BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1843

Length=1432
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009625976.1|  PREDICTED: probable glycerophosphoryl dieste...    431   2e-139   Nicotiana tomentosiformis
ref|XP_009787408.1|  PREDICTED: probable glycerophosphoryl dieste...    429   1e-138   Nicotiana sylvestris
ref|XP_011097815.1|  PREDICTED: glycerophosphodiester phosphodies...    405   3e-129   Sesamum indicum [beniseed]
ref|XP_009588257.1|  PREDICTED: probable glycerophosphoryl dieste...    403   6e-129   
ref|XP_006344880.1|  PREDICTED: probable glycerophosphoryl dieste...    400   2e-127   Solanum tuberosum [potatoes]
ref|XP_006346174.1|  PREDICTED: probable glycerophosphoryl dieste...    396   7e-126   Solanum tuberosum [potatoes]
ref|XP_010324292.1|  PREDICTED: glycerophosphodiester phosphodies...    395   1e-125   Solanum lycopersicum
ref|XP_004251903.1|  PREDICTED: glycerophosphodiester phosphodies...    389   3e-123   Solanum lycopersicum
emb|CDP13760.1|  unnamed protein product                                388   4e-123   Coffea canephora [robusta coffee]
gb|EYU33686.1|  hypothetical protein MIMGU_mgv1a001772mg                384   3e-121   Erythranthe guttata [common monkey flower]
gb|EYU27402.1|  hypothetical protein MIMGU_mgv1a001806mg                382   2e-120   Erythranthe guttata [common monkey flower]
ref|XP_009361078.1|  PREDICTED: probable glycerophosphoryl dieste...    375   6e-118   Pyrus x bretschneideri [bai li]
ref|XP_009348463.1|  PREDICTED: probable glycerophosphoryl dieste...    375   8e-118   Pyrus x bretschneideri [bai li]
ref|XP_008366428.1|  PREDICTED: probable glycerophosphoryl dieste...    373   3e-117   
ref|XP_009335427.1|  PREDICTED: probable glycerophosphoryl dieste...    372   8e-117   Pyrus x bretschneideri [bai li]
ref|XP_011095489.1|  PREDICTED: glycerophosphodiester phosphodies...    368   4e-115   Sesamum indicum [beniseed]
ref|XP_011014930.1|  PREDICTED: glycerophosphodiester phosphodies...    365   6e-114   Populus euphratica
gb|KCW70259.1|  hypothetical protein EUGRSUZ_F03515                     361   1e-113   Eucalyptus grandis [rose gum]
ref|XP_011014752.1|  PREDICTED: glycerophosphodiester phosphodies...    364   1e-113   Populus euphratica
gb|KHG12016.1|  putative glycerophosphoryl diester phosphodiester...    362   5e-113   Gossypium arboreum [tree cotton]
gb|KHN43860.1|  Putative glycerophosphoryl diester phosphodiester...    362   8e-113   Glycine soja [wild soybean]
ref|XP_003519608.1|  PREDICTED: probable glycerophosphoryl dieste...    362   9e-113   Glycine max [soybeans]
ref|XP_004294052.1|  PREDICTED: glycerophosphodiester phosphodies...    362   1e-112   Fragaria vesca subsp. vesca
ref|XP_010064948.1|  PREDICTED: probable glycerophosphoryl dieste...    361   1e-112   
gb|KJB13799.1|  hypothetical protein B456_002G094900                    361   2e-112   Gossypium raimondii
ref|XP_008447692.1|  PREDICTED: probable glycerophosphoryl dieste...    360   5e-112   Cucumis melo [Oriental melon]
ref|XP_002529027.1|  glycerophosphoryl diester phosphodiesterase,...    360   6e-112   Ricinus communis
ref|XP_002300351.2|  hypothetical protein POPTR_0001s37160g             359   9e-112   Populus trichocarpa [western balsam poplar]
ref|XP_008227060.1|  PREDICTED: probable glycerophosphoryl dieste...    358   3e-111   Prunus mume [ume]
ref|XP_007020652.1|  PLC-like phosphodiesterase family protein, p...    357   6e-111   
ref|XP_007214645.1|  hypothetical protein PRUPE_ppa001847mg             355   3e-110   Prunus persica
gb|KHG08046.1|  putative glycerophosphoryl diester phosphodiester...    355   6e-110   Gossypium arboreum [tree cotton]
ref|XP_009794308.1|  PREDICTED: probable glycerophosphoryl dieste...    339   1e-109   Nicotiana sylvestris
ref|NP_176869.2|  putative glycerophosphoryl diester phosphodiest...    353   3e-109   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001185333.1|  putative glycerophosphoryl diester phosphodi...    352   6e-109   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006452490.1|  hypothetical protein CICLE_v10007536mg             351   1e-108   Citrus clementina [clementine]
ref|XP_004150252.1|  PREDICTED: glycerophosphodiester phosphodies...    351   2e-108   Cucumis sativus [cucumbers]
ref|XP_006474966.1|  PREDICTED: probable glycerophosphoryl dieste...    351   2e-108   Citrus sinensis [apfelsine]
emb|CDY46687.1|  BnaA03g48210D                                          348   4e-108   Brassica napus [oilseed rape]
ref|XP_009137609.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    348   1e-107   Brassica rapa
gb|KDO62174.1|  hypothetical protein CISIN_1g003550mg                   349   3e-107   Citrus sinensis [apfelsine]
gb|AAP40466.1|  unknown protein                                         348   3e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007020653.1|  PLC-like phosphodiesterase family protein, p...    345   1e-106   
ref|XP_010253010.1|  PREDICTED: glycerophosphodiester phosphodies...    344   3e-106   Nelumbo nucifera [Indian lotus]
ref|XP_004293798.1|  PREDICTED: glycerophosphodiester phosphodies...    344   5e-106   Fragaria vesca subsp. vesca
ref|XP_010099974.1|  putative glycerophosphoryl diester phosphodi...    343   8e-106   
emb|CDX94294.1|  BnaC01g18900D                                          343   8e-106   
ref|XP_010496108.1|  PREDICTED: glycerophosphodiester phosphodies...    343   1e-105   Camelina sativa [gold-of-pleasure]
ref|XP_006401453.1|  hypothetical protein EUTSA_v10012748mg             343   2e-105   Eutrema salsugineum [saltwater cress]
ref|XP_009142640.1|  PREDICTED: probable glycerophosphoryl dieste...    342   2e-105   Brassica rapa
emb|CDX92806.1|  BnaC07g40640D                                          341   3e-105   
ref|XP_007142366.1|  hypothetical protein PHAVU_008G274200g             342   4e-105   Phaseolus vulgaris [French bean]
emb|CDY45656.1|  BnaC09g31980D                                          339   4e-105   Brassica napus [oilseed rape]
emb|CDY17323.1|  BnaA10g09570D                                          341   1e-104   Brassica napus [oilseed rape]
emb|CDX89312.1|  BnaA01g15810D                                          340   1e-104   
ref|XP_002276757.1|  PREDICTED: glycerophosphodiester phosphodies...    340   2e-104   Vitis vinifera
ref|XP_010449676.1|  PREDICTED: glycerophosphodiester phosphodies...    339   4e-104   Camelina sativa [gold-of-pleasure]
ref|XP_002864395.1|  glycerophosphoryl diester phosphodiesterase ...    339   4e-104   
ref|XP_009120058.1|  PREDICTED: probable glycerophosphoryl dieste...    339   4e-104   Brassica rapa
ref|XP_010511612.1|  PREDICTED: glycerophosphodiester phosphodies...    337   3e-103   Camelina sativa [gold-of-pleasure]
ref|XP_002867546.1|  MRH5/SHV3                                          336   4e-103   
ref|XP_004491450.1|  PREDICTED: probable glycerophosphoryl dieste...    336   5e-103   Cicer arietinum [garbanzo]
ref|NP_200359.1|  putative glycerophosphoryl diester phosphodiest...    336   6e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006280047.1|  hypothetical protein CARUB_v10025925mg             333   1e-102   
ref|XP_010270134.1|  PREDICTED: glycerophosphodiester phosphodies...    334   2e-102   Nelumbo nucifera [Indian lotus]
gb|EPS69135.1|  glycerophosphodiesterase-like protein                   333   2e-102   Genlisea aurea
ref|XP_010511610.1|  PREDICTED: LOW QUALITY PROTEIN: glycerophosp...    334   3e-102   Camelina sativa [gold-of-pleasure]
ref|XP_003544723.1|  PREDICTED: probable glycerophosphoryl dieste...    333   5e-102   Glycine max [soybeans]
ref|XP_006413151.1|  hypothetical protein EUTSA_v10024494mg             333   5e-102   Eutrema salsugineum [saltwater cress]
gb|KHN23877.1|  Putative glycerophosphoryl diester phosphodiester...    333   9e-102   Glycine soja [wild soybean]
ref|XP_011013351.1|  PREDICTED: glycerophosphodiester phosphodies...    333   9e-102   Populus euphratica
emb|CDY13237.1|  BnaC09g24190D                                          333   1e-101   Brassica napus [oilseed rape]
ref|NP_567755.1|  glycerophosphoryl diester phosphodiesterase-like 3    332   1e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006280048.1|  hypothetical protein CARUB_v10025925mg             333   1e-101   Capsella rubella
gb|AAL07129.1|  unknown protein                                         332   1e-101   Arabidopsis thaliana [mouse-ear cress]
emb|CAB36515.1|  putative protein                                       333   2e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_012070946.1|  PREDICTED: glycerophosphodiester phosphodies...    332   3e-101   Jatropha curcas
ref|XP_010545263.1|  PREDICTED: glycerophosphodiester phosphodies...    332   3e-101   Tarenaya hassleriana [spider flower]
ref|XP_010482994.1|  PREDICTED: glycerophosphodiester phosphodies...    332   4e-101   Camelina sativa [gold-of-pleasure]
ref|XP_010536709.1|  PREDICTED: glycerophosphodiester phosphodies...    331   6e-101   Tarenaya hassleriana [spider flower]
ref|XP_010443178.1|  PREDICTED: glycerophosphodiester phosphodies...    331   8e-101   Camelina sativa [gold-of-pleasure]
gb|KJB62956.1|  hypothetical protein B456_009G445400                    326   1e-100   Gossypium raimondii
gb|KFK27133.1|  hypothetical protein AALP_AA8G339300                    330   1e-100   Arabis alpina [alpine rockcress]
ref|XP_006391459.1|  hypothetical protein EUTSA_v10018170mg             329   3e-100   Eutrema salsugineum [saltwater cress]
gb|KFK29182.1|  hypothetical protein AALP_AA7G100300                    328   6e-100   Arabis alpina [alpine rockcress]
ref|XP_006283180.1|  hypothetical protein CARUB_v10004210mg             327   1e-99    Capsella rubella
ref|XP_009108190.1|  PREDICTED: probable glycerophosphoryl dieste...    327   1e-99    Brassica rapa
ref|XP_003617676.1|  Glycerophosphodiesterase-like protein              327   2e-99    Medicago truncatula
ref|XP_010448228.1|  PREDICTED: glycerophosphodiester phosphodies...    327   2e-99    Camelina sativa [gold-of-pleasure]
ref|XP_007142367.1|  hypothetical protein PHAVU_008G274300g             327   2e-99    Phaseolus vulgaris [French bean]
emb|CDY61647.1|  BnaCnng38120D                                          326   4e-99    Brassica napus [oilseed rape]
ref|XP_009105134.1|  PREDICTED: probable glycerophosphoryl dieste...    326   4e-99    Brassica rapa
gb|KJB62955.1|  hypothetical protein B456_009G445400                    325   7e-99    Gossypium raimondii
emb|CDY11996.1|  BnaC03g14220D                                          325   9e-99    Brassica napus [oilseed rape]
ref|XP_009132384.1|  PREDICTED: probable glycerophosphoryl dieste...    325   1e-98    Brassica rapa
emb|CDY36746.1|  BnaA03g11400D                                          325   1e-98    Brassica napus [oilseed rape]
ref|XP_006279180.1|  hypothetical protein CARUB_v10007932mg             318   2e-98    
ref|XP_010438711.1|  PREDICTED: glycerophosphodiester phosphodies...    323   7e-98    Camelina sativa [gold-of-pleasure]
ref|XP_004491451.1|  PREDICTED: probable glycerophosphoryl dieste...    323   9e-98    Cicer arietinum [garbanzo]
ref|XP_004500131.1|  PREDICTED: probable glycerophosphoryl dieste...    321   1e-97    Cicer arietinum [garbanzo]
ref|XP_009127510.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    322   2e-97    Brassica rapa
emb|CDY12605.1|  BnaA02g12730D                                          320   3e-97    Brassica napus [oilseed rape]
ref|XP_010252665.1|  PREDICTED: glycerophosphodiester phosphodies...    321   3e-97    Nelumbo nucifera [Indian lotus]
emb|CDX92782.1|  BnaC07g40400D                                          329   7e-97    
ref|XP_006603452.1|  PREDICTED: probable glycerophosphoryl dieste...    310   9e-97    Glycine max [soybeans]
ref|XP_010511611.1|  PREDICTED: LOW QUALITY PROTEIN: glycerophosp...    327   1e-96    
gb|AAF98210.1|AC007152_6  Unknown protein                               326   1e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010474164.1|  PREDICTED: glycerophosphodiester phosphodies...    317   2e-96    Camelina sativa [gold-of-pleasure]
ref|NP_176870.2|  suppressor of npr1-1 constitutive 4                   326   2e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010496109.1|  PREDICTED: glycerophosphodiester phosphodies...    326   2e-96    
ref|XP_010470589.1|  PREDICTED: glycerophosphodiester phosphodies...    319   2e-96    Camelina sativa [gold-of-pleasure]
ref|XP_006279182.1|  hypothetical protein CARUB_v10007932mg             317   8e-96    Capsella rubella
ref|XP_002888565.1|  glycerophosphoryl diester phosphodiesterase ...    315   2e-95    
ref|XP_006300773.1|  hypothetical protein CARUB_v10019847mg             317   2e-95    
ref|XP_002888566.1|  kinase family protein                              322   3e-95    
ref|XP_004499801.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    316   3e-95    
ref|XP_009137635.1|  PREDICTED: probable glycerophosphoryl dieste...    324   3e-95    Brassica rapa
ref|XP_010513618.1|  PREDICTED: glycerophosphodiester phosphodies...    311   1e-94    Camelina sativa [gold-of-pleasure]
ref|XP_010415240.1|  PREDICTED: glycerophosphodiester phosphodies...    313   4e-94    Camelina sativa [gold-of-pleasure]
ref|XP_010675853.1|  PREDICTED: glycerophosphodiester phosphodies...    310   4e-93    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010419030.1|  PREDICTED: glycerophosphodiester phosphodies...    310   1e-92    
emb|CDY46667.1|  BnaA03g48410D                                          317   1e-92    Brassica napus [oilseed rape]
gb|KHN28414.1|  Putative glycerophosphoryl diester phosphodiester...    307   1e-92    Glycine soja [wild soybean]
ref|XP_006300798.1|  hypothetical protein CARUB_v10019878mg             306   2e-92    
ref|XP_003553031.1|  PREDICTED: probable glycerophosphoryl dieste...    307   2e-92    
ref|XP_006300799.1|  hypothetical protein CARUB_v10019878mg             306   3e-92    
ref|XP_010252664.1|  PREDICTED: glycerophosphodiester phosphodies...    307   5e-92    Nelumbo nucifera [Indian lotus]
gb|KHM99502.1|  Putative glycerophosphoryl diester phosphodiester...    306   8e-92    Glycine soja [wild soybean]
ref|XP_003530776.1|  PREDICTED: probable glycerophosphoryl dieste...    306   9e-92    Glycine max [soybeans]
ref|XP_007146558.1|  hypothetical protein PHAVU_006G050600g             306   1e-91    Phaseolus vulgaris [French bean]
gb|KCW70260.1|  hypothetical protein EUGRSUZ_F03515                     300   3e-91    Eucalyptus grandis [rose gum]
ref|XP_008345038.1|  PREDICTED: probable glycerophosphoryl dieste...    291   1e-90    
ref|XP_009399679.1|  PREDICTED: probable glycerophosphoryl dieste...    302   7e-90    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007146552.1|  hypothetical protein PHAVU_006G050300g             300   8e-90    Phaseolus vulgaris [French bean]
gb|AES70468.2|  glycerophosphoryl diester phosphodiesterase famil...    300   2e-89    Medicago truncatula
gb|KHM99500.1|  Putative glycerophosphoryl diester phosphodiester...    300   2e-89    Glycine soja [wild soybean]
ref|XP_003600217.1|  Glycerophosphodiesterase-like protein              299   3e-89    
ref|XP_007146559.1|  hypothetical protein PHAVU_006G050800g             300   4e-89    Phaseolus vulgaris [French bean]
ref|XP_003530777.1|  PREDICTED: probable glycerophosphoryl dieste...    298   1e-88    Glycine max [soybeans]
ref|XP_010928867.1|  PREDICTED: glycerophosphodiester phosphodies...    296   1e-87    Elaeis guineensis
ref|XP_008798764.1|  PREDICTED: probable glycerophosphoryl dieste...    293   2e-87    Phoenix dactylifera
ref|XP_010913957.1|  PREDICTED: glycerophosphodiester phosphodies...    294   2e-87    
ref|XP_010913956.1|  PREDICTED: glycerophosphodiester phosphodies...    294   4e-87    Elaeis guineensis
ref|XP_003530778.1|  PREDICTED: probable glycerophosphoryl dieste...    294   5e-87    Glycine max [soybeans]
emb|CDY14478.1|  BnaC03g21170D                                          300   8e-87    Brassica napus [oilseed rape]
gb|KHN28413.1|  Putative glycerophosphoryl diester phosphodiester...    293   2e-86    Glycine soja [wild soybean]
ref|XP_008798763.1|  PREDICTED: probable glycerophosphoryl dieste...    292   4e-86    Phoenix dactylifera
ref|XP_008782908.1|  PREDICTED: probable glycerophosphoryl dieste...    291   1e-85    Phoenix dactylifera
gb|KDO62175.1|  hypothetical protein CISIN_1g003550mg                   289   2e-85    Citrus sinensis [apfelsine]
ref|XP_010483369.1|  PREDICTED: glycerophosphodiester phosphodies...    283   9e-85    Camelina sativa [gold-of-pleasure]
ref|XP_010446175.1|  PREDICTED: glycerophosphodiester phosphodies...    284   2e-84    
ref|XP_009415406.1|  PREDICTED: probable glycerophosphoryl dieste...    286   4e-84    Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAC42822.1|  GPI-anchored protein                                   275   6e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006282081.1|  hypothetical protein CARUB_v10028327mg             286   7e-84    Capsella rubella
gb|KJB13801.1|  hypothetical protein B456_002G094900                    283   3e-83    Gossypium raimondii
ref|XP_010483370.1|  PREDICTED: glycerophosphodiester phosphodies...    284   3e-83    Camelina sativa [gold-of-pleasure]
ref|XP_010453288.1|  PREDICTED: glycerophosphodiester phosphodies...    283   6e-83    Camelina sativa [gold-of-pleasure]
ref|XP_002523503.1|  glycerophosphoryl diester phosphodiesterase,...    283   7e-83    Ricinus communis
gb|KEH28442.1|  glycerophosphoryl diester phosphodiesterase famil...    281   7e-83    Medicago truncatula
ref|XP_008806340.1|  PREDICTED: probable glycerophosphoryl dieste...    284   9e-83    Phoenix dactylifera
gb|KJB13800.1|  hypothetical protein B456_002G094900                    281   1e-82    Gossypium raimondii
ref|XP_010453117.1|  PREDICTED: glycerophosphodiester phosphodies...    281   2e-82    Camelina sativa [gold-of-pleasure]
ref|XP_009120321.1|  PREDICTED: probable glycerophosphoryl dieste...    280   6e-82    Brassica rapa
ref|XP_010675854.1|  PREDICTED: glycerophosphodiester phosphodies...    280   7e-82    Beta vulgaris subsp. vulgaris [field beet]
emb|CDY58867.1|  BnaC09g52640D                                          279   8e-82    Brassica napus [oilseed rape]
dbj|BAD94535.1|  Glycerophosphodiesterase-like                          269   1e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002866246.1|  glycerophosphoryl diester phosphodiesterase ...    279   2e-81    Arabidopsis lyrata subsp. lyrata
ref|XP_002866252.1|  glycerophosphoryl diester phosphodiesterase ...    278   3e-81    Arabidopsis lyrata subsp. lyrata
ref|XP_009126795.1|  PREDICTED: probable glycerophosphoryl dieste...    278   4e-81    Brassica rapa
emb|CDX86766.1|  BnaA09g21560D                                          275   4e-81    
ref|XP_008242952.1|  PREDICTED: probable glycerophosphoryl dieste...    279   4e-81    Prunus mume [ume]
ref|XP_006401135.1|  hypothetical protein EUTSA_v10012762mg             278   5e-81    
ref|XP_008811209.1|  PREDICTED: probable glycerophosphoryl dieste...    278   7e-81    Phoenix dactylifera
ref|XP_007201937.1|  hypothetical protein PRUPE_ppa001673mg             278   1e-80    Prunus persica
ref|XP_010545539.1|  PREDICTED: glycerophosphodiester phosphodies...    276   1e-80    Tarenaya hassleriana [spider flower]
ref|XP_006297062.1|  hypothetical protein CARUB_v10013062mg             276   2e-80    Capsella rubella
ref|XP_007011972.1|  SHV3-like 5                                        276   2e-80    
ref|XP_009358473.1|  PREDICTED: probable glycerophosphoryl dieste...    276   3e-80    Pyrus x bretschneideri [bai li]
ref|XP_004952935.1|  PREDICTED: probable glycerophosphoryl dieste...    275   3e-80    
ref|NP_200625.1|  glycerophosphodiester phosphodiesterase like 7        275   5e-80    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002308389.2|  hypothetical protein POPTR_0006s20170g             275   7e-80    
emb|CDY12599.1|  BnaA02g12670D                                          266   7e-80    Brassica napus [oilseed rape]
ref|XP_009132086.1|  PREDICTED: probable glycerophosphoryl dieste...    275   1e-79    Brassica rapa
ref|XP_004975931.1|  PREDICTED: probable glycerophosphoryl dieste...    274   1e-79    Setaria italica
ref|XP_009390640.1|  PREDICTED: probable glycerophosphoryl dieste...    273   2e-79    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008361197.1|  PREDICTED: probable glycerophosphoryl dieste...    274   3e-79    
ref|NP_001053060.1|  Os04g0472300                                       273   3e-79    
emb|CAH67272.1|  B0806H07.1                                             273   4e-79    Oryza sativa [red rice]
emb|CDX82242.1|  BnaA03g35790D                                          265   4e-79    
ref|XP_002325146.2|  hypothetical protein POPTR_0018s11890g             272   6e-79    Populus trichocarpa [western balsam poplar]
ref|XP_011033465.1|  PREDICTED: glycerophosphodiester phosphodies...    272   6e-79    Populus euphratica
ref|XP_006652401.1|  PREDICTED: probable glycerophosphoryl dieste...    272   8e-79    Oryza brachyantha
ref|XP_009126781.1|  PREDICTED: probable glycerophosphoryl dieste...    271   1e-78    
ref|XP_009126782.1|  PREDICTED: probable glycerophosphoryl dieste...    271   1e-78    
emb|CDY32720.1|  BnaA02g07820D                                          271   2e-78    Brassica napus [oilseed rape]
ref|XP_010536984.1|  PREDICTED: glycerophosphodiester phosphodies...    270   3e-78    Tarenaya hassleriana [spider flower]
ref|XP_010943202.1|  PREDICTED: glycerophosphodiester phosphodies...    271   4e-78    Elaeis guineensis
ref|XP_009366150.1|  PREDICTED: probable glycerophosphoryl dieste...    271   4e-78    Pyrus x bretschneideri [bai li]
ref|XP_008645878.1|  PREDICTED: probable glycerophosphoryl dieste...    270   5e-78    Zea mays [maize]
ref|NP_200613.2|  glycerophosphodiester phosphodiesterase like 6        269   8e-78    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008799657.1|  PREDICTED: probable glycerophosphoryl dieste...    269   9e-78    Phoenix dactylifera
ref|XP_010235616.1|  PREDICTED: glycerophosphodiester phosphodies...    266   2e-77    
ref|XP_008345027.1|  PREDICTED: probable glycerophosphoryl dieste...    255   3e-77    
gb|EMS58329.1|  putative glycerophosphoryl diester phosphodiester...    268   3e-77    Triticum urartu
ref|XP_003579951.1|  PREDICTED: glycerophosphodiester phosphodies...    268   3e-77    Brachypodium distachyon [annual false brome]
ref|XP_009385529.1|  PREDICTED: probable glycerophosphoryl dieste...    265   3e-77    
ref|XP_006300797.1|  hypothetical protein CARUB_v10019878mg             266   4e-77    
ref|XP_007020655.1|  SHV3-like 2, putative isoform 4                    263   5e-77    
gb|KDO59429.1|  hypothetical protein CISIN_1g005894mg                   265   6e-77    Citrus sinensis [apfelsine]
ref|XP_010913177.1|  PREDICTED: glycerophosphodiester phosphodies...    267   6e-77    Elaeis guineensis
dbj|BAJ85772.1|  predicted protein                                      266   8e-77    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003575252.1|  PREDICTED: glycerophosphodiester phosphodies...    266   9e-77    
ref|XP_010928375.1|  PREDICTED: LOW QUALITY PROTEIN: glycerophosp...    266   1e-76    Elaeis guineensis
emb|CDY29432.1|  BnaC05g32380D                                          262   1e-76    Brassica napus [oilseed rape]
ref|XP_011017989.1|  PREDICTED: glycerophosphodiester phosphodies...    266   2e-76    Populus euphratica
ref|XP_006474608.1|  PREDICTED: probable glycerophosphoryl dieste...    266   2e-76    
ref|XP_008384576.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    265   6e-76    
emb|CDY32730.1|  BnaA02g07920D                                          264   6e-76    Brassica napus [oilseed rape]
dbj|BAJ87963.1|  predicted protein                                      263   1e-75    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008343908.1|  PREDICTED: probable glycerophosphoryl dieste...    264   2e-75    
ref|XP_010656583.1|  PREDICTED: glycerophosphodiester phosphodies...    263   2e-75    Vitis vinifera
ref|XP_002862842.1|  glycerophosphoryl diester phosphodiesterase ...    262   2e-75    
ref|XP_002883252.1|  glycerophosphoryl diester phosphodiesterase ...    262   2e-75    
emb|CBI18678.3|  unnamed protein product                                263   2e-75    Vitis vinifera
gb|KCW78936.1|  hypothetical protein EUGRSUZ_C00368                     262   3e-75    Eucalyptus grandis [rose gum]
emb|CDY02788.1|  BnaC02g11010D                                          262   4e-75    
ref|XP_010050300.1|  PREDICTED: probable glycerophosphoryl dieste...    262   6e-75    
emb|CDY02800.1|  BnaC02g10890D                                          259   3e-74    
ref|XP_009127505.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    265   4e-74    
emb|CDY19634.1|  BnaA05g20420D                                          257   2e-73    Brassica napus [oilseed rape]
ref|XP_010687738.1|  PREDICTED: glycerophosphodiester phosphodies...    257   2e-73    Beta vulgaris subsp. vulgaris [field beet]
emb|CDX88656.1|  BnaA03g09930D                                          258   2e-73    
ref|XP_009145621.1|  PREDICTED: probable glycerophosphoryl dieste...    256   3e-73    Brassica rapa
ref|XP_010109457.1|  putative glycerophosphoryl diester phosphodi...    257   3e-73    Morus notabilis
emb|CDY36036.1|  BnaC03g41620D                                          258   8e-73    Brassica napus [oilseed rape]
emb|CDY43885.1|  BnaC09g33580D                                          256   8e-73    Brassica napus [oilseed rape]
ref|NP_001062173.1|  Os08g0503200                                       256   1e-72    
ref|XP_002300352.2|  hypothetical protein POPTR_0001s371702g            241   2e-72    
ref|XP_006660255.1|  PREDICTED: probable glycerophosphoryl dieste...    255   2e-72    
ref|XP_010241663.1|  PREDICTED: glycerophosphodiester phosphodies...    254   3e-72    Nelumbo nucifera [Indian lotus]
ref|XP_006406374.1|  hypothetical protein EUTSA_v10020151mg             254   3e-72    
ref|XP_010433460.1|  PREDICTED: glycerophosphodiester phosphodies...    253   3e-72    
ref|XP_006647435.1|  PREDICTED: probable glycerophosphoryl dieste...    254   3e-72    Oryza brachyantha
ref|XP_009396661.1|  PREDICTED: probable glycerophosphoryl dieste...    254   4e-72    
emb|CDY60415.1|  BnaC02g45340D                                          258   4e-72    Brassica napus [oilseed rape]
gb|KFK39359.1|  hypothetical protein AALP_AA3G234500                    254   4e-72    Arabis alpina [alpine rockcress]
ref|XP_002452366.1|  hypothetical protein SORBIDRAFT_04g024440          254   4e-72    Sorghum bicolor [broomcorn]
ref|XP_012071459.1|  PREDICTED: glycerophosphodiester phosphodies...    253   1e-71    Jatropha curcas
emb|CDY42328.1|  BnaC02g17050D                                          239   2e-71    Brassica napus [oilseed rape]
ref|XP_006856834.1|  PREDICTED: glycerophosphodiester phosphodies...    252   2e-71    Amborella trichopoda
ref|NP_001169682.1|  hypothetical protein precursor                     251   3e-71    Zea mays [maize]
gb|EMT15515.1|  Putative glycerophosphoryl diester phosphodiester...    253   3e-71    
ref|NP_001168748.1|  uncharacterized protein LOC100382543 precursor     251   5e-71    Zea mays [maize]
gb|EAY86479.1|  hypothetical protein OsI_07859                          250   5e-71    Oryza sativa Indica Group [Indian rice]
ref|XP_009364630.1|  PREDICTED: probable glycerophosphoryl dieste...    237   6e-71    
ref|NP_001047275.1|  Os02g0588500                                       250   1e-70    
gb|EMS66577.1|  putative glycerophosphoryl diester phosphodiester...    255   1e-70    Triticum urartu
ref|XP_002446646.1|  hypothetical protein SORBIDRAFT_06g019730          250   1e-70    Sorghum bicolor [broomcorn]
ref|XP_009417318.1|  PREDICTED: probable glycerophosphoryl dieste...    249   2e-70    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_188688.1|  glycerophosphodiester phosphodiesterase-like pr...    247   7e-70    Arabidopsis thaliana [mouse-ear cress]
gb|AAO42211.1|  unknown protein                                         247   7e-70    Arabidopsis thaliana [mouse-ear cress]
emb|CAN61355.1|  hypothetical protein VITISV_027762                     245   9e-70    Vitis vinifera
dbj|BAJ93663.1|  predicted protein                                      248   1e-69    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006829998.1|  PREDICTED: glycerophosphodiester phosphodies...    247   1e-69    Amborella trichopoda
ref|XP_007146557.1|  hypothetical protein PHAVU_006G050600g             245   2e-69    Phaseolus vulgaris [French bean]
gb|AES92567.2|  glycerophosphoryl diester phosphodiesterase famil...    246   3e-69    Medicago truncatula
ref|XP_002437331.1|  hypothetical protein SORBIDRAFT_10g025000          246   3e-69    
ref|XP_004965787.1|  PREDICTED: probable glycerophosphoryl dieste...    243   6e-69    
gb|EMT33222.1|  Putative glycerophosphoryl diester phosphodiester...    245   1e-68    
gb|EMS62136.1|  putative glycerophosphoryl diester phosphodiester...    244   1e-68    Triticum urartu
ref|XP_003572357.1|  PREDICTED: glycerophosphodiester phosphodies...    244   2e-68    
gb|KEH37864.1|  glycerophosphoryl diester phosphodiesterase famil...    244   5e-68    Medicago truncatula
gb|KHG04342.1|  putative glycerophosphoryl diester phosphodiester...    238   7e-68    Gossypium arboreum [tree cotton]
gb|KHN41389.1|  Putative glycerophosphoryl diester phosphodiester...    228   1e-67    Glycine soja [wild soybean]
ref|XP_004965786.1|  PREDICTED: probable glycerophosphoryl dieste...    242   2e-67    
ref|XP_006279181.1|  hypothetical protein CARUB_v10007932mg             240   2e-67    
gb|AFW66254.1|  hypothetical protein ZEAMMB73_246886                    240   4e-67    
gb|ABG22015.1|  Glycerophosphoryl diester phosphodiesterase famil...    231   7e-67    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008677441.1|  PREDICTED: uncharacterized protein LOC100304...    241   2e-66    
ref|NP_001066731.1|  Os12g0456700                                       231   4e-66    
ref|XP_008677439.1|  PREDICTED: uncharacterized protein LOC100304...    241   4e-66    
ref|XP_006586115.1|  PREDICTED: probable glycerophosphoryl dieste...    235   1e-65    
ref|XP_004973844.1|  PREDICTED: probable glycerophosphoryl dieste...    236   2e-65    
ref|XP_003610370.1|  GPI-anchored protein                               233   1e-64    
gb|KJB54927.1|  hypothetical protein B456_009G054700                    232   6e-64    
emb|CDP10204.1|  unnamed protein product                                231   2e-63    
emb|CDX86807.1|  BnaA09g21970D                                          217   2e-63    
gb|KHN22089.1|  Putative glycerophosphoryl diester phosphodiester...    229   3e-63    
ref|XP_003541467.2|  PREDICTED: probable glycerophosphoryl dieste...    229   9e-63    
ref|XP_008677440.1|  PREDICTED: uncharacterized protein LOC100304...    231   2e-62    
gb|AAD10252.1|  S222                                                    221   3e-62    
ref|XP_004979884.1|  PREDICTED: probable glycerophosphoryl dieste...    228   1e-61    
ref|XP_010315562.1|  PREDICTED: glycerophosphodiester phosphodies...    224   2e-61    
gb|AFW70514.1|  hypothetical protein ZEAMMB73_076757                    223   3e-61    
ref|XP_002461022.1|  hypothetical protein SORBIDRAFT_02g039350          221   4e-61    
gb|EMT03737.1|  Putative glycerophosphoryl diester phosphodiester...    227   5e-61    
ref|XP_008645346.1|  PREDICTED: probable glycerophosphoryl dieste...    222   1e-60    
ref|XP_006600556.1|  PREDICTED: probable glycerophosphoryl dieste...    222   2e-60    
gb|KHN18329.1|  Putative glycerophosphoryl diester phosphodiester...    222   2e-60    
ref|XP_009803612.1|  PREDICTED: probable glycerophosphoryl dieste...    221   3e-60    
ref|XP_008440682.1|  PREDICTED: probable glycerophosphoryl dieste...    221   4e-60    
ref|XP_011084009.1|  PREDICTED: glycerophosphodiester phosphodies...    219   2e-59    
ref|XP_006340583.1|  PREDICTED: probable glycerophosphoryl dieste...    219   2e-59    
ref|XP_009594117.1|  PREDICTED: probable glycerophosphoryl dieste...    219   3e-59    
ref|XP_004143578.1|  PREDICTED: glycerophosphodiester phosphodies...    218   4e-59    
ref|XP_011460616.1|  PREDICTED: glycerophosphodiester phosphodies...    216   3e-58    
ref|XP_002445920.1|  hypothetical protein SORBIDRAFT_07g028050          216   4e-58    
ref|XP_004951679.1|  PREDICTED: probable glycerophosphoryl dieste...    214   1e-57    
gb|EYU25341.1|  hypothetical protein MIMGU_mgv1a001922mg                212   5e-57    
ref|XP_010315575.1|  PREDICTED: glycerophosphodiester phosphodies...    211   1e-56    
ref|XP_006340538.1|  PREDICTED: probable glycerophosphoryl dieste...    211   1e-56    
ref|XP_008679540.1|  PREDICTED: probable glycerophosphoryl dieste...    211   1e-56    
ref|XP_010433459.1|  PREDICTED: glycerophosphodiester phosphodies...    199   1e-56    
ref|XP_003570935.1|  PREDICTED: glycerophosphodiester phosphodies...    210   2e-56    
dbj|BAD15424.1|  glycerophosphoryl diester phosphodiesterase 2 pr...    207   5e-55    
ref|XP_007154910.1|  hypothetical protein PHAVU_003G158000g             206   7e-55    
ref|XP_009803613.1|  PREDICTED: probable glycerophosphoryl dieste...    205   1e-54    
gb|EPS68532.1|  hypothetical protein M569_06231                         203   5e-54    
ref|XP_002453429.1|  hypothetical protein SORBIDRAFT_04g005910          193   1e-53    
ref|XP_010231120.1|  PREDICTED: glycerophosphodiester phosphodies...    200   3e-53    
ref|XP_006387051.1|  hypothetical protein POPTR_2051s00200g             188   6e-53    
ref|XP_003566003.1|  PREDICTED: glycerophosphodiester phosphodies...    200   1e-52    
gb|EEE53168.1|  hypothetical protein OsJ_36008                          203   1e-52    
ref|XP_010231119.1|  PREDICTED: glycerophosphodiester phosphodies...    199   1e-52    
dbj|BAK08209.1|  predicted protein                                      197   8e-52    
gb|KDO62176.1|  hypothetical protein CISIN_1g003550mg                   196   1e-51    
ref|XP_010913178.1|  PREDICTED: glycerophosphodiester phosphodies...    193   2e-50    
gb|EMT22700.1|  Putative glycerophosphoryl diester phosphodiester...    194   2e-50    
ref|XP_004973845.1|  PREDICTED: probable glycerophosphoryl dieste...    192   3e-50    
ref|NP_001046128.1|  Os02g0187400                                       189   4e-49    
gb|EEC72640.1|  hypothetical protein OsI_06154                          189   2e-48    
ref|XP_010496105.1|  PREDICTED: glycerophosphodiester phosphodies...    171   2e-46    
gb|EMT29224.1|  Putative glycerophosphoryl diester phosphodiester...    181   7e-46    
gb|AFW58562.1|  hypothetical protein ZEAMMB73_533189                    171   1e-45    
ref|XP_008811210.1|  PREDICTED: probable glycerophosphoryl dieste...    171   6e-43    
gb|EMS54688.1|  putative glycerophosphoryl diester phosphodiester...    171   9e-43    
gb|EEC69228.1|  hypothetical protein OsI_38235                          172   2e-42    
gb|EEE56466.1|  hypothetical protein OsJ_05675                          169   1e-41    
ref|NP_001170117.1|  hypothetical protein                               155   2e-37    
ref|NP_001141559.1|  hypothetical protein                               148   4e-37    
ref|XP_008645839.1|  PREDICTED: uncharacterized protein LOC100384...    153   1e-36    
gb|ACF79780.1|  unknown                                                 149   1e-36    
ref|XP_010443532.1|  PREDICTED: glycerophosphodiester phosphodies...    146   7e-35    
ref|XP_001766682.1|  predicted protein                                  146   1e-34    
ref|XP_006301866.1|  hypothetical protein CARUB_v10022337mg             136   7e-34    
gb|ACF74306.1|  putative glycerophosphoryl diesterphosphodiestera...    134   3e-33    
ref|XP_002973791.1|  hypothetical protein SELMODRAFT_100702             137   2e-31    
ref|XP_002983605.1|  hypothetical protein SELMODRAFT_118548             136   6e-31    
ref|XP_007146555.1|  hypothetical protein PHAVU_006G0504000g            122   3e-29    
ref|XP_009129031.1|  PREDICTED: probable glycerophosphoryl dieste...    123   3e-28    
ref|XP_008364336.1|  PREDICTED: probable glycerophosphoryl dieste...    124   3e-27    
emb|CDY59886.1|  BnaC02g47600D                                          117   3e-27    
ref|XP_002300353.2|  glycerophosphoryl diester phosphodiesterase ...    122   1e-26    
ref|XP_001756342.1|  predicted protein                                  122   2e-26    
ref|NP_001062919.2|  Os09g0339800                                       121   4e-26    
dbj|BAD28342.1|  glycerophosphoryl diester phosphodiesterase 2 pr...    117   1e-24    
ref|XP_007020654.1|  PLC-like phosphodiesterase family protein, p...    115   2e-24    
ref|XP_010489971.1|  PREDICTED: glycerophosphodiester phosphodies...    110   2e-23    
emb|CDY11832.1|  BnaC03g12580D                                          101   2e-21    
emb|CDY11831.1|  BnaC03g12570D                                          102   5e-20    
ref|NP_001159159.1|  uncharacterized protein LOC100304242             96.3    1e-19    
ref|XP_008336911.1|  PREDICTED: probable glycerophosphoryl dieste...  96.3    1e-19    
emb|CDY72472.1|  BnaAnng41260D                                        99.4    2e-19    
ref|XP_007146553.1|  hypothetical protein PHAVU_006G0504001g          98.2    1e-18    
dbj|BAD94065.1|  Glycerophosphodiesterase-like                        87.0    9e-17    
ref|XP_001756508.1|  predicted protein                                93.2    1e-16    
gb|EYU43134.1|  hypothetical protein MIMGU_mgv11b015422mg             81.6    4e-15    
dbj|BAD94573.1|  Glycerophosphodiesterase-like                        81.6    1e-14    
tpg|DAA47913.1|  TPA: hypothetical protein ZEAMMB73_887943            78.6    5e-12    
emb|CDY28913.1|  BnaA02g25630D                                        69.7    2e-10    
ref|XP_008349893.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...  71.6    5e-10    
ref|XP_009364631.1|  PREDICTED: probable glycerophosphoryl dieste...  71.2    7e-10    
ref|XP_003549570.1|  PREDICTED: probable glycerophosphoryl dieste...  65.9    3e-08    
ref|NP_001241112.1|  uncharacterized protein LOC100778145 precursor   63.5    2e-07    
ref|XP_010695228.1|  PREDICTED: glycerophosphodiester phosphodies...  63.2    2e-07    
ref|XP_006602095.1|  PREDICTED: uncharacterized protein LOC100782575  58.9    5e-07    
gb|KDO62177.1|  hypothetical protein CISIN_1g003550mg                 60.5    2e-06    
ref|XP_010068779.1|  PREDICTED: probable glycerophosphoryl dieste...  59.7    3e-06    
gb|KCW64880.1|  hypothetical protein EUGRSUZ_G02445                   59.7    3e-06    
ref|XP_006650282.1|  PREDICTED: probable glycerophosphoryl dieste...  58.2    9e-06    
emb|CDX99041.1|  BnaC09g47940D                                        57.8    1e-05    
ref|XP_006344951.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...  57.8    1e-05    
ref|XP_002965444.1|  hypothetical protein SELMODRAFT_167542           57.8    1e-05    
ref|XP_002984547.1|  hypothetical protein SELMODRAFT_120066           57.4    1e-05    
ref|NP_196420.1|  glycerophosphoryl diester phosphodiesterase         57.0    2e-05    
ref|XP_010491423.1|  PREDICTED: glycerophosphodiester phosphodies...  56.6    3e-05    
gb|EEE69509.1|  hypothetical protein OsJ_28963                        56.6    3e-05    
dbj|BAF81519.1|  glycerophosphodiester phosphodiesterase              55.8    4e-05    
ref|XP_009122415.1|  PREDICTED: probable glycerophosphoryl dieste...  55.8    4e-05    
ref|XP_010423145.1|  PREDICTED: glycerophosphodiester phosphodies...  55.5    5e-05    
gb|ERN07541.1|  hypothetical protein AMTR_s00154p00055550             55.1    8e-05    
ref|XP_011623962.1|  PREDICTED: glycerophosphodiester phosphodies...  55.1    8e-05    
ref|XP_009122414.1|  PREDICTED: probable glycerophosphoryl dieste...  55.1    9e-05    
ref|XP_002283945.1|  PREDICTED: glycerophosphodiester phosphodies...  53.9    2e-04    
ref|XP_010452775.1|  PREDICTED: glycerophosphodiester phosphodies...  53.9    2e-04    
ref|XP_009020602.1|  hypothetical protein HELRODRAFT_192312           53.5    3e-04    
emb|CBY07237.1|  unnamed protein product                              52.8    4e-04    
ref|XP_006399290.1|  hypothetical protein EUTSA_v10013858mg           52.8    4e-04    
gb|AFW72078.1|  hypothetical protein ZEAMMB73_869244                  52.0    7e-04    
gb|AFW70515.1|  hypothetical protein ZEAMMB73_076757                  52.0    7e-04    



>ref|XP_009625976.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Nicotiana tomentosiformis]
 dbj|BAE53680.1| putative glycerophosphoryl diester phosphodiesterase family protein 
[Nicotiana tabacum]
 dbj|BAF34116.1| glycerophosphodiesterase-like protein [Nicotiana tabacum]
Length=752

 Score =   431 bits (1107),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 216/325 (66%), Positives = 262/325 (81%), Gaps = 8/325 (2%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QMTKD +PFC+GS+N+ID TTAAQ  FSN+A ++PELK  N I + +L W +IQSL+  I
Sbjct  392   QMTKDRVPFCLGSINLIDKTTAAQSPFSNIATTVPELKITNGILTINLTWTEIQSLKPAI  451

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SN +++FRLFRNP A+N+G FM+L DFLTFA NATSVSGV+I+VENAAY+A K+GLGVT 
Sbjct  452   SNRWSEFRLFRNPKARNDGNFMSLADFLTFAKNATSVSGVMISVENAAYMA-KQGLGVTG  510

Query  1073  AVLLALNKA---DLKTKKVMIHSNDSSVLMKFTNSKYERVYGIKEEISDIQNSTILEIKK  903
             AVL AL+KA   +   KKV+I S DSSVL +F  S YE VYG+ ++I DI++STILEIK 
Sbjct  511   AVLDALSKAGYNNQTAKKVLIQSTDSSVLEEFKKSSYELVYGVGDDIRDIESSTILEIKT  570

Query  902   FASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVE  723
             FA SVII K SVFP++D+F++  TNVV KLQ+S + VYVQL +NEFVSQ+WDFFSD  VE
Sbjct  571   FAKSVIITKQSVFPSEDAFIIAQTNVVQKLQSSNLTVYVQLLNNEFVSQSWDFFSDSSVE  630

Query  722   LNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLP  543
             LN+Y  GA     DGVIT +PATA RYRRNRCLG+K+ PPYM  V PGSLL+LM+PQ+LP
Sbjct  631   LNNYAVGAG---IDGVITEYPATAARYRRNRCLGFKDSPPYMTSVQPGSLLELMAPQFLP  687

Query  542   PAEAPYPVLTESDVVEPPLPPVAKI  468
             PAEAP PVLTESDVVEPPLPPVAKI
Sbjct  688   PAEAPNPVLTESDVVEPPLPPVAKI  712



>ref|XP_009787408.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Nicotiana sylvestris]
Length=752

 Score =   429 bits (1103),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 215/325 (66%), Positives = 261/325 (80%), Gaps = 8/325 (2%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QMTKDGIPFC+GS+N+ID TTAAQ  FS++  ++PELK  N I + +L W +IQSL+  I
Sbjct  392   QMTKDGIPFCLGSINLIDKTTAAQSPFSSITTTVPELKITNGILTINLTWTEIQSLRPTI  451

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SN ++ FRLFRNP A+N+G FM+L DFLTFA N TSVSGV+I++ENAAYLA K+GLGVT 
Sbjct  452   SNRWSVFRLFRNPKARNDGNFMSLADFLTFAKNTTSVSGVMISIENAAYLA-KQGLGVTG  510

Query  1073  AVLLALNKA---DLKTKKVMIHSNDSSVLMKFTNSKYERVYGIKEEISDIQNSTILEIKK  903
             AVL AL+K+   +   KKV+I S DSSVL +F  S YE VYG+ ++I DI++STILEIK 
Sbjct  511   AVLDALSKSGYNNQTAKKVLIQSTDSSVLEEFKKSSYELVYGVGDDIRDIESSTILEIKT  570

Query  902   FASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVE  723
             FA SVII K SVFP++D+F++  TNVV KLQ+S + VYVQLF+NEFVSQAWDFFSD  +E
Sbjct  571   FAKSVIITKESVFPSEDAFIIAQTNVVQKLQSSNLTVYVQLFNNEFVSQAWDFFSDSSLE  630

Query  722   LNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLP  543
             LN+Y  GA     DGVIT +PATA RYRRNRCLG K++PPYM PV PGSLL L++PQ+LP
Sbjct  631   LNNYAVGAG---IDGVITEYPATAARYRRNRCLGLKDLPPYMSPVQPGSLLGLIAPQFLP  687

Query  542   PAEAPYPVLTESDVVEPPLPPVAKI  468
             PAEAP PVLTESDVVEPPLPPVAKI
Sbjct  688   PAEAPNPVLTESDVVEPPLPPVAKI  712



>ref|XP_011097815.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Sesamum indicum]
Length=760

 Score =   405 bits (1040),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 201/325 (62%), Positives = 252/325 (78%), Gaps = 8/325 (2%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QMT DG+P C+GS+N+ D T  AQ  FSNLA   P+L  QN I +++L W  IQ+L+  I
Sbjct  395   QMTNDGVPICLGSINLRDRTDVAQSDFSNLATDNPDLNIQNGIFTYNLTWSQIQTLKPAI  454

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNP++ + LFRNP ++N+G  M+L DFL FA NA+SVSGVLIT+ENAAYLA+K+GLGVTD
Sbjct  455   SNPYSNYSLFRNPRSRNDGNLMSLADFLAFANNASSVSGVLITIENAAYLAQKQGLGVTD  514

Query  1073  AVLLALNKA---DLKTKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTILEIK  906
             AV+ AL+KA   +  TKKVMI S+DS+VL+KF ++S YE VY +  ++ DI NSTILEIK
Sbjct  515   AVVDALSKAGYNNQTTKKVMIRSSDSAVLLKFKSSSNYELVYLVDNDVRDILNSTILEIK  574

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             KFASSV++ K SVFPTDD+F+ G TNVV KLQA  + VYVQ F NEFV+Q WDFFSD YV
Sbjct  575   KFASSVVLSKGSVFPTDDAFVTGETNVVPKLQAFNLTVYVQYFRNEFVAQPWDFFSDAYV  634

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYL  546
             E+N++V   S    +GV+T FPATA +YRRNRCLGYKE+P YM PV P  L+ LM+P++L
Sbjct  635   EINTHV---SYMGINGVVTDFPATAAKYRRNRCLGYKEVPLYMTPVQPAGLISLMAPKFL  691

Query  545   PPAEAPYPVLTESDVVEPPLPPVAK  471
             PPAEAP PVLTE+DV EPPLPPV +
Sbjct  692   PPAEAPNPVLTENDVTEPPLPPVVE  716



>ref|XP_009588257.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Nicotiana tomentosiformis]
Length=741

 Score =   403 bits (1036),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 202/325 (62%), Positives = 252/325 (78%), Gaps = 8/325 (2%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM KDGIPFC+GS+N+ID TT AQ  F N+  ++PEL   N I +F+L W +I+SL+  I
Sbjct  380   QMAKDGIPFCLGSINLIDKTTVAQSPFDNIGSAVPELNITNGIFTFNLTWDEIKSLKPAI  439

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNP+++FRL+RNP A+N+G F++L DFLT+A NAT+VSGV+I +ENAAYLA K G GVT 
Sbjct  440   SNPWSEFRLYRNPKARNDGNFVSLVDFLTYAKNATTVSGVMIGIENAAYLA-KHGFGVTA  498

Query  1073  AVLLALNKA---DLKTKKVMIHSNDSSVLMKFTNSKYERVYGIKEEISDIQNSTILEIKK  903
             AVL AL+ A   +   KKVMI S DSSVL +F  S+YE VY + ++ISDI+ STI EIK 
Sbjct  499   AVLKALSSAAYNNQSAKKVMIQSTDSSVLKEFKKSQYELVYRVADDISDIKISTISEIKS  558

Query  902   FASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVE  723
             FASSVI+ K SVFP+++ FL+G T+VV KLQ+S + VY +LF+NEFVSQAWDFFSD  VE
Sbjct  559   FASSVIVTKKSVFPSEEEFLIGQTDVVQKLQSSNLPVYARLFNNEFVSQAWDFFSDSSVE  618

Query  722   LNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLP  543
             +N+Y+ GA     DG+IT FP TA RYRRNRCLGYK+ P Y+ PV PG LLQ M+PQ LP
Sbjct  619   INNYISGAG---IDGIITEFPGTAARYRRNRCLGYKDRPLYLSPVEPGGLLQFMAPQLLP  675

Query  542   PAEAPYPVLTESDVVEPPLPPVAKI  468
              AEAP P+LT+SDVVEPPLPPVAKI
Sbjct  676   AAEAPNPILTDSDVVEPPLPPVAKI  700



>ref|XP_006344880.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Solanum tuberosum]
Length=753

 Score =   400 bits (1027),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 204/325 (63%), Positives = 248/325 (76%), Gaps = 8/325 (2%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QMTKDGIPFC+GS+N+ID TT  Q  F+N+A ++PEL   N I +F+L W +I SL+ +I
Sbjct  391   QMTKDGIPFCLGSINLIDKTTVFQSLFTNIASTVPELNITNGIVTFNLTWDEINSLKPEI  450

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             +NP+ +FRL+RNP A+NEG F++L DFLT+A NAT+VSGV+I++ENAAYLA  +G GVTD
Sbjct  451   TNPWLEFRLYRNPKARNEGNFVSLVDFLTYAKNATTVSGVMISIENAAYLA-NQGFGVTD  509

Query  1073  AVLLALNKA---DLKTKKVMIHSNDSSVLMKFTNSKYERVYGIKEEISDIQNSTILEIKK  903
             AV  AL  A   +   KKVMI S DSSVL +F  ++YE VY + ++ISDI++STI EIK 
Sbjct  510   AVREALRNAGYNNQTVKKVMIQSKDSSVLKEFKKTRYELVYRVADDISDIESSTISEIKS  569

Query  902   FASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVE  723
             FASSVI+ K+SVFP++  FLVG TNVV KL +S + VYVQ F+NEFVSQAWDFFSD  VE
Sbjct  570   FASSVILTKNSVFPSESKFLVGKTNVVEKLHSSNLSVYVQRFNNEFVSQAWDFFSDSSVE  629

Query  722   LNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLP  543
             +N+Y  GA     DGVIT FP TA RYRRNRCL YK  P Y   V PG LLQ MS Q LP
Sbjct  630   INNYFIGAG---IDGVITDFPRTAARYRRNRCLRYKVPPLYFSLVSPGVLLQFMSRQSLP  686

Query  542   PAEAPYPVLTESDVVEPPLPPVAKI  468
             PAEAP P+LTESDVVEPPLPPVAKI
Sbjct  687   PAEAPSPILTESDVVEPPLPPVAKI  711



>ref|XP_006346174.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Solanum tuberosum]
Length=753

 Score =   396 bits (1017),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 201/325 (62%), Positives = 252/325 (78%), Gaps = 9/325 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QMTKDGIPFC+GS+N+ID TTAAQ  FS++A ++PEL+  + I + +LNW DIQ+L+  I
Sbjct  392   QMTKDGIPFCLGSINLIDTTTAAQSPFSDIATTVPELQITDGILTINLNWSDIQTLKPAI  451

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             S  ++ + L RNP A+N+G FM+L DFLTF+ NA +VSGVLI++ENAAYLA K+GLGVTD
Sbjct  452   STRYSDYSLSRNPKARNDGNFMSLADFLTFSKNA-NVSGVLISIENAAYLA-KQGLGVTD  509

Query  1073  AVLLALNKA---DLKTKKVMIHSNDSSVLMKFTNSKYERVYGIKEEISDIQNSTILEIKK  903
             AV  AL+ A   +   KKVMI SNDSSVL +F  S YE VY + E+ISDI+NST+LEIK 
Sbjct  510   AVSDALSTAGYNNQTAKKVMIQSNDSSVLEEFKKSSYELVYLVDEDISDIKNSTLLEIKT  569

Query  902   FASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVE  723
             FA SV+I K+SVFP++ +F++G TNVV KLQ++ + VYV+LF+NEFVSQAWDFFSD   E
Sbjct  570   FAKSVVITKNSVFPSEGAFIIGQTNVVQKLQSANLPVYVRLFNNEFVSQAWDFFSDSSTE  629

Query  722   LNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLP  543
             LN+YV GA     DG++T +P TA RYRRNRCL YK++P YM PV PGSLL LM+ Q +P
Sbjct  630   LNNYVLGAGV---DGLVTEYPGTAARYRRNRCLAYKDLPSYMSPVQPGSLLGLMTVQSMP  686

Query  542   PAEAPYPVLTESDVVEPPLPPVAKI  468
             P E P PVL  SDV EPPLPPVAKI
Sbjct  687   PVEPPNPVLDVSDVTEPPLPPVAKI  711



>ref|XP_010324292.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4 [Solanum 
lycopersicum]
Length=753

 Score =   395 bits (1016),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 199/325 (61%), Positives = 250/325 (77%), Gaps = 9/325 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QMTKDGIPFC+ S+N+ID TTAAQ  FS++A + PEL+  + I + +LNW DIQ+L+  I
Sbjct  392   QMTKDGIPFCLSSINLIDTTTAAQSPFSDIATTAPELQITDGILTINLNWSDIQTLKPVI  451

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             S  ++ FRL RNP A+N GKFM+L DFLTF+  A +VSG++I++ENAAYLA K+GLGVTD
Sbjct  452   STRYSDFRLSRNPKARNVGKFMSLADFLTFSKTA-NVSGIMISIENAAYLA-KQGLGVTD  509

Query  1073  AVLLALNKA---DLKTKKVMIHSNDSSVLMKFTNSKYERVYGIKEEISDIQNSTILEIKK  903
             AVL AL+ A   +   +KVMI SNDSSVL +F  S YE VY + + ISDI+NSTILEIK 
Sbjct  510   AVLDALSTAGYNNQTARKVMIQSNDSSVLEEFKKSSYELVYLVDDNISDIKNSTILEIKT  569

Query  902   FASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVE  723
             FA SV+I K SVFP++D+F++G TN+V KLQ++ + VYV+LF+NEF+SQAWDFFSD   E
Sbjct  570   FAKSVVITKKSVFPSEDAFIIGQTNIVQKLQSANLPVYVRLFNNEFISQAWDFFSDSSTE  629

Query  722   LNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLP  543
             +N+YV GA     DG++T +P TA RYRRNRCL YK +PPYM PV PGSLL LM+ Q +P
Sbjct  630   INNYVLGAGV---DGLVTEYPGTAARYRRNRCLAYKNLPPYMSPVQPGSLLGLMTVQSMP  686

Query  542   PAEAPYPVLTESDVVEPPLPPVAKI  468
             P E P PVL  SDV EPPLPPVAKI
Sbjct  687   PVEPPSPVLDVSDVTEPPLPPVAKI  711



>ref|XP_004251903.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Solanum lycopersicum]
Length=751

 Score =   389 bits (999),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 198/325 (61%), Positives = 245/325 (75%), Gaps = 8/325 (2%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM KDGIPFC+GS+N+ID TT  +  F N+A ++PEL   N I +F+L W +I+SL+ +I
Sbjct  389   QMAKDGIPFCLGSINLIDKTTVFRSPFINIASTVPELNITNGIFTFNLTWDEIKSLKPEI  448

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             +NP+ +FRL+RNP A+NEG F++L +FLT+A NAT+VSGV+I++ENAAYLA  +G GVTD
Sbjct  449   TNPWLEFRLYRNPKARNEGNFVSLMEFLTYAKNATTVSGVMISIENAAYLA-NQGFGVTD  507

Query  1073  AVLLALNKA---DLKTKKVMIHSNDSSVLMKFTNSKYERVYGIKEEISDIQNSTILEIKK  903
             AVL AL  A   +   KKVMI S DSSVL +F  ++YE VY + ++ISDI++STI EI+ 
Sbjct  508   AVLEALRNAGYNNQTAKKVMIQSKDSSVLKEFKKNRYELVYRVADDISDIESSTISEIRS  567

Query  902   FASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVE  723
             FASSVI+ K SVFP++  FLVG TNVV KL +S + VYVQ F+NEFVSQ WDFFSD  VE
Sbjct  568   FASSVILTKKSVFPSESQFLVGKTNVVEKLHSSNLSVYVQHFNNEFVSQPWDFFSDSSVE  627

Query  722   LNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLP  543
             +N+Y  GA     DG+IT FP TA RYRRNRCL YK  P Y   V PG L Q MS Q LP
Sbjct  628   INNYFVGAG---IDGIITDFPRTAARYRRNRCLHYKVPPMYFSLVSPGVLQQFMSRQSLP  684

Query  542   PAEAPYPVLTESDVVEPPLPPVAKI  468
             PAEAP P+LTESDVVEPPLPPVAKI
Sbjct  685   PAEAPSPILTESDVVEPPLPPVAKI  709



>emb|CDP13760.1| unnamed protein product [Coffea canephora]
Length=745

 Score =   388 bits (997),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 193/320 (60%), Positives = 242/320 (76%), Gaps = 6/320 (2%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM++DG+PFCMGS+N+I+ TTAAQ  F +   +IP+L  Q+ I +F+L W  IQ+L+  +
Sbjct  390   QMSQDGVPFCMGSINLIERTTAAQSAFRSFTKTIPDLNIQDGIFAFNLTWSQIQTLKPSM  449

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
              NP   + LFRNP A+N+G F+ L DFL  A+NATSVSGVLI +E+AAYLA+ +GL V D
Sbjct  450   YNPNTIYALFRNPKAQNDGNFVQLSDFLAIASNATSVSGVLIGIEHAAYLAQNQGLDVVD  509

Query  1073  AVLLALNKADLKTKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTILEIKKFA  897
             AVL  LNK+    KKV+I SNDSSVL+     SKYE VY I E ISDI NSTILEI KFA
Sbjct  510   AVLTTLNKSSYN-KKVLIESNDSSVLVNIGKKSKYELVYSINETISDITNSTILEIMKFA  568

Query  896   SSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELN  717
             SSV++ K SV+P++++FL GVT VV K+QA  ++VYVQLFSNEFVSQAWDFFSDPYVE+N
Sbjct  569   SSVLVTKGSVYPSEEAFLTGVTKVVPKVQALGLRVYVQLFSNEFVSQAWDFFSDPYVEIN  628

Query  716   SYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPA  537
             +Y+   + N   G++T +PATA RYR+NRCLGYK+ P YMLPV PGSL+ +M    LPP 
Sbjct  629   TYISNMTIN---GLVTDYPATAARYRKNRCLGYKQAPSYMLPVQPGSLISVMDRSLLPPT  685

Query  536   EAPYPVLTESDVVEPPLPPV  477
             EAP PVL E+DV EPPLP V
Sbjct  686   EAPKPVLKENDVTEPPLPHV  705



>gb|EYU33686.1| hypothetical protein MIMGU_mgv1a001772mg [Erythranthe guttata]
Length=761

 Score =   384 bits (986),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 196/323 (61%), Positives = 244/323 (76%), Gaps = 8/323 (2%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             Q++ DG+PFC+GS+N+ + T AAQ  FSNLA++ P+L  ++ I +++L W  IQ+L   I
Sbjct  395   QISNDGVPFCLGSINLRERTNAAQSDFSNLAITNPDLNIEDGIFAYNLTWTQIQTLIPAI  454

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNP++ F LFRNP  +N G  M L DFL FA  A SVSGVLI++ENAAYLA+K+GLGVTD
Sbjct  455   SNPYSNFSLFRNPKNRNSGTLMQLSDFLAFANTAPSVSGVLISIENAAYLAQKQGLGVTD  514

Query  1073  AVLLALNKA---DLKTKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTILEIK  906
             AVL AL+ A   +  TKK+MI S++S+VL KF + + Y+ VY I E+I DI NSTIL+IK
Sbjct  515   AVLEALSTAGYNNQTTKKIMIKSSESAVLTKFKSTTNYDLVYLIDEDIRDILNSTILQIK  574

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             KFASSV+I K SVFPT+ +FLVG T VV KLQA  + VYVQ F NE+VSQ WDFFSD YV
Sbjct  575   KFASSVVISKRSVFPTERAFLVGETPVVPKLQAFNLTVYVQFFRNEYVSQPWDFFSDAYV  634

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYL  546
             E+N++V   S    +GVIT +PATA RY+RNRCLGYK+IP YM PV PG LL LM+ Q+L
Sbjct  635   EINTHV---SYMEINGVITDYPATAARYKRNRCLGYKDIPLYMTPVQPGGLLTLMTSQFL  691

Query  545   PPAEAPYPVLTESDVVEPPLPPV  477
             PPAEAP PVLTE DV EPPLP V
Sbjct  692   PPAEAPSPVLTEDDVAEPPLPAV  714



>gb|EYU27402.1| hypothetical protein MIMGU_mgv1a001806mg [Erythranthe guttata]
Length=757

 Score =   382 bits (980),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 187/323 (58%), Positives = 248/323 (77%), Gaps = 8/323 (2%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             Q+T DGIPFC+GS+N++D + A +  FSN+A + P+L  ++ I +++L W  IQ+L+  I
Sbjct  396   QITNDGIPFCLGSINLMDKSNAVESIFSNMATTNPDLNIRDGIFAYNLTWSQIQTLKPAI  455

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNP++ + LFRNP A+N+GKFM L +FL F  N++SV GVLI++ENAAYLAEK+GLGVTD
Sbjct  456   SNPYSNYSLFRNPRARNDGKFMQLTNFLAFGNNSSSVKGVLISIENAAYLAEKQGLGVTD  515

Query  1073  AVLLALNKA---DLKTKKVMIHSNDSSVLMKFTNS-KYERVYGIKEEISDIQNSTILEIK  906
             AVL AL K+   +  +KK+MI S+DS+VL KF +S  YE VY + E+ISDI NSTI+EIK
Sbjct  516   AVLNALRKSGHNNQTSKKIMIKSSDSAVLEKFKSSGNYELVYLVGEDISDILNSTIVEIK  575

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             +FA++V+I K SVFPTD+S++ G T+VV K+QA  + VYVQ+F NEFV+QAWDFFSD Y+
Sbjct  576   EFATAVVISKRSVFPTDESYMTGQTSVVPKIQAFNLPVYVQIFQNEFVAQAWDFFSDAYL  635

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYL  546
             E+ +YV   + N   GV+T +PATA +++RNRCLGYK  PPYM PV PG L+ LM+P  L
Sbjct  636   EMLNYVDAMNIN---GVVTDYPATAAKFKRNRCLGYKNRPPYMTPVRPGGLISLMAPGSL  692

Query  545   PPAEAPYPVLTESDVVEPPLPPV  477
              PAEAPYPVLT  DV EPPLP V
Sbjct  693   TPAEAPYPVLTGDDVAEPPLPAV  715



>ref|XP_009361078.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Pyrus x bretschneideri]
Length=752

 Score =   375 bits (963),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 190/323 (59%), Positives = 244/323 (76%), Gaps = 8/323 (2%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             Q++KDGIPFC  S+N+ID TT AQ  F++L   +PE+K  + I++F L WKDI+ L   I
Sbjct  389   QISKDGIPFCASSINLIDSTTVAQSPFNSLTAFVPEIKAGSGIYTFSLAWKDIEGLTPTI  448

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNP++KF LFRNP++K  GK++TL DFL  A  ++S+SGVLI +E AAYLAEK+ L +TD
Sbjct  449   SNPWSKFTLFRNPMSKTGGKYLTLSDFLALAKRSSSLSGVLIDIEYAAYLAEKQKLSITD  508

Query  1073  AVLLALNKADLKTK---KVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
             AV+  L+KA   ++    V I S +SSVLMKF   + YE VY I+EEI D  +STI +IK
Sbjct  509   AVMNTLSKAGFDSQTALDVKIQSANSSVLMKFKEKTSYELVYKIEEEIGDAPSSTIEDIK  568

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             KFA SV+I K+S+FP  ++F  GVT+VV+KLQA+K+ VYV+LFSNEFVSQAWDFFSDP V
Sbjct  569   KFADSVVIKKASIFPEVEAFTTGVTDVVSKLQAAKLPVYVELFSNEFVSQAWDFFSDPTV  628

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYL  546
             E+NS+V GA+    DGVIT FP TA RY++NRCLG KEIP YM P+ P SL+Q+++  YL
Sbjct  629   EINSFVSGAN---IDGVITDFPKTAARYKKNRCLGKKEIPNYMSPIQPASLIQVVTSAYL  685

Query  545   PPAEAPYPVLTESDVVEPPLPPV  477
             PPAEAP P L ESDV+EPPLP V
Sbjct  686   PPAEAPNPPLRESDVIEPPLPSV  708



>ref|XP_009348463.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Pyrus x bretschneideri]
Length=752

 Score =   375 bits (962),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 190/323 (59%), Positives = 244/323 (76%), Gaps = 8/323 (2%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             Q++KDGIPFC  S+N+ID TT AQ  F++L   +PE+K  + I++F L WKDI+ L   I
Sbjct  389   QISKDGIPFCASSINLIDSTTVAQSPFNSLTAFVPEIKAGSGIYTFSLAWKDIEGLTPTI  448

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNP++KF LFRNP++K  GK++TL DFL  A  ++S+SGVLI +E AAYLAEK+ L +TD
Sbjct  449   SNPWSKFTLFRNPMSKTGGKYLTLSDFLALAKRSSSLSGVLIDIEYAAYLAEKQKLSITD  508

Query  1073  AVLLALNKADLKTK---KVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
             AV+  L+KA   ++    V I S +SSVLMKF   + YE VY I+EEI D  +STI +IK
Sbjct  509   AVMNTLSKAGFDSQTALDVKIQSANSSVLMKFKEKTSYELVYKIEEEIGDAPSSTIEDIK  568

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             KFA SV+I K+S+FP  ++F  GVT+VV+KLQA+K+ VYV+LFSNEFVSQAWDFFSDP V
Sbjct  569   KFADSVVIKKASIFPEVEAFTTGVTDVVSKLQAAKLPVYVELFSNEFVSQAWDFFSDPTV  628

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYL  546
             E+NS+V GA+    DGVIT FP TA RY++NRCLG KEIP YM P+ P SL+Q+++  YL
Sbjct  629   EINSFVSGAN---IDGVITDFPKTAARYKKNRCLGKKEIPNYMSPIQPASLIQVVTSAYL  685

Query  545   PPAEAPYPVLTESDVVEPPLPPV  477
             PPAEAP P L ESDV+EPPLP V
Sbjct  686   PPAEAPNPPLRESDVIEPPLPSV  708



>ref|XP_008366428.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Malus domestica]
Length=752

 Score =   373 bits (958),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 190/326 (58%), Positives = 241/326 (74%), Gaps = 8/326 (2%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             Q++KDGIPFC  S+N+ID TT AQ  FSNL   +PE+K  + I++F L WKDI+ L   I
Sbjct  389   QISKDGIPFCASSINLIDSTTVAQSXFSNLTTVVPEIKAGSGIYTFSLAWKDIEGLTXTI  448

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNP +K+ LFRNP  K  GK++TL DFL  A  ++S+SGVLI +E AAYLAE++ L VTD
Sbjct  449   SNPSSKYALFRNPRFKTGGKYLTLSDFLALAKKSSSLSGVLIGIEYAAYLAEEQRLSVTD  508

Query  1073  AVLLALNKADLKTK---KVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
             AV+  L+KA    K    V I S +SSVLMKF   + YE VY I+E I D  +STI +IK
Sbjct  509   AVMNTLSKAGFDNKTALNVKIQSTNSSVLMKFKEKTSYELVYKIEENIGDTLSSTIEDIK  568

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             KFA SV+I K+S+FP  ++F+ GVT+VV+KLQA+K+ VYV+LFSNEFV+QAWDFFSDP V
Sbjct  569   KFADSVVINKASIFPESEAFITGVTDVVSKLQAAKLPVYVELFSNEFVTQAWDFFSDPTV  628

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYL  546
             E+N +V GA+    DGVIT FP TA RY++N CL  KEIP YM P+ P SL+Q+++P YL
Sbjct  629   EINLFVSGANV---DGVITDFPKTAARYKKNPCLRQKEIPSYMSPIPPASLVQVITPSYL  685

Query  545   PPAEAPYPVLTESDVVEPPLPPVAKI  468
             PPAEAP PVLTESDV+EPPLP V  +
Sbjct  686   PPAEAPNPVLTESDVIEPPLPSVTAV  711



>ref|XP_009335427.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Pyrus x bretschneideri]
Length=752

 Score =   372 bits (955),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 189/326 (58%), Positives = 241/326 (74%), Gaps = 8/326 (2%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             Q++KDGIPFC  S+N+ID TT AQ  FSNL   +PE+K  + I++F L WKDI+ L   I
Sbjct  389   QISKDGIPFCASSINLIDSTTVAQSGFSNLTTFVPEIKAGSGIYTFSLAWKDIEGLTPTI  448

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNP + + LFRNP  K  GK++TL DFL  A  ++S+SGVLI +E AAYLAE++ L VTD
Sbjct  449   SNPSSNYALFRNPRFKTGGKYLTLSDFLALAKKSSSLSGVLIGIEYAAYLAEEQRLSVTD  508

Query  1073  AVLLALNKADLKTK---KVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
             AV+  L+KA    K    V I S +SSVLMKF   + YE VY I+E I D  +ST+ +IK
Sbjct  509   AVMNTLSKAGFDNKTALNVKIQSTNSSVLMKFKEKTSYELVYKIEENIGDTLSSTVEDIK  568

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             KFA SV++ K+S+FP  ++F+ GVT+VV+KLQA+K+ VYV+LFSNEFV+QAWDFFSDP V
Sbjct  569   KFADSVVVNKASIFPESEAFITGVTDVVSKLQAAKLPVYVELFSNEFVTQAWDFFSDPTV  628

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYL  546
             E+NS+V GA+    DGVIT FP TA RY++N CL  KEIP YM PV P SL+Q+++P YL
Sbjct  629   EINSFVSGAN---IDGVITDFPKTAARYKKNLCLRQKEIPSYMSPVQPASLVQVITPSYL  685

Query  545   PPAEAPYPVLTESDVVEPPLPPVAKI  468
             PPAEAP PVLTESDV+EPPLP V  +
Sbjct  686   PPAEAPNPVLTESDVIEPPLPSVTAL  711



>ref|XP_011095489.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Sesamum indicum]
 ref|XP_011095490.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Sesamum indicum]
Length=767

 Score =   368 bits (945),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 181/323 (56%), Positives = 244/323 (76%), Gaps = 9/323 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QMT DGIPFC+GS+++ + T   +  F+NL+ +  +L   + I +++L W  IQ+L+  I
Sbjct  392   QMTNDGIPFCLGSIDLKEKTNTGESIFTNLSTTNSDLNIIDGILAYNLTWSQIQTLKPAI  451

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNP++ + +FRNP AK+ G  M L DFL FA NA+S+SGVLI++ENAAYLAEK+GLGV D
Sbjct  452   SNPYSIYSMFRNPAAKHVGNLMQLSDFLAFAHNASSISGVLISIENAAYLAEKQGLGVAD  511

Query  1073  AVLLALNKA---DLKTKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTILEIK  906
             AVL AL+KA   +   K++MI S+DS+VL KF + S YE VY I E ISDI N+TILEI+
Sbjct  512   AVLDALSKAGYNNQTAKRIMITSSDSAVLSKFKSTSNYELVYLIDEIISDILNTTILEIR  571

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             KFASSV+I K+S+FP+DD+F+ G T+++ K++A  + VYV+LF NEF SQ +DFFSD YV
Sbjct  572   KFASSVVIRKASIFPSDDAFITGKTSIIPKIKAFDLPVYVKLFRNEFRSQPYDFFSDAYV  631

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYL  546
             E+N++ F       DGVIT +PATA R++RNRCLGYK+ PPYM+P+    L+ L+SP YL
Sbjct  632   EINAHYFAG----IDGVITDYPATAARFKRNRCLGYKDTPPYMMPLQARLLIDLISPTYL  687

Query  545   PPAEAPYPVLTESDVVEPPLPPV  477
             PPAEAP P+LT++DV EPPLPPV
Sbjct  688   PPAEAPSPILTDNDVAEPPLPPV  710



>ref|XP_011014930.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Populus euphratica]
 ref|XP_011014931.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Populus euphratica]
Length=753

 Score =   365 bits (936),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 190/321 (59%), Positives = 233/321 (73%), Gaps = 9/321 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             Q++KDGIPFC+GS+N+ D TT AQ  +SN A  IP++K  N I +F L W +IQSL   I
Sbjct  391   QISKDGIPFCLGSINLYDSTTVAQSSYSNRAQDIPQIKAGNGIFTFSLTWSEIQSLTPVI  450

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNPF+K+ L RNP  +N GKF+TL DFL  A N +S+SGVLI++ENAAYL +K+GL VTD
Sbjct  451   SNPFSKYELSRNPKFRNSGKFLTLSDFLALAKNTSSLSGVLISIENAAYLIQKEGLLVTD  510

Query  1073  AVLLALNKA---DLKTKKVMIHSNDSSVLMKFTNSK-YERVYGIKEEISDIQNSTILEIK  906
              VL  L+KA   D  +KKVMI S +SSVLMKF + K YE VY I+E+I D Q++ + +IK
Sbjct  511   KVLDILSKAGYDDPTSKKVMIESTNSSVLMKFRDKKSYELVYRIEEDIQDTQDAALKDIK  570

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
              FA SV+I K SVFP    FL GVTNVV KLQ+  + VYV+ F NEFVSQAWDFFSD  V
Sbjct  571   DFADSVVISKISVFPESSLFLTGVTNVVPKLQSHGLSVYVETFRNEFVSQAWDFFSDSTV  630

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYL  546
             E+NSYV G +     GVIT FP T+ RY+RNRCLG  ++PPYM P  PG L+QL+SP  L
Sbjct  631   EINSYVMGVN---ISGVITEFPLTSARYKRNRCLG-SDLPPYMSPAQPGGLMQLISPYAL  686

Query  545   PPAEAPYPVLTESDVVEPPLP  483
             PPAE P PVLT +DVVE PLP
Sbjct  687   PPAEPPNPVLTATDVVEGPLP  707



>gb|KCW70259.1| hypothetical protein EUGRSUZ_F03515 [Eucalyptus grandis]
Length=640

 Score =   361 bits (926),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 185/322 (57%), Positives = 234/322 (73%), Gaps = 9/322 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGT-TAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+KDGIPFC+ S N+ID +  A  +F NL  + PE+++   I SF LNW DIQ+L   I
Sbjct  278   QMSKDGIPFCLSSANLIDSSNVATTKFRNLMTTAPEIQSGTGIFSFSLNWSDIQTLTPAI  337

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             ++P+++F++FRNP  KN GKF++L +FL    N +SVSGVLI +ENAAYLAEK+ L VTD
Sbjct  338   ASPYSQFKIFRNPANKNAGKFLSLSEFLVLVKN-SSVSGVLIGIENAAYLAEKQSLSVTD  396

Query  1073  AVLLALNKADL--KTKKVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTILEIKK  903
             AVL AL+KA    +T+KVMI S +SSVLM    N+ Y+ VY + E I D  N T+L+IKK
Sbjct  397   AVLAALSKAGFSNQTEKVMIKSTNSSVLMNIKENANYKLVYEVDENIRDANNDTVLDIKK  456

Query  902   FASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVE  723
             FA SV++ K+SVFP +  FL G+T+VV KL A K+ VYVQ FSNEFVSQAWDFFSD  VE
Sbjct  457   FADSVVVMKNSVFPENQFFLTGITDVVTKLHAFKLPVYVQTFSNEFVSQAWDFFSDATVE  516

Query  722   LNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLP  543
             +NS+V G      DGVIT FP T+  Y+RN+CLG    PPYM PV PGSL+Q+++   LP
Sbjct  517   VNSFVVGGDV---DGVITDFPKTSASYKRNKCLG-SAAPPYMSPVQPGSLMQVITTPMLP  572

Query  542   PAEAPYPVLTESDVVEPPLPPV  477
             PA+APYPVL ESDV EPPLP V
Sbjct  573   PAQAPYPVLIESDVDEPPLPAV  594



>ref|XP_011014752.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Populus euphratica]
 ref|XP_011014753.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Populus euphratica]
Length=753

 Score =   364 bits (934),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 190/321 (59%), Positives = 234/321 (73%), Gaps = 9/321 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             Q++KDGIPFC+GS+N+ D TT AQ  +SN A  IP++K  N I +F L W +IQSL   I
Sbjct  391   QISKDGIPFCLGSINLYDSTTVAQSSYSNRAQDIPQIKAGNGIFTFSLTWSEIQSLTPVI  450

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNPF+KF L RNP  +N GKF+TL +FL  A + +S+SGVLI++ENAAYL +K+GL VTD
Sbjct  451   SNPFSKFELSRNPKFRNSGKFLTLSEFLALAKSTSSLSGVLISIENAAYLIQKEGLLVTD  510

Query  1073  AVLLALNKA---DLKTKKVMIHSNDSSVLMKFTNSK-YERVYGIKEEISDIQNSTILEIK  906
              VL  L+KA   D  +KKVMI S +SSVLMKF + K YE VY I+E+I D Q++ + +IK
Sbjct  511   KVLDILSKAGYDDPTSKKVMIESTNSSVLMKFRDKKSYELVYRIEEDIQDTQDAALKDIK  570

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
              FA SV+I K SVFP    FL GVTNVV KLQ+  + VYV+ FSNEFVSQAWDFFSD  V
Sbjct  571   DFADSVVISKISVFPESSLFLTGVTNVVPKLQSHGLSVYVETFSNEFVSQAWDFFSDSTV  630

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYL  546
             E+NSYV G +     GVIT FP T+ RY+RNRCLG  ++PPYM P  PG L+QL+SP  L
Sbjct  631   EINSYVMGVN---ISGVITEFPLTSARYKRNRCLG-SDLPPYMSPAQPGGLMQLISPYAL  686

Query  545   PPAEAPYPVLTESDVVEPPLP  483
             PPAE P PVLT +DVVE PLP
Sbjct  687   PPAEPPNPVLTATDVVEGPLP  707



>gb|KHG12016.1| putative glycerophosphoryl diester phosphodiesterase 1 -like 
protein [Gossypium arboreum]
Length=762

 Score =   362 bits (930),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 187/326 (57%), Positives = 242/326 (74%), Gaps = 10/326 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QMTKDGIP C+GS+N+I+ T   +  FSNL  ++PE+   + I +++L+W DI+SL+  I
Sbjct  397   QMTKDGIPICLGSINLIESTDIVRTGFSNLTTTVPEIMQSSGIFTYNLSWSDIKSLKPVI  456

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             S+P ++++LFRNP  +N GK++ L +FL  A   +S++GVLI++ENAAYLA K+G GVTD
Sbjct  457   SSPQSQYKLFRNPKFQNAGKYLQLSEFLRMANTTSSLNGVLISIENAAYLA-KQGFGVTD  515

Query  1073  AVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
             AVL ALN+A      T+KVMI S+ SSVLMKF   + Y+ VY I E+I   Q+STI +IK
Sbjct  516   AVLKALNEAGYDKQTTQKVMIQSSSSSVLMKFKGKTNYQLVYKIDEDIGGAQSSTIDDIK  575

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             +FAS+V+I K SVFP + +FL G T+VV++LQA+ + V VQ F NEF SQAWDFFSD  V
Sbjct  576   RFASAVVISKDSVFPENSAFLAGATDVVSRLQAANLSVLVQTFRNEFTSQAWDFFSDATV  635

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMSPQY  549
             E+NS+  GA  N   GVIT FP T++RYRRNRCL    +IP YM PV PGSLLQL++  Y
Sbjct  636   EINSFYVGAGIN---GVITDFPKTSDRYRRNRCLKRGNKIPTYMSPVPPGSLLQLVTTDY  692

Query  548   LPPAEAPYPVLTESDVVEPPLPPVAK  471
             LPPAEAP P LTESDVVEPPLPPVAK
Sbjct  693   LPPAEAPKPYLTESDVVEPPLPPVAK  718



>gb|KHN43860.1| Putative glycerophosphoryl diester phosphodiesterase 3 [Glycine 
soja]
Length=753

 Score =   362 bits (928),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 183/327 (56%), Positives = 236/327 (72%), Gaps = 9/327 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+KDG PFC+ S+++I+ TT AQ  FS  A++IPE+K+   I +F+L W DI+SL   I
Sbjct  391   QMSKDGTPFCLNSIDLIESTTVAQSSFSKFAMTIPEIKSGIGIFAFNLTWNDIKSLTPSI  450

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
              NPFAK+RLFRNP +KN G  + L DFL+   N TS+SGV I VENAAYLA+K+GL V D
Sbjct  451   LNPFAKYRLFRNPRSKNAGTLLALSDFLSLTKNQTSLSGVAIIVENAAYLADKQGLSVID  510

Query  1073  AVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
             AV+ AL+KA      ++KV I S +SSVL+KF   + YE VY I E I D  N+ + +IK
Sbjct  511   AVIGALSKAGYDKPGSQKVYIQSTNSSVLLKFKEKTSYELVYKIDETIGDAANAAVEDIK  570

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
              FASSV++ K S+ P +D FL   TN+V KL+ + + V+V+ FSNEFVSQAWDFFSD  V
Sbjct  571   SFASSVVVNKDSIIPNNDQFLTAYTNIVPKLKNANLSVFVETFSNEFVSQAWDFFSDATV  630

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMSPQY  549
             E+N+Y+ GA     DG+IT FP TA+RYRRN+CLG  +  P YM PV PGSL  L++ ++
Sbjct  631   EINTYITGAQ---IDGIITDFPKTADRYRRNKCLGLGDNKPTYMEPVQPGSLFGLITKEF  687

Query  548   LPPAEAPYPVLTESDVVEPPLPPVAKI  468
             LPPAEAP+P LTES+V EPPLPPVAKI
Sbjct  688   LPPAEAPFPPLTESEVAEPPLPPVAKI  714



>ref|XP_003519608.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
3-like [Glycine max]
Length=753

 Score =   362 bits (928),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 183/327 (56%), Positives = 236/327 (72%), Gaps = 9/327 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+KDG PFC+ S+++I+ TT AQ  FS  A++IPE+K+   I +F+L W DI+SL   I
Sbjct  391   QMSKDGTPFCLNSIDLIESTTVAQSSFSKFAMTIPEIKSGIGIFAFNLTWNDIKSLTPSI  450

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
              NPFAK+RLFRNP +KN G  + L DFL+   N TS+SGV I VENAAYLA+K+GL V D
Sbjct  451   LNPFAKYRLFRNPRSKNAGTLLALSDFLSLTKNQTSLSGVAIIVENAAYLADKQGLSVID  510

Query  1073  AVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
             AV+ AL+KA      ++KV I S +SSVL+KF   + YE VY I E I D  N+ + +IK
Sbjct  511   AVIGALSKAGYDKPGSQKVYIQSTNSSVLLKFKEKTSYELVYKIDETIGDAANAAVEDIK  570

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
              FASSV++ K S+ P +D FL   TN+V KL+ + + V+V+ FSNEFVSQAWDFFSD  V
Sbjct  571   SFASSVVVNKDSIIPNNDQFLTAYTNIVPKLKNASLSVFVETFSNEFVSQAWDFFSDATV  630

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMSPQY  549
             E+N+Y+ GA     DG+IT FP TA+RYRRN+CLG  +  P YM PV PGSL  L++ ++
Sbjct  631   EINTYITGAQ---IDGIITDFPKTADRYRRNKCLGLGDNKPTYMEPVQPGSLFGLITKEF  687

Query  548   LPPAEAPYPVLTESDVVEPPLPPVAKI  468
             LPPAEAP+P LTES+V EPPLPPVAKI
Sbjct  688   LPPAEAPFPPLTESEVAEPPLPPVAKI  714



>ref|XP_004294052.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Fragaria vesca subsp. vesca]
Length=753

 Score =   362 bits (928),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 183/321 (57%), Positives = 233/321 (73%), Gaps = 8/321 (2%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+KDGIPFC  S+N+ID TT AQ  F+N  + +PE+K  + I++F L W  I+ L   I
Sbjct  390   QMSKDGIPFCSSSINLIDSTTVAQSPFNNYTMVVPEIKVGSGIYTFSLTWDQIKKLTPTI  449

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             S+P   F L+RNP  K+ G ++ L +FLT A N++S+SGV+I +E AAYL EKKGL VTD
Sbjct  450   SSPQKDFTLYRNPRFKSAGTYLKLSEFLTLAKNSSSLSGVIIGIEYAAYLIEKKGLSVTD  509

Query  1073  AVLLALNKADLKTK---KVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
             AV+  LNKA    +    VMI S +SSVLMKF   +KY+ VY I+E+I    + T+ +IK
Sbjct  510   AVITELNKAGFGNQTALDVMIQSTNSSVLMKFKEKTKYKLVYEIEEDIGGAPDKTVQDIK  569

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             KFA++V+I K+SVFP +  F+ GVT+VV KLQ  K+ +YV+LFSNEFVSQAWDFFSDP V
Sbjct  570   KFANAVVIKKTSVFPENQEFVTGVTDVVTKLQGFKIPIYVELFSNEFVSQAWDFFSDPSV  629

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYL  546
             E+NS+V G      DGVIT FP TA RY+RNRCL YKE P YM PV PGSL+Q++S  Y+
Sbjct  630   EINSFVTGPV---IDGVITDFPKTAARYKRNRCLSYKETPAYMSPVQPGSLIQVISSVYM  686

Query  545   PPAEAPYPVLTESDVVEPPLP  483
             PPAEAP P LTESDV+EPPLP
Sbjct  687   PPAEAPKPYLTESDVIEPPLP  707



>ref|XP_010064948.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Eucalyptus grandis]
Length=746

 Score =   361 bits (926),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 185/322 (57%), Positives = 234/322 (73%), Gaps = 9/322 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGT-TAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+KDGIPFC+ S N+ID +  A  +F NL  + PE+++   I SF LNW DIQ+L   I
Sbjct  384   QMSKDGIPFCLSSANLIDSSNVATTKFRNLMTTAPEIQSGTGIFSFSLNWSDIQTLTPAI  443

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             ++P+++F++FRNP  KN GKF++L +FL    N +SVSGVLI +ENAAYLAEK+ L VTD
Sbjct  444   ASPYSQFKIFRNPANKNAGKFLSLSEFLVLVKN-SSVSGVLIGIENAAYLAEKQSLSVTD  502

Query  1073  AVLLALNKADL--KTKKVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTILEIKK  903
             AVL AL+KA    +T+KVMI S +SSVLM    N+ Y+ VY + E I D  N T+L+IKK
Sbjct  503   AVLAALSKAGFSNQTEKVMIKSTNSSVLMNIKENANYKLVYEVDENIRDANNDTVLDIKK  562

Query  902   FASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVE  723
             FA SV++ K+SVFP +  FL G+T+VV KL A K+ VYVQ FSNEFVSQAWDFFSD  VE
Sbjct  563   FADSVVVMKNSVFPENQFFLTGITDVVTKLHAFKLPVYVQTFSNEFVSQAWDFFSDATVE  622

Query  722   LNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLP  543
             +NS+V G      DGVIT FP T+  Y+RN+CLG    PPYM PV PGSL+Q+++   LP
Sbjct  623   VNSFVVGGDV---DGVITDFPKTSASYKRNKCLG-SAAPPYMSPVQPGSLMQVITTPMLP  678

Query  542   PAEAPYPVLTESDVVEPPLPPV  477
             PA+APYPVL ESDV EPPLP V
Sbjct  679   PAQAPYPVLIESDVDEPPLPAV  700



>gb|KJB13799.1| hypothetical protein B456_002G094900 [Gossypium raimondii]
Length=762

 Score =   361 bits (926),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 187/326 (57%), Positives = 242/326 (74%), Gaps = 10/326 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QMTKDGIP C+GS+N+I  T   +  FSNL  ++PE+   + I +++L+W DI+SL+  I
Sbjct  397   QMTKDGIPICLGSINLIQSTDIVRTGFSNLTETVPEIMQSSGIFTYNLSWSDIKSLKPVI  456

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             S+P ++++LFRNP  +N GK++ L +FL+ A   +S++GVLI++ENAAYLA K+G GVTD
Sbjct  457   SSPQSQYKLFRNPKFQNAGKYLKLSEFLSMANTTSSLNGVLISIENAAYLA-KQGFGVTD  515

Query  1073  AVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
             AVL ALN+A      T+KVMI S+ SSVLMKF   + Y+ VY I E+I   Q+STI +IK
Sbjct  516   AVLKALNEAGYDKQTTQKVMIQSSSSSVLMKFKGKTNYQLVYKIDEDIGGAQSSTIDDIK  575

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             +FAS+V+I K SVFP + +FL G T+VV++LQA+ + V VQ FSNEF SQAWDFFSD  V
Sbjct  576   RFASAVVISKDSVFPENSAFLAGATDVVSRLQAANLSVLVQTFSNEFTSQAWDFFSDATV  635

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMSPQY  549
             E+NS+  GAS N   GVIT FP T++RYRRNRCL    + P YM PV PGSLL L++  Y
Sbjct  636   EINSFCAGASIN---GVITDFPKTSDRYRRNRCLKRGNKTPTYMSPVQPGSLLSLVTTDY  692

Query  548   LPPAEAPYPVLTESDVVEPPLPPVAK  471
             LPPAEAP P LTESDVVEPPLPPVAK
Sbjct  693   LPPAEAPKPYLTESDVVEPPLPPVAK  718



>ref|XP_008447692.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Cucumis melo]
 ref|XP_008447693.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Cucumis melo]
Length=764

 Score =   360 bits (924),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 188/326 (58%), Positives = 233/326 (71%), Gaps = 10/326 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             Q+TKDGIPFCM S+N+ID TT +Q  F N + +IPE+   +AI +FDL W++IQSL   I
Sbjct  394   QITKDGIPFCMSSINLIDSTTISQSPFINRSKNIPEISPNDAIFAFDLTWEEIQSLSPSI  453

Query  1253  SNPFA-KFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
              +P++ K+ LFRNP  +N+G F TL DFL  A NA ++SGVLI +ENAAYLA+ +GL VT
Sbjct  454   LSPYSSKYALFRNPRFRNKGNFTTLPDFLAMAKNAGTLSGVLIQIENAAYLAKDQGLSVT  513

Query  1076  DAVLLALNKADLKTK---KVMIHSNDSSVLMKFT--NSKYERVYGIKEEISDIQNSTILE  912
             DAVL +L+KA    +   KV+I S DS+VLMKF   N  YE VY +   ISD+ N+T+ +
Sbjct  514   DAVLSSLSKAGYDNQTAVKVLIQSPDSAVLMKFKQENKNYELVYKVDPPISDVLNTTVED  573

Query  911   IKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDP  732
             IK FA SV I K+SVFP +  FL G TNVV KL+A  + VYV  FSNEFVSQAWDFFSD 
Sbjct  574   IKSFADSVTITKNSVFPVNQFFLTGATNVVKKLKALNLSVYVDTFSNEFVSQAWDFFSDA  633

Query  731   YVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQ  552
              VE+NS+V GA     DGVIT FP T+ RY++NRCL  KE P YM PV PGSLLQL++P 
Sbjct  634   TVEINSFVLGAE---IDGVITDFPKTSARYKKNRCLAMKETPNYMSPVQPGSLLQLVTPN  690

Query  551   YLPPAEAPYPVLTESDVVEPPLPPVA  474
             YLPP   P PVL + DV EPPLPPV+
Sbjct  691   YLPPKTPPSPVLDDKDVAEPPLPPVS  716



>ref|XP_002529027.1| glycerophosphoryl diester phosphodiesterase, putative [Ricinus 
communis]
 gb|EEF33338.1| glycerophosphoryl diester phosphodiesterase, putative [Ricinus 
communis]
Length=768

 Score =   360 bits (923),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 184/324 (57%), Positives = 240/324 (74%), Gaps = 9/324 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+KDGIPFC+ ++N+ID T  AQ  + +LA +IPEL+  + I++F+L W  IQ+L   I
Sbjct  402   QMSKDGIPFCLSTINLIDSTKVAQTNYGSLAANIPELEKGSGIYTFNLTWSQIQTLTPAI  461

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             +NP+A ++LFRNP  +N GKF+TL DFL  A N +S+SGVLI++E+AAYL EK+ L VTD
Sbjct  462   ANPYAIYKLFRNPKFRNAGKFLTLSDFLALAKNTSSLSGVLISIEHAAYLIEKQQLPVTD  521

Query  1073  AVLLALNKADLKTK---KVMIHSNDSSVLMKFTNSK-YERVYGIKEEISDIQNSTILEIK  906
             AVL AL+KA  + +    VMI S +S+VLMKF + K Y+ VY + E I D  ++TI +I+
Sbjct  522   AVLGALSKAGYENQTAIDVMIQSTNSAVLMKFKDKKNYKLVYKVDENIRDALDATIEDIR  581

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
              FA+SV++ K+SVFP +  FL G T+VV KLQ++ + VYV+LFSNEFVSQAWDFFSD  V
Sbjct  582   TFANSVVVNKNSVFPDNSLFLTGATDVVPKLQSAGLPVYVELFSNEFVSQAWDFFSDANV  641

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMSPQY  549
             E+NSYV GA+ +   GVIT FP TA RY+RN+CL      P YM PV PGSLLQL++  Y
Sbjct  642   EINSYVIGANVS---GVITDFPKTAARYKRNKCLNMGNSTPAYMAPVQPGSLLQLITQDY  698

Query  548   LPPAEAPYPVLTESDVVEPPLPPV  477
             LPPAEAP PVLTE+DV E PLPPV
Sbjct  699   LPPAEAPNPVLTEADVAEAPLPPV  722



>ref|XP_002300351.2| hypothetical protein POPTR_0001s37160g [Populus trichocarpa]
 gb|EEE85156.2| hypothetical protein POPTR_0001s37160g [Populus trichocarpa]
Length=754

 Score =   359 bits (921),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 186/321 (58%), Positives = 232/321 (72%), Gaps = 8/321 (2%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             Q++KDGIPFC+GS+N+ D TT AQ  +SN   +IP++K  + I +F L W +IQ+L   I
Sbjct  391   QISKDGIPFCLGSINLYDSTTVAQSIYSNREQNIPQIKAGSGIFTFSLTWSEIQNLTPVI  450

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNP++K+ L RNP  KN GKF+TL DFL  A N +S+SGVLI++ENAAYL EK+GL +TD
Sbjct  451   SNPYSKYELLRNPKFKNLGKFLTLSDFLALAKNTSSLSGVLISIENAAYLIEKEGLPITD  510

Query  1073  AVLLALNKA---DLKTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
              VL  L+ A   D  +KKVMI S +SSVLMKF + S YE VY I+E+I D Q++ + +IK
Sbjct  511   KVLEVLSLAGYDDPTSKKVMIESTNSSVLMKFRDESNYELVYRIEEDIQDAQDAALKDIK  570

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
              FA+SV+I K+SVFP   SFL GVTNVV KLQ+  + VYV+ FSNEFVSQAWDFFSD  V
Sbjct  571   DFANSVVISKASVFPESSSFLSGVTNVVPKLQSHGLSVYVETFSNEFVSQAWDFFSDSTV  630

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYL  546
             E+NSYV G +     GVIT FP T+ RY+RNRCLGY  +P YM P  PG L+ L+ P  L
Sbjct  631   EINSYVMGVN---ISGVITEFPLTSARYKRNRCLGYNVLPHYMSPAQPGGLMPLIPPFAL  687

Query  545   PPAEAPYPVLTESDVVEPPLP  483
             PPAE P PVLT  DVVE PLP
Sbjct  688   PPAEPPNPVLTAPDVVEGPLP  708



>ref|XP_008227060.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Prunus mume]
Length=755

 Score =   358 bits (918),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 182/323 (56%), Positives = 237/323 (73%), Gaps = 8/323 (2%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             Q++KDGIPFC  ++N+ID TT AQ  FSNL   IPE+K  + I++F L W++I+SL   I
Sbjct  391   QISKDGIPFCSSNINLIDSTTVAQSSFSNLTTVIPEIKAGSGIYTFSLTWENIKSLTPII  450

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNP++ + LFR+P  KN GK++TL DFLT A  ++S+SGVLI +E+A YLAE++GL VTD
Sbjct  451   SNPWSSYTLFRSPRNKNAGKYLTLSDFLTLAQKSSSLSGVLIGIEHAPYLAEEQGLSVTD  510

Query  1073  AVLLALNKADLKTK---KVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
              V+ AL KA    +    V I S +SSVLMKF   + YE VY I+E+I D  +STI +IK
Sbjct  511   TVIAALRKAGFDNRTAPDVKIQSTNSSVLMKFKEKTNYELVYKIEEDIGDALSSTIEDIK  570

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             KFA SV+I K+S+FP   +F+  VT+VV +LQA+K++VYV+LFSNEFVSQAWDFFSDP V
Sbjct  571   KFADSVVINKASIFPQTQAFVARVTHVVPELQAAKLQVYVELFSNEFVSQAWDFFSDPTV  630

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYL  546
             E+NS+  G +    DGVIT FP TA RY+RNRCL  K +P YM P+   SL+Q+++  YL
Sbjct  631   EINSFATGVN---IDGVITDFPKTAARYKRNRCLSEKVLPNYMSPIQGASLIQVVTSDYL  687

Query  545   PPAEAPYPVLTESDVVEPPLPPV  477
             PPAEAP P LT SDV+EPPLP V
Sbjct  688   PPAEAPNPPLTASDVIEPPLPSV  710



>ref|XP_007020652.1| PLC-like phosphodiesterase family protein, putative isoform 1 
[Theobroma cacao]
 gb|EOY12177.1| PLC-like phosphodiesterase family protein, putative isoform 1 
[Theobroma cacao]
Length=760

 Score =   357 bits (916),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 187/325 (58%), Positives = 241/325 (74%), Gaps = 10/325 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QMTKDG P C+GS+N+ID T  AQ  FSNL+ +IPE+   + I +FD++W+DI SL   I
Sbjct  397   QMTKDGTPICLGSINLIDSTDVAQSSFSNLSKTIPEIMQGSGIFTFDMSWRDILSLTTAI  456

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             S+P ++++LFRNP  KN GKF+TL +FL  A +A+S+ GVLI +ENAAYLAE+ G GVTD
Sbjct  457   SSPQSEYKLFRNPKFKNVGKFLTLSEFLAMAKSASSLQGVLIAIENAAYLAEQ-GFGVTD  515

Query  1073  AVLLALNKA--DLKT-KKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
             AV  AL++A  D +T +KVMI S++SSVLMKF   S Y+ VY + E+I   Q ++I +IK
Sbjct  516   AVFDALSEAGYDKQTAQKVMIQSSNSSVLMKFKGKSNYKLVYKVDEDIGGAQQASIDDIK  575

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
              FAS+V+I K SVFP +++FL GVT+VV +LQA+ + VYV  FSNEF SQAWDFFSD  V
Sbjct  576   SFASAVVISKDSVFPENNAFLTGVTDVVPRLQAANLSVYVHTFSNEFTSQAWDFFSDATV  635

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMSPQY  549
             E+NS+  G   N   GVIT FP T++RYRRNRCL   +  P YM PV PGSLLQL++ +Y
Sbjct  636   EVNSFHVGGLIN---GVITDFPETSDRYRRNRCLNKGDNTPGYMSPVQPGSLLQLVTAEY  692

Query  548   LPPAEAPYPVLTESDVVEPPLPPVA  474
             LPPAEAP P LTE+D+ E PLPPVA
Sbjct  693   LPPAEAPNPYLTEADIAESPLPPVA  717



>ref|XP_007214645.1| hypothetical protein PRUPE_ppa001847mg [Prunus persica]
 gb|EMJ15844.1| hypothetical protein PRUPE_ppa001847mg [Prunus persica]
Length=756

 Score =   355 bits (911),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 181/323 (56%), Positives = 235/323 (73%), Gaps = 8/323 (2%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             Q+++DGIPFC  S+N+ID TT AQ +FSNL   IP++K  + I++F L W+DI+SL   I
Sbjct  392   QISRDGIPFCSSSINLIDSTTVAQSRFSNLTTVIPKIKAGSGIYTFSLTWEDIKSLTPII  451

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNP++ + L+R+P  KN GK++TL DFLT A  ++S+SGVLI +E+A YLAE++GL VTD
Sbjct  452   SNPWSTYTLYRSPRTKNAGKYLTLSDFLTLAQKSSSLSGVLIGIEHATYLAEEQGLSVTD  511

Query  1073  AVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
              V+ AL KA L       V I S +SSVLMKF   + Y RVY I+E I D  +S+I +IK
Sbjct  512   KVIAALRKAGLDNWTAPDVKIQSTNSSVLMKFKEKTNYGRVYKIEENIGDALSSSIEDIK  571

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             KFA SV+I K+S+FP   +F+  VT+VV KL+A+K+ VYV+LFSNEFVSQAWDFFSDP V
Sbjct  572   KFADSVVINKASIFPETQAFITRVTDVVPKLKAAKLPVYVELFSNEFVSQAWDFFSDPTV  631

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYL  546
             E+NS+V   +    DGVIT FP TA RY+RNRCL  K  P YM PV   SL+Q+++  YL
Sbjct  632   EINSFVLAVN---IDGVITDFPKTAARYKRNRCLSEKVPPSYMTPVQAASLIQVVTADYL  688

Query  545   PPAEAPYPVLTESDVVEPPLPPV  477
             PPAEAP P LT +DV+EPPLP V
Sbjct  689   PPAEAPNPPLTATDVIEPPLPSV  711



>gb|KHG08046.1| putative glycerophosphoryl diester phosphodiesterase 2 -like 
protein [Gossypium arboreum]
Length=775

 Score =   355 bits (910),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 182/325 (56%), Positives = 238/325 (73%), Gaps = 10/325 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QMT DG P C+ S+N+ID TT AQ +F+NL  +IP++ + + I +F+L+W  I++L   I
Sbjct  412   QMTMDGTPICLSSINLIDSTTVAQSEFNNLTTTIPQIMSGSGIFTFNLSWSGIKTLTPII  471

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             ++P ++++LFRNP  KN GKF+TL +FLT A+NA+S+ GVLI++ENA +L E+ G  +TD
Sbjct  472   ASPQSQYKLFRNPRFKNAGKFLTLSEFLTMASNASSLQGVLISIENAPFLLEQ-GFAITD  530

Query  1073  AVLLALNKADLKTK---KVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTILEIK  906
             AVL AL+KA    K   KVMI S+ SSVLMKF + + Y+ VY + E+I   Q+STI +IK
Sbjct  531   AVLDALSKAGYGNKTDQKVMIQSSSSSVLMKFKSQTNYDLVYKVDEDIGGAQSSTIDDIK  590

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             +FAS+V+I K SVFP   +F+   TNVV +L+A+ + VYVQ FSNEF SQAWDFFSDP V
Sbjct  591   RFASAVVISKDSVFPETSAFITSATNVVPRLKAANLSVYVQTFSNEFTSQAWDFFSDPTV  650

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMSPQY  549
             E+NS+  G   N   GVIT FP T+NRYRRNRCL    +IP YM PV PGSL QL++  Y
Sbjct  651   EINSFYLGGGIN---GVITDFPKTSNRYRRNRCLNRGNQIPGYMSPVQPGSLYQLITAPY  707

Query  548   LPPAEAPYPVLTESDVVEPPLPPVA  474
             LPPAEAP P LTE+DV EPPLPPVA
Sbjct  708   LPPAEAPNPFLTEADVNEPPLPPVA  732



>ref|XP_009794308.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2, partial [Nicotiana sylvestris]
Length=305

 Score =   339 bits (869),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 171/268 (64%), Positives = 210/268 (78%), Gaps = 7/268 (3%)
 Frame = -3

Query  1262  AQISNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLG  1083
             A ISNP+++FRL+RNP A+N+G F++L DFLT+A NAT+VSGV+I++ENA YLA K G G
Sbjct  2     AAISNPWSEFRLYRNPKