEFITGGELFDKIVHHGRLSEAESRRYFQQLI  117



>ref|XP_009790124.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
isoform X4 [Nicotiana sylvestris]
Length=447

 Score =   224 bits (572),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/117 (92%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MV+RK+GKYEVGRTIGEGTFAKVKFAQNTETGESVAMKV+DR+ IIKHKMVDQIKREISI
Sbjct  1    MVIRKLGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVLDRTTIIKHKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEVIA+RTKIYIILEFITGGELFDKI+HHGRL EAESRRYF QLI
Sbjct  61   MKLVRHPYVVRLHEVIATRTKIYIILEFITGGELFDKIVHHGRLSEAESRRYFQQLI  117



>ref|XP_009790121.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
isoform X1 [Nicotiana sylvestris]
Length=471

 Score =   225 bits (573),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 108/117 (92%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MV+RK+GKYEVGRTIGEGTFAKVKFAQNTETGESVAMKV+DR+ IIKHKMVDQIKREISI
Sbjct  1    MVIRKLGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVLDRTTIIKHKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEVIA+RTKIYIILEFITGGELFDKI+HHGRL EAESRRYF QLI
Sbjct  61   MKLVRHPYVVRLHEVIATRTKIYIILEFITGGELFDKIVHHGRLSEAESRRYFQQLI  117



>ref|XP_009790123.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
isoform X3 [Nicotiana sylvestris]
Length=454

 Score =   224 bits (571),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 108/117 (92%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MV+RK+GKYEVGRTIGEGTFAKVKFAQNTETGESVAMKV+DR+ IIKHKMVDQIKREISI
Sbjct  1    MVIRKLGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVLDRTTIIKHKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEVIA+RTKIYIILEFITGGELFDKI+HHGRL EAESRRYF QLI
Sbjct  61   MKLVRHPYVVRLHEVIATRTKIYIILEFITGGELFDKIVHHGRLSEAESRRYFQQLI  117



>gb|KEH28132.1| CBL-interacting kinase [Medicago truncatula]
Length=407

 Score =   223 bits (568),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 106/117 (91%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MV+RKVGKYE+GRTIGEGTFAKVKFAQNTETGESVAMK++DRS IIKHKM DQIKREISI
Sbjct  1    MVLRKVGKYEIGRTIGEGTFAKVKFAQNTETGESVAMKILDRSTIIKHKMADQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEV+ASRTKIYIILEFITGGELFDKI+HHGRL EAE+RRYF QLI
Sbjct  61   MKLVRHPYVVRLHEVLASRTKIYIILEFITGGELFDKIVHHGRLSEAEARRYFQQLI  117



>gb|KHN08228.1| CBL-interacting serine/threonine-protein kinase 8 [Glycine soja]
Length=417

 Score =   223 bits (569),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 108/117 (92%), Positives = 112/117 (96%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYE+GRTIGEGTFAKVKFAQNTETGESVAMKV+DRS IIKHKM DQIKREISI
Sbjct  1    MVVRKVGKYEIGRTIGEGTFAKVKFAQNTETGESVAMKVLDRSTIIKHKMADQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEV+ASRTKIYIILEFITGGELFDKIIHHGRL E +SRRYF QLI
Sbjct  61   MKLVRHPYVVRLHEVLASRTKIYIILEFITGGELFDKIIHHGRLSETDSRRYFQQLI  117



>ref|XP_003519209.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
isoform X1 [Glycine max]
Length=444

 Score =   224 bits (570),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 107/117 (91%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MV+RKVGKYE+GRT+GEGTFAKVKFAQNTE+GESVAMKV+DRSAIIKHKMVDQIKREISI
Sbjct  1    MVLRKVGKYEIGRTVGEGTFAKVKFAQNTESGESVAMKVLDRSAIIKHKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEV+ASRTKIYIILEFITGGELFDKI+ HGRL EAESRRYF QLI
Sbjct  61   MKLVRHPYVVRLHEVLASRTKIYIILEFITGGELFDKIVSHGRLSEAESRRYFQQLI  117



>ref|XP_004287407.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
[Fragaria vesca subsp. vesca]
Length=446

 Score =   224 bits (570),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 107/117 (91%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYE+GRTIGEGTFAKVKFAQNTETGESVAMK+IDRS+IIKHKMVDQIKREISI
Sbjct  1    MVVRKVGKYEIGRTIGEGTFAKVKFAQNTETGESVAMKIIDRSSIIKHKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEV+ASRTKIYIILEFITGGELFDKI+HHGRL E E+RR+F QLI
Sbjct  61   MKLVRHPYVVRLHEVLASRTKIYIILEFITGGELFDKIVHHGRLSEGEARRFFQQLI  117



>ref|XP_003522743.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8-like 
[Glycine max]
Length=446

 Score =   224 bits (570),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 108/117 (92%), Positives = 112/117 (96%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYE+GRTIGEGTFAKVKFAQNTETGESVAMKV+DRS IIKHKM DQIKREISI
Sbjct  1    MVVRKVGKYEIGRTIGEGTFAKVKFAQNTETGESVAMKVLDRSTIIKHKMADQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEV+ASRTKIYIILEFITGGELFDKIIHHGRL E +SRRYF QLI
Sbjct  61   MKLVRHPYVVRLHEVLASRTKIYIILEFITGGELFDKIIHHGRLSETDSRRYFQQLI  117



>ref|XP_007137664.1| hypothetical protein PHAVU_009G145400g [Phaseolus vulgaris]
 gb|ESW09658.1| hypothetical protein PHAVU_009G145400g [Phaseolus vulgaris]
Length=446

 Score =   224 bits (570),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 108/117 (92%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MV+RKVGKYE+GRTIGEGTFAKVKFAQNTETGESVAMKV+DRS IIKHKMVDQIKREISI
Sbjct  1    MVLRKVGKYEIGRTIGEGTFAKVKFAQNTETGESVAMKVLDRSTIIKHKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRL+EV+ASRTKIYIILEFITGGELFDKIIHHGRL EA+SRRYF QLI
Sbjct  61   MKLVRHPYVVRLYEVLASRTKIYIILEFITGGELFDKIIHHGRLSEADSRRYFQQLI  117



>ref|XP_007137665.1| hypothetical protein PHAVU_009G145400g [Phaseolus vulgaris]
 gb|ESW09659.1| hypothetical protein PHAVU_009G145400g [Phaseolus vulgaris]
Length=444

 Score =   223 bits (569),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 108/117 (92%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MV+RKVGKYE+GRTIGEGTFAKVKFAQNTETGESVAMKV+DRS IIKHKMVDQIKREISI
Sbjct  1    MVLRKVGKYEIGRTIGEGTFAKVKFAQNTETGESVAMKVLDRSTIIKHKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRL+EV+ASRTKIYIILEFITGGELFDKIIHHGRL EA+SRRYF QLI
Sbjct  61   MKLVRHPYVVRLYEVLASRTKIYIILEFITGGELFDKIIHHGRLSEADSRRYFQQLI  117



>gb|AFK34091.1| unknown [Lotus japonicus]
Length=429

 Score =   223 bits (568),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 105/117 (90%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MV+RKVG+YE+GRT+GEGTFAKVKFAQNTE+GESVAMK++DRS IIKHKMVDQIKREISI
Sbjct  1    MVLRKVGRYEIGRTVGEGTFAKVKFAQNTESGESVAMKILDRSTIIKHKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEV+ASRTKIYIILEFITGGELFDKI+HHGRL EAESRRYF QLI
Sbjct  61   MKLVRHPYVVRLHEVLASRTKIYIILEFITGGELFDKIVHHGRLSEAESRRYFQQLI  117



>ref|XP_009366378.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
isoform X2 [Pyrus x bretschneideri]
Length=448

 Score =   223 bits (569),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 108/117 (92%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKV+DR+ IIKHKMVDQIKREISI
Sbjct  1    MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVLDRTTIIKHKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEV+ASRTKIYIILEFITGGELFDKI+HHGRL E E+RRYF QLI
Sbjct  61   MKLVRHPYVVRLHEVLASRTKIYIILEFITGGELFDKIVHHGRLSEGEARRYFQQLI  117



>ref|XP_008357566.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8-like 
isoform X2 [Malus domestica]
Length=448

 Score =   223 bits (569),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 108/117 (92%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKV+DR+ IIKHKMVDQIKREISI
Sbjct  1    MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVLDRTTIIKHKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEV+ASRTKIYIILEFITGGELFDKI+HHGRL E E+RRYF QLI
Sbjct  61   MKLVRHPYVVRLHEVLASRTKIYIILEFITGGELFDKIVHHGRLSEGEARRYFQQLI  117



>ref|XP_008357565.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8-like 
isoform X1 [Malus domestica]
Length=449

 Score =   223 bits (569),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 108/117 (92%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKV+DR+ IIKHKMVDQIKREISI
Sbjct  1    MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVLDRTTIIKHKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEV+ASRTKIYIILEFITGGELFDKI+HHGRL E E+RRYF QLI
Sbjct  61   MKLVRHPYVVRLHEVLASRTKIYIILEFITGGELFDKIVHHGRLSEGEARRYFQQLI  117



>ref|XP_008378623.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
isoform X2 [Malus domestica]
Length=448

 Score =   223 bits (569),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 108/117 (92%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKV+DR+ IIKHKMVDQIKREISI
Sbjct  1    MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVLDRTTIIKHKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEV+ASRTKIYIILEFITGGELFDKI+HHGRL E E+RRYF QLI
Sbjct  61   MKLVRHPYVVRLHEVLASRTKIYIILEFITGGELFDKIVHHGRLSEGEARRYFQQLI  117



>ref|XP_008378622.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
isoform X1 [Malus domestica]
Length=449

 Score =   223 bits (569),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 108/117 (92%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKV+DR+ IIKHKMVDQIKREISI
Sbjct  1    MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVLDRTTIIKHKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEV+ASRTKIYIILEFITGGELFDKI+HHGRL E E+RRYF QLI
Sbjct  61   MKLVRHPYVVRLHEVLASRTKIYIILEFITGGELFDKIVHHGRLSEGEARRYFQQLI  117



>ref|XP_009366377.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
isoform X1 [Pyrus x bretschneideri]
Length=449

 Score =   223 bits (569),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 108/117 (92%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKV+DR+ IIKHKMVDQIKREISI
Sbjct  1    MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVLDRTTIIKHKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEV+ASRTKIYIILEFITGGELFDKI+HHGRL E E+RRYF QLI
Sbjct  61   MKLVRHPYVVRLHEVLASRTKIYIILEFITGGELFDKIVHHGRLSEGEARRYFQQLI  117



>gb|AES98330.2| CBL-interacting kinase [Medicago truncatula]
Length=446

 Score =   223 bits (568),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 106/117 (91%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MV+RKVGKYE+GRTIGEGTFAKVKFAQNTETGESVAMK++DRS IIKHKM DQIKREISI
Sbjct  1    MVLRKVGKYEIGRTIGEGTFAKVKFAQNTETGESVAMKILDRSTIIKHKMADQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEV+ASRTKIYIILEFITGGELFDKI+HHGRL EAE+RRYF QLI
Sbjct  61   MKLVRHPYVVRLHEVLASRTKIYIILEFITGGELFDKIVHHGRLSEAEARRYFQQLI  117



>ref|XP_006433759.1| hypothetical protein CICLE_v10001147mg [Citrus clementina]
 gb|ESR46999.1| hypothetical protein CICLE_v10001147mg [Citrus clementina]
Length=447

 Score =   223 bits (568),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 108/117 (92%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKV+DRSAIIKHKM DQIKREISI
Sbjct  1    MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVLDRSAIIKHKMADQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHP VVRLHEV+ASRTKIYIILEFITGGELFDKI+HHGRL E+E+RRYF QLI
Sbjct  61   MKLVRHPCVVRLHEVLASRTKIYIILEFITGGELFDKIVHHGRLSESEARRYFQQLI  117



>ref|XP_008219188.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
isoform X1 [Prunus mume]
Length=449

 Score =   223 bits (568),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 108/117 (92%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKV+DR+ IIKHKMVDQIKREISI
Sbjct  1    MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVLDRTTIIKHKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEV+ASRTKIYIILEFITGGELFDKI+HHGRL E E+RRYF QLI
Sbjct  61   MKLVRHPYVVRLHEVLASRTKIYIILEFITGGELFDKIVHHGRLSEGEARRYFHQLI  117



>gb|EYU36430.1| hypothetical protein MIMGU_mgv1a006373mg [Erythranthe guttata]
Length=446

 Score =   223 bits (567),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 108/117 (92%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKV+DRS IIKHKMVDQIKREISI
Sbjct  1    MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVLDRSTIIKHKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MK VRHP+VVRLHEVIASRTKIYIILEFITGGELFDKI+HHGRL E+ESRRYF QL+
Sbjct  61   MKRVRHPFVVRLHEVIASRTKIYIILEFITGGELFDKIVHHGRLSESESRRYFQQLV  117



>gb|KJB64073.1| hypothetical protein B456_010G032200 [Gossypium raimondii]
Length=421

 Score =   222 bits (566),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 108/117 (92%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYE+GRTIGEGTFAKVKFAQNTETGESVAMKV+DRS IIKHKMVDQIKREISI
Sbjct  1    MVVRKVGKYEIGRTIGEGTFAKVKFAQNTETGESVAMKVLDRSTIIKHKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKI+H GRL EAE+RR+F QLI
Sbjct  61   MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIVHKGRLSEAEARRFFQQLI  117



>ref|XP_008219189.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
isoform X2 [Prunus mume]
Length=448

 Score =   223 bits (567),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 108/117 (92%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKV+DR+ IIKHKMVDQIKREISI
Sbjct  1    MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVLDRTTIIKHKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEV+ASRTKIYIILEFITGGELFDKI+HHGRL E E+RRYF QLI
Sbjct  61   MKLVRHPYVVRLHEVLASRTKIYIILEFITGGELFDKIVHHGRLSEGEARRYFHQLI  117



>ref|XP_003615372.1| CBL-interacting protein kinase [Medicago truncatula]
Length=475

 Score =   223 bits (569),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 106/117 (91%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MV+RKVGKYE+GRTIGEGTFAKVKFAQNTETGESVAMK++DRS IIKHKM DQIKREISI
Sbjct  1    MVLRKVGKYEIGRTIGEGTFAKVKFAQNTETGESVAMKILDRSTIIKHKMADQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEV+ASRTKIYIILEFITGGELFDKI+HHGRL EAE+RRYF QLI
Sbjct  61   MKLVRHPYVVRLHEVLASRTKIYIILEFITGGELFDKIVHHGRLSEAEARRYFQQLI  117



>ref|XP_009396330.1| PREDICTED: CBL-interacting protein kinase 8 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=377

 Score =   220 bits (561),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 106/117 (91%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            +V+R+VGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKV+DR+ IIKH MVDQIKREISI
Sbjct  2    VVLRRVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVLDRATIIKHNMVDQIKREISI  61

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEV+ASRTKIYIILEFITGGELFDKIIHHG+L EAESRRYF QLI
Sbjct  62   MKLVRHPYVVRLHEVLASRTKIYIILEFITGGELFDKIIHHGKLSEAESRRYFQQLI  118



>ref|XP_007227712.1| hypothetical protein PRUPE_ppa005163mg [Prunus persica]
 gb|EMJ28911.1| hypothetical protein PRUPE_ppa005163mg [Prunus persica]
Length=474

 Score =   223 bits (568),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/117 (92%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKV+DR+ IIKHKMVDQIKREISI
Sbjct  1    MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVLDRTTIIKHKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEV+ASRTKIYIILEFITGGELFDKI+HHGRL E E+RRYF QLI
Sbjct  61   MKLVRHPYVVRLHEVLASRTKIYIILEFITGGELFDKIVHHGRLSEGEARRYFHQLI  117



>ref|XP_006386453.1| hypothetical protein POPTR_0002s10970g [Populus trichocarpa]
 gb|ERP64250.1| hypothetical protein POPTR_0002s10970g [Populus trichocarpa]
Length=416

 Score =   221 bits (564),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/117 (91%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            + +RKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMK++DRS IIKHKMVDQIKREISI
Sbjct  2    VAIRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKILDRSTIIKHKMVDQIKREISI  61

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEV+ASRTKIYIILEFITGGELFDKI+HHGRL EAE+RRYF QLI
Sbjct  62   MKLVRHPYVVRLHEVLASRTKIYIILEFITGGELFDKIVHHGRLSEAEARRYFQQLI  118



>gb|KHG16968.1| CBL-interacting serine/threonine-protein kinase 8 [Gossypium 
arboreum]
Length=431

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/117 (92%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYE+GRTIGEGTFAKVKFAQNTETGESVAMKV+DRS IIKHKMVDQIKREISI
Sbjct  1    MVVRKVGKYEIGRTIGEGTFAKVKFAQNTETGESVAMKVLDRSTIIKHKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKI+H GRL EAE+RR+F QLI
Sbjct  61   MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIVHKGRLSEAEARRFFQQLI  117



>gb|KJB64072.1| hypothetical protein B456_010G032200 [Gossypium raimondii]
Length=449

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/117 (92%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYE+GRTIGEGTFAKVKFAQNTETGESVAMKV+DRS IIKHKMVDQIKREISI
Sbjct  1    MVVRKVGKYEIGRTIGEGTFAKVKFAQNTETGESVAMKVLDRSTIIKHKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKI+H GRL EAE+RR+F QLI
Sbjct  61   MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIVHKGRLSEAEARRFFQQLI  117



>ref|XP_011016974.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
isoform X1 [Populus euphratica]
Length=447

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/117 (91%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            + +RKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMK++DRS IIKHKMVDQIKREISI
Sbjct  2    VAIRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKILDRSTIIKHKMVDQIKREISI  61

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEV+ASRTKIYIILEFITGGELFDKI+HHGRL EAE+RRYF QLI
Sbjct  62   MKLVRHPYVVRLHEVLASRTKIYIILEFITGGELFDKIVHHGRLSEAEARRYFQQLI  118



>ref|XP_002301109.2| hypothetical protein POPTR_0002s10970g [Populus trichocarpa]
 gb|EEE80382.2| hypothetical protein POPTR_0002s10970g [Populus trichocarpa]
Length=447

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/117 (91%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            + +RKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMK++DRS IIKHKMVDQIKREISI
Sbjct  2    VAIRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKILDRSTIIKHKMVDQIKREISI  61

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEV+ASRTKIYIILEFITGGELFDKI+HHGRL EAE+RRYF QLI
Sbjct  62   MKLVRHPYVVRLHEVLASRTKIYIILEFITGGELFDKIVHHGRLSEAEARRYFQQLI  118



>gb|AFO10125.1| CIPK [Gossypium aridum]
Length=449

 Score =   222 bits (565),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 108/117 (92%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYE+GRTIGEGTFAKVKFAQNTETGESVAMKV+DRS IIKHKMVDQIKREISI
Sbjct  1    MVVRKVGKYEIGRTIGEGTFAKVKFAQNTETGESVAMKVLDRSTIIKHKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKI+H GRL EAE+RR+F QLI
Sbjct  61   MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIVHKGRLSEAEARRFFQQLI  117



>gb|KHG19822.1| CBL-interacting serine/threonine-protein kinase 8 [Gossypium 
arboreum]
Length=449

 Score =   221 bits (563),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 106/117 (91%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYE+GRTIGEGTFAKVKFAQNTETGESVAMKV+DRS IIKHKMVDQIKREISI
Sbjct  1    MVVRKVGKYEIGRTIGEGTFAKVKFAQNTETGESVAMKVLDRSTIIKHKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEVIASRT+IYIILEFITGGELFDK++H+GR  EAE+RRYF QLI
Sbjct  61   MKLVRHPYVVRLHEVIASRTRIYIILEFITGGELFDKLVHNGRFSEAEARRYFQQLI  117



>gb|KJB58803.1| hypothetical protein B456_009G226900 [Gossypium raimondii]
Length=449

 Score =   221 bits (563),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 106/117 (91%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYE+GRTIGEGTFAKVKFAQNTETGESVAMKV+DRS IIKHKMVDQIKREISI
Sbjct  1    MVVRKVGKYEIGRTIGEGTFAKVKFAQNTETGESVAMKVLDRSTIIKHKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEVIASRT+IYIILEFITGGELFDK++H+GR  EAE+RRYF QLI
Sbjct  61   MKLVRHPYVVRLHEVIASRTRIYIILEFITGGELFDKLVHNGRFSEAEARRYFQQLI  117



>gb|KJB58806.1| hypothetical protein B456_009G226900 [Gossypium raimondii]
Length=435

 Score =   221 bits (562),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 106/117 (91%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYE+GRTIGEGTFAKVKFAQNTETGESVAMKV+DRS IIKHKMVDQIKREISI
Sbjct  1    MVVRKVGKYEIGRTIGEGTFAKVKFAQNTETGESVAMKVLDRSTIIKHKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEVIASRT+IYIILEFITGGELFDK++H+GR  EAE+RRYF QLI
Sbjct  61   MKLVRHPYVVRLHEVIASRTRIYIILEFITGGELFDKLVHNGRFSEAEARRYFQQLI  117



>gb|KJB58804.1| hypothetical protein B456_009G226900 [Gossypium raimondii]
Length=428

 Score =   220 bits (561),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 106/117 (91%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYE+GRTIGEGTFAKVKFAQNTETGESVAMKV+DRS IIKHKMVDQIKREISI
Sbjct  1    MVVRKVGKYEIGRTIGEGTFAKVKFAQNTETGESVAMKVLDRSTIIKHKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEVIASRT+IYIILEFITGGELFDK++H+GR  EAE+RRYF QLI
Sbjct  61   MKLVRHPYVVRLHEVIASRTRIYIILEFITGGELFDKLVHNGRFSEAEARRYFQQLI  117



>ref|XP_010254634.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
[Nelumbo nucifera]
 ref|XP_010254635.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
[Nelumbo nucifera]
 ref|XP_010254636.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
[Nelumbo nucifera]
Length=444

 Score =   221 bits (562),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 106/117 (91%), Positives = 112/117 (96%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYE+GRTIGEGTFAKVKFAQNTETGESVAMKV+DR+ IIKHKM+DQIKREISI
Sbjct  1    MVVRKVGKYEIGRTIGEGTFAKVKFAQNTETGESVAMKVLDRNTIIKHKMIDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEV+ASRTKIYIILEFITGGELFDKI+H GRL E ESRRYF QLI
Sbjct  61   MKLVRHPYVVRLHEVLASRTKIYIILEFITGGELFDKIVHQGRLSETESRRYFQQLI  117



>ref|XP_009396329.1| PREDICTED: CBL-interacting protein kinase 8 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=442

 Score =   220 bits (561),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 106/117 (91%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            +V+R+VGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKV+DR+ IIKH MVDQIKREISI
Sbjct  2    VVLRRVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVLDRATIIKHNMVDQIKREISI  61

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEV+ASRTKIYIILEFITGGELFDKIIHHG+L EAESRRYF QLI
Sbjct  62   MKLVRHPYVVRLHEVLASRTKIYIILEFITGGELFDKIIHHGKLSEAESRRYFQQLI  118



>ref|XP_009396326.1| PREDICTED: CBL-interacting protein kinase 8 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009396328.1| PREDICTED: CBL-interacting protein kinase 8 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=443

 Score =   220 bits (561),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 106/117 (91%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            +V+R+VGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKV+DR+ IIKH MVDQIKREISI
Sbjct  2    VVLRRVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVLDRATIIKHNMVDQIKREISI  61

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEV+ASRTKIYIILEFITGGELFDKIIHHG+L EAESRRYF QLI
Sbjct  62   MKLVRHPYVVRLHEVLASRTKIYIILEFITGGELFDKIIHHGKLSEAESRRYFQQLI  118



>emb|CDP00953.1| unnamed protein product [Coffea canephora]
Length=446

 Score =   220 bits (560),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/117 (91%), Positives = 112/117 (96%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYE+GRTIGEGTFAKVKFAQNTETGESVAMK++DRS IIKHKMVDQIKREISI
Sbjct  1    MVVRKVGKYEIGRTIGEGTFAKVKFAQNTETGESVAMKILDRSTIIKHKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVV+ + VIASRTKIYIILEFITGGELFDKI+HHGRL EAESRRYF QLI
Sbjct  61   MKLVRHPYVVQFYAVIASRTKIYIILEFITGGELFDKIVHHGRLSEAESRRYFQQLI  117



>ref|XP_006472400.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8-like 
[Citrus sinensis]
Length=447

 Score =   220 bits (560),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 107/117 (91%), Positives = 112/117 (96%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKV+DRSAIIKHKM DQIKREISI
Sbjct  1    MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVLDRSAIIKHKMADQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHP VVRLHEV+ASRTKIYIILEFITGGELFDKI+HHGRL E+E+RRY  QLI
Sbjct  61   MKLVRHPCVVRLHEVLASRTKIYIILEFITGGELFDKIVHHGRLSESEARRYIQQLI  117



>ref|XP_004148410.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
[Cucumis sativus]
 gb|KGN62772.1| hypothetical protein Csa_2G372190 [Cucumis sativus]
Length=446

 Score =   219 bits (558),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 106/117 (91%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKV+DRS IIKHKMV+QIK+EISI
Sbjct  1    MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVLDRSTIIKHKMVEQIKKEISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEV+ASRTKIYIILE+ITGGELFDKI+ HGRL EAESR+YF QLI
Sbjct  61   MKLVRHPYVVRLHEVLASRTKIYIILEYITGGELFDKIVRHGRLSEAESRKYFQQLI  117



>ref|XP_008444962.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
[Cucumis melo]
Length=446

 Score =   219 bits (557),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 105/117 (90%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKV+DRS IIKHKMV+QIK+EISI
Sbjct  1    MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVLDRSTIIKHKMVEQIKKEISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPY+VRLHEV+ASRTKIYIILE+ITGGELFDKI+ HGRL EAESR+YF QLI
Sbjct  61   MKLVRHPYIVRLHEVLASRTKIYIILEYITGGELFDKIVRHGRLSEAESRKYFQQLI  117



>dbj|BAD95890.1| Ser/Thr protein kinase [Lotus japonicus]
Length=448

 Score =   218 bits (556),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 106/117 (91%), Positives = 112/117 (96%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MV+RKVGKYE+GRTIGEGTFAKVKFAQNTETGESVAMKV+DR+ IIKH MVDQIKREISI
Sbjct  1    MVLRKVGKYEIGRTIGEGTFAKVKFAQNTETGESVAMKVLDRNTIIKHNMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRL+EV+ASRTKIYIILEFITGGELFDKII HGRL EAESRRYF QLI
Sbjct  61   MKLVRHPYVVRLYEVLASRTKIYIILEFITGGELFDKIIRHGRLSEAESRRYFQQLI  117



>ref|XP_010664075.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8-like 
isoform X1 [Vitis vinifera]
Length=447

 Score =   218 bits (555),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 106/117 (91%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            + VRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKV+DRS IIKHKM DQIKREISI
Sbjct  2    VAVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVLDRSTIIKHKMTDQIKREISI  61

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEV+ASRTKIYIILEFITGGELFDKI+HHGRL E ESR YF QLI
Sbjct  62   MKLVRHPYVVRLHEVLASRTKIYIILEFITGGELFDKIVHHGRLSENESRSYFQQLI  118



>emb|CBI19308.3| unnamed protein product [Vitis vinifera]
Length=453

 Score =   218 bits (554),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/117 (91%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            + VRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKV+DRS IIKHKM DQIKREISI
Sbjct  2    VAVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVLDRSTIIKHKMTDQIKREISI  61

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEV+ASRTKIYIILEFITGGELFDKI+HHGRL E ESR YF QLI
Sbjct  62   MKLVRHPYVVRLHEVLASRTKIYIILEFITGGELFDKIVHHGRLSENESRSYFQQLI  118



>ref|XP_007141302.1| hypothetical protein PHAVU_008G184400g [Phaseolus vulgaris]
 gb|ESW13296.1| hypothetical protein PHAVU_008G184400g [Phaseolus vulgaris]
Length=446

 Score =   217 bits (553),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/117 (89%), Positives = 112/117 (96%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MV+RKVGKYE+GRT+GEGTFAKVKFAQNTETGESVAMKV+DRS IIKHKMVDQIK EISI
Sbjct  1    MVLRKVGKYEIGRTVGEGTFAKVKFAQNTETGESVAMKVLDRSTIIKHKMVDQIKMEISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRL+EV+ASRTKIYIILEFITGGELFDKI+ HGRL EA+SRRYF QLI
Sbjct  61   MKLVRHPYVVRLYEVLASRTKIYIILEFITGGELFDKIVSHGRLSEADSRRYFQQLI  117



>ref|XP_008778476.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8-like, 
partial [Phoenix dactylifera]
Length=249

 Score =   211 bits (536),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/117 (86%), Positives = 112/117 (96%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYEVGRTIG GTFAKVKFAQNTE+GESVAMKV+DR+ IIKHKMVDQIKREI I
Sbjct  1    MVVRKVGKYEVGRTIGAGTFAKVKFAQNTESGESVAMKVLDRATIIKHKMVDQIKREIFI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHP+VVRL+EV+ASRTKIYIILEFITGGELFDKI+HHG+L EA++RRYF QL+
Sbjct  61   MKLVRHPHVVRLYEVLASRTKIYIILEFITGGELFDKIVHHGKLSEADARRYFQQLV  117



>ref|XP_010519151.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
isoform X1 [Tarenaya hassleriana]
Length=446

 Score =   215 bits (548),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 104/117 (89%), Positives = 112/117 (96%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYE+GRTIGEGTFAKVKFAQNTE+GESVAMKV+DRS IIK KMVDQIKREISI
Sbjct  1    MVVRKVGKYEIGRTIGEGTFAKVKFAQNTESGESVAMKVVDRSTIIKRKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEV+ASRTKIYIILE+ITGGELFDKI+ HGRL EAE+R+YF QLI
Sbjct  61   MKLVRHPYVVRLHEVLASRTKIYIILEYITGGELFDKIVRHGRLSEAEARKYFQQLI  117



>ref|XP_010519152.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
isoform X2 [Tarenaya hassleriana]
Length=428

 Score =   215 bits (547),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 104/117 (89%), Positives = 112/117 (96%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYE+GRTIGEGTFAKVKFAQNTE+GESVAMKV+DRS IIK KMVDQIKREISI
Sbjct  1    MVVRKVGKYEIGRTIGEGTFAKVKFAQNTESGESVAMKVVDRSTIIKRKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEV+ASRTKIYIILE+ITGGELFDKI+ HGRL EAE+R+YF QLI
Sbjct  61   MKLVRHPYVVRLHEVLASRTKIYIILEYITGGELFDKIVRHGRLSEAEARKYFQQLI  117



>ref|XP_010520824.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
isoform X2 [Tarenaya hassleriana]
Length=429

 Score =   214 bits (546),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/117 (89%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYE+GRTIGEGTFAKVKFAQNTETGESVAMKV+DR  IIK KMVDQIKREISI
Sbjct  1    MVVRKVGKYEIGRTIGEGTFAKVKFAQNTETGESVAMKVVDRGTIIKRKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEV+ASRTKIYIILE+ITGGELFDKI+ HGRL EAE+R+YF QLI
Sbjct  61   MKLVRHPYVVRLHEVLASRTKIYIILEYITGGELFDKIVRHGRLSEAETRKYFQQLI  117



>ref|XP_010671024.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=450

 Score =   215 bits (547),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/117 (88%), Positives = 112/117 (96%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYE+GRT+GEGTFAKVKFAQNTETGESVAMKV+DRS I+KHKMV+QIKREISI
Sbjct  1    MVVRKVGKYEIGRTVGEGTFAKVKFAQNTETGESVAMKVLDRSTILKHKMVEQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHP+VVRLHEV+ASRTKIYIILE+ITGGELFDKI HHGRL E E+RRYF QLI
Sbjct  61   MKLVRHPHVVRLHEVLASRTKIYIILEYITGGELFDKIAHHGRLSELEARRYFQQLI  117



>ref|XP_006856630.1| PREDICTED: CBL-interacting protein kinase 8 isoform X2 [Amborella 
trichopoda]
 gb|ERN18097.1| hypothetical protein AMTR_s00046p00229830 [Amborella trichopoda]
Length=442

 Score =   215 bits (547),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/117 (87%), Positives = 112/117 (96%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MV+RKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKV+D+++I+KHKM DQIKREISI
Sbjct  1    MVIRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVLDKASILKHKMADQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEV+ASRTKIYIILEFITGGELFDKI+H GRL E +SR+YF QLI
Sbjct  61   MKLVRHPYVVRLHEVLASRTKIYIILEFITGGELFDKIVHRGRLSENDSRKYFQQLI  117



>ref|XP_010671031.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=447

 Score =   215 bits (547),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/117 (88%), Positives = 112/117 (96%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYE+GRT+GEGTFAKVKFAQNTETGESVAMKV+DRS I+KHKMV+QIKREISI
Sbjct  1    MVVRKVGKYEIGRTVGEGTFAKVKFAQNTETGESVAMKVLDRSTILKHKMVEQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHP+VVRLHEV+ASRTKIYIILE+ITGGELFDKI HHGRL E E+RRYF QLI
Sbjct  61   MKLVRHPHVVRLHEVLASRTKIYIILEYITGGELFDKIAHHGRLSELEARRYFQQLI  117



>ref|XP_010520822.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010520823.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
isoform X1 [Tarenaya hassleriana]
Length=446

 Score =   214 bits (546),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/117 (89%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYE+GRTIGEGTFAKVKFAQNTETGESVAMKV+DR  IIK KMVDQIKREISI
Sbjct  1    MVVRKVGKYEIGRTIGEGTFAKVKFAQNTETGESVAMKVVDRGTIIKRKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEV+ASRTKIYIILE+ITGGELFDKI+ HGRL EAE+R+YF QLI
Sbjct  61   MKLVRHPYVVRLHEVLASRTKIYIILEYITGGELFDKIVRHGRLSEAETRKYFQQLI  117



>gb|EMT28938.1| CBL-interacting protein kinase 8 [Aegilops tauschii]
Length=201

 Score =   205 bits (522),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 110/116 (95%), Gaps = 0/116 (0%)
 Frame = +3

Query  456  VVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIM  635
             +R+VGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKV+DRS+I+KHKMVDQIKREISIM
Sbjct  9    ALRRVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVLDRSSILKHKMVDQIKREISIM  68

Query  636  KLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            KLVRHP VVRL+EV+ASR KI+IILEFITGGELFDKII HGRL EA++R+YF QLI
Sbjct  69   KLVRHPNVVRLYEVLASRKKIFIILEFITGGELFDKIIRHGRLSEADARKYFQQLI  124



>ref|XP_010924073.1| PREDICTED: CBL-interacting protein kinase 8 isoform X3 [Elaeis 
guineensis]
Length=412

 Score =   212 bits (539),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 103/117 (88%), Positives = 112/117 (96%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYEVGRTIG+GTFAKVKFAQNTETGESVAMKV+DR+ IIKHKMVDQIKREI I
Sbjct  1    MVVRKVGKYEVGRTIGQGTFAKVKFAQNTETGESVAMKVLDRATIIKHKMVDQIKREIFI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHP+VVRL+EV+ASRTKIYIILEFITGGELFDKI+H G+L EA+SRRYF QLI
Sbjct  61   MKLVRHPHVVRLYEVLASRTKIYIILEFITGGELFDKIVHRGKLSEADSRRYFQQLI  117



>ref|XP_010924071.1| PREDICTED: CBL-interacting protein kinase 8 isoform X1 [Elaeis 
guineensis]
Length=442

 Score =   212 bits (539),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/117 (88%), Positives = 112/117 (96%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYEVGRTIG+GTFAKVKFAQNTETGESVAMKV+DR+ IIKHKMVDQIKREI I
Sbjct  1    MVVRKVGKYEVGRTIGQGTFAKVKFAQNTETGESVAMKVLDRATIIKHKMVDQIKREIFI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHP+VVRL+EV+ASRTKIYIILEFITGGELFDKI+H G+L EA+SRRYF QLI
Sbjct  61   MKLVRHPHVVRLYEVLASRTKIYIILEFITGGELFDKIVHRGKLSEADSRRYFQQLI  117



>gb|KFK26443.1| hypothetical protein AALP_AA8G249200 [Arabis alpina]
Length=444

 Score =   212 bits (539),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 101/117 (86%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYE+GRTIGEGTFAKVKFAQNTETGESVAMK++DRS I+K KM DQIKREISI
Sbjct  1    MVVRKVGKYEIGRTIGEGTFAKVKFAQNTETGESVAMKIMDRSTIVKRKMADQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRL+EV+ASRTKIYIILE+ITGGELFDKI+ HGRL EAE+R+YF QLI
Sbjct  61   MKLVRHPYVVRLYEVLASRTKIYIILEYITGGELFDKIVRHGRLTEAEARKYFQQLI  117



>gb|KHN09031.1| CBL-interacting serine/threonine-protein kinase 8 [Glycine soja]
Length=490

 Score =   213 bits (542),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 114/143 (80%), Gaps = 26/143 (18%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYE+GRTIGEGTFAKVKFAQNTETGESVAMKV+DRS IIKHKMVDQIKREISI
Sbjct  1    MVVRKVGKYEIGRTIGEGTFAKVKFAQNTETGESVAMKVLDRSTIIKHKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHE--------------------------VIASRTKIYIILEFITGGEL  734
            MKLVRHPYVVRLHE                          V+ASRTKIYIILEFITGGEL
Sbjct  61   MKLVRHPYVVRLHEACDNCFPFSYCHSQALLSIVKRFFLQVLASRTKIYIILEFITGGEL  120

Query  735  FDKIIHHGRLXEAESRRYFXQLI  803
            FDKIIHHGRL EA+SRRYF QLI
Sbjct  121  FDKIIHHGRLSEADSRRYFQQLI  143



>ref|XP_010924072.1| PREDICTED: CBL-interacting protein kinase 8 isoform X2 [Elaeis 
guineensis]
Length=441

 Score =   212 bits (539),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/117 (88%), Positives = 112/117 (96%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYEVGRTIG+GTFAKVKFAQNTETGESVAMKV+DR+ IIKHKMVDQIKREI I
Sbjct  1    MVVRKVGKYEVGRTIGQGTFAKVKFAQNTETGESVAMKVLDRATIIKHKMVDQIKREIFI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHP+VVRL+EV+ASRTKIYIILEFITGGELFDKI+H G+L EA+SRRYF QLI
Sbjct  61   MKLVRHPHVVRLYEVLASRTKIYIILEFITGGELFDKIVHRGKLSEADSRRYFQQLI  117



>gb|KFK26444.1| hypothetical protein AALP_AA8G249200 [Arabis alpina]
Length=448

 Score =   212 bits (539),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 101/117 (86%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYE+GRTIGEGTFAKVKFAQNTETGESVAMK++DRS I+K KM DQIKREISI
Sbjct  1    MVVRKVGKYEIGRTIGEGTFAKVKFAQNTETGESVAMKIMDRSTIVKRKMADQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRL+EV+ASRTKIYIILE+ITGGELFDKI+ HGRL EAE+R+YF QLI
Sbjct  61   MKLVRHPYVVRLYEVLASRTKIYIILEYITGGELFDKIVRHGRLTEAEARKYFQQLI  117



>ref|NP_001291255.1| CBL-interacting serine/threonine-protein kinase 24 [Populus euphratica]
 gb|ACN76476.1| CBL-interacting protein kinase 26 [Populus euphratica]
Length=444

 Score =   212 bits (539),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/119 (85%), Positives = 111/119 (93%), Gaps = 0/119 (0%)
 Frame = +3

Query  447  LKMVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREI  626
            +K V RKVGKYEVGRTIGEGTFAKVKFAQN ETGESVAMK++ +SAI+KH+MVDQIKREI
Sbjct  2    MKKVTRKVGKYEVGRTIGEGTFAKVKFAQNRETGESVAMKILSKSAILKHRMVDQIKREI  61

Query  627  SIMKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            SIMKLVRHPY+VRLHEV+ASRTKIYIILEF+TGGELFDKI+H GRL E ESRRYF QLI
Sbjct  62   SIMKLVRHPYIVRLHEVLASRTKIYIILEFVTGGELFDKIVHQGRLGENESRRYFQQLI  120



>ref|XP_011017771.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
isoform X1 [Populus euphratica]
 ref|XP_011017772.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
isoform X1 [Populus euphratica]
Length=444

 Score =   212 bits (539),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/119 (85%), Positives = 111/119 (93%), Gaps = 0/119 (0%)
 Frame = +3

Query  447  LKMVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREI  626
            +K V RKVGKYEVGRTIGEGTFAKVKFAQN ETGESVAMK++ +SAI+KH+MVDQIKREI
Sbjct  2    MKKVTRKVGKYEVGRTIGEGTFAKVKFAQNRETGESVAMKILSKSAILKHRMVDQIKREI  61

Query  627  SIMKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            SIMKLVRHPY+VRLHEV+ASRTKIYIILEF+TGGELFDKI+H GRL E ESRRYF QLI
Sbjct  62   SIMKLVRHPYIVRLHEVLASRTKIYIILEFVTGGELFDKIVHQGRLGENESRRYFQQLI  120



>emb|CDM83002.1| unnamed protein product [Triticum aestivum]
Length=366

 Score =   209 bits (531),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 100/116 (86%), Positives = 110/116 (95%), Gaps = 0/116 (0%)
 Frame = +3

Query  456  VVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIM  635
             +R+VGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKV+DRS+I+KHKMVDQIKREISIM
Sbjct  9    ALRRVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVLDRSSILKHKMVDQIKREISIM  68

Query  636  KLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            KLVRHP VVRLHEV+ASR KI+IILEFITGGELFDKII HGRL EA++R+YF QLI
Sbjct  69   KLVRHPNVVRLHEVLASRKKIFIILEFITGGELFDKIIRHGRLSEADARKYFQQLI  124



>ref|XP_011627891.1| PREDICTED: CBL-interacting protein kinase 8 isoform X1 [Amborella 
trichopoda]
Length=443

 Score =   210 bits (535),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 112/118 (95%), Gaps = 1/118 (1%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MV+RKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKV+D+++I+KHKM DQIKREISI
Sbjct  1    MVIRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVLDKASILKHKMADQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKI-IHHGRLXEAESRRYFXQLI  803
            MKLVRHPYVVRLHEV+ASRTKIYIILEFITGGELFDKI +H GRL E +SR+YF QLI
Sbjct  61   MKLVRHPYVVRLHEVLASRTKIYIILEFITGGELFDKIQVHRGRLSENDSRKYFQQLI  118



>ref|XP_010250123.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
[Nelumbo nucifera]
 ref|XP_010250124.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
[Nelumbo nucifera]
Length=444

 Score =   209 bits (531),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MV RKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKV+ +S I+KHKMVDQIKREISI
Sbjct  1    MVTRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVMAKSTILKHKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MK+VRHP +VRLHEV+ASRTKIYIIL+F+TGGELFDKI+H GRL E ESRRYF QLI
Sbjct  61   MKIVRHPNIVRLHEVLASRTKIYIILDFVTGGELFDKIVHQGRLPENESRRYFQQLI  117



>ref|NP_001078442.1| CBL-interacting serine/threonine-protein kinase 8 [Arabidopsis 
thaliana]
 gb|AEE84900.1| CBL-interacting serine/threonine-protein kinase 8 [Arabidopsis 
thaliana]
Length=416

 Score =   207 bits (526),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYE+GRTIGEGTFAKVKFAQNTETGESVAMK++DRS IIK KMVDQIKREISI
Sbjct  1    MVVRKVGKYELGRTIGEGTFAKVKFAQNTETGESVAMKIVDRSTIIKRKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHP VVRL+EV+ASRTKIYIILE+ITGGELFDKI+ +GRL E+E+R+YF QLI
Sbjct  61   MKLVRHPCVVRLYEVLASRTKIYIILEYITGGELFDKIVRNGRLSESEARKYFHQLI  117



>ref|NP_001043259.1| Os01g0536000 [Oryza sativa Japonica Group]
 sp|Q5JLD8.1|CIPK8_ORYSJ RecName: Full=CBL-interacting protein kinase 8; AltName: Full=OsCIPK08 
[Oryza sativa Japonica Group]
 dbj|BAD87720.1| putative serine/threonine kinase [Oryza sativa Japonica Group]
 dbj|BAF05173.1| Os01g0536000 [Oryza sativa Japonica Group]
Length=446

 Score =   207 bits (528),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 111/123 (90%), Gaps = 4/123 (3%)
 Frame = +3

Query  435  GGSCLKMVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQI  614
            GG  L    R+VGKYEVGRTIGEGTFAKVKFAQNTE+GESVAMKV+DRS+I+KHKM DQI
Sbjct  3    GGGAL----RRVGKYEVGRTIGEGTFAKVKFAQNTESGESVAMKVVDRSSILKHKMADQI  58

Query  615  KREISIMKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFX  794
            KREISIMKLVRHP VVRLHEV+ASR KI+IILEFITGGELFDKII HGRL EA++RRYF 
Sbjct  59   KREISIMKLVRHPNVVRLHEVLASRKKIFIILEFITGGELFDKIIRHGRLNEADARRYFQ  118

Query  795  QLI  803
            QLI
Sbjct  119  QLI  121



>ref|XP_003569165.1| PREDICTED: CBL-interacting protein kinase 8 [Brachypodium distachyon]
Length=450

 Score =   207 bits (527),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 110/116 (95%), Gaps = 0/116 (0%)
 Frame = +3

Query  456  VVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIM  635
             +R+VGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKV+DRS+I++HKMVDQIKREISIM
Sbjct  10   ALRRVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVLDRSSILRHKMVDQIKREISIM  69

Query  636  KLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            KLVRHP VVRLHEV+ASR KI+IILEFITGGELFDKII HGRL EA++R+YF QLI
Sbjct  70   KLVRHPNVVRLHEVLASRKKIFIILEFITGGELFDKIIRHGRLAEADARKYFQQLI  125



>ref|NP_194171.1| CBL-interacting serine/threonine-protein kinase 8 [Arabidopsis 
thaliana]
 sp|Q9STV4.1|CIPK8_ARATH RecName: Full=CBL-interacting serine/threonine-protein kinase 
8; AltName: Full=SNF1-related kinase 3.13; AltName: Full=SOS2-like 
protein kinase PKS11 [Arabidopsis thaliana]
 gb|AAK16683.2|AF290193_1 CBL-interacting protein kinase 8 [Arabidopsis thaliana]
 emb|CAB45075.1| serine/threonine kinase-like protein [Arabidopsis thaliana]
 emb|CAB79350.1| serine/threonine kinase-like protein [Arabidopsis thaliana]
 gb|AAN41358.1| putative serine/threonine kinase [Arabidopsis thaliana]
 gb|AEE84899.1| CBL-interacting serine/threonine-protein kinase 8 [Arabidopsis 
thaliana]
Length=445

 Score =   207 bits (526),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYE+GRTIGEGTFAKVKFAQNTETGESVAMK++DRS IIK KMVDQIKREISI
Sbjct  1    MVVRKVGKYELGRTIGEGTFAKVKFAQNTETGESVAMKIVDRSTIIKRKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHP VVRL+EV+ASRTKIYIILE+ITGGELFDKI+ +GRL E+E+R+YF QLI
Sbjct  61   MKLVRHPCVVRLYEVLASRTKIYIILEYITGGELFDKIVRNGRLSESEARKYFHQLI  117



>ref|XP_006413437.1| hypothetical protein EUTSA_v10025204mg [Eutrema salsugineum]
 gb|ESQ54890.1| hypothetical protein EUTSA_v10025204mg [Eutrema salsugineum]
Length=445

 Score =   207 bits (526),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYE+GRTIGEGTFAKVKFAQNTETGESVAMK++DRS I+K KMVDQIKREISI
Sbjct  1    MVVRKVGKYELGRTIGEGTFAKVKFAQNTETGESVAMKIVDRSTILKRKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHP VVRL+EV+ASRTKIYIILE+ITGGELFDKI+ +GRL EAE+R+YF QLI
Sbjct  61   MKLVRHPCVVRLYEVLASRTKIYIILEYITGGELFDKIVRNGRLSEAEARKYFHQLI  117



>ref|XP_002869721.1| cbl-interacting protein kinase 8 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45980.1| cbl-interacting protein kinase 8 [Arabidopsis lyrata subsp. lyrata]
Length=445

 Score =   207 bits (526),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYE+GRTIGEGTFAKVKFAQNTETGESVAMK++DRS IIK KMVDQIKREISI
Sbjct  1    MVVRKVGKYELGRTIGEGTFAKVKFAQNTETGESVAMKIVDRSTIIKRKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHP VVRL+EV+ASRTKIYIILE+ITGGELFDKI+ +GRL E+E+R+YF QLI
Sbjct  61   MKLVRHPCVVRLYEVLASRTKIYIILEYITGGELFDKIVRNGRLGESEARKYFQQLI  117



>dbj|BAK07603.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=449

 Score =   207 bits (526),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 110/116 (95%), Gaps = 0/116 (0%)
 Frame = +3

Query  456  VVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIM  635
             +R+VGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKV+DRS+I+KHKMVDQIKREISIM
Sbjct  9    ALRRVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVLDRSSILKHKMVDQIKREISIM  68

Query  636  KLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            KLVRHP VVRLHEV+ASR +I+IILEFITGGELFDKII HGRL EA++R+YF QLI
Sbjct  69   KLVRHPNVVRLHEVLASRKRIFIILEFITGGELFDKIIRHGRLGEADARKYFQQLI  124



>ref|XP_002976133.1| hypothetical protein SELMODRAFT_175338 [Selaginella moellendorffii]
 gb|EFJ23038.1| hypothetical protein SELMODRAFT_175338 [Selaginella moellendorffii]
Length=457

 Score =   207 bits (526),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/117 (85%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MV+RKVGKYE+GRTIGEGTFAKVKFAQNTETGESVAMKV+++  I+KHKMVDQIKREISI
Sbjct  1    MVMRKVGKYEIGRTIGEGTFAKVKFAQNTETGESVAMKVLNKETILKHKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHP VVRLHEV+ASRTKIYIILEF+TGGELFDKI+  GRL E ESR+YF QLI
Sbjct  61   MKLVRHPNVVRLHEVLASRTKIYIILEFVTGGELFDKIVDQGRLTEIESRKYFQQLI  117



>gb|EYU36431.1| hypothetical protein MIMGU_mgv1a006373mg [Erythranthe guttata]
Length=441

 Score =   206 bits (525),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/117 (88%), Positives = 108/117 (92%), Gaps = 5/117 (4%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKV+DRS IIKHKMVDQIKREISI
Sbjct  1    MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVLDRSTIIKHKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MK VRHP+V     VIASRTKIYIILEFITGGELFDKI+HHGRL E+ESRRYF QL+
Sbjct  61   MKRVRHPFV-----VIASRTKIYIILEFITGGELFDKIVHHGRLSESESRRYFQQLV  112



>tpg|DAA52653.1| TPA: putative CBL-interacting protein kinase family protein [Zea 
mays]
Length=349

 Score =   204 bits (519),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/115 (85%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +3

Query  459  VRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMK  638
            +R+VGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKV+DRS+I+K+KM +QIKREISIMK
Sbjct  125  LRRVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVLDRSSILKNKMAEQIKREISIMK  184

Query  639  LVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            LVRHP VVRLHEV+ASR KI+IILEFITGGELFDKII HGRL EA++RRYF QLI
Sbjct  185  LVRHPNVVRLHEVLASRKKIFIILEFITGGELFDKIIRHGRLSEADARRYFQQLI  239



>gb|AJR22392.1| CBL-interacting protein kinase 8 [Triticum aestivum]
Length=449

 Score =   207 bits (526),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 109/116 (94%), Gaps = 0/116 (0%)
 Frame = +3

Query  456  VVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIM  635
             +R+VGKYEVGRTIGEGTF KVKFAQNTETGESVAMKV+DRS+I+KHKMVDQIKREISIM
Sbjct  9    ALRRVGKYEVGRTIGEGTFDKVKFAQNTETGESVAMKVLDRSSILKHKMVDQIKREISIM  68

Query  636  KLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            KLVRHP VVRLHEV+ASR KI+IILEFITGGELFDKII HGRL EA++R+YF QLI
Sbjct  69   KLVRHPNVVRLHEVLASRKKIFIILEFITGGELFDKIIRHGRLSEADARKYFQQLI  124



>ref|XP_002968247.1| hypothetical protein SELMODRAFT_267186 [Selaginella moellendorffii]
 gb|ACQ83484.1| CBL-interacting protein kinase 05 [Selaginella moellendorffii]
 gb|EFJ30501.1| hypothetical protein SELMODRAFT_267186 [Selaginella moellendorffii]
Length=457

 Score =   207 bits (526),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/117 (85%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MV+RKVGKYE+GRTIGEGTFAKVKFAQNTETGESVAMKV+++  I+KHKMVDQIKREISI
Sbjct  1    MVMRKVGKYEIGRTIGEGTFAKVKFAQNTETGESVAMKVLNKETILKHKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHP VVRLHEV+ASRTKIYIILEF+TGGELFDKI+  GRL E ESR+YF QLI
Sbjct  61   MKLVRHPNVVRLHEVLASRTKIYIILEFVTGGELFDKIVDQGRLTEIESRKYFQQLI  117



>ref|XP_004971907.1| PREDICTED: CBL-interacting protein kinase 8-like, partial [Setaria 
italica]
Length=519

 Score =   207 bits (528),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 109/116 (94%), Gaps = 0/116 (0%)
 Frame = +3

Query  456  VVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIM  635
             +R+VGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKV+DRS+I+KHKM +QIKREISIM
Sbjct  79   ALRRVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVLDRSSILKHKMAEQIKREISIM  138

Query  636  KLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            KLVRHP VVRLHEV+ASR KI+IILEFITGGELFDKII HGRL EA++RRYF QLI
Sbjct  139  KLVRHPNVVRLHEVLASRKKIFIILEFITGGELFDKIIRHGRLNEADARRYFQQLI  194



>emb|CDY68878.1| BnaA01g35110D [Brassica napus]
Length=446

 Score =   206 bits (523),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 99/117 (85%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYE+GRTIGEGTFAKVKFAQNTETGESVAMK++DR+ I+K KMVDQIKREISI
Sbjct  1    MVVRKVGKYELGRTIGEGTFAKVKFAQNTETGESVAMKIVDRNTILKRKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHP VVRL+EV+ASRTKIYIILE+ITGGELFDKI+ +GRL EAE+R+YF QLI
Sbjct  61   MKLVRHPCVVRLYEVLASRTKIYIILEYITGGELFDKIVRNGRLSEAEARKYFHQLI  117



>ref|XP_002324651.1| CBL-interacting protein kinase 24 [Populus trichocarpa]
 gb|ABJ91232.1| CBL-interacting protein kinase 26 [Populus trichocarpa]
 gb|EEF03216.1| CBL-interacting protein kinase 24 [Populus trichocarpa]
Length=444

 Score =   205 bits (522),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 99/119 (83%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = +3

Query  447  LKMVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREI  626
            +K V RKVGKYEVGRTIGEGTFAKVKFAQN ETGESVAMK++ +SAI+KH+MVDQIKREI
Sbjct  2    MKKVTRKVGKYEVGRTIGEGTFAKVKFAQNRETGESVAMKILSKSAILKHRMVDQIKREI  61

Query  627  SIMKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            SIMKLVRHPY+V LHEV+ASRTKIYIILEF+TGGELFDKI+H  RL E ESRRYF QLI
Sbjct  62   SIMKLVRHPYIVMLHEVLASRTKIYIILEFVTGGELFDKIVHQRRLEENESRRYFQQLI  120



>gb|AGA37211.1| CBL-interacting protein kinase 8.1 [Brassica napus]
Length=451

 Score =   206 bits (523),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 99/117 (85%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYE+GRTIGEGTFAKVKFAQNTETGESVAMK++DR+ I+K KMVDQIKREISI
Sbjct  1    MVVRKVGKYELGRTIGEGTFAKVKFAQNTETGESVAMKIVDRNTILKRKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHP VVRL+EV+ASRTKIYIILE+ITGGELFDKI+ +GRL EAE+R+YF QLI
Sbjct  61   MKLVRHPCVVRLYEVLASRTKIYIILEYITGGELFDKIVRNGRLSEAEARKYFHQLI  117



>emb|CDP10421.1| unnamed protein product [Coffea canephora]
Length=186

 Score =   197 bits (502),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 110/119 (92%), Gaps = 0/119 (0%)
 Frame = +3

Query  447  LKMVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREI  626
            +++V  K+GKYE+GRTIGEGTFAKVKFAQNTETGESVA+KV+ +S I+KHKMVDQIKREI
Sbjct  1    MRLVKNKLGKYELGRTIGEGTFAKVKFAQNTETGESVAVKVLAKSTILKHKMVDQIKREI  60

Query  627  SIMKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            SIMK+VRHPY+V LHEV+AS+TKI+I+LEF+TGGELFDKI+H GRL E +SRRYF QLI
Sbjct  61   SIMKIVRHPYIVGLHEVLASKTKIFIVLEFVTGGELFDKIVHQGRLSEDDSRRYFQQLI  119



>tpg|DAA52654.1| TPA: putative CBL-interacting protein kinase family protein isoform 
1 [Zea mays]
 tpg|DAA52655.1| TPA: putative CBL-interacting protein kinase family protein isoform 
2 [Zea mays]
 tpg|DAA52656.1| TPA: putative CBL-interacting protein kinase family protein isoform 
3 [Zea mays]
Length=402

 Score =   204 bits (518),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 98/115 (85%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +3

Query  459  VRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMK  638
            +R+VGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKV+DRS+I+K+KM +QIKREISIMK
Sbjct  125  LRRVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVLDRSSILKNKMAEQIKREISIMK  184

Query  639  LVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            LVRHP VVRLHEV+ASR KI+IILEFITGGELFDKII HGRL EA++RRYF QLI
Sbjct  185  LVRHPNVVRLHEVLASRKKIFIILEFITGGELFDKIIRHGRLSEADARRYFQQLI  239



>ref|XP_010439044.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
[Camelina sativa]
Length=446

 Score =   205 bits (521),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 98/117 (84%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYE+GRTIGEGTFAKVKFAQNTETGESVAMK++DRS I+K KMVDQIKREISI
Sbjct  1    MVVRKVGKYELGRTIGEGTFAKVKFAQNTETGESVAMKIVDRSTILKRKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHP VVRL+EV+ASRTKIYIILE+ITGGELFD+I+ +GRL E+E+R+YF QLI
Sbjct  61   MKLVRHPCVVRLYEVLASRTKIYIILEYITGGELFDQIVRNGRLGESEARKYFQQLI  117



>ref|XP_010433771.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8-like 
[Camelina sativa]
Length=446

 Score =   205 bits (521),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 98/117 (84%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYE+GRTIGEGTFAKVKFAQNTETGESVAMK++DRS I+K KMVDQIKREISI
Sbjct  1    MVVRKVGKYELGRTIGEGTFAKVKFAQNTETGESVAMKIVDRSTILKRKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHP VVRL+EV+ASRTKIYIILE+ITGGELFD+I+ +GRL E+E+R+YF QLI
Sbjct  61   MKLVRHPCVVRLYEVLASRTKIYIILEYITGGELFDQIVRNGRLGESEARKYFQQLI  117



>ref|XP_006283734.1| hypothetical protein CARUB_v10004806mg [Capsella rubella]
 gb|EOA16632.1| hypothetical protein CARUB_v10004806mg [Capsella rubella]
Length=445

 Score =   204 bits (520),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 99/117 (85%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYE+GRTIGEGTFAKVKFAQNTETGESVAMK++DRS I+K KMVDQIKREISI
Sbjct  1    MVVRKVGKYELGRTIGEGTFAKVKFAQNTETGESVAMKIVDRSTILKRKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHP VVRL+EV+ASRTKIYIILE+ITGGELFDKI+  GRL E+E+R+YF QLI
Sbjct  61   MKLVRHPCVVRLYEVLASRTKIYIILEYITGGELFDKIVRSGRLGESEARKYFHQLI  117



>ref|XP_010448567.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8-like 
[Camelina sativa]
Length=446

 Score =   204 bits (520),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 98/117 (84%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MVVRKVGKYE+GRTIGEGTFAKVKFAQNTETGESVAMK++DRS I+K KMVDQIKREISI
Sbjct  1    MVVRKVGKYELGRTIGEGTFAKVKFAQNTETGESVAMKIVDRSTILKRKMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHP VVRL+EV+ASRTKIYIILE+ITGGELFD+I+ +GRL E+E+R+YF QLI
Sbjct  61   MKLVRHPCVVRLYEVLASRTKIYIILEYITGGELFDQIVRNGRLGESEARKYFQQLI  117



>gb|AGY49229.1| CBL-interacting protein kinase 6 [Physcomitrella patens]
Length=448

 Score =   204 bits (519),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = +3

Query  459  VRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMK  638
            +RKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKV+DR  ++KHKMV+QIKREISIMK
Sbjct  1    MRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVLDRQTVLKHKMVEQIKREISIMK  60

Query  639  LVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            LVRHP VVRLHEV+ASR KIYIILEF+TGGELFDKI+H GRL E +SR+YF QL+
Sbjct  61   LVRHPNVVRLHEVLASRCKIYIILEFVTGGELFDKIVHQGRLNENDSRKYFQQLM  115



>ref|XP_009138030.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
[Brassica rapa]
 ref|XP_009138034.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 8 
[Brassica rapa]
Length=446

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/117 (84%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            +VVRKVGKYE+GRTIGEGTFAKVKFAQNTETGESVAMK++DR+ I+K KMVDQIKREISI
Sbjct  2    VVVRKVGKYELGRTIGEGTFAKVKFAQNTETGESVAMKIVDRNTILKRKMVDQIKREISI  61

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHP VVRL+EV+ASRTKIYIILE+ITGGELFDKI+ +GRL EAE+R+YF QLI
Sbjct  62   MKLVRHPCVVRLYEVLASRTKIYIILEYITGGELFDKIVRNGRLSEAEARKYFHQLI  118



>ref|NP_001268130.1| CBL-interacting serine/threonine-protein kinase 8-like [Vitis 
vinifera]
 gb|ACQ83533.1| CBL-interacting protein kinase 17 [Vitis vinifera]
Length=439

 Score =   202 bits (513),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 101/117 (86%), Positives = 105/117 (90%), Gaps = 5/117 (4%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            + VRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKV+DRS IIKHKM DQIKREISI
Sbjct  2    VAVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVLDRSTIIKHKMTDQIKREISI  61

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MKLVRHPYV     V+ASRTKIYIILEFITGGELFDKI+HHGRL E ESR YF QLI
Sbjct  62   MKLVRHPYV-----VLASRTKIYIILEFITGGELFDKIVHHGRLSENESRSYFQQLI  113



>ref|XP_011078405.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
[Sesamum indicum]
Length=446

 Score =   202 bits (514),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 96/119 (81%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = +3

Query  447  LKMVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREI  626
            +K V RKVGKYEVGRTIGEGTFAKVKFA+NTETGESVA+KV+ +S I+KHKMVDQIKREI
Sbjct  1    MKAVKRKVGKYEVGRTIGEGTFAKVKFARNTETGESVAIKVLAKSTILKHKMVDQIKREI  60

Query  627  SIMKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            SIMK+VRHP +VRLHEV+A + KIYI+LEF+TGGELFDKI+HHGRL E ESRRYF QLI
Sbjct  61   SIMKIVRHPCIVRLHEVLAGQAKIYIVLEFVTGGELFDKIVHHGRLSENESRRYFQQLI  119



>gb|ABK25058.1| unknown [Picea sitchensis]
Length=450

 Score =   202 bits (514),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 95/118 (81%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +3

Query  450  KMVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREIS  629
            K V+ KVGKYE+GRTIGEGTFAKVKFAQNTETGESVAMKV+D+ AI++HKMVDQIKREI 
Sbjct  5    KTVMNKVGKYEIGRTIGEGTFAKVKFAQNTETGESVAMKVLDKGAILRHKMVDQIKREIC  64

Query  630  IMKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            +MKLVRHP +V LHEV+ASRTKIYIILEF+TGGELFDKI+H  RL E ESR+YF QLI
Sbjct  65   VMKLVRHPNIVHLHEVLASRTKIYIILEFVTGGELFDKIVHQQRLSENESRKYFQQLI  122



>tpg|DAA52657.1| TPA: LOW QUALITY PROTEIN: putative CBL-interacting protein kinase 
family protein [Zea mays]
Length=566

 Score =   204 bits (520),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 98/115 (85%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +3

Query  459  VRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMK  638
            +R+VGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKV+DRS+I+K+KM +QIKREISIMK
Sbjct  125  LRRVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVLDRSSILKNKMAEQIKREISIMK  184

Query  639  LVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            LVRHP VVRLHEV+ASR KI+IILEFITGGELFDKII HGRL EA++RRYF QLI
Sbjct  185  LVRHPNVVRLHEVLASRKKIFIILEFITGGELFDKIIRHGRLSEADARRYFQQLI  239



>gb|AIZ68215.1| CBL-interacting protein kinase 09-like protein [Ornithogalum 
saundersiae]
Length=444

 Score =   201 bits (512),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            M  +KVGKYEVGRTIGEGTFAKVKFA+N ETGESVAMKV+++SAI+KHKMV+QIKREISI
Sbjct  1    MGTKKVGKYEVGRTIGEGTFAKVKFARNMETGESVAMKVLEKSAILKHKMVNQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MK+VRHPY+VRLHEV++S++KIYIILEFITGGELFDKI+H G+L E+ESRRYF QLI
Sbjct  61   MKIVRHPYIVRLHEVLSSKSKIYIILEFITGGELFDKIVHQGKLHESESRRYFQQLI  117



>gb|EYU23009.1| hypothetical protein MIMGU_mgv1a0074942mg, partial [Erythranthe 
guttata]
Length=251

 Score =   196 bits (497),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = +3

Query  456  VVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIM  635
            V RKVGKYE+GRTIGEGTFAKVKFAQ+TETGESVA+KV+ +S I+KHKMVDQIKREISIM
Sbjct  4    VKRKVGKYELGRTIGEGTFAKVKFAQSTETGESVAIKVLAKSTILKHKMVDQIKREISIM  63

Query  636  KLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            K+VRHP +V+LHEV++S TKIYI+LEF+TGGELFDKI+ HGR+ E ESRRYF QLI
Sbjct  64   KIVRHPCIVKLHEVLSSHTKIYIVLEFVTGGELFDKIVQHGRISENESRRYFQQLI  119



>tpg|DAA59081.1| TPA: putative CBL-interacting protein kinase family protein [Zea 
mays]
Length=434

 Score =   201 bits (510),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/115 (84%), Positives = 108/115 (94%), Gaps = 0/115 (0%)
 Frame = +3

Query  459  VRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMK  638
            +R+VGKYEVGRTI EGTFAKVKFAQNTETGESVAMKV+DRS+I+K+KM +QIKREISIMK
Sbjct  10   LRRVGKYEVGRTIEEGTFAKVKFAQNTETGESVAMKVLDRSSILKNKMAEQIKREISIMK  69

Query  639  LVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            LVRHP VVRLHEV+ASR KI+IILEFITGGELFDKII HGRL EA++RRYF QLI
Sbjct  70   LVRHPNVVRLHEVLASRKKIFIILEFITGGELFDKIIRHGRLSEADARRYFQQLI  124



>ref|NP_001168497.1| uncharacterized LOC100382276 [Zea mays]
 gb|ACN28426.1| unknown [Zea mays]
 tpg|DAA59082.1| TPA: putative CBL-interacting protein kinase family protein [Zea 
mays]
Length=451

 Score =   201 bits (511),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/115 (84%), Positives = 108/115 (94%), Gaps = 0/115 (0%)
 Frame = +3

Query  459  VRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMK  638
            +R+VGKYEVGRTI EGTFAKVKFAQNTETGESVAMKV+DRS+I+K+KM +QIKREISIMK
Sbjct  10   LRRVGKYEVGRTIEEGTFAKVKFAQNTETGESVAMKVLDRSSILKNKMAEQIKREISIMK  69

Query  639  LVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            LVRHP VVRLHEV+ASR KI+IILEFITGGELFDKII HGRL EA++RRYF QLI
Sbjct  70   LVRHPNVVRLHEVLASRKKIFIILEFITGGELFDKIIRHGRLSEADARRYFQQLI  124



>ref|XP_002308077.2| CBL-interacting protein kinase 24 [Populus trichocarpa]
 gb|EEE91600.2| CBL-interacting protein kinase 24 [Populus trichocarpa]
Length=431

 Score =   200 bits (509),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 96/119 (81%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = +3

Query  447  LKMVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREI  626
            +K V R VGKYEVGRTIGEG FAKVKFAQN ETGESVAMK++ +S I+KHKMVDQIKREI
Sbjct  2    MKKVTRMVGKYEVGRTIGEGNFAKVKFAQNRETGESVAMKILAKSTILKHKMVDQIKREI  61

Query  627  SIMKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            SIMK+VRHP +VRLHEV++SRTKIYIILEF+TGGELFDKI+H GRL E ESRRYF QLI
Sbjct  62   SIMKIVRHPNIVRLHEVLSSRTKIYIILEFVTGGELFDKIVHQGRLSENESRRYFQQLI  120



>gb|ABJ91233.1| CBL-interacting protein kinase 27 [Populus trichocarpa]
Length=431

 Score =   200 bits (509),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 96/119 (81%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = +3

Query  447  LKMVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREI  626
            +K V R VGKYEVGRTIGEG FAKVKFAQN ETGESVAMK++ +S I+KHKMVDQIKREI
Sbjct  2    MKKVTRMVGKYEVGRTIGEGNFAKVKFAQNRETGESVAMKILAKSTILKHKMVDQIKREI  61

Query  627  SIMKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            SIMK+VRHP +VRLHEV++SRTKIYIILEF+TGGELFDKI+H GRL E ESRRYF QLI
Sbjct  62   SIMKIVRHPNIVRLHEVLSSRTKIYIILEFVTGGELFDKIVHQGRLSENESRRYFQQLI  120



>ref|XP_010656044.1| PREDICTED: CBL-interacting protein kinase 09 isoform X1 [Vitis 
vinifera]
 ref|XP_010656045.1| PREDICTED: CBL-interacting protein kinase 09 isoform X1 [Vitis 
vinifera]
 ref|XP_010656046.1| PREDICTED: CBL-interacting protein kinase 09 isoform X1 [Vitis 
vinifera]
 emb|CBI28210.3| unnamed protein product [Vitis vinifera]
Length=446

 Score =   200 bits (509),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 95/119 (80%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = +3

Query  447  LKMVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREI  626
            +K V RKVGKYEVGRTIGEGTFAKVKFA NTETGESVAMKV+ +S I+KH+MVDQIK+EI
Sbjct  1    MKKVTRKVGKYEVGRTIGEGTFAKVKFAHNTETGESVAMKVMAKSTILKHRMVDQIKQEI  60

Query  627  SIMKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            SIMK+VRHP +VRLHEV+AS+T IYIILEF+TGGEL+DKI+H GRL E ESRRYF QLI
Sbjct  61   SIMKIVRHPNIVRLHEVLASQTTIYIILEFVTGGELYDKIVHQGRLSENESRRYFQQLI  119



>ref|NP_001268145.1| CBL-interacting protein kinase 09 [Vitis vinifera]
 emb|CAN83760.1| hypothetical protein VITISV_043742 [Vitis vinifera]
 gb|ACQ83525.1| CBL-interacting protein kinase 09 [Vitis vinifera]
Length=446

 Score =   200 bits (509),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 95/119 (80%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = +3

Query  447  LKMVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREI  626
            +K V RKVGKYEVGRTIGEGTFAKVKFA NTETGESVAMKV+ +S I+KH+MVDQIK+EI
Sbjct  1    MKKVTRKVGKYEVGRTIGEGTFAKVKFAHNTETGESVAMKVMAKSTILKHRMVDQIKQEI  60

Query  627  SIMKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            SIMK+VRHP +VRLHEV+AS+T IYIILEF+TGGEL+DKI+H GRL E ESRRYF QLI
Sbjct  61   SIMKIVRHPNIVRLHEVLASQTTIYIILEFVTGGELYDKIVHQGRLSENESRRYFQQLI  119



>ref|XP_006645971.1| PREDICTED: CBL-interacting protein kinase 8-like, partial [Oryza 
brachyantha]
Length=434

 Score =   199 bits (507),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +3

Query  477  YEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMKLVRHPY  656
            YEVGRTIGEGTFAKVKFAQNTETGESVAMKV+DRS+I+KHKM DQIKREISIMKLVRHP 
Sbjct  1    YEVGRTIGEGTFAKVKFAQNTETGESVAMKVVDRSSILKHKMADQIKREISIMKLVRHPN  60

Query  657  VVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            VVRLHEV+ASR KI+IILEFITGGELFDKII HGRL EA++RRYF QLI
Sbjct  61   VVRLHEVLASRKKIFIILEFITGGELFDKIIRHGRLGEADARRYFQQLI  109



>ref|XP_002524508.1| CBL-interacting serine/threonine-protein kinase, putative [Ricinus 
communis]
 gb|EEF37948.1| CBL-interacting serine/threonine-protein kinase, putative [Ricinus 
communis]
Length=449

 Score =   200 bits (508),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 97/119 (82%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = +3

Query  447  LKMVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREI  626
            +K V RKVGKYEVGRTIGEGTFAKVKFAQN ETGESVAMKV+ +S I+KH+MVDQIKREI
Sbjct  4    MKSVSRKVGKYEVGRTIGEGTFAKVKFAQNLETGESVAMKVMAKSTILKHRMVDQIKREI  63

Query  627  SIMKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            SIMK+VRH  +VRLHEV+ASRTKIYIILEF+TGGELFDKI+H GRL E E+RRYF QLI
Sbjct  64   SIMKIVRHNNIVRLHEVLASRTKIYIILEFVTGGELFDKIVHQGRLSENEARRYFQQLI  122



>ref|XP_001776382.1| predicted protein [Physcomitrella patens]
 gb|EDQ58766.1| predicted protein [Physcomitrella patens]
 gb|ACQ83478.1| CBL-interacting protein kinase 06 [Physcomitrella patens]
Length=445

 Score =   199 bits (507),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 107/116 (92%), Gaps = 1/116 (1%)
 Frame = +3

Query  459  VRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQ-IKREISIM  635
            +RKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKV+DR  ++KHKMV+Q IKREISIM
Sbjct  1    MRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVLDRQTVLKHKMVEQQIKREISIM  60

Query  636  KLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            KLVRHP VVRLHEV+ASR KIYIILEF+TGGELFDKI+H GRL E +SR+YF QL+
Sbjct  61   KLVRHPNVVRLHEVLASRCKIYIILEFVTGGELFDKIVHQGRLNENDSRKYFQQLM  116



>emb|CDY03449.1| BnaC01g16330D [Brassica napus]
Length=453

 Score =   199 bits (506),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 111/124 (90%), Gaps = 7/124 (6%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQ-------  611
            MVVRKVGKYE+GRTIGEGTFAKVKFAQNTETGESVAMK++DR+ I+K KMVDQ       
Sbjct  1    MVVRKVGKYELGRTIGEGTFAKVKFAQNTETGESVAMKIVDRNTILKRKMVDQFLICNYQ  60

Query  612  IKREISIMKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYF  791
            IKREISIMKLVRHP VVRL+EV+ASRTKIYIILE+ITGGELFDKI+ +GRL EAE+R+YF
Sbjct  61   IKREISIMKLVRHPCVVRLYEVLASRTKIYIILEYITGGELFDKIVRNGRLSEAEARKYF  120

Query  792  XQLI  803
             QLI
Sbjct  121  HQLI  124



>ref|XP_004287304.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
[Fragaria vesca subsp. vesca]
Length=448

 Score =   198 bits (503),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = +3

Query  450  KMVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREIS  629
            K V R VGKYEVGRTIGEGTFAKVKFA+N ETGESVAMKV+ +S I+KH+MVDQIKREIS
Sbjct  4    KKVTRNVGKYEVGRTIGEGTFAKVKFARNAETGESVAMKVLAKSTILKHRMVDQIKREIS  63

Query  630  IMKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            IMK+VRHP +VRLHEV+A RTKIYIILEF+TGGELFDKI+H G+L E ESR+YF QLI
Sbjct  64   IMKIVRHPNIVRLHEVLAGRTKIYIILEFVTGGELFDKIVHQGKLRENESRKYFQQLI  121



>gb|KDO80232.1| hypothetical protein CISIN_1g013421mg [Citrus sinensis]
Length=379

 Score =   196 bits (498),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = +3

Query  447  LKMVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREI  626
            +K   R+V KYEVGRTIGEGTFAKV+FAQN ETGESVAMKV+ +S I+KH+MVDQIKREI
Sbjct  1    MKKQTRRVAKYEVGRTIGEGTFAKVRFAQNRETGESVAMKVLAKSTILKHRMVDQIKREI  60

Query  627  SIMKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            SIMK+VRHP +VRLHEV+ASRTK+YIILEF+TGGELFDKI+H GRL E + RRYF QLI
Sbjct  61   SIMKIVRHPNIVRLHEVLASRTKVYIILEFVTGGELFDKIVHQGRLLENDCRRYFQQLI  119



>ref|XP_010533153.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
[Tarenaya hassleriana]
Length=455

 Score =   197 bits (502),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 92/115 (80%), Positives = 108/115 (94%), Gaps = 0/115 (0%)
 Frame = +3

Query  459  VRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMK  638
            +RKVGKYEVGRTIGEGTFAKVKFA+NTETGE+VAMK++ +S I+KH+MVDQIKREISIMK
Sbjct  14   MRKVGKYEVGRTIGEGTFAKVKFARNTETGENVAMKIMAKSTILKHRMVDQIKREISIMK  73

Query  639  LVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            +VRHP +VRLHEV+AS TKIYIILEF+TGGELFDKI+H+GRL E+E R+YF QLI
Sbjct  74   IVRHPNIVRLHEVLASHTKIYIILEFVTGGELFDKIVHNGRLRESECRKYFQQLI  128



>gb|KDO80231.1| hypothetical protein CISIN_1g013421mg [Citrus sinensis]
Length=406

 Score =   196 bits (497),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = +3

Query  447  LKMVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREI  626
            +K   R+V KYEVGRTIGEGTFAKV+FAQN ETGESVAMKV+ +S I+KH+MVDQIKREI
Sbjct  1    MKKQTRRVAKYEVGRTIGEGTFAKVRFAQNRETGESVAMKVLAKSTILKHRMVDQIKREI  60

Query  627  SIMKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            SIMK+VRHP +VRLHEV+ASRTK+YIILEF+TGGELFDKI+H GRL E + RRYF QLI
Sbjct  61   SIMKIVRHPNIVRLHEVLASRTKVYIILEFVTGGELFDKIVHQGRLLENDCRRYFQQLI  119



>ref|XP_006450913.1| hypothetical protein CICLE_v10008418mg [Citrus clementina]
 gb|ESR64153.1| hypothetical protein CICLE_v10008418mg [Citrus clementina]
Length=419

 Score =   196 bits (498),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = +3

Query  447  LKMVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREI  626
            +K   R+V KYEVGRTIGEGTFAKV+FAQN ETGESVAMKV+ +S I+KH+MVDQIKREI
Sbjct  1    MKKQTRRVAKYEVGRTIGEGTFAKVRFAQNRETGESVAMKVLAKSTILKHRMVDQIKREI  60

Query  627  SIMKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            SIMK+VRHP +VRLHEV+ASRTK+YIILEF+TGGELFDKI+H GRL E + RRYF QLI
Sbjct  61   SIMKIVRHPNIVRLHEVLASRTKVYIILEFVTGGELFDKIVHQGRLLENDCRRYFQQLI  119



>ref|XP_007013469.1| Salt overly sensitive protein 2a isoform 1 [Theobroma cacao]
 ref|XP_007013470.1| Salt overly sensitive protein 2a isoform 1 [Theobroma cacao]
 ref|XP_007013471.1| Salt overly sensitive protein 2a isoform 1 [Theobroma cacao]
 gb|EOY31088.1| Salt overly sensitive protein 2a isoform 1 [Theobroma cacao]
 gb|EOY31089.1| Salt overly sensitive protein 2a isoform 1 [Theobroma cacao]
 gb|EOY31090.1| Salt overly sensitive protein 2a isoform 1 [Theobroma cacao]
Length=445

 Score =   196 bits (499),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = +3

Query  447  LKMVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREI  626
            +K   RKVGKYEVGRTIGEGTFAKVKFA+N +TGESVA+KV+ ++ I+KHKMVDQIKREI
Sbjct  1    MKKGTRKVGKYEVGRTIGEGTFAKVKFARNIDTGESVALKVLAKTTILKHKMVDQIKREI  60

Query  627  SIMKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            SIMK+VRHP +VRLHEV+ASRTKIYI+LEF++GGELFDKI+H GRL E ESRRYF QLI
Sbjct  61   SIMKIVRHPNIVRLHEVLASRTKIYIVLEFVSGGELFDKIVHRGRLPENESRRYFQQLI  119



>ref|XP_007013472.1| Salt overly sensitive protein 2a isoform 4 [Theobroma cacao]
 gb|EOY31091.1| Salt overly sensitive protein 2a isoform 4 [Theobroma cacao]
Length=425

 Score =   196 bits (498),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = +3

Query  447  LKMVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREI  626
            +K   RKVGKYEVGRTIGEGTFAKVKFA+N +TGESVA+KV+ ++ I+KHKMVDQIKREI
Sbjct  1    MKKGTRKVGKYEVGRTIGEGTFAKVKFARNIDTGESVALKVLAKTTILKHKMVDQIKREI  60

Query  627  SIMKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            SIMK+VRHP +VRLHEV+ASRTKIYI+LEF++GGELFDKI+H GRL E ESRRYF QLI
Sbjct  61   SIMKIVRHPNIVRLHEVLASRTKIYIVLEFVSGGELFDKIVHRGRLPENESRRYFQQLI  119



>ref|XP_008242780.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24-like 
[Prunus mume]
Length=437

 Score =   196 bits (499),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = +3

Query  447  LKMVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREI  626
            +K V RKVGKYEVGRTIGEGTFAKVKFA+N ETGESVAMK++ +S I+KH+MVDQIKREI
Sbjct  1    MKKVSRKVGKYEVGRTIGEGTFAKVKFARNIETGESVAMKILAKSTILKHRMVDQIKREI  60

Query  627  SIMKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            SIMK+VRHP +VRLHEV+A RTKI+IILEF+TGGELFDKI+H G+L E ESR+YF QLI
Sbjct  61   SIMKIVRHPNIVRLHEVLAGRTKIFIILEFVTGGELFDKIVHQGKLPEYESRKYFQQLI  119



>ref|XP_006475856.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24-like 
isoform X1 [Citrus sinensis]
 gb|KDO80229.1| hypothetical protein CISIN_1g013421mg [Citrus sinensis]
Length=443

 Score =   196 bits (499),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = +3

Query  447  LKMVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREI  626
            +K   R+V KYEVGRTIGEGTFAKV+FAQN ETGESVAMKV+ +S I+KH+MVDQIKREI
Sbjct  1    MKKQTRRVAKYEVGRTIGEGTFAKVRFAQNRETGESVAMKVLAKSTILKHRMVDQIKREI  60

Query  627  SIMKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            SIMK+VRHP +VRLHEV+ASRTK+YIILEF+TGGELFDKI+H GRL E + RRYF QLI
Sbjct  61   SIMKIVRHPNIVRLHEVLASRTKVYIILEFVTGGELFDKIVHQGRLLENDCRRYFQQLI  119



>gb|KDO80230.1| hypothetical protein CISIN_1g013421mg [Citrus sinensis]
Length=441

 Score =   196 bits (498),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = +3

Query  447  LKMVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREI  626
            +K   R+V KYEVGRTIGEGTFAKV+FAQN ETGESVAMKV+ +S I+KH+MVDQIKREI
Sbjct  1    MKKQTRRVAKYEVGRTIGEGTFAKVRFAQNRETGESVAMKVLAKSTILKHRMVDQIKREI  60

Query  627  SIMKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            SIMK+VRHP +VRLHEV+ASRTK+YIILEF+TGGELFDKI+H GRL E + RRYF QLI
Sbjct  61   SIMKIVRHPNIVRLHEVLASRTKVYIILEFVTGGELFDKIVHQGRLLENDCRRYFQQLI  119



>ref|XP_011020139.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24-like 
isoform X5 [Populus euphratica]
Length=387

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  447  LKMVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREI  626
            +K V R VG YEVGRTIGEG FAKVKFAQN ETGESVAM +  +S I+KHK+VDQIKREI
Sbjct  2    MKKVTRMVGNYEVGRTIGEGNFAKVKFAQNRETGESVAMNIFAKSTILKHKLVDQIKREI  61

Query  627  SIMKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            SIMK+VRHP +VRLHEV++SRTKIYIILEF+TGG+LFDKI+H GRL E ESRRYF QLI
Sbjct  62   SIMKIVRHPNIVRLHEVLSSRTKIYIILEFVTGGDLFDKIVHQGRLSENESRRYFQQLI  120



>ref|XP_011020140.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24-like 
isoform X6 [Populus euphratica]
Length=373

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  447  LKMVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREI  626
            +K V R VG YEVGRTIGEG FAKVKFAQN ETGESVAM +  +S I+KHK+VDQIKREI
Sbjct  2    MKKVTRMVGNYEVGRTIGEGNFAKVKFAQNRETGESVAMNIFAKSTILKHKLVDQIKREI  61

Query  627  SIMKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            SIMK+VRHP +VRLHEV++SRTKIYIILEF+TGG+LFDKI+H GRL E ESRRYF QLI
Sbjct  62   SIMKIVRHPNIVRLHEVLSSRTKIYIILEFVTGGDLFDKIVHQGRLSENESRRYFQQLI  120



>ref|XP_010047960.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24-like 
isoform X2 [Eucalyptus grandis]
Length=446

 Score =   196 bits (498),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MV RKVGKY+VGRT+GEGTFAKVKFAQNTE GE VA+K++ +S I+KH+MVDQIKREISI
Sbjct  1    MVTRKVGKYQVGRTVGEGTFAKVKFAQNTENGECVAVKILAKSTILKHRMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MK+VRHPY+VRLHEV+AS TKIYIILEF++GGEL+DKI++ GRL E ESRR+F QLI
Sbjct  61   MKIVRHPYIVRLHEVLASPTKIYIILEFVSGGELYDKIVNQGRLSENESRRFFQQLI  117



>ref|XP_007202049.1| hypothetical protein PRUPE_ppa005741mg [Prunus persica]
 gb|EMJ03248.1| hypothetical protein PRUPE_ppa005741mg [Prunus persica]
Length=446

 Score =   196 bits (497),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = +3

Query  447  LKMVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREI  626
            +K V RKVGKYEVGRTIGEGTFAKVKFA+N ETGESVAMK++ +S I+KH+MVDQIKREI
Sbjct  1    MKKVSRKVGKYEVGRTIGEGTFAKVKFARNIETGESVAMKILAKSTILKHRMVDQIKREI  60

Query  627  SIMKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            SIMK+VRHP +VRLHEV+A RTKI+IILEF+TGGELFDKI+H G+L E ESR+YF QLI
Sbjct  61   SIMKIVRHPNIVRLHEVLAGRTKIFIILEFVTGGELFDKIVHQGKLPEYESRKYFQQLI  119



>ref|XP_010047958.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24-like 
isoform X1 [Eucalyptus grandis]
 ref|XP_010047959.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24-like 
isoform X1 [Eucalyptus grandis]
Length=448

 Score =   196 bits (497),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            MV RKVGKY+VGRT+GEGTFAKVKFAQNTE GE VA+K++ +S I+KH+MVDQIKREISI
Sbjct  1    MVTRKVGKYQVGRTVGEGTFAKVKFAQNTENGECVAVKILAKSTILKHRMVDQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MK+VRHPY+VRLHEV+AS TKIYIILEF++GGEL+DKI++ GRL E ESRR+F QLI
Sbjct  61   MKIVRHPYIVRLHEVLASPTKIYIILEFVSGGELYDKIVNQGRLSENESRRFFQQLI  117



>ref|XP_011020138.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24-like 
isoform X4 [Populus euphratica]
Length=391

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  447  LKMVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREI  626
            +K V R VG YEVGRTIGEG FAKVKFAQN ETGESVAM +  +S I+KHK+VDQIKREI
Sbjct  2    MKKVTRMVGNYEVGRTIGEGNFAKVKFAQNRETGESVAMNIFAKSTILKHKLVDQIKREI  61

Query  627  SIMKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            SIMK+VRHP +VRLHEV++SRTKIYIILEF+TGG+LFDKI+H GRL E ESRRYF QLI
Sbjct  62   SIMKIVRHPNIVRLHEVLSSRTKIYIILEFVTGGDLFDKIVHQGRLSENESRRYFQQLI  120



>ref|XP_011622470.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
isoform X3 [Amborella trichopoda]
Length=403

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/115 (82%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = +3

Query  459  VRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMK  638
            +RKVGKYEVGRTIGEGTFAKVKFAQNTETGE+VAMKV+ +S I++HKMVDQIKREISIMK
Sbjct  1    MRKVGKYEVGRTIGEGTFAKVKFAQNTETGENVAMKVMAKSTILRHKMVDQIKREISIMK  60

Query  639  LVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            LVRHP ++RL EV+ASRTKIYIILEFITGGELFDKI+   +L E ESRRYF QLI
Sbjct  61   LVRHPNIIRLREVLASRTKIYIILEFITGGELFDKIVDQCKLSERESRRYFQQLI  115



>ref|XP_011020137.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24-like 
isoform X3 [Populus euphratica]
Length=392

 Score =   194 bits (493),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  447  LKMVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREI  626
            +K V R VG YEVGRTIGEG FAKVKFAQN ETGESVAM +  +S I+KHK+VDQIKREI
Sbjct  2    MKKVTRMVGNYEVGRTIGEGNFAKVKFAQNRETGESVAMNIFAKSTILKHKLVDQIKREI  61

Query  627  SIMKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            SIMK+VRHP +VRLHEV++SRTKIYIILEF+TGG+LFDKI+H GRL E ESRRYF QLI
Sbjct  62   SIMKIVRHPNIVRLHEVLSSRTKIYIILEFVTGGDLFDKIVHQGRLSENESRRYFQQLI  120



>gb|KCW80000.1| hypothetical protein EUGRSUZ_C01333 [Eucalyptus grandis]
Length=548

 Score =   197 bits (501),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +3

Query  450  KMVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREIS  629
            KMV RKVGKY+VGRT+GEGTFAKVKFAQNTE GE VA+K++ +S I+KH+MVDQIKREIS
Sbjct  102  KMVTRKVGKYQVGRTVGEGTFAKVKFAQNTENGECVAVKILAKSTILKHRMVDQIKREIS  161

Query  630  IMKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            IMK+VRHPY+VRLHEV+AS TKIYIILEF++GGEL+DKI++ GRL E ESRR+F QLI
Sbjct  162  IMKIVRHPYIVRLHEVLASPTKIYIILEFVSGGELYDKIVNQGRLSENESRRFFQQLI  219



>gb|KCW79999.1| hypothetical protein EUGRSUZ_C01333 [Eucalyptus grandis]
Length=550

 Score =   197 bits (501),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +3

Query  450  KMVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREIS  629
            KMV RKVGKY+VGRT+GEGTFAKVKFAQNTE GE VA+K++ +S I+KH+MVDQIKREIS
Sbjct  102  KMVTRKVGKYQVGRTVGEGTFAKVKFAQNTENGECVAVKILAKSTILKHRMVDQIKREIS  161

Query  630  IMKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            IMK+VRHPY+VRLHEV+AS TKIYIILEF++GGEL+DKI++ GRL E ESRR+F QLI
Sbjct  162  IMKIVRHPYIVRLHEVLASPTKIYIILEFVSGGELYDKIVNQGRLSENESRRFFQQLI  219



>ref|XP_011020135.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24-like 
isoform X1 [Populus euphratica]
Length=431

 Score =   194 bits (493),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  447  LKMVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREI  626
            +K V R VG YEVGRTIGEG FAKVKFAQN ETGESVAM +  +S I+KHK+VDQIKREI
Sbjct  2    MKKVTRMVGNYEVGRTIGEGNFAKVKFAQNRETGESVAMNIFAKSTILKHKLVDQIKREI  61

Query  627  SIMKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            SIMK+VRHP +VRLHEV++SRTKIYIILEF+TGG+LFDKI+H GRL E ESRRYF QLI
Sbjct  62   SIMKIVRHPNIVRLHEVLSSRTKIYIILEFVTGGDLFDKIVHQGRLSENESRRYFQQLI  120



>ref|XP_006842063.1| PREDICTED: CBL-interacting protein kinase 24 isoform X2 [Amborella 
trichopoda]
 gb|ERN03738.1| hypothetical protein AMTR_s00078p00042970 [Amborella trichopoda]
Length=442

 Score =   194 bits (493),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 94/115 (82%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = +3

Query  459  VRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMK  638
            +RKVGKYEVGRTIGEGTFAKVKFAQNTETGE+VAMKV+ +S I++HKMVDQIKREISIMK
Sbjct  1    MRKVGKYEVGRTIGEGTFAKVKFAQNTETGENVAMKVMAKSTILRHKMVDQIKREISIMK  60

Query  639  LVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            LVRHP ++RL EV+ASRTKIYIILEFITGGELFDKI+   +L E ESRRYF QLI
Sbjct  61   LVRHPNIIRLREVLASRTKIYIILEFITGGELFDKIVDQCKLSERESRRYFQQLI  115



>ref|XP_011622468.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
isoform X1 [Amborella trichopoda]
 ref|XP_011622469.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
isoform X1 [Amborella trichopoda]
Length=449

 Score =   194 bits (494),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 94/115 (82%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = +3

Query  459  VRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMK  638
            +RKVGKYEVGRTIGEGTFAKVKFAQNTETGE+VAMKV+ +S I++HKMVDQIKREISIMK
Sbjct  1    MRKVGKYEVGRTIGEGTFAKVKFAQNTETGENVAMKVMAKSTILRHKMVDQIKREISIMK  60

Query  639  LVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            LVRHP ++RL EV+ASRTKIYIILEFITGGELFDKI+   +L E ESRRYF QLI
Sbjct  61   LVRHPNIIRLREVLASRTKIYIILEFITGGELFDKIVDQCKLSERESRRYFQQLI  115



>ref|XP_012078806.1| PREDICTED: CBL-interacting protein kinase 24 isoform X2 [Jatropha 
curcas]
Length=445

 Score =   194 bits (492),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 95/119 (80%), Positives = 107/119 (90%), Gaps = 1/119 (1%)
 Frame = +3

Query  447  LKMVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREI  626
            +K + RKVGKYEVGRTIGEGTFAKVKFAQN ETGESVAMKV+ ++ I+KHKMVDQIKREI
Sbjct  1    MKNLTRKVGKYEVGRTIGEGTFAKVKFAQNRETGESVAMKVMAKTTILKHKMVDQIKREI  60

Query  627  SIMKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            SIMK+VRHP +VRLHEV+ASRTKIYIILEF+TGGELFDKI+   RL E E+RRYF QLI
Sbjct  61   SIMKIVRHPNIVRLHEVLASRTKIYIILEFVTGGELFDKIVQR-RLSENEARRYFQQLI  118



>gb|ACQ83515.1| CBL-interacting protein kinase 08 [Sorghum bicolor]
Length=459

 Score =   194 bits (492),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 106/121 (88%), Gaps = 5/121 (4%)
 Frame = +3

Query  456  VVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIM  635
             +R+VGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKV+DRS+I+KHKM +QIKREISIM
Sbjct  12   ALRRVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVLDRSSILKHKMAEQIKREISIM  71

Query  636  KLVRHPYVVRLH-----EVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQL  800
            KLVRHP V   H     +V+ASR KI+IILEFITGGELFDKII HGRL EA++RRYF QL
Sbjct  72   KLVRHPNVYPCHPFCYVQVLASRKKIFIILEFITGGELFDKIIRHGRLNEADARRYFQQL  131

Query  801  I  803
            I
Sbjct  132  I  132



>gb|KJB64753.1| hypothetical protein B456_010G063300 [Gossypium raimondii]
Length=343

 Score =   190 bits (483),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = +3

Query  459  VRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMK  638
             R VGKYEVGRTIG+GTFAKVKFA+N+ TGESVA+KV+ ++ I+KH+MVDQIKREISIMK
Sbjct  5    TRTVGKYEVGRTIGQGTFAKVKFARNSVTGESVALKVLPKATILKHRMVDQIKREISIMK  64

Query  639  LVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            +VRHP +VRLHEV+ASRTKIYIILEFI+GGELFDKI+H GRL E E RRYF QLI
Sbjct  65   IVRHPNIVRLHEVLASRTKIYIILEFISGGELFDKIVHCGRLPENECRRYFQQLI  119



>ref|XP_006345226.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24-like 
[Solanum tuberosum]
Length=446

 Score =   192 bits (489),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = +3

Query  447  LKMVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREI  626
            +K V RK+GKYEVGRTIGEGTFAKVKFA+NTETGE+VA+KV+ +S I+KH+MV+QIKREI
Sbjct  1    MKKVKRKLGKYEVGRTIGEGTFAKVKFARNTETGENVAIKVLAKSTILKHRMVEQIKREI  60

Query  627  SIMKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            SIMK+VRHP +VRLHEV+AS+TKIYII EF+TGGELFDKI+H GRL E E+RRYF QLI
Sbjct  61   SIMKIVRHPCIVRLHEVLASQTKIYIIQEFVTGGELFDKIVHLGRLSEDEARRYFQQLI  119



>gb|KJB64754.1| hypothetical protein B456_010G063300 [Gossypium raimondii]
Length=371

 Score =   191 bits (484),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = +3

Query  459  VRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMK  638
             R VGKYEVGRTIG+GTFAKVKFA+N+ TGESVA+KV+ ++ I+KH+MVDQIKREISIMK
Sbjct  5    TRTVGKYEVGRTIGQGTFAKVKFARNSVTGESVALKVLPKATILKHRMVDQIKREISIMK  64

Query  639  LVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            +VRHP +VRLHEV+ASRTKIYIILEFI+GGELFDKI+H GRL E E RRYF QLI
Sbjct  65   IVRHPNIVRLHEVLASRTKIYIILEFISGGELFDKIVHCGRLPENECRRYFQQLI  119



>gb|KJB64759.1| hypothetical protein B456_010G063300 [Gossypium raimondii]
Length=381

 Score =   191 bits (484),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = +3

Query  459  VRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMK  638
             R VGKYEVGRTIG+GTFAKVKFA+N+ TGESVA+KV+ ++ I+KH+MVDQIKREISIMK
Sbjct  5    TRTVGKYEVGRTIGQGTFAKVKFARNSVTGESVALKVLPKATILKHRMVDQIKREISIMK  64

Query  639  LVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            +VRHP +VRLHEV+ASRTKIYIILEFI+GGELFDKI+H GRL E E RRYF QLI
Sbjct  65   IVRHPNIVRLHEVLASRTKIYIILEFISGGELFDKIVHCGRLPENECRRYFQQLI  119



>ref|XP_012078803.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
isoform X1 [Jatropha curcas]
 ref|XP_012078804.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
isoform X1 [Jatropha curcas]
 gb|KDP32419.1| hypothetical protein JCGZ_13344 [Jatropha curcas]
Length=448

 Score =   192 bits (489),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 107/121 (88%), Gaps = 2/121 (2%)
 Frame = +3

Query  447  LKMVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREI  626
            +K + RKVGKYEVGRTIGEGTFAKVKFAQN ETGESVAMKV+ ++ I+KHKMVDQIKREI
Sbjct  1    MKNLTRKVGKYEVGRTIGEGTFAKVKFAQNRETGESVAMKVMAKTTILKHKMVDQIKREI  60

Query  627  SIMKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIH--HGRLXEAESRRYFXQL  800
            SIMK+VRHP +VRLHEV+ASRTKIYIILEF+TGGELFDKI+     RL E E+RRYF QL
Sbjct  61   SIMKIVRHPNIVRLHEVLASRTKIYIILEFVTGGELFDKIVEQVQRRLSENEARRYFQQL  120

Query  801  I  803
            I
Sbjct  121  I  121



>ref|NP_001291227.1| CBL-interacting serine/threonine-protein kinase 24-like [Populus 
euphratica]
 gb|ACN76477.1| CBL-interacting protein kinase 27 [Populus euphratica]
Length=434

 Score =   192 bits (488),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  447  LKMVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREI  626
            +K V R VG YEVGRTIGEG FAKVKFAQN ETGESV M +  +S I+KHK+VDQIKREI
Sbjct  2    MKKVTRMVGNYEVGRTIGEGNFAKVKFAQNRETGESVDMNIFAKSTILKHKLVDQIKREI  61

Query  627  SIMKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            SIMK+VRHP +VRLHEV++SRTKIYIILEF+TGG+LFDKI+H GRL E ESRRYF QLI
Sbjct  62   SIMKIVRHPNIVRLHEVLSSRTKIYIILEFVTGGDLFDKIVHQGRLSENESRRYFQQLI  120



>ref|XP_010907284.1| PREDICTED: CBL-interacting protein kinase 24 isoform X3 [Elaeis 
guineensis]
Length=398

 Score =   190 bits (483),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            M  RKVGKYEVGRTIGEGTFAKVKFA N+ETGESVAMKV+ ++ I+KHKMV QIKREISI
Sbjct  1    MGARKVGKYEVGRTIGEGTFAKVKFAINSETGESVAMKVLAKTTILKHKMVHQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MK+VRHP +VRLHEV+ASRTKIYIILE I GGELFDKI+H G+L E ESRRYF QLI
Sbjct  61   MKIVRHPNIVRLHEVLASRTKIYIILELIRGGELFDKIVHQGKLHEDESRRYFQQLI  117



>gb|KJB64755.1| hypothetical protein B456_010G063300 [Gossypium raimondii]
Length=397

 Score =   190 bits (483),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = +3

Query  459  VRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMK  638
             R VGKYEVGRTIG+GTFAKVKFA+N+ TGESVA+KV+ ++ I+KH+MVDQIKREISIMK
Sbjct  5    TRTVGKYEVGRTIGQGTFAKVKFARNSVTGESVALKVLPKATILKHRMVDQIKREISIMK  64

Query  639  LVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            +VRHP +VRLHEV+ASRTKIYIILEFI+GGELFDKI+H GRL E E RRYF QLI
Sbjct  65   IVRHPNIVRLHEVLASRTKIYIILEFISGGELFDKIVHCGRLPENECRRYFQQLI  119



>gb|KJB64749.1| hypothetical protein B456_010G063300 [Gossypium raimondii]
 gb|KJB64750.1| hypothetical protein B456_010G063300 [Gossypium raimondii]
 gb|KJB64752.1| hypothetical protein B456_010G063300 [Gossypium raimondii]
Length=445

 Score =   191 bits (485),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = +3

Query  459  VRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMK  638
             R VGKYEVGRTIG+GTFAKVKFA+N+ TGESVA+KV+ ++ I+KH+MVDQIKREISIMK
Sbjct  5    TRTVGKYEVGRTIGQGTFAKVKFARNSVTGESVALKVLPKATILKHRMVDQIKREISIMK  64

Query  639  LVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            +VRHP +VRLHEV+ASRTKIYIILEFI+GGELFDKI+H GRL E E RRYF QLI
Sbjct  65   IVRHPNIVRLHEVLASRTKIYIILEFISGGELFDKIVHCGRLPENECRRYFQQLI  119



>gb|KJB64756.1| hypothetical protein B456_010G063300 [Gossypium raimondii]
Length=415

 Score =   190 bits (483),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = +3

Query  459  VRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMK  638
             R VGKYEVGRTIG+GTFAKVKFA+N+ TGESVA+KV+ ++ I+KH+MVDQIKREISIMK
Sbjct  5    TRTVGKYEVGRTIGQGTFAKVKFARNSVTGESVALKVLPKATILKHRMVDQIKREISIMK  64

Query  639  LVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            +VRHP +VRLHEV+ASRTKIYIILEFI+GGELFDKI+H GRL E E RRYF QLI
Sbjct  65   IVRHPNIVRLHEVLASRTKIYIILEFISGGELFDKIVHCGRLPENECRRYFQQLI  119



>gb|KJB64758.1| hypothetical protein B456_010G063300 [Gossypium raimondii]
Length=446

 Score =   191 bits (485),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = +3

Query  459  VRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMK  638
             R VGKYEVGRTIG+GTFAKVKFA+N+ TGESVA+KV+ ++ I+KH+MVDQIKREISIMK
Sbjct  5    TRTVGKYEVGRTIGQGTFAKVKFARNSVTGESVALKVLPKATILKHRMVDQIKREISIMK  64

Query  639  LVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            +VRHP +VRLHEV+ASRTKIYIILEFI+GGELFDKI+H GRL E E RRYF QLI
Sbjct  65   IVRHPNIVRLHEVLASRTKIYIILEFISGGELFDKIVHCGRLPENECRRYFQQLI  119



>gb|KJB64751.1| hypothetical protein B456_010G063300 [Gossypium raimondii]
Length=446

 Score =   191 bits (485),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = +3

Query  459  VRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMK  638
             R VGKYEVGRTIG+GTFAKVKFA+N+ TGESVA+KV+ ++ I+KH+MVDQIKREISIMK
Sbjct  5    TRTVGKYEVGRTIGQGTFAKVKFARNSVTGESVALKVLPKATILKHRMVDQIKREISIMK  64

Query  639  LVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            +VRHP +VRLHEV+ASRTKIYIILEFI+GGELFDKI+H GRL E E RRYF QLI
Sbjct  65   IVRHPNIVRLHEVLASRTKIYIILEFISGGELFDKIVHCGRLPENECRRYFQQLI  119



>ref|XP_010907283.1| PREDICTED: CBL-interacting protein kinase 24 isoform X2 [Elaeis 
guineensis]
Length=409

 Score =   190 bits (482),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            M  RKVGKYEVGRTIGEGTFAKVKFA N+ETGESVAMKV+ ++ I+KHKMV QIKREISI
Sbjct  1    MGARKVGKYEVGRTIGEGTFAKVKFAINSETGESVAMKVLAKTTILKHKMVHQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MK+VRHP +VRLHEV+ASRTKIYIILE I GGELFDKI+H G+L E ESRRYF QLI
Sbjct  61   MKIVRHPNIVRLHEVLASRTKIYIILELIRGGELFDKIVHQGKLHEDESRRYFQQLI  117



>ref|NP_001241229.1| uncharacterized protein LOC100784566 [Glycine max]
 gb|ACU18338.1| unknown [Glycine max]
Length=289

 Score =   186 bits (473),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/102 (89%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = +3

Query  498  GEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMKLVRHPYVVRLHEV  677
            GEGTFA+VKFAQNT TGE VAMKV+DRS IIKHKMVDQIKREISIMKLVRHP VVRLHEV
Sbjct  35   GEGTFAEVKFAQNTGTGEIVAMKVLDRSTIIKHKMVDQIKREISIMKLVRHPDVVRLHEV  94

Query  678  IASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            +ASRTK+YIILEFITGGELFDKIIHHGRL EA+SRRYF QLI
Sbjct  95   LASRTKLYIILEFITGGELFDKIIHHGRLSEADSRRYFQQLI  136



>ref|XP_008443989.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
[Cucumis melo]
Length=437

 Score =   190 bits (483),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = +3

Query  447  LKMVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREI  626
            +K + RKVGKYEVGRT+GEGTFAKVKFA NTETGE VAMKV+ +S+I+KHKMV+QIKREI
Sbjct  1    MKRLTRKVGKYEVGRTVGEGTFAKVKFACNTETGEGVAMKVLAKSSILKHKMVEQIKREI  60

Query  627  SIMKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            SIMK+VRHP++VRLHEV+ASRTKIYIILEF++GGEL+DKI+   +L E ESRRYF QLI
Sbjct  61   SIMKIVRHPHIVRLHEVLASRTKIYIILEFVSGGELYDKIVLQKKLPEIESRRYFHQLI  119



>ref|XP_010907282.1| PREDICTED: CBL-interacting protein kinase 24 isoform X1 [Elaeis 
guineensis]
Length=439

 Score =   190 bits (483),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            M  RKVGKYEVGRTIGEGTFAKVKFA N+ETGESVAMKV+ ++ I+KHKMV QIKREISI
Sbjct  1    MGARKVGKYEVGRTIGEGTFAKVKFAINSETGESVAMKVLAKTTILKHKMVHQIKREISI  60

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MK+VRHP +VRLHEV+ASRTKIYIILE I GGELFDKI+H G+L E ESRRYF QLI
Sbjct  61   MKIVRHPNIVRLHEVLASRTKIYIILELIRGGELFDKIVHQGKLHEDESRRYFQQLI  117



>gb|ACN41002.1| unknown [Picea sitchensis]
Length=288

 Score =   186 bits (472),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = +3

Query  423  LRESGGSCLKMVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKM  602
            +RE     ++ V  +VGKYE+GRT+GEGTFAKVKFA+NTE GE+VA+K++D+  I+KHKM
Sbjct  1    MRERQRMSIQSVRTRVGKYELGRTLGEGTFAKVKFAKNTENGENVAIKILDKENILKHKM  60

Query  603  VDQIKREISIMKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESR  782
            V+QIKREIS MKL++HP V+RLHEV+AS+TKIYI+L+F+ GGELFDKI++HGRL E E+R
Sbjct  61   VEQIKREISTMKLIKHPNVIRLHEVMASKTKIYIVLDFVNGGELFDKIVNHGRLREDEAR  120

Query  783  RYFXQLI  803
            RYF QLI
Sbjct  121  RYFQQLI  127



>ref|NP_001234210.1| calcineurin B-like interacting protein kinase [Solanum lycopersicum]
 emb|CAG30526.1| calcineurin B-like interacting protein kinase [Solanum lycopersicum]
 gb|ABR37648.1| putative SOS2-like protein kinase [Solanum lycopersicum]
Length=446

 Score =   190 bits (483),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = +3

Query  447  LKMVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREI  626
            +K V RK+GKYEVGRTIGEGTFAKVKFA+NTETGE+VA+KV+ +S I+KH+MV+QIKREI
Sbjct  1    MKKVKRKLGKYEVGRTIGEGTFAKVKFARNTETGENVAIKVLAKSTILKHRMVEQIKREI  60

Query  627  SIMKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            SIMK+VRHP +VRLHEV+AS+TKIYI+ EF+TGGELFDKI+H GRL E E+RRYF +LI
Sbjct  61   SIMKIVRHPCIVRLHEVLASQTKIYIVQEFVTGGELFDKIVHLGRLSEDEARRYFQELI  119



>ref|XP_009788220.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24-like 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009788228.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24-like 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009788237.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24-like 
isoform X1 [Nicotiana sylvestris]
Length=462

 Score =   190 bits (483),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = +3

Query  447  LKMVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREI  626
            +K V RK+GKYE+GRTIGEG F+KVKFAQNTETGE+VA+KV+ +S I+K+KMV+QIKREI
Sbjct  1    MKKVKRKLGKYELGRTIGEGAFSKVKFAQNTETGENVAIKVLAKSTILKNKMVEQIKREI  60

Query  627  SIMKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            SIMK+VRHP +VRLHEV+ASRTKIYII+EF+TGGELFDKI+H  RL E E+RRYF QLI
Sbjct  61   SIMKIVRHPCIVRLHEVLASRTKIYIIMEFVTGGELFDKIVHQVRLPEKEARRYFQQLI  119



>ref|XP_006603707.1| PREDICTED: uncharacterized protein LOC100784566 isoform X1 [Glycine 
max]
Length=296

 Score =   186 bits (472),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 91/102 (89%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = +3

Query  498  GEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMKLVRHPYVVRLHEV  677
            GEGTFA+VKFAQNT TGE VAMKV+DRS IIKHKMVDQIKREISIMKLVRHP VVRLHEV
Sbjct  42   GEGTFAEVKFAQNTGTGEIVAMKVLDRSTIIKHKMVDQIKREISIMKLVRHPDVVRLHEV  101

Query  678  IASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            +ASRTK+YIILEFITGGELFDKIIHHGRL EA+SRRYF QLI
Sbjct  102  LASRTKLYIILEFITGGELFDKIIHHGRLSEADSRRYFQQLI  143



>ref|XP_009607232.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
isoform X2 [Nicotiana tomentosiformis]
Length=426

 Score =   189 bits (481),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = +3

Query  462  RKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMKL  641
            RK+GKYE+GRTIGEGTFAKVKFAQNT+TGE+VA+K++ +S I+KH+MV+QIKREISIMK+
Sbjct  3    RKLGKYELGRTIGEGTFAKVKFAQNTQTGENVAVKILAKSTILKHRMVEQIKREISIMKI  62

Query  642  VRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            VRHP +VRLHEV+AS+TKIYII EF+TGGELFDKI+H GR+ E E+RRYF QLI
Sbjct  63   VRHPCIVRLHEVLASQTKIYIIQEFVTGGELFDKIVHQGRISEDEARRYFQQLI  116



>ref|XP_010450374.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24-like 
[Camelina sativa]
 ref|XP_010450375.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24-like 
[Camelina sativa]
 ref|XP_010450376.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24-like 
[Camelina sativa]
Length=447

 Score =   190 bits (482),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +3

Query  459  VRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMK  638
            VR+VGKYEVGRTIGEGTFAKVKFA+NT+TGE+VA+K++ +S I+KH+MVDQIKREISIMK
Sbjct  6    VRRVGKYEVGRTIGEGTFAKVKFARNTDTGENVAIKIMAKSTILKHRMVDQIKREISIMK  65

Query  639  LVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            +VRHP +VRL+EV+AS +KIYI+LEF+TGGELFD+I+H+GRL E+ESR+YF QL+
Sbjct  66   IVRHPNIVRLYEVLASPSKIYIVLEFVTGGELFDRIVHNGRLEESESRKYFQQLV  120



>ref|XP_011659824.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
isoform X1 [Cucumis sativus]
 ref|XP_011659825.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
isoform X1 [Cucumis sativus]
Length=437

 Score =   189 bits (481),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = +3

Query  447  LKMVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREI  626
            +K + RKVGKYEVGRT+GEGTFAKVKFA NTETGE VAMKV+ +S+I+KHKMV QIKREI
Sbjct  1    MKRLTRKVGKYEVGRTVGEGTFAKVKFACNTETGEGVAMKVLAKSSILKHKMVQQIKREI  60

Query  627  SIMKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            SIMK+VRHP++VRLHEV+ASRTKIYIILEF++GGEL+DKI+   +L E ESRRYF QLI
Sbjct  61   SIMKIVRHPHIVRLHEVLASRTKIYIILEFVSGGELYDKIVLQKKLPEIESRRYFHQLI  119



>ref|XP_010687975.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=446

 Score =   190 bits (482),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = +3

Query  447  LKMVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREI  626
            +    R+VGKYE+GRT+GEGTFAKVKFA NTETGESVA+KV+ +S I+KH+MVDQIKREI
Sbjct  1    MSSTTRRVGKYELGRTVGEGTFAKVKFAINTETGESVAVKVLAKSTILKHRMVDQIKREI  60

Query  627  SIMKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            SIMK+VRHP++VRLHEV+ASRT+IYIILEF+ GGELFDKI+H G+L E ESR+Y  QLI
Sbjct  61   SIMKIVRHPFIVRLHEVLASRTRIYIILEFVPGGELFDKIVHKGKLSEMESRKYLQQLI  119



>ref|XP_009607229.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009607230.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009607231.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
isoform X1 [Nicotiana tomentosiformis]
Length=443

 Score =   189 bits (481),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = +3

Query  462  RKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMKL  641
            RK+GKYE+GRTIGEGTFAKVKFAQNT+TGE+VA+K++ +S I+KH+MV+QIKREISIMK+
Sbjct  3    RKLGKYELGRTIGEGTFAKVKFAQNTQTGENVAVKILAKSTILKHRMVEQIKREISIMKI  62

Query  642  VRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            VRHP +VRLHEV+AS+TKIYII EF+TGGELFDKI+H GR+ E E+RRYF QLI
Sbjct  63   VRHPCIVRLHEVLASQTKIYIIQEFVTGGELFDKIVHQGRISEDEARRYFQQLI  116



>ref|XP_009625261.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24-like 
isoform X1 [Nicotiana tomentosiformis]
Length=350

 Score =   187 bits (475),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = +3

Query  447  LKMVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREI  626
            +K V RK+GKYE+GRTIGEG F+KVK AQNTETGE+VA+KV+ +S I+K+KMV+QIKREI
Sbjct  1    MKKVKRKLGKYELGRTIGEGAFSKVKSAQNTETGENVAIKVLAKSTILKNKMVEQIKREI  60

Query  627  SIMKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            SIMK+VRHP +VRLHEV+ASRTKIYII+EF+TGGELFDKI+H  RL E E+RRYF QLI
Sbjct  61   SIMKIVRHPCIVRLHEVLASRTKIYIIMEFVTGGELFDKIVHQVRLPEKEARRYFQQLI  119



>ref|NP_001280754.1| son of sevenless homolog 2 [Malus domestica]
 gb|ACQ90245.1| serine/threonine protein kinase [Malus domestica]
Length=446

 Score =   189 bits (481),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = +3

Query  447  LKMVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREI  626
            +K   R VGKYEVGRTIGEGTFAKVKFA+N ETGESVAMKV+ +S I+KH+MVDQIKREI
Sbjct  1    MKKKSRNVGKYEVGRTIGEGTFAKVKFARNCETGESVAMKVLAKSTILKHRMVDQIKREI  60

Query  627  SIMKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            SIMK+VRHP +VRL EV+A RTKI+IILEF+TGGELFDKI+H G+L E ESR+YF QLI
Sbjct  61   SIMKIVRHPNIVRLLEVLAGRTKIFIILEFVTGGELFDKIVHQGKLPENESRKYFQQLI  119



>ref|XP_008792023.1| PREDICTED: CBL-interacting protein kinase 24-like isoform X2 
[Phoenix dactylifera]
Length=410

 Score =   188 bits (478),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = +3

Query  462  RKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMKL  641
            RKVGKYEVGRTIGEGTFAKVKFA NTETGESVAMKV+ ++ I+KHKMV QIKREISIMK+
Sbjct  4    RKVGKYEVGRTIGEGTFAKVKFAINTETGESVAMKVLAKTTILKHKMVHQIKREISIMKI  63

Query  642  VRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            VRHP +VRLHEV+ASRTKIYIILE I GGELFD+I+H G+L E ESRRYF QLI
Sbjct  64   VRHPGIVRLHEVLASRTKIYIILELIRGGELFDRIVHQGKLHENESRRYFQQLI  117



>ref|XP_010687974.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=455

 Score =   189 bits (480),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = +3

Query  447  LKMVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREI  626
            +    R+VGKYE+GRT+GEGTFAKVKFA NTETGESVA+KV+ +S I+KH+MVDQIKREI
Sbjct  1    MSSTTRRVGKYELGRTVGEGTFAKVKFAINTETGESVAVKVLAKSTILKHRMVDQIKREI  60

Query  627  SIMKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            SIMK+VRHP++VRLHEV+ASRT+IYIILEF+ GGELFDKI+H G+L E ESR+Y  QLI
Sbjct  61   SIMKIVRHPFIVRLHEVLASRTRIYIILEFVPGGELFDKIVHKGKLSEMESRKYLQQLI  119



>ref|XP_008792021.1| PREDICTED: CBL-interacting protein kinase 24-like isoform X1 
[Phoenix dactylifera]
Length=434

 Score =   189 bits (479),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = +3

Query  462  RKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMKL  641
            RKVGKYEVGRTIGEGTFAKVKFA NTETGESVAMKV+ ++ I+KHKMV QIKREISIMK+
Sbjct  4    RKVGKYEVGRTIGEGTFAKVKFAINTETGESVAMKVLAKTTILKHKMVHQIKREISIMKI  63

Query  642  VRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            VRHP +VRLHEV+ASRTKIYIILE I GGELFD+I+H G+L E ESRRYF QLI
Sbjct  64   VRHPGIVRLHEVLASRTKIYIILELIRGGELFDRIVHQGKLHENESRRYFQQLI  117



>ref|XP_010435433.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24-like 
[Camelina sativa]
 ref|XP_010435434.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24-like 
[Camelina sativa]
Length=447

 Score =   188 bits (478),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 108/115 (94%), Gaps = 0/115 (0%)
 Frame = +3

Query  459  VRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMK  638
            +R+VGKYEVGRTIGEGTFAKVKFA+NT+TGE+VA+K++ +S I+KH+MVDQIKREISIMK
Sbjct  6    MRRVGKYEVGRTIGEGTFAKVKFARNTDTGENVAIKIMAKSTILKHRMVDQIKREISIMK  65

Query  639  LVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            +VRHP +VRL+EV+AS +KIYIILEF+TGGELFD+I+H+GRL E ESR+YF QL+
Sbjct  66   IVRHPNIVRLYEVLASPSKIYIILEFVTGGELFDRIVHNGRLEENESRKYFQQLV  120



>ref|XP_009364020.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24-like 
[Pyrus x bretschneideri]
 ref|XP_009364021.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24-like 
[Pyrus x bretschneideri]
Length=446

 Score =   188 bits (478),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = +3

Query  447  LKMVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREI  626
            +K   R VGKYEVGRTIGEGTFAKVKFA+N ETGESVAMKV+ +S I+KH+MVDQIKREI
Sbjct  1    MKKKSRNVGKYEVGRTIGEGTFAKVKFARNCETGESVAMKVLAKSTILKHRMVDQIKREI  60

Query  627  SIMKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            SIMK+VRHP +VRL EV+A +TKI+IILEF++GGELFDKI+H G+L E ESR+YF QLI
Sbjct  61   SIMKIVRHPNIVRLQEVLAGQTKIFIILEFVSGGELFDKIVHQGKLPENESRKYFQQLI  119



>ref|XP_009791398.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
[Nicotiana sylvestris]
 ref|XP_009791399.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
[Nicotiana sylvestris]
 ref|XP_009791400.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
[Nicotiana sylvestris]
Length=446

 Score =   188 bits (477),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = +3

Query  447  LKMVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREI  626
            +K V RK+GKYE+GRTIGEGTFAKVKFAQNTETGE+VA+K++ +S I+KH+MV+QIKREI
Sbjct  1    MKKVKRKLGKYELGRTIGEGTFAKVKFAQNTETGENVAVKILAKSTILKHRMVEQIKREI  60

Query  627  SIMKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            SIMK+VRHP +VRLHEV+AS+TKIYII EF+TGGELFDKI+  GR+ + E+RRYF QLI
Sbjct  61   SIMKIVRHPCIVRLHEVLASQTKIYIIQEFVTGGELFDKIVLQGRISDDEARRYFQQLI  119



>gb|ADP37983.1| salt overly sensitive protein 2b [Gossypium hirsutum]
Length=445

 Score =   188 bits (477),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = +3

Query  468  VGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMKLVR  647
            VGKYEVGRTIG+GTFAKVKFA+N+ +GESVA+KV+ ++ I+KH+MVDQIKREISIMK+VR
Sbjct  8    VGKYEVGRTIGQGTFAKVKFARNSVSGESVALKVLPKATILKHRMVDQIKREISIMKIVR  67

Query  648  HPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            HP +VRLHEV+ASRTKIYIILEFI+GGELFDKI+H GRL E E RRYF QLI
Sbjct  68   HPNIVRLHEVLASRTKIYIILEFISGGELFDKIVHCGRLPENECRRYFQQLI  119



>ref|XP_010440713.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
[Camelina sativa]
 ref|XP_010440714.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
[Camelina sativa]
 ref|XP_010440715.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
[Camelina sativa]
 ref|XP_010440716.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
[Camelina sativa]
 ref|XP_010440717.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
[Camelina sativa]
Length=447

 Score =   188 bits (477),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 108/115 (94%), Gaps = 0/115 (0%)
 Frame = +3

Query  459  VRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMK  638
            +R+VGKYEVGRTIGEGTFAKVKFA+NT+TGE+VA+K++ +S I+KH+MVDQIKREISIMK
Sbjct  6    MRRVGKYEVGRTIGEGTFAKVKFARNTDTGENVAIKIMAKSTILKHRMVDQIKREISIMK  65

Query  639  LVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            +VRHP +VRL+EV+AS +KIYI+LEF+TGGELFD+I+H+GRL E ESR+YF QL+
Sbjct  66   IVRHPNIVRLYEVLASPSKIYIVLEFVTGGELFDRIVHNGRLEENESRKYFQQLV  120



>gb|AHW50679.1| calcineurin B-like interacting protein kinase [Nicotiana tabacum]
Length=446

 Score =   187 bits (476),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = +3

Query  447  LKMVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREI  626
            +K V RK+GKYE+GRTIGEGTFAKVKFAQNTETGE+VA+K++ +S I+KH+MV+QIKREI
Sbjct  1    MKKVKRKLGKYELGRTIGEGTFAKVKFAQNTETGENVAVKILAKSTILKHRMVEQIKREI  60

Query  627  SIMKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            SIMK+VRHP +VRLHEV+AS+TKIYII EF+TGGELFDKI+  GR+ + E+RRYF QLI
Sbjct  61   SIMKIVRHPCIVRLHEVLASQTKIYIIQEFVTGGELFDKIVLQGRISDDEARRYFQQLI  119



>ref|XP_008337394.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24-like 
[Malus domestica]
Length=405

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = +3

Query  462  RKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMKL  641
            RKVGKYEVGR +GEGTF KVKFA+N ETGESVAMK++ +S I+KH+MVDQIKREISIMK+
Sbjct  5    RKVGKYEVGRMVGEGTFGKVKFARNCETGESVAMKILAKSTILKHRMVDQIKREISIMKI  64

Query  642  VRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            VRHP +VRLHEV+A R KI+IILEF+TGGELFDKI+H G+L E ESR+YF QL+
Sbjct  65   VRHPNIVRLHEVLAGRAKIFIILEFVTGGELFDKIVHRGKLPENESRKYFQQLV  118



>ref|XP_006405548.1| hypothetical protein EUTSA_v10027753mg [Eutrema salsugineum]
 gb|ESQ47001.1| hypothetical protein EUTSA_v10027753mg [Eutrema salsugineum]
Length=457

 Score =   188 bits (477),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 113/123 (92%), Gaps = 2/123 (2%)
 Frame = +3

Query  441  SCLKMV--VRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQI  614
            +C +M   +R+VGKYEVGRTIGEGTFAKVKFA+N++TGE+VA+K++ +S I+KH+MVDQI
Sbjct  8    NCQRMTKKMRRVGKYEVGRTIGEGTFAKVKFARNSDTGENVAIKIMAKSTILKHRMVDQI  67

Query  615  KREISIMKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFX  794
            KREISIMK+VRHP +VRL+EV+AS +KIYI+LEF+TGGELFD+I+H+GRL E+E+R+YF 
Sbjct  68   KREISIMKIVRHPNIVRLYEVLASPSKIYIVLEFVTGGELFDRIVHNGRLEESEARKYFQ  127

Query  795  QLI  803
            QL+
Sbjct  128  QLV  130



>dbj|BAD95978.1| Ser/Thr protein kinase [Lotus japonicus]
Length=446

 Score =   187 bits (476),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/119 (72%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = +3

Query  447  LKMVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREI  626
            +K V R++GKYEVGRTIGEGTFAKVKFA+N+ETGESVA+K++D++ I+KH+MV+QIKREI
Sbjct  1    MKKVRRRIGKYEVGRTIGEGTFAKVKFAKNSETGESVAIKIMDKTTILKHRMVEQIKREI  60

Query  627  SIMKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            SIMK+VRHP +VRLHEV++S+TKIYIILEF+ GGEL+D+I+  G+L E ESRRYF QLI
Sbjct  61   SIMKIVRHPNIVRLHEVLSSQTKIYIILEFVMGGELYDRIVQRGKLSEDESRRYFQQLI  119



>ref|XP_008362901.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24-like 
[Malus domestica]
Length=446

 Score =   187 bits (476),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  447  LKMVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREI  626
            +K   R VGKYEVGRTIGEGTFAKVKFA+N E GESVAMKV+ +S I+KH+MVDQIKREI
Sbjct  1    MKKKSRNVGKYEVGRTIGEGTFAKVKFARNCEXGESVAMKVLAKSTILKHRMVDQIKREI  60

Query  627  SIMKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            SIMK+VRHP +VRL EV+A RTKI+IILEF+TGGELFDKI+H G+L E ESR+YF QLI
Sbjct  61   SIMKIVRHPNIVRLLEVLAGRTKIFIILEFVTGGELFDKIVHQGKLPENESRKYFQQLI  119



>ref|XP_009368859.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24-like 
isoform X1 [Pyrus x bretschneideri]
 ref|XP_009368860.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24-like 
isoform X1 [Pyrus x bretschneideri]
Length=446

 Score =   187 bits (476),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = +3

Query  462  RKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMKL  641
            RKVGKY+VGR +GEGTFAKVKFA+N ETGE VAMK++ +S+I+KH+MVDQIKREISIMK+
Sbjct  5    RKVGKYQVGRVVGEGTFAKVKFARNCETGEGVAMKILAKSSILKHRMVDQIKREISIMKI  64

Query  642  VRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            VRHP +VRLHEV+A R KI+IILEF+TGGELFDKI+H G+L E ESR+YF QL+
Sbjct  65   VRHPNIVRLHEVLAGRAKIFIILEFVTGGELFDKIVHQGKLPENESRKYFQQLV  118



>ref|XP_008385538.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24 
[Malus domestica]
Length=446

 Score =   187 bits (475),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  447  LKMVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREI  626
            +K   R VGKYEVGRTIGEGTFAKVKFA+N E GESVAMKV+ +S I+KH+MVDQIKREI
Sbjct  1    MKKKSRNVGKYEVGRTIGEGTFAKVKFARNCEXGESVAMKVLAKSTILKHRMVDQIKREI  60

Query  627  SIMKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            SIMK+VRHP +VRL EV+A RTKI+IILEF+TGGELFDKI+H G+L E ESR+YF QLI
Sbjct  61   SIMKIVRHPNIVRLLEVLAGRTKIFIILEFVTGGELFDKIVHQGKLPENESRKYFQQLI  119



>gb|KDO66334.1| hypothetical protein CISIN_1g013407mg [Citrus sinensis]
Length=269

 Score =   182 bits (463),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = +3

Query  462  RKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMKL  641
            R+VGKYEVGRTIGEGTFAKVKFA+N+ETGE VA+K++D+  ++KHKM +QIKRE++ MKL
Sbjct  8    RRVGKYEVGRTIGEGTFAKVKFARNSETGEPVALKILDKEKVLKHKMAEQIKREVATMKL  67

Query  642  VRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            V+HP VVRL+EV+ S+TKI+I+LEF+TGGELFDKI++HGR+ E E+RRYF QLI
Sbjct  68   VKHPNVVRLYEVMGSKTKIFIVLEFVTGGELFDKIVNHGRMKEDEARRYFQQLI  121



>ref|XP_009368863.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24-like 
isoform X3 [Pyrus x bretschneideri]
Length=445

 Score =   187 bits (475),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = +3

Query  462  RKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMKL  641
            RKVGKY+VGR +GEGTFAKVKFA+N ETGE VAMK++ +S+I+KH+MVDQIKREISIMK+
Sbjct  5    RKVGKYQVGRVVGEGTFAKVKFARNCETGEGVAMKILAKSSILKHRMVDQIKREISIMKI  64

Query  642  VRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            VRHP +VRLHEV+A R KI+IILEF+TGGELFDKI+H G+L E ESR+YF QL+
Sbjct  65   VRHPNIVRLHEVLAGRAKIFIILEFVTGGELFDKIVHQGKLPENESRKYFQQLV  118



>ref|XP_007015396.1| CBL-interacting serine/threonine-protein kinase 3 isoform 2 [Theobroma 
cacao]
 gb|EOY33015.1| CBL-interacting serine/threonine-protein kinase 3 isoform 2 [Theobroma 
cacao]
Length=176

 Score =   179 bits (455),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = +3

Query  462  RKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMKL  641
            R+VGKYEVGRTIGEGTFAKVKFA+N+ETGE VA+K++D+  ++KHKM +QIKREI+ MKL
Sbjct  8    RRVGKYEVGRTIGEGTFAKVKFARNSETGEPVALKILDKEKVLKHKMAEQIKREIATMKL  67

Query  642  VRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            ++HP VVRL+EV+ S+TKI+I+LEF+TGGELFDKI+ HGR+ E E+RRYF QLI
Sbjct  68   IKHPNVVRLYEVMGSKTKIFIVLEFVTGGELFDKIVKHGRMREEEARRYFHQLI  121



>ref|XP_004508487.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24-like 
[Cicer arietinum]
Length=416

 Score =   186 bits (472),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = +3

Query  447  LKMVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREI  626
            +K V RK+GKYEVGRTIGEGTFAKVKFA+++ETG+SVA+KV+ ++ I+KHKMVDQIKREI
Sbjct  1    MKKVRRKIGKYEVGRTIGEGTFAKVKFAKDSETGKSVAIKVMAKTTILKHKMVDQIKREI  60

Query  627  SIMKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            SIMK+VRHP +VRLHEV+AS+ KIYIILEF+ GGEL+DKI+  G+L E ESRRYF QLI
Sbjct  61   SIMKIVRHPNIVRLHEVLASQNKIYIILEFVMGGELYDKIVRQGKLSENESRRYFQQLI  119



>gb|KDO66333.1| hypothetical protein CISIN_1g013407mg [Citrus sinensis]
Length=334

 Score =   183 bits (465),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = +3

Query  462  RKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMKL  641
            R+VGKYEVGRTIGEGTFAKVKFA+N+ETGE VA+K++D+  ++KHKM +QIKRE++ MKL
Sbjct  8    RRVGKYEVGRTIGEGTFAKVKFARNSETGEPVALKILDKEKVLKHKMAEQIKREVATMKL  67

Query  642  VRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            V+HP VVRL+EV+ S+TKI+I+LEF+TGGELFDKI++HGR+ E E+RRYF QLI
Sbjct  68   VKHPNVVRLYEVMGSKTKIFIVLEFVTGGELFDKIVNHGRMKEDEARRYFQQLI  121



>ref|XP_006369417.1| hypothetical protein POPTR_0001s23030g [Populus trichocarpa]
 ref|XP_006369418.1| hypothetical protein POPTR_0001s23030g [Populus trichocarpa]
 gb|ERP65986.1| hypothetical protein POPTR_0001s23030g [Populus trichocarpa]
 gb|ERP65987.1| hypothetical protein POPTR_0001s23030g [Populus trichocarpa]
Length=261

 Score =   181 bits (460),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = +3

Query  462  RKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMKL  641
            R+VGKYEVGRTIGEGTFAKVKFA+N+ETGE VA+K++D+  ++KHKM +QIKREI  MKL
Sbjct  8    RRVGKYEVGRTIGEGTFAKVKFARNSETGEPVALKILDKEKVLKHKMAEQIKREIETMKL  67

Query  642  VRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            ++HP VVRL+EV+ S+TKI+I+LEF+TGGELFDKI++HGR+ E E+RRYF QLI
Sbjct  68   IKHPNVVRLYEVMGSKTKIFIVLEFVTGGELFDKIVNHGRMREDEARRYFQQLI  121



>ref|XP_009368861.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24-like 
isoform X2 [Pyrus x bretschneideri]
Length=446

 Score =   186 bits (472),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = +3

Query  462  RKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMKL  641
            RKVGKYEVG  +GEGTFAKVKFA+N ETGE VAMK++ +S+I+KH+MVDQIKREISIMK+
Sbjct  5    RKVGKYEVGWVVGEGTFAKVKFARNCETGEGVAMKILAKSSILKHRMVDQIKREISIMKI  64

Query  642  VRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            VRHP +VRLHEV+A R KI+IILEF+TGGELFDKI+H G+L E ESR+YF QL+
Sbjct  65   VRHPNIVRLHEVLAGRAKIFIILEFVTGGELFDKIVHQGKLPENESRKYFQQLV  118



>ref|XP_003617147.1| CBL-interacting protein kinase [Medicago truncatula]
 gb|AET00106.1| CBL-interacting kinase [Medicago truncatula]
Length=338

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = +3

Query  462  RKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMKL  641
            R+VG YEVGRTIGEGTFAKVKFA+N+ETGE+VA+K++D+  ++KHKM +QIKREI+ MKL
Sbjct  8    RRVGIYEVGRTIGEGTFAKVKFARNSETGEAVALKILDKEKVLKHKMAEQIKREIATMKL  67

Query  642  VRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            ++HP VVRL+EV+ SRTKIYI+LEF+TGGELFDKI++HGR+ E E+RRYF QLI
Sbjct  68   IKHPNVVRLYEVMGSRTKIYIVLEFVTGGELFDKIVNHGRMGEPEARRYFQQLI  121



>ref|XP_007141550.1| hypothetical protein PHAVU_008G205700g [Phaseolus vulgaris]
 ref|XP_007141551.1| hypothetical protein PHAVU_008G205700g [Phaseolus vulgaris]
 ref|XP_007141552.1| hypothetical protein PHAVU_008G205700g [Phaseolus vulgaris]
 ref|XP_007141553.1| hypothetical protein PHAVU_008G205700g [Phaseolus vulgaris]
 gb|ESW13544.1| hypothetical protein PHAVU_008G205700g [Phaseolus vulgaris]
 gb|ESW13545.1| hypothetical protein PHAVU_008G205700g [Phaseolus vulgaris]
 gb|ESW13546.1| hypothetical protein PHAVU_008G205700g [Phaseolus vulgaris]
 gb|ESW13547.1| hypothetical protein PHAVU_008G205700g [Phaseolus vulgaris]
Length=441

 Score =   186 bits (471),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = +3

Query  462  RKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMKL  641
            R+VGKYEVGRTIGEGTFAKVKFA+N+ETGE VA+K++D+  ++KHKM +QI+RE++ MKL
Sbjct  8    RRVGKYEVGRTIGEGTFAKVKFARNSETGEPVALKILDKEKVLKHKMAEQIRREVATMKL  67

Query  642  VRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            ++HP+VV+LHEV+ S+TKIYI+LEF+TGGELFDKI++HGR+ E E+RRYF QLI
Sbjct  68   IKHPHVVQLHEVMGSKTKIYIVLEFVTGGELFDKIVNHGRMSENEARRYFQQLI  121



>ref|XP_002868418.1| hypothetical protein ARALYDRAFT_915669 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44677.1| hypothetical protein ARALYDRAFT_915669 [Arabidopsis lyrata subsp. 
lyrata]
Length=446

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +3

Query  459  VRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMK  638
            +R+VGKYEVGRT+GEGTFAKVKFA+NT+TGE+VA+K++ +S I+K++MVDQIKREISIMK
Sbjct  5    MRRVGKYEVGRTVGEGTFAKVKFARNTDTGENVAIKIMAKSTILKNRMVDQIKREISIMK  64

Query  639  LVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            +VRHP +VRL+EV+AS +KIYI+LEF+TGGELFD+I+H+GRL E+ESR+YF QL+
Sbjct  65   IVRHPNIVRLYEVLASPSKIYIVLEFVTGGELFDRIVHNGRLEESESRKYFQQLV  119



>ref|XP_007155013.1| hypothetical protein PHAVU_003G165700g [Phaseolus vulgaris]
 gb|ESW27007.1| hypothetical protein PHAVU_003G165700g [Phaseolus vulgaris]
Length=452

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +3

Query  456  VVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIM  635
            V RK+GKYEVGRTIGEGTFAKVKFA N+ETGESVA+KV+ ++ I++H+MVDQIKREISIM
Sbjct  10   VRRKIGKYEVGRTIGEGTFAKVKFAINSETGESVAIKVMAKTTILQHRMVDQIKREISIM  69

Query  636  KLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            K+VRHP +VRLHEV+AS+TKIYIILEF+ GGEL+DKI+  GRL E ESRRYF QLI
Sbjct  70   KIVRHPNIVRLHEVLASQTKIYIILEFVMGGELYDKIVQLGRLSENESRRYFQQLI  125



>emb|CDL67726.1| Ser/Thr protein kinase [Arachis hypogaea]
Length=446

 Score =   185 bits (469),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = +3

Query  447  LKMVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREI  626
            +K V  K+GKYEVGRTIGEGTFAKVKFA+NT+TG+SVA+KV+ +S I+KH+MV+QIKREI
Sbjct  1    MKKVRNKIGKYEVGRTIGEGTFAKVKFAKNTDTGDSVAIKVMAKSTILKHRMVEQIKREI  60

Query  627  SIMKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            SIMK+VRHP +VRLHEV+AS+TKIYIILEF+ GGEL+DKI   G+L E +SRRYF QLI
Sbjct  61   SIMKIVRHPNIVRLHEVLASKTKIYIILEFVMGGELYDKIAQQGKLSENDSRRYFQQLI  119



>ref|XP_006283730.1| hypothetical protein CARUB_v10004801mg [Capsella rubella]
 gb|EOA16628.1| hypothetical protein CARUB_v10004801mg [Capsella rubella]
Length=447

 Score =   185 bits (469),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = +3

Query  459  VRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMK  638
            +R+VGKYEVGRT+GEGTFAKVKFA+NT TGE+VA+K++ +S I+KH+MVDQIKREISIMK
Sbjct  6    MRRVGKYEVGRTLGEGTFAKVKFARNTVTGENVAIKIMAKSTILKHRMVDQIKREISIMK  65

Query  639  LVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            +VRHP +VRL+EV+AS +KIYI+LEF+TGGELFD+I+H+GRL E ESR+YF QL+
Sbjct  66   IVRHPNIVRLYEVLASPSKIYIVLEFVTGGELFDRIVHNGRLEENESRKYFQQLV  120



>gb|KCW51025.1| hypothetical protein EUGRSUZ_J00641 [Eucalyptus grandis]
Length=418

 Score =   184 bits (467),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +3

Query  456  VVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIM  635
            V R+VGKYEVGRTIGEGTFAKVKFA+N+ETGE+VA+K++D+  ++KHKM +QIKREI  M
Sbjct  11   VKRRVGKYEVGRTIGEGTFAKVKFARNSETGEAVALKILDKEKVLKHKMAEQIKREIETM  70

Query  636  KLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            KL++HP VVRL+EVI S+TKI+I+LEF+TGGELFDKI++HGR+ E E+RRYF QLI
Sbjct  71   KLIKHPNVVRLYEVIGSKTKIFIVLEFVTGGELFDKIVNHGRMREDEARRYFQQLI  126



>ref|XP_009772992.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 3-like 
[Nicotiana sylvestris]
 ref|XP_009772993.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 3-like 
[Nicotiana sylvestris]
Length=438

 Score =   184 bits (468),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = +3

Query  462  RKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMKL  641
            R+VGKYEVGRTIGEGTFAKVKFA+N+ETGE+VA+K++D+  ++KHKM +QIKREI+IMKL
Sbjct  8    RRVGKYEVGRTIGEGTFAKVKFARNSETGENVAIKILDKDKVLKHKMAEQIKREIAIMKL  67

Query  642  VRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            +RHP+VV+L+EV+ S+TKI+I+LEF+TGGELFDKI++HGR+ E E+R+YF QLI
Sbjct  68   IRHPHVVQLYEVMGSKTKIFIVLEFVTGGELFDKIVNHGRMREEEARKYFQQLI  121



>ref|XP_010541706.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 26 
[Tarenaya hassleriana]
 ref|XP_010541707.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 26 
[Tarenaya hassleriana]
Length=439

 Score =   184 bits (468),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +3

Query  456  VVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIM  635
            V R+VGKYEVGRTIGEGTFAKV++A+N+ETGE+VA+K++D+  ++KHKM +QI+REIS M
Sbjct  6    VKRRVGKYEVGRTIGEGTFAKVRYARNSETGEAVALKILDKEKVLKHKMAEQIRREISTM  65

Query  636  KLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            KL+ HP VVRL+EV+AS+TKIYI+LEF+TGGELFDKI++HGR+ E E+RRYF QLI
Sbjct  66   KLITHPNVVRLYEVLASKTKIYIVLEFVTGGELFDKIVNHGRMKEEEARRYFQQLI  121



>ref|XP_010031661.1| PREDICTED: CBL-interacting protein kinase 32-like [Eucalyptus 
grandis]
 ref|XP_010031662.1| PREDICTED: CBL-interacting protein kinase 32-like [Eucalyptus 
grandis]
 ref|XP_010031663.1| PREDICTED: CBL-interacting protein kinase 32-like [Eucalyptus 
grandis]
 ref|XP_010031664.1| PREDICTED: CBL-interacting protein kinase 32-like [Eucalyptus 
grandis]
 ref|XP_010031665.1| PREDICTED: CBL-interacting protein kinase 32-like [Eucalyptus 
grandis]
 gb|KCW51022.1| hypothetical protein EUGRSUZ_J00641 [Eucalyptus grandis]
Length=444

 Score =   184 bits (468),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +3

Query  456  VVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIM  635
            V R+VGKYEVGRTIGEGTFAKVKFA+N+ETGE+VA+K++D+  ++KHKM +QIKREI  M
Sbjct  11   VKRRVGKYEVGRTIGEGTFAKVKFARNSETGEAVALKILDKEKVLKHKMAEQIKREIETM  70

Query  636  KLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            KL++HP VVRL+EVI S+TKI+I+LEF+TGGELFDKI++HGR+ E E+RRYF QLI
Sbjct  71   KLIKHPNVVRLYEVIGSKTKIFIVLEFVTGGELFDKIVNHGRMREDEARRYFQQLI  126



>ref|XP_006369416.1| hypothetical protein POPTR_0001s23030g [Populus trichocarpa]
 gb|ERP65985.1| hypothetical protein POPTR_0001s23030g [Populus trichocarpa]
Length=345

 Score =   182 bits (461),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = +3

Query  462  RKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMKL  641
            R+VGKYEVGRTIGEGTFAKVKFA+N+ETGE VA+K++D+  ++KHKM +QIKREI  MKL
Sbjct  8    RRVGKYEVGRTIGEGTFAKVKFARNSETGEPVALKILDKEKVLKHKMAEQIKREIETMKL  67

Query  642  VRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            ++HP VVRL+EV+ S+TKI+I+LEF+TGGELFDKI++HGR+ E E+RRYF QLI
Sbjct  68   IKHPNVVRLYEVMGSKTKIFIVLEFVTGGELFDKIVNHGRMREDEARRYFQQLI  121



>emb|CCH26589.1| salt overly sensitive 2 [Arabidopsis thaliana]
 emb|CCH26592.1| salt overly sensitive 2 [Arabidopsis thaliana]
Length=446

 Score =   184 bits (468),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 108/115 (94%), Gaps = 0/115 (0%)
 Frame = +3

Query  459  VRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMK  638
            +R+VGKYEVGRTIGEGTFAKVKFA+NT+TG++VA+K++ +S I+K++MVDQIKREISIMK
Sbjct  5    MRRVGKYEVGRTIGEGTFAKVKFARNTDTGDNVAIKIMAKSTILKNRMVDQIKREISIMK  64

Query  639  LVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            +VRHP +VRL+EV+AS +KIYI+LEF+TGGELFD+I+H GRL E+ESR+YF QL+
Sbjct  65   IVRHPNIVRLYEVLASPSKIYIVLEFVTGGELFDRIVHKGRLEESESRKYFQQLV  119



>pdb|4D28|A Chain A, Crystal Structure Of The Kinase Domain Of Snrk3.11 At5g35410
 pdb|4D28|B Chain B, Crystal Structure Of The Kinase Domain Of Snrk3.11 At5g35410
 pdb|4D28|C Chain C, Crystal Structure Of The Kinase Domain Of Snrk3.11 At5g35410
 pdb|4D28|D Chain D, Crystal Structure Of The Kinase Domain Of Snrk3.11 At5g35410
Length=446

 Score =   184 bits (467),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 108/115 (94%), Gaps = 0/115 (0%)
 Frame = +3

Query  459  VRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMK  638
            +R+VGKYEVGRTIGEGTFAKVKFA+NT+TG++VA+K++ +S I+K++MVDQIKREISIMK
Sbjct  5    MRRVGKYEVGRTIGEGTFAKVKFARNTDTGDNVAIKIMAKSTILKNRMVDQIKREISIMK  64

Query  639  LVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            +VRHP +VRL+EV+AS++KIYI+LEF+TGGELFD+I+H GRL E ESR+YF QL+
Sbjct  65   IVRHPNIVRLYEVLASKSKIYIVLEFVTGGELFDRIVHKGRLKEDESRKYFQQLV  119



>ref|NP_198391.1| CBL-interacting serine/threonine-protein kinase 24 [Arabidopsis 
thaliana]
 sp|Q9LDI3.1|CIPKO_ARATH RecName: Full=CBL-interacting serine/threonine-protein kinase 
24; AltName: Full=Protein SALT OVERLY SENSITIVE 2; AltName: 
Full=SNF1-related kinase 3.11 [Arabidopsis thaliana]
 gb|AAF62923.1|AF237670_1 serine/threonine protein kinase SOS2 [Arabidopsis thaliana]
 gb|AAK72257.1|AF395081_1 CBL-interacting protein kinase 24 [Arabidopsis thaliana]
 dbj|BAA98146.1| serine/threonine protein kinase SOS2 [Arabidopsis thaliana]
 gb|AAM20472.1| serine/threonine protein kinase SOS2 [Arabidopsis thaliana]
 gb|AAN72149.1| serine/threonine protein kinase SOS2 [Arabidopsis thaliana]
 gb|AED93966.1| CBL-interacting serine/threonine-protein kinase 24 [Arabidopsis 
thaliana]
 emb|CCH26588.1| salt overly sensitive 2 [Arabidopsis thaliana]
 emb|CCH26590.1| salt overly sensitive 2 [Arabidopsis thaliana]
 emb|CCH26591.1| salt overly sensitive 2 [Arabidopsis thaliana]
 emb|CCH26593.1| salt overly sensitive 2 [Arabidopsis thaliana]
 emb|CCH26594.1| salt overly sensitive 2 [Arabidopsis thaliana]
 emb|CCH26595.1| salt overly sensitive 2 [Arabidopsis thaliana]
 emb|CCH26596.1| salt overly sensitive 2 [Arabidopsis thaliana]
 emb|CCH26597.1| salt overly sensitive 2 [Arabidopsis thaliana]
 emb|CCH26598.1| salt overly sensitive 2 [Arabidopsis thaliana]
 emb|CCH26599.1| salt overly sensitive 2 [Arabidopsis thaliana]
 emb|CCH26600.1| salt overly sensitive 2 [Arabidopsis thaliana]
 emb|CCH26601.1| salt overly sensitive 2 [Arabidopsis thaliana]
 emb|CCH26602.1| salt overly sensitive 2 [Arabidopsis thaliana]
 emb|CCH26603.1| salt overly sensitive 2 [Arabidopsis thaliana]
 emb|CCH26604.1| salt overly sensitive 2 [Arabidopsis thaliana]
 emb|CCH26605.1| salt overly sensitive 2 [Arabidopsis thaliana]
 emb|CCH26606.1| salt overly sensitive 2 [Arabidopsis thaliana]
 emb|CCH26607.1| salt overly sensitive 2 [Arabidopsis thaliana]
Length=446

 Score =   184 bits (467),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 108/115 (94%), Gaps = 0/115 (0%)
 Frame = +3

Query  459  VRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMK  638
            +R+VGKYEVGRTIGEGTFAKVKFA+NT+TG++VA+K++ +S I+K++MVDQIKREISIMK
Sbjct  5    MRRVGKYEVGRTIGEGTFAKVKFARNTDTGDNVAIKIMAKSTILKNRMVDQIKREISIMK  64

Query  639  LVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            +VRHP +VRL+EV+AS +KIYI+LEF+TGGELFD+I+H GRL E+ESR+YF QL+
Sbjct  65   IVRHPNIVRLYEVLASPSKIYIVLEFVTGGELFDRIVHKGRLEESESRKYFQQLV  119



>gb|KDO66332.1| hypothetical protein CISIN_1g013407mg [Citrus sinensis]
Length=416

 Score =   183 bits (465),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = +3

Query  462  RKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMKL  641
            R+VGKYEVGRTIGEGTFAKVKFA+N+ETGE VA+K++D+  ++KHKM +QIKRE++ MKL
Sbjct  8    RRVGKYEVGRTIGEGTFAKVKFARNSETGEPVALKILDKEKVLKHKMAEQIKREVATMKL  67

Query  642  VRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            V+HP VVRL+EV+ S+TKI+I+LEF+TGGELFDKI++HGR+ E E+RRYF QLI
Sbjct  68   VKHPNVVRLYEVMGSKTKIFIVLEFVTGGELFDKIVNHGRMKEDEARRYFQQLI  121



>gb|KJB35624.1| hypothetical protein B456_006G121600 [Gossypium raimondii]
 gb|KJB35626.1| hypothetical protein B456_006G121600 [Gossypium raimondii]
Length=397

 Score =   183 bits (464),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 104/113 (92%), Gaps = 0/113 (0%)
 Frame = +3

Query  465  KVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMKLV  644
            +VGKY+VGRTIGEGTFAKVKFA+N+ETGE VA+K++D+  ++KHKM +QIKREI+ MKL+
Sbjct  9    RVGKYQVGRTIGEGTFAKVKFARNSETGEPVALKILDKDKVLKHKMAEQIKREIATMKLI  68

Query  645  RHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            +HP V+RLHEV+AS+TKI+I+LEF+TGGELFDKI++HGR+ E E+RRYF QLI
Sbjct  69   KHPNVIRLHEVMASKTKIFIVLEFVTGGELFDKIVNHGRMIENEARRYFQQLI  121



>gb|KCW51021.1| hypothetical protein EUGRSUZ_J00641 [Eucalyptus grandis]
Length=458

 Score =   184 bits (468),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +3

Query  456  VVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIM  635
            V R+VGKYEVGRTIGEGTFAKVKFA+N+ETGE+VA+K++D+  ++KHKM +QIKREI  M
Sbjct  25   VKRRVGKYEVGRTIGEGTFAKVKFARNSETGEAVALKILDKEKVLKHKMAEQIKREIETM  84

Query  636  KLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            KL++HP VVRL+EVI S+TKI+I+LEF+TGGELFDKI++HGR+ E E+RRYF QLI
Sbjct  85   KLIKHPNVVRLYEVIGSKTKIFIVLEFVTGGELFDKIVNHGRMREDEARRYFQQLI  140



>ref|XP_007015398.1| CBL-interacting protein kinase 3 isoform 4 [Theobroma cacao]
 gb|EOY33017.1| CBL-interacting protein kinase 3 isoform 4 [Theobroma cacao]
Length=338

 Score =   181 bits (460),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = +3

Query  462  RKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMKL  641
            R+VGKYEVGRTIGEGTFAKVKFA+N+ETGE VA+K++D+  ++KHKM +QIKREI+ MKL
Sbjct  8    RRVGKYEVGRTIGEGTFAKVKFARNSETGEPVALKILDKEKVLKHKMAEQIKREIATMKL  67

Query  642  VRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            ++HP VVRL+EV+ S+TKI+I+LEF+TGGELFDKI+ HGR+ E E+RRYF QLI
Sbjct  68   IKHPNVVRLYEVMGSKTKIFIVLEFVTGGELFDKIVKHGRMREEEARRYFHQLI  121



>ref|XP_004228494.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 3-like 
[Solanum lycopersicum]
 ref|XP_010314164.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 3-like 
[Solanum lycopersicum]
 ref|XP_010314200.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 3-like 
[Solanum lycopersicum]
Length=438

 Score =   184 bits (466),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = +3

Query  462  RKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMKL  641
            R+VGKYEVGRTIGEGTFAKVKFA+N+ETGESVA+K++D+  ++KHKM +QIKREI+ MKL
Sbjct  8    RRVGKYEVGRTIGEGTFAKVKFAKNSETGESVAIKILDKDKVLKHKMAEQIKREIATMKL  67

Query  642  VRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            +RHP+VV+L+EV+ S+TKI+I+LEF+TGGELFDKI++HGR+ E E+R+YF QLI
Sbjct  68   IRHPHVVQLYEVMGSKTKIFIVLEFVTGGELFDKIVNHGRMREEEARKYFQQLI  121



>ref|XP_010050019.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 24-like 
[Eucalyptus grandis]
 gb|KCW82857.1| hypothetical protein EUGRSUZ_C04226 [Eucalyptus grandis]
Length=445

 Score =   184 bits (466),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +3

Query  453  MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISI  632
            +  R++GKY+VGRTIGEGTFAKVKFAQN E G +VA+K++ +S I+KH+MVDQI+REISI
Sbjct  2    VTTRRIGKYQVGRTIGEGTFAKVKFAQNLENGNNVAIKIMAKSTILKHRMVDQIRREISI  61

Query  633  MKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            MK+VRHP +VRLHEV+ASRTKIYIILEF++GGELFDKI+H GRL E   R+YF QLI
Sbjct  62   MKIVRHPNIVRLHEVLASRTKIYIILEFVSGGELFDKIVHQGRLPENLCRKYFQQLI  118



>ref|XP_006574419.1| PREDICTED: uncharacterized protein LOC100794566 isoform X1 [Glycine 
max]
 ref|XP_006574420.1| PREDICTED: uncharacterized protein LOC100794566 isoform X2 [Glycine 
max]
 ref|XP_006574421.1| PREDICTED: uncharacterized protein LOC100794566 isoform X3 [Glycine 
max]
 ref|XP_006574422.1| PREDICTED: uncharacterized protein LOC100794566 isoform X4 [Glycine 
max]
 ref|XP_006574423.1| PREDICTED: uncharacterized protein LOC100794566 isoform X5 [Glycine 
max]
 gb|KHN38423.1| CBL-interacting serine/threonine-protein kinase 3 [Glycine soja]
Length=441

 Score =   184 bits (466),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = +3

Query  462  RKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMKL  641
            R+VGKYEVGRTIGEGTFAKVKFA+N+ETGE VA+K++D+  ++KHKM +QI+RE++ MKL
Sbjct  8    RRVGKYEVGRTIGEGTFAKVKFARNSETGEPVALKILDKEKVLKHKMAEQIRREVATMKL  67

Query  642  VRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            ++HP VVRL+EV+ S+TKIYI+LEF+TGGELFDKI++HGR+ E E+RRYF QLI
Sbjct  68   IKHPNVVRLYEVMGSKTKIYIVLEFVTGGELFDKIVNHGRMSENEARRYFQQLI  121



>ref|XP_006470418.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 3-like 
isoform X1 [Citrus sinensis]
 ref|XP_006470419.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 3-like 
isoform X2 [Citrus sinensis]
 ref|XP_006470420.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 3-like 
isoform X3 [Citrus sinensis]
 ref|XP_006470421.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 3-like 
isoform X4 [Citrus sinensis]
 gb|KDO66327.1| hypothetical protein CISIN_1g013407mg [Citrus sinensis]
 gb|KDO66328.1| hypothetical protein CISIN_1g013407mg [Citrus sinensis]
 gb|KDO66329.1| hypothetical protein CISIN_1g013407mg [Citrus sinensis]
 gb|KDO66330.1| hypothetical protein CISIN_1g013407mg [Citrus sinensis]
 gb|KDO66331.1| hypothetical protein CISIN_1g013407mg [Citrus sinensis]
Length=439

 Score =   184 bits (466),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = +3

Query  462  RKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMKL  641
            R+VGKYEVGRTIGEGTFAKVKFA+N+ETGE VA+K++D+  ++KHKM +QIKRE++ MKL
Sbjct  8    RRVGKYEVGRTIGEGTFAKVKFARNSETGEPVALKILDKEKVLKHKMAEQIKREVATMKL  67

Query  642  VRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            V+HP VVRL+EV+ S+TKI+I+LEF+TGGELFDKI++HGR+ E E+RRYF QLI
Sbjct  68   VKHPNVVRLYEVMGSKTKIFIVLEFVTGGELFDKIVNHGRMKEDEARRYFQQLI  121



>gb|KJB35620.1| hypothetical protein B456_006G121600 [Gossypium raimondii]
Length=415

 Score =   183 bits (464),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 104/113 (92%), Gaps = 0/113 (0%)
 Frame = +3

Query  465  KVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMKLV  644
            +VGKY+VGRTIGEGTFAKVKFA+N+ETGE VA+K++D+  ++KHKM +QIKREI+ MKL+
Sbjct  9    RVGKYQVGRTIGEGTFAKVKFARNSETGEPVALKILDKDKVLKHKMAEQIKREIATMKLI  68

Query  645  RHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            +HP V+RLHEV+AS+TKI+I+LEF+TGGELFDKI++HGR+ E E+RRYF QLI
Sbjct  69   KHPNVIRLHEVMASKTKIFIVLEFVTGGELFDKIVNHGRMIENEARRYFQQLI  121



>ref|XP_003617145.1| CBL-interacting protein kinase [Medicago truncatula]
 gb|AET00104.1| CBL-interacting kinase [Medicago truncatula]
Length=441

 Score =   184 bits (466),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = +3

Query  462  RKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMKL  641
            R+VG YEVGRTIGEGTFAKVKFA+N+ETGE+VA+K++D+  ++KHKM +QIKREI+ MKL
Sbjct  8    RRVGIYEVGRTIGEGTFAKVKFARNSETGEAVALKILDKEKVLKHKMAEQIKREIATMKL  67

Query  642  VRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            ++HP VVRL+EV+ SRTKIYI+LEF+TGGELFDKI++HGR+ E E+RRYF QLI
Sbjct  68   IKHPNVVRLYEVMGSRTKIYIVLEFVTGGELFDKIVNHGRMGEPEARRYFQQLI  121



>ref|XP_003617146.1| CBL-interacting protein kinase [Medicago truncatula]
 gb|AET00105.1| CBL-interacting kinase [Medicago truncatula]
Length=430

 Score =   183 bits (465),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = +3

Query  462  RKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMKL  641
            R+VG YEVGRTIGEGTFAKVKFA+N+ETGE+VA+K++D+  ++KHKM +QIKREI+ MKL
Sbjct  8    RRVGIYEVGRTIGEGTFAKVKFARNSETGEAVALKILDKEKVLKHKMAEQIKREIATMKL  67

Query  642  VRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            ++HP VVRL+EV+ SRTKIYI+LEF+TGGELFDKI++HGR+ E E+RRYF QLI
Sbjct  68   IKHPNVVRLYEVMGSRTKIYIVLEFVTGGELFDKIVNHGRMGEPEARRYFQQLI  121



>gb|KJB35622.1| hypothetical protein B456_006G121600 [Gossypium raimondii]
Length=433

 Score =   183 bits (465),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 104/113 (92%), Gaps = 0/113 (0%)
 Frame = +3

Query  465  KVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMKLV  644
            +VGKY+VGRTIGEGTFAKVKFA+N+ETGE VA+K++D+  ++KHKM +QIKREI+ MKL+
Sbjct  9    RVGKYQVGRTIGEGTFAKVKFARNSETGEPVALKILDKDKVLKHKMAEQIKREIATMKLI  68

Query  645  RHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            +HP V+RLHEV+AS+TKI+I+LEF+TGGELFDKI++HGR+ E E+RRYF QLI
Sbjct  69   KHPNVIRLHEVMASKTKIFIVLEFVTGGELFDKIVNHGRMIENEARRYFQQLI  121



>gb|KDO66326.1| hypothetical protein CISIN_1g013407mg [Citrus sinensis]
Length=443

 Score =   184 bits (466),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = +3

Query  462  RKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMKL  641
            R+VGKYEVGRTIGEGTFAKVKFA+N+ETGE VA+K++D+  ++KHKM +QIKRE++ MKL
Sbjct  8    RRVGKYEVGRTIGEGTFAKVKFARNSETGEPVALKILDKEKVLKHKMAEQIKREVATMKL  67

Query  642  VRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            V+HP VVRL+EV+ S+TKI+I+LEF+TGGELFDKI++HGR+ E E+RRYF QLI
Sbjct  68   VKHPNVVRLYEVMGSKTKIFIVLEFVTGGELFDKIVNHGRMKEDEARRYFQQLI  121



>gb|KJB09268.1| hypothetical protein B456_001G132200 [Gossypium raimondii]
Length=336

 Score =   181 bits (458),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = +3

Query  462  RKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMKL  641
            R+VGKYEVGRTIGEGTFAKVKFA+N+ETGE+VA+K++D+  ++KHKM +QIKREI+ MKL
Sbjct  8    RRVGKYEVGRTIGEGTFAKVKFARNSETGEAVALKILDKEKVLKHKMAEQIKREIATMKL  67

Query  642  VRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            ++HP VVRL+EV+ S+TKI+I+LEF+TGGELFDKI+++GR+ E E+RRYF QLI
Sbjct  68   IQHPNVVRLYEVMGSKTKIFIVLEFVTGGELFDKIVNNGRMREDEARRYFQQLI  121



>gb|KJB35615.1| hypothetical protein B456_006G121600 [Gossypium raimondii]
 gb|KJB35616.1| hypothetical protein B456_006G121600 [Gossypium raimondii]
 gb|KJB35617.1| hypothetical protein B456_006G121600 [Gossypium raimondii]
 gb|KJB35618.1| hypothetical protein B456_006G121600 [Gossypium raimondii]
 gb|KJB35619.1| hypothetical protein B456_006G121600 [Gossypium raimondii]
 gb|KJB35625.1| hypothetical protein B456_006G121600 [Gossypium raimondii]
Length=442

 Score =   183 bits (465),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 104/113 (92%), Gaps = 0/113 (0%)
 Frame = +3

Query  465  KVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMKLV  644
            +VGKY+VGRTIGEGTFAKVKFA+N+ETGE VA+K++D+  ++KHKM +QIKREI+ MKL+
Sbjct  9    RVGKYQVGRTIGEGTFAKVKFARNSETGEPVALKILDKDKVLKHKMAEQIKREIATMKLI  68

Query  645  RHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            +HP V+RLHEV+AS+TKI+I+LEF+TGGELFDKI++HGR+ E E+RRYF QLI
Sbjct  69   KHPNVIRLHEVMASKTKIFIVLEFVTGGELFDKIVNHGRMIENEARRYFQQLI  121



>ref|XP_009768708.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 3-like 
isoform X2 [Nicotiana sylvestris]
Length=437

 Score =   183 bits (465),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = +3

Query  462  RKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMKL  641
            R+VGKYE+GRTIGEGTFAKVKFA+N+ETGE+VA+K++D+  ++KHKM +QIKREI+ MKL
Sbjct  8    RRVGKYEMGRTIGEGTFAKVKFARNSETGEAVAIKILDKDKVLKHKMAEQIKREIATMKL  67

Query  642  VRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            +RHP+VVRL+EV+ S+TKI+I+LEFITGGELFDKI++HGR+ E E+R+YF QLI
Sbjct  68   IRHPHVVRLYEVMGSKTKIFIVLEFITGGELFDKIVNHGRMHEKEARKYFQQLI  121



>ref|XP_004250885.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 3 
[Solanum lycopersicum]
 ref|XP_010313226.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 3 
[Solanum lycopersicum]
 ref|XP_010313227.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 3 
[Solanum lycopersicum]
 ref|XP_010313228.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 3 
[Solanum lycopersicum]
Length=437

 Score =   183 bits (465),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = +3

Query  462  RKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMKL  641
            R+VGKYE+GRTIGEGTFAKVKFA+N+ETGE+VA+K++D+  ++KHKM +QIKREI+ MKL
Sbjct  8    RRVGKYEMGRTIGEGTFAKVKFARNSETGEAVAIKILDKDKVLKHKMAEQIKREIATMKL  67

Query  642  VRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            +RHP+VV+L+EV+AS+TKI+I+LEF+TGGELFDKI++HGR+ E E+R+YF QLI
Sbjct  68   IRHPHVVQLYEVLASKTKIFIVLEFVTGGELFDKIVNHGRMHEKEARKYFQQLI  121



>ref|XP_009768703.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 3-like 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009768704.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 3-like 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009768705.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 3-like 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009768706.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 3-like 
isoform X1 [Nicotiana sylvestris]
Length=438

 Score =   183 bits (465),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = +3

Query  462  RKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMKL  641
            R+VGKYE+GRTIGEGTFAKVKFA+N+ETGE+VA+K++D+  ++KHKM +QIKREI+ MKL
Sbjct  8    RRVGKYEMGRTIGEGTFAKVKFARNSETGEAVAIKILDKDKVLKHKMAEQIKREIATMKL  67

Query  642  VRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            +RHP+VVRL+EV+ S+TKI+I+LEFITGGELFDKI++HGR+ E E+R+YF QLI
Sbjct  68   IRHPHVVRLYEVMGSKTKIFIVLEFITGGELFDKIVNHGRMHEKEARKYFQQLI  121



>ref|XP_010251746.1| PREDICTED: CBL-interacting protein kinase 32 [Nelumbo nucifera]
 ref|XP_010251748.1| PREDICTED: CBL-interacting protein kinase 32 [Nelumbo nucifera]
Length=442

 Score =   183 bits (465),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +3

Query  456  VVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIM  635
            V R+VGKYEVGRTIGEGTFAKVKFA+N+ETGE VA+K++D+  ++KHKM +QIKREI+ M
Sbjct  6    VKRRVGKYEVGRTIGEGTFAKVKFARNSETGEPVAIKILDKEKVLKHKMAEQIKREIATM  65

Query  636  KLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            KL++HP VVRL+EV+ S+TKI+I+LEF+TGGELFDKI++HGR+ E E+RRYF QLI
Sbjct  66   KLIKHPNVVRLYEVMGSKTKIFIVLEFVTGGELFDKIVNHGRMREDEARRYFQQLI  121



>dbj|BAD95889.1| Ser/Thr protein kinase [Lotus japonicus]
Length=441

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = +3

Query  462  RKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMKL  641
            R+VGKYEVGRTIGEGTFAKVKFA+N+ETGE+VA+K++D+  ++KHKM +QIKRE++ MKL
Sbjct  8    RRVGKYEVGRTIGEGTFAKVKFARNSETGEAVALKILDKEKVLKHKMAEQIKREVATMKL  67

Query  642  VRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            ++HP VV+L+EV+ S+TKIY++LEF+TGGELFDKI++HGR+ E E+RRYF QLI
Sbjct  68   IKHPNVVQLYEVLGSKTKIYMVLEFVTGGELFDKIVNHGRMCEDEARRYFQQLI  121



>ref|XP_011080462.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 3 
isoform X2 [Sesamum indicum]
 ref|XP_011080463.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 3 
isoform X2 [Sesamum indicum]
Length=440

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = +3

Query  462  RKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMKL  641
            R++GKYEVGRTIGEGTFAKVKFA+N+ETGE+VA+K++D+  ++KHKM +QIKREI+ MKL
Sbjct  8    RRIGKYEVGRTIGEGTFAKVKFARNSETGEAVAVKILDKDKVLKHKMAEQIKREIATMKL  67

Query  642  VRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            ++HP VVR++EV+AS+TKI+IILEFITGGELFDKI++HGR+ E E+R+YF QLI
Sbjct  68   IKHPNVVRIYEVMASKTKIFIILEFITGGELFDKIVNHGRMKEDEARKYFQQLI  121



>ref|XP_003549757.1| PREDICTED: CBL-interacting protein kinase 24 isoform 1 [Glycine 
max]
 gb|KHN15082.1| CBL-interacting protein kinase 24 [Glycine soja]
Length=446

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = +3

Query  447  LKMVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREI  626
            +K V RK+GKYEVGRTIGEGTFAKVKFA+N+ETGESVA+KV+ ++ I++H+MV+QIKREI
Sbjct  1    MKKVRRKIGKYEVGRTIGEGTFAKVKFARNSETGESVAIKVMAKTTILQHRMVEQIKREI  60

Query  627  SIMKLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            SIMK+VRHP +VRLHEV+AS+TKIYIILEF+ GGEL+DKI+  G+L E ESR YF QLI
Sbjct  61   SIMKIVRHPNIVRLHEVLASQTKIYIILEFVMGGELYDKIVQLGKLSENESRHYFQQLI  119



>gb|AGA37205.1| CBL-interacting protein kinase 24.1 [Brassica napus]
 emb|CDY44603.1| BnaA04g09870D [Brassica napus]
Length=453

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +3

Query  459  VRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMK  638
             RK+GKYEVGRTIGEG+FAKVKFA+NT+TGE+VA+K++ +S I+K+KM DQIKREISIMK
Sbjct  12   TRKLGKYEVGRTIGEGSFAKVKFARNTDTGENVAIKIMAKSTILKNKMADQIKREISIMK  71

Query  639  LVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            +VRHP +VRL+EV+AS +KIYI+LEF+TGGELFD+I+H GRL E+E+R+YF QLI
Sbjct  72   IVRHPNIVRLYEVLASPSKIYIVLEFVTGGELFDRIVHKGRLEESEARKYFQQLI  126



>ref|XP_006356369.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 3-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006356370.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 3-like 
isoform X2 [Solanum tuberosum]
 ref|XP_006356371.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 3-like 
isoform X3 [Solanum tuberosum]
Length=437

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = +3

Query  462  RKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMKL  641
            R+VGKYE+GRTIGEGTFAKVKFA+N+ETGE VA+K++D+  ++KHKM +QIKREI+ MKL
Sbjct  8    RRVGKYEMGRTIGEGTFAKVKFARNSETGEPVAIKILDKDKVLKHKMAEQIKREIATMKL  67

Query  642  VRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            +RHP+VV+L+EV+AS+TKI+I+LEF+TGGELFDKI++HGR+ E E+R+YF QLI
Sbjct  68   IRHPHVVQLYEVLASKTKIFIVLEFVTGGELFDKIVNHGRMHEKEARKYFQQLI  121



>ref|XP_003577877.1| PREDICTED: CBL-interacting protein kinase 32 [Brachypodium distachyon]
 ref|XP_010237970.1| PREDICTED: CBL-interacting protein kinase 32 [Brachypodium distachyon]
Length=439

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +3

Query  456  VVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIM  635
            V R+VGKYE+GRTIGEGTFAKVKFA++TETG+ VA+K++D+  ++KHKMV+QIKREI+ M
Sbjct  6    VKRRVGKYELGRTIGEGTFAKVKFARDTETGDPVAIKILDKEKLLKHKMVEQIKREIATM  65

Query  636  KLVRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            KL++HP VVR+HEV+AS+TKIYI+LE++TGGELFD I++HGR+ E E+RRYF QLI
Sbjct  66   KLIKHPNVVRMHEVMASKTKIYIVLEYVTGGELFDTIVNHGRMREDEARRYFQQLI  121



>ref|XP_011080461.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 3 
isoform X1 [Sesamum indicum]
Length=463

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = +3

Query  462  RKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMKL  641
            R++GKYEVGRTIGEGTFAKVKFA+N+ETGE+VA+K++D+  ++KHKM +QIKREI+ MKL
Sbjct  31   RRIGKYEVGRTIGEGTFAKVKFARNSETGEAVAVKILDKDKVLKHKMAEQIKREIATMKL  90

Query  642  VRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            ++HP VVR++EV+AS+TKI+IILEFITGGELFDKI++HGR+ E E+R+YF QLI
Sbjct  91   IKHPNVVRIYEVMASKTKIFIILEFITGGELFDKIVNHGRMKEDEARKYFQQLI  144



>ref|XP_006446408.1| hypothetical protein CICLE_v10015272mg [Citrus clementina]
 ref|XP_006446409.1| hypothetical protein CICLE_v10015272mg [Citrus clementina]
 gb|ESR59648.1| hypothetical protein CICLE_v10015272mg [Citrus clementina]
 gb|ESR59649.1| hypothetical protein CICLE_v10015272mg [Citrus clementina]
Length=439

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = +3

Query  462  RKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVIDRSAIIKHKMVDQIKREISIMKL  641
            R+VGKYEVGRTIGEG+FAKVKFA+N+ETGE VA+K++D+  ++KHKM +QIKRE++ MKL
Sbjct  8    RRVGKYEVGRTIGEGSFAKVKFARNSETGEPVALKILDKEKVLKHKMAEQIKREVATMKL  67

Query  642  VRHPYVVRLHEVIASRTKIYIILEFITGGELFDKIIHHGRLXEAESRRYFXQLI  803
            V+HP VVRL+EV+ S+TKI+I+LEF+TGGELFDKI++HGR+ E E+RRYF QLI
Sbjct  68   VKHPNVVRLYEVMGSKTKIFIVLEFVTGGELFDKIVNHGRMKEDEARRYFQQLI  121



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1669417592084