BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig2133

Length=720
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008222861.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           328   4e-107   Prunus mume [ume]
ref|XP_008380476.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           327   3e-106   Malus domestica [apple tree]
ref|XP_009373545.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           327   3e-106   Pyrus x bretschneideri [bai li]
ref|XP_007223132.1|  hypothetical protein PRUPE_ppa005434mg             327   3e-106   Prunus persica
ref|XP_011084213.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           325   1e-105   Sesamum indicum [beniseed]
ref|XP_009608204.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      324   2e-105   Nicotiana tomentosiformis
ref|XP_004247883.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           324   3e-105   Solanum lycopersicum
ref|XP_006360928.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      323   5e-105   Solanum tuberosum [potatoes]
ref|XP_009768456.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      322   2e-104   Nicotiana sylvestris
ref|XP_010093344.1|  UDP-glucuronate 4-epimerase 6                      317   2e-102   Morus notabilis
ref|XP_004297013.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           316   3e-102   Fragaria vesca subsp. vesca
ref|XP_004502237.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      316   3e-102   Cicer arietinum [garbanzo]
ref|XP_010023657.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           316   4e-102   Eucalyptus grandis [rose gum]
ref|XP_002265088.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           315   7e-102   Vitis vinifera
ref|XP_004138968.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           315   2e-101   Cucumis sativus [cucumbers]
gb|AFK49564.1|  unknown                                                 314   2e-101   Medicago truncatula
ref|XP_003601662.1|  UDP-D-glucuronic acid 4-epimerase                  314   2e-101   Medicago truncatula
emb|CAN83418.1|  hypothetical protein VITISV_041351                     314   2e-101   Vitis vinifera
ref|XP_010274074.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      314   3e-101   Nelumbo nucifera [Indian lotus]
ref|XP_008457221.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           312   9e-101   Cucumis melo [Oriental melon]
ref|XP_010243459.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      309   2e-99    Nelumbo nucifera [Indian lotus]
ref|XP_012071089.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           309   2e-99    Jatropha curcas
ref|XP_011003624.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      309   2e-99    Populus euphratica
dbj|BAE71216.1|  putative NAD dependent epimerase                       308   3e-99    Trifolium pratense [peavine clover]
ref|XP_006421024.1|  hypothetical protein CICLE_v10004881mg             309   3e-99    Citrus clementina [clementine]
ref|XP_006492536.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      309   4e-99    Citrus sinensis [apfelsine]
gb|KDO42082.1|  hypothetical protein CISIN_1g011841mg                   309   4e-99    Citrus sinensis [apfelsine]
ref|XP_002298679.1|  UDP-D-GLUCURONATE 4-EPIMERASE 6 family protein     308   6e-99    Populus trichocarpa [western balsam poplar]
ref|XP_007034225.1|  UDP-D-glucuronate 4-epimerase 6                    304   2e-97    Theobroma cacao [chocolate]
ref|XP_006349916.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      303   3e-97    Solanum tuberosum [potatoes]
gb|KJB28115.1|  hypothetical protein B456_005G028000                    301   6e-97    Gossypium raimondii
ref|XP_006373087.1|  hypothetical protein POPTR_0017s08580g             301   2e-96    
gb|ADB24770.1|  UDP-D-glucuronic acid 4-epimerase                       300   4e-96    Gossypium hirsutum [American cotton]
ref|XP_011042175.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      300   4e-96    Populus euphratica
ref|XP_009783247.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      300   5e-96    Nicotiana sylvestris
emb|CDP21869.1|  unnamed protein product                                299   1e-95    Coffea canephora [robusta coffee]
ref|XP_007163818.1|  hypothetical protein PHAVU_001G267000g             298   2e-95    Phaseolus vulgaris [French bean]
gb|AGV54436.1|  UDP-D-glucuronic acid 4-epimerase                       298   3e-95    Phaseolus vulgaris [French bean]
gb|AHA84281.1|  UDP-glucuronate 4-epimerase 6                           297   5e-95    Phaseolus vulgaris [French bean]
ref|XP_009616292.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      296   2e-94    Nicotiana tomentosiformis
ref|XP_003538527.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      294   1e-93    Glycine max [soybeans]
gb|KJB72008.1|  hypothetical protein B456_011G153500                    291   2e-92    Gossypium raimondii
gb|ADB24769.1|  UDP-D-glucuronic acid 4-epimerase                       291   2e-92    Gossypium hirsutum [American cotton]
ref|XP_010532756.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           275   3e-86    Tarenaya hassleriana [spider flower]
ref|XP_010673389.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           273   1e-85    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010527460.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...    273   2e-85    Tarenaya hassleriana [spider flower]
ref|NP_189024.1|  UDP-D-glucuronate 4-epimerase 6                       272   5e-85    Arabidopsis thaliana [mouse-ear cress]
gb|AAN60250.1|  unknown                                                 272   5e-85    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009408344.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      271   6e-85    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002883465.1|  hypothetical protein ARALYDRAFT_898926             271   1e-84    Arabidopsis lyrata subsp. lyrata
gb|KFK39681.1|  hypothetical protein AALP_AA3G275400                    270   3e-84    Arabis alpina [alpine rockcress]
ref|XP_008794651.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...    270   4e-84    Phoenix dactylifera
ref|XP_009106288.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           269   6e-84    Brassica rapa
ref|XP_010421811.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      266   9e-84    Camelina sativa [gold-of-pleasure]
ref|XP_006418833.1|  hypothetical protein EUTSA_v10002521mg             269   1e-83    Eutrema salsugineum [saltwater cress]
ref|XP_006297629.1|  hypothetical protein CARUB_v10013650mg             268   1e-83    Capsella rubella
ref|XP_009102574.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           268   1e-83    Brassica rapa
emb|CDY18087.1|  BnaA01g23480D                                          268   2e-83    Brassica napus [oilseed rape]
emb|CDY64583.1|  BnaCnng44170D                                          268   2e-83    Brassica napus [oilseed rape]
ref|XP_010905148.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      267   3e-83    Elaeis guineensis
ref|XP_010906178.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      266   9e-83    Elaeis guineensis
ref|XP_010488461.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           266   1e-82    Camelina sativa [gold-of-pleasure]
ref|XP_010468437.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      266   1e-82    Camelina sativa [gold-of-pleasure]
emb|CDX77481.1|  BnaA07g06190D                                          261   6e-81    
ref|XP_008792930.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      260   3e-80    Phoenix dactylifera
emb|CDX85133.1|  BnaC07g07730D                                          258   1e-79    
emb|CDX92990.1|  BnaA03g37120D                                          256   5e-79    
ref|XP_009135867.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      256   6e-79    Brassica rapa
ref|XP_006365466.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      255   8e-79    Solanum tuberosum [potatoes]
ref|XP_009386871.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      256   1e-78    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006848494.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           254   3e-78    Amborella trichopoda
emb|CDY53207.1|  BnaC03g74010D                                          253   1e-77    Brassica napus [oilseed rape]
ref|XP_009412723.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      244   6e-74    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003532740.2|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      243   1e-73    Glycine max [soybeans]
ref|XP_002522810.1|  UDP-glucuronate 5-epimerase, putative              235   3e-71    
ref|XP_004239852.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      233   3e-70    Solanum lycopersicum
ref|XP_006580148.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-lik...    231   1e-69    
ref|XP_003524930.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-lik...    231   1e-69    Glycine max [soybeans]
ref|XP_002965131.1|  hypothetical protein SELMODRAFT_266836             227   8e-68    
ref|NP_001147328.1|  protein capI                                       228   1e-67    Zea mays [maize]
ref|XP_002962217.1|  hypothetical protein SELMODRAFT_77268              226   2e-67    Selaginella moellendorffii
ref|XP_009411848.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      224   1e-66    Musa acuminata subsp. malaccensis [pisang utan]
gb|ABK25339.1|  unknown                                                 223   1e-66    Picea sitchensis
dbj|BAC75426.1|  putative type 1 capsule synthesis gene(CapI)           223   4e-66    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001062295.1|  Os08g0526100                                       223   5e-66    
gb|EEC84839.1|  hypothetical protein OsI_31939                          223   1e-65    Oryza sativa Indica Group [Indian rice]
ref|NP_001063595.1|  Os09g0504000                                       223   1e-65    
gb|EEC83914.1|  hypothetical protein OsI_29969                          224   2e-65    Oryza sativa Indica Group [Indian rice]
ref|XP_002320057.1|  UDP-D-GLUCURONATE 4-EPIMERASE 3 family protein     218   1e-64    Populus trichocarpa [western balsam poplar]
ref|XP_006396209.1|  hypothetical protein EUTSA_v10028667mg             219   1e-64    Eutrema salsugineum [saltwater cress]
ref|NP_191922.1|  UDP-D-glucuronate 4-epimerase 3                       218   1e-64    Arabidopsis thaliana [mouse-ear cress]
gb|KFK30589.1|  hypothetical protein AALP_AA6G001300                    217   4e-64    Arabis alpina [alpine rockcress]
ref|XP_009397005.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      216   1e-63    Musa acuminata subsp. malaccensis [pisang utan]
gb|EAZ43405.1|  hypothetical protein OsJ_28010                          220   1e-63    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009591830.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           216   2e-63    Nicotiana tomentosiformis
ref|XP_002872971.1|  UDP-D-glucuronate 4-epimerase 2                    215   2e-63    Arabidopsis lyrata subsp. lyrata
ref|XP_008351675.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           215   2e-63    
dbj|BAJ86203.1|  predicted protein                                      216   3e-63    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003605138.1|  UDP-glucuronate 4-epimerase                        215   3e-63    Medicago truncatula
ref|XP_004229804.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           215   3e-63    Solanum lycopersicum
ref|XP_002301280.2|  hypothetical protein POPTR_0002s14750g             215   3e-63    Populus trichocarpa [western balsam poplar]
ref|XP_004506538.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      215   4e-63    Cicer arietinum [garbanzo]
ref|XP_008364369.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           214   4e-63    
gb|ABR16292.1|  unknown                                                 214   7e-63    Picea sitchensis
ref|XP_009342752.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           214   8e-63    Pyrus x bretschneideri [bai li]
ref|XP_006287814.1|  hypothetical protein CARUB_v10001027mg             213   9e-63    Capsella rubella
ref|XP_004957272.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      214   2e-62    Setaria italica
ref|XP_010523080.1|  PREDICTED: UDP-glucuronate 4-epimerase 3 iso...    213   2e-62    Tarenaya hassleriana [spider flower]
ref|XP_009399578.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           213   2e-62    
ref|XP_007052086.1|  UDP-D-glucuronate 4-epimerase 3                    213   3e-62    
ref|XP_009417460.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           213   3e-62    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003519171.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      212   3e-62    Glycine max [soybeans]
gb|KJB41101.1|  hypothetical protein B456_007G090500                    213   3e-62    Gossypium raimondii
ref|NP_001142515.1|  hypothetical protein                               212   3e-62    Zea mays [maize]
ref|XP_007218024.1|  hypothetical protein PRUPE_ppa005953mg             212   3e-62    Prunus persica
ref|XP_010424029.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      207   4e-62    Camelina sativa [gold-of-pleasure]
ref|XP_011017483.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      212   4e-62    Populus euphratica
ref|XP_007154841.1|  hypothetical protein PHAVU_003G152300g             212   4e-62    Phaseolus vulgaris [French bean]
emb|CDX86716.1|  BnaA09g21060D                                          212   5e-62    
ref|XP_006286788.1|  hypothetical protein CARUB_v10003353mg             212   5e-62    Capsella rubella
ref|XP_006347877.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      211   6e-62    Solanum tuberosum [potatoes]
ref|XP_004513504.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      211   6e-62    Cicer arietinum [garbanzo]
ref|XP_006445275.1|  hypothetical protein CICLE_v10020187mg             211   7e-62    Citrus clementina [clementine]
emb|CDX94504.1|  BnaC09g23320D                                          211   8e-62    
ref|XP_006345514.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      211   8e-62    Solanum tuberosum [potatoes]
ref|XP_012083592.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           211   8e-62    Jatropha curcas
ref|XP_010433651.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      211   9e-62    Camelina sativa [gold-of-pleasure]
gb|KDP28767.1|  hypothetical protein JCGZ_14538                         211   9e-62    Jatropha curcas
ref|XP_002444715.1|  hypothetical protein SORBIDRAFT_07g026520          211   2e-61    Sorghum bicolor [broomcorn]
ref|XP_003549520.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      210   2e-61    Glycine max [soybeans]
ref|XP_009596624.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           210   2e-61    Nicotiana tomentosiformis
ref|XP_010692224.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           211   2e-61    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004240046.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      210   2e-61    Solanum lycopersicum
ref|XP_010914055.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           210   2e-61    Elaeis guineensis
ref|XP_008438174.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           210   3e-61    Cucumis melo [Oriental melon]
gb|EMT02349.1|  UDP-glucuronate 4-epimerase 6                           215   3e-61    
ref|XP_004954186.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      210   3e-61    Setaria italica
ref|XP_011034154.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           209   3e-61    Populus euphratica
ref|XP_007134861.1|  hypothetical protein PHAVU_010G082300g             209   4e-61    Phaseolus vulgaris [French bean]
emb|CDY63064.1|  BnaAnng18570D                                          209   4e-61    Brassica napus [oilseed rape]
ref|XP_002281007.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      209   5e-61    Vitis vinifera
ref|XP_009111519.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           209   5e-61    Brassica rapa
ref|XP_003517038.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      209   5e-61    Glycine max [soybeans]
gb|AAM61323.1|  nucleotide sugar epimerase, putative                    209   5e-61    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006396783.1|  hypothetical protein EUTSA_v10028672mg             209   5e-61    Eutrema salsugineum [saltwater cress]
ref|XP_002452964.1|  hypothetical protein SORBIDRAFT_04g035630          209   6e-61    Sorghum bicolor [broomcorn]
ref|XP_010539945.1|  PREDICTED: UDP-glucuronate 4-epimerase 5           209   6e-61    Tarenaya hassleriana [spider flower]
ref|XP_010661665.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      209   6e-61    Vitis vinifera
ref|XP_009114629.1|  PREDICTED: UDP-glucuronate 4-epimerase 5 iso...    209   6e-61    
ref|XP_008649176.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      209   6e-61    Zea mays [maize]
gb|KEH32594.1|  UDP-D-glucuronate 4-epimerase                           209   6e-61    Medicago truncatula
ref|XP_011650790.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           209   6e-61    Cucumis sativus [cucumbers]
ref|XP_011069826.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           209   7e-61    Sesamum indicum [beniseed]
ref|XP_010413058.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like      202   8e-61    Camelina sativa [gold-of-pleasure]
ref|XP_010053904.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           209   8e-61    Eucalyptus grandis [rose gum]
ref|XP_008354844.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           208   8e-61    
ref|XP_011079342.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           208   9e-61    Sesamum indicum [beniseed]
ref|NP_171702.1|  UDP-D-glucuronate 4-epimerase 2                       208   9e-61    Arabidopsis thaliana [mouse-ear cress]
emb|CDY04398.1|  BnaC02g28500D                                          208   1e-60    
ref|NP_001048359.1|  Os02g0791500                                       208   1e-60    
ref|XP_009800153.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           208   1e-60    Nicotiana sylvestris
ref|XP_009586623.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           208   1e-60    Nicotiana tomentosiformis
ref|XP_003578376.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      209   1e-60    Brachypodium distachyon [annual false brome]
ref|XP_009114630.1|  PREDICTED: UDP-glucuronate 4-epimerase 5 iso...    208   1e-60    
ref|XP_010909513.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...    209   1e-60    Elaeis guineensis
ref|XP_002874760.1|  UDP-D-glucuronate 4-epimerase 5                    208   1e-60    
ref|XP_009128629.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      207   1e-60    Brassica rapa
gb|ADB24771.1|  UDP-D-glucuronic acid 4-epimerase                       208   2e-60    Gossypium hirsutum [American cotton]
ref|XP_006648037.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      208   2e-60    Oryza brachyantha
emb|CDX97356.1|  BnaA02g21470D                                          207   2e-60    
dbj|BAJ85817.1|  predicted protein                                      208   2e-60    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_192962.1|  UDP-D-glucuronate 4-epimerase 5                       207   2e-60    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004248561.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      207   2e-60    Solanum lycopersicum
ref|XP_006853046.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           207   2e-60    Amborella trichopoda
ref|XP_002280967.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           207   2e-60    
gb|EPS60141.1|  hypothetical protein M569_14661                         207   2e-60    Genlisea aurea
ref|XP_003521958.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      207   2e-60    Glycine max [soybeans]
ref|NP_001105911.1|  LOC732831                                          207   2e-60    Zea mays [maize]
ref|XP_010268405.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      207   2e-60    Nelumbo nucifera [Indian lotus]
ref|XP_010278008.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           207   2e-60    Nelumbo nucifera [Indian lotus]
gb|AAK93670.1|  putative nucleotide sugar epimerase                     207   2e-60    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010276827.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      207   3e-60    Nelumbo nucifera [Indian lotus]
ref|XP_010422190.1|  PREDICTED: UDP-glucuronate 4-epimerase 5 iso...    207   3e-60    Camelina sativa [gold-of-pleasure]
ref|XP_008677814.1|  PREDICTED: LOC732831 isoform X1                    207   3e-60    Zea mays [maize]
gb|KJB24820.1|  hypothetical protein B456_004G162700                    207   3e-60    Gossypium raimondii
ref|XP_006660806.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      209   3e-60    Oryza brachyantha
ref|XP_009784108.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      207   3e-60    Nicotiana sylvestris
ref|XP_002462620.1|  hypothetical protein SORBIDRAFT_02g029130          209   3e-60    Sorghum bicolor [broomcorn]
ref|XP_002892033.1|  UDP-D-glucuronate 4-epimerase 2                    207   3e-60    Arabidopsis lyrata subsp. lyrata
ref|XP_010264164.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           207   3e-60    Nelumbo nucifera [Indian lotus]
ref|XP_008465609.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           207   4e-60    Cucumis melo [Oriental melon]
dbj|BAK06545.1|  predicted protein                                      207   4e-60    Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDO97699.1|  unnamed protein product                                207   4e-60    Coffea canephora [robusta coffee]
dbj|BAJ99315.1|  predicted protein                                      207   4e-60    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010929207.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           206   4e-60    Elaeis guineensis
ref|XP_004507780.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      206   4e-60    Cicer arietinum [garbanzo]
ref|XP_010525760.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           206   4e-60    Tarenaya hassleriana [spider flower]
gb|KEH16056.1|  UDP-D-glucuronate 4-epimerase                           206   5e-60    Medicago truncatula
ref|XP_004144711.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           206   5e-60    Cucumis sativus [cucumbers]
gb|AFW85530.1|  hypothetical protein ZEAMMB73_797483                    206   6e-60    
ref|XP_002309376.1|  hypothetical protein POPTR_0006s19240g             206   7e-60    Populus trichocarpa [western balsam poplar]
ref|XP_010426564.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           206   7e-60    Camelina sativa [gold-of-pleasure]
ref|XP_003564175.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      206   8e-60    Brachypodium distachyon [annual false brome]
ref|XP_010419541.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      206   8e-60    Camelina sativa [gold-of-pleasure]
ref|XP_009789635.1|  PREDICTED: UDP-glucuronate 4-epimerase 5           206   9e-60    Nicotiana sylvestris
ref|XP_002437985.1|  hypothetical protein SORBIDRAFT_10g005920          206   9e-60    Sorghum bicolor [broomcorn]
ref|XP_011093361.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      206   1e-59    Sesamum indicum [beniseed]
ref|XP_004298689.1|  PREDICTED: UDP-glucuronate 4-epimerase 4           206   1e-59    Fragaria vesca subsp. vesca
ref|XP_011090565.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      205   1e-59    Sesamum indicum [beniseed]
ref|XP_010098924.1|  UDP-glucuronate 4-epimerase 3                      206   1e-59    Morus notabilis
ref|XP_009786918.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      205   1e-59    Nicotiana sylvestris
emb|CAN73016.1|  hypothetical protein VITISV_004388                     205   2e-59    Vitis vinifera
ref|XP_006359203.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      205   2e-59    Solanum tuberosum [potatoes]
gb|EPS72617.1|  hypothetical protein M569_02133                         205   2e-59    Genlisea aurea
gb|ACJ11754.1|  UDP-D-glucuronic acid 4-epimerase                       205   2e-59    Gossypium hirsutum [American cotton]
ref|XP_010103125.1|  UDP-glucuronate 4-epimerase 1                      204   2e-59    Morus notabilis
ref|XP_009409770.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      204   3e-59    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004966666.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      205   3e-59    Setaria italica
ref|XP_009600710.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      204   3e-59    Nicotiana tomentosiformis
gb|KDO62346.1|  hypothetical protein CISIN_1g043169mg                   204   3e-59    Citrus sinensis [apfelsine]
gb|KJB76605.1|  hypothetical protein B456_012G096800                    204   3e-59    Gossypium raimondii
emb|CDP21367.1|  unnamed protein product                                204   3e-59    Coffea canephora [robusta coffee]
ref|XP_006453511.1|  hypothetical protein CICLE_v10008355mg             204   3e-59    Citrus clementina [clementine]
emb|CDY70926.1|  BnaCnng70410D                                          204   3e-59    Brassica napus [oilseed rape]
ref|XP_006282616.1|  hypothetical protein CARUB_v10004864mg             204   4e-59    Capsella rubella
ref|XP_010438178.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           204   4e-59    Camelina sativa [gold-of-pleasure]
ref|XP_009593138.1|  PREDICTED: UDP-glucuronate 4-epimerase 5           204   4e-59    Nicotiana tomentosiformis
ref|XP_010432987.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           204   4e-59    Camelina sativa [gold-of-pleasure]
ref|XP_009127808.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           204   4e-59    Brassica rapa
ref|XP_007013947.1|  UDP-D-glucuronate 4-epimerase 1                    204   4e-59    
ref|NP_194773.1|  UDP-D-glucuronate 4-epimerase 1                       204   4e-59    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003570280.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           204   5e-59    Brachypodium distachyon [annual false brome]
gb|KFK42571.1|  hypothetical protein AALP_AA1G012900                    204   5e-59    Arabis alpina [alpine rockcress]
emb|CDX72242.1|  BnaC07g42640D                                          204   5e-59    
gb|KFK29619.1|  hypothetical protein AALP_AA7G157500                    204   5e-59    Arabis alpina [alpine rockcress]
ref|XP_011656020.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      204   5e-59    Cucumis sativus [cucumbers]
ref|XP_009348282.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           204   6e-59    Pyrus x bretschneideri [bai li]
ref|XP_008372097.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           204   6e-59    Malus domestica [apple tree]
gb|KJB09908.1|  hypothetical protein B456_001G174300                    204   7e-59    Gossypium raimondii
ref|XP_006412706.1|  hypothetical protein EUTSA_v10025193mg             204   7e-59    
ref|XP_008781382.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      203   7e-59    Phoenix dactylifera
ref|XP_008443815.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      203   7e-59    Cucumis melo [Oriental melon]
ref|XP_004973970.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      204   9e-59    Setaria italica
ref|XP_006397710.1|  hypothetical protein EUTSA_v10001454mg             203   1e-58    Eutrema salsugineum [saltwater cress]
ref|XP_008794398.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           203   1e-58    Phoenix dactylifera
emb|CDY39205.1|  BnaA03g50170D                                          203   1e-58    Brassica napus [oilseed rape]
ref|XP_002993206.1|  hypothetical protein SELMODRAFT_136684             203   1e-58    
ref|XP_002324510.1|  UDP-D-GLUCURONATE 4-EPIMERASE 1 family protein     203   1e-58    Populus trichocarpa [western balsam poplar]
ref|XP_002965479.1|  hypothetical protein SELMODRAFT_84174              203   1e-58    
ref|XP_011018096.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           203   1e-58    Populus euphratica
dbj|BAD36515.1|  putative uridine diphosphate galacturonate 4-epi...    203   1e-58    Oryza sativa Japonica Group [Japonica rice]
gb|EAY99954.1|  hypothetical protein OsI_21957                          203   2e-58    Oryza sativa Indica Group [Indian rice]
emb|CDX95646.1|  BnaC03g25270D                                          202   2e-58    
ref|XP_010447717.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      202   2e-58    Camelina sativa [gold-of-pleasure]
emb|CDY67756.1|  BnaA03g56770D                                          202   2e-58    Brassica napus [oilseed rape]
ref|XP_010047879.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           202   2e-58    Eucalyptus grandis [rose gum]
gb|KJB27036.1|  hypothetical protein B456_004G273500                    201   2e-58    Gossypium raimondii
ref|XP_009614886.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      202   2e-58    Nicotiana tomentosiformis
ref|XP_010539138.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      202   2e-58    Tarenaya hassleriana [spider flower]
ref|XP_009390535.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      202   2e-58    
ref|XP_007222381.1|  hypothetical protein PRUPE_ppa006006mg             202   2e-58    Prunus persica
ref|XP_009133725.1|  PREDICTED: UDP-glucuronate 4-epimerase 4           202   3e-58    Brassica rapa
ref|XP_010055537.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      202   3e-58    Eucalyptus grandis [rose gum]
ref|XP_008223573.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           202   3e-58    Prunus mume [ume]
ref|XP_009781950.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      202   3e-58    Nicotiana sylvestris
gb|KJB27035.1|  hypothetical protein B456_004G273500                    201   3e-58    Gossypium raimondii
ref|XP_012071600.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           201   4e-58    Jatropha curcas
gb|EYU37123.1|  hypothetical protein MIMGU_mgv1a006776mg                201   4e-58    Erythranthe guttata [common monkey flower]
ref|XP_004296420.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           201   4e-58    Fragaria vesca subsp. vesca
gb|EYU34305.1|  hypothetical protein MIMGU_mgv1a006903mg                201   5e-58    Erythranthe guttata [common monkey flower]
ref|XP_008794557.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      202   5e-58    Phoenix dactylifera
ref|XP_009137920.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      201   5e-58    Brassica rapa
ref|XP_008361335.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           201   7e-58    Malus domestica [apple tree]
ref|XP_009380772.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      201   7e-58    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006845469.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           201   7e-58    Amborella trichopoda
ref|XP_010506473.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like      201   7e-58    
ref|XP_010506472.1|  PREDICTED: UDP-glucuronate 4-epimerase 4           201   8e-58    Camelina sativa [gold-of-pleasure]
ref|XP_006350062.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      201   8e-58    Solanum tuberosum [potatoes]
ref|XP_010508183.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like      201   8e-58    Camelina sativa [gold-of-pleasure]
ref|XP_001767292.1|  predicted protein                                  201   8e-58    
ref|XP_010047039.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           201   9e-58    
ref|XP_007209167.1|  hypothetical protein PRUPE_ppa006148mg             200   9e-58    
gb|KFK31963.1|  hypothetical protein AALP_AA6G182500                    200   1e-57    
ref|XP_002509598.1|  UDP-glucuronate 5-epimerase, putative              200   1e-57    
ref|XP_010687680.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           200   1e-57    
ref|XP_006295696.1|  hypothetical protein CARUB_v10024814mg             200   1e-57    
ref|XP_002880171.1|  UDP-D-glucuronate 4-epimerase 4                    200   2e-57    
gb|EYU30554.1|  hypothetical protein MIMGU_mgv1a006591mg                199   3e-57    
ref|XP_011010511.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      199   3e-57    
ref|XP_008780407.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like      195   3e-57    
ref|XP_004251783.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      199   3e-57    
ref|XP_011014804.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      199   3e-57    
ref|XP_011033905.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      199   3e-57    
ref|XP_010544649.1|  PREDICTED: UDP-glucuronate 4-epimerase 4           199   4e-57    
ref|XP_002303529.2|  hypothetical protein POPTR_0003s11410g             199   5e-57    
ref|XP_004515772.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      198   8e-57    
ref|XP_001754001.1|  predicted protein                                  198   9e-57    
ref|XP_001769370.1|  predicted protein                                  198   9e-57    
gb|KFK37325.1|  hypothetical protein AALP_AA4G242100                    198   9e-57    
ref|NP_182056.1|  UDP-D-glucuronate 4-epimerase 4                       198   1e-56    
ref|XP_003635629.2|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      197   1e-56    
ref|XP_002528222.1|  UDP-glucuronate 5-epimerase, putative              197   1e-56    
gb|KDP25603.1|  hypothetical protein JCGZ_20759                         197   1e-56    
ref|XP_012087106.1|  PREDICTED: UDP-glucuronate 4-epimerase 5           197   2e-56    
ref|XP_008238641.1|  PREDICTED: UDP-glucuronate 4-epimerase 5           197   2e-56    
emb|CAN60968.1|  hypothetical protein VITISV_008097                     197   2e-56    
ref|XP_003635586.2|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      197   2e-56    
ref|XP_004306933.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           197   3e-56    
ref|XP_011076316.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      196   3e-56    
ref|XP_004147978.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           196   4e-56    
ref|XP_008448903.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           196   4e-56    
ref|XP_006477270.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      196   4e-56    
ref|XP_009395225.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      196   6e-56    
ref|XP_010676680.1|  PREDICTED: UDP-glucuronate 4-epimerase 4           196   7e-56    
ref|XP_006343570.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      195   8e-56    
emb|CDP09891.1|  unnamed protein product                                196   8e-56    
ref|XP_001751991.1|  predicted protein                                  195   2e-55    
gb|EYU30447.1|  hypothetical protein MIMGU_mgv1a006641mg                194   2e-55    
ref|XP_006440401.1|  hypothetical protein CICLE_v10020257mg             194   2e-55    
ref|XP_010108144.1|  UDP-glucuronate 4-epimerase 3                      194   4e-55    
ref|XP_006837081.1|  PREDICTED: UDP-glucuronate 4-epimerase 2           194   4e-55    
ref|XP_010323223.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           193   6e-55    
gb|AFW61553.1|  NAD-dependent epimerase/dehydratase family protein      194   7e-55    
ref|XP_001761086.1|  predicted protein                                  193   7e-55    
ref|NP_001150944.1|  NAD-dependent epimerase/dehydratase family p...    194   7e-55    
gb|KJB43946.1|  hypothetical protein B456_007G225300                    192   9e-55    
ref|XP_009781927.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      191   2e-54    
ref|XP_006363737.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      192   2e-54    
ref|XP_001761984.1|  predicted protein                                  192   2e-54    
ref|XP_004245716.1|  PREDICTED: UDP-glucuronate 4-epimerase 5           192   3e-54    
ref|XP_004234942.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      190   4e-54    
ref|XP_006365249.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      190   6e-54    
ref|XP_011081125.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           191   6e-54    
ref|XP_007155583.1|  hypothetical protein PHAVU_003G214400g             190   8e-54    
ref|XP_007039971.1|  UDP-D-glucuronate 4-epimerase 3                    190   9e-54    
ref|XP_009621323.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      189   1e-53    
gb|KJB25649.1|  hypothetical protein B456_004G202200                    189   1e-53    
gb|EPS64795.1|  hypothetical protein M569_09984                         187   1e-53    
ref|XP_003558346.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      190   3e-53    
ref|XP_008660337.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      188   1e-52    
gb|KEH31675.1|  UDP-D-glucuronate 4-epimerase                           187   1e-52    
ref|XP_001759693.1|  predicted protein                                  186   2e-52    
ref|XP_002468173.1|  hypothetical protein SORBIDRAFT_01g041030          187   4e-52    
gb|KDO65412.1|  hypothetical protein CISIN_1g015113mg                   185   5e-52    
ref|XP_003549880.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      185   5e-52    
ref|XP_002318876.1|  hypothetical protein POPTR_0012s14480g             184   1e-51    
ref|XP_011029969.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      184   2e-51    
ref|XP_003525759.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      183   3e-51    
ref|XP_008664162.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      184   3e-51    
ref|XP_003572425.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      184   4e-51    
ref|XP_002266529.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like      182   4e-51    
ref|XP_006490076.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      182   6e-51    
ref|XP_006421730.1|  hypothetical protein CICLE_v10005072mg             182   6e-51    
gb|KHN30291.1|  UDP-glucuronate 4-epimerase 1                           179   1e-50    
ref|XP_001781238.1|  predicted protein                                  181   2e-50    
ref|XP_001777338.1|  predicted protein                                  181   4e-50    
gb|AFW82019.1|  hypothetical protein ZEAMMB73_069067                    177   1e-49    
ref|XP_012090411.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      178   1e-49    
ref|XP_003611251.1|  UDP-glucuronate 4-epimerase                        178   3e-49    
ref|XP_009401924.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      178   5e-49    
gb|EPS73152.1|  hypothetical protein M569_01604                         175   1e-48    
ref|XP_009370520.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like      175   1e-48    
ref|XP_008234372.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like      175   2e-48    
ref|XP_009372935.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like      174   3e-48    
ref|XP_008653512.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      176   4e-48    
ref|NP_001049561.1|  Os03g0249500                                       175   9e-48    
ref|XP_007221187.1|  hypothetical protein PRUPE_ppa021672mg             174   1e-47    
ref|XP_004985001.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      175   1e-47    
ref|XP_008376451.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...    173   1e-47    
ref|XP_003533522.2|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...    172   3e-47    
ref|XP_006587717.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...    172   3e-47    
ref|XP_006587718.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...    172   3e-47    
ref|XP_006587715.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...    172   4e-47    
ref|XP_006587716.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...    172   4e-47    
ref|XP_006587714.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...    172   4e-47    
ref|XP_010053408.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           172   4e-47    
gb|ACN26174.1|  unknown                                                 167   5e-47    
dbj|BAJ88176.1|  predicted protein                                      172   2e-46    
ref|XP_008439108.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      169   3e-46    
ref|XP_004148129.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      168   1e-45    
ref|XP_010540291.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      165   9e-45    
tpg|DAA44393.1|  TPA: 40S ribosomal protein S20                         163   3e-43    
ref|XP_002968145.1|  hypothetical protein SELMODRAFT_89938              160   4e-43    
ref|XP_002970377.1|  hypothetical protein SELMODRAFT_93183              160   5e-43    
gb|EAZ36080.1|  hypothetical protein OsJ_20391                          159   5e-42    
gb|EMS53276.1|  UDP-glucuronate 4-epimerase 1                           159   2e-41    
gb|EMT09376.1|  UDP-glucuronate 4-epimerase 1                           149   4e-39    
emb|CBI18845.3|  unnamed protein product                                144   8e-38    
ref|XP_002504144.1|  predicted protein                                  146   2e-37    
ref|XP_006651218.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      140   5e-35    
gb|AFW77898.1|  hypothetical protein ZEAMMB73_133895                    137   2e-34    
ref|WP_044881557.1|  hypothetical protein                               136   3e-34    
gb|AFW76910.1|  hypothetical protein ZEAMMB73_383341                    137   3e-34    
gb|KIC75589.1|  UDP-glucuronate 4-epimerase 4                           135   3e-34    
gb|AFW73050.1|  hypothetical protein ZEAMMB73_892883                    136   7e-34    
ref|XP_002965132.1|  hypothetical protein SELMODRAFT_82699              128   8e-34    
ref|WP_042239280.1|  hypothetical protein                               134   9e-34    
ref|WP_039386438.1|  hypothetical protein                               134   1e-33    
ref|XP_003060215.1|  protein arginine methyltransferase                 132   9e-33    
ref|XP_002945754.1|  NAD-dependent epimerase/dehydratase                130   7e-32    
emb|CEG01274.1|  Nucleotide sugar epimerase                             129   3e-31    
ref|XP_001698020.1|  NAD-dependent epimerase/dehydratase                128   3e-31    
ref|XP_003075335.1|  putative nucleotide sugar epimerase (ISS)          127   2e-30    
ref|WP_013182875.1|  NAD-dependent epimerase                            125   2e-30    
ref|XP_007512695.1|  predicted protein                                  127   5e-30    
ref|WP_013942574.1|  NAD-dependent epimerase                            124   1e-29    
gb|KJE95471.1|  UDP-glucuronat epimerase                                125   2e-29    
ref|XP_004345510.1|  UDP-glucuronat epimerase                           125   3e-29    
ref|WP_018604345.1|  NAD dependent epimerase/dehydratase                122   3e-29    
ref|XP_001416501.1|  predicted protein                                  122   5e-29    
ref|WP_020559072.1|  NAD dependent epimerase/dehydratase                122   6e-29    
ref|WP_012468563.1|  NAD-dependent epimerase/dehydratase                121   8e-29    
gb|KIA76468.1|  UDP-glucuronate 4-epimerase 4                           120   1e-28    
ref|WP_013924154.1|  NAD-dependent epimerase                            120   1e-28    
ref|WP_006341506.1|  NAD-dependent epimerase                            120   1e-28    
gb|KDD74739.1|  NAD dependent epimerase/dehydratase                     121   1e-28    
ref|WP_032124748.1|  protein CapI                                       120   2e-28    
gb|ABQ26775.1|  NAD-dependent epimerase/dehydratase                     120   2e-28    
ref|WP_017165470.1|  NAD dependent epimerase/dehydratase                115   3e-28    
ref|WP_041245451.1|  capsular biosynthesis protein CpsI                 120   3e-28    
ref|WP_009573440.1|  putatively exported UDP-glucuronate 4-epimerase    119   6e-28    
ref|WP_012823883.1|  NAD-dependent epimerase/dehydratase                119   7e-28    
ref|XP_005538382.1|  probable nucleotide sugar epimerase                119   1e-27    
ref|WP_039008500.1|  protein CapI                                       118   1e-27    
ref|NP_001057015.1|  Os06g0187200                                       117   1e-27    
ref|WP_027183803.1|  capsular biosynthesis protein CpsI                 118   1e-27    
ref|WP_043743205.1|  protein CapI                                       118   2e-27    
ref|WP_042406657.1|  capsular biosynthesis protein CpsI                 117   2e-27    
ref|WP_034680088.1|  capsular biosynthesis protein CpsI                 117   2e-27    
ref|WP_004304270.1|  MULTISPECIES: NAD-dependent epimerase/dehydr...    117   2e-27    
ref|WP_026444165.1|  capsular biosynthesis protein CpsI                 117   3e-27    
ref|WP_005995570.1|  nucleoside-diphosphate-sugar epimerase             117   3e-27    
ref|WP_039423618.1|  protein CapI                                       117   3e-27    
ref|WP_045761190.1|  protein CapI                                       117   3e-27    
ref|WP_028143322.1|  MULTISPECIES: UDP-glucuronate 5-epimerase          117   3e-27    
emb|CBA14652.1|  putative nucleoside-diphosphate-sugar epimerases...    117   4e-27    
ref|WP_045766580.1|  protein CapI                                       117   4e-27    
ref|WP_039446968.1|  protein CapI                                       112   4e-27    
ref|WP_020651173.1|  hypothetical protein                               117   4e-27    
ref|WP_045770846.1|  protein CapI                                       116   4e-27    
ref|WP_004334639.1|  NAD-dependent epimerase/dehydratase                116   6e-27    
ref|WP_029221470.1|  hypothetical protein                               116   6e-27    
ref|WP_045198775.1|  UDP-glucuronate 5-epimerase                        116   6e-27    
ref|WP_017164095.1|  NAD dependent epimerase/dehydratase                115   6e-27    
ref|WP_003467001.1|  nucleoside-diphosphate-sugar epimerase protein     116   6e-27    
ref|WP_006448976.1|  nucleoside-diphosphate-sugar epimerase             116   6e-27    
ref|WP_023905465.1|  nucleotide sugar epimerase                         116   7e-27    
ref|WP_026686095.1|  hypothetical protein                               116   7e-27    
ref|WP_017167115.1|  NAD dependent epimerase/dehydratase                115   7e-27    
gb|KIA57531.1|  protein CapI                                            115   7e-27    
ref|WP_042595585.1|  protein CapI                                       115   8e-27    
ref|WP_036997098.1|  UDP-glucuronate 5-epimerase                        116   8e-27    
ref|WP_039742914.1|  capsular biosynthesis protein CpsI                 115   9e-27    
ref|WP_021248343.1|  NAD dependent epimerase/dehydratase                115   9e-27    
ref|WP_045179869.1|  UDP-glucuronate 5-epimerase                        116   9e-27    
ref|WP_011038928.1|  nucleotide sugar epimerase                         115   9e-27    
ref|WP_014506300.1|  nucleotide sugar epimerase                         115   1e-26    
ref|WP_012439452.1|  ly UDP-glucuronate 4-epimerase                     115   1e-26    
ref|WP_023794561.1|  hypothetical protein                               111   1e-26    
ref|WP_017156761.1|  NAD dependent epimerase/dehydratase                115   1e-26    
ref|WP_017169566.1|  NAD dependent epimerase/dehydratase                115   1e-26    
ref|WP_004261111.1|  NAD-dependent epimerase/dehydratase                115   1e-26    
ref|WP_013146568.1|  NAD-dependent epimerase                            115   1e-26    
ref|WP_024940454.1|  hypothetical protein                               115   1e-26    
ref|WP_039563723.1|  protein CapI                                       115   1e-26    
gb|KGK59727.1|  protein CapI                                            115   1e-26    
ref|WP_039524863.1|  protein CapI                                       115   1e-26    
ref|WP_040941973.1|  protein CapI                                       115   1e-26    
ref|WP_004088268.1|  Nucleoside-diphosphate-sugar epimerase             115   1e-26    
ref|WP_039520953.1|  protein CapI                                       115   2e-26    
ref|WP_010150292.1|  nucleoside-diphosphate sugar epimerase             115   2e-26    
ref|WP_042129435.1|  UDP-glucuronate 5-epimerase                        115   2e-26    
ref|WP_045764860.1|  protein CapI                                       115   2e-26    
ref|WP_014322901.1|  NAD-dependent epimerase/dehydratase                115   2e-26    
ref|WP_045726581.1|  protein CapI                                       114   2e-26    
ref|XP_005705758.1|  NAD-dependent epimerase/dehydratase                115   2e-26    
ref|WP_045738457.1|  protein CapI                                       114   2e-26    
ref|WP_039816708.1|  protein CapI                                       114   2e-26    
ref|WP_039510306.1|  protein CapI                                       114   2e-26    
ref|WP_016901961.1|  NAD dependent epimerase/dehydratase                114   2e-26    
ref|WP_002936329.1|  NAD-dependent epimerase/dehydratase                114   3e-26    
ref|WP_039413403.1|  protein CapI                                       114   3e-26    
ref|WP_005220977.1|  hypothetical protein                               114   3e-26    
ref|WP_028008006.1|  hypothetical protein                               114   3e-26    
ref|WP_004813072.1|  hypothetical protein                               114   3e-26    
ref|WP_028915214.1|  hypothetical protein                               114   3e-26    
ref|WP_008303431.1|  NAD-dependent epimerase/dehydratase                114   3e-26    
ref|WP_034705487.1|  capsular biosynthesis protein CpsI                 114   3e-26    
ref|WP_010226857.1|  UDP-glucuronate 5'-epimerase                       114   3e-26    
ref|WP_008842667.1|  UDP-glucuronate 5'-epimerase                       114   3e-26    
ref|WP_009552387.1|  nucleoside-diphosphate-sugar epimerase             114   4e-26    
ref|WP_027840589.1|  capsular biosynthesis protein CpsI                 114   4e-26    
dbj|GAJ57228.1|  nucleotide sugar epimerase                             114   5e-26    
ref|WP_038151637.1|  protein CapI                                       114   5e-26    
ref|WP_035038771.1|  protein CapI                                       114   6e-26    
ref|WP_002927007.1|  NAD-dependent epimerase/dehydratase                113   6e-26    
ref|WP_038228294.1|  protein CapI                                       113   7e-26    
ref|WP_004983551.1|  hypothetical protein                               113   7e-26    
ref|WP_036168659.1|  protein CapI                                       113   7e-26    
ref|WP_020852009.1|  NAD-dependent epimerase/dehydratase                113   7e-26    



>ref|XP_008222861.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Prunus mume]
Length=440

 Score =   328 bits (841),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 170/217 (78%), Positives = 192/217 (88%), Gaps = 6/217 (3%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA PPDTSK  KLERYNSY+RRVNS+KL+ ASSKLLFRATL+VAL+LIFFFTINYPPL+E
Sbjct  1    MASPPDTSKTIKLERYNSYLRRVNSTKLLNASSKLLFRATLLVALVLIFFFTINYPPLSE  60

Query  262  SSGGGRRRALHTTGHSLLAATF----SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVG  429
              GGG    +HTT H+ L++ F     GG AWEKQV+ S+TP+R NGMSVLVTGAAGFVG
Sbjct  61   HMGGGAHH-VHTT-HNFLSSAFYGGGVGGTAWEKQVRHSSTPKRPNGMSVLVTGAAGFVG  118

Query  430  SHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDI  609
            +HCSLALKKRGDGVLGLDNFN+YYDPSLKRARQ LL++H++F+VEGDLND PLL+KLFD+
Sbjct  119  THCSLALKKRGDGVLGLDNFNSYYDPSLKRARQALLKRHEVFVVEGDLNDEPLLTKLFDV  178

Query  610  VPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            VPFTHILHLAAQAGVRYAMQNP SYVSSNIAG VNLL
Sbjct  179  VPFTHILHLAAQAGVRYAMQNPQSYVSSNIAGFVNLL  215



>ref|XP_008380476.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Malus domestica]
Length=465

 Score =   327 bits (837),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 170/217 (78%), Positives = 191/217 (88%), Gaps = 6/217 (3%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA PPDTSK  KLERYNSY+RRVNS+KL+ ASSKLLFRATL+VAL+LI FFT+NYPPL++
Sbjct  5    MASPPDTSKTIKLERYNSYLRRVNSTKLLNASSKLLFRATLLVALVLILFFTLNYPPLSD  64

Query  262  SSGGGRRRALHTTGHSLLAATF----SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVG  429
              GGG    +HTT H+ L++ F     GG AWEKQV+ SATPRR NGMSVLVTGAAGFVG
Sbjct  65   HVGGGANH-VHTT-HNFLSSAFYGGGVGGTAWEKQVRKSATPRRPNGMSVLVTGAAGFVG  122

Query  430  SHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDI  609
            SHCSLALKKRGDGVLGLDNFN+YYDPSLKR+RQ LL+KH++F+VEGDLND PLL+KLFD+
Sbjct  123  SHCSLALKKRGDGVLGLDNFNSYYDPSLKRSRQALLKKHEVFVVEGDLNDEPLLTKLFDV  182

Query  610  VPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            VPFTHILHLAAQAGVRYAMQNP SYVSSNIAG VNLL
Sbjct  183  VPFTHILHLAAQAGVRYAMQNPQSYVSSNIAGFVNLL  219



>ref|XP_009373545.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Pyrus x bretschneideri]
Length=465

 Score =   327 bits (837),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 170/217 (78%), Positives = 191/217 (88%), Gaps = 6/217 (3%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA PPDTSK  KLERYNSY+RRVNS+KL+ ASSKLLFRATL+VAL+LI FFT+NYPPL++
Sbjct  5    MASPPDTSKTIKLERYNSYLRRVNSTKLLNASSKLLFRATLLVALVLILFFTLNYPPLSD  64

Query  262  SSGGGRRRALHTTGHSLLAATF----SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVG  429
              GGG    +HTT H+ L++ F     GG AWEKQV+ SATPRR NGMSVLVTGAAGFVG
Sbjct  65   HVGGGANH-VHTT-HNFLSSAFYGGGVGGTAWEKQVRKSATPRRPNGMSVLVTGAAGFVG  122

Query  430  SHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDI  609
            SHCSLALKKRGDGVLGLDNFN+YYDPSLKR+RQ LL+KH++F+VEGDLND PLL+KLFD+
Sbjct  123  SHCSLALKKRGDGVLGLDNFNSYYDPSLKRSRQALLKKHEVFVVEGDLNDEPLLTKLFDV  182

Query  610  VPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            VPFTHILHLAAQAGVRYAMQNP SYVSSNIAG VNLL
Sbjct  183  VPFTHILHLAAQAGVRYAMQNPQSYVSSNIAGFVNLL  219



>ref|XP_007223132.1| hypothetical protein PRUPE_ppa005434mg [Prunus persica]
 gb|EMJ24331.1| hypothetical protein PRUPE_ppa005434mg [Prunus persica]
Length=461

 Score =   327 bits (837),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 169/217 (78%), Positives = 192/217 (88%), Gaps = 6/217 (3%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA PPDTSK  KLERYNSY+RRVNS+KL+ ASSKLLFRATL+VAL+LIFFFTINYPPL++
Sbjct  1    MASPPDTSKTIKLERYNSYLRRVNSTKLLNASSKLLFRATLLVALVLIFFFTINYPPLSD  60

Query  262  SSGGGRRRALHTTGHSLLAATFSGGA----AWEKQVQSSATPRRQNGMSVLVTGAAGFVG  429
              GGG    +HTT H+ L++ F GG     AWEKQV+ S+TP+R NGMSVLVTGAAGFVG
Sbjct  61   HMGGGAHH-VHTT-HNFLSSAFYGGGVGGTAWEKQVRHSSTPKRPNGMSVLVTGAAGFVG  118

Query  430  SHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDI  609
            +HCSLALKKRGDGVLGLDNFN+YYDPSLKRARQ LL++H++F+VEGDLND PLL+KLFD+
Sbjct  119  THCSLALKKRGDGVLGLDNFNSYYDPSLKRARQALLKRHEVFVVEGDLNDEPLLTKLFDV  178

Query  610  VPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            VPFTHILHLAAQAGVRYAMQNP SYVSSNIAG VNLL
Sbjct  179  VPFTHILHLAAQAGVRYAMQNPQSYVSSNIAGFVNLL  215



>ref|XP_011084213.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Sesamum indicum]
Length=459

 Score =   325 bits (833),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 166/212 (78%), Positives = 187/212 (88%), Gaps = 4/212 (2%)
 Frame = +1

Query  85   AFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAES  264
            A PPDTSK +KLERYNSYIRRVNS+KL+ ASSKLLFR TL+VALILIFFFT+NYPPL+ +
Sbjct  10   ASPPDTSKTTKLERYNSYIRRVNSTKLLQASSKLLFRVTLLVALILIFFFTLNYPPLSSA  69

Query  265  SGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSL  444
                    +H+T H L +A +  GAAWEKQV+ SATPRR NG SVLVTGAAGFVGSHCSL
Sbjct  70   D----NHHIHSTNHFLASAFYGSGAAWEKQVRHSATPRRPNGFSVLVTGAAGFVGSHCSL  125

Query  445  ALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTH  624
            ALKKRGDGVLGLDNFN+YYDPSLKRARQKLL KH+IF+VEGD+NDA LL+KLFD+VPF+H
Sbjct  126  ALKKRGDGVLGLDNFNSYYDPSLKRARQKLLSKHEIFVVEGDINDAELLNKLFDVVPFSH  185

Query  625  ILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            +LHLAAQAGVRYAMQNPLSYVSSN+AG VNLL
Sbjct  186  VLHLAAQAGVRYAMQNPLSYVSSNVAGFVNLL  217



>ref|XP_009608204.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nicotiana tomentosiformis]
Length=450

 Score =   324 bits (831),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 173/214 (81%), Positives = 187/214 (87%), Gaps = 2/214 (1%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA PPDTSK +KLERYNSYIR+VNS+KLIAASSKLLFR TL+VAL+LIFFFTINYPPLA 
Sbjct  1    MASPPDTSKTTKLERYNSYIRKVNSTKLIAASSKLLFRITLLVALLLIFFFTINYPPLA-  59

Query  262  SSGGGRRRALHTTGHSLLAATF-SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHC  438
            S        +HTT H+LL++ F  GGA+WEKQV+ SATP R NG SVLVTGAAGFVGSH 
Sbjct  60   SDNTNSHNNIHTTTHNLLSSAFYGGGASWEKQVRRSATPSRPNGFSVLVTGAAGFVGSHS  119

Query  439  SLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  618
            SLALKKRGDGVLGLDNFN+YYDPSLKRARQ LL KHQIFIVEGD+ND  LL+KLFDIVPF
Sbjct  120  SLALKKRGDGVLGLDNFNSYYDPSLKRARQNLLSKHQIFIVEGDINDVELLNKLFDIVPF  179

Query  619  THILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            THILHLAAQAGVRYAMQNPLSYV SNIAG VNLL
Sbjct  180  THILHLAAQAGVRYAMQNPLSYVKSNIAGFVNLL  213



>ref|XP_004247883.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Solanum lycopersicum]
Length=452

 Score =   324 bits (830),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 171/214 (80%), Positives = 188/214 (88%), Gaps = 3/214 (1%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA PPDTSK +KLERYNSYIRRVNS+KLIAASSKLLFR TL+VAL+LIFFFTINYPPL  
Sbjct  5    MASPPDTSKTTKLERYNSYIRRVNSTKLIAASSKLLFRVTLLVALLLIFFFTINYPPL--  62

Query  262  SSGGGRRRALHTTGHSLLA-ATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHC  438
            +S       +HTT H+LL+ A + GGA+WEKQV+ S+TP R NG+SVLVTGAAGFVGSHC
Sbjct  63   TSEKSFNNNIHTTTHNLLSSAIYGGGASWEKQVRHSSTPHRPNGLSVLVTGAAGFVGSHC  122

Query  439  SLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  618
            SLALKKRGDGVLGLDNFN+YYDPSLKRARQ  L KHQIFIVEGD+ND  LL KLFDIVPF
Sbjct  123  SLALKKRGDGVLGLDNFNSYYDPSLKRARQDQLSKHQIFIVEGDINDTELLKKLFDIVPF  182

Query  619  THILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            THILHLAAQAGVRYAMQNPLSYV+SN+AG VNLL
Sbjct  183  THILHLAAQAGVRYAMQNPLSYVNSNVAGFVNLL  216



>ref|XP_006360928.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Solanum tuberosum]
Length=448

 Score =   323 bits (828),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 170/214 (79%), Positives = 189/214 (88%), Gaps = 3/214 (1%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA PPDTSK +KLERYNSYIR+VNS+KLIAASSKLLFR TL+VAL+LIFFFTINYPPL  
Sbjct  1    MASPPDTSKTTKLERYNSYIRKVNSTKLIAASSKLLFRVTLLVALLLIFFFTINYPPL--  58

Query  262  SSGGGRRRALHTTGHSLLAAT-FSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHC  438
            +S       +HTT H+LL++T + GGA+WEKQV+ S+TP R NG+SVLVTGAAGFVGSHC
Sbjct  59   TSEKTFNNNIHTTTHNLLSSTIYGGGASWEKQVRHSSTPHRPNGLSVLVTGAAGFVGSHC  118

Query  439  SLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  618
            SLALKKRGDGVLGLDNFN+YYDPSLKRARQ  L KHQIFIVEGD+ND  LL KLFDIVPF
Sbjct  119  SLALKKRGDGVLGLDNFNSYYDPSLKRARQDQLTKHQIFIVEGDINDTELLKKLFDIVPF  178

Query  619  THILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            THILHLAAQAGVRYAMQNPLSYV+SN+AG VNLL
Sbjct  179  THILHLAAQAGVRYAMQNPLSYVNSNVAGFVNLL  212



>ref|XP_009768456.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nicotiana sylvestris]
Length=450

 Score =   322 bits (824),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 171/214 (80%), Positives = 187/214 (87%), Gaps = 2/214 (1%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA PPDTSK +KLERYNSYIR+VNS+KLIAASSKLLFR TL+VAL+LIFFFTINYPPLA 
Sbjct  1    MASPPDTSKTTKLERYNSYIRKVNSTKLIAASSKLLFRVTLLVALLLIFFFTINYPPLA-  59

Query  262  SSGGGRRRALHTTGHSLLAATF-SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHC  438
            S        +HTT H+L+++ F  GGA+WEKQV+ S+TP R NG SVLVTGAAGFVGSH 
Sbjct  60   SDNPNSHNNIHTTTHNLISSAFYGGGASWEKQVRRSSTPSRPNGFSVLVTGAAGFVGSHS  119

Query  439  SLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  618
            SLALKKRGDGVLGLDNFN+YYDPSLKRARQ LL KHQIFIVEGDLND  LL KLFDIVPF
Sbjct  120  SLALKKRGDGVLGLDNFNSYYDPSLKRARQNLLSKHQIFIVEGDLNDVELLRKLFDIVPF  179

Query  619  THILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            TH+LHLAAQAGVRYAMQNPLSYV+SNIAG VNLL
Sbjct  180  THVLHLAAQAGVRYAMQNPLSYVNSNIAGFVNLL  213



>ref|XP_010093344.1| UDP-glucuronate 4-epimerase 6 [Morus notabilis]
 gb|EXB53916.1| UDP-glucuronate 4-epimerase 6 [Morus notabilis]
Length=454

 Score =   317 bits (812),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 168/216 (78%), Positives = 183/216 (85%), Gaps = 5/216 (2%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA PPDTSK  KLERYNSYIRRVNS+KL+ ASSKLLFRATL++AL+LI FFT+NYPPL+ 
Sbjct  1    MASPPDTSKTMKLERYNSYIRRVNSTKLLNASSKLLFRATLLIALVLILFFTLNYPPLSS  60

Query  262  SSGG-GRRRALHTTGHSLLAATF--SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGS  432
            SS       + H   H+ L++ F   GGA WEKQV+ SATPRRQNG SVLVTGAAGFVGS
Sbjct  61   SSDTPNTHHSFHH--HNFLSSAFYGGGGATWEKQVRHSATPRRQNGFSVLVTGAAGFVGS  118

Query  433  HCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIV  612
            HCSLALKKRGDGVLGLDNFN YYDPSLKRARQ LL KHQIFIV+GDLND PLL KLFD+V
Sbjct  119  HCSLALKKRGDGVLGLDNFNNYYDPSLKRARQALLSKHQIFIVDGDLNDGPLLYKLFDVV  178

Query  613  PFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            PFTHILHLAAQAGVRYAMQNP SY+ SNIAG VNLL
Sbjct  179  PFTHILHLAAQAGVRYAMQNPQSYIHSNIAGFVNLL  214



>ref|XP_004297013.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Fragaria vesca subsp. 
vesca]
Length=451

 Score =   316 bits (810),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 164/217 (76%), Positives = 186/217 (86%), Gaps = 6/217 (3%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA PPDTSK  KLERYNSY+RRVNS+KLI ASSKLLFR TL+VAL+LIFFFT+NYPPL+ 
Sbjct  3    MASPPDTSKTIKLERYNSYLRRVNSTKLINASSKLLFRVTLLVALVLIFFFTLNYPPLSS  62

Query  262  SSGGGRRRALHTTGHSLLAATF----SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVG  429
            SS       LH T  + L++ F     GG AWEKQV+ S+TP+R NGMSVLVTGAAGF+G
Sbjct  63   SSDQNGSHRLHNT--NFLSSAFYGGGVGGTAWEKQVRHSSTPKRPNGMSVLVTGAAGFIG  120

Query  430  SHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDI  609
            SHCSLALKKRGDGVLGLDNFN+YYDPSLKRARQ +L+KH+IFIVE DLND P+L+KLFD+
Sbjct  121  SHCSLALKKRGDGVLGLDNFNSYYDPSLKRARQAMLKKHEIFIVEADLNDGPMLTKLFDV  180

Query  610  VPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            VPFTH+LHLAAQAGVRYAMQNP SYV+SNIAG VNLL
Sbjct  181  VPFTHVLHLAAQAGVRYAMQNPQSYVASNIAGFVNLL  217



>ref|XP_004502237.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Cicer arietinum]
Length=451

 Score =   316 bits (809),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 166/214 (78%), Positives = 183/214 (86%), Gaps = 7/214 (3%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA PPDTSK  KLERYNSYIR+VNS+KL+ ASSKLLFRATL++ALIL+F FT NYPPL+E
Sbjct  1    MASPPDTSKTIKLERYNSYIRKVNSTKLLNASSKLLFRATLLIALILVFLFTFNYPPLSE  60

Query  262  SSGGGRRRALHTTGHS-LLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHC  438
            ++       LHT  HS  LA+ F GG AWE+QV+ SATPRR NG SVLVTGAAGFVGSHC
Sbjct  61   TAN----HHLHT--HSNFLASAFGGGGAWERQVRHSATPRRPNGFSVLVTGAAGFVGSHC  114

Query  439  SLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  618
            SLALKKRGDGV+GLDNFN YYDPSLKRARQ LL +HQIFI EGDLND PLL+KLFD+VPF
Sbjct  115  SLALKKRGDGVVGLDNFNTYYDPSLKRARQALLTQHQIFIAEGDLNDTPLLTKLFDLVPF  174

Query  619  THILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            THILHLAAQAGVRYAMQNP SY+ SNIAG VNLL
Sbjct  175  THILHLAAQAGVRYAMQNPQSYIKSNIAGFVNLL  208



>ref|XP_010023657.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Eucalyptus grandis]
 gb|KCW59958.1| hypothetical protein EUGRSUZ_H02683 [Eucalyptus grandis]
Length=459

 Score =   316 bits (810),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 168/215 (78%), Positives = 187/215 (87%), Gaps = 6/215 (3%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA PPD+SK +KLERYNSYIRRVNS+KL+ ASSKLLFRATL++AL L+ FFT+NYPPL+ 
Sbjct  1    MAPPPDSSKTAKLERYNSYIRRVNSTKLLNASSKLLFRATLLIALALVLFFTLNYPPLSS  60

Query  262  SSGGGRRRALHTTGHSLLAATFS--GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSH  435
            SS      A H    S L++TFS  GGAAWEKQV+ S+TPRR NG SVLVTGAAGFVGSH
Sbjct  61   SSTSDH--APHR--RSFLSSTFSSAGGAAWEKQVRHSSTPRRPNGFSVLVTGAAGFVGSH  116

Query  436  CSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVP  615
            CSLALKKRGDGVLGLDNFN YYDPSLKRARQ LL+KHQIFIVEGDLND PLL+KLFD+VP
Sbjct  117  CSLALKKRGDGVLGLDNFNDYYDPSLKRARQALLQKHQIFIVEGDLNDGPLLTKLFDVVP  176

Query  616  FTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            FTH+LHLAAQAGVRYAMQNP SYV+SNIAG V+LL
Sbjct  177  FTHVLHLAAQAGVRYAMQNPQSYVASNIAGFVSLL  211



>ref|XP_002265088.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Vitis vinifera]
Length=451

 Score =   315 bits (807),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 168/215 (78%), Positives = 186/215 (87%), Gaps = 9/215 (4%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA PPDTSK +KLERYNSYIRRVNS+KL+AASSKLLFRATL+VAL+LIFFFT+NYPPL++
Sbjct  1    MASPPDTSKTTKLERYNSYIRRVNSTKLMAASSKLLFRATLLVALVLIFFFTLNYPPLSD  60

Query  262  SSGGGRRRALHTTGH-SLLAATFSG-GAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSH  435
            +         H   H + L++ F G GA+WEKQV+ S+TPRR NG SVLVTGA GFVG+H
Sbjct  61   NPH-------HVLTHQNFLSSAFYGSGASWEKQVRHSSTPRRPNGFSVLVTGAGGFVGTH  113

Query  436  CSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVP  615
            CSLALKKRGDGVLGLDNFN YYDPSLKRARQ +L KHQIFIVEGDLNDAPLLSKLFD+VP
Sbjct  114  CSLALKKRGDGVLGLDNFNDYYDPSLKRARQAMLSKHQIFIVEGDLNDAPLLSKLFDMVP  173

Query  616  FTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            FTHILHLAAQAGVRYAMQNP SYV SNIAG VNLL
Sbjct  174  FTHILHLAAQAGVRYAMQNPQSYVRSNIAGFVNLL  208



>ref|XP_004138968.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Cucumis sativus]
 gb|KGN61492.1| hypothetical protein Csa_2G146400 [Cucumis sativus]
Length=463

 Score =   315 bits (806),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 169/217 (78%), Positives = 186/217 (86%), Gaps = 5/217 (2%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA PPDTSK  KLERYNSY+R+VNS+KLI ASSKLLFRATL+VAL+L+F FT+NYPPL+ 
Sbjct  4    MASPPDTSKTLKLERYNSYLRKVNSTKLINASSKLLFRATLLVALVLVFIFTLNYPPLS-  62

Query  262  SSGGGRRRALHTTGHSLLAATF----SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVG  429
            S  G     LHT  + L +A +     GGAAWEKQV+ S+TPRR NGMSVLVTGAAGFVG
Sbjct  63   SENGSSGNHLHTHRNFLSSAFYGGSDQGGAAWEKQVRHSSTPRRLNGMSVLVTGAAGFVG  122

Query  430  SHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDI  609
            SHCS+ALKKRGDGVLGLDNFN YYDPSLKRARQ LL KHQIFIVEGDLNDA LLSKLFD+
Sbjct  123  SHCSMALKKRGDGVLGLDNFNNYYDPSLKRARQSLLLKHQIFIVEGDLNDAALLSKLFDV  182

Query  610  VPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            VPFTHILHLAAQAGVRYAMQNP SY++SNIAG VNLL
Sbjct  183  VPFTHILHLAAQAGVRYAMQNPQSYINSNIAGFVNLL  219



>gb|AFK49564.1| unknown [Medicago truncatula]
Length=447

 Score =   314 bits (804),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 162/213 (76%), Positives = 182/213 (85%), Gaps = 5/213 (2%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA PPDTSK  KLERYNSYIR+VNS+KL+ ASSKLLFRATL++AL+L+FFFT NYPPL++
Sbjct  1    MASPPDTSKTIKLERYNSYIRKVNSTKLLNASSKLLFRATLLIALVLVFFFTFNYPPLSD  60

Query  262  SSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  441
            S+        HT  H L +A F GG AWE+ V+ SA PRR NG +VLVTGAAGFVGSHCS
Sbjct  61   STN----HHFHTHSHFLTSA-FGGGGAWERHVRHSAIPRRPNGFTVLVTGAAGFVGSHCS  115

Query  442  LALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFT  621
            LALKKRGDGV+GLDNFN+YYDPSLKRARQ LL +HQIFIVEGDLNDAPLL+KLFD+VP T
Sbjct  116  LALKKRGDGVIGLDNFNSYYDPSLKRARQALLTQHQIFIVEGDLNDAPLLTKLFDVVPIT  175

Query  622  HILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            HILHLAAQAGVRYAMQNP SY+ SNIAG VNLL
Sbjct  176  HILHLAAQAGVRYAMQNPQSYIKSNIAGFVNLL  208



>ref|XP_003601662.1| UDP-D-glucuronic acid 4-epimerase [Medicago truncatula]
 gb|AES71913.1| UDP-D-glucuronate 4-epimerase [Medicago truncatula]
Length=447

 Score =   314 bits (804),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 162/213 (76%), Positives = 182/213 (85%), Gaps = 5/213 (2%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA PPDTSK  KLERYNSYIR+VNS+KL+ ASSKLLFRATL++AL+L+FFFT NYPPL++
Sbjct  1    MASPPDTSKTIKLERYNSYIRKVNSTKLLNASSKLLFRATLLIALVLVFFFTFNYPPLSD  60

Query  262  SSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  441
            S+        HT  H L +A F GG AWE+ V+ SA PRR NG +VLVTGAAGFVGSHCS
Sbjct  61   STN----HHFHTHSHFLTSA-FGGGGAWERHVRHSAIPRRPNGFTVLVTGAAGFVGSHCS  115

Query  442  LALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFT  621
            LALKKRGDGV+GLDNFN+YYDPSLKRARQ LL +HQIFIVEGDLNDAPLL+KLFD+VP T
Sbjct  116  LALKKRGDGVIGLDNFNSYYDPSLKRARQALLTQHQIFIVEGDLNDAPLLTKLFDVVPIT  175

Query  622  HILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            HILHLAAQAGVRYAMQNP SY+ SNIAG VNLL
Sbjct  176  HILHLAAQAGVRYAMQNPQSYIKSNIAGFVNLL  208



>emb|CAN83418.1| hypothetical protein VITISV_041351 [Vitis vinifera]
Length=459

 Score =   314 bits (805),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 168/215 (78%), Positives = 186/215 (87%), Gaps = 9/215 (4%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA PPDTSK +KLERYNSYIRRVNS+KL+AASSKLLFRATL+VAL+LIFFFT+NYPPL++
Sbjct  1    MASPPDTSKTTKLERYNSYIRRVNSTKLMAASSKLLFRATLLVALVLIFFFTLNYPPLSD  60

Query  262  SSGGGRRRALHTTGH-SLLAATFSG-GAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSH  435
            +         H   H + L++ F G GA+WEKQV+ S+TPRR NG SVLVTGA GFVG+H
Sbjct  61   NPH-------HVLTHQNFLSSAFYGSGASWEKQVRHSSTPRRPNGFSVLVTGAGGFVGTH  113

Query  436  CSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVP  615
            CSLALKKRGDGVLGLDNFN YYDPSLKRARQ +L KHQIFIVEGDLNDAPLLSKLFD+VP
Sbjct  114  CSLALKKRGDGVLGLDNFNDYYDPSLKRARQAMLSKHQIFIVEGDLNDAPLLSKLFDMVP  173

Query  616  FTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            FTHILHLAAQAGVRYAMQNP SYV SNIAG VNLL
Sbjct  174  FTHILHLAAQAGVRYAMQNPQSYVRSNIAGFVNLL  208



>ref|XP_010274074.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nelumbo nucifera]
Length=456

 Score =   314 bits (804),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 165/213 (77%), Positives = 185/213 (87%), Gaps = 2/213 (1%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA PPDTSK +KLERYNSY+RRVNS+KL+AASSKLLFR TL+VALILIFFFT+N+PPL  
Sbjct  1    MASPPDTSKTTKLERYNSYLRRVNSTKLLAASSKLLFRVTLLVALILIFFFTLNHPPL--  58

Query  262  SSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  441
            SS       LH   + L +A +  GA WEKQV+ S+TPRR NG SVLVTGAAGFVG+HCS
Sbjct  59   SSDSPNHVPLHHHQNFLASAFYGNGATWEKQVRHSSTPRRSNGFSVLVTGAAGFVGTHCS  118

Query  442  LALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFT  621
            LALKKRGDGVLGLDNFN+YYDPSLKRARQ LL KH+IFIV+GDLNDAPLLSKLFD+VPFT
Sbjct  119  LALKKRGDGVLGLDNFNSYYDPSLKRARQALLSKHEIFIVKGDLNDAPLLSKLFDVVPFT  178

Query  622  HILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            H+LHLAAQAGVRYAM+NP SYV+SNIAG VNLL
Sbjct  179  HVLHLAAQAGVRYAMKNPQSYVNSNIAGFVNLL  211



>ref|XP_008457221.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Cucumis melo]
Length=453

 Score =   312 bits (800),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 169/218 (78%), Positives = 188/218 (86%), Gaps = 7/218 (3%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPL-A  258
            MA PPDTSK  KLERYNSY+R+VNS+KL+ ASSKLLFRATL+VAL+L+F FT+NYPPL A
Sbjct  4    MASPPDTSKTLKLERYNSYLRKVNSTKLLNASSKLLFRATLLVALVLVFIFTLNYPPLSA  63

Query  259  ESSGGGRRRALHTTGHSLLAATFSG----GAAWEKQVQSSATPRRQNGMSVLVTGAAGFV  426
            E++  G    LHT  + L +A + G    GAAWEKQV+ S+TPRR NGMSVLVTGAAGFV
Sbjct  64   ENASPGNH--LHTHRNFLSSAFYGGSDHGGAAWEKQVRHSSTPRRLNGMSVLVTGAAGFV  121

Query  427  GSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFD  606
            GSHCS+ALKKRGDGVLGLDNFN YYDPSLKRARQ LL KHQIFIVEGDLNDA LLSKLFD
Sbjct  122  GSHCSMALKKRGDGVLGLDNFNNYYDPSLKRARQSLLLKHQIFIVEGDLNDAALLSKLFD  181

Query  607  IVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            +VPFTHILHLAAQAGVRYAMQNP SY++SNIAG VNLL
Sbjct  182  VVPFTHILHLAAQAGVRYAMQNPQSYINSNIAGFVNLL  219



>ref|XP_010243459.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nelumbo nucifera]
Length=455

 Score =   309 bits (792),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 160/214 (75%), Positives = 183/214 (86%), Gaps = 5/214 (2%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA PPDTSK +KLERYNSY+RRVNS+K +AASSKLLFR TL+VALILIFFFT+NYPPL++
Sbjct  1    MASPPDTSKTTKLERYNSYLRRVNSTKFLAASSKLLFRVTLLVALILIFFFTLNYPPLSD  60

Query  262  SSGGGRRRALHTTGHSLLAATFSG-GAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHC  438
            +              + +A+ F G GA WEK+V+ S+TPRR NG SVLVTGAAGFVG+HC
Sbjct  61   NP----HHVHLHHHQNFIASAFYGNGATWEKKVRHSSTPRRPNGFSVLVTGAAGFVGTHC  116

Query  439  SLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  618
            +LALKKRGDGVLGLDNFN+YYDPSLKRARQ LL KHQIF+VE DLNDAPLLSKLFD+VPF
Sbjct  117  ALALKKRGDGVLGLDNFNSYYDPSLKRARQSLLSKHQIFVVEADLNDAPLLSKLFDVVPF  176

Query  619  THILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            TH+LHLAAQAGVRYAM+NP SYV+SNIAG VNLL
Sbjct  177  THVLHLAAQAGVRYAMKNPQSYVNSNIAGLVNLL  210



>ref|XP_012071089.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Jatropha curcas]
 gb|KDP39331.1| hypothetical protein JCGZ_01088 [Jatropha curcas]
Length=458

 Score =   309 bits (791),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 162/219 (74%), Positives = 186/219 (85%), Gaps = 9/219 (4%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA PPDTSK  KLERYNSY+RR++S+K++ ASSKLLFRATL++AL+LI FFTINYPPL++
Sbjct  1    MASPPDTSKTIKLERYNSYLRRIHSTKVLNASSKLLFRATLLIALVLILFFTINYPPLSD  60

Query  262  SSGGGRRRALHTTGHSLLAATF------SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGF  423
            +      +  H   H+ L+  F       GG+AWEKQV+ SATPRR NG SVLVTGAAGF
Sbjct  61   NP---HHQNHHIHHHNFLSTAFFARSSSVGGSAWEKQVRHSATPRRPNGFSVLVTGAAGF  117

Query  424  VGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLF  603
            VGSHCSLALKKRGDGVLG+DNFN YYDPSLKRARQKLL KHQ+FI+EGD+ND+PLLSKLF
Sbjct  118  VGSHCSLALKKRGDGVLGIDNFNDYYDPSLKRARQKLLSKHQVFIIEGDINDSPLLSKLF  177

Query  604  DIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            D+VPFTH+LHLAAQAGVRYAMQNP SYVSSNIAG VNLL
Sbjct  178  DVVPFTHVLHLAAQAGVRYAMQNPQSYVSSNIAGFVNLL  216



>ref|XP_011003624.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Populus euphratica]
Length=456

 Score =   309 bits (791),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 160/217 (74%), Positives = 187/217 (86%), Gaps = 8/217 (4%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA PPDTSK  KLERYNSY+RR++S+K++ ASSKLLFRATL++AL+LI FFT+NYPPL++
Sbjct  1    MASPPDTSKTIKLERYNSYLRRLHSTKVLNASSKLLFRATLLIALVLILFFTLNYPPLSD  60

Query  262  SSGGGRRRALHTTGHSLLAATF----SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVG  429
            +         H   H+ L+  F    +GGAAWEKQV+ S+TP+R+NG+SVLVTGAAGFVG
Sbjct  61   NIPN----HAHPPHHNFLSTAFFTSSAGGAAWEKQVRHSSTPKRRNGLSVLVTGAAGFVG  116

Query  430  SHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDI  609
            SHCSLALKKRGDGVLGLDNFN+YYDP+LKRARQKLL +H++FIVEGDLNDA LL KLFD+
Sbjct  117  SHCSLALKKRGDGVLGLDNFNSYYDPTLKRARQKLLLRHEVFIVEGDLNDASLLRKLFDV  176

Query  610  VPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            VPFTHILHLAAQAGVRYAMQNP SYVSSNIAG VNLL
Sbjct  177  VPFTHILHLAAQAGVRYAMQNPQSYVSSNIAGFVNLL  213



>dbj|BAE71216.1| putative NAD dependent epimerase [Trifolium pratense]
Length=451

 Score =   308 bits (790),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 160/213 (75%), Positives = 179/213 (84%), Gaps = 5/213 (2%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA PPDTSK  KLERYNSYIR+VNS+KL+ ASSKLLFRATL++AL+L+FFFT NYPPL++
Sbjct  1    MASPPDTSKTIKLERYNSYIRKVNSTKLLNASSKLLFRATLLIALVLVFFFTFNYPPLSD  60

Query  262  SSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  441
            ++          T    L + F GG AWE+QV+ SATPRR NG +VLVTGAAGFVGSHCS
Sbjct  61   TT-----SHHFHTHSHFLTSAFGGGGAWERQVRHSATPRRPNGFTVLVTGAAGFVGSHCS  115

Query  442  LALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFT  621
            LALKKRGDGV+GLDNFN YYDPSLKRARQ LL +HQIFIVEGDLND PLLSKLFD+VP T
Sbjct  116  LALKKRGDGVIGLDNFNNYYDPSLKRARQDLLSQHQIFIVEGDLNDGPLLSKLFDVVPIT  175

Query  622  HILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            HILHLAAQAGVRYAMQNP SY+ SNIAG VNLL
Sbjct  176  HILHLAAQAGVRYAMQNPQSYIKSNIAGFVNLL  208



>ref|XP_006421024.1| hypothetical protein CICLE_v10004881mg [Citrus clementina]
 gb|ESR34264.1| hypothetical protein CICLE_v10004881mg [Citrus clementina]
Length=476

 Score =   309 bits (792),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 163/228 (71%), Positives = 193/228 (85%), Gaps = 15/228 (7%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA PPDTSK  KLERYNSY+RR++ +K++ +SSKL FRAT+++AL+LI FFT+N+PPL++
Sbjct  1    MASPPDTSKTIKLERYNSYLRRLHVTKMLHSSSKLFFRATILIALVLILFFTLNHPPLSD  60

Query  262  SSGGG---------RRRALHTTGHSLLAATF------SGGAAWEKQVQSSATPRRQNGMS  396
            ++G             R L T  HSLL+++F      +GGA WEKQV+ SATPRR NGM+
Sbjct  61   NTGESGDNNSNNKNNPRNLFTHQHSLLSSSFFSSSFSTGGAEWEKQVRHSATPRRPNGMT  120

Query  397  VLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLN  576
            VLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN+YYDPSLKRARQKLL+KHQ+FIVEGDLN
Sbjct  121  VLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNSYYDPSLKRARQKLLQKHQVFIVEGDLN  180

Query  577  DAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            DAPLL+KLFD+VPFTH+LHLAAQAGVRYAMQNP SYV+SNIAG VNLL
Sbjct  181  DAPLLTKLFDVVPFTHVLHLAAQAGVRYAMQNPQSYVASNIAGFVNLL  228



>ref|XP_006492536.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Citrus sinensis]
 gb|KDO42081.1| hypothetical protein CISIN_1g011841mg [Citrus sinensis]
Length=476

 Score =   309 bits (791),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 163/228 (71%), Positives = 193/228 (85%), Gaps = 15/228 (7%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA PPDTSK  KLERYNSY+RR++ +K++ +SSKL FRAT+++AL+LI FFT+N+PPL++
Sbjct  1    MASPPDTSKTIKLERYNSYLRRLHVTKMLHSSSKLFFRATILIALVLILFFTLNHPPLSD  60

Query  262  SSGGG---------RRRALHTTGHSLLAATF------SGGAAWEKQVQSSATPRRQNGMS  396
            ++G             R L T  HSLL+++F      +GGA WEKQV+ SATPRR NGM+
Sbjct  61   NTGESGDNNSNNKNNPRNLFTHQHSLLSSSFFSSSFSTGGAEWEKQVRHSATPRRPNGMT  120

Query  397  VLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLN  576
            VLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN+YYDPSLKRARQKLL+KHQ+FIVEGDLN
Sbjct  121  VLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNSYYDPSLKRARQKLLQKHQVFIVEGDLN  180

Query  577  DAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            DAPLL+KLFD+VPFTH+LHLAAQAGVRYAMQNP SYV+SNIAG VNLL
Sbjct  181  DAPLLTKLFDVVPFTHVLHLAAQAGVRYAMQNPQSYVASNIAGFVNLL  228



>gb|KDO42082.1| hypothetical protein CISIN_1g011841mg [Citrus sinensis]
Length=469

 Score =   309 bits (791),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 163/228 (71%), Positives = 193/228 (85%), Gaps = 15/228 (7%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA PPDTSK  KLERYNSY+RR++ +K++ +SSKL FRAT+++AL+LI FFT+N+PPL++
Sbjct  1    MASPPDTSKTIKLERYNSYLRRLHVTKMLHSSSKLFFRATILIALVLILFFTLNHPPLSD  60

Query  262  SSGGG---------RRRALHTTGHSLLAATF------SGGAAWEKQVQSSATPRRQNGMS  396
            ++G             R L T  HSLL+++F      +GGA WEKQV+ SATPRR NGM+
Sbjct  61   NTGESGDNNSNNKNNPRNLFTHQHSLLSSSFFSSSFSTGGAEWEKQVRHSATPRRPNGMT  120

Query  397  VLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLN  576
            VLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN+YYDPSLKRARQKLL+KHQ+FIVEGDLN
Sbjct  121  VLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNSYYDPSLKRARQKLLQKHQVFIVEGDLN  180

Query  577  DAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            DAPLL+KLFD+VPFTH+LHLAAQAGVRYAMQNP SYV+SNIAG VNLL
Sbjct  181  DAPLLTKLFDVVPFTHVLHLAAQAGVRYAMQNPQSYVASNIAGFVNLL  228



>ref|XP_002298679.1| UDP-D-GLUCURONATE 4-EPIMERASE 6 family protein [Populus trichocarpa]
 gb|ABK93061.1| unknown [Populus trichocarpa]
 gb|EEE83484.1| UDP-D-GLUCURONATE 4-EPIMERASE 6 family protein [Populus trichocarpa]
Length=457

 Score =   308 bits (788),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 160/218 (73%), Positives = 186/218 (85%), Gaps = 9/218 (4%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA PPDTSK  KLERYNSY+RR++S+K++ ASSKLLFRATL++AL+LI FFT+NYPPL++
Sbjct  1    MASPPDTSKTIKLERYNSYLRRLHSTKVLNASSKLLFRATLLIALVLILFFTLNYPPLSD  60

Query  262  SSGGGRRRALHTTGHSLLAATF-----SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFV  426
            +         H   H+ L+  F      GGAAWEKQV+ S+TP+R+NG+SVLVTGAAGFV
Sbjct  61   NIPN----HAHLHHHNFLSTAFFTSSAGGGAAWEKQVRHSSTPKRRNGLSVLVTGAAGFV  116

Query  427  GSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFD  606
            GSHCSLALKKRGDGVLGLDNFN+YYDP+LKRARQKLL +H++FIVEGDLNDA LL KLFD
Sbjct  117  GSHCSLALKKRGDGVLGLDNFNSYYDPTLKRARQKLLLRHEVFIVEGDLNDASLLRKLFD  176

Query  607  IVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            +VPFTHILHLAAQAGVRYAMQNP SYVSSNIAG VNLL
Sbjct  177  VVPFTHILHLAAQAGVRYAMQNPQSYVSSNIAGFVNLL  214



>ref|XP_007034225.1| UDP-D-glucuronate 4-epimerase 6 [Theobroma cacao]
 gb|EOY05151.1| UDP-D-glucuronate 4-epimerase 6 [Theobroma cacao]
Length=453

 Score =   304 bits (778),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 160/214 (75%), Positives = 180/214 (84%), Gaps = 1/214 (0%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            M  PPDTSK  KLERYNSY+R+++S+KL+ ASSKLLFR TL++AL+LI FFTINYPPL++
Sbjct  1    MPTPPDTSKTVKLERYNSYLRKLHSTKLLNASSKLLFRVTLLIALVLILFFTINYPPLSD  60

Query  262  SSGGGRRRALHTTGHSL-LAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHC  438
            +         H +  S  L +   GGAAWEKQV+ S+TPRR NG SVLVTGAAGF+GSHC
Sbjct  61   NPHHVPPHQHHHSFLSTSLFSISPGGAAWEKQVRHSSTPRRPNGFSVLVTGAAGFIGSHC  120

Query  439  SLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  618
            SLALKKRGDGVLGLDNFN YYDPSLKRARQ LL KHQIFIVEGDLND PLL+KLFD+VPF
Sbjct  121  SLALKKRGDGVLGLDNFNNYYDPSLKRARQNLLSKHQIFIVEGDLNDGPLLTKLFDVVPF  180

Query  619  THILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            TH+LHLAAQAGVRYAMQNP SYVSSNIAG VNLL
Sbjct  181  THVLHLAAQAGVRYAMQNPQSYVSSNIAGFVNLL  214



>ref|XP_006349916.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Solanum tuberosum]
Length=454

 Score =   303 bits (777),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 163/212 (77%), Positives = 184/212 (87%), Gaps = 2/212 (1%)
 Frame = +1

Query  91   PPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSG  270
            P DTSK  KLERYNSYIRR+NS+KLI ASSKLLFR TL+VALILIFFF INYPP   S  
Sbjct  5    PIDTSKEMKLERYNSYIRRLNSTKLIVASSKLLFRVTLLVALILIFFFIINYPPFTSSEN  64

Query  271  GG-RRRALHTTGHSLLAATF-SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSL  444
                   +HTT H+LL+++F  GGAAWEKQV+ S+TPRR NG+SVLVTGAAGFVGSHCS+
Sbjct  65   SNPHHHNIHTTTHNLLSSSFYGGGAAWEKQVRHSSTPRRVNGLSVLVTGAAGFVGSHCSM  124

Query  445  ALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTH  624
            ALKKRGDGVLG+DNFN+YYDPSLKR RQKLL +H++FIVEGD+NDA LLSKLFDIVPFTH
Sbjct  125  ALKKRGDGVLGIDNFNSYYDPSLKRGRQKLLAQHEVFIVEGDINDAELLSKLFDIVPFTH  184

Query  625  ILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            +LHLAAQAGVRYAM+NPLSY+ SNIAG VNLL
Sbjct  185  VLHLAAQAGVRYAMKNPLSYIQSNIAGFVNLL  216



>gb|KJB28115.1| hypothetical protein B456_005G028000 [Gossypium raimondii]
Length=409

 Score =   301 bits (771),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 157/214 (73%), Positives = 178/214 (83%), Gaps = 3/214 (1%)
 Frame = +1

Query  88   FPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESS  267
             P DTSK  KLERYNSYIR+V+S+KL+ ASSK LFR TL++AL+LI FFTINYPPL++++
Sbjct  1    MPTDTSKPMKLERYNSYIRKVHSTKLLNASSKFLFRVTLLIALVLILFFTINYPPLSDNT  60

Query  268  GGGRRRALHTT--GHSLLA-ATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHC  438
                      +    SL + ++  GGAAWEKQV+ S+TPRR NG SVLVTGAAGF+GSHC
Sbjct  61   HSAPHHHHRHSFLSTSLFSGSSLVGGAAWEKQVRHSSTPRRVNGFSVLVTGAAGFIGSHC  120

Query  439  SLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  618
            SLALKKRGDGVLGLDNFN YYDPSLKRARQ LL KHQIFIVEGDLND PLL+KLFD+VPF
Sbjct  121  SLALKKRGDGVLGLDNFNDYYDPSLKRARQNLLSKHQIFIVEGDLNDGPLLTKLFDVVPF  180

Query  619  THILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            TH+LHLAAQAGVRYAMQNP SYV SNIAG VNLL
Sbjct  181  THVLHLAAQAGVRYAMQNPQSYVKSNIAGFVNLL  214



>ref|XP_006373087.1| hypothetical protein POPTR_0017s08580g [Populus trichocarpa]
 gb|ERP50884.1| hypothetical protein POPTR_0017s08580g [Populus trichocarpa]
Length=462

 Score =   301 bits (771),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 154/213 (72%), Positives = 182/213 (85%), Gaps = 0/213 (0%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA PP TSK  KLERYNSY+RR++S+K++ ASSKL+FR TL++AL+LI FFT+NYPPL++
Sbjct  1    MASPPHTSKTLKLERYNSYLRRLHSTKVLNASSKLIFRVTLLIALVLILFFTLNYPPLSD  60

Query  262  SSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  441
             +        H    + L  + +GG AWEKQV+ S+TP++ NG+SVLVTGAAGFVGSHCS
Sbjct  61   KNPNHAHLHHHNFLSAALFTSSAGGDAWEKQVRHSSTPKKPNGLSVLVTGAAGFVGSHCS  120

Query  442  LALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFT  621
            +ALKKRGDGVLGLDNFN+YYDPSLKRARQKLL K+Q+FIVEGDLNDA LL+KLFD+VPFT
Sbjct  121  IALKKRGDGVLGLDNFNSYYDPSLKRARQKLLLKNQVFIVEGDLNDASLLTKLFDVVPFT  180

Query  622  HILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            HILHLAAQAGVRYAMQNP SYVSSNIAG VNLL
Sbjct  181  HILHLAAQAGVRYAMQNPQSYVSSNIAGFVNLL  213



>gb|ADB24770.1| UDP-D-glucuronic acid 4-epimerase [Gossypium hirsutum]
 gb|KJB28114.1| hypothetical protein B456_005G028000 [Gossypium raimondii]
Length=453

 Score =   300 bits (769),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 157/213 (74%), Positives = 178/213 (84%), Gaps = 3/213 (1%)
 Frame = +1

Query  91   PPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSG  270
            P DTSK  KLERYNSYIR+V+S+KL+ ASSK LFR TL++AL+LI FFTINYPPL++++ 
Sbjct  2    PTDTSKPMKLERYNSYIRKVHSTKLLNASSKFLFRVTLLIALVLILFFTINYPPLSDNTH  61

Query  271  GGRRRALHTT--GHSLLA-ATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  441
                     +    SL + ++  GGAAWEKQV+ S+TPRR NG SVLVTGAAGF+GSHCS
Sbjct  62   SAPHHHHRHSFLSTSLFSGSSLVGGAAWEKQVRHSSTPRRVNGFSVLVTGAAGFIGSHCS  121

Query  442  LALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFT  621
            LALKKRGDGVLGLDNFN YYDPSLKRARQ LL KHQIFIVEGDLND PLL+KLFD+VPFT
Sbjct  122  LALKKRGDGVLGLDNFNDYYDPSLKRARQNLLSKHQIFIVEGDLNDGPLLTKLFDVVPFT  181

Query  622  HILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            H+LHLAAQAGVRYAMQNP SYV SNIAG VNLL
Sbjct  182  HVLHLAAQAGVRYAMQNPQSYVKSNIAGFVNLL  214



>ref|XP_011042175.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Populus euphratica]
 ref|XP_011016239.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Populus euphratica]
Length=456

 Score =   300 bits (769),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 153/213 (72%), Positives = 182/213 (85%), Gaps = 0/213 (0%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA PP TSK  KLERYN+Y+RR++S+K++ ASSKL+FR TL++AL+LI FFT+NYPPL++
Sbjct  1    MASPPHTSKTLKLERYNNYLRRLHSTKVLNASSKLIFRVTLLIALVLILFFTLNYPPLSD  60

Query  262  SSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  441
             +        H    + L  + +GG AWEKQV+ S+TP++ NG+SVLVTGAAGFVGSHCS
Sbjct  61   KNPNHAHLHHHNFLSAALFTSSAGGDAWEKQVRHSSTPKKPNGLSVLVTGAAGFVGSHCS  120

Query  442  LALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFT  621
            +ALKKRGDGVLGLDNFN+YYDPSLKRARQKLL K+Q+FIVEGDLNDA LL+KLFD+VPFT
Sbjct  121  IALKKRGDGVLGLDNFNSYYDPSLKRARQKLLLKNQVFIVEGDLNDASLLTKLFDVVPFT  180

Query  622  HILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            HILHLAAQAGVRYAMQNP SYVSSNIAG VNLL
Sbjct  181  HILHLAAQAGVRYAMQNPQSYVSSNIAGFVNLL  213



>ref|XP_009783247.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nicotiana sylvestris]
Length=453

 Score =   300 bits (769),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 168/214 (79%), Positives = 186/214 (87%), Gaps = 3/214 (1%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA   DTSK  KLERYNSYIRRVNSSKLIAASSKLLFR TL+VAL+LIFFFTINY PL  
Sbjct  1    MASSLDTSKVMKLERYNSYIRRVNSSKLIAASSKLLFRVTLLVALLLIFFFTINYHPL--  58

Query  262  SSGGGRRRALHTTGHSLLAATF-SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHC  438
            SS       +HTT H+LL++ F  GGAAWEKQV+ S+TPRR NG+SVLVTGAAGFVGSHC
Sbjct  59   SSENTSHHHIHTTTHNLLSSAFYGGGAAWEKQVRHSSTPRRANGLSVLVTGAAGFVGSHC  118

Query  439  SLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  618
            S+ALKKRGDGVLG+DNFN+YYDPSLKR RQKLL +H+IFIVEGD+NDA LLSKLFDIVPF
Sbjct  119  SMALKKRGDGVLGIDNFNSYYDPSLKRGRQKLLAQHEIFIVEGDINDAELLSKLFDIVPF  178

Query  619  THILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            TH+LHLAAQAGVRYAM+NP SY+ SNIAG VNLL
Sbjct  179  THVLHLAAQAGVRYAMKNPQSYIKSNIAGFVNLL  212



>emb|CDP21869.1| unnamed protein product [Coffea canephora]
Length=450

 Score =   299 bits (765),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 165/211 (78%), Positives = 184/211 (87%), Gaps = 6/211 (3%)
 Frame = +1

Query  91   PPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSG  270
            PPD SK +KLERYNSYIR+VNS+KLIAASSKLLFR TL+VAL+LI FFT+NYPPL+E+  
Sbjct  6    PPDFSKTTKLERYNSYIRKVNSTKLIAASSKLLFRVTLLVALLLILFFTLNYPPLSENP-  64

Query  271  GGRRRALHTTGHSLLAATFSG-GAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLA  447
                  +H T H+L ++ F G GA WEK+V+ SATPRR NG+SVLVTGAAGFVGSHCSLA
Sbjct  65   ----HHIHHTTHNLFSSAFYGSGAGWEKKVRHSATPRRPNGLSVLVTGAAGFVGSHCSLA  120

Query  448  LKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHI  627
            LKKRGDGVLGLDNFN+YYDPSLKRAR+ LL KHQIF+VEGDLNDA LL KLFDIVPFTHI
Sbjct  121  LKKRGDGVLGLDNFNSYYDPSLKRARRDLLTKHQIFVVEGDLNDAELLEKLFDIVPFTHI  180

Query  628  LHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            LHLAAQAGVRYAMQNPLSY+ SNIAG VNLL
Sbjct  181  LHLAAQAGVRYAMQNPLSYIKSNIAGFVNLL  211



>ref|XP_007163818.1| hypothetical protein PHAVU_001G267000g [Phaseolus vulgaris]
 gb|ESW35812.1| hypothetical protein PHAVU_001G267000g [Phaseolus vulgaris]
Length=437

 Score =   298 bits (763),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 157/208 (75%), Positives = 179/208 (86%), Gaps = 8/208 (4%)
 Frame = +1

Query  97   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  276
            +TSK+ KLERYNSYIRRVNS+KL+ ASSKLLFRATL+VALIL+F FT NYPPLA+S+   
Sbjct  2    ETSKSMKLERYNSYIRRVNSTKLLNASSKLLFRATLLVALILVFLFTFNYPPLADST---  58

Query  277  RRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKK  456
              R LH   H  L++ F    AWEKQ++ S+TPRR NG++VLVTGAAGFVGSHCSLALK+
Sbjct  59   -HRHLHAHSH-FLSSAF---GAWEKQLRHSSTPRRPNGLTVLVTGAAGFVGSHCSLALKR  113

Query  457  RGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHL  636
            RGDGVLGLDNFNAYYDPSLKRARQ +L KHQ+FIVEGDLND PLL KLFD+V FTHILHL
Sbjct  114  RGDGVLGLDNFNAYYDPSLKRARQAMLAKHQVFIVEGDLNDTPLLQKLFDVVAFTHILHL  173

Query  637  AAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            AAQAGVRYAMQNP SY+++NIAG VNLL
Sbjct  174  AAQAGVRYAMQNPQSYITANIAGFVNLL  201



>gb|AGV54436.1| UDP-D-glucuronic acid 4-epimerase [Phaseolus vulgaris]
Length=437

 Score =   298 bits (762),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 157/208 (75%), Positives = 179/208 (86%), Gaps = 8/208 (4%)
 Frame = +1

Query  97   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  276
            +TSK+ KLERYNSYIRRVNS+KL+ ASSKLLFRATL+VALIL+F FT NYPPLA+S+   
Sbjct  2    ETSKSMKLERYNSYIRRVNSTKLLNASSKLLFRATLLVALILVFLFTFNYPPLADST---  58

Query  277  RRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKK  456
              R LH   H  L++ F    AWEKQ++ S+TPRR NG++VLVTGAAGFVGSHCSLALK+
Sbjct  59   -HRHLHAHSH-FLSSAF---GAWEKQLRHSSTPRRPNGLTVLVTGAAGFVGSHCSLALKR  113

Query  457  RGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHL  636
            RGDGVLGLDNFNAYYDPSLKRARQ +L KHQ+FIVEGDLND PLL KLFD+V FTHILHL
Sbjct  114  RGDGVLGLDNFNAYYDPSLKRARQAMLAKHQVFIVEGDLNDTPLLQKLFDVVAFTHILHL  173

Query  637  AAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            AAQAGVRYAMQNP SY+++NIAG VNLL
Sbjct  174  AAQAGVRYAMQNPQSYITANIAGFVNLL  201



>gb|AHA84281.1| UDP-glucuronate 4-epimerase 6 [Phaseolus vulgaris]
Length=444

 Score =   297 bits (761),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 157/208 (75%), Positives = 179/208 (86%), Gaps = 8/208 (4%)
 Frame = +1

Query  97   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  276
            +TSK+ KLERYNSYIRRVNS+KL+ ASSKLLFRATL+VALIL+F FT NYPPLA+S+   
Sbjct  2    ETSKSMKLERYNSYIRRVNSTKLLNASSKLLFRATLLVALILVFLFTFNYPPLADST---  58

Query  277  RRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKK  456
              R LH   H  L++ F    AWEKQ++ S+TPRR NG++VLVTGAAGFVGSHCSLALK+
Sbjct  59   -HRHLHAHSH-FLSSAF---GAWEKQLRHSSTPRRPNGLTVLVTGAAGFVGSHCSLALKR  113

Query  457  RGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHL  636
            RGDGVLGLDNFNAYYDPSLKRARQ +L KHQ+FIVEGDLND PLL KLFD+V FTHILHL
Sbjct  114  RGDGVLGLDNFNAYYDPSLKRARQAMLAKHQVFIVEGDLNDTPLLQKLFDVVAFTHILHL  173

Query  637  AAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            AAQAGVRYAMQNP SY+++NIAG VNLL
Sbjct  174  AAQAGVRYAMQNPQSYITANIAGFVNLL  201



>ref|XP_009616292.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nicotiana tomentosiformis]
Length=453

 Score =   296 bits (757),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 166/214 (78%), Positives = 184/214 (86%), Gaps = 3/214 (1%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA   DTSK  KLERYNSYIRRVNSSKLIAASSKLLFR TL+VAL+LIFFFTINY PL  
Sbjct  1    MASSLDTSKVMKLERYNSYIRRVNSSKLIAASSKLLFRVTLLVALLLIFFFTINYHPL--  58

Query  262  SSGGGRRRALHTTGHSLLAATF-SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHC  438
            +S       +HTT HSLL++ F  GGAAWEKQV+ S+TPRR NG+SVLVTGAAGFVGSHC
Sbjct  59   NSENTPHHHIHTTTHSLLSSAFYGGGAAWEKQVRHSSTPRRANGLSVLVTGAAGFVGSHC  118

Query  439  SLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  618
            S+ALKKRGDGVLG+DNFN+YYDP LKR RQKLL +H+IFIVEGD+NDA LLSKLFDIVPF
Sbjct  119  SMALKKRGDGVLGIDNFNSYYDPLLKRGRQKLLAQHEIFIVEGDINDAELLSKLFDIVPF  178

Query  619  THILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            TH+LHLAAQAGVRYAM+NP SY+ SNI G VNLL
Sbjct  179  THVLHLAAQAGVRYAMKNPQSYIKSNIGGFVNLL  212



>ref|XP_003538527.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Glycine max]
Length=462

 Score =   294 bits (753),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 157/210 (75%), Positives = 178/210 (85%), Gaps = 4/210 (2%)
 Frame = +1

Query  91   PPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSG  270
            PPDTSK+ KLERYNSYIRR+NS+KL+ ASSKLLFRAT++VALIL+F FT NYPPLA    
Sbjct  20   PPDTSKSIKLERYNSYIRRLNSTKLLNASSKLLFRATILVALILVFLFTFNYPPLAPDF-  78

Query  271  GGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLAL  450
                   H   HS   ++ S  A+WEKQV+ S+TPRR NG++VLVTGAAGFVGSHCSLAL
Sbjct  79   ---TSHRHLHSHSHFLSSSSSFASWEKQVRHSSTPRRPNGLTVLVTGAAGFVGSHCSLAL  135

Query  451  KKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHIL  630
            KKRGDGVLGLDNFN+YYDPSLKR+RQ +L KHQ+FIVEGDLND PLL KLFD+VPFTHIL
Sbjct  136  KKRGDGVLGLDNFNSYYDPSLKRSRQAMLWKHQVFIVEGDLNDTPLLEKLFDVVPFTHIL  195

Query  631  HLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            HLAAQAGVRYAMQNP SYV++NIAG VNLL
Sbjct  196  HLAAQAGVRYAMQNPQSYVTANIAGFVNLL  225



>gb|KJB72008.1| hypothetical protein B456_011G153500 [Gossypium raimondii]
Length=454

 Score =   291 bits (744),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 160/215 (74%), Positives = 179/215 (83%), Gaps = 2/215 (1%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            M  PPDTSK  KLERYN+Y+R+++S+KLI ASSKLLFRATL++ALILI FFTINYPPL++
Sbjct  1    MPTPPDTSKTLKLERYNNYLRKIHSTKLITASSKLLFRATLLIALILILFFTINYPPLSD  60

Query  262  SSGGGRRRALHTTGHSLLAATFS--GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSH  435
            +               L  + FS  GGAAWEKQV+ S+TPRR NG SVLVTGA GFVGSH
Sbjct  61   TPHHVPPHHRLHHHSLLSTSLFSAGGGAAWEKQVRLSSTPRRTNGFSVLVTGAGGFVGSH  120

Query  436  CSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVP  615
            CSLALKKRGDGVLGLDNFN YYDPSLKRARQ LL KHQ+FIVEGDLND PLL+KLFD+VP
Sbjct  121  CSLALKKRGDGVLGLDNFNNYYDPSLKRARQNLLSKHQVFIVEGDLNDGPLLTKLFDVVP  180

Query  616  FTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            FTH+LHLAAQAGVRYAMQNP SY+SSNIAG VNLL
Sbjct  181  FTHVLHLAAQAGVRYAMQNPQSYISSNIAGFVNLL  215



>gb|ADB24769.1| UDP-D-glucuronic acid 4-epimerase [Gossypium hirsutum]
Length=454

 Score =   291 bits (744),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 160/215 (74%), Positives = 180/215 (84%), Gaps = 2/215 (1%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            M  PPDTSK  KLERYN+Y+R+++S+KLI ASSKLLFRATL++ALILI FFTINYPPL++
Sbjct  1    MPTPPDTSKTLKLERYNNYLRKIHSTKLITASSKLLFRATLLIALILILFFTINYPPLSD  60

Query  262  SSGGGRRRALHTTGHSLLAATFS--GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSH  435
            +               L  + FS  GGAAWEKQV+ S+TPRR NG SVLVTGAAGFVGSH
Sbjct  61   TPHHVPPHHRLHHHSLLSTSLFSAGGGAAWEKQVRLSSTPRRTNGFSVLVTGAAGFVGSH  120

Query  436  CSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVP  615
            CSLALKKRGDGVLGLDNFN YYDPSLKRARQ LL KHQ+FIV+GDLND PLL+KLFD+VP
Sbjct  121  CSLALKKRGDGVLGLDNFNNYYDPSLKRARQNLLSKHQVFIVKGDLNDGPLLTKLFDVVP  180

Query  616  FTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            FTH+LHLAAQAGVRYAMQNP SY+SSNIAG VNLL
Sbjct  181  FTHVLHLAAQAGVRYAMQNPQSYISSNIAGFVNLL  215



>ref|XP_010532756.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Tarenaya hassleriana]
Length=458

 Score =   275 bits (703),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 155/212 (73%), Positives = 179/212 (84%), Gaps = 5/212 (2%)
 Frame = +1

Query  97   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  276
            DTSK  KLERYNSY+R+++SSK+I ASSKLLFRATL+VAL+L+  F +NYPPL+ SS   
Sbjct  8    DTSKTVKLERYNSYLRKIHSSKIINASSKLLFRATLLVALLLVLVFAVNYPPLSFSSSSD  67

Query  277  ----RRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSL  444
                 RR+  +TG    +++  GGAAWEK+V+ S+ PRR NG SVLVTGAAGFVGSHCS+
Sbjct  68   NHRLHRRSFLSTG-IFSSSSLGGGAAWEKRVRLSSAPRRPNGFSVLVTGAAGFVGSHCSI  126

Query  445  ALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTH  624
            ALKKRGDGVLGLDNFN YYDPSLKRARQ LLEKHQ+FIVEGDLND PLL+KLFD+VPFTH
Sbjct  127  ALKKRGDGVLGLDNFNDYYDPSLKRARQNLLEKHQVFIVEGDLNDGPLLTKLFDVVPFTH  186

Query  625  ILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            +LHLAAQAGVRYAM+NP SYV SNIAG VNLL
Sbjct  187  VLHLAAQAGVRYAMKNPQSYVRSNIAGFVNLL  218



>ref|XP_010673389.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Beta vulgaris subsp. 
vulgaris]
Length=449

 Score =   273 bits (699),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 152/213 (71%), Positives = 176/213 (83%), Gaps = 2/213 (1%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA   D SK++KLERYNSY+RRVN++KL+AASSKLLFRATL+VAL+L+FFFT+NYP    
Sbjct  1    MALSSDLSKSTKLERYNSYLRRVNNTKLLAASSKLLFRATLLVALLLVFFFTLNYPITGN  60

Query  262  SSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  441
             +      ++HTT     +  +  GA WEKQV+ S+TPRR NG S+LVTGAAGFVG+HCS
Sbjct  61   DAQNNA--SIHTTSRFFSSGFYGSGATWEKQVRQSSTPRRPNGFSILVTGAAGFVGTHCS  118

Query  442  LALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFT  621
            +ALKKRGDGVLGLDNFN YYDPSLKRARQKLL + QIFIVE DLND P+L KLFDIVPFT
Sbjct  119  IALKKRGDGVLGLDNFNRYYDPSLKRARQKLLSRQQIFIVEADLNDNPMLMKLFDIVPFT  178

Query  622  HILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            H+LHLAAQAGVRYAMQNP SY+ SNIAG VNLL
Sbjct  179  HVLHLAAQAGVRYAMQNPQSYIQSNIAGFVNLL  211



>ref|XP_010527460.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glucuronate 4-epimerase 6-like 
[Tarenaya hassleriana]
Length=460

 Score =   273 bits (699),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 151/214 (71%), Positives = 176/214 (82%), Gaps = 6/214 (3%)
 Frame = +1

Query  97   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  276
            DTSK  KLERYNSY+R+++S+K+I ASSKLLFRATL++AL+L+  FT+NYPPL+ S+  G
Sbjct  8    DTSKTVKLERYNSYLRKIHSTKVINASSKLLFRATLLIALVLVLIFTLNYPPLSSSTDAG  67

Query  277  ----RRRALHTTG--HSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHC  438
                 RR+  +TG   S  AA+  GG AWEK+       +  NG SVLVTGAAGFVGSHC
Sbjct  68   GHRVHRRSFLSTGIFSSSDAASLGGGPAWEKRXXXXXNXQYPNGFSVLVTGAAGFVGSHC  127

Query  439  SLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  618
            S+ALKKRGDGVLG DNFN YYDPSLKRARQKLL+KHQ+FIVEGDLND PLL+KLFD+VPF
Sbjct  128  SIALKKRGDGVLGFDNFNDYYDPSLKRARQKLLDKHQVFIVEGDLNDGPLLAKLFDVVPF  187

Query  619  THILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            TH+LHLAAQAGVRYAM+NP SYVSSNIAG VNLL
Sbjct  188  THVLHLAAQAGVRYAMKNPQSYVSSNIAGFVNLL  221



>ref|NP_189024.1| UDP-D-glucuronate 4-epimerase 6 [Arabidopsis thaliana]
 sp|Q9LIS3.1|GAE6_ARATH RecName: Full=UDP-glucuronate 4-epimerase 6; AltName: Full=UDP-glucuronic 
acid epimerase 6; Short=AtUGlcAE2 [Arabidopsis 
thaliana]
 gb|AAK44025.1|AF370210_1 putative NAD dependent epimerase [Arabidopsis thaliana]
 dbj|BAB03000.1| nucleotide sugar epimerase-like protein [Arabidopsis thaliana]
 gb|AAL07003.1| AT3g23820/F14O13_1 [Arabidopsis thaliana]
 gb|AAL32703.1| nucleotide sugar epimerase-like protein [Arabidopsis thaliana]
 gb|AAM91705.1| putative NAD dependent epimerase [Arabidopsis thaliana]
 emb|CAI53858.1| UDP-D-glucuronate 4-epimerase [Arabidopsis thaliana]
 gb|AEE76818.1| UDP-D-glucuronate 4-epimerase 6 [Arabidopsis thaliana]
 gb|AFI41201.1| UDP-D-glucuronate 4-epimerase 6, partial [Arabidopsis thaliana]
Length=460

 Score =   272 bits (696),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 149/214 (70%), Positives = 180/214 (84%), Gaps = 6/214 (3%)
 Frame = +1

Query  97   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  276
            DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F INYPPL++S    
Sbjct  8    DTSKTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALVLVLIFAINYPPLSDSRAAA  67

Query  277  ----RRRALHTTG--HSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHC  438
                 RR+  +TG   S  +++  GGAAWEK+V+ S+T +R +G+SVLVTGAAGFVGSHC
Sbjct  68   AHHLHRRSFLSTGLFSSSSSSSSIGGAAWEKRVRQSSTAKRPHGLSVLVTGAAGFVGSHC  127

Query  439  SLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  618
            SLAL+KRGDGVLG DNFN YYDPSLKRARQ+LLEK Q+FIVEGDLND PLL KLFD+VPF
Sbjct  128  SLALRKRGDGVLGFDNFNDYYDPSLKRARQELLEKQQVFIVEGDLNDGPLLRKLFDVVPF  187

Query  619  THILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            THILHLAAQAGVRYAM+NP SY++SNIAG VNLL
Sbjct  188  THILHLAAQAGVRYAMKNPQSYIASNIAGFVNLL  221



>gb|AAN60250.1| unknown [Arabidopsis thaliana]
Length=460

 Score =   272 bits (695),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 149/214 (70%), Positives = 179/214 (84%), Gaps = 6/214 (3%)
 Frame = +1

Query  97   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  276
            DTSK  KLERYNSY+R+++S+K++ ASSK LFRATL+VAL+L+  F INYPPL++S    
Sbjct  8    DTSKTVKLERYNSYLRKIHSTKVLNASSKXLFRATLLVALVLVLIFAINYPPLSDSRAAA  67

Query  277  ----RRRALHTTG--HSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHC  438
                 RR+  +TG   S  +++  GGAAWEK+V+ S+T +R +G+SVLVTGAAGFVGSHC
Sbjct  68   AHHLHRRSFLSTGLFSSSSSSSSIGGAAWEKRVRQSSTAKRPHGLSVLVTGAAGFVGSHC  127

Query  439  SLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  618
            SLAL+KRGDGVLG DNFN YYDPSLKRARQ+LLEK Q+FIVEGDLND PLL KLFD+VPF
Sbjct  128  SLALRKRGDGVLGFDNFNDYYDPSLKRARQELLEKQQVFIVEGDLNDGPLLRKLFDVVPF  187

Query  619  THILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            THILHLAAQAGVRYAM+NP SY++SNIAG VNLL
Sbjct  188  THILHLAAQAGVRYAMKNPQSYIASNIAGFVNLL  221



>ref|XP_009408344.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Musa acuminata 
subsp. malaccensis]
Length=447

 Score =   271 bits (694),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 141/214 (66%), Positives = 180/214 (84%), Gaps = 1/214 (0%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA PPDTSK +KLER N+Y+RRVNS+K+I+ASS+LLFRA+++  + LI  FT++YPPL  
Sbjct  1    MASPPDTSKTAKLERCNNYLRRVNSAKIISASSRLLFRASILATVALILLFTLHYPPLLL  60

Query  262  SSGGGRRRALHTTGHSLLAATFS-GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHC  438
             S      A  ++  SLL++  + GGAAWE++V+SSATPRR +G++VLVTGAAGFVG+HC
Sbjct  61   LSHYSANAAARSSHRSLLSSDVTYGGAAWEREVRSSATPRRPSGLTVLVTGAAGFVGTHC  120

Query  439  SLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  618
            SLALKKRGDGV+GLDNFN+YYDPSLKRARQ LL +H + +V+GD+ND PLL+KL D+VPF
Sbjct  121  SLALKKRGDGVVGLDNFNSYYDPSLKRARQSLLSRHGVLVVDGDINDTPLLTKLLDVVPF  180

Query  619  THILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            +H+LHLAAQAGVRYAM+NP SYV+SN+AG V LL
Sbjct  181  SHVLHLAAQAGVRYAMRNPQSYVTSNVAGLVALL  214



>ref|XP_002883465.1| hypothetical protein ARALYDRAFT_898926 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59724.1| hypothetical protein ARALYDRAFT_898926 [Arabidopsis lyrata subsp. 
lyrata]
Length=461

 Score =   271 bits (693),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 149/215 (69%), Positives = 180/215 (84%), Gaps = 7/215 (3%)
 Frame = +1

Query  97   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  276
            DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F INYPPL++S    
Sbjct  8    DTSKTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALVLVLLFAINYPPLSDSRAAA  67

Query  277  ----RRRALHTTG---HSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSH  435
                 RR+  +TG    S  +++  GGAAWEK+V+ S+T +R +G+SVLVTGAAGFVGSH
Sbjct  68   AHHLHRRSFLSTGLFSSSSSSSSSIGGAAWEKRVRQSSTAKRPHGLSVLVTGAAGFVGSH  127

Query  436  CSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVP  615
            CSLAL+KRGDGVLG DNFN YYDPSLKRARQ+LLEK Q+FIVEGDLND PLL KLFD+VP
Sbjct  128  CSLALRKRGDGVLGFDNFNDYYDPSLKRARQELLEKQQVFIVEGDLNDGPLLRKLFDVVP  187

Query  616  FTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            FTHILHLAAQAGVRYAM+NP SY++SNIAG VNLL
Sbjct  188  FTHILHLAAQAGVRYAMKNPQSYIASNIAGFVNLL  222



>gb|KFK39681.1| hypothetical protein AALP_AA3G275400 [Arabis alpina]
Length=458

 Score =   270 bits (691),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 148/212 (70%), Positives = 176/212 (83%), Gaps = 4/212 (2%)
 Frame = +1

Query  97   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  276
            DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F INYPPL++S    
Sbjct  8    DTSKTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALVLVLLFAINYPPLSDSRAAA  67

Query  277  ----RRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSL  444
                 RR+  +TG    +++   GAAWEK+V+ S+T +R +G+SVLVTGAAGFVGSH SL
Sbjct  68   AHHLHRRSFLSTGIFSSSSSLGEGAAWEKRVRQSSTAKRPHGLSVLVTGAAGFVGSHASL  127

Query  445  ALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTH  624
            AL+KRGDGVLG DNFN YYDPSLKRARQ LLEK Q+FIVEGDLND PLL KLFD+VPFTH
Sbjct  128  ALRKRGDGVLGFDNFNDYYDPSLKRARQDLLEKQQVFIVEGDLNDGPLLRKLFDVVPFTH  187

Query  625  ILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            ILHLAAQAGVRYAM+NP SYVSSNIAG VNLL
Sbjct  188  ILHLAAQAGVRYAMKNPQSYVSSNIAGFVNLL  219



>ref|XP_008794651.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glucuronate 4-epimerase 6-like 
[Phoenix dactylifera]
Length=468

 Score =   270 bits (690),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 142/213 (67%), Positives = 174/213 (82%), Gaps = 1/213 (0%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA PPDTSK +KLERYNSYIRRVNS+KL+AAS+ LLFRATL+ A++LI  FT++YPPL  
Sbjct  1    MAPPPDTSKTTKLERYNSYIRRVNSTKLLAASTNLLFRATLLTAVVLILLFTLHYPPLLA  60

Query  262  SSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  441
                    A H+    L + +  GGA WE++V+ SATPRR+ G+SVLVTGAAGFVG+HCS
Sbjct  61   GHHPSAASA-HSHRSLLSSYSSYGGATWEREVRRSATPRRRGGLSVLVTGAAGFVGTHCS  119

Query  442  LALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFT  621
            LALK RGDGVLGLDNFN+YYDPSLKR+RQKLL  H I +++ D+ND+ LL KLFD+VPF+
Sbjct  120  LALKXRGDGVLGLDNFNSYYDPSLKRSRQKLLSHHGILVIDADINDSKLLIKLFDVVPFS  179

Query  622  HILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            H+LHLAAQAGVRYAM+NP SYV+SN+AG V+L 
Sbjct  180  HVLHLAAQAGVRYAMRNPQSYVASNVAGLVSLF  212



>ref|XP_009106288.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Brassica rapa]
Length=460

 Score =   269 bits (688),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 147/213 (69%), Positives = 180/213 (85%), Gaps = 5/213 (2%)
 Frame = +1

Query  97   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  276
            DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F INY PL++S    
Sbjct  9    DTSKTVKLERYNSYLRKIHSTKVLKASSKVLFRATLLVALVLVLVFAINYHPLSDSHSAA  68

Query  277  ----RRRALHTTG-HSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  441
                 RR+  +TG  S  +++   GAAWEK+V+ S+TP+R +G+SVLVTGAAGFVGSHCS
Sbjct  69   SHHLHRRSFLSTGIFSSSSSSLGEGAAWEKRVRQSSTPKRPHGLSVLVTGAAGFVGSHCS  128

Query  442  LALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFT  621
            +AL+KRGDGVLG DNFN YYDPSLKRARQ+LLEK+Q+FIVEGDLND PLL KLFD+VPFT
Sbjct  129  IALRKRGDGVLGFDNFNDYYDPSLKRARQELLEKNQVFIVEGDLNDGPLLRKLFDVVPFT  188

Query  622  HILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            H+LHLAAQAGVRYAM+NP SY+SSNIAG VNLL
Sbjct  189  HVLHLAAQAGVRYAMKNPQSYISSNIAGLVNLL  221



>ref|XP_010421811.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Camelina sativa]
Length=372

 Score =   266 bits (680),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 147/223 (66%), Positives = 179/223 (80%), Gaps = 10/223 (4%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            M+   DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F INYPPL++
Sbjct  3    MSATADTSKTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALVLVLLFAINYPPLSD  62

Query  262  SSGGG----RRRALHTTG------HSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTG  411
            S         RR+  +TG       S  +++  GGAAWEK+V+ S+T +R  G+SVLVTG
Sbjct  63   SRAAAAHHLHRRSFLSTGLFSSSSSSSSSSSSIGGAAWEKRVRQSSTAKRPRGLSVLVTG  122

Query  412  AAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLL  591
            AAGFVGSHCSL L+KRGDGVLG DNFN YYDP+LKRARQ LLEK Q+FIVEGDLND PLL
Sbjct  123  AAGFVGSHCSLYLRKRGDGVLGFDNFNDYYDPALKRARQALLEKQQVFIVEGDLNDGPLL  182

Query  592  SKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
             KLFD+VPFTH+LHLAAQAGVRYAM+NP SY++SNIAG VNLL
Sbjct  183  RKLFDVVPFTHVLHLAAQAGVRYAMKNPQSYIASNIAGFVNLL  225



>ref|XP_006418833.1| hypothetical protein EUTSA_v10002521mg [Eutrema salsugineum]
 gb|ESQ37269.1| hypothetical protein EUTSA_v10002521mg [Eutrema salsugineum]
Length=461

 Score =   269 bits (687),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 149/215 (69%), Positives = 180/215 (84%), Gaps = 7/215 (3%)
 Frame = +1

Query  97   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  276
            DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F INYPPL++S    
Sbjct  8    DTSKTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALLLVLLFAINYPPLSDSRAAA  67

Query  277  ----RRRALHTTG---HSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSH  435
                 RR+  +TG    S  +++ S GAAWEK+V+ S+T +R +G+SVLVTGAAGFVGSH
Sbjct  68   AHHLHRRSFLSTGLFSSSSSSSSASLGAAWEKRVRQSSTAKRPHGLSVLVTGAAGFVGSH  127

Query  436  CSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVP  615
            CS+ALKKRGDGVLG DNFN YYDPSLKRARQ+LLEK Q+FIVEGDLND PLL KLFD+VP
Sbjct  128  CSIALKKRGDGVLGFDNFNDYYDPSLKRARQQLLEKQQVFIVEGDLNDGPLLRKLFDVVP  187

Query  616  FTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            FTH+LHLAAQAGVRYAM+NP SY+SSNIAG VNLL
Sbjct  188  FTHVLHLAAQAGVRYAMKNPQSYISSNIAGLVNLL  222



>ref|XP_006297629.1| hypothetical protein CARUB_v10013650mg [Capsella rubella]
 gb|EOA30527.1| hypothetical protein CARUB_v10013650mg [Capsella rubella]
Length=462

 Score =   268 bits (686),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 147/216 (68%), Positives = 179/216 (83%), Gaps = 8/216 (4%)
 Frame = +1

Query  97   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  276
            DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F INYPPL++S    
Sbjct  8    DTSKTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALVLVLLFAINYPPLSDSRAAA  67

Query  277  ----RRRALHTTG----HSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGS  432
                 RR+  +TG     S  +++  GGAAWEK+V+ S+T +RQ+G+SVLVTGAAGFVGS
Sbjct  68   AHHLHRRSFLSTGLFSSSSSSSSSSIGGAAWEKRVRQSSTAKRQHGLSVLVTGAAGFVGS  127

Query  433  HCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIV  612
            HCSL L+KRGDGVLG DNFN YYDP+LKRARQ LLEK Q+FIVEGDLND PLL KLFD+V
Sbjct  128  HCSLYLRKRGDGVLGFDNFNDYYDPALKRARQALLEKQQVFIVEGDLNDGPLLRKLFDVV  187

Query  613  PFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            PFTH+LHLAAQAGVRYAM+NP SY++SNIAG VNLL
Sbjct  188  PFTHVLHLAAQAGVRYAMKNPQSYIASNIAGFVNLL  223



>ref|XP_009102574.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Brassica rapa]
Length=454

 Score =   268 bits (686),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 145/208 (70%), Positives = 176/208 (85%), Gaps = 0/208 (0%)
 Frame = +1

Query  97   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  276
            DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL++AL+L+  F +NY P ++S    
Sbjct  8    DTSKTVKLERYNSYLRKIHSTKVLKASSKVLFRATLLIALVLVLLFAVNYHPHSDSHHLH  67

Query  277  RRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKK  456
            RR  L T   S  +++   GAAWEK+V+ S+T +RQ+G+SVLVTGAAGFVGSHCS+AL+K
Sbjct  68   RRSFLSTGLFSSSSSSLGEGAAWEKRVRQSSTAKRQHGLSVLVTGAAGFVGSHCSIALRK  127

Query  457  RGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHL  636
            RGDGVLG DNFN YYDPSLKRARQ LLEK+Q+FIVEGDLND PLL KLFDIVPFTH+LHL
Sbjct  128  RGDGVLGFDNFNDYYDPSLKRARQHLLEKNQVFIVEGDLNDGPLLRKLFDIVPFTHVLHL  187

Query  637  AAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            AAQAGVRYAM+NP SY+SSNIAG VNLL
Sbjct  188  AAQAGVRYAMKNPQSYISSNIAGLVNLL  215



>emb|CDY18087.1| BnaA01g23480D [Brassica napus]
Length=460

 Score =   268 bits (685),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 147/213 (69%), Positives = 180/213 (85%), Gaps = 5/213 (2%)
 Frame = +1

Query  97   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  276
            DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F INY PL++S    
Sbjct  9    DTSKTVKLERYNSYLRKIHSTKVLKASSKVLFRATLLVALVLVLVFAINYHPLSDSHSPA  68

Query  277  ----RRRALHTTG-HSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  441
                 RR+  +TG  S  +++   GAAWEK+V+ S+TP+R +G+SVLVTGAAGFVGSHCS
Sbjct  69   SHHLHRRSFLSTGIFSSSSSSLGEGAAWEKRVRQSSTPKRPHGLSVLVTGAAGFVGSHCS  128

Query  442  LALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFT  621
            +AL+KRGDGVLG DNFN YYDPSLKRARQ+LLEK+Q+FIVEGDLND PLL KLFD+VPFT
Sbjct  129  IALRKRGDGVLGFDNFNDYYDPSLKRARQELLEKNQVFIVEGDLNDGPLLRKLFDVVPFT  188

Query  622  HILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            H+LHLAAQAGVRYAM+NP SY+SSNIAG VNLL
Sbjct  189  HVLHLAAQAGVRYAMKNPQSYISSNIAGLVNLL  221



>emb|CDY64583.1| BnaCnng44170D [Brassica napus]
Length=460

 Score =   268 bits (685),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 146/213 (69%), Positives = 180/213 (85%), Gaps = 5/213 (2%)
 Frame = +1

Query  97   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  276
            DTSK  KLERYN+Y+R+++S+K++ ASSK+LFRATL+VAL+L+  F INY PL++S    
Sbjct  9    DTSKTVKLERYNNYLRKIHSTKVLKASSKVLFRATLLVALVLVLVFAINYHPLSDSHSAA  68

Query  277  ----RRRALHTTG-HSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  441
                 RR+  +TG  S  +++   GAAWEK+V+ S+TP+R +G+SVLVTGAAGFVGSHCS
Sbjct  69   SHHLHRRSFLSTGIFSSSSSSLGEGAAWEKRVRQSSTPKRPHGLSVLVTGAAGFVGSHCS  128

Query  442  LALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFT  621
            +AL+KRGDGVLG DNFN YYDPSLKRARQ+LLEK+Q+FIVEGDLND PLL KLFD+VPFT
Sbjct  129  IALRKRGDGVLGFDNFNDYYDPSLKRARQELLEKNQVFIVEGDLNDGPLLRKLFDVVPFT  188

Query  622  HILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            H+LHLAAQAGVRYAM+NP SY+SSNIAG VNLL
Sbjct  189  HVLHLAAQAGVRYAMKNPQSYISSNIAGLVNLL  221



>ref|XP_010905148.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Elaeis guineensis]
Length=463

 Score =   267 bits (683),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 139/218 (64%), Positives = 172/218 (79%), Gaps = 13/218 (6%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA PPD SK +KLERYNSY+RRVNS+KL+AASS +LFRATL+ A++LI  FT++YPPL  
Sbjct  1    MAPPPDNSKTTKLERYNSYLRRVNSTKLLAASSNILFRATLLTAVVLILLFTLHYPPLLA  60

Query  262  SSGGGRRRALHTTGHS-----LLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFV  426
                      H   HS       +++  GGAAWE++V+ SATP R  G+ VLVTGAAGFV
Sbjct  61   GH--------HPPAHSHRSLLSPSSSSYGGAAWEREVRRSATPHRPGGLFVLVTGAAGFV  112

Query  427  GSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFD  606
            G+HCSLALKKRGDGVLGLDNFN+YYDPSLKR+RQ LL +H I +++ D+ND+ LL KLFD
Sbjct  113  GTHCSLALKKRGDGVLGLDNFNSYYDPSLKRSRQNLLSRHGILVIDADINDSNLLIKLFD  172

Query  607  IVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            +VPF+H+LHLAAQAGVRYAM+NP SYV+SN+AG V+L 
Sbjct  173  VVPFSHVLHLAAQAGVRYAMRNPQSYVASNVAGLVSLF  210



>ref|XP_010906178.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Elaeis guineensis]
Length=467

 Score =   266 bits (681),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 136/213 (64%), Positives = 168/213 (79%), Gaps = 0/213 (0%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA  PDTSK +KLERYNSY+RRVN++KL+A +S LLFRATL+ A++LI  FT++YPPL  
Sbjct  1    MAPLPDTSKTTKLERYNSYLRRVNTTKLLATTSNLLFRATLLTAVVLILLFTLHYPPLLA  60

Query  262  SSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  441
                    A          ++  GGAAWE+ V+ SATPR   G+SVLVTGAAGFVG+HCS
Sbjct  61   GHHLSPTSAHSHRSLLSSPSSSYGGAAWERNVRRSATPRHPGGLSVLVTGAAGFVGTHCS  120

Query  442  LALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFT  621
            LALKKRGDGVLGLDNFN+YYDPSLKR+RQ LL +H I +++ D+ND+ LL KLFD+VPF+
Sbjct  121  LALKKRGDGVLGLDNFNSYYDPSLKRSRQNLLSRHGILVLDADINDSDLLIKLFDVVPFS  180

Query  622  HILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            H+LHLAAQAGVRYAM+NP SYV+SN+AG V+L 
Sbjct  181  HVLHLAAQAGVRYAMRNPQSYVASNVAGLVSLF  213



>ref|XP_010488461.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Camelina sativa]
Length=462

 Score =   266 bits (680),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 147/221 (67%), Positives = 179/221 (81%), Gaps = 8/221 (4%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            M+   DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F INYPPL++
Sbjct  3    MSATADTSKTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALVLVLLFAINYPPLSD  62

Query  262  SSGGG----RRRALHTTG----HSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAA  417
            S         RR+  +TG     S  +++  GGAAWEK+V+ S+T +R  G+SVLVTGAA
Sbjct  63   SRAAAAHHLHRRSFLSTGLFSSSSSSSSSSIGGAAWEKRVRQSSTAKRPRGLSVLVTGAA  122

Query  418  GFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSK  597
            GFVGSHCSL L+KRGDGVLG DNFN YYDP+LKRARQ LLEK Q+FIVEGDLND PLL K
Sbjct  123  GFVGSHCSLYLRKRGDGVLGFDNFNDYYDPALKRARQALLEKQQVFIVEGDLNDGPLLRK  182

Query  598  LFDIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            LFD+VPFTH+LHLAAQAGVRYAM+NP SY++SNIAG VNLL
Sbjct  183  LFDVVPFTHVLHLAAQAGVRYAMKNPQSYIASNIAGFVNLL  223



>ref|XP_010468437.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Camelina sativa]
Length=456

 Score =   266 bits (679),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 147/221 (67%), Positives = 179/221 (81%), Gaps = 8/221 (4%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            M+   DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F INYPPL++
Sbjct  3    MSATADTSKTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALVLVLLFAINYPPLSD  62

Query  262  SSGGG----RRRALHTTG----HSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAA  417
            S         RR+  +TG     S  +++  GGAAWEK+V+ S+T +R  G+SVLVTGAA
Sbjct  63   SRAAAAHHLHRRSFLSTGLFSSSSSSSSSSIGGAAWEKRVRQSSTAKRPRGLSVLVTGAA  122

Query  418  GFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSK  597
            GFVGSHCSL L+KRGDGVLG DNFN YYDP+LKRARQ LLEK Q+FIVEGDLND PLL K
Sbjct  123  GFVGSHCSLYLRKRGDGVLGFDNFNDYYDPALKRARQALLEKQQVFIVEGDLNDGPLLRK  182

Query  598  LFDIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            LFD+VPFTH+LHLAAQAGVRYAM+NP SY++SNIAG VNLL
Sbjct  183  LFDVVPFTHVLHLAAQAGVRYAMKNPQSYIASNIAGFVNLL  223



>emb|CDX77481.1| BnaA07g06190D [Brassica napus]
Length=453

 Score =   261 bits (668),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 144/208 (69%), Positives = 177/208 (85%), Gaps = 1/208 (0%)
 Frame = +1

Query  97   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  276
            DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL++AL+L+  F +NY P ++S    
Sbjct  8    DTSKTVKLERYNSYLRKIHSTKVLKASSKVLFRATLLIALVLVLLFAVNYHPHSDSHHL-  66

Query  277  RRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKK  456
             RR+  +TG    +++   GAAWEK+V+ S+T +RQ+G+SVLVTGAAGFVGSHCS+AL+K
Sbjct  67   HRRSFLSTGLFSSSSSLGEGAAWEKRVRQSSTAKRQHGLSVLVTGAAGFVGSHCSIALRK  126

Query  457  RGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHL  636
            RGDGVLG DNFN YYDPSLKRARQ LLEK+Q+FIVEGDLND PLL KLFDIVPFTH+LHL
Sbjct  127  RGDGVLGFDNFNDYYDPSLKRARQHLLEKNQVFIVEGDLNDGPLLRKLFDIVPFTHVLHL  186

Query  637  AAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            AAQAGVRYAM+NP SY+SSNIAG VNLL
Sbjct  187  AAQAGVRYAMKNPQSYISSNIAGLVNLL  214



>ref|XP_008792930.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Phoenix dactylifera]
Length=464

 Score =   260 bits (664),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 139/223 (62%), Positives = 169/223 (76%), Gaps = 23/223 (10%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA   DTSK +KLERYNSY+RRVNS+KL+AAS   LFRATL+ A++LI  FT++YPPL  
Sbjct  1    MALLTDTSKTTKLERYNSYLRRVNSTKLLAASWNFLFRATLLTAIVLILLFTLHYPPL--  58

Query  262  SSGGGRRRALHTTGHSLLAAT----------FSGGAAWEKQVQSSATPRRQNGMSVLVTG  411
                         GH L AA+            GG+AWE+ V+ SATPRR  GM+VLVTG
Sbjct  59   -----------LAGHHLSAASAHSHRSLLSSSYGGSAWERDVRRSATPRRHGGMTVLVTG  107

Query  412  AAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLL  591
            AAGFVG+HCSLALKKRGDGVLGLDNFN+YYDPSLKR+RQ LL +  I +++ D+ND+ LL
Sbjct  108  AAGFVGTHCSLALKKRGDGVLGLDNFNSYYDPSLKRSRQNLLSRRGILVLDADINDSNLL  167

Query  592  SKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
             KLFD+VPF+H+LHLAAQAGVRYAM+NP SYV+SN+AG V+L 
Sbjct  168  IKLFDVVPFSHVLHLAAQAGVRYAMRNPQSYVASNVAGLVSLF  210



>emb|CDX85133.1| BnaC07g07730D [Brassica napus]
Length=456

 Score =   258 bits (659),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 146/210 (70%), Positives = 177/210 (84%), Gaps = 2/210 (1%)
 Frame = +1

Query  97   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  276
            DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL++AL+L+  F +NY P ++S    
Sbjct  8    DTSKTVKLERYNSYLRKIHSTKVLKASSKVLFRATLLIALVLVLLFAVNYHPHSDSHHLH  67

Query  277  RRRALHTT--GHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLAL  450
            RR  L T     S  +++  GGAAWEK+V+ S+T +RQ+G+SVLVTGAAGFVGSHCS+AL
Sbjct  68   RRSFLSTGLFSSSSASSSLGGGAAWEKRVRQSSTAKRQHGLSVLVTGAAGFVGSHCSIAL  127

Query  451  KKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHIL  630
            +KRGDGVLG DNFN YYDPSLKRARQ LLEK+Q+FIVEGDLND PLL KLFDIVPFTH+L
Sbjct  128  RKRGDGVLGFDNFNDYYDPSLKRARQHLLEKNQVFIVEGDLNDGPLLRKLFDIVPFTHVL  187

Query  631  HLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            HLAAQAGVRYAM+NP SY+SSNIAG VNLL
Sbjct  188  HLAAQAGVRYAMKNPQSYISSNIAGLVNLL  217



>emb|CDX92990.1| BnaA03g37120D [Brassica napus]
Length=456

 Score =   256 bits (655),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 144/212 (68%), Positives = 175/212 (83%), Gaps = 7/212 (3%)
 Frame = +1

Query  97   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  276
            DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F  NY PL++S    
Sbjct  9    DTSKTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALVLLLLFAFNYHPLSDSRAAA  68

Query  277  ----RRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSL  444
                 RR+  +TG   + ++ S  +AWEK+V+ S+T +RQ+G+SVLVTGAAGFVGSHCS+
Sbjct  69   SHHLHRRSFLSTG---IFSSSSSSSAWEKRVRQSSTAKRQHGLSVLVTGAAGFVGSHCSI  125

Query  445  ALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTH  624
            AL+KRGDGVLG DNFN YYD SLKRARQ LLEK Q+FIVEGDLND PLL KLFDIVPFTH
Sbjct  126  ALRKRGDGVLGFDNFNDYYDTSLKRARQNLLEKQQVFIVEGDLNDGPLLRKLFDIVPFTH  185

Query  625  ILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            +LHLAAQAGVRYAM+NP SY+SSNIAG VNLL
Sbjct  186  VLHLAAQAGVRYAMKNPQSYISSNIAGLVNLL  217



>ref|XP_009135867.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Brassica rapa]
Length=456

 Score =   256 bits (654),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 144/212 (68%), Positives = 175/212 (83%), Gaps = 7/212 (3%)
 Frame = +1

Query  97   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  276
            DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F  NY PL++S    
Sbjct  9    DTSKTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALVLLLLFAFNYHPLSDSRAAA  68

Query  277  ----RRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSL  444
                 RR+  +TG   + ++ S  +AWEK+V+ S+T +RQ+G+SVLVTGAAGFVGSHCS+
Sbjct  69   SHHLHRRSFLSTG---IFSSSSSSSAWEKRVRQSSTAKRQHGLSVLVTGAAGFVGSHCSI  125

Query  445  ALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTH  624
            AL+KRGDGVLG DNFN YYD SLKRARQ LLEK Q+FIVEGDLND PLL KLFDIVPFTH
Sbjct  126  ALRKRGDGVLGFDNFNDYYDTSLKRARQNLLEKQQVFIVEGDLNDGPLLRKLFDIVPFTH  185

Query  625  ILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            +LHLAAQAGVRYAM+NP SY+SSNIAG VNLL
Sbjct  186  VLHLAAQAGVRYAMKNPQSYISSNIAGLVNLL  217



>ref|XP_006365466.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Solanum tuberosum]
Length=434

 Score =   255 bits (652),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 135/212 (64%), Positives = 167/212 (79%), Gaps = 10/212 (5%)
 Frame = +1

Query  88   FPPDTSKNSKLERYNSYIRRVNsskl-iaasskllFRATLMVALILIFFFTINYPPLAES  264
            F  DT+K++KL+RYN+YIR+VNSS   IAASSKLL+R T+++  +LI  F INY     +
Sbjct  5    FSVDTNKSTKLDRYNTYIRKVNSSTKFIAASSKLLYRITILIFALLICSFIINYFLFVSN  64

Query  265  SGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSL  444
            +     R L +         F GGA WEK+V+ S+ P++ NG  VLVTGAAGFVGSHC+L
Sbjct  65   NSNQHGRRLFS---------FGGGAGWEKKVRHSSIPKKINGKVVLVTGAAGFVGSHCAL  115

Query  445  ALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTH  624
            ALKKRGDGV+G+DNFN+YYDPSLKRARQ+LL KH+IFIVEGD+ND  L++KLFDIVPFTH
Sbjct  116  ALKKRGDGVIGIDNFNSYYDPSLKRARQELLAKHEIFIVEGDINDIDLVNKLFDIVPFTH  175

Query  625  ILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            +LHLAAQAGVRYAM+NPLSY+ SN+ G VNLL
Sbjct  176  VLHLAAQAGVRYAMENPLSYIHSNVNGFVNLL  207



>ref|XP_009386871.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Musa acuminata 
subsp. malaccensis]
Length=465

 Score =   256 bits (653),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 134/216 (62%), Positives = 175/216 (81%), Gaps = 3/216 (1%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYI-RRVNsskliaasskllFRATLMVALILIFFFTINYPPLA  258
            MA  PDTSK+ KLER+  Y+ RR+NS+K+IAASS LLFRA+++  ++LI  FT++YPPL 
Sbjct  1    MASAPDTSKSFKLERHGGYLLRRINSTKVIAASSHLLFRASILATVVLILLFTLHYPPLL  60

Query  259  ESSGGGRRRALHTTGH-SLLAATFS-GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGS  432
                G    +   + H SLL++  + GGAAWE++V+ SATPR  +G++VLVTGAAGFVG+
Sbjct  61   LYHSGAAASSAAHSNHRSLLSSAVTYGGAAWEREVRRSATPRSPSGLTVLVTGAAGFVGT  120

Query  433  HCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIV  612
            HCSLALKKRGDGV+GLDNFN+YY+PSLKRARQ LL +H + +++ D+ND PLL+KLFD+V
Sbjct  121  HCSLALKKRGDGVVGLDNFNSYYNPSLKRARQSLLSRHGVLVLDADINDTPLLTKLFDVV  180

Query  613  PFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            PF+H+LHLAAQAGVRYAM+NP SYV+SN+AG V L 
Sbjct  181  PFSHVLHLAAQAGVRYAMRNPQSYVASNVAGLVALF  216



>ref|XP_006848494.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Amborella trichopoda]
 gb|ERN10075.1| hypothetical protein AMTR_s00013p00257170 [Amborella trichopoda]
Length=446

 Score =   254 bits (649),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 138/202 (68%), Positives = 161/202 (80%), Gaps = 6/202 (3%)
 Frame = +1

Query  115  KLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGGRRRALH  294
            KLERYNSYIR++NSSK +AASSKLLFRA++++AL L+FF T+   P         RR L 
Sbjct  9    KLERYNSYIRKMNSSKALAASSKLLFRASILIALFLVFFLTLTSYPTEV------RRRLS  62

Query  295  TTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  474
            +T     A+   GG  WEKQV+ S+TPRR NG SVLVTGAAGFVGSH SLALKKRGDGVL
Sbjct  63   STSSFGAASARWGGPLWEKQVRHSSTPRRPNGFSVLVTGAAGFVGSHSSLALKKRGDGVL  122

Query  475  GLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGV  654
            GLDNFN YYDPSLKRARQ LL K  IFIV+GD+N+A LL+KLFD+VPF+H+LHLAAQAGV
Sbjct  123  GLDNFNDYYDPSLKRARQALLAKQSIFIVDGDINNAYLLAKLFDVVPFSHVLHLAAQAGV  182

Query  655  RYAMQNPLSYVSSNIAGXVNLL  720
            RYA+QNP SYV SN+AG V+L 
Sbjct  183  RYALQNPSSYVHSNVAGLVSLF  204



>emb|CDY53207.1| BnaC03g74010D [Brassica napus]
Length=455

 Score =   253 bits (645),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 146/219 (67%), Positives = 176/219 (80%), Gaps = 11/219 (5%)
 Frame = +1

Query  88   FPP----DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPL  255
             PP    DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL L+  F  NY PL
Sbjct  1    MPPSATADTSKTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALFLLLLFAFNYHPL  60

Query  256  AESSGGG----RRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGF  423
            ++S         RR+  +TG   + ++ S  +AWEK+V+ S+T +RQ+G+SVLVTGAAGF
Sbjct  61   SDSRAAASHHLHRRSFLSTG---IFSSSSSSSAWEKRVRQSSTAKRQHGLSVLVTGAAGF  117

Query  424  VGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLF  603
            VGSHCS+AL+KRGDGVLG DNFN YYD SLKRARQ LLEK Q+FIVEGDLND PLL KLF
Sbjct  118  VGSHCSIALRKRGDGVLGFDNFNDYYDTSLKRARQNLLEKQQVFIVEGDLNDGPLLRKLF  177

Query  604  DIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            DIVPFTH+LHLAAQAGVRYAM+NP SY+SSNIAG VNLL
Sbjct  178  DIVPFTHVLHLAAQAGVRYAMKNPQSYISSNIAGLVNLL  216



>ref|XP_009412723.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Musa acuminata 
subsp. malaccensis]
Length=466

 Score =   244 bits (622),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 142/214 (66%), Positives = 175/214 (82%), Gaps = 1/214 (0%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYI-RRVNsskliaasskllFRATLMVALILIFFFTINYPPLA  258
            MA PPDTSK+SKLERYNSY+ RRV+S+KLIAASS LLFRAT++ ALILIF F ++YPPL 
Sbjct  2    MASPPDTSKSSKLERYNSYLLRRVSSAKLIAASSHLLFRATILAALILIFLFLLHYPPLL  61

Query  259  ESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHC  438
             SS      + H+   SLL++   GG  WE+ V+ SA PRR +G+SVLVTGAAGFVG+HC
Sbjct  62   LSSSHYSSSSPHSNHRSLLSSGSYGGGYWERDVRRSAAPRRPDGLSVLVTGAAGFVGTHC  121

Query  439  SLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  618
            SLALK+RGDGV+GLDNFNAYYDP+LKR+RQ LL  H + ++E D+ND  LL+KLFD+VPF
Sbjct  122  SLALKRRGDGVVGLDNFNAYYDPALKRSRQALLSSHGVLVLEADINDGTLLAKLFDVVPF  181

Query  619  THILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            +H+LHLAAQAGVRYA +NP SYV+SN+AG V+L 
Sbjct  182  SHVLHLAAQAGVRYATRNPQSYVASNVAGLVSLF  215



>ref|XP_003532740.2| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Glycine max]
Length=493

 Score =   243 bits (621),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 131/213 (62%), Positives = 153/213 (72%), Gaps = 30/213 (14%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA  PDTSK  KL RYNSY+RR+NS           F+      ++L+  +T+       
Sbjct  73   MASSPDTSKTIKLMRYNSYLRRLNS-----------FKLLKTSFILLLLLYTL-------  114

Query  262  SSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  441
                       +T H LL++ F G  AWE QV+ SA PRR +GMSVLVTGAAGFVGSHCS
Sbjct  115  -----------STHHLLLSSAFHG-PAWENQVRHSALPRRPHGMSVLVTGAAGFVGSHCS  162

Query  442  LALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFT  621
            L+LKKRGDGVLGLDNFN+YYDPSLKRARQ LL KHQI I+E DLNDAPLL+K+FD+V F+
Sbjct  163  LSLKKRGDGVLGLDNFNSYYDPSLKRARQHLLAKHQILIIEADLNDAPLLAKIFDVVSFS  222

Query  622  HILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            H+LHLAAQAGVRYAMQNP SYV+SNIAG V LL
Sbjct  223  HVLHLAAQAGVRYAMQNPHSYVASNIAGFVTLL  255



>ref|XP_002522810.1| UDP-glucuronate 5-epimerase, putative [Ricinus communis]
 gb|EEF39661.1| UDP-glucuronate 5-epimerase, putative [Ricinus communis]
Length=401

 Score =   235 bits (599),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  331  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  510
            GGA+WEKQV+ S+TPRR +G+SVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN YYDPS
Sbjct  31   GGASWEKQVRHSSTPRRPSGLSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNNYYDPS  90

Query  511  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVS  690
            LKRARQ+LL KHQ+FIVEGD+ND  LL+KLFD+VPFTHILHLAAQAGVRYA+QNP SY+S
Sbjct  91   LKRARQQLLLKHQVFIVEGDINDGQLLAKLFDVVPFTHILHLAAQAGVRYAIQNPQSYIS  150

Query  691  SNIAGXVNLL  720
            SNIAG VNLL
Sbjct  151  SNIAGFVNLL  160



>ref|XP_004239852.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Solanum lycopersicum]
Length=433

 Score =   233 bits (594),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 121/212 (57%), Positives = 154/212 (73%), Gaps = 11/212 (5%)
 Frame = +1

Query  88   FPPDTSKNSKLERYNSYIRRVNsskliaasskllFRA-TLMVALILIFFFTINYPPLAES  264
            F  DT K+ KL+R N+YI +VNSS  +  +   LF    ++++ +LI  F +N+     +
Sbjct  5    FSIDTKKSIKLDR-NTYIHKVNSSTKLIVAFIKLFYCIAILISALLIGLFILNHILFIST  63

Query  265  SGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSL  444
                  R L +         F GGA WEK+V+ S+ P++ NG  VLVTGAAGFVGSHC L
Sbjct  64   DSNQHGRRLFS---------FGGGAGWEKKVRHSSIPKKINGKVVLVTGAAGFVGSHCGL  114

Query  445  ALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTH  624
            ALKKRGDGV+G+DNFN+YYDPSLKRARQ+L+ KH+IFIV+GD+ND  L++KLFDIV FTH
Sbjct  115  ALKKRGDGVIGIDNFNSYYDPSLKRARQELMSKHEIFIVDGDINDIDLVNKLFDIVRFTH  174

Query  625  ILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            +LHLAAQAGVRYAM+NPLSYV SN+ G VNLL
Sbjct  175  VLHLAAQAGVRYAMENPLSYVHSNVNGFVNLL  206



>ref|XP_006580148.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like isoform X2 [Glycine 
max]
Length=405

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 128/213 (60%), Positives = 142/213 (67%), Gaps = 33/213 (15%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA  PDTSK  KL R NSY+RR+N                            I++  L  
Sbjct  1    MASSPDTSKTIKLVRNNSYLRRLN----------------------------ISFKILFL  32

Query  262  SSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  441
                     L T  H L  ++     AWE QV+ SA PRR NGMSVLVTGAAGFVGSHCS
Sbjct  33   LLALLLLYTLSTHHHHLPLSS-----AWENQVRHSALPRRPNGMSVLVTGAAGFVGSHCS  87

Query  442  LALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFT  621
            LALKKRGDGVLGLDNFN YYDPSLKRARQ LL KH+I I+E DLNDAPLL+KLFD+V F+
Sbjct  88   LALKKRGDGVLGLDNFNPYYDPSLKRARQHLLAKHRILIIEADLNDAPLLAKLFDVVSFS  147

Query  622  HILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            H+LHLAAQAGVRYAMQNP SYV+SNIAG V LL
Sbjct  148  HVLHLAAQAGVRYAMQNPQSYVASNIAGFVTLL  180



>ref|XP_003524930.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like isoform X1 [Glycine 
max]
Length=416

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 128/213 (60%), Positives = 142/213 (67%), Gaps = 33/213 (15%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  261
            MA  PDTSK  KL R NSY+RR+N                            I++  L  
Sbjct  1    MASSPDTSKTIKLVRNNSYLRRLN----------------------------ISFKILFL  32

Query  262  SSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  441
                     L T  H L  ++     AWE QV+ SA PRR NGMSVLVTGAAGFVGSHCS
Sbjct  33   LLALLLLYTLSTHHHHLPLSS-----AWENQVRHSALPRRPNGMSVLVTGAAGFVGSHCS  87

Query  442  LALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFT  621
            LALKKRGDGVLGLDNFN YYDPSLKRARQ LL KH+I I+E DLNDAPLL+KLFD+V F+
Sbjct  88   LALKKRGDGVLGLDNFNPYYDPSLKRARQHLLAKHRILIIEADLNDAPLLAKLFDVVSFS  147

Query  622  HILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            H+LHLAAQAGVRYAMQNP SYV+SNIAG V LL
Sbjct  148  HVLHLAAQAGVRYAMQNPQSYVASNIAGFVTLL  180



>ref|XP_002965131.1| hypothetical protein SELMODRAFT_266836 [Selaginella moellendorffii]
 gb|EFJ33969.1| hypothetical protein SELMODRAFT_266836 [Selaginella moellendorffii]
Length=445

 Score =   227 bits (579),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 121/209 (58%), Positives = 151/209 (72%), Gaps = 9/209 (4%)
 Frame = +1

Query  94   PDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGG  273
            P T    K+ER N+Y  RV++    + S +  F   + VAL+   FF I+ PP  ++   
Sbjct  6    PSTPGKVKMER-NNYFGRVSNRWHSSGSGRYFFWMFVSVALMFYAFFHISAPPAVQTGLE  64

Query  274  GRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALK  453
             R       G+  LA    GG+ WEKQV+ SA  +R+NGM VLVTGAAGFVG+H SLALK
Sbjct  65   SRH-----FGNRALAW---GGSKWEKQVRHSARTKRENGMVVLVTGAAGFVGTHVSLALK  116

Query  454  KRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILH  633
            KRGDGV+GLDNFN+YYDPSLKRARQ+LLEK  +FIV+GD+N++ LL+KLF +VPFTH++H
Sbjct  117  KRGDGVVGLDNFNSYYDPSLKRARQELLEKQSVFIVDGDVNNSELLAKLFSMVPFTHVMH  176

Query  634  LAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            LAAQAGVRYAMQNP SYV+SNIAG V L 
Sbjct  177  LAAQAGVRYAMQNPASYVNSNIAGLVTLF  205



>ref|NP_001147328.1| protein capI [Zea mays]
 gb|ACG26819.1| protein capI [Zea mays]
 tpg|DAA62203.1| TPA: protein capI [Zea mays]
Length=487

 Score =   228 bits (580),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 129/223 (58%), Positives = 161/223 (72%), Gaps = 20/223 (9%)
 Frame = +1

Query  103  SKNSKLERYNS----YIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESS-  267
            +K  KLERY S     +RR  S+KL++ASS LLFRAT++  L L+F FT++YP L   S 
Sbjct  13   AKGMKLERYASGGALLLRRATSAKLVSASSHLLFRATVLATLALVFLFTLHYPSLLSRSF  72

Query  268  -----------GGGRRRALHTTGHSLLAATFS-GGAAWEKQVQSSATPRRQNGMSVLVTG  411
                        G R  A H    SLL ++ S GGAAWEK+V+ SA P R  G+SVLVTG
Sbjct  73   HLSAGGGGGADDGARSSASH---RSLLMSSASYGGAAWEKEVRRSARPSRDGGISVLVTG  129

Query  412  AAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLL  591
            AAGFVG+HCSLAL+ RGDGVLGLDNFN+YYDPSLKRARQ LL    + +++ D+NDAPLL
Sbjct  130  AAGFVGTHCSLALRARGDGVLGLDNFNSYYDPSLKRARQALLASRGVLVLDADINDAPLL  189

Query  592  SKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
             +LFD+  FTH+LHLAAQAGVRYAM+ P +YV+SN+AG V++L
Sbjct  190  ERLFDVAAFTHVLHLAAQAGVRYAMEAPQTYVASNVAGLVSVL  232



>ref|XP_002962217.1| hypothetical protein SELMODRAFT_77268 [Selaginella moellendorffii]
 gb|EFJ37477.1| hypothetical protein SELMODRAFT_77268 [Selaginella moellendorffii]
Length=450

 Score =   226 bits (577),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 120/209 (57%), Positives = 149/209 (71%), Gaps = 9/209 (4%)
 Frame = +1

Query  94   PDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGG  273
            P T    K+ER N+Y  RV++    + S +  F   + VAL+   FF I+ PP  ++   
Sbjct  11   PSTPGKVKMER-NNYFGRVSNRWHSSGSGRYFFWMFVSVALMFYAFFHISAPPAVQTGLE  69

Query  274  GRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALK  453
             R        H    A   GG+ WEKQV+ SA  +R+NGM VLVTGAAGFVG+H SLALK
Sbjct  70   SR--------HFGNRALTWGGSKWEKQVRHSARTKRENGMVVLVTGAAGFVGTHVSLALK  121

Query  454  KRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILH  633
            KRGDGV+GLDNFN+YYDPSLKRARQ+LLEK  +FIV+GD+N++ LL+KLF +VPFTH++H
Sbjct  122  KRGDGVVGLDNFNSYYDPSLKRARQELLEKQSVFIVDGDVNNSELLAKLFSMVPFTHVMH  181

Query  634  LAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            LAAQAGVRYAMQNP SYV+SNIAG V L 
Sbjct  182  LAAQAGVRYAMQNPASYVNSNIAGLVTLF  210



>ref|XP_009411848.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Musa acuminata 
subsp. malaccensis]
Length=466

 Score =   224 bits (572),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 138/216 (64%), Positives = 176/216 (81%), Gaps = 4/216 (2%)
 Frame = +1

Query  82   MAFPPDTSKNSKLERYNSYIRR-VNsskliaasskllFRATLMVALILIFFFTINYPPL-  255
            MA PPDTSK SKLERYNSY+RR V+S+KLIAASS +LFRATL+ AL+LIF F ++ PPL 
Sbjct  1    MASPPDTSKASKLERYNSYLRRRVSSAKLIAASSYILFRATLLAALLLIFLFLLHSPPLL  60

Query  256  -AESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGS  432
             + S       + H +  S  +A + GGAAWE+ V+ SATPRR +G+SVLVTGAAGFVG+
Sbjct  61   FSGSHYYSSSHSNHRSLLSSSSAAY-GGAAWEQDVRRSATPRRADGLSVLVTGAAGFVGT  119

Query  433  HCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIV  612
            HCSLALK+RGDGV+G+DNFNAYYDP+LKR+RQ LL +H + +++ D+N+  LL+KLFD+V
Sbjct  120  HCSLALKRRGDGVVGVDNFNAYYDPALKRSRQVLLTRHGVLVLDADINNVALLAKLFDVV  179

Query  613  PFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            PF+H+LHLAAQAGVRYA +NP SYV+SN+AG V+L 
Sbjct  180  PFSHVLHLAAQAGVRYATRNPQSYVASNVAGLVSLF  215



>gb|ABK25339.1| unknown [Picea sitchensis]
Length=430

 Score =   223 bits (569),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 121/212 (57%), Positives = 149/212 (70%), Gaps = 16/212 (8%)
 Frame = +1

Query  91   PP--DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAES  264
            PP  D +   K+ER   Y  R  +S+  + S++L F A  ++AL+ IFF  +  P     
Sbjct  2    PPSMDGALKGKMERNGGYFGRPANSRCCSPSARLFFWAATLIALLFIFFMGMTSPSEP--  59

Query  265  SGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSL  444
                RRR        +L +   GG  WEKQV+ S   +R+NG+ VLVTGAAGFVGSH SL
Sbjct  60   ----RRR--------VLGSYSWGGPDWEKQVRHSCKLKRENGIVVLVTGAAGFVGSHVSL  107

Query  445  ALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTH  624
            ALKKRGDGVLG+DNFN YYDPSLKR+RQ++LE H IFIVEGD+ND  LL KLFD+VPF+H
Sbjct  108  ALKKRGDGVLGIDNFNNYYDPSLKRSRQRVLENHGIFIVEGDINDRYLLKKLFDVVPFSH  167

Query  625  ILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            ++HLAAQAGVRYAM+NP+SYV SNIAG VNL 
Sbjct  168  VMHLAAQAGVRYAMENPISYVHSNIAGLVNLF  199



>dbj|BAC75426.1| putative type 1 capsule synthesis gene(CapI) [Oryza sativa Japonica 
Group]
Length=477

 Score =   223 bits (569),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 121/207 (58%), Positives = 154/207 (74%), Gaps = 13/207 (6%)
 Frame = +1

Query  139  IRRVNsskliaasskllFRATLMVALILIFFFTINYPPL---------AESSGGGRRRAL  291
            +RRV S KL++ASS LLFRAT++  L L+  FT++YP L         A ++  G+ RA 
Sbjct  26   VRRVASGKLLSASSHLLFRATILATLCLVCLFTVHYPSLLSHSFHLSSAAAAANGKHRAA  85

Query  292  HTTGH-SLL---AATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  459
              + H SLL   AA   GGAAWEK+V+ SA PRR  G+SVLVTGAAGFVG+HCSLAL+ R
Sbjct  86   SRSSHRSLLGSSAAVAYGGAAWEKEVRRSAAPRRDGGLSVLVTGAAGFVGAHCSLALRAR  145

Query  460  GDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLA  639
            GDGV+GLDNFN+YYDPSLKRARQ+LL    + +++ D+NDA LL +LFD   FTH+LHLA
Sbjct  146  GDGVVGLDNFNSYYDPSLKRARQRLLASRGVAVLDADINDAALLERLFDAARFTHVLHLA  205

Query  640  AQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            AQAGVRYAM+ P +YV+SN+AG V++ 
Sbjct  206  AQAGVRYAMRAPQTYVASNVAGLVSVF  232



>ref|NP_001062295.1| Os08g0526100 [Oryza sativa Japonica Group]
 gb|ABC59070.1| UDP-glucuronic acid 4-epimerase isoform 3 [Oryza sativa Japonica 
Group]
 dbj|BAF24209.1| Os08g0526100 [Oryza sativa Japonica Group]
Length=478

 Score =   223 bits (569),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 121/207 (58%), Positives = 154/207 (74%), Gaps = 13/207 (6%)
 Frame = +1

Query  139  IRRVNsskliaasskllFRATLMVALILIFFFTINYPPL---------AESSGGGRRRAL  291
            +RRV S KL++ASS LLFRAT++  L L+  FT++YP L         A ++  G+ RA 
Sbjct  27   VRRVASGKLLSASSHLLFRATILATLCLVCLFTVHYPSLLSHSFHLSSAAAAANGKHRAA  86

Query  292  HTTGH-SLL---AATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  459
              + H SLL   AA   GGAAWEK+V+ SA PRR  G+SVLVTGAAGFVG+HCSLAL+ R
Sbjct  87   SRSSHRSLLGSSAAVAYGGAAWEKEVRRSAAPRRDGGLSVLVTGAAGFVGAHCSLALRAR  146

Query  460  GDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLA  639
            GDGV+GLDNFN+YYDPSLKRARQ+LL    + +++ D+NDA LL +LFD   FTH+LHLA
Sbjct  147  GDGVVGLDNFNSYYDPSLKRARQRLLASRGVAVLDADINDAALLERLFDAARFTHVLHLA  206

Query  640  AQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            AQAGVRYAM+ P +YV+SN+AG V++ 
Sbjct  207  AQAGVRYAMRAPQTYVASNVAGLVSVF  233



>gb|EEC84839.1| hypothetical protein OsI_31939 [Oryza sativa Indica Group]
Length=498

 Score =   223 bits (568),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 130/235 (55%), Positives = 162/235 (69%), Gaps = 24/235 (10%)
 Frame = +1

Query  88   FPPDTS-KNSKLERYNS------YIRRVNsskliaasskllFRATLMVALILIFFFTINY  246
             P D + K  KLERY S       +RR  S K+++ASS LLFRAT++  + L+F FT +Y
Sbjct  1    MPADAAAKGMKLERYASSAGAMLLLRRAASGKVVSASSHLLFRATVLATMALVFLFTFHY  60

Query  247  PPLAESS--------GGGRRRALHTTGHSLL---------AATFSGGAAWEKQVQSSATP  375
            P L   S         G    A H +  SLL         AA+  GGAAWEK+V+ SA P
Sbjct  61   PSLLSRSFTLSSGAGAGEGGAAAHASHRSLLMSSSSASASAASVYGGAAWEKEVRRSAKP  120

Query  376  RRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIF  555
            R+  G++VLVTGAAGFVG+HCSLAL+ RGDGVLGLDNFNAYYDP LKRARQ+LL    + 
Sbjct  121  RKDGGIAVLVTGAAGFVGTHCSLALRARGDGVLGLDNFNAYYDPELKRARQRLLAGRGVL  180

Query  556  IVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            +++ D+NDA LL KLFD+VPFTH+LHLAAQAGVRYAM+ P +YV+SN+AG V +L
Sbjct  181  VLDADINDALLLEKLFDLVPFTHVLHLAAQAGVRYAMEAPQTYVASNVAGLVTVL  235



>ref|NP_001063595.1| Os09g0504000 [Oryza sativa Japonica Group]
 dbj|BAF25509.1| Os09g0504000 [Oryza sativa Japonica Group]
 gb|EEE70003.1| hypothetical protein OsJ_29922 [Oryza sativa Japonica Group]
Length=498

 Score =   223 bits (568),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 130/235 (55%), Positives = 162/235 (69%), Gaps = 24/235 (10%)
 Frame = +1

Query  88   FPPDTS-KNSKLERYNS------YIRRVNsskliaasskllFRATLMVALILIFFFTINY  246
             P D + K  KLERY S       +RR  S K+++ASS LLFRAT++  + L+F FT +Y
Sbjct  1    MPADAAAKGMKLERYASGAGAMLLLRRAASGKVVSASSHLLFRATVLATMALVFLFTFHY  60

Query  247  PPLAESS--------GGGRRRALHTTGHSLL---------AATFSGGAAWEKQVQSSATP  375
            P L   S         G    A H +  SLL         AA+  GGAAWEK+V+ SA P
Sbjct  61   PSLLSRSFTLSSGAGAGEGGAAAHASHRSLLMSSSSASASAASVYGGAAWEKEVRRSAKP  120

Query  376  RRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIF  555
            R+  G++VLVTGAAGFVG+HCSLAL+ RGDGVLGLDNFNAYYDP LKRARQ+LL    + 
Sbjct  121  RKDGGIAVLVTGAAGFVGTHCSLALRARGDGVLGLDNFNAYYDPELKRARQRLLAGRGVL  180

Query  556  IVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            +++ D+NDA LL KLFD+VPFTH+LHLAAQAGVRYAM+ P +YV+SN+AG V +L
Sbjct  181  VLDADINDALLLEKLFDLVPFTHVLHLAAQAGVRYAMEAPQTYVASNVAGLVTVL  235



>gb|EEC83914.1| hypothetical protein OsI_29969 [Oryza sativa Indica Group]
Length=565

 Score =   224 bits (570),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 119/208 (57%), Positives = 152/208 (73%), Gaps = 13/208 (6%)
 Frame = +1

Query  136  YIRRVNsskliaasskllFRATLMVALILIFFFTINYPPL---------AESSGGGRRRA  288
            YI R+    L++ASS LLFRAT++  L L+  FT++YP L         A ++  G+ RA
Sbjct  113  YIDRIGEKTLLSASSHLLFRATILATLCLVCLFTVHYPSLLSHSFHLSSAAAAANGKHRA  172

Query  289  LHTTGH-SLL---AATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKK  456
               + H SLL   AA   GGAAWEK+V+ SA PRR  G+SVLVTGAAGFVG+HCSLAL+ 
Sbjct  173  ASRSSHRSLLGSSAAVAYGGAAWEKEVRRSAAPRRDGGLSVLVTGAAGFVGAHCSLALRA  232

Query  457  RGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHL  636
            RGDGV+GLDNFN+YYDPSLKRARQ+LL    + +++ D+NDA LL +LFD   FTH+LHL
Sbjct  233  RGDGVVGLDNFNSYYDPSLKRARQRLLASRGVAVLDADINDAALLERLFDAARFTHVLHL  292

Query  637  AAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            AAQAGVRYAM+ P +YV+SN+AG V++ 
Sbjct  293  AAQAGVRYAMRAPQTYVASNVAGLVSVF  320



>ref|XP_002320057.1| UDP-D-GLUCURONATE 4-EPIMERASE 3 family protein [Populus trichocarpa]
 gb|EEE98372.1| UDP-D-GLUCURONATE 4-EPIMERASE 3 family protein [Populus trichocarpa]
Length=431

 Score =   218 bits (556),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 111/173 (64%), Positives = 135/173 (78%), Gaps = 11/173 (6%)
 Frame = +1

Query  202  LMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRR  381
            L +A+I +FF+    PP + +S   RR         L +AT+ GGAAWEK+V++SA  R 
Sbjct  40   LFIAVIFVFFY--RSPPSSSNSDLSRRY--------LTSATW-GGAAWEKRVRTSARIRS  88

Query  382  QNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIV  561
            +NG SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN YYDP+LKRARQ LLE+  +FIV
Sbjct  89   RNGFSVLVTGAAGFVGTHVSSALKRRGDGVLGLDNFNDYYDPTLKRARQALLERSGVFIV  148

Query  562  EGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            EGD+ND  LL KLF++VPFTH++HLAAQAGVRYAM+NP SYV SNIAG V+LL
Sbjct  149  EGDINDVSLLKKLFEVVPFTHVMHLAAQAGVRYAMKNPASYVHSNIAGFVSLL  201



>ref|XP_006396209.1| hypothetical protein EUTSA_v10028667mg [Eutrema salsugineum]
 gb|ESQ37662.1| hypothetical protein EUTSA_v10028667mg [Eutrema salsugineum]
Length=437

 Score =   219 bits (557),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 134/177 (76%), Gaps = 8/177 (5%)
 Frame = +1

Query  190  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  369
            F + + V LI IFF+    P     S    RR+L T  ++       GG AWEK+V+SSA
Sbjct  39   FWSLVFVGLIFIFFY--RSPSSNPVSSDPSRRSLRTYAYTW------GGPAWEKRVRSSA  90

Query  370  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  549
              R ++G+SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN YYDPSLKRARQ LLE+  
Sbjct  91   RVRTRHGISVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDPSLKRARQALLERSG  150

Query  550  IFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            +F+V+GD+NDA LL KLF++VPFTH++HLAAQAGVRYAM+NP SYV SNIAG VNLL
Sbjct  151  VFVVQGDINDAALLKKLFEVVPFTHVMHLAAQAGVRYAMENPSSYVHSNIAGFVNLL  207



>ref|NP_191922.1| UDP-D-glucuronate 4-epimerase 3 [Arabidopsis thaliana]
 sp|O81312.1|GAE3_ARATH RecName: Full=UDP-glucuronate 4-epimerase 3; AltName: Full=UDP-glucuronic 
acid epimerase 3 [Arabidopsis thaliana]
 gb|AAC19298.1| contains similarity to nucleotide sugar epimerases [Arabidopsis 
thaliana]
 emb|CAB80769.1| putative nucleotide sugar epimerase [Arabidopsis thaliana]
 gb|ABH04594.1| At4g00110 [Arabidopsis thaliana]
 gb|AEE81824.1| UDP-D-glucuronate 4-epimerase 3 [Arabidopsis thaliana]
Length=430

 Score =   218 bits (556),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 132/177 (75%), Gaps = 11/177 (6%)
 Frame = +1

Query  190  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  369
            F + + V LI IFF+     P++ +     RR+L T           GG AWEK+V+SSA
Sbjct  35   FWSLVFVGLIFIFFYR---SPVSSNPADPSRRSLRTYSW--------GGPAWEKRVRSSA  83

Query  370  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  549
              R + G SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN YYDPSLKRARQ LLE+  
Sbjct  84   RLRTRRGFSVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDPSLKRARQALLERSG  143

Query  550  IFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            +F+VEGD+NDA LL KLF++VPFTH++HLAAQAGVRYAM+NP SYV SNIAG VNLL
Sbjct  144  VFVVEGDINDAALLKKLFEVVPFTHVMHLAAQAGVRYAMENPSSYVHSNIAGFVNLL  200



>gb|KFK30589.1| hypothetical protein AALP_AA6G001300 [Arabis alpina]
Length=432

 Score =   217 bits (553),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 112/177 (63%), Positives = 132/177 (75%), Gaps = 10/177 (6%)
 Frame = +1

Query  190  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  369
            F + + V LI IFF+    P     S    RR+L T           GG AWEK+V+SSA
Sbjct  36   FWSLVFVGLIFIFFY--RSPSSNPVSSDPSRRSLRTYSW--------GGPAWEKRVRSSA  85

Query  370  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  549
              R ++G+SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN YYDPSLKRARQ LLE+  
Sbjct  86   RVRTRHGVSVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDPSLKRARQALLERSG  145

Query  550  IFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            +F+VEGD+NDA LL KLF++VPFTH++HLAAQAGVRYAM+NP SYV SNIAG VNLL
Sbjct  146  VFVVEGDINDAALLKKLFEVVPFTHVMHLAAQAGVRYAMENPSSYVHSNIAGFVNLL  202



>ref|XP_009397005.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Musa acuminata 
subsp. malaccensis]
Length=451

 Score =   216 bits (551),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 110/173 (64%), Positives = 130/173 (75%), Gaps = 9/173 (5%)
 Frame = +1

Query  202  LMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRR  381
            L +AL++ FFF     P + S+ G R         SL  A   GG AWEK V+SSA  RR
Sbjct  49   LAIALLVAFFFLSPTTPNSSSTSGRR---------SLRNAAPWGGPAWEKCVRSSARVRR  99

Query  382  QNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIV  561
              G+SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN YYDPSLKRARQ LL++  +F+V
Sbjct  100  SGGISVLVTGAAGFVGTHVSTALKRRGDGVLGLDNFNDYYDPSLKRARQALLDRAGVFVV  159

Query  562  EGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            EGD+ND PLL KLFD+VPFTH++HLAAQAGVRYAM NP SYV SN+AG V++L
Sbjct  160  EGDVNDGPLLHKLFDVVPFTHVMHLAAQAGVRYAMTNPSSYVHSNVAGLVSVL  212



>gb|EAZ43405.1| hypothetical protein OsJ_28010 [Oryza sativa Japonica Group]
Length=623

 Score =   220 bits (561),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 140/190 (74%), Gaps = 13/190 (7%)
 Frame = +1

Query  190  FRATLMVALILIFFFTINYPPL---------AESSGGGRRRALHTTGH-SLL---AATFS  330
            FRAT++  L L+  FT++YP L         A ++  G+ RA   + H SLL   AA   
Sbjct  189  FRATILATLCLVCLFTVHYPSLLSHSFHLSSAAAAANGKHRAASRSSHRSLLGSSAAVAY  248

Query  331  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  510
            GGAAWEK+V+ SA PRR  G+SVLVTGAAGFVG+HCSLAL+ RGDGV+GLDNFN+YYDPS
Sbjct  249  GGAAWEKEVRRSAAPRRDGGLSVLVTGAAGFVGAHCSLALRARGDGVVGLDNFNSYYDPS  308

Query  511  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVS  690
            LKRARQ+LL    + +++ D+NDA LL +LFD   FTH+LHLAAQAGVRYAM+ P +YV+
Sbjct  309  LKRARQRLLASRGVAVLDADINDAALLERLFDAARFTHVLHLAAQAGVRYAMRAPQTYVA  368

Query  691  SNIAGXVNLL  720
            SN+AG V++ 
Sbjct  369  SNVAGLVSVF  378



>ref|XP_009591830.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nicotiana tomentosiformis]
 ref|XP_009591831.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nicotiana tomentosiformis]
 ref|XP_009802117.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nicotiana sylvestris]
Length=435

 Score =   216 bits (549),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 135/177 (76%), Gaps = 9/177 (5%)
 Frame = +1

Query  190  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  369
            F + + + LI +FF+       +  S    RR+L T+ +        GG AWEK++++SA
Sbjct  38   FWSFVFLGLIFVFFYRSPAS-SSPVSSDLSRRSLRTSSY--------GGPAWEKRIKASA  88

Query  370  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  549
              R +NG+SVLVTGAAGFVG+H S+ALK+RGDGVLGLDNFN YYDPSLKRARQ LLE+  
Sbjct  89   KVRSRNGISVLVTGAAGFVGTHVSVALKRRGDGVLGLDNFNDYYDPSLKRARQALLERTG  148

Query  550  IFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            ++IVEGD+NDA LL KLFDIVPFTH++HLAAQAGVRYAM+NP SYV SNIAG VN+L
Sbjct  149  VYIVEGDINDATLLKKLFDIVPFTHVMHLAAQAGVRYAMENPGSYVHSNIAGLVNVL  205



>ref|XP_002872971.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49230.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis lyrata subsp. lyrata]
Length=429

 Score =   215 bits (548),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 112/177 (63%), Positives = 130/177 (73%), Gaps = 12/177 (7%)
 Frame = +1

Query  190  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  369
            F + + V LI IFF    Y     S+    RR+L T           GG AWEK+V+SSA
Sbjct  35   FWSLVFVGLIFIFF----YRSPVSSNPDPSRRSLRTYSW--------GGPAWEKRVRSSA  82

Query  370  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  549
              R + G SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN YYDPSLKRARQ LLE+  
Sbjct  83   RVRTRRGFSVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDPSLKRARQALLERSG  142

Query  550  IFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            +F+VEGD+NDA LL KLF++VPFTH++HLAAQAGVRYAM+NP SYV SNIAG VNLL
Sbjct  143  VFVVEGDINDAALLKKLFEVVPFTHVMHLAAQAGVRYAMENPSSYVHSNIAGFVNLL  199



>ref|XP_008351675.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Malus domestica]
Length=438

 Score =   215 bits (548),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 133/177 (75%), Gaps = 10/177 (6%)
 Frame = +1

Query  190  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  369
            F + + + LILIFFF    P    S     RR+L T           GG AWEK+V+SSA
Sbjct  42   FWSFVFLGLILIFFFHSPSPNSLPSDPS--RRSLRTYNW--------GGXAWEKRVRSSA  91

Query  370  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  549
              R ++G+SVLVTGAAGFVG+H S ALK+RGDGVLGLD FN YYDPSLKRARQ LLE+  
Sbjct  92   KVRSRHGISVLVTGAAGFVGTHVSAALKRRGDGVLGLDCFNDYYDPSLKRARQALLERSG  151

Query  550  IFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            +FIVEGD+NDAPLLSKLF++V FTH++HLAAQAGVRYAM+NP SYV SNIAG VNLL
Sbjct  152  VFIVEGDINDAPLLSKLFEVVAFTHVMHLAAQAGVRYAMENPGSYVHSNIAGLVNLL  208



>dbj|BAJ86203.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=490

 Score =   216 bits (551),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 122/216 (56%), Positives = 154/216 (71%), Gaps = 10/216 (5%)
 Frame = +1

Query  103  SKNSKLERYNS-----YIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESS  267
            +K  KLERY S      +RR  SSK++AASS LLFRAT++  L L+  F ++YP L   S
Sbjct  18   AKGVKLERYASGGGALLMRRAGSSKIVAASSHLLFRATVLATLALVCLFAVHYPTLLSRS  77

Query  268  ---GGGRRRALHTTGHSLLAATFSG--GAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGS  432
                        T+ H  L  + S   GAAWE++V+ SATPRR  GMSVLVTGAAGFVG+
Sbjct  78   FRLSAASSPPRPTSRHRNLLGSSSAYAGAAWEREVRRSATPRRDGGMSVLVTGAAGFVGA  137

Query  433  HCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIV  612
            HC+LAL+ RGDGVLGLDNFNAYY+P+LKRARQ+LL    + ++  D+NDA LL +LF  V
Sbjct  138  HCALALRARGDGVLGLDNFNAYYEPALKRARQRLLASRGVVVLGADINDAALLERLFAAV  197

Query  613  PFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            PFTH+LHLAAQAGVRYAM+ P +YV+SN+AG V++ 
Sbjct  198  PFTHVLHLAAQAGVRYAMRAPQAYVASNVAGLVSVF  233



>ref|XP_003605138.1| UDP-glucuronate 4-epimerase [Medicago truncatula]
 gb|AES87335.1| UDP-D-glucuronate 4-epimerase [Medicago truncatula]
Length=440

 Score =   215 bits (547),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 120/209 (57%), Positives = 141/209 (67%), Gaps = 13/209 (6%)
 Frame = +1

Query  94   PDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGG  273
            P T    K+E+  SY  RV      A      F   +  A ILIFFF    P  +     
Sbjct  15   PSTPGKFKMEK-ASYFNRVRWHASPAKLCLWSF---VFSAAILIFFF--RSPASSPLPAD  68

Query  274  GRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALK  453
              RR+L +  +        GG  WEK+V+SSA  R +NG SVLVTGAAGFVG+H S ALK
Sbjct  69   PSRRSLRSPSNW-------GGPVWEKRVRSSARVRSRNGFSVLVTGAAGFVGTHVSAALK  121

Query  454  KRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILH  633
            +RGDGVLG+DNFN YYDPSLKRARQ LLE+  +FIVEGD+NDA LL KLF++VPFTH++H
Sbjct  122  RRGDGVLGIDNFNDYYDPSLKRARQALLERTGVFIVEGDINDAALLRKLFEVVPFTHVMH  181

Query  634  LAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            LAAQAGVRYAM+NP SYV SNIAG VNLL
Sbjct  182  LAAQAGVRYAMENPGSYVHSNIAGFVNLL  210



>ref|XP_004229804.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Solanum lycopersicum]
Length=435

 Score =   215 bits (547),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 135/177 (76%), Gaps = 9/177 (5%)
 Frame = +1

Query  190  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  369
            F + + + LI +FF+       +  S    RR+L T+ +        GG AWEK++++SA
Sbjct  38   FWSFVFLGLIFVFFYRSPAS-SSPVSSDLSRRSLRTSSY--------GGPAWEKRIKASA  88

Query  370  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  549
              R +NG+SVLVTGAAGFVG+H S+ALK+RGDGVLGLDNFN YYDPSLKRARQ LLE+  
Sbjct  89   KVRSRNGISVLVTGAAGFVGTHVSVALKRRGDGVLGLDNFNDYYDPSLKRARQALLERTG  148

Query  550  IFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            +++VEGD+NDA LL KLFDIVPFTH++HLAAQAGVRYAM+NP SYV SNIAG VN+L
Sbjct  149  VYVVEGDINDATLLKKLFDIVPFTHVMHLAAQAGVRYAMENPGSYVHSNIAGLVNVL  205



>ref|XP_002301280.2| hypothetical protein POPTR_0002s14750g [Populus trichocarpa]
 gb|EEE80553.2| hypothetical protein POPTR_0002s14750g [Populus trichocarpa]
Length=435

 Score =   215 bits (547),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 129/175 (74%), Gaps = 7/175 (4%)
 Frame = +1

Query  196  ATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATP  375
            ++L VALI +FF+                R         LA+   GGAAWEK+V++SA  
Sbjct  38   SSLFVALIFLFFYRSPSSSSNNPPSSDPSR-------RYLASANWGGAAWEKRVRTSARI  90

Query  376  RRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIF  555
            R +NG SVLVTGAAGFVG+H S ALK+RGDGVLG+DNFN YYDP+LKRARQ LLE+  +F
Sbjct  91   RSRNGFSVLVTGAAGFVGTHVSSALKRRGDGVLGIDNFNDYYDPTLKRARQALLERSGVF  150

Query  556  IVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            IVEGD+ND  LL KLFDIVPFTH++HLAAQAGVRYAMQNP SYV SNIAG V+LL
Sbjct  151  IVEGDINDVALLKKLFDIVPFTHVMHLAAQAGVRYAMQNPGSYVHSNIAGFVSLL  205



>ref|XP_004506538.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Cicer arietinum]
Length=440

 Score =   215 bits (547),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 120/209 (57%), Positives = 141/209 (67%), Gaps = 13/209 (6%)
 Frame = +1

Query  94   PDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGG  273
            P T    K+E+  SY  RV      A      F   +  A ILIFFF    P  +     
Sbjct  15   PSTPGKFKMEK-ASYFNRVRWHASPAKLILWSF---VFSAAILIFFF--RSPATSPLPAD  68

Query  274  GRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALK  453
              RR+L +  +        GG  WEK+V+SSA  R +NG+SVLVTGAAGFVG+H S ALK
Sbjct  69   PSRRSLRSPSNW-------GGPIWEKRVRSSARVRSRNGLSVLVTGAAGFVGTHVSAALK  121

Query  454  KRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILH  633
            +RGDGVLG+DNFN YYDPSLKRARQ LLE+  IFIVEGD+ND  LL KLF++VPFTH++H
Sbjct  122  RRGDGVLGIDNFNDYYDPSLKRARQALLERTGIFIVEGDINDGALLRKLFEVVPFTHVMH  181

Query  634  LAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            LAAQAGVRYAM+NP SYV SNIAG VNLL
Sbjct  182  LAAQAGVRYAMENPGSYVHSNIAGFVNLL  210



>ref|XP_008364369.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Malus domestica]
Length=438

 Score =   214 bits (546),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 113/177 (64%), Positives = 132/177 (75%), Gaps = 10/177 (6%)
 Frame = +1

Query  190  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  369
            F + + + LILIFFF    P          RR+L T           GG AWEK+V+SSA
Sbjct  42   FWSFVFLGLILIFFF--RSPSSNSLPSDPXRRSLRTYNW--------GGPAWEKRVRSSA  91

Query  370  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  549
              R ++G+SVLVTGAAGFVG+H S ALK+RGDGVLGLD FN YYDPSLKRARQ LLE+  
Sbjct  92   KVRSRHGISVLVTGAAGFVGTHVSAALKRRGDGVLGLDCFNDYYDPSLKRARQALLERSG  151

Query  550  IFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            +FIVEGD+NDAPLLSKLF++V FTH++HLAAQAGVRYAM+NP SYV SNIAG VNLL
Sbjct  152  VFIVEGDINDAPLLSKLFEVVAFTHVMHLAAQAGVRYAMENPGSYVHSNIAGLVNLL  208



>gb|ABR16292.1| unknown [Picea sitchensis]
Length=437

 Score =   214 bits (545),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 119/209 (57%), Positives = 144/209 (69%), Gaps = 16/209 (8%)
 Frame = +1

Query  94   PDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGG  273
            P T    K+ER N Y  R  S++  ++ +KL F   ++V LI+IFF       +  SS  
Sbjct  14   PSTPGKVKMERSNIYFGR-GSTRWQSSVAKLFFWTVVVVGLIVIFF-------MRSSSPV  65

Query  274  GRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALK  453
              RR        LL+    GG  WEK+V+ S   + + G+ VLVTGAAGFVGSH SLALK
Sbjct  66   ETRR--------LLSTPHWGGHDWEKRVRYSCRVKTEKGIVVLVTGAAGFVGSHVSLALK  117

Query  454  KRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILH  633
            +RGDGVLGLDNFN YYD SLKRARQ LL+K  +F+VEGD+NDAPLL KLFD+VPFTH++H
Sbjct  118  RRGDGVLGLDNFNDYYDQSLKRARQGLLDKQGVFVVEGDINDAPLLKKLFDVVPFTHVMH  177

Query  634  LAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            LAAQAGVRYAMQNP SYV SNIAG V + 
Sbjct  178  LAAQAGVRYAMQNPNSYVHSNIAGLVTIF  206



>ref|XP_009342752.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Pyrus x bretschneideri]
Length=438

 Score =   214 bits (545),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 113/177 (64%), Positives = 133/177 (75%), Gaps = 10/177 (6%)
 Frame = +1

Query  190  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  369
            F + + + LILIFFF    P    S     RR+L T           GG AWEK+V+SSA
Sbjct  42   FWSFVFLGLILIFFFHSPSPNSLPSDPS--RRSLRTYNW--------GGPAWEKRVRSSA  91

Query  370  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  549
              R ++G+SVLVTGAAGFVG+H S ALK+RGDGVLGLD FN YYDPSLKRARQ LLE+  
Sbjct  92   KVRSRHGISVLVTGAAGFVGTHVSAALKRRGDGVLGLDCFNDYYDPSLKRARQALLERSG  151

Query  550  IFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            +FIVEGD+NDAPLLSKLF++V FTH++HLAAQAGVRYAM+NP SYV SNIAG VN+L
Sbjct  152  VFIVEGDINDAPLLSKLFEVVAFTHVMHLAAQAGVRYAMENPGSYVHSNIAGLVNVL  208



>ref|XP_006287814.1| hypothetical protein CARUB_v10001027mg [Capsella rubella]
 gb|EOA20712.1| hypothetical protein CARUB_v10001027mg [Capsella rubella]
Length=426

 Score =   213 bits (543),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 112/177 (63%), Positives = 130/177 (73%), Gaps = 12/177 (7%)
 Frame = +1

Query  190  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  369
            F + + V LI IFF    Y     S+    RR+L T           GG AWEK+V+SSA
Sbjct  32   FWSLVFVGLIFIFF----YRSPVSSNPDPSRRSLRTYSW--------GGPAWEKRVRSSA  79

Query  370  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  549
              R + G SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN YYDPSLKRARQ LLE+  
Sbjct  80   RLRFRRGFSVLVTGAAGFVGTHVSSALKRRGDGVLGLDNFNDYYDPSLKRARQALLERSG  139

Query  550  IFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            +F+VEGD+NDA LL KLF++VPFTH++HLAAQAGVRYAM+NP SYV SNIAG VNLL
Sbjct  140  VFVVEGDINDAALLKKLFEVVPFTHVMHLAAQAGVRYAMENPSSYVHSNIAGFVNLL  196



>ref|XP_004957272.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Setaria italica]
Length=488

 Score =   214 bits (546),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 121/228 (53%), Positives = 154/228 (68%), Gaps = 29/228 (13%)
 Frame = +1

Query  103  SKNSKLERYNS----YIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSG  270
            +K  KLERY S     +RR  S+K+++ASS LLFRAT++  L L+F FT++YP L     
Sbjct  13   AKGMKLERYASGGALMLRRATSAKIVSASSHLLFRATVLATLALVFLFTLHYPSLLF---  69

Query  271  GGRRRALHTTG--------HSLLAATFS----------GGAAWEKQVQSSATPRRQNGMS  396
                R+ H +         HS    +            GGAAWEK+++ SA P R  G+S
Sbjct  70   ----RSFHLSAGGGGPGGAHSASHRSLLMSSSSTSASYGGAAWEKEMRQSARPSRDGGIS  125

Query  397  VLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLN  576
            VLVTGAAGFVG+HCSLALK RGDGV+GLDNFN+YYDPSLKRARQ LL    + +V+ D+N
Sbjct  126  VLVTGAAGFVGTHCSLALKARGDGVVGLDNFNSYYDPSLKRARQALLASRGVAVVDADIN  185

Query  577  DAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            D  LL KLFD+  FTH+LHLAAQAGVRYAM+ P +YV+SN+AG V++ 
Sbjct  186  DGLLLEKLFDVAAFTHVLHLAAQAGVRYAMEAPQTYVASNVAGLVSVF  233



>ref|XP_010523080.1| PREDICTED: UDP-glucuronate 4-epimerase 3 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010523081.1| PREDICTED: UDP-glucuronate 4-epimerase 3 isoform X2 [Tarenaya 
hassleriana]
Length=435

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 129/177 (73%), Gaps = 10/177 (6%)
 Frame = +1

Query  190  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  369
            F + +   LI IFF+    P     S    RR+L T           GG  WEK+V+SSA
Sbjct  39   FWSLVFTGLIFIFFY--RSPSSNPISSAPSRRSLRTYSW--------GGPDWEKRVRSSA  88

Query  370  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  549
              R +NG+SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN YYDPSLKR RQ LLE+  
Sbjct  89   RVRTRNGISVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDPSLKRTRQALLERSG  148

Query  550  IFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            +FIVEGD+ND+ LL K+F++VPFTH++HLAAQAGVRYAM+NP SYV SNIAG VNLL
Sbjct  149  VFIVEGDINDSALLKKIFEVVPFTHVMHLAAQAGVRYAMENPSSYVHSNIAGFVNLL  205



>ref|XP_009399578.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Musa acuminata subsp. 
malaccensis]
Length=439

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = +1

Query  331  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  510
            GG  WEKQ+++SATPRR  G+SVLVTGAAGFVG+H SLAL+KRGDGV+GLDNFN+YYDPS
Sbjct  71   GGMHWEKQIRASATPRRPGGVSVLVTGAAGFVGTHVSLALRKRGDGVVGLDNFNSYYDPS  130

Query  511  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVS  690
            LK+AR+ LL  H +F+VEGD+NDA LL+KLFD+VPFTH++HLAAQAGVRYA++NP SYV 
Sbjct  131  LKKARKALLTSHGVFVVEGDINDARLLAKLFDVVPFTHVMHLAAQAGVRYAIENPASYVH  190

Query  691  SNIAGXVNLL  720
            SNIAG V LL
Sbjct  191  SNIAGLVTLL  200



>ref|XP_007052086.1| UDP-D-glucuronate 4-epimerase 3 [Theobroma cacao]
 gb|EOX96243.1| UDP-D-glucuronate 4-epimerase 3 [Theobroma cacao]
Length=437

 Score =   213 bits (541),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 135/178 (76%), Gaps = 12/178 (7%)
 Frame = +1

Query  190  FRATLMVALILIFFF-TINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSS  366
            F + + + LILIFFF + +  PL +      RR+L T           GG AWEK+V+SS
Sbjct  41   FWSFIFLGLILIFFFRSPSSNPLPQDPS---RRSLRTYNW--------GGPAWEKRVRSS  89

Query  367  ATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKH  546
            A  R +NG+SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN YYDPSLKRARQ LLE+ 
Sbjct  90   ARVRSRNGISVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDPSLKRARQALLERT  149

Query  547  QIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
             +FIVEGD+ND+ LL KLF++V FTH++HLAAQAGVRYAM+NP SYV SNIAG V+LL
Sbjct  150  GVFIVEGDINDSALLRKLFEVVAFTHVMHLAAQAGVRYAMENPGSYVHSNIAGLVSLL  207



>ref|XP_009417460.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Musa acuminata subsp. 
malaccensis]
Length=444

 Score =   213 bits (541),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = +1

Query  331  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  510
            GG  WEKQ+++SAT RR  GMSVLVTGAAGFVG+H SLAL+KRGDGV+GLDNFN+YYDPS
Sbjct  72   GGMHWEKQIRASATVRRPGGMSVLVTGAAGFVGTHVSLALRKRGDGVVGLDNFNSYYDPS  131

Query  511  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVS  690
            LK+AR+ LLE H +F+VEGD++DA LL+KLFD+VPFTH++HLAAQAGVRYA++NP SYV 
Sbjct  132  LKKAREALLESHGVFVVEGDIDDARLLAKLFDVVPFTHVMHLAAQAGVRYAIENPASYVH  191

Query  691  SNIAGXVNLL  720
            SNIAG V LL
Sbjct  192  SNIAGLVTLL  201



>ref|XP_003519171.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Glycine max]
Length=431

 Score =   212 bits (540),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 120/141 (85%), Gaps = 1/141 (1%)
 Frame = +1

Query  298  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  477
            +G   L+A++ GG  WEKQV++SA   RQ GMSVLVTGAAGFVGSH SLALK+RGDGV+G
Sbjct  61   SGSRYLSASW-GGIQWEKQVRTSAQIHRQGGMSVLVTGAAGFVGSHVSLALKRRGDGVVG  119

Query  478  LDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVR  657
            LDNFN YYDPSLK+AR+ LL KH +FIV+GDLNDA LL+KLFD+V FTH++HLAAQAGVR
Sbjct  120  LDNFNDYYDPSLKKARKSLLAKHDVFIVDGDLNDAKLLAKLFDVVAFTHVMHLAAQAGVR  179

Query  658  YAMQNPLSYVSSNIAGXVNLL  720
            YAM+NP SYV SNIAG V LL
Sbjct  180  YAMENPHSYVHSNIAGLVTLL  200



>gb|KJB41101.1| hypothetical protein B456_007G090500 [Gossypium raimondii]
Length=437

 Score =   213 bits (541),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 134/178 (75%), Gaps = 12/178 (7%)
 Frame = +1

Query  190  FRATLMVALILIFFF-TINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSS  366
            F + + + LILIFFF + +  PL +      RR+L T           GG AWEK+V+SS
Sbjct  41   FWSFIFLGLILIFFFRSPSSNPLPQDPS---RRSLRTYNW--------GGPAWEKRVRSS  89

Query  367  ATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKH  546
            A  R  NG+SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN YYDPSLKRARQ LLE+ 
Sbjct  90   ARVRSHNGISVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDPSLKRARQALLERS  149

Query  547  QIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
             +FIVEGD+ND+ LL KLF++V FTH++HLAAQAGVRYAM+NP SYV SNIAG V+LL
Sbjct  150  GVFIVEGDINDSALLRKLFEVVAFTHVMHLAAQAGVRYAMENPGSYVHSNIAGLVSLL  207



>ref|NP_001142515.1| hypothetical protein [Zea mays]
 gb|ACG24575.1| hypothetical protein [Zea mays]
 gb|ACN27084.1| unknown [Zea mays]
 gb|AFW73831.1| hypothetical protein ZEAMMB73_770166 [Zea mays]
Length=439

 Score =   212 bits (540),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 121/147 (82%), Gaps = 7/147 (5%)
 Frame = +1

Query  298  TGHSLLAATFSGGAAWEKQVQSSATPRRQ------NGMSVLVTGAAGFVGSHCSLALKKR  459
            T    LAA++ GG  WE+Q+++SA PRR        GMSVLVTGAAGFVG+HCSLAL+KR
Sbjct  61   TSSKYLAASW-GGLHWERQIRASAAPRRPPGSAAGAGMSVLVTGAAGFVGTHCSLALRKR  119

Query  460  GDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLA  639
            GDGV+G+DNFNAYYDPSLK+AR+ LL  H +FIVEGD+ND  LL+KLFD+VPFTH+LHLA
Sbjct  120  GDGVVGVDNFNAYYDPSLKKARRALLASHGVFIVEGDINDGRLLAKLFDVVPFTHVLHLA  179

Query  640  AQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            AQAGVRYAMQNP SYV SNIAG V LL
Sbjct  180  AQAGVRYAMQNPASYVHSNIAGLVTLL  206



>ref|XP_007218024.1| hypothetical protein PRUPE_ppa005953mg [Prunus persica]
 ref|XP_008232642.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Prunus mume]
 gb|EMJ19223.1| hypothetical protein PRUPE_ppa005953mg [Prunus persica]
Length=435

 Score =   212 bits (540),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 112/177 (63%), Positives = 131/177 (74%), Gaps = 10/177 (6%)
 Frame = +1

Query  190  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  369
            F + + + LILIFFF    P          RR+L T           GG AWEK+V+SSA
Sbjct  39   FWSFIFLGLILIFFF--RSPSSNSLPSDPSRRSLRTYNW--------GGPAWEKRVRSSA  88

Query  370  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  549
              R ++GMSVLVTGAAGFVG+H S ALK+RGDGVLGLD FN YYDPSLKRARQ LLE+  
Sbjct  89   RVRSRHGMSVLVTGAAGFVGTHVSAALKRRGDGVLGLDCFNDYYDPSLKRARQALLERSG  148

Query  550  IFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            +FIVEGD+ND+ LLSKLF++V FTH++HLAAQAGVRYAM+NP SYV SNIAG VNLL
Sbjct  149  VFIVEGDINDSALLSKLFEVVAFTHVMHLAAQAGVRYAMENPGSYVHSNIAGLVNLL  205



>ref|XP_010424029.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like, partial [Camelina 
sativa]
Length=256

 Score =   207 bits (526),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 132/177 (75%), Gaps = 10/177 (6%)
 Frame = +1

Query  190  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  369
            F + + V LI IFF+    P +++      RR+L T           GG AWEK+V+SSA
Sbjct  32   FWSLVFVGLIFIFFY--RSPLVSDDPTSTSRRSLRTYSW--------GGPAWEKRVRSSA  81

Query  370  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  549
              R + G SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN YYDPSLKRARQ LLE+  
Sbjct  82   RLRSRRGFSVLVTGAAGFVGTHVSSALKRRGDGVLGLDNFNDYYDPSLKRARQALLERSG  141

Query  550  IFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            +F+VEGD+NDA LL KLF++VPFTH++HLAAQAGVRYAM+NP SYV SNIAG VNLL
Sbjct  142  VFVVEGDINDAALLKKLFEVVPFTHVMHLAAQAGVRYAMENPSSYVHSNIAGFVNLL  198



>ref|XP_011017483.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Populus euphratica]
Length=435

 Score =   212 bits (540),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 102/136 (75%), Positives = 117/136 (86%), Gaps = 0/136 (0%)
 Frame = +1

Query  313  LAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN  492
            LA+   GGAAWEK+V++SA  R +NG SVLVTGAAGFVG+H S ALK+RGDGVLG+DNFN
Sbjct  70   LASATWGGAAWEKRVRTSARIRSRNGFSVLVTGAAGFVGTHVSSALKRRGDGVLGIDNFN  129

Query  493  AYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQN  672
             YYDP+LKRARQ LLE+  +FIVEGD+ND  LL KLFDIVPFTH++HLAAQAGVRYAMQN
Sbjct  130  DYYDPTLKRARQALLERGGVFIVEGDINDVALLKKLFDIVPFTHVMHLAAQAGVRYAMQN  189

Query  673  PLSYVSSNIAGXVNLL  720
            P SYV SNIAG V+LL
Sbjct  190  PGSYVHSNIAGFVSLL  205



>ref|XP_007154841.1| hypothetical protein PHAVU_003G152300g [Phaseolus vulgaris]
 gb|ESW26835.1| hypothetical protein PHAVU_003G152300g [Phaseolus vulgaris]
Length=431

 Score =   212 bits (539),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 120/141 (85%), Gaps = 1/141 (1%)
 Frame = +1

Query  298  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  477
            +G   L+A++ GG  WEKQV++SA   RQ GMSVLVTGAAGFVGSH SLALK+RGDGV+G
Sbjct  61   SGSRYLSASW-GGIQWEKQVRTSAQIHRQGGMSVLVTGAAGFVGSHVSLALKRRGDGVVG  119

Query  478  LDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVR  657
            LDNFN YYDPSLK+AR+ LL  H++FIVEGD+NDA LL+KLFD+V FTH++HLAAQAGVR
Sbjct  120  LDNFNDYYDPSLKKARKSLLNTHEVFIVEGDVNDAKLLAKLFDVVAFTHVMHLAAQAGVR  179

Query  658  YAMQNPLSYVSSNIAGXVNLL  720
            YAM+NP SYV SNIAG V LL
Sbjct  180  YAMENPQSYVHSNIAGLVTLL  200



>emb|CDX86716.1| BnaA09g21060D [Brassica napus]
Length=434

 Score =   212 bits (539),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 124/147 (84%), Gaps = 2/147 (1%)
 Frame = +1

Query  280  RRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  459
            RR+L+ +  SL +A   GG+ WEKQV+ SA PR + G++VLVTGAAGFVG+H S+AL++R
Sbjct  61   RRSLNDS--SLSSAAKYGGSQWEKQVRKSAHPRSRGGLTVLVTGAAGFVGTHVSIALRRR  118

Query  460  GDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLA  639
            GDGVLGLDNFN YYDP LKRARQ LLE+  +F+VEGD+NDA LL KL+D+V FTH++HLA
Sbjct  119  GDGVLGLDNFNRYYDPKLKRARQGLLERSGVFVVEGDINDAVLLKKLYDVVLFTHVMHLA  178

Query  640  AQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            AQAGVRYAMQNP SYVSSNIAG VNLL
Sbjct  179  AQAGVRYAMQNPGSYVSSNIAGFVNLL  205



>ref|XP_006286788.1| hypothetical protein CARUB_v10003353mg [Capsella rubella]
 gb|EOA19686.1| hypothetical protein CARUB_v10003353mg [Capsella rubella]
Length=438

 Score =   212 bits (539),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 105/158 (66%), Positives = 127/158 (80%), Gaps = 6/158 (4%)
 Frame = +1

Query  247  PPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFV  426
            PP + S     RR L+ +  S+ AA + GG+ WEKQV+ SA PR   G++VLVTGA+GFV
Sbjct  55   PPPSPS-----RRNLNDSSSSVSAAKY-GGSHWEKQVRKSARPRTHGGLTVLVTGASGFV  108

Query  427  GSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFD  606
            G+H S+AL++RGDGVLGLDNFN YYDP LKRARQ LLE+  +F+VEGD+NDA LL KLFD
Sbjct  109  GTHVSIALRRRGDGVLGLDNFNRYYDPKLKRARQGLLERSGVFVVEGDINDAVLLKKLFD  168

Query  607  IVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            +V FTH++HLAAQAGVRYAMQNP SYV+SNIAG VNLL
Sbjct  169  VVLFTHVMHLAAQAGVRYAMQNPGSYVNSNIAGFVNLL  206



>ref|XP_006347877.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum tuberosum]
Length=435

 Score =   211 bits (538),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = +1

Query  331  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  510
            GG AWEK++++SA  R +NG+SVLVTGAAGFVG+H S+ALK+RGDGVLGLDNFN YYDPS
Sbjct  76   GGPAWEKRIKASAKVRSRNGISVLVTGAAGFVGTHVSVALKRRGDGVLGLDNFNDYYDPS  135

Query  511  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVS  690
            LKRARQ LLE+  +++VEGD+NDA LL KLFDIVPFTH++HLAAQAGVRYAM+NP SYV 
Sbjct  136  LKRARQALLERTGVYVVEGDINDATLLKKLFDIVPFTHVMHLAAQAGVRYAMENPGSYVH  195

Query  691  SNIAGXVNLL  720
            SNIAG VN+L
Sbjct  196  SNIAGLVNVL  205



>ref|XP_004513504.1| PREDICTED: UDP-glucuronate 4-epimerase 2-like [Cicer arietinum]
Length=426

 Score =   211 bits (537),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 132/177 (75%), Gaps = 12/177 (7%)
 Frame = +1

Query  190  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  369
            F + L V +I   FF     P + SS   RR +L T  +        GG+AWEK+V+SSA
Sbjct  33   FWSILFVGIIFFLFFRT---PSSFSSDTSRR-SLRTYNY--------GGSAWEKKVRSSA  80

Query  370  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  549
                +NG++VLVTGAAGFVG+H S+ALK+RGDGVLGLDNFN YYDPSLKR RQ LLE + 
Sbjct  81   RVTSKNGVTVLVTGAAGFVGTHTSIALKQRGDGVLGLDNFNDYYDPSLKRGRQALLEHNG  140

Query  550  IFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            +FIVEGD+NDA LL KLF++V FTH++HLAAQAGVRYAM+NP SYV SNIAG VNLL
Sbjct  141  VFIVEGDINDATLLKKLFEVVSFTHVMHLAAQAGVRYAMENPGSYVHSNIAGFVNLL  197



>ref|XP_006445275.1| hypothetical protein CICLE_v10020187mg [Citrus clementina]
 ref|XP_006490911.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Citrus sinensis]
 gb|ESR58515.1| hypothetical protein CICLE_v10020187mg [Citrus clementina]
 gb|KDO85806.1| hypothetical protein CISIN_1g013602mg [Citrus sinensis]
Length=439

 Score =   211 bits (538),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 136/180 (76%), Gaps = 15/180 (8%)
 Frame = +1

Query  190  FRATLMVALILIFFF---TINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQ  360
            F + + +A+ILIFFF   + N  P A+ S    RR+L T           GG A+EK+V+
Sbjct  42   FWSFIFLAVILIFFFRSPSSNPLPSADPS----RRSLRTYDW--------GGPAFEKRVR  89

Query  361  SSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLE  540
            SSA  R +NG+SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN YYDPSLK+ARQ LLE
Sbjct  90   SSARVRARNGISVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDPSLKKARQALLE  149

Query  541  KHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            +  IFIVEGD+ND  LL KLFD+V FTH++HLAAQAGVRYAMQNP SYV SNIAG V+LL
Sbjct  150  RSGIFIVEGDINDMALLKKLFDVVSFTHVMHLAAQAGVRYAMQNPNSYVHSNIAGLVSLL  209



>emb|CDX94504.1| BnaC09g23320D [Brassica napus]
Length=435

 Score =   211 bits (538),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 125/147 (85%), Gaps = 3/147 (2%)
 Frame = +1

Query  280  RRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  459
            RR+L+ +  SL AA + GG+ WEKQV+ SA PR + G++VLVTGAAGFVG+H S+AL++R
Sbjct  61   RRSLNDS--SLSAAKY-GGSQWEKQVRKSAHPRSRGGLTVLVTGAAGFVGTHVSIALRRR  117

Query  460  GDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLA  639
            GDGVLGLDNFN YYDP LKRARQ LLE+  +F+VEGD+NDA LL KLFD+V FTH++HLA
Sbjct  118  GDGVLGLDNFNRYYDPKLKRARQGLLERSGVFVVEGDINDAVLLKKLFDVVLFTHVMHLA  177

Query  640  AQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            AQAGVRYAMQNP SYV+SNIAG VNLL
Sbjct  178  AQAGVRYAMQNPGSYVNSNIAGFVNLL  204



>ref|XP_006345514.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum tuberosum]
Length=435

 Score =   211 bits (538),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 132/177 (75%), Gaps = 9/177 (5%)
 Frame = +1

Query  190  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  369
            F + + V LI +FF+       +  S    RR+L T+ +        GG AWEK++++SA
Sbjct  38   FWSLVFVGLIFVFFYRSPSS-SSHVSSDLFRRSLRTSSY--------GGPAWEKKIKASA  88

Query  370  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  549
             PR  NGM VLVTGAAGFVG+H S ALK+RG+GVLGLDNFN YYDPSLKRARQ+LLE+  
Sbjct  89   KPRSSNGMCVLVTGAAGFVGTHVSAALKRRGNGVLGLDNFNDYYDPSLKRARQELLERSG  148

Query  550  IFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            ++IVE D+NDA LL KLF+IV FTH++HLAAQAGVRYAM+NP SYV SNIAG VN+L
Sbjct  149  VYIVEADINDATLLKKLFEIVAFTHVMHLAAQAGVRYAMENPSSYVHSNIAGLVNML  205



>ref|XP_012083592.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Jatropha curcas]
Length=441

 Score =   211 bits (538),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 129/177 (73%), Gaps = 9/177 (5%)
 Frame = +1

Query  190  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  369
            F + + V +I +FF+               RR+L T+          GG+ WEK+V+SSA
Sbjct  43   FWSLVFVGVIFLFFYRSPSSSTNPLPSDPSRRSLRTSW---------GGSDWEKRVRSSA  93

Query  370  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  549
              R +NG SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN YYDPSLKRARQ LLE+  
Sbjct  94   RIRSRNGFSVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDPSLKRARQALLERSG  153

Query  550  IFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            +FIVEGD+ND  LL KLF++VPFTH++HLAAQAGVRYAM+NP SYV SNIAG V+LL
Sbjct  154  VFIVEGDINDVALLKKLFEVVPFTHVMHLAAQAGVRYAMENPSSYVHSNIAGLVSLL  210



>ref|XP_010433651.1| PREDICTED: UDP-glucuronate 4-epimerase 5-like [Camelina sativa]
Length=436

 Score =   211 bits (537),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 105/158 (66%), Positives = 127/158 (80%), Gaps = 6/158 (4%)
 Frame = +1

Query  247  PPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFV  426
            PP + S     RR L+ +  S+ AA + GG+ WEKQV+ SA PR   G++VLVTGA+GFV
Sbjct  56   PPPSPS-----RRNLNDSSSSVSAAKY-GGSHWEKQVRKSARPRSPGGLTVLVTGASGFV  109

Query  427  GSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFD  606
            G+H S+AL++RGDGVLGLDNFN YYDP LKRARQ LLE+  +F+VEGD+NDA LL KLFD
Sbjct  110  GTHVSIALRRRGDGVLGLDNFNRYYDPKLKRARQGLLERSGVFVVEGDINDAVLLRKLFD  169

Query  607  IVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            +V FTH++HLAAQAGVRYAMQNP SYV+SNIAG VNLL
Sbjct  170  VVLFTHVMHLAAQAGVRYAMQNPGSYVNSNIAGFVNLL  207



>gb|KDP28767.1| hypothetical protein JCGZ_14538 [Jatropha curcas]
Length=435

 Score =   211 bits (537),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 129/177 (73%), Gaps = 9/177 (5%)
 Frame = +1

Query  190  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  369
            F + + V +I +FF+               RR+L T+          GG+ WEK+V+SSA
Sbjct  37   FWSLVFVGVIFLFFYRSPSSSTNPLPSDPSRRSLRTSW---------GGSDWEKRVRSSA  87

Query  370  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  549
              R +NG SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN YYDPSLKRARQ LLE+  
Sbjct  88   RIRSRNGFSVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDPSLKRARQALLERSG  147

Query  550  IFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            +FIVEGD+ND  LL KLF++VPFTH++HLAAQAGVRYAM+NP SYV SNIAG V+LL
Sbjct  148  VFIVEGDINDVALLKKLFEVVPFTHVMHLAAQAGVRYAMENPSSYVHSNIAGLVSLL  204



>ref|XP_002444715.1| hypothetical protein SORBIDRAFT_07g026520 [Sorghum bicolor]
 gb|EES14210.1| hypothetical protein SORBIDRAFT_07g026520 [Sorghum bicolor]
Length=479

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 118/219 (54%), Positives = 152/219 (69%), Gaps = 13/219 (6%)
 Frame = +1

Query  103  SKNSKLERYNSYIRRV-NsskliaasskllFRATLMVALILIFFFTINYPPL--------  255
            +K  KLER+   +RR   +  L++ASS LLFRAT++  L L+  F ++YP L        
Sbjct  10   AKGVKLERHAVLLRRAAGAKHLVSASSHLLFRATVLATLALVVLFAVHYPSLLSHSFTLS  69

Query  256  ---AESSGGGRRRALHTTGHSLLAATFSG-GAAWEKQVQSSATPRRQNGMSVLVTGAAGF  423
               A  S   R R  H +     A++  G GAAWE++V+ SATPRR   +SVLVTGAAGF
Sbjct  70   AAPASPSSTPRSRHSHRSLLGSGASSSYGRGAAWEREVRRSATPRRDGALSVLVTGAAGF  129

Query  424  VGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLF  603
            VG+HCSLAL+ RGDGV+GLDNFNAYYDPSLKRARQ+LL    + +++ D+NDA LL +L 
Sbjct  130  VGAHCSLALRARGDGVVGLDNFNAYYDPSLKRARQRLLASRGVVVLDADINDAALLERLL  189

Query  604  DIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
              VPFTH+LHLAAQAGVR+AM+ P +YV+SN+AG V L 
Sbjct  190  SAVPFTHVLHLAAQAGVRHAMRAPQAYVASNVAGLVALF  228



>ref|XP_003549520.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Glycine max]
Length=431

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 118/141 (84%), Gaps = 1/141 (1%)
 Frame = +1

Query  298  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  477
            +G   L A++ GG  WEKQV++SA   RQ GMSVLVTGAAGFVGSH SLALK+RGDGV+G
Sbjct  61   SGSRYLTASW-GGIQWEKQVRTSAQIHRQGGMSVLVTGAAGFVGSHVSLALKRRGDGVVG  119

Query  478  LDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVR  657
            LDNFN YYDPSLK+AR+ LL  H +FIVEGD+NDA LL+KLFD+V FTH++HLAAQAGVR
Sbjct  120  LDNFNDYYDPSLKKARKSLLATHDVFIVEGDVNDAKLLAKLFDVVAFTHVMHLAAQAGVR  179

Query  658  YAMQNPLSYVSSNIAGXVNLL  720
            YAM+NP SYV SNIAG V LL
Sbjct  180  YAMENPHSYVHSNIAGLVTLL  200



>ref|XP_009596624.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nicotiana tomentosiformis]
Length=435

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 131/177 (74%), Gaps = 9/177 (5%)
 Frame = +1

Query  190  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  369
            F A + V LI +FF+         SS   RR +L T+ +        GG  WEK+++SSA
Sbjct  38   FWALVFVGLIFVFFYRSPNSVSNVSSDLSRR-SLRTSSY--------GGPVWEKKIKSSA  88

Query  370  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  549
              R +NG+ VLVTGAAGFVG+H S ALK+RGDGV+GLDNFN YYDPSLKRARQ+LLE+  
Sbjct  89   KIRSKNGICVLVTGAAGFVGTHVSAALKRRGDGVVGLDNFNDYYDPSLKRARQELLERTG  148

Query  550  IFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            ++IVEGD+ND  LL KLFDIV FTH++HLAAQAGVRYAM+NP SYV SNIAG VN+L
Sbjct  149  VYIVEGDINDVALLKKLFDIVAFTHVMHLAAQAGVRYAMENPGSYVHSNIAGLVNVL  205



>ref|XP_010692224.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Beta vulgaris subsp. 
vulgaris]
Length=450

 Score =   211 bits (536),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 117/210 (56%), Positives = 144/210 (69%), Gaps = 2/210 (1%)
 Frame = +1

Query  94   PDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGG  273
            P T    K+E+    I      +L    +KL F   + V LIL+F    +      +S  
Sbjct  11   PSTPGKFKMEKSGYNIHHQYHHRLRWPVAKLTFWCCIFVGLILVFMLRSSSSSSYSASDY  70

Query  274  GRRRALHTTGHSLLAATFS-GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLAL  450
              + ++ +T HS    TFS GG +WEK+V++S   R  NG SVLVTGAAGFVG+H S AL
Sbjct  71   RDKDSI-STRHSRSLRTFSWGGPSWEKRVRNSGRVRAPNGFSVLVTGAAGFVGTHVSAAL  129

Query  451  KKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHIL  630
            K+RGDGVLGLDNFN YYDPSLKRARQ LL++  +FIV+GD+ND PLL KLF +VPFTH++
Sbjct  130  KRRGDGVLGLDNFNDYYDPSLKRARQALLDRSGVFIVQGDINDEPLLKKLFQLVPFTHVM  189

Query  631  HLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            HLAAQAGVRYAMQNP SY+ SNIAG VNLL
Sbjct  190  HLAAQAGVRYAMQNPSSYIHSNIAGFVNLL  219



>ref|XP_004240046.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum lycopersicum]
Length=435

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 106/177 (60%), Positives = 131/177 (74%), Gaps = 9/177 (5%)
 Frame = +1

Query  190  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  369
            F + + V LI +FF+       +  S    RR+L T+ +        GG AWEK++++S 
Sbjct  38   FWSLVFVGLIFVFFYRSPSS-SSHVSSDLFRRSLRTSSY--------GGPAWEKKIKAST  88

Query  370  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  549
             PR  NG+ VLVTGAAGFVG+H S ALK+RGDGVLGLDNFN YYDPSLKRARQ+LLE+  
Sbjct  89   KPRSSNGLCVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDPSLKRARQELLERSG  148

Query  550  IFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            ++IVE D+NDA LL KLF+IV FTH++HLAAQAGVRYAM+NP SYV SNIAG VN+L
Sbjct  149  VYIVEADINDATLLKKLFEIVAFTHVMHLAAQAGVRYAMENPSSYVHSNIAGLVNML  205



>ref|XP_010914055.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Elaeis guineensis]
Length=432

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = +1

Query  331  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  510
            GG  WEKQ+++SA PRR  G SVLVTGAAGFVG+H SLAL+KRGDGV+GLDNFN+YYDPS
Sbjct  71   GGLHWEKQIRASAEPRRSQGFSVLVTGAAGFVGTHVSLALRKRGDGVVGLDNFNSYYDPS  130

Query  511  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVS  690
            LK+AR+ LL  H IF+VEGD+ND  LL+KLFD+VPFTH++HLAAQAGVRYA++NP SYV 
Sbjct  131  LKKARKSLLASHGIFVVEGDINDGRLLAKLFDVVPFTHVMHLAAQAGVRYAIENPASYVH  190

Query  691  SNIAGXVNLL  720
            SNIAG V LL
Sbjct  191  SNIAGLVTLL  200



>ref|XP_008438174.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Cucumis melo]
Length=432

 Score =   210 bits (534),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 132/177 (75%), Gaps = 10/177 (6%)
 Frame = +1

Query  190  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  369
            F + +++  ILIFFF         S     RR+L T           GG +WEK+V+SSA
Sbjct  36   FWSLVILGSILIFFFRSPSSSPLPSDHS--RRSLSTYDW--------GGPSWEKRVRSSA  85

Query  370  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  549
              R +NG+SVLVTGAAGFVG+H S+ALK+RGDGVLGLDNFN YYD SLKRARQ LLE+  
Sbjct  86   RVRSRNGISVLVTGAAGFVGTHVSVALKRRGDGVLGLDNFNNYYDQSLKRARQALLERTG  145

Query  550  IFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            +F+VEGD+ND+ LL KLF++VPFTH++HLAAQAGVRYAM+NP SYV SNIAG VNLL
Sbjct  146  VFVVEGDINDSALLKKLFEVVPFTHVMHLAAQAGVRYAMENPSSYVHSNIAGLVNLL  202



>gb|EMT02349.1| UDP-glucuronate 4-epimerase 6 [Aegilops tauschii]
Length=705

 Score =   215 bits (547),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 123/233 (53%), Positives = 157/233 (67%), Gaps = 25/233 (11%)
 Frame = +1

Query  88   FPPDTS-KNSKLERYNS----YIRRVNsskliaasskllFRATLMVALILIFFFTINYPP  252
             P D + K  KLERY S     +RRV S K ++ASS LLFRAT++  L L+F F ++YP 
Sbjct  1    MPSDAAAKGVKLERYASGGALLLRRVASGKFVSASSHLLFRATVLATLALVFLFALHYPS  60

Query  253  LAESS-------------GGGRRRALHTTGHSLLAATFS----GGAAWEKQVQSSATPRR  381
            L   S             G  R  A H    SLLA+T +    G   W+K+++ SA P R
Sbjct  61   LLSRSFSLASDGSSSSVPGASRSHASH---RSLLASTSAAATYGSERWQKEIRRSAKPGR  117

Query  382  QNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIV  561
              G+SVLVTGA GFVG+HCSLALK RGDGV+GLDNFN+YYDP+LKR RQ+LL    + ++
Sbjct  118  DGGLSVLVTGAGGFVGAHCSLALKARGDGVVGLDNFNSYYDPALKRGRQQLLADRGVVVL  177

Query  562  EGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            + D+NDA LL KLF+ VPFTH+LHLAAQAGVRYAM+ P +YV+SN+AG V++ 
Sbjct  178  DADINDALLLEKLFEAVPFTHVLHLAAQAGVRYAMEAPQTYVASNVAGLVSVF  230



>ref|XP_004954186.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Setaria italica]
Length=439

 Score =   210 bits (534),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 120/147 (82%), Gaps = 7/147 (5%)
 Frame = +1

Query  298  TGHSLLAATFSGGAAWEKQVQSSATPRRQ------NGMSVLVTGAAGFVGSHCSLALKKR  459
            T     AA++ GG  WE+Q+++SA PRR        GMSVLVTGAAGFVG+HCSLAL+KR
Sbjct  61   TSSKYFAASW-GGLHWERQIRASAAPRRPPGSAAGAGMSVLVTGAAGFVGTHCSLALRKR  119

Query  460  GDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLA  639
            GDGV+G+DNFNAYYDPSLK+AR+ LL  H +F+VEGD+ND  LL+KLFD+VPFTH+LHLA
Sbjct  120  GDGVVGIDNFNAYYDPSLKKARKALLSSHGVFVVEGDINDGRLLAKLFDVVPFTHVLHLA  179

Query  640  AQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            AQAGVRYAM+NP SYV SNIAG V LL
Sbjct  180  AQAGVRYAMENPASYVHSNIAGLVTLL  206



>ref|XP_011034154.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Populus euphratica]
Length=431

 Score =   209 bits (533),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 119/137 (87%), Gaps = 1/137 (1%)
 Frame = +1

Query  310  LLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNF  489
            L +AT+ GGAAWEK+V++SA  R +NG SVLVTGAAGFVG+H S ALK+RGDGVLGLDNF
Sbjct  66   LTSATW-GGAAWEKRVRTSARIRSRNGFSVLVTGAAGFVGTHVSSALKRRGDGVLGLDNF  124

Query  490  NAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQ  669
            N YYDP+LKRARQ LLE+  +FIVEGD+ND  LL KLF++VPFTH++HLAAQAGVRYAM+
Sbjct  125  NDYYDPTLKRARQALLERSGVFIVEGDINDVSLLKKLFEVVPFTHVMHLAAQAGVRYAMK  184

Query  670  NPLSYVSSNIAGXVNLL  720
            NP SYV SNIAG V+LL
Sbjct  185  NPASYVHSNIAGFVSLL  201



>ref|XP_007134861.1| hypothetical protein PHAVU_010G082300g [Phaseolus vulgaris]
 gb|ESW06855.1| hypothetical protein PHAVU_010G082300g [Phaseolus vulgaris]
Length=432

 Score =   209 bits (533),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 116/209 (56%), Positives = 141/209 (67%), Gaps = 14/209 (7%)
 Frame = +1

Query  94   PDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGG  273
            P T    K+E+  SY  RV     +A  +   F   + +  ILIFFF    P  +     
Sbjct  8    PSTPGKFKMEK-ASYFNRVRWHTSLAKLAVWSF---VFLGAILIFFF--RSPASSPVPAD  61

Query  274  GRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALK  453
              RR+L T           GG  WEK+V++SA  R +NG +VLVTGAAGFVG+H S ALK
Sbjct  62   LSRRSLRTYNW--------GGPVWEKRVRASARVRSRNGFAVLVTGAAGFVGTHVSAALK  113

Query  454  KRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILH  633
            +RGDGVLG+DNFN YYDPSLKRARQ LLE+  ++IVEGD+ND  LL KLF++VPFTH++H
Sbjct  114  RRGDGVLGIDNFNEYYDPSLKRARQLLLERTGVYIVEGDINDEALLRKLFEVVPFTHVMH  173

Query  634  LAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            LAAQAGVRYAM+NP SYV SNIAG VNLL
Sbjct  174  LAAQAGVRYAMENPGSYVHSNIAGFVNLL  202



>emb|CDY63064.1| BnaAnng18570D [Brassica napus]
Length=430

 Score =   209 bits (532),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +1

Query  331  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  510
            GG AWEK+V+SSA  R + G+SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN YYDPS
Sbjct  71   GGPAWEKRVRSSAHVRTRRGVSVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDPS  130

Query  511  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVS  690
            LKRARQ LLE+  +F+VEGD+NDA LL KLF++VPFTH++HLAAQAGVRYAM+NP SYV 
Sbjct  131  LKRARQALLERSGVFVVEGDINDAALLKKLFEVVPFTHVMHLAAQAGVRYAMENPSSYVH  190

Query  691  SNIAGXVNLL  720
            SNIAG VNLL
Sbjct  191  SNIAGFVNLL  200



>ref|XP_002281007.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Vitis vinifera]
Length=433

 Score =   209 bits (532),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +1

Query  331  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  510
            GG AWEK+V+SSA  R +NG+SVLVTGAAGFVG+H S ALK+RGDGV+GLDNFN YYDPS
Sbjct  74   GGPAWEKRVRSSAKVRARNGISVLVTGAAGFVGTHVSAALKRRGDGVVGLDNFNDYYDPS  133

Query  511  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVS  690
            LKRARQ LLE+  +FIVEGD+ND+ LL KLFD+V FTH++HLAAQAGVRYAM+NP SYV 
Sbjct  134  LKRARQALLERTGVFIVEGDINDSELLKKLFDVVTFTHVMHLAAQAGVRYAMENPSSYVH  193

Query  691  SNIAGXVNLL  720
            SNIAG VNLL
Sbjct  194  SNIAGLVNLL  203



>ref|XP_009111519.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Brassica rapa]
Length=430

 Score =   209 bits (532),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +1

Query  331  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  510
            GG AWEK+V+SSA  R + G+SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN YYDPS
Sbjct  71   GGPAWEKRVRSSAHVRTRRGVSVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDPS  130

Query  511  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVS  690
            LKRARQ LLE+  +F+VEGD+NDA LL KLF++VPFTH++HLAAQAGVRYAM+NP SYV 
Sbjct  131  LKRARQALLERSGVFVVEGDINDAALLKKLFEVVPFTHVMHLAAQAGVRYAMENPSSYVH  190

Query  691  SNIAGXVNLL  720
            SNIAG VNLL
Sbjct  191  SNIAGFVNLL  200



>ref|XP_003517038.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Glycine max]
Length=438

 Score =   209 bits (532),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 116/209 (56%), Positives = 141/209 (67%), Gaps = 14/209 (7%)
 Frame = +1

Query  94   PDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGG  273
            P T    K+E+  SY  RV     +A  +   F   + +  ILIFF  +  P  +     
Sbjct  14   PSTPGKFKMEK-ASYFNRVRWHTSLAKLAVWSF---VFLGAILIFF--LRSPASSPVPAD  67

Query  274  GRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALK  453
              RR+L T           GG  WEK+V++SA  R +NG +VLVTGAAGFVG+H S ALK
Sbjct  68   LSRRSLRTYNW--------GGPVWEKRVRASAQIRSRNGFAVLVTGAAGFVGTHVSAALK  119

Query  454  KRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILH  633
            +RGDGVLGLDNFN YYDPSLKRARQ LLE+  ++IVEGD+ND  LL KLF++VPFTH++H
Sbjct  120  RRGDGVLGLDNFNDYYDPSLKRARQGLLERSGVYIVEGDINDEALLRKLFEVVPFTHVMH  179

Query  634  LAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            LAAQAGVRYAM+NP SYV SNIAG VNLL
Sbjct  180  LAAQAGVRYAMENPGSYVHSNIAGFVNLL  208



>gb|AAM61323.1| nucleotide sugar epimerase, putative [Arabidopsis thaliana]
Length=419

 Score =   209 bits (531),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 131/177 (74%), Gaps = 13/177 (7%)
 Frame = +1

Query  190  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  369
            F + +   L+ IFF+     P+  S+    RR+L T           GG AWEK+V+SSA
Sbjct  23   FWSLVFFGLLFIFFYR---SPI--SNPDSSRRSLRTYSW--------GGPAWEKRVRSSA  69

Query  370  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  549
              R +NG+SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN YYD SLKR+RQ LLE+  
Sbjct  70   RVRTRNGVSVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDTSLKRSRQALLERSG  129

Query  550  IFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            +FIVEGD+ND  LL KLF++VPFTH++HLAAQAGVRYAM+NP SYV SNIAG VNLL
Sbjct  130  VFIVEGDINDLSLLKKLFEVVPFTHVMHLAAQAGVRYAMENPGSYVHSNIAGFVNLL  186



>ref|XP_006396783.1| hypothetical protein EUTSA_v10028672mg [Eutrema salsugineum]
 gb|ESQ38236.1| hypothetical protein EUTSA_v10028672mg [Eutrema salsugineum]
Length=435

 Score =   209 bits (532),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 106/158 (67%), Positives = 128/158 (81%), Gaps = 8/158 (5%)
 Frame = +1

Query  247  PPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFV  426
            PP + S     RR L+ +  S+ AA + GG+ WEKQV+ SA PR + G++VLVTGAAGFV
Sbjct  55   PPPSPS-----RRNLYDS--SVSAAKY-GGSHWEKQVRKSARPRSRGGLTVLVTGAAGFV  106

Query  427  GSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFD  606
            G+H S+AL++RGDGVLGLDNFN YYDP LKRARQ LLE+  +F+VEGD+NDA LL KLFD
Sbjct  107  GTHVSIALRRRGDGVLGLDNFNRYYDPKLKRARQGLLERSGVFVVEGDINDAVLLRKLFD  166

Query  607  IVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            +V FTH++HLAAQAGVRYAMQNP SYV+SNIAG VNLL
Sbjct  167  VVLFTHVMHLAAQAGVRYAMQNPGSYVNSNIAGFVNLL  204



>ref|XP_002452964.1| hypothetical protein SORBIDRAFT_04g035630 [Sorghum bicolor]
 gb|EES05940.1| hypothetical protein SORBIDRAFT_04g035630 [Sorghum bicolor]
Length=439

 Score =   209 bits (532),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 120/147 (82%), Gaps = 7/147 (5%)
 Frame = +1

Query  298  TGHSLLAATFSGGAAWEKQVQSSATPRRQ------NGMSVLVTGAAGFVGSHCSLALKKR  459
            T     AA++ GG  WE+Q+++SA PRR        GMSVLVTGAAGFVG+HCSLAL+KR
Sbjct  61   TSSKYFAASW-GGLHWERQIRASAAPRRPPGSAAGAGMSVLVTGAAGFVGTHCSLALRKR  119

Query  460  GDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLA  639
            GDGV+G+DNFNAYYDPSLK+AR+ LL  H +F+VEGD+ND  LL+KLFD+VPFTH+LHLA
Sbjct  120  GDGVVGVDNFNAYYDPSLKKARKALLASHGVFVVEGDINDGRLLAKLFDVVPFTHVLHLA  179

Query  640  AQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            AQAGVRYAM+NP SYV SNIAG V LL
Sbjct  180  AQAGVRYAMENPASYVHSNIAGLVTLL  206



>ref|XP_010539945.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [Tarenaya hassleriana]
Length=437

 Score =   209 bits (532),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 122/146 (84%), Gaps = 1/146 (1%)
 Frame = +1

Query  283  RALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRG  462
            R L+ +  S+  AT+ GG+ WEKQV+ SA PR + G++VLVTGAAGFVG+H S+AL +RG
Sbjct  62   RNLNKSSSSVSPATY-GGSQWEKQVRKSARPRSRGGLTVLVTGAAGFVGTHVSIALHRRG  120

Query  463  DGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAA  642
            DGVLGLDNFN YYDP LKRARQ LLE+  +F+V+GD+NDA LL KLFD+V FTH++HLAA
Sbjct  121  DGVLGLDNFNHYYDPKLKRARQGLLERTGVFVVDGDINDAVLLRKLFDVVLFTHVMHLAA  180

Query  643  QAGVRYAMQNPLSYVSSNIAGXVNLL  720
            QAGVRYAMQNP SYV+SNIAG VNLL
Sbjct  181  QAGVRYAMQNPGSYVNSNIAGLVNLL  206



>ref|XP_010661665.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Vitis vinifera]
Length=427

 Score =   209 bits (531),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 121/147 (82%), Gaps = 8/147 (5%)
 Frame = +1

Query  280  RRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  459
            RR+L T  HS       GG AWEK+V+SSA  R +NG+SVLVTGAAGFVG+H S ALK+R
Sbjct  59   RRSLRT--HSW------GGPAWEKRVRSSAKVRARNGISVLVTGAAGFVGTHVSAALKRR  110

Query  460  GDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLA  639
            GDGV+GLDNFN YYDPSLKRARQ LLE+  +FIVEGD+ND+ LL KLF++V FTH++HLA
Sbjct  111  GDGVIGLDNFNDYYDPSLKRARQALLERTGVFIVEGDINDSKLLKKLFEVVAFTHVMHLA  170

Query  640  AQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            AQAGVRYAM+NP SYV SNIAG VNLL
Sbjct  171  AQAGVRYAMENPSSYVHSNIAGLVNLL  197



>ref|XP_009114629.1| PREDICTED: UDP-glucuronate 4-epimerase 5 isoform X1 [Brassica 
rapa]
Length=435

 Score =   209 bits (531),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 125/147 (85%), Gaps = 3/147 (2%)
 Frame = +1

Query  280  RRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  459
            RR+L+ +  SL +A + GG+ WEK+V+ SA PR + G++VLVTGAAGFVG+H S+AL++R
Sbjct  61   RRSLNDS--SLSSAKY-GGSQWEKKVRKSAHPRSRGGLTVLVTGAAGFVGTHVSIALRRR  117

Query  460  GDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLA  639
            GDGVLGLDNFN YYDP LKRARQ LLE+  +F+VEGD+NDA LL KL+D+V FTH++HLA
Sbjct  118  GDGVLGLDNFNRYYDPKLKRARQGLLERSGVFVVEGDINDAVLLKKLYDVVLFTHVMHLA  177

Query  640  AQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            AQAGVRYAMQNP SYVSSNIAG VNLL
Sbjct  178  AQAGVRYAMQNPGSYVSSNIAGFVNLL  204



>ref|XP_008649176.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Zea mays]
Length=440

 Score =   209 bits (532),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 122/147 (83%), Gaps = 7/147 (5%)
 Frame = +1

Query  298  TGHSLLAATFSGGAAWEKQVQSSATPRRQ------NGMSVLVTGAAGFVGSHCSLALKKR  459
            T     AA++ GG  WE+Q+++SA+PRR        G+SVLVTGAAGFVG+HCSLAL+KR
Sbjct  61   TSSRYFAASW-GGLHWERQIRASASPRRPPGSAEGAGLSVLVTGAAGFVGTHCSLALRKR  119

Query  460  GDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLA  639
            GDGVLGLDNFN+YYDPSLK+AR+ LL  H +F+VEGD+ND  LL+KLFD+VPFTH+LHLA
Sbjct  120  GDGVLGLDNFNSYYDPSLKKARRALLGSHGVFVVEGDINDGRLLAKLFDVVPFTHVLHLA  179

Query  640  AQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            AQAGVRYAM+NP SYV SNIAG V+LL
Sbjct  180  AQAGVRYAMENPASYVHSNIAGLVSLL  206



>gb|KEH32594.1| UDP-D-glucuronate 4-epimerase [Medicago truncatula]
Length=434

 Score =   209 bits (531),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 120/141 (85%), Gaps = 1/141 (1%)
 Frame = +1

Query  298  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  477
            +G   L+A++ GG  WEKQV++SA   RQ GMSVLVTGAAGF+GSH SLALK+RGDGV+G
Sbjct  65   SGSRYLSASW-GGIQWEKQVRASAQIHRQGGMSVLVTGAAGFIGSHVSLALKRRGDGVVG  123

Query  478  LDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVR  657
            LDNFN YYDPSLK+AR+ LL+   +FIV GDLNDA LL+KLFD+V FTH++HLAAQAGVR
Sbjct  124  LDNFNDYYDPSLKKARKALLQSRGVFIVHGDLNDAKLLAKLFDVVAFTHVMHLAAQAGVR  183

Query  658  YAMQNPLSYVSSNIAGXVNLL  720
            YAM+NP+SYV+SNIAG V LL
Sbjct  184  YAMENPMSYVNSNIAGLVTLL  204



>ref|XP_011650790.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Cucumis sativus]
 gb|KGN56607.1| UDP-glucuronate 4-epimerase 3 [Cucumis sativus]
Length=432

 Score =   209 bits (531),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 132/177 (75%), Gaps = 10/177 (6%)
 Frame = +1

Query  190  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  369
            F + +++  ILIFFF         S     RR+L T           GG AWEK+V+SSA
Sbjct  36   FWSLVILGSILIFFFRSPSSSPLPSDHS--RRSLSTYDW--------GGPAWEKRVRSSA  85

Query  370  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  549
              R +NG+SVLVTGAAGFVG+H S+ALK+RGDGVLGLDNFN YYD SLKRARQ LLE+  
Sbjct  86   RVRSRNGISVLVTGAAGFVGTHVSVALKRRGDGVLGLDNFNNYYDQSLKRARQALLERTG  145

Query  550  IFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            +F+VEGD+ND+ LL KLF++VPFTH++HLAAQAGVRYAM+NP SYV SNIAG V+LL
Sbjct  146  VFVVEGDINDSALLKKLFEVVPFTHVMHLAAQAGVRYAMENPSSYVHSNIAGLVSLL  202



>ref|XP_011069826.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Sesamum indicum]
Length=432

 Score =   209 bits (531),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 113/134 (84%), Gaps = 0/134 (0%)
 Frame = +1

Query  319  ATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAY  498
            +T  GG  WEKQV+ SA   RQNG SVLVTGAAGFVGSH SLALKKRGDGV+GLDNFN Y
Sbjct  68   STAWGGIHWEKQVRDSAQIHRQNGFSVLVTGAAGFVGSHVSLALKKRGDGVVGLDNFNNY  127

Query  499  YDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPL  678
            YDPSLK+AR+ LL  H +FIVEGD+NDA LL+KLF+IV FTH++HLAAQAGVRYAM+NP 
Sbjct  128  YDPSLKKARKHLLNSHNVFIVEGDVNDARLLAKLFEIVAFTHVMHLAAQAGVRYAMENPH  187

Query  679  SYVSSNIAGXVNLL  720
            SYV SNIAG V LL
Sbjct  188  SYVHSNIAGLVTLL  201



>ref|XP_010413058.1| PREDICTED: UDP-glucuronate 4-epimerase 4-like, partial [Camelina 
sativa]
Length=234

 Score =   202 bits (515),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 111/132 (84%), Gaps = 2/132 (2%)
 Frame = +1

Query  331  GGAAWEKQVQSSATPRRQ--NGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYD  504
            GG AWEK+++SSA  R    NG++VLVTGAAGFVG+H S ALK+RGDGV+GLDNFN YYD
Sbjct  78   GGPAWEKRIRSSARIRTSTTNGITVLVTGAAGFVGTHVSAALKRRGDGVIGLDNFNDYYD  137

Query  505  PSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSY  684
            PSLKRARQ LLE+  IFIVEGD+ND  LL KLF IV FTH++HLAAQAGVRYAM+NP SY
Sbjct  138  PSLKRARQALLERSSIFIVEGDINDVELLRKLFKIVSFTHVMHLAAQAGVRYAMENPSSY  197

Query  685  VSSNIAGXVNLL  720
            V SNIAG VNLL
Sbjct  198  VHSNIAGFVNLL  209



>ref|XP_010053904.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Eucalyptus grandis]
 gb|KCW78281.1| hypothetical protein EUGRSUZ_D02464 [Eucalyptus grandis]
Length=436

 Score =   209 bits (531),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 100/130 (77%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +1

Query  331  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  510
            GGAAWEK+V+SSA  R +NGMSVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN YYDPS
Sbjct  77   GGAAWEKRVRSSARIRSRNGMSVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDPS  136

Query  511  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVS  690
            LKRARQ LLE+  +FIVEGD+ND  LL KLF++V FTH++HLAAQAGVRYAM+NP SYV 
Sbjct  137  LKRARQALLERAGVFIVEGDINDEALLRKLFEVVAFTHVMHLAAQAGVRYAMENPSSYVH  196

Query  691  SNIAGXVNLL  720
            SNIAG V+LL
Sbjct  197  SNIAGLVSLL  206



>ref|XP_008354844.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Malus domestica]
Length=432

 Score =   208 bits (530),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 129/177 (73%), Gaps = 10/177 (6%)
 Frame = +1

Query  190  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  369
            F + + + +ILIFFF    P          RR+L T           GG AWEK V+SSA
Sbjct  36   FWSFVFLGMILIFFF--RSPSSNSLPSDPSRRSLRTYNW--------GGPAWEKXVRSSA  85

Query  370  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  549
              R ++G+SVLVTGAAGFVG+H S ALK+RGDGVLGLD FN YYDPSLKRARQ LLE+  
Sbjct  86   RVRSRHGISVLVTGAAGFVGTHVSAALKRRGDGVLGLDCFNDYYDPSLKRARQALLERSG  145

Query  550  IFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            +FIVEGD+ND  LLSKLF++V FTH++HLAAQAGVRYAM+NP SYV SNIAG VNLL
Sbjct  146  VFIVEGDINDVTLLSKLFEVVAFTHVMHLAAQAGVRYAMENPGSYVHSNIAGLVNLL  202



>ref|XP_011079342.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Sesamum indicum]
Length=432

 Score =   208 bits (530),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 113/134 (84%), Gaps = 0/134 (0%)
 Frame = +1

Query  319  ATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAY  498
            +T  GG  WEKQV+SSA   RQNG SVLVTGAAGFVG+H SLALKKRGDGV+GLDNFN Y
Sbjct  68   STAWGGIQWEKQVRSSAQIHRQNGFSVLVTGAAGFVGTHVSLALKKRGDGVVGLDNFNNY  127

Query  499  YDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPL  678
            YDP LKRAR+ LL  H +FIVEGD+NDA +L+KLF+IV FTH++HLAAQAGVRYAM+NP 
Sbjct  128  YDPVLKRARRDLLSSHNVFIVEGDVNDARMLAKLFEIVAFTHVMHLAAQAGVRYAMENPH  187

Query  679  SYVSSNIAGXVNLL  720
            SYV SNIAG V LL
Sbjct  188  SYVHSNIAGLVTLL  201



>ref|NP_171702.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis thaliana]
 sp|Q9LPC1.1|GAE2_ARATH RecName: Full=UDP-glucuronate 4-epimerase 2; AltName: Full=UDP-glucuronic 
acid epimerase 2 [Arabidopsis thaliana]
 gb|AAF76478.1|AC020622_12 Contains similarity to CAPI protein from Staphylococcus aureus 
gi|P39858 and contains a NAD dependent epimerase/dehydratase 
PF|01370 domain. ESTs gb|N97076, gb|AI997010 come from this 
gene [Arabidopsis thaliana]
 gb|AAG50112.1|AF334734_1 putative nucleotide sugar epimerase [Arabidopsis thaliana]
 gb|AEE27364.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis thaliana]
Length=434

 Score =   208 bits (530),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 131/177 (74%), Gaps = 13/177 (7%)
 Frame = +1

Query  190  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  369
            F + +   L+ IFF+     P+  S+    RR+L T           GG AWEK+V+SSA
Sbjct  38   FWSLVFFGLLFIFFYR---SPI--SNPDSSRRSLRTYSW--------GGPAWEKRVRSSA  84

Query  370  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  549
              R +NG+SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN YYD SLKR+RQ LLE+  
Sbjct  85   RVRTRNGVSVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDTSLKRSRQALLERSG  144

Query  550  IFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            +FIVEGD+ND  LL KLF++VPFTH++HLAAQAGVRYAM+NP SYV SNIAG VNLL
Sbjct  145  VFIVEGDINDLSLLKKLFEVVPFTHVMHLAAQAGVRYAMENPGSYVHSNIAGFVNLL  201



>emb|CDY04398.1| BnaC02g28500D [Brassica napus]
Length=429

 Score =   208 bits (530),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = +1

Query  331  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  510
            GG+ WEKQV+ SA PR   G++VLVTGAAGFVG+H S+AL++RGDGVLGLDNFN YYDP 
Sbjct  69   GGSHWEKQVRKSACPRSSGGLTVLVTGAAGFVGTHVSIALRRRGDGVLGLDNFNRYYDPK  128

Query  511  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVS  690
            LKRARQ LLE+  +F+VEGD+NDA LL KLFD+V FTH++HLAAQAGVRYAMQNP SYV+
Sbjct  129  LKRARQGLLERSGVFVVEGDINDAVLLRKLFDVVLFTHVMHLAAQAGVRYAMQNPGSYVN  188

Query  691  SNIAGXVNLL  720
            SNIAG VNLL
Sbjct  189  SNIAGFVNLL  198



>ref|NP_001048359.1| Os02g0791500 [Oryza sativa Japonica Group]
 dbj|BAD19123.1| putative nucleotide sugar epimerase [Oryza sativa Japonica Group]
 dbj|BAD19172.1| putative nucleotide sugar epimerase [Oryza sativa Japonica Group]
 gb|ABC59069.1| UDP-glucuronic acid 4-epimerase isoform 2 [Oryza sativa Japonica 
Group]
 dbj|BAF10273.1| Os02g0791500 [Oryza sativa Japonica Group]
 gb|EAY87821.1| hypothetical protein OsI_09239 [Oryza sativa Indica Group]
 gb|EAZ24901.1| hypothetical protein OsJ_08679 [Oryza sativa Japonica Group]
Length=437

 Score =   208 bits (530),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 120/147 (82%), Gaps = 7/147 (5%)
 Frame = +1

Query  298  TGHSLLAATFSGGAAWEKQVQSSATPRRQ------NGMSVLVTGAAGFVGSHCSLALKKR  459
            T     AA++ GG  WE+Q+++SA PRR        GMSVLVTGAAGFVG+HCSLAL+KR
Sbjct  61   TSSKYFAASW-GGLHWERQIRASAAPRRPPGSAAGAGMSVLVTGAAGFVGTHCSLALRKR  119

Query  460  GDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLA  639
            GDGV+G+DNFN+YYDPSLK+AR+ LL  H +F++EGD+ND  LL+KLFD+VPFTH+LHLA
Sbjct  120  GDGVVGIDNFNSYYDPSLKKARRSLLASHGVFVIEGDINDGRLLAKLFDVVPFTHVLHLA  179

Query  640  AQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            AQAGVRYAM+NP SYV SNIAG V LL
Sbjct  180  AQAGVRYAMENPASYVHSNIAGLVTLL  206



>ref|XP_009800153.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Nicotiana sylvestris]
Length=426

 Score =   208 bits (529),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 120/146 (82%), Gaps = 1/146 (1%)
 Frame = +1

Query  283  RALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRG  462
            ++   TG+   +AT+ GG  WEKQV++SA   R NGMSVLVTGAAGFVGSH SLALKKRG
Sbjct  51   QSFMDTGNRYFSATW-GGHHWEKQVRTSAQIHRSNGMSVLVTGAAGFVGSHVSLALKKRG  109

Query  463  DGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAA  642
            DGV+GLDNFN YYDP+LK+AR+ LL  H IFI+EGD+ND  +L+KLF+IV FTH++HLAA
Sbjct  110  DGVVGLDNFNNYYDPTLKKARKNLLNDHNIFIIEGDINDMRMLAKLFEIVRFTHVMHLAA  169

Query  643  QAGVRYAMQNPLSYVSSNIAGXVNLL  720
            QAGVRYAM+NP SYV SNIAG V LL
Sbjct  170  QAGVRYAMENPGSYVHSNIAGLVTLL  195



>ref|XP_009586623.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Nicotiana tomentosiformis]
Length=426

 Score =   208 bits (529),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 120/146 (82%), Gaps = 1/146 (1%)
 Frame = +1

Query  283  RALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRG  462
            ++   TG+   +AT+ GG  WEKQV++SA   R NGMSVLVTGAAGFVGSH SLALKKRG
Sbjct  51   QSFMDTGNRYFSATW-GGHHWEKQVRTSAQIHRSNGMSVLVTGAAGFVGSHVSLALKKRG  109

Query  463  DGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAA  642
            DGV+GLDNFN YYDPSLK+AR+ LL  H IFI+EGD+ND  +L+KLF+IV FTH++HLAA
Sbjct  110  DGVVGLDNFNNYYDPSLKKARKNLLNNHNIFIIEGDINDMRMLTKLFEIVRFTHVMHLAA  169

Query  643  QAGVRYAMQNPLSYVSSNIAGXVNLL  720
            QAGVRYA++NP SYV SNIAG V LL
Sbjct  170  QAGVRYALENPGSYVHSNIAGLVTLL  195



>ref|XP_003578376.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Brachypodium distachyon]
Length=485

 Score =   209 bits (532),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 121/236 (51%), Positives = 161/236 (68%), Gaps = 27/236 (11%)
 Frame = +1

Query  88   FPPDTS-KNSKLERYNS----YIRRVNsskliaasskllFRATLMVALILIFFFTINYP-  249
             P D + K  KLERY S     +RRV S KL++ASS LLFRAT++  + L+F FT++YP 
Sbjct  1    MPADAAAKGVKLERYASGGALLLRRVASGKLVSASSHLLFRATVLATIALVFLFTLHYPS  60

Query  250  ------------------PLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATP  375
                              PL  +S   R   + ++  +  AA+  G   W+K+++ SA P
Sbjct  61   LLSRSFSLSSSSSSSSPTPLQHASH--RSLLMSSSTPAASAASVYGSEKWQKEIKKSAKP  118

Query  376  RRQNG-MSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQI  552
            R+ +G MSVLVTGAAGFVG+HC+LAL+ RGDGVLGLDNFN+YYDPSLKRARQ +L    +
Sbjct  119  RKADGGMSVLVTGAAGFVGTHCALALRARGDGVLGLDNFNSYYDPSLKRARQGVLAARGV  178

Query  553  FIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
             +++ D+NDAPLL+ LF+ VPFTH+LHLAAQAGVRYAM+ P +YV+SN+AG V + 
Sbjct  179  VVLDADINDAPLLAALFEAVPFTHVLHLAAQAGVRYAMEAPQTYVASNVAGLVTVF  234



>ref|XP_009114630.1| PREDICTED: UDP-glucuronate 4-epimerase 5 isoform X2 [Brassica 
rapa]
Length=436

 Score =   208 bits (529),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +1

Query  331  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  510
            GG+ WEKQV+ SA PR + G++VLVTGAAGFVG+H S+AL++RGDGVLGLDNFN YYDP 
Sbjct  76   GGSQWEKQVRKSAHPRSRGGLTVLVTGAAGFVGTHVSIALRRRGDGVLGLDNFNRYYDPK  135

Query  511  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVS  690
            LKRARQ LLE+  +F+VEGD+NDA LL KL+D+V FTH++HLAAQAGVRYAMQNP SYVS
Sbjct  136  LKRARQGLLERSGVFVVEGDINDAVLLKKLYDVVLFTHVMHLAAQAGVRYAMQNPGSYVS  195

Query  691  SNIAGXVNLL  720
            SNIAG VNLL
Sbjct  196  SNIAGFVNLL  205



>ref|XP_010909513.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glucuronate 4-epimerase 3-like 
[Elaeis guineensis]
Length=469

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 114/192 (59%), Positives = 132/192 (69%), Gaps = 23/192 (12%)
 Frame = +1

Query  190  FRATLMVALILIFFFTINYPPLAES--------------SGGGRRRALHTTGHSLLAATF  327
            F A L +A+    F     PP AE+              +GG  RR+L T          
Sbjct  47   FWAFLAIAVFAALFLLSPXPPSAEADPPPSSSLGGAASGNGGQHRRSLRTASW-------  99

Query  328  SGGAAWEKQVQSSATPRRQ-NGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYD  504
             GG AWEK+V+SSA  RRQ  G SVLVTGAAGFVG+H S ALKKRGDGVLGLD FN YYD
Sbjct  100  -GGPAWEKRVRSSARIRRQLGGFSVLVTGAAGFVGTHVSAALKKRGDGVLGLDCFNDYYD  158

Query  505  PSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSY  684
            PSLKRARQ LL++  +F+VEGD+NDA LL KLFD+VPFTH++HLAAQAGVRYAM NP SY
Sbjct  159  PSLKRARQALLQRAGVFVVEGDVNDALLLRKLFDVVPFTHVMHLAAQAGVRYAMTNPASY  218

Query  685  VSSNIAGXVNLL  720
            V SN+AG V+LL
Sbjct  219  VHSNVAGLVSLL  230



>ref|XP_002874760.1| UDP-D-glucuronate 4-epimerase 5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51019.1| UDP-D-glucuronate 4-epimerase 5 [Arabidopsis lyrata subsp. lyrata]
Length=436

 Score =   208 bits (529),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/158 (66%), Positives = 127/158 (80%), Gaps = 7/158 (4%)
 Frame = +1

Query  247  PPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFV  426
            PP + S     RR L+ +  S ++A   GG+ WEKQV+ SA PR + G++VLVTGA+GFV
Sbjct  55   PPPSPS-----RRNLNDS--SSISAAKYGGSHWEKQVRKSARPRSRGGLTVLVTGASGFV  107

Query  427  GSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFD  606
            G+H S+AL++RGDGVLGLDNFN YYDP LKRARQ LLE+  +F+VEGD+NDA LL KLFD
Sbjct  108  GTHVSIALRRRGDGVLGLDNFNRYYDPKLKRARQGLLERSGVFVVEGDINDAVLLRKLFD  167

Query  607  IVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            +V FTH++HLAAQAGVRYAMQNP SYV+SNIAG VNLL
Sbjct  168  VVLFTHVMHLAAQAGVRYAMQNPGSYVNSNIAGFVNLL  205



>ref|XP_009128629.1| PREDICTED: UDP-glucuronate 4-epimerase 5-like [Brassica rapa]
Length=429

 Score =   207 bits (528),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +1

Query  331  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  510
            GG+ WEKQV+ SA PR + G++VLVTGAAGFVG+H S+AL++RGDGVLGLDNFN YYDP 
Sbjct  69   GGSHWEKQVRKSARPRSRGGLTVLVTGAAGFVGTHVSIALRRRGDGVLGLDNFNRYYDPK  128

Query  511  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVS  690
            LKRARQ LLE+  +F+VEGD+NDA LL KLFD+V FTH++HLAAQAGVRYAMQNP SYV+
Sbjct  129  LKRARQGLLERSGVFVVEGDVNDAVLLRKLFDVVLFTHVMHLAAQAGVRYAMQNPGSYVN  188

Query  691  SNIAGXVNLL  720
            SNIAG VNLL
Sbjct  189  SNIAGFVNLL  198



>gb|ADB24771.1| UDP-D-glucuronic acid 4-epimerase [Gossypium hirsutum]
 gb|KJB22312.1| hypothetical protein B456_004G040600 [Gossypium raimondii]
Length=435

 Score =   208 bits (529),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/130 (77%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +1

Query  331  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  510
            GG AWEK+V+SSA  R +NG SVLVTGAAGFVG+H S ALKKRGDGVLGLDNFN YYDPS
Sbjct  76   GGPAWEKRVRSSARVRSRNGFSVLVTGAAGFVGTHVSSALKKRGDGVLGLDNFNDYYDPS  135

Query  511  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVS  690
            LKRARQ+LLE+  +FIVEGD+ND+ LL KLF++V FTH++HLAAQAGVRYAM+NP SYV 
Sbjct  136  LKRARQELLERSGVFIVEGDINDSALLMKLFEVVAFTHVMHLAAQAGVRYAMENPGSYVH  195

Query  691  SNIAGXVNLL  720
            SNIAG VNLL
Sbjct  196  SNIAGFVNLL  205



>ref|XP_006648037.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Oryza brachyantha]
Length=437

 Score =   208 bits (529),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 120/147 (82%), Gaps = 7/147 (5%)
 Frame = +1

Query  298  TGHSLLAATFSGGAAWEKQVQSSATPRRQ------NGMSVLVTGAAGFVGSHCSLALKKR  459
            T     AA++ GG  WE+Q+++SA PRR        GMSVLVTGAAGFVG+HCSLAL+KR
Sbjct  61   TSSKYFAASW-GGLHWERQIRASAAPRRPPGSAAGAGMSVLVTGAAGFVGTHCSLALRKR  119

Query  460  GDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLA  639
            GDGV+G+DNFN+YYDPSLK+AR+ LL  H +F++EGD+ND  LL+KLFD+VPFTH+LHLA
Sbjct  120  GDGVVGIDNFNSYYDPSLKKARRSLLASHGVFVIEGDINDGRLLAKLFDVVPFTHVLHLA  179

Query  640  AQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            AQAGVRYAM+NP SYV SNIAG V LL
Sbjct  180  AQAGVRYAMENPASYVHSNIAGLVTLL  206



>emb|CDX97356.1| BnaA02g21470D [Brassica napus]
Length=429

 Score =   207 bits (528),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +1

Query  331  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  510
            GG+ WEKQV+ SA PR + G++VLVTGAAGFVG+H S+AL++RGDGVLGLDNFN YYDP 
Sbjct  69   GGSHWEKQVRKSARPRSRGGLTVLVTGAAGFVGTHVSIALRRRGDGVLGLDNFNRYYDPK  128

Query  511  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVS  690
            LKRARQ LLE+  +F+VEGD+NDA LL KLFD+V FTH++HLAAQAGVRYAMQNP SYV+
Sbjct  129  LKRARQGLLERSGVFVVEGDVNDAVLLRKLFDVVLFTHVMHLAAQAGVRYAMQNPGSYVN  188

Query  691  SNIAGXVNLL  720
            SNIAG VNLL
Sbjct  189  SNIAGFVNLL  198



>dbj|BAJ85817.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96031.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96148.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88803.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08139.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=438

 Score =   208 bits (529),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 120/147 (82%), Gaps = 7/147 (5%)
 Frame = +1

Query  298  TGHSLLAATFSGGAAWEKQVQSSATPRRQ------NGMSVLVTGAAGFVGSHCSLALKKR  459
            T     AA++ GG  WE+Q+++SA PRR        GMSVLVTGA+GFVG+HCSLAL+KR
Sbjct  62   TSSKYFAASW-GGLHWERQIRASAAPRRPPGSAAGAGMSVLVTGASGFVGAHCSLALRKR  120

Query  460  GDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLA  639
            GDGV+G+DNFNAYYDPSLK+AR+ LL  H +F+VEGD+ND  LL+KLFD+VPFTH+LHLA
Sbjct  121  GDGVVGIDNFNAYYDPSLKKARKALLSSHGVFVVEGDINDGRLLAKLFDVVPFTHVLHLA  180

Query  640  AQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            AQAGVRYAM+NP SYV SN+AG V LL
Sbjct  181  AQAGVRYAMENPASYVHSNVAGLVTLL  207



>ref|NP_192962.1| UDP-D-glucuronate 4-epimerase 5 [Arabidopsis thaliana]
 sp|Q9STI6.1|GAE5_ARATH RecName: Full=UDP-glucuronate 4-epimerase 5; AltName: Full=UDP-glucuronic 
acid epimerase 5 [Arabidopsis thaliana]
 emb|CAB45972.1| nucleotide sugar epimerase-like protein [Arabidopsis thaliana]
 emb|CAB78268.1| nucleotide sugar epimerase-like protein [Arabidopsis thaliana]
 gb|AAN12948.1| putative nucleotide sugar epimerase [Arabidopsis thaliana]
 gb|AEE83108.1| UDP-D-glucuronate 4-epimerase 5 [Arabidopsis thaliana]
Length=436

 Score =   207 bits (528),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 104/158 (66%), Positives = 126/158 (80%), Gaps = 7/158 (4%)
 Frame = +1

Query  247  PPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFV  426
            PP + S     RR L+ +  S ++A   GG+ WEKQV+ SA PR   G++VLVTGA+GFV
Sbjct  55   PPPSPS-----RRNLNDS--SSISAAKYGGSHWEKQVRKSARPRSHGGLTVLVTGASGFV  107

Query  427  GSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFD  606
            G+H S+AL++RGDGVLGLDNFN YYDP LKRARQ LLE+  +F+VEGD+NDA LL KLFD
Sbjct  108  GTHVSIALRRRGDGVLGLDNFNRYYDPKLKRARQGLLERSGVFVVEGDINDAVLLRKLFD  167

Query  607  IVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            +V FTH++HLAAQAGVRYAMQNP SYV+SNIAG VNLL
Sbjct  168  VVLFTHVMHLAAQAGVRYAMQNPGSYVNSNIAGFVNLL  205



>ref|XP_004248561.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum lycopersicum]
Length=435

 Score =   207 bits (528),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 106/177 (60%), Positives = 128/177 (72%), Gaps = 8/177 (5%)
 Frame = +1

Query  190  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  369
            F + + + LI I FF       +  S    RR+L T+ +         G AWEK++++SA
Sbjct  37   FWSFVFLGLIFICFFKSTSSSSSPVSSDLSRRSLRTSSYD--------GPAWEKRIKASA  88

Query  370  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  549
              R  NG+SVLVTGAAGFVG+H S ALK+RGDGV+GLDNFN YYDPSLKRARQ LLE   
Sbjct  89   KIRSTNGISVLVTGAAGFVGTHVSSALKRRGDGVVGLDNFNDYYDPSLKRARQTLLESAG  148

Query  550  IFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            ++IVEGD+ND  LL KLFDIV F+H++HLAAQAGVRYAM+NP SYV SNIAG VNLL
Sbjct  149  VYIVEGDINDVALLKKLFDIVQFSHVMHLAAQAGVRYAMENPSSYVHSNIAGLVNLL  205



>ref|XP_006853046.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Amborella trichopoda]
 ref|XP_011626493.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Amborella trichopoda]
 gb|ERN14513.1| hypothetical protein AMTR_s00038p00035160 [Amborella trichopoda]
Length=439

 Score =   207 bits (528),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 115/143 (80%), Gaps = 1/143 (1%)
 Frame = +1

Query  292  HTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGV  471
            H  G +  AA++ GG AWEKQ++ S   RR N   VLVTGAAGF+G+H SLALKKRGDGV
Sbjct  66   HARGATTAAASW-GGPAWEKQLRRSCETRRANAQVVLVTGAAGFIGTHVSLALKKRGDGV  124

Query  472  LGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAG  651
            LGLDNFN YYDPSLKRARQ LL +H IF+ EGD+ND  LLSKL D VPFTH++HLAAQAG
Sbjct  125  LGLDNFNDYYDPSLKRARQSLLARHGIFVAEGDINDGALLSKLLDFVPFTHVMHLAAQAG  184

Query  652  VRYAMQNPLSYVSSNIAGXVNLL  720
            VRYAM+NP SYV SN+AG V+LL
Sbjct  185  VRYAMENPNSYVHSNVAGLVSLL  207



>ref|XP_002280967.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Vitis vinifera]
Length=433

 Score =   207 bits (528),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +1

Query  331  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  510
            GG AWEK+V+SSA  R +NG+SVLVTGAAGFVG+H S ALK+RGDGV+GLDNFN YYDPS
Sbjct  74   GGPAWEKRVRSSAKVRARNGISVLVTGAAGFVGTHVSAALKRRGDGVVGLDNFNDYYDPS  133

Query  511  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVS  690
            LKRARQ LLE+  +FIVEGD+ND+ LL KLF++V FTH++HLAAQAGVRYAM+NP SYV 
Sbjct  134  LKRARQALLERTGVFIVEGDINDSELLRKLFEVVAFTHVMHLAAQAGVRYAMENPSSYVH  193

Query  691  SNIAGXVNLL  720
            SNIAG VNLL
Sbjct  194  SNIAGLVNLL  203



>gb|EPS60141.1| hypothetical protein M569_14661, partial [Genlisea aurea]
Length=429

 Score =   207 bits (528),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 120/146 (82%), Gaps = 1/146 (1%)
 Frame = +1

Query  283  RALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRG  462
            +A   +G    + T+ GG  WE+QV++SA  RRQNG SVLVTGAAGFVGSH SLALKKRG
Sbjct  55   KACVDSGSRYFSTTW-GGGHWERQVRASAQIRRQNGFSVLVTGAAGFVGSHVSLALKKRG  113

Query  463  DGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAA  642
            DGV+GLDNFN+YYDPSLKRAR+++L   +IF+VEGD+ND  +L+KLF+I  FTH++HLAA
Sbjct  114  DGVVGLDNFNSYYDPSLKRARKRILNSREIFVVEGDINDGRMLAKLFEIADFTHVMHLAA  173

Query  643  QAGVRYAMQNPLSYVSSNIAGXVNLL  720
            QAGVRYAM+NP SYV SNIAG V +L
Sbjct  174  QAGVRYAMENPHSYVHSNIAGLVTIL  199



>ref|XP_003521958.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Glycine max]
Length=438

 Score =   207 bits (528),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 115/209 (55%), Positives = 142/209 (68%), Gaps = 14/209 (7%)
 Frame = +1

Query  94   PDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGG  273
            P T    K+++  SY  RV     +A  +   F   + +  ILIFF  +  P  +     
Sbjct  14   PPTPGKFKMDK-ASYFNRVRWHTSLAKLAVWSF---VFLGAILIFF--LRSPASSPVPAD  67

Query  274  GRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALK  453
              RR+L T           GG  WEK+V++SA  R +NG +VLVTGAAGFVG+H S ALK
Sbjct  68   LSRRSLRTYNW--------GGPVWEKRVRASAQVRSRNGFAVLVTGAAGFVGTHVSAALK  119

Query  454  KRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILH  633
            +RGDGVLGLDNFN YYDPSLKRARQ LLE++ ++IVEGD+ND  LL KLF++VPFTH++H
Sbjct  120  RRGDGVLGLDNFNDYYDPSLKRARQGLLERNGVYIVEGDINDEALLRKLFEVVPFTHVMH  179

Query  634  LAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            LAAQAGVRYAM+NP SYV SNIAG VNLL
Sbjct  180  LAAQAGVRYAMENPGSYVHSNIAGFVNLL  208



>ref|NP_001105911.1| LOC732831 [Zea mays]
 gb|ABB51650.1| UDP-glucuronic acid 4-epimerase [Zea mays]
Length=440

 Score =   207 bits (528),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 120/147 (82%), Gaps = 7/147 (5%)
 Frame = +1

Query  298  TGHSLLAATFSGGAAWEKQVQSSATPRRQ------NGMSVLVTGAAGFVGSHCSLALKKR  459
            T     AA++ GG  WE+Q+++SA PRR        GMSVLVTGAAGFVG+HCSLAL++R
Sbjct  61   TSSKYFAASW-GGLHWERQIRASAVPRRPPGSAAGAGMSVLVTGAAGFVGTHCSLALRRR  119

Query  460  GDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLA  639
            GDGV+G+DNFNAYYDPSLK+AR+ LL  H +F+VEGD+ND  LL+KLFD+VPFTH+LHLA
Sbjct  120  GDGVVGVDNFNAYYDPSLKKARRALLASHGVFVVEGDINDGRLLAKLFDVVPFTHVLHLA  179

Query  640  AQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            AQAGVRYAM+NP SYV SN+AG V LL
Sbjct  180  AQAGVRYAMENPASYVHSNVAGLVTLL  206



>ref|XP_010268405.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Nelumbo nucifera]
Length=431

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = +1

Query  331  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  510
            GG  WEKQV++SA  RR  GMSVLVTG AGFVG+H SLALKKRGDGV+GLDNFN YYDPS
Sbjct  69   GGIQWEKQVRTSAQIRRSGGMSVLVTGGAGFVGTHVSLALKKRGDGVVGLDNFNNYYDPS  128

Query  511  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVS  690
            LK+AR+ LL  H IF+VEGD+NDA LL+KLFDIV FTH++HLAAQAGVRYAM+NP SYV 
Sbjct  129  LKKARKALLNNHGIFVVEGDINDARLLAKLFDIVAFTHVMHLAAQAGVRYAMENPHSYVH  188

Query  691  SNIAGXVNLL  720
            SNIAG V+LL
Sbjct  189  SNIAGLVSLL  198



>ref|XP_010278008.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Nelumbo nucifera]
Length=433

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 116/141 (82%), Gaps = 1/141 (1%)
 Frame = +1

Query  298  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  477
            TG   L A++ GG  WEKQV++SA  RR  G SVLVTG AGFVG+H SLALKKRGDGV+G
Sbjct  61   TGSRYLTASW-GGIQWEKQVRTSAEIRRSGGFSVLVTGGAGFVGTHVSLALKKRGDGVVG  119

Query  478  LDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVR  657
            LDNFN YYDPSLKRAR+ LL  H IF+VEGD+NDA LL+KLFD+V FTH++HLAAQAGVR
Sbjct  120  LDNFNNYYDPSLKRARKTLLNNHGIFVVEGDINDARLLAKLFDVVAFTHVMHLAAQAGVR  179

Query  658  YAMQNPLSYVSSNIAGXVNLL  720
            YAM+NP SYV SNIAG V LL
Sbjct  180  YAMENPHSYVHSNIAGLVALL  200



>gb|AAK93670.1| putative nucleotide sugar epimerase [Arabidopsis thaliana]
Length=436

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 104/158 (66%), Positives = 126/158 (80%), Gaps = 7/158 (4%)
 Frame = +1

Query  247  PPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFV  426
            PP + S     RR L+ +  S ++A   GG+ WEKQV+ SA PR   G++VLVTGA+GFV
Sbjct  55   PPPSPS-----RRNLNDS--SSISAAKYGGSHWEKQVRKSARPRSHGGLTVLVTGASGFV  107

Query  427  GSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFD  606
            G+H S+AL++RGDGVLGLDNFN YYDP LKRARQ LLE+  +F+VEGD+NDA LL KLFD
Sbjct  108  GTHVSIALQRRGDGVLGLDNFNRYYDPKLKRARQGLLERSGVFVVEGDINDAVLLRKLFD  167

Query  607  IVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            +V FTH++HLAAQAGVRYAMQNP SYV+SNIAG VNLL
Sbjct  168  VVLFTHVMHLAAQAGVRYAMQNPGSYVNSNIAGFVNLL  205



>ref|XP_010276827.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Nelumbo nucifera]
Length=438

 Score =   207 bits (527),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +1

Query  331  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  510
            GG +WEK+V+SSA  R +NG+SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN YYDPS
Sbjct  78   GGPSWEKRVRSSARVRSRNGLSVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDPS  137

Query  511  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVS  690
            LKRARQ LLE+  +F+VEGD+ND+ LL KLFD+V FTH++HLAAQAGVRYAMQNP SYV 
Sbjct  138  LKRARQALLERTGVFVVEGDINDSALLRKLFDVVAFTHVMHLAAQAGVRYAMQNPGSYVH  197

Query  691  SNIAGXVNLL  720
            SNIAG VN+L
Sbjct  198  SNIAGLVNVL  207



>ref|XP_010422190.1| PREDICTED: UDP-glucuronate 4-epimerase 5 isoform X1 [Camelina 
sativa]
 ref|XP_010422191.1| PREDICTED: UDP-glucuronate 4-epimerase 5 isoform X2 [Camelina 
sativa]
 ref|XP_010422192.1| PREDICTED: UDP-glucuronate 4-epimerase 5 isoform X3 [Camelina 
sativa]
 ref|XP_010422193.1| PREDICTED: UDP-glucuronate 4-epimerase 5 isoform X4 [Camelina 
sativa]
 ref|XP_010455665.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [Camelina sativa]
Length=435

 Score =   207 bits (527),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 104/158 (66%), Positives = 126/158 (80%), Gaps = 7/158 (4%)
 Frame = +1

Query  247  PPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFV  426
            PP + S     RR L+ +  S ++A   GG+ WEKQV+ SA PR   G++VLVTGA+GFV
Sbjct  56   PPPSPS-----RRNLNDS--SSVSAAKYGGSHWEKQVRKSARPRSPGGLTVLVTGASGFV  108

Query  427  GSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFD  606
            G+H S+AL++RGDGVLGLDNFN YYDP LKRARQ LLE+  +F+VEGD+NDA LL KLFD
Sbjct  109  GTHVSIALRRRGDGVLGLDNFNRYYDPKLKRARQGLLERSGVFVVEGDINDAVLLRKLFD  168

Query  607  IVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            +V FTH++HLAAQAGVRYAMQNP SYV+SNIAG VNLL
Sbjct  169  VVLFTHVMHLAAQAGVRYAMQNPGSYVNSNIAGFVNLL  206



>ref|XP_008677814.1| PREDICTED: LOC732831 isoform X1 [Zea mays]
 gb|ACF78800.1| unknown [Zea mays]
 gb|ACN28799.1| unknown [Zea mays]
 gb|ACR36221.1| unknown [Zea mays]
 gb|AFW64179.1| UDP-glucuronic acid 4-epimerase [Zea mays]
Length=440

 Score =   207 bits (527),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 120/147 (82%), Gaps = 7/147 (5%)
 Frame = +1

Query  298  TGHSLLAATFSGGAAWEKQVQSSATPRRQ------NGMSVLVTGAAGFVGSHCSLALKKR  459
            T     AA++ GG  WE+Q+++SA PRR        GMSVLVTGAAGFVG+HCSLAL++R
Sbjct  61   TSSKYFAASW-GGLHWERQIRASAVPRRPPGSAAGAGMSVLVTGAAGFVGTHCSLALRRR  119

Query  460  GDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLA  639
            GDGV+G+DNFNAYYDPSLK+AR+ LL  H +F+VEGD+ND  LL+KLFD+VPFTH+LHLA
Sbjct  120  GDGVVGVDNFNAYYDPSLKKARRALLASHGVFVVEGDINDGRLLAKLFDVVPFTHVLHLA  179

Query  640  AQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            AQAGVRYAM+NP SYV SN+AG V LL
Sbjct  180  AQAGVRYAMENPASYVHSNVAGLVTLL  206



>gb|KJB24820.1| hypothetical protein B456_004G162700 [Gossypium raimondii]
Length=433

 Score =   207 bits (527),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = +1

Query  331  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  510
            GG AWEK+V+SSA  R +NG+SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN YYDPS
Sbjct  74   GGPAWEKRVRSSARIRSRNGISVLVTGAAGFVGTHVSTALKRRGDGVLGLDNFNDYYDPS  133

Query  511  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVS  690
            LKRARQ LL++  +F+VEGD+ND+ LL KLF++VPFTH++HLAAQAGVRYAM+NP SYV 
Sbjct  134  LKRARQALLDRTGVFVVEGDINDSTLLRKLFEVVPFTHVMHLAAQAGVRYAMENPSSYVH  193

Query  691  SNIAGXVNLL  720
            SNIAG V+LL
Sbjct  194  SNIAGLVSLL  203



>ref|XP_006660806.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Oryza brachyantha]
Length=492

 Score =   209 bits (531),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 124/231 (54%), Positives = 158/231 (68%), Gaps = 20/231 (9%)
 Frame = +1

Query  88   FPPDTS-KNSKLERYNS------YIRRVNsskliaasskllFRATLMVALILIFFFTINY  246
             P D + K  KLERY S       +RR +  K+++ASS LLFRAT++  L L+F FT +Y
Sbjct  1    MPADAAAKGMKLERYASGGAMLLLLRRASGGKIVSASSHLLFRATVLATLGLVFLFTFHY  60

Query  247  PPLAESSGGGRRRAL-----HTTGHSLL--------AATFSGGAAWEKQVQSSATPRRQN  387
            P L   S             H +  SLL        A+   GGAAWEK+V+ SA PR+  
Sbjct  61   PSLLSRSFSLSGGGGDGGPAHASHRSLLMSSSSSYSASAAYGGAAWEKEVRKSAKPRKDG  120

Query  388  GMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEG  567
            G++VLVTGAAGFVG+HCSLAL+ RGDGVLGLDNFN+YYDP LKRARQ+LL    + +++ 
Sbjct  121  GIAVLVTGAAGFVGTHCSLALRARGDGVLGLDNFNSYYDPELKRARQRLLADRGVLVLDA  180

Query  568  DLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            D+ND  LL KLFD+VPFTH+LHLAAQAGVRYAM+ P +YV+SN+AG V++ 
Sbjct  181  DINDGLLLEKLFDLVPFTHVLHLAAQAGVRYAMEAPQTYVASNVAGLVSVF  231



>ref|XP_009784108.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Nicotiana sylvestris]
Length=435

 Score =   207 bits (527),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 105/177 (59%), Positives = 131/177 (74%), Gaps = 9/177 (5%)
 Frame = +1

Query  190  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  369
            F + + V LI +FF+         SS   RR +L T+ +        GG  WEK+++SSA
Sbjct  38   FWSLVFVGLIFVFFYRSPNSVSNVSSDLSRR-SLRTSSY--------GGPVWEKKIKSSA  88

Query  370  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  549
              R +NG+ VLVTGAAGFVG+H S ALK+RGDGV+GLDNFN YYDPSLKRARQ+LLE+  
Sbjct  89   KIRSKNGICVLVTGAAGFVGTHVSAALKRRGDGVVGLDNFNDYYDPSLKRARQELLERSG  148

Query  550  IFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            ++IVEGD+ND  LL KLF++V FTH++HLAAQAGVRYAM+NP SYV SNIAG VN+L
Sbjct  149  VYIVEGDINDVALLKKLFEVVAFTHVMHLAAQAGVRYAMENPGSYVHSNIAGLVNVL  205



>ref|XP_002462620.1| hypothetical protein SORBIDRAFT_02g029130 [Sorghum bicolor]
 gb|EER99141.1| hypothetical protein SORBIDRAFT_02g029130 [Sorghum bicolor]
Length=494

 Score =   209 bits (531),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 126/224 (56%), Positives = 155/224 (69%), Gaps = 19/224 (8%)
 Frame = +1

Query  106  KNSKLERYNS----YIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESS--  267
            K  KLERY S     +RR  S+KL++ASS LLFRAT++  L L+F FT++YP L   S  
Sbjct  14   KGMKLERYASGGALLLRRATSAKLVSASSHLLFRATVLATLALVFLFTLHYPSLLSRSFH  73

Query  268  ------GGGRRRALHTTG---HSLL----AATFSGGAAWEKQVQSSATPRRQNGMSVLVT  408
                          H+T     SLL    A+   GGAAWEK+V+ SA P R  G+SVLVT
Sbjct  74   LSAGAGDDSAGGGAHSTSASHRSLLMSSSASASYGGAAWEKEVRRSARPSRDGGISVLVT  133

Query  409  GAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPL  588
            GAAGFVG+HCSLALK RGDGVLGLDNFN+YYDPSLKRARQ LL    + +++ D+ND  L
Sbjct  134  GAAGFVGTHCSLALKARGDGVLGLDNFNSYYDPSLKRARQALLASRGVVVLDADINDGLL  193

Query  589  LSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            L KLFD+  FTH+LHLAAQAGVRYAM+ P +YV+SN+AG V++ 
Sbjct  194  LEKLFDVAAFTHVLHLAAQAGVRYAMEAPQTYVASNVAGLVSVF  237



>ref|XP_002892033.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68292.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis lyrata subsp. lyrata]
Length=434

 Score =   207 bits (527),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 130/177 (73%), Gaps = 13/177 (7%)
 Frame = +1

Query  190  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  369
            F + +   L+ IFF+     P+  S+    RR+L T           GG  WEK+V+SSA
Sbjct  38   FWSLVFFGLLFIFFYR---SPI--SNPDSSRRSLRTYSW--------GGPHWEKRVRSSA  84

Query  370  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  549
              R +NG+SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN YYD SLKR+RQ LLE+  
Sbjct  85   RVRTRNGVSVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDTSLKRSRQALLERSG  144

Query  550  IFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            +FIVEGD+ND  LL KLF++VPFTH++HLAAQAGVRYAM+NP SYV SNIAG VNLL
Sbjct  145  VFIVEGDINDLSLLKKLFEVVPFTHVMHLAAQAGVRYAMENPSSYVHSNIAGFVNLL  201



>ref|XP_010264164.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nelumbo nucifera]
Length=438

 Score =   207 bits (527),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +1

Query  331  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  510
            GG AWEK+V+SSA  R +NG+SVLVTGAAGFVG+H S ALK+RGDGVLG+DNFN YYDPS
Sbjct  78   GGPAWEKRVRSSARVRARNGLSVLVTGAAGFVGTHVSAALKRRGDGVLGVDNFNDYYDPS  137

Query  511  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVS  690
            LKRARQ LLE+  +F+VEGD+ND+ LL KLFD+V FTH++HLAAQAGVRYAMQNP SYV 
Sbjct  138  LKRARQALLERTGVFVVEGDINDSALLRKLFDVVAFTHVMHLAAQAGVRYAMQNPGSYVH  197

Query  691  SNIAGXVNLL  720
            SNIAG VN+L
Sbjct  198  SNIAGLVNVL  207



>ref|XP_008465609.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Cucumis melo]
Length=431

 Score =   207 bits (526),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 116/141 (82%), Gaps = 1/141 (1%)
 Frame = +1

Query  298  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  477
            +G    +A++ GG  WEKQV+ SA P R NG SVLVTGAAGFVGSH SLALKKRGDGV+G
Sbjct  61   SGSRYFSASW-GGIQWEKQVRVSAQPHRTNGFSVLVTGAAGFVGSHVSLALKKRGDGVVG  119

Query  478  LDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVR  657
            LDNFN+YYDPSLK+AR+ LL  H IF+V+GD+ND  LL KLFD+V FTH++HLAAQAGVR
Sbjct  120  LDNFNSYYDPSLKKARKSLLSNHGIFVVDGDINDVRLLDKLFDVVVFTHVMHLAAQAGVR  179

Query  658  YAMQNPLSYVSSNIAGXVNLL  720
            YAM+NP SYV SNIAG V LL
Sbjct  180  YAMENPNSYVHSNIAGLVTLL  200



>dbj|BAK06545.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=443

 Score =   207 bits (526),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 121/147 (82%), Gaps = 7/147 (5%)
 Frame = +1

Query  298  TGHSLLAATFSGGAAWEKQVQSSATPRRQ------NGMSVLVTGAAGFVGSHCSLALKKR  459
            T     AA++ GG  WE+Q+++SA+PRR        G+SVLVTGAAGFVG+HCSLAL+KR
Sbjct  64   TSSRYFAASW-GGLHWERQIRASASPRRPPGSAEGAGLSVLVTGAAGFVGTHCSLALRKR  122

Query  460  GDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLA  639
            GDGV+G+DNFN YYDPSLK+AR+ LL  H +F+VEGD+ND  LL+KLFD+VPFTH+LHLA
Sbjct  123  GDGVVGIDNFNKYYDPSLKKARRALLASHGVFVVEGDINDGRLLTKLFDVVPFTHVLHLA  182

Query  640  AQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            AQAGVRYAM+NP SYV SNIAG V+LL
Sbjct  183  AQAGVRYAMENPASYVHSNIAGLVSLL  209



>emb|CDO97699.1| unnamed protein product [Coffea canephora]
Length=437

 Score =   207 bits (526),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 131/178 (74%), Gaps = 9/178 (5%)
 Frame = +1

Query  190  FRATLMVALILIFFFTINYPPLAES-SGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSS  366
            F + + + LI +FFF        ES +    RR+L T+ +        GG  WEK++++S
Sbjct  38   FWSFVFLGLIFVFFFRSPSSSSPESLTADPSRRSLRTSSY--------GGPDWEKRIKAS  89

Query  367  ATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKH  546
            A  R +NGMSVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN YYD SLKRARQ LLE+ 
Sbjct  90   AKVRSRNGMSVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDQSLKRARQALLERS  149

Query  547  QIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
             ++IVEGD+ND  LL KLFDIV FTH++HLAAQAGVRYAM+NP SYV SNIAG V++L
Sbjct  150  GVYIVEGDINDVALLKKLFDIVQFTHVMHLAAQAGVRYAMENPSSYVHSNIAGLVSVL  207



>dbj|BAJ99315.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=478

 Score =   207 bits (528),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 119/222 (54%), Positives = 153/222 (69%), Gaps = 11/222 (5%)
 Frame = +1

Query  88   FPPDTS-KNSKLERYNS----YIRRVNsskliaasskllFRATLMVALILIFFFTINYPP  252
             P D + K  KLERY S     +RRV S K ++ASS LLFRAT++  L L+F F ++YP 
Sbjct  1    MPSDAAAKGVKLERYASGSALLLRRVASGKFVSASSHLLFRATVLATLALVFLFALHYPS  60

Query  253  LAESSGGGRR------RALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGA  414
            L   S           R+  +   S  AA   GG  W+K+++ SA PRR  G+SVLVTGA
Sbjct  61   LLSRSFSLASSSSVPPRSHRSLLASSSAAATYGGERWQKEIRRSAKPRRDGGLSVLVTGA  120

Query  415  AGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLS  594
             GFVG+HCSLALK RGDGV+GLDNFN+YYDP+LKR RQ LL    + +++ D+NDA LL 
Sbjct  121  GGFVGAHCSLALKARGDGVVGLDNFNSYYDPALKRGRQALLADRGVVVLDADINDALLLE  180

Query  595  KLFDIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            +LF+ VPFTH+LHLAAQAGVRYAM+ P +YV+SN+AG V++ 
Sbjct  181  RLFEAVPFTHVLHLAAQAGVRYAMEAPQTYVASNVAGLVSVF  222



>ref|XP_010929207.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Elaeis guineensis]
Length=432

 Score =   206 bits (525),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 118/141 (84%), Gaps = 1/141 (1%)
 Frame = +1

Query  298  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  477
            T    L+A++ GG  WEKQ++ SA  RR +G+SVLVTGAAGFVGSH S+AL KRGDGV+G
Sbjct  61   TSSKYLSASW-GGLHWEKQIRVSAEVRRAHGISVLVTGAAGFVGSHVSIALHKRGDGVVG  119

Query  478  LDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVR  657
            LDNFN+YYDPSLK+AR+ LL  H IF+VEGD+ND  LLSKLFD+VPFTH++HLAAQAGVR
Sbjct  120  LDNFNSYYDPSLKKARKSLLASHGIFVVEGDINDGRLLSKLFDVVPFTHVMHLAAQAGVR  179

Query  658  YAMQNPLSYVSSNIAGXVNLL  720
            YA++NP SYV SNIAG V LL
Sbjct  180  YAIENPASYVHSNIAGLVTLL  200



>ref|XP_004507780.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Cicer arietinum]
Length=432

 Score =   206 bits (525),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 118/141 (84%), Gaps = 1/141 (1%)
 Frame = +1

Query  298  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  477
            +G   L+A++ GG  WEKQV++SA   RQ GMSVLVTG+A FVGSH SLALK+RGDGV+G
Sbjct  64   SGSRYLSASW-GGIQWEKQVRTSAQIHRQGGMSVLVTGSACFVGSHVSLALKRRGDGVVG  122

Query  478  LDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVR  657
            LDNFN YYDPSLK+AR+ LL  H +FIVEGD+NDA LL+KLFD+V FTH++HLAAQAGVR
Sbjct  123  LDNFNDYYDPSLKKARKTLLSSHGVFIVEGDINDAKLLAKLFDVVAFTHVMHLAAQAGVR  182

Query  658  YAMQNPLSYVSSNIAGXVNLL  720
            YAM+NP SYV SNIAG V LL
Sbjct  183  YAMENPHSYVHSNIAGLVTLL  203



>ref|XP_010525760.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Tarenaya hassleriana]
Length=431

 Score =   206 bits (525),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 117/141 (83%), Gaps = 1/141 (1%)
 Frame = +1

Query  298  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  477
            +G   L+A++ GG  WEKQV++SA   R  G+SVLVTGAAGFVGSH SLALKKRGDG +G
Sbjct  58   SGSKYLSASW-GGIQWEKQVRTSAEIHRSGGISVLVTGAAGFVGSHVSLALKKRGDGAVG  116

Query  478  LDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVR  657
            LDNFN YYDPSLKRAR+ LL    IF+VEGDLND+ LL+KLFD+V FTH++HLAAQAGVR
Sbjct  117  LDNFNNYYDPSLKRARRSLLSSRGIFVVEGDLNDSKLLAKLFDVVAFTHVMHLAAQAGVR  176

Query  658  YAMQNPLSYVSSNIAGXVNLL  720
            YAM+NP SYV SNIAG VNLL
Sbjct  177  YAMENPQSYVHSNIAGLVNLL  197



>gb|KEH16056.1| UDP-D-glucuronate 4-epimerase [Medicago truncatula]
Length=421

 Score =   206 bits (525),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 106/177 (60%), Positives = 129/177 (73%), Gaps = 12/177 (7%)
 Frame = +1

Query  190  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  369
            F + L   +I   FF       +++S    RR+L T  +        GGAAWEK+V+SSA
Sbjct  27   FWSILFFGVIYFLFFRTPSSFSSDTS----RRSLRTYNY--------GGAAWEKKVRSSA  74

Query  370  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  549
                +NG+SVLVTGAAGFVGSH S+ALK+RGDGV+G+DNFN YYDP LK  RQ LLE+  
Sbjct  75   KVTSKNGVSVLVTGAAGFVGSHVSIALKRRGDGVVGIDNFNDYYDPMLKLGRQALLERTG  134

Query  550  IFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            +FIVEGD+ND  LL KLF++VPFTH++HLAAQAGVRYAM+NP SYV SNIAG VNLL
Sbjct  135  VFIVEGDINDPTLLKKLFEVVPFTHVMHLAAQAGVRYAMENPGSYVHSNIAGFVNLL  191



>ref|XP_004144711.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Cucumis sativus]
 gb|KGN61076.1| UDP-glucuronate 5-epimerase [Cucumis sativus]
Length=431

 Score =   206 bits (525),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 116/141 (82%), Gaps = 1/141 (1%)
 Frame = +1

Query  298  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  477
            +G    +A++ GG  WEKQV+ SA P R NG SV+VTGAAGFVGSH SLALKKRGDGV+G
Sbjct  61   SGSRYFSASW-GGIQWEKQVRISAQPHRTNGFSVVVTGAAGFVGSHVSLALKKRGDGVVG  119

Query  478  LDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVR  657
            LDNFN+YYDPSLK+AR+ LL  H IFIV+GD+ND  LL KLFD+V FTH++HLAAQAGVR
Sbjct  120  LDNFNSYYDPSLKKARKSLLSNHGIFIVDGDINDVRLLDKLFDVVVFTHVMHLAAQAGVR  179

Query  658  YAMQNPLSYVSSNIAGXVNLL  720
            YAM+NP SYV SNIAG V LL
Sbjct  180  YAMENPNSYVHSNIAGLVTLL  200



>gb|AFW85530.1| hypothetical protein ZEAMMB73_797483 [Zea mays]
Length=413

 Score =   206 bits (523),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 126/150 (84%), Gaps = 7/150 (5%)
 Frame = +1

Query  289  LHTTGHSLLAATFSGGAAWEKQVQSSATPRRQN------GMSVLVTGAAGFVGSHCSLAL  450
            + +T     AA++ GG  WE+Q+++SA+PRR++      G+SVLVTGAAGFVG+HCSLAL
Sbjct  36   VDSTSPRYFAASW-GGLHWERQIRASASPRRRSAPGAPAGLSVLVTGAAGFVGAHCSLAL  94

Query  451  KKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHIL  630
            +KRGDGV+G+D+FN+YYDPSLK+AR+ LL  H +F+VEGD+ND  LL+KLFD+VPFTH+L
Sbjct  95   RKRGDGVVGIDSFNSYYDPSLKKARRALLGSHGVFVVEGDINDGRLLAKLFDVVPFTHVL  154

Query  631  HLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            HLAAQAGVRYAM+NP SYV SN+AG V+LL
Sbjct  155  HLAAQAGVRYAMENPASYVHSNVAGLVSLL  184



>ref|XP_002309376.1| hypothetical protein POPTR_0006s19240g [Populus trichocarpa]
 gb|EEE92899.1| hypothetical protein POPTR_0006s19240g [Populus trichocarpa]
Length=431

 Score =   206 bits (524),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 115/141 (82%), Gaps = 1/141 (1%)
 Frame = +1

Query  298  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  477
            TG   L A++ GG  WEKQ++ SA   R NGMSVLVTGAAGFVGSH SLALKKRGDGV+G
Sbjct  61   TGSRYLTASW-GGIQWEKQIRHSAQIHRSNGMSVLVTGAAGFVGSHVSLALKKRGDGVVG  119

Query  478  LDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVR  657
            +DNFN YYDPSLKRAR+ LL    IFIVEGD+NDA L++KLFD V FTH++HLAAQAGVR
Sbjct  120  IDNFNNYYDPSLKRARKSLLNNQGIFIVEGDINDARLIAKLFDTVAFTHVMHLAAQAGVR  179

Query  658  YAMQNPLSYVSSNIAGXVNLL  720
            YAM+NP SYV SNIAG V LL
Sbjct  180  YAMENPHSYVHSNIAGLVTLL  200



>ref|XP_010426564.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Camelina sativa]
 ref|XP_010456322.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Camelina sativa]
Length=428

 Score =   206 bits (524),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 132/177 (75%), Gaps = 10/177 (6%)
 Frame = +1

Query  190  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  369
            F + + V LI IFF+    P +++      RR+L T           GG AWEK+V+SSA
Sbjct  32   FWSLVFVGLIFIFFY--RSPLVSDDPTSTSRRSLRTYSW--------GGPAWEKRVRSSA  81

Query  370  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  549
              R + G SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN YYDPSLKRARQ LLE+  
Sbjct  82   RLRSRRGFSVLVTGAAGFVGTHVSSALKRRGDGVLGLDNFNDYYDPSLKRARQALLERSG  141

Query  550  IFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            +F+VEGD+NDA LL KLF++VPFTH++HLAAQAGVRYAM+NP SYV SNIAG VNLL
Sbjct  142  VFVVEGDINDAALLKKLFEVVPFTHVMHLAAQAGVRYAMENPSSYVHSNIAGFVNLL  198



>ref|XP_003564175.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Brachypodium distachyon]
Length=441

 Score =   206 bits (524),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 121/147 (82%), Gaps = 7/147 (5%)
 Frame = +1

Query  298  TGHSLLAATFSGGAAWEKQVQSSATPRRQ------NGMSVLVTGAAGFVGSHCSLALKKR  459
            T     AA++ GG  WE+Q+++SA+PRR        G+SVLVTGAAGFVG+HCSLAL+KR
Sbjct  62   TSSRYFAASW-GGLHWERQIRASASPRRPPGSAEGAGLSVLVTGAAGFVGTHCSLALRKR  120

Query  460  GDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLA  639
            GDGV+G+DNFN YYDPSLK+AR+ LL  H +F+VEGD+ND  LL+KLFD+VPFTH+LHLA
Sbjct  121  GDGVVGIDNFNKYYDPSLKKARRALLASHGVFVVEGDINDGRLLAKLFDVVPFTHVLHLA  180

Query  640  AQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            AQAGVRYAM+NP SYV SNIAG V+LL
Sbjct  181  AQAGVRYAMENPSSYVHSNIAGLVSLL  207



>ref|XP_010419541.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Camelina sativa]
Length=428

 Score =   206 bits (523),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 132/177 (75%), Gaps = 10/177 (6%)
 Frame = +1

Query  190  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  369
            F + + V LI IFF+    P +++      RR+L T           GG AWEK+V+SSA
Sbjct  32   FWSLVFVGLIFIFFY--RSPLVSDDPTSTSRRSLRTYSW--------GGPAWEKRVRSSA  81

Query  370  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  549
              R + G SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN YYDPSLKRARQ LLE+  
Sbjct  82   RLRSRRGFSVLVTGAAGFVGTHVSSALKRRGDGVLGLDNFNDYYDPSLKRARQALLERSG  141

Query  550  IFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            +F+VEGD+NDA LL KLF++VPFTH++HLAAQAGVRYAM+NP SYV SNIAG VNLL
Sbjct  142  VFVVEGDINDAALLKKLFEVVPFTHVMHLAAQAGVRYAMENPSSYVHSNIAGFVNLL  198



>ref|XP_009789635.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [Nicotiana sylvestris]
Length=445

 Score =   206 bits (524),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 104/173 (60%), Positives = 129/173 (75%), Gaps = 7/173 (4%)
 Frame = +1

Query  202  LMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRR  381
            L +  I++FFF   + P    + G  RR+L  T    ++   + G  WE++V++SA PR 
Sbjct  50   LFICFIVLFFF---FSPPTSPAAGNNRRSLKNT----VSPPAALGPNWERRVRASARPRS  102

Query  382  QNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIV  561
            + G +VLVTGAAGFVGSH SLALK+RGDGVLGLDNFN YYD  LK+AR  LLE+  I+IV
Sbjct  103  KTGFTVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNHYYDVGLKKARMGLLERSGIYIV  162

Query  562  EGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            +GD+NDA LL KLFD VPFTH++H+AAQAGVRYAMQNP SYV SNIAG V+LL
Sbjct  163  DGDINDAVLLKKLFDAVPFTHVMHMAAQAGVRYAMQNPGSYVHSNIAGFVSLL  215



>ref|XP_002437985.1| hypothetical protein SORBIDRAFT_10g005920 [Sorghum bicolor]
 gb|EER89352.1| hypothetical protein SORBIDRAFT_10g005920 [Sorghum bicolor]
Length=440

 Score =   206 bits (524),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 121/147 (82%), Gaps = 7/147 (5%)
 Frame = +1

Query  298  TGHSLLAATFSGGAAWEKQVQSSATPRRQ------NGMSVLVTGAAGFVGSHCSLALKKR  459
            T     AA++ GG  WE+Q+++SA+PRR        G+SVLVTGAAGFVG+HCSLAL+KR
Sbjct  61   TSSRYFAASW-GGLHWERQIRASASPRRPPGSAEGAGLSVLVTGAAGFVGTHCSLALRKR  119

Query  460  GDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLA  639
            GDGV+G+DNFN YYDPSLK+AR+ LL  H +F+VEGD+ND  LL+KLFD+VPFTH+LHLA
Sbjct  120  GDGVVGIDNFNNYYDPSLKKARRALLGSHGVFVVEGDINDGRLLAKLFDVVPFTHVLHLA  179

Query  640  AQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            AQAGVRYAM+NP SYV SNIAG V+LL
Sbjct  180  AQAGVRYAMENPASYVHSNIAGLVSLL  206



>ref|XP_011093361.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Sesamum indicum]
Length=434

 Score =   206 bits (523),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +1

Query  331  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  510
            GG  +EK+V++SA  R +NG+SVLVTGAAGFVGSH S ALK+RGDGVLG+DNFN YYDPS
Sbjct  75   GGPNFEKRVRASAKIRSRNGISVLVTGAAGFVGSHVSAALKRRGDGVLGIDNFNNYYDPS  134

Query  511  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVS  690
            LKRARQ LLE+  ++IVEGD+ND+ LL KLFDIVPFTH++HLAAQAGVRYAM+NP SYV 
Sbjct  135  LKRARQALLERSGVYIVEGDINDSALLKKLFDIVPFTHVMHLAAQAGVRYAMENPSSYVH  194

Query  691  SNIAGXVNLL  720
            SNIAG VNLL
Sbjct  195  SNIAGLVNLL  204



>ref|XP_004298689.1| PREDICTED: UDP-glucuronate 4-epimerase 4 [Fragaria vesca subsp. 
vesca]
Length=437

 Score =   206 bits (523),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 113/209 (54%), Positives = 139/209 (67%), Gaps = 17/209 (8%)
 Frame = +1

Query  94   PDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGG  273
            P T    KLE+   YI R+     ++       + TL  +  L+F     Y     S   
Sbjct  14   PSTPGKFKLEKSQPYIHRLRFHASLS-------KLTLWSSFFLVFIL-FYYVLSPPSPSL  65

Query  274  GRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALK  453
              RRAL+ +          GG  WEK+V  SA     +G++VLVTGAAGFVG+H S+ALK
Sbjct  66   PSRRALNDSSW--------GGPDWEKRVTRSAR-TSPHGLTVLVTGAAGFVGTHVSMALK  116

Query  454  KRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILH  633
            +RGDGVLG+DNFN YYDP LKR RQKLLE++ +F+VEGD+NDAPLL KLFD+VPFTH++H
Sbjct  117  RRGDGVLGIDNFNHYYDPRLKRDRQKLLERNGVFVVEGDINDAPLLRKLFDVVPFTHVMH  176

Query  634  LAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            LAAQAGVRYAMQNP SYV SNIAG V+LL
Sbjct  177  LAAQAGVRYAMQNPGSYVHSNIAGFVSLL  205



>ref|XP_011090565.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Sesamum indicum]
 ref|XP_011090567.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Sesamum indicum]
Length=432

 Score =   205 bits (522),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 130/177 (73%), Gaps = 9/177 (5%)
 Frame = +1

Query  190  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  369
            F + + + LI +FF+       +  S   RR          L  ++ GG  +E++V++SA
Sbjct  35   FWSLVFLGLIFVFFYRSPSSSSSAPSDLSRRS---------LRTSYYGGPNFERRVRASA  85

Query  370  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  549
              R +NG+SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN YYDPSLKRARQ LLE+  
Sbjct  86   KIRSRNGISVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDPSLKRARQALLERSG  145

Query  550  IFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            ++IVEGD+ND  LL KLFDIVPFTH++HLAAQAGVRYAM+NP SYV SNIAG V++L
Sbjct  146  VYIVEGDINDVSLLKKLFDIVPFTHVMHLAAQAGVRYAMENPSSYVHSNIAGLVSIL  202



>ref|XP_010098924.1| UDP-glucuronate 4-epimerase 3 [Morus notabilis]
 gb|EXB76226.1| UDP-glucuronate 4-epimerase 3 [Morus notabilis]
Length=445

 Score =   206 bits (523),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +1

Query  331  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  510
            GG AWEK+V+SSA  R +NG+SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN YYDPS
Sbjct  86   GGPAWEKRVRSSARVRSRNGISVLVTGAAGFVGTHVSSALKRRGDGVLGLDNFNDYYDPS  145

Query  511  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVS  690
            LKRARQ LL++  +F+VEGD+ND+ LL KLF++V FTH++HLAAQAGVRYAM+NP SYV 
Sbjct  146  LKRARQALLDRTGVFVVEGDINDSALLKKLFEVVAFTHVMHLAAQAGVRYAMENPSSYVH  205

Query  691  SNIAGXVNLL  720
            SNIAG VNLL
Sbjct  206  SNIAGLVNLL  215



>ref|XP_009786918.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Nicotiana sylvestris]
Length=431

 Score =   205 bits (522),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 116/141 (82%), Gaps = 1/141 (1%)
 Frame = +1

Query  298  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  477
            +G   L++T+ G   WEKQV+ SA   R NGMSVLVTGAAGFVG+H SLALKKRGDGV+G
Sbjct  61   SGTRYLSSTW-GSLHWEKQVRDSAQIHRVNGMSVLVTGAAGFVGTHVSLALKKRGDGVVG  119

Query  478  LDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVR  657
            LDNFN YYDPSLK+AR+ LL    IFIVEGD+NDA +L+KLFDIV FTH++HLAAQAGVR
Sbjct  120  LDNFNNYYDPSLKKARKNLLNSQNIFIVEGDINDARMLAKLFDIVAFTHVMHLAAQAGVR  179

Query  658  YAMQNPLSYVSSNIAGXVNLL  720
            YAM+NP SYV SNIAG V LL
Sbjct  180  YAMENPQSYVHSNIAGLVTLL  200



>emb|CAN73016.1| hypothetical protein VITISV_004388 [Vitis vinifera]
Length=427

 Score =   205 bits (521),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = +1

Query  331  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  510
            GG AWEK+V+SSA    +NG+SVLVTGAAGFVG+H S ALK+RGDGV+GLDNFN YYDPS
Sbjct  68   GGPAWEKRVRSSAKVXARNGISVLVTGAAGFVGTHVSAALKRRGDGVVGLDNFNDYYDPS  127

Query  511  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVS  690
            LKRARQ LLE+  +FIVEGD+ND+ LL KLF++V FTH++HLAAQAGVRYAM+NP SYV 
Sbjct  128  LKRARQALLERTGVFIVEGDINDSELLRKLFEVVAFTHVMHLAAQAGVRYAMENPSSYVH  187

Query  691  SNIAGXVNLL  720
            SNIAG VNLL
Sbjct  188  SNIAGLVNLL  197



>ref|XP_006359203.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum tuberosum]
Length=435

 Score =   205 bits (521),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 129/177 (73%), Gaps = 8/177 (5%)
 Frame = +1

Query  190  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  369
            F + + + LI + FF       + +S    RR+L T+ +         G AWEK++++SA
Sbjct  37   FWSFVFLGLIFVCFFRSPSSSSSPASSDLSRRSLRTSSYD--------GPAWEKRIKASA  88

Query  370  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  549
              R +NG+SVLVTGAAGFVG+H S ALK+RGDGV+GLDNFN YYDPSLKRARQ LLE   
Sbjct  89   KIRSRNGISVLVTGAAGFVGTHVSSALKRRGDGVVGLDNFNDYYDPSLKRARQTLLEGAG  148

Query  550  IFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            ++IVEGD+ND  LL KLFD+V F H++HLAAQAGVRYAM+NP SYV SNIAG VNLL
Sbjct  149  VYIVEGDINDVTLLKKLFDVVQFNHVMHLAAQAGVRYAMENPSSYVHSNIAGLVNLL  205



>gb|EPS72617.1| hypothetical protein M569_02133, partial [Genlisea aurea]
Length=435

 Score =   205 bits (521),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 130/178 (73%), Gaps = 9/178 (5%)
 Frame = +1

Query  190  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  369
            F + + + LI +FFF       A       RR+L TT        F GG  +E++V+ SA
Sbjct  33   FWSLVFLGLIFVFFFRSPASSSASVQSDLSRRSLRTT--------FYGGPEFERKVRGSA  84

Query  370  TPRR-QNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKH  546
              R  + GMSVLVTGAAGFVG+H SLALK+RGDGV+GLD+FN YYDPSLKRARQ LLE+ 
Sbjct  85   KVRSGRRGMSVLVTGAAGFVGTHVSLALKRRGDGVVGLDSFNDYYDPSLKRARQALLERG  144

Query  547  QIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
             +F+VEGD+ND  LL+KLFD+V FTH++HLAAQAGVRYAM+NP SYV SNIAG VNLL
Sbjct  145  GVFVVEGDINDGALLNKLFDVVAFTHVMHLAAQAGVRYAMENPGSYVHSNIAGLVNLL  202



>gb|ACJ11754.1| UDP-D-glucuronic acid 4-epimerase [Gossypium hirsutum]
Length=431

 Score =   205 bits (521),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 119/148 (80%), Gaps = 1/148 (1%)
 Frame = +1

Query  277  RRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKK  456
            R ++   +G    +A++ GG  WEKQV++SA   R  GMSVLVTGAAGFVG+H SLALKK
Sbjct  54   RFQSFVDSGSRYFSASW-GGIQWEKQVRNSAQIHRSGGMSVLVTGAAGFVGTHVSLALKK  112

Query  457  RGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHL  636
            RGDGV+GLDNFN YYDPSLK+AR+ LL  H I +VEGDLNDA LL+KLFD+V FTH++HL
Sbjct  113  RGDGVVGLDNFNNYYDPSLKKARKSLLNSHGILVVEGDLNDAKLLAKLFDVVAFTHVMHL  172

Query  637  AAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            AAQAGVRYAM+NP SYV SNIAG V LL
Sbjct  173  AAQAGVRYAMENPNSYVHSNIAGLVTLL  200



>ref|XP_010103125.1| UDP-glucuronate 4-epimerase 1 [Morus notabilis]
 gb|EXB94890.1| UDP-glucuronate 4-epimerase 1 [Morus notabilis]
Length=432

 Score =   204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 117/141 (83%), Gaps = 1/141 (1%)
 Frame = +1

Query  298  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  477
            +G    +A++ GG  WEKQV++SA   R  GMSVLVTGAAGFVG+H SLALKKRGDGV+G
Sbjct  61   SGSRYFSASW-GGIQWEKQVRTSAQIHRSGGMSVLVTGAAGFVGTHVSLALKKRGDGVVG  119

Query  478  LDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVR  657
            LDNFN YYDPSLK+AR+ +L  H IFIVEGD+ND+ LL KLFD+V FTH++HLAAQAGVR
Sbjct  120  LDNFNNYYDPSLKKARKSMLNGHGIFIVEGDINDSRLLDKLFDVVAFTHVMHLAAQAGVR  179

Query  658  YAMQNPLSYVSSNIAGXVNLL  720
            YAM+NP SYV SNIAG V+LL
Sbjct  180  YAMENPQSYVHSNIAGLVSLL  200



>ref|XP_009409770.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Musa acuminata 
subsp. malaccensis]
Length=434

 Score =   204 bits (520),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = +1

Query  331  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  510
            GG  WE+Q+++SA  RR++G++VLVTGAAGFVG+H SLAL++RGDGV+GLDNFNAYYDPS
Sbjct  73   GGLHWERQIRASAAVRREDGIAVLVTGAAGFVGTHVSLALRRRGDGVVGLDNFNAYYDPS  132

Query  511  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVS  690
            LK+AR+ LL  H +F+VEGD+NDA LL+KLFD VPFTH++HLAAQAGVRYA++NP SYV 
Sbjct  133  LKKARKALLASHGVFVVEGDVNDARLLAKLFDTVPFTHVMHLAAQAGVRYAIENPASYVH  192

Query  691  SNIAGXVNLL  720
            SN+AG V LL
Sbjct  193  SNVAGLVTLL  202



>ref|XP_004966666.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Setaria italica]
Length=440

 Score =   205 bits (521),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 117/136 (86%), Gaps = 6/136 (4%)
 Frame = +1

Query  331  GGAAWEKQVQSSATPRRQ------NGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN  492
            GG  WE+Q++SSA+PRR        G+SVLVTGAAGFVG+HC+LAL++RGDGV+G+DNFN
Sbjct  71   GGLHWERQIRSSASPRRPPGSAEGAGLSVLVTGAAGFVGTHCALALRRRGDGVVGIDNFN  130

Query  493  AYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQN  672
            +YYDPSLK+AR+ LL  H +F+VEGD+ND  LL+KLFD+VPFTH+LHLAAQAGVRYAM+N
Sbjct  131  SYYDPSLKKARRALLGSHGVFVVEGDVNDGRLLAKLFDVVPFTHVLHLAAQAGVRYAMEN  190

Query  673  PLSYVSSNIAGXVNLL  720
            P SYV SN+AG V+LL
Sbjct  191  PASYVHSNVAGLVSLL  206



>ref|XP_009600710.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Nicotiana tomentosiformis]
Length=431

 Score =   204 bits (520),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 116/141 (82%), Gaps = 1/141 (1%)
 Frame = +1

Query  298  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  477
            +G   L++T+ G   WEKQV+ SA   R NGMSVLVTGAAGFVG+H SLALKKRGDGV+G
Sbjct  61   SGTRYLSSTW-GSLHWEKQVRDSAQIHRVNGMSVLVTGAAGFVGTHVSLALKKRGDGVVG  119

Query  478  LDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVR  657
            LDNFN YYDP+LK+AR+ LL    IFIVEGD+NDA +L+KLFDIV FTH++HLAAQAGVR
Sbjct  120  LDNFNNYYDPTLKKARKNLLNSQNIFIVEGDINDARMLAKLFDIVAFTHVMHLAAQAGVR  179

Query  658  YAMQNPLSYVSSNIAGXVNLL  720
            YAM+NP SYV SNIAG V LL
Sbjct  180  YAMENPQSYVHSNIAGLVTLL  200



>gb|KDO62346.1| hypothetical protein CISIN_1g043169mg [Citrus sinensis]
Length=421

 Score =   204 bits (519),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 112/209 (54%), Positives = 137/209 (66%), Gaps = 18/209 (9%)
 Frame = +1

Query  94   PDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGG  273
            P T    K+ER N+  R+ +            F +T  + L  +F   +    L+  S  
Sbjct  10   PSTPGKFKIERSNTMNRQFHRC----------FTSTSTMFLWALFLVALTASYLSFQS--  57

Query  274  GRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALK  453
                    +G    +A++ GG  WEK V+SSA   R  GMSVLVTGAAGFVG+H SLALK
Sbjct  58   -----FVDSGSRYFSASW-GGIQWEKHVRSSAQIHRSGGMSVLVTGAAGFVGTHVSLALK  111

Query  454  KRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILH  633
            KRGDGV+GLDNFN YYDPSLK+AR+ LL  H +F++EGD+NDA LL+KLFD V FTH++H
Sbjct  112  KRGDGVVGLDNFNNYYDPSLKKARKALLNNHGVFVIEGDINDAKLLAKLFDAVAFTHVMH  171

Query  634  LAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            LAAQAGVRYAMQNP SYV SNIAG V LL
Sbjct  172  LAAQAGVRYAMQNPHSYVHSNIAGLVTLL  200



>gb|KJB76605.1| hypothetical protein B456_012G096800 [Gossypium raimondii]
Length=431

 Score =   204 bits (520),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 116/141 (82%), Gaps = 1/141 (1%)
 Frame = +1

Query  298  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  477
            +G    +A++ GG  WEKQV++SA   R  GMSVLVTGAAGFVG+H SLALKKRGDGV+G
Sbjct  61   SGSRYFSASW-GGIQWEKQVRNSAQIHRSGGMSVLVTGAAGFVGTHVSLALKKRGDGVVG  119

Query  478  LDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVR  657
            LDNFN YYDPSLK+AR+ LL  H I +VEGDLNDA LL+KLFD+V FTH++HLAAQAGVR
Sbjct  120  LDNFNNYYDPSLKKARKSLLNSHGILVVEGDLNDAKLLAKLFDVVAFTHVMHLAAQAGVR  179

Query  658  YAMQNPLSYVSSNIAGXVNLL  720
            YAM+NP SYV SNIAG V LL
Sbjct  180  YAMENPNSYVHSNIAGLVTLL  200



>emb|CDP21367.1| unnamed protein product [Coffea canephora]
Length=433

 Score =   204 bits (520),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = +1

Query  331  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  510
            GG  WEKQV+SSA   R NG SVLVTGAAGFVGSH SLALKKRGDGV+G DNFN YYDP 
Sbjct  72   GGHHWEKQVKSSAQIHRANGFSVLVTGAAGFVGSHVSLALKKRGDGVVGFDNFNNYYDPL  131

Query  511  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVS  690
            LK+AR+ LL  H +FIVEGD+NDA L++KLFDIV FTH++HLAAQAGVRYAM+NP SYV 
Sbjct  132  LKKARKALLNSHNVFIVEGDVNDAKLIAKLFDIVEFTHVMHLAAQAGVRYAMENPHSYVH  191

Query  691  SNIAGXVNLL  720
            SNIAG V LL
Sbjct  192  SNIAGLVTLL  201



>ref|XP_006453511.1| hypothetical protein CICLE_v10008355mg [Citrus clementina]
 ref|XP_006474082.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Citrus sinensis]
 gb|ESR66751.1| hypothetical protein CICLE_v10008355mg [Citrus clementina]
Length=431

 Score =   204 bits (519),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 112/209 (54%), Positives = 137/209 (66%), Gaps = 18/209 (9%)
 Frame = +1

Query  94   PDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGG  273
            P T    K+ER N+  R+ +            F +T  + L  +F   +    L+  S  
Sbjct  10   PSTPGKFKIERSNTMNRQFHRC----------FTSTSTMFLWALFLVALTASYLSFQS--  57

Query  274  GRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALK  453
                    +G    +A++ GG  WEK V+SSA   R  GMSVLVTGAAGFVG+H SLALK
Sbjct  58   -----FVDSGSRYFSASW-GGIQWEKHVRSSAQIHRSGGMSVLVTGAAGFVGTHVSLALK  111

Query  454  KRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILH  633
            KRGDGV+GLDNFN YYDPSLK+AR+ LL  H +F++EGD+NDA LL+KLFD V FTH++H
Sbjct  112  KRGDGVVGLDNFNNYYDPSLKKARKALLNNHGVFVIEGDINDAKLLAKLFDAVAFTHVMH  171

Query  634  LAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            LAAQAGVRYAMQNP SYV SNIAG V LL
Sbjct  172  LAAQAGVRYAMQNPHSYVHSNIAGLVTLL  200



>emb|CDY70926.1| BnaCnng70410D [Brassica napus]
 emb|CDY28188.1| BnaA01g06610D [Brassica napus]
Length=429

 Score =   204 bits (519),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 116/141 (82%), Gaps = 1/141 (1%)
 Frame = +1

Query  298  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  477
            +G   L A++ GG  WEKQV++SA   R  G+SVLVTGA GFVGSH SLAL+KRGDGV+G
Sbjct  58   SGSRYLTASW-GGIQWEKQVRTSAQIHRSGGISVLVTGATGFVGSHVSLALRKRGDGVVG  116

Query  478  LDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVR  657
            LDNFN YYDPSLKRAR+ LL    IF+VEGDLNDA LL+KLFD+V FTH++HLAAQAGVR
Sbjct  117  LDNFNNYYDPSLKRARRSLLSSRGIFVVEGDLNDAKLLAKLFDVVAFTHVMHLAAQAGVR  176

Query  658  YAMQNPLSYVSSNIAGXVNLL  720
            YA++NP SYV SNIAG VNLL
Sbjct  177  YALENPQSYVHSNIAGLVNLL  197



>ref|XP_006282616.1| hypothetical protein CARUB_v10004864mg [Capsella rubella]
 gb|EOA15514.1| hypothetical protein CARUB_v10004864mg [Capsella rubella]
Length=429

 Score =   204 bits (519),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 116/141 (82%), Gaps = 1/141 (1%)
 Frame = +1

Query  298  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  477
            +G   L A++ GG  WEKQV++SA   R  G+SVLVTGA GFVGSH SLAL+KRGDGV+G
Sbjct  58   SGSRYLTASW-GGIQWEKQVRTSAQIHRSGGISVLVTGATGFVGSHVSLALRKRGDGVVG  116

Query  478  LDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVR  657
            LDNFN YYDPSLKRAR+ LL    IF+VEGDLNDA LL+KLFD+V FTH++HLAAQAGVR
Sbjct  117  LDNFNNYYDPSLKRARRSLLSSRGIFVVEGDLNDAKLLAKLFDVVAFTHVMHLAAQAGVR  176

Query  658  YAMQNPLSYVSSNIAGXVNLL  720
            YA++NP SYV SNIAG VNLL
Sbjct  177  YALENPQSYVHSNIAGLVNLL  197



>ref|XP_010438178.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Camelina sativa]
Length=430

 Score =   204 bits (519),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 116/141 (82%), Gaps = 1/141 (1%)
 Frame = +1

Query  298  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  477
            +G   L A++ GG  WEKQV++SA   R  G+SVLVTGA GFVGSH SLAL+KRGDGV+G
Sbjct  58   SGSRYLTASW-GGIQWEKQVRTSAQIHRSGGISVLVTGATGFVGSHVSLALRKRGDGVVG  116

Query  478  LDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVR  657
            LDNFN YYDPSLKRAR+ LL    IF+VEGDLNDA LL+KLFD+V FTH++HLAAQAGVR
Sbjct  117  LDNFNNYYDPSLKRARRSLLSSRGIFVVEGDLNDAKLLAKLFDVVAFTHVMHLAAQAGVR  176

Query  658  YAMQNPLSYVSSNIAGXVNLL  720
            YA++NP SYV SNIAG VNLL
Sbjct  177  YALENPQSYVHSNIAGLVNLL  197



>ref|XP_009593138.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [Nicotiana tomentosiformis]
Length=445

 Score =   204 bits (520),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 104/173 (60%), Positives = 129/173 (75%), Gaps = 7/173 (4%)
 Frame = +1

Query  202  LMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRR  381
            L +  I++FFF   + P   S+ G  RR+L  T    ++   + G  WE++V++SA PR 
Sbjct  50   LFICFIVLFFF---FSPPTNSAAGNNRRSLKNT----VSPPAALGPNWERRVRASARPRS  102

Query  382  QNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIV  561
            + G +VLVTGAAGFVGSH SLALK+RGDGVLGLDNFN YYD  LK+AR  LLE+  I+IV
Sbjct  103  KTGFTVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNHYYDVGLKKARMGLLERSGIYIV  162

Query  562  EGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            +GD+NDA LL KLFD V FTH++H+AAQAGVRYAMQNP SYV SNIAG V+LL
Sbjct  163  DGDINDAVLLKKLFDAVAFTHVMHMAAQAGVRYAMQNPGSYVHSNIAGFVSLL  215



>ref|XP_010432987.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Camelina sativa]
Length=429

 Score =   204 bits (519),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 116/141 (82%), Gaps = 1/141 (1%)
 Frame = +1

Query  298  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  477
            +G   L A++ GG  WEKQV++SA   R  G+SVLVTGA GFVGSH SLAL+KRGDGV+G
Sbjct  58   SGSRYLTASW-GGIQWEKQVRTSAQIHRSGGISVLVTGATGFVGSHVSLALRKRGDGVVG  116

Query  478  LDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVR  657
            LDNFN YYDPSLKRAR+ LL    IF+VEGDLNDA LL+KLFD+V FTH++HLAAQAGVR
Sbjct  117  LDNFNNYYDPSLKRARRSLLSSRGIFVVEGDLNDAKLLAKLFDVVAFTHVMHLAAQAGVR  176

Query  658  YAMQNPLSYVSSNIAGXVNLL  720
            YA++NP SYV SNIAG VNLL
Sbjct  177  YALENPQSYVHSNIAGLVNLL  197



>ref|XP_009127808.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Brassica rapa]
Length=429

 Score =   204 bits (519),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 116/141 (82%), Gaps = 1/141 (1%)
 Frame = +1

Query  298  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  477
            +G   L A++ GG  WEKQV++SA   R  G+SVLVTGA GFVGSH SLAL+KRGDGV+G
Sbjct  58   SGSRYLTASW-GGIQWEKQVRTSAQIHRSGGISVLVTGATGFVGSHVSLALRKRGDGVVG  116

Query  478  LDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVR  657
            LDNFN YYDPSLKRAR+ LL    IF+VEGDLNDA LL+KLFD+V FTH++HLAAQAGVR
Sbjct  117  LDNFNNYYDPSLKRARRSLLSSRGIFVVEGDLNDAKLLAKLFDVVAFTHVMHLAAQAGVR  176

Query  658  YAMQNPLSYVSSNIAGXVNLL  720
            YA++NP SYV SNIAG VNLL
Sbjct  177  YALENPQSYVHSNIAGLVNLL  197



>ref|XP_007013947.1| UDP-D-glucuronate 4-epimerase 1 [Theobroma cacao]
 gb|EOY31566.1| UDP-D-glucuronate 4-epimerase 1 [Theobroma cacao]
Length=433

 Score =   204 bits (519),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 116/141 (82%), Gaps = 1/141 (1%)
 Frame = +1

Query  298  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  477
            +G   L A++ GG  WEKQV+SS+   R  GMSVLVTGAAGFVG+H SLALKKRGDGV+G
Sbjct  63   SGSRYLTASW-GGIQWEKQVRSSSQIHRSGGMSVLVTGAAGFVGTHVSLALKKRGDGVVG  121

Query  478  LDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVR  657
            LDNFN YYDPSLK+AR+ LL  H I ++EGDLNDA LL+KLFD+V FTH++HLAAQAGVR
Sbjct  122  LDNFNNYYDPSLKKARKSLLISHGILVIEGDLNDAKLLAKLFDVVAFTHVMHLAAQAGVR  181

Query  658  YAMQNPLSYVSSNIAGXVNLL  720
            YAM+NP SYV SNIAG V LL
Sbjct  182  YAMENPNSYVHSNIAGLVTLL  202



>ref|NP_194773.1| UDP-D-glucuronate 4-epimerase 1 [Arabidopsis thaliana]
 ref|XP_002867348.1| UDP-D-glucuronate 4-epimerase 1 [Arabidopsis lyrata subsp. lyrata]
 sp|Q9M0B6.1|GAE1_ARATH RecName: Full=UDP-glucuronate 4-epimerase 1; AltName: Full=UDP-glucuronic 
acid epimerase 1; Short=AtUGlcAE3 [Arabidopsis 
thaliana]
 emb|CAB79762.1| nucleotide sugar epimerase-like protein [Arabidopsis thaliana]
 gb|AAL07152.1| putative nucleotide sugar epimerase [Arabidopsis thaliana]
 gb|AAM20706.1| nucleotide sugar epimerase-like protein [Arabidopsis thaliana]
 gb|AAM62729.1| nucleotide sugar epimerase-like protein [Arabidopsis thaliana]
 gb|AAN15627.1| nucleotide sugar epimerase-like protein [Arabidopsis thaliana]
 gb|AAT77233.1| UDP-D-glucuronate 4-epimerase [Arabidopsis thaliana]
 gb|EFH43607.1| UDP-D-glucuronate 4-epimerase 1 [Arabidopsis lyrata subsp. lyrata]
 gb|AEE85765.1| UDP-D-glucuronate 4-epimerase 1 [Arabidopsis thaliana]
 gb|AFI41204.1| UDP-D-glucuronate 4-epimerase 1, partial [Arabidopsis thaliana]
Length=429

 Score =   204 bits (518),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 116/141 (82%), Gaps = 1/141 (1%)
 Frame = +1

Query  298  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  477
            +G   L A++ GG  WEKQV++SA   R  G+SVLVTGA GFVGSH SLAL+KRGDGV+G
Sbjct  58   SGSRYLTASW-GGIQWEKQVRTSAQIHRSGGISVLVTGATGFVGSHVSLALRKRGDGVVG  116

Query  478  LDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVR  657
            LDNFN YYDPSLKRAR+ LL    IF+VEGDLNDA LL+KLFD+V FTH++HLAAQAGVR
Sbjct  117  LDNFNNYYDPSLKRARRSLLSSRGIFVVEGDLNDAKLLAKLFDVVAFTHVMHLAAQAGVR  176

Query  658  YAMQNPLSYVSSNIAGXVNLL  720
            YA++NP SYV SNIAG VNLL
Sbjct  177  YALENPQSYVHSNIAGLVNLL  197



>ref|XP_003570280.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Brachypodium distachyon]
Length=441

 Score =   204 bits (519),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 119/147 (81%), Gaps = 7/147 (5%)
 Frame = +1

Query  298  TGHSLLAATFSGGAAWEKQVQSSATPRRQ------NGMSVLVTGAAGFVGSHCSLALKKR  459
            T     AA++ GG  WE+Q+++SA  RR        GMSVLVTGAAGFVG+HCSLAL+KR
Sbjct  65   TSSKYFAASW-GGLHWERQIRASAAVRRPPGSAAGAGMSVLVTGAAGFVGTHCSLALRKR  123

Query  460  GDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLA  639
            GDGV+G+DNFN+YYDPSLK+AR+ LL  H +F+VEGD+ND  LL+KLFD+VPFTH+LHLA
Sbjct  124  GDGVVGIDNFNSYYDPSLKKARKALLTSHGVFVVEGDINDGRLLAKLFDVVPFTHVLHLA  183

Query  640  AQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            AQAGVRYAM+NP SYV SN+AG V LL
Sbjct  184  AQAGVRYAMENPASYVHSNVAGLVTLL  210



>gb|KFK42571.1| hypothetical protein AALP_AA1G012900 [Arabis alpina]
Length=436

 Score =   204 bits (519),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 106/178 (60%), Positives = 129/178 (72%), Gaps = 12/178 (7%)
 Frame = +1

Query  190  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFS-GGAAWEKQVQSS  366
            F + + V LI IFF+     P++          + +         +S GG  WEK+V+SS
Sbjct  40   FWSLVFVGLIFIFFYR---SPISN--------PVSSDSSRRSLRNYSWGGPDWEKRVRSS  88

Query  367  ATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKH  546
            A  R +NG+SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN YYD SLKR+RQ LLE+ 
Sbjct  89   ARVRTRNGVSVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDTSLKRSRQALLERS  148

Query  547  QIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
             +FIVEGD+ND  LL KLF++VPFTH++HLAAQAGVRYAM+NP SYV SNIAG VNLL
Sbjct  149  GVFIVEGDINDMTLLKKLFEVVPFTHVMHLAAQAGVRYAMENPSSYVHSNIAGFVNLL  206



>emb|CDX72242.1| BnaC07g42640D [Brassica napus]
Length=430

 Score =   204 bits (518),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 114/141 (81%), Gaps = 1/141 (1%)
 Frame = +1

Query  298  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  477
            +G   L A++ GG  WEKQV++SA   R  G+SVLVTGA GFVGSH SLAL+KRGDGV+G
Sbjct  59   SGSRYLTASW-GGIQWEKQVRTSAQIHRSGGISVLVTGATGFVGSHVSLALRKRGDGVVG  117

Query  478  LDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVR  657
            LDNFN YYDPSLKRAR  LL    IF+VEGDLND  LLSKLFD+V FTH++HLAAQAGVR
Sbjct  118  LDNFNNYYDPSLKRARMSLLSSRGIFVVEGDLNDGKLLSKLFDVVAFTHVMHLAAQAGVR  177

Query  658  YAMQNPLSYVSSNIAGXVNLL  720
            YA++NP SYV SNIAG VNLL
Sbjct  178  YALENPQSYVHSNIAGLVNLL  198



>gb|KFK29619.1| hypothetical protein AALP_AA7G157500 [Arabis alpina]
Length=430

 Score =   204 bits (518),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 115/141 (82%), Gaps = 1/141 (1%)
 Frame = +1

Query  298  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  477
            +G   L A++ GG  WEKQV++SA   R  G+SVLVTGA GFVGSH SLAL+KRGDGV+G
Sbjct  58   SGSRYLTASW-GGIQWEKQVRTSAQIHRSGGISVLVTGATGFVGSHVSLALRKRGDGVVG  116

Query  478  LDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVR  657
            LDNFN YYDPSLKRAR+ LL    IF+VEGDLND  LLSKLFD+V FTH++HLAAQAGVR
Sbjct  117  LDNFNNYYDPSLKRARRSLLSSRGIFVVEGDLNDGKLLSKLFDVVAFTHVMHLAAQAGVR  176

Query  658  YAMQNPLSYVSSNIAGXVNLL  720
            YA++NP SYV SNIAG VNLL
Sbjct  177  YALENPQSYVHSNIAGLVNLL  197



>ref|XP_011656020.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Cucumis sativus]
 gb|KGN65261.1| hypothetical protein Csa_1G277970 [Cucumis sativus]
Length=432

 Score =   204 bits (518),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 118/141 (84%), Gaps = 1/141 (1%)
 Frame = +1

Query  298  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  477
            +G   L+A++ GG  WEKQV++SA   R  GMSVLVTGA+GFVG+H SLALK+RGDGV+G
Sbjct  62   SGTRYLSASW-GGLQWEKQVRTSAEITRSGGMSVLVTGASGFVGTHVSLALKRRGDGVVG  120

Query  478  LDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVR  657
            LDNFN YYDPSLK+AR+ L+ +H +F++EGD+NDA LL KLFDIV FTH++HLAAQAGVR
Sbjct  121  LDNFNNYYDPSLKKARKALVNRHGVFVIEGDINDARLLDKLFDIVAFTHVMHLAAQAGVR  180

Query  658  YAMQNPLSYVSSNIAGXVNLL  720
            YAM+NP SYV SNIAG V LL
Sbjct  181  YAMENPHSYVHSNIAGLVTLL  201



>ref|XP_009348282.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Pyrus x bretschneideri]
Length=432

 Score =   204 bits (518),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 116/141 (82%), Gaps = 1/141 (1%)
 Frame = +1

Query  298  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  477
            +G    +A++ GG  WEKQV++SA   R  GMSVLVTGAAGFVG+H SLALKKRGDGV+G
Sbjct  62   SGSRYFSASW-GGIQWEKQVRNSAQIHRSGGMSVLVTGAAGFVGTHVSLALKKRGDGVVG  120

Query  478  LDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVR  657
            +DNFN+YYDPSLK+AR+ LLE H +FIVEGD+ND  LL KLFD V FTH++HLAAQAGVR
Sbjct  121  IDNFNSYYDPSLKKARRSLLETHGVFIVEGDINDNRLLDKLFDTVAFTHVMHLAAQAGVR  180

Query  658  YAMQNPLSYVSSNIAGXVNLL  720
            YAM+NP SYV SNIAG V +L
Sbjct  181  YAMENPQSYVHSNIAGLVTIL  201



>ref|XP_008372097.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Malus domestica]
Length=432

 Score =   204 bits (518),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = +1

Query  331  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  510
            GG  WEKQV++SA   R  GMSVL+TGAAGFVGSH SLALKKRGDGV+G+DNFN+YYDPS
Sbjct  72   GGIQWEKQVRNSAQIHRSGGMSVLITGAAGFVGSHVSLALKKRGDGVVGIDNFNSYYDPS  131

Query  511  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVS  690
            LK AR+ LL+ H IFIVEGD+ND  LL KLFD V FTH++HLAAQAGVRYAM+NP SYV 
Sbjct  132  LKEARRSLLKTHDIFIVEGDINDNRLLDKLFDTVAFTHVMHLAAQAGVRYAMENPHSYVH  191

Query  691  SNIAGXVNLL  720
            SNIAG V LL
Sbjct  192  SNIAGLVTLL  201



>gb|KJB09908.1| hypothetical protein B456_001G174300 [Gossypium raimondii]
Length=437

 Score =   204 bits (518),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 135/178 (76%), Gaps = 12/178 (7%)
 Frame = +1

Query  190  FRATLMVALILIFFF-TINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSS  366
            F + + + LILIFFF + +  PL +      RR+L T           GG AWEK+V+SS
Sbjct  41   FWSFMFLGLILIFFFRSPSSNPLPQDPS---RRSLRTYNW--------GGPAWEKRVRSS  89

Query  367  ATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKH  546
            +  R +NG+SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN YYDPSLKRARQ LLE+ 
Sbjct  90   SRIRSRNGISVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDPSLKRARQALLERS  149

Query  547  QIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
             +FIVEGD+ND+ LL KLF++V FTH++HLAAQAGVRYAM+NP SYV SNIAG VNLL
Sbjct  150  GVFIVEGDINDSALLRKLFEVVAFTHVMHLAAQAGVRYAMENPGSYVHSNIAGFVNLL  207



>ref|XP_006412706.1| hypothetical protein EUTSA_v10025193mg [Eutrema salsugineum]
 gb|ESQ54159.1| hypothetical protein EUTSA_v10025193mg [Eutrema salsugineum]
Length=449

 Score =   204 bits (518),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 116/141 (82%), Gaps = 1/141 (1%)
 Frame = +1

Query  298  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  477
            +G   L A++ GG  WEKQV++SA   R  G+SVLVTGA GFVGSH SLAL+KRGDGV+G
Sbjct  58   SGSRYLTASW-GGIQWEKQVRTSAQIHRSGGISVLVTGATGFVGSHVSLALRKRGDGVVG  116

Query  478  LDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVR  657
            LDNFN YYDPSLKRAR+ LL    IF+VEGDLNDA LL+KLFD+V FTH++HLAAQAGVR
Sbjct  117  LDNFNNYYDPSLKRARRSLLSSRGIFVVEGDLNDAKLLAKLFDVVAFTHVMHLAAQAGVR  176

Query  658  YAMQNPLSYVSSNIAGXVNLL  720
            YA++NP SYV SNIAG VNLL
Sbjct  177  YALENPQSYVHSNIAGLVNLL  197



>ref|XP_008781382.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Phoenix dactylifera]
Length=432

 Score =   203 bits (517),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 111/130 (85%), Gaps = 0/130 (0%)
 Frame = +1

Query  331  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  510
            GG  WEKQ+++SA  RR  G+SVLVTGAAGFVGSH SLAL+KRGDGV+GLDNFN YYDPS
Sbjct  71   GGLHWEKQIRASAEVRRPQGISVLVTGAAGFVGSHVSLALRKRGDGVVGLDNFNTYYDPS  130

Query  511  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVS  690
            LK+AR+ LL  H I +VEGD+ND  LL+KLFD+VPFTH++HLAAQAGVRYA++NP SYV 
Sbjct  131  LKKARKSLLVSHGIVVVEGDINDGRLLAKLFDVVPFTHVMHLAAQAGVRYAIENPASYVH  190

Query  691  SNIAGXVNLL  720
            SNIAG V LL
Sbjct  191  SNIAGLVTLL  200



>ref|XP_008443815.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Cucumis melo]
Length=432

 Score =   203 bits (517),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 118/141 (84%), Gaps = 1/141 (1%)
 Frame = +1

Query  298  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  477
            +G   L+A++ GG  WEKQV++SA   R  GMSVLVTGA+GFVG+H SLALK+RGDGV+G
Sbjct  62   SGTRYLSASW-GGLQWEKQVRTSAEISRSGGMSVLVTGASGFVGTHVSLALKRRGDGVVG  120

Query  478  LDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVR  657
            LDNFN YYDPSLK+AR+ L+ +H +F++EGD+NDA LL KLFDIV FTH++HLAAQAGVR
Sbjct  121  LDNFNNYYDPSLKKARKALVNRHGVFVIEGDINDARLLDKLFDIVAFTHVMHLAAQAGVR  180

Query  658  YAMQNPLSYVSSNIAGXVNLL  720
            YAM+NP SYV SNIAG V LL
Sbjct  181  YAMENPHSYVHSNIAGLVTLL  201



>ref|XP_004973970.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Setaria italica]
Length=485

 Score =   204 bits (520),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 105/192 (55%), Positives = 134/192 (70%), Gaps = 15/192 (8%)
 Frame = +1

Query  190  FRATLMVALILIFFFTINYPPLAESS--------------GGGRRRALHTTGHSLLAATF  327
            FRAT++  L L+  F ++YP L   S              G        ++  SLL +  
Sbjct  44   FRATVLATLALVVLFAVHYPSLLSRSFTLSSASPSSSSSSGSSSSPRSRSSHRSLLGSGA  103

Query  328  S-GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYD  504
            S GGAAWE++V+ SATPRR  G+SVLVTGAAGFVG+HCSLAL+ RGDGV+GLDNFNAYYD
Sbjct  104  SYGGAAWEREVRRSATPRRDGGLSVLVTGAAGFVGAHCSLALRGRGDGVVGLDNFNAYYD  163

Query  505  PSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSY  684
            PSLKRARQ+LL    + +++ D+ND  LL +LF   PFTH+LHLAAQAGVRYAM+ P +Y
Sbjct  164  PSLKRARQRLLASRGVAVLDADINDGALLERLFAAAPFTHVLHLAAQAGVRYAMRAPQTY  223

Query  685  VSSNIAGXVNLL  720
            V+SN+AG V++ 
Sbjct  224  VASNVAGLVSVF  235



>ref|XP_006397710.1| hypothetical protein EUTSA_v10001454mg [Eutrema salsugineum]
 gb|ESQ39163.1| hypothetical protein EUTSA_v10001454mg [Eutrema salsugineum]
Length=435

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 114/210 (54%), Positives = 140/210 (67%), Gaps = 14/210 (7%)
 Frame = +1

Query  94   PDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGG  273
            P +    K+E+ +SY  R+     +   +   F    ++ LI I F   + P +  S   
Sbjct  8    PSSPGKFKMEK-SSYFHRLRFQSSLTKFAFFSF---FLLCLISILFLR-SPPSVNPSQSD  62

Query  274  GRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPR-RQNGMSVLVTGAAGFVGSHCSLAL  450
              RR+L T  +        GG AWEK +++SA  R   NG++VLVTGAAGFVG+H S AL
Sbjct  63   PSRRSLRTYSY--------GGPAWEKHLRASARIRTSNNGITVLVTGAAGFVGTHVSAAL  114

Query  451  KKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHIL  630
            K+RGDGV+GLDNFN YYDPSLKRARQ LLE+  IFIVEGD+ND  LL KLF IV FTH++
Sbjct  115  KRRGDGVIGLDNFNDYYDPSLKRARQALLERSGIFIVEGDINDVELLRKLFKIVSFTHVM  174

Query  631  HLAAQAGVRYAMQNPLSYVSSNIAGXVNLL  720
            HLAAQAGVRYAM+NP SYV SNIAG VNLL
Sbjct  175  HLAAQAGVRYAMENPSSYVHSNIAGLVNLL  204



>ref|XP_008794398.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Phoenix dactylifera]
Length=432

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 117/141 (83%), Gaps = 1/141 (1%)
 Frame = +1

Query  298  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  477
            T    L+A++ GG  WEKQ++ SA  RR  G+SVLVTGAAGFVGSH S+AL KRGDGV+G
Sbjct  61   TSSKYLSASW-GGLHWEKQIRVSAEVRRPQGISVLVTGAAGFVGSHVSIALHKRGDGVVG  119

Query  478  LDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVR  657
            LDNFN+YYDPSLK+AR+ LL+   IF+VEGD+ND  LL+KLFD+VPFTH++HLAAQAGVR
Sbjct  120  LDNFNSYYDPSLKKARKSLLDSQGIFVVEGDVNDGRLLAKLFDVVPFTHVMHLAAQAGVR  179

Query  658  YAMQNPLSYVSSNIAGXVNLL  720
            YA++NP SYV SNIAG V LL
Sbjct  180  YAIENPASYVHSNIAGLVTLL  200



>emb|CDY39205.1| BnaA03g50170D [Brassica napus]
Length=430

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 114/141 (81%), Gaps = 1/141 (1%)
 Frame = +1

Query  298  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  477
            +G   L A++ GG  WEKQV++SA   R  G+SVLVTGA GFVGSH SLAL+KRGDGV+G
Sbjct  59   SGSRYLTASW-GGIQWEKQVRTSAQIHRSGGISVLVTGATGFVGSHVSLALRKRGDGVVG  117

Query  478  LDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVR  657
            LDNFN YYDPSLKRAR  LL    IF+VEGDLND  L+SKLFD+V FTH++HLAAQAGVR
Sbjct  118  LDNFNNYYDPSLKRARMSLLSSRGIFVVEGDLNDGKLMSKLFDVVAFTHVMHLAAQAGVR  177

Query  658  YAMQNPLSYVSSNIAGXVNLL  720
            YA++NP SYV SNIAG VNLL
Sbjct  178  YALENPQSYVHSNIAGLVNLL  198



>ref|XP_002993206.1| hypothetical protein SELMODRAFT_136684 [Selaginella moellendorffii]
 gb|EFJ05726.1| hypothetical protein SELMODRAFT_136684 [Selaginella moellendorffii]
Length=455

 Score =   203 bits (517),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = +1

Query  331  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  510
            GG+ WEK V+ SA  +R+NG+ VLVTGAAGFVG+H SLALKKRGDGV+GLDNFN+YYDP 
Sbjct  86   GGSVWEKHVRHSAHAKRENGLVVLVTGAAGFVGTHVSLALKKRGDGVIGLDNFNSYYDPF  145

Query  511  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVS  690
            LKRARQ LLEK  +F+VEGD+N+  LL KLFD++ FTH++HLAAQAGVRYAM+NP SYV 
Sbjct  146  LKRARQGLLEKQGVFVVEGDINNIALLRKLFDVITFTHVMHLAAQAGVRYAMENPGSYVH  205

Query  691  SNIAGXVNLL  720
            SNIAG VNLL
Sbjct  206  SNIAGFVNLL  215



>ref|XP_002324510.1| UDP-D-GLUCURONATE 4-EPIMERASE 1 family protein [Populus trichocarpa]
 gb|EEF03075.1| UDP-D-GLUCURONATE 4-EPIMERASE 1 family protein [Populus trichocarpa]
Length=431

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = +1

Query  331  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  510
            GG  WEKQ+++SA   R  GMSVLVTGAAGFVGSH SLALKKRGDGV+G+DNFN YYDPS
Sbjct  71   GGIQWEKQIRNSAQIHRSKGMSVLVTGAAGFVGSHVSLALKKRGDGVVGIDNFNNYYDPS  130

Query  511  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVS  690
            LK+AR+ LL    IFIVEGD+NDA L++KLFDIV FTH++HLAAQAGVRYAM+NP SYV 
Sbjct  131  LKKARKSLLNNQGIFIVEGDINDARLIAKLFDIVAFTHVMHLAAQAGVRYAMENPHSYVH  190

Query  691  SNIAGXVNLL  720
            SNIAG V LL
Sbjct  191  SNIAGLVTLL  200



>ref|XP_002965479.1| hypothetical protein SELMODRAFT_84174 [Selaginella moellendorffii]
 gb|EFJ32899.1| hypothetical protein SELMODRAFT_84174 [Selaginella moellendorffii]
Length=456

 Score =   203 bits (517),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = +1

Query  331  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  510
            GG+ WEK V+ SA  +R+NG+ VLVTGAAGFVG+H SLALKKRGDGV+GLDNFN+YYDP 
Sbjct  86   GGSVWEKHVRHSAHAKRENGLVVLVTGAAGFVGTHVSLALKKRGDGVIGLDNFNSYYDPF  145

Query  511  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVS  690
            LKRARQ LLEK  +F+VEGD+N+  LL KLFD++ FTH++HLAAQAGVRYAM+NP SYV 
Sbjct  146  LKRARQGLLEKQGVFVVEGDINNIALLRKLFDVITFTHVMHLAAQAGVRYAMENPGSYVH  205

Query  691  SNIAGXVNLL  720
            SNIAG VNLL
Sbjct  206  SNIAGFVNLL  215



>ref|XP_011018096.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Populus euphratica]
Length=431

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = +1

Query  331  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  510
            GG  WEKQ+++SA   R  GMSVLVTGAAGFVGSH SLALKKRGDGV+G+DNFN YYDPS
Sbjct  71   GGIQWEKQIRNSAQIHRSKGMSVLVTGAAGFVGSHVSLALKKRGDGVVGIDNFNNYYDPS  130

Query  511  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPFTHILHLAAQAGVRYAMQNPLSYVS  690
            LK+AR+ LL    IFIVEGD+NDA L++KLFDIV FTH++HLAAQAGVRYAM+NP SYV 
Sbjct  131  LKKARKSLLNNQGIFIVEGDINDARLIAKLFDIVAFTHVMHLAAQAGVRYAMENPHSYVH  190

Query  691  SNIAGXVNLL  720
            SNIAG V LL
Sbjct  191  SNIAGLVTLL  200



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1323106870870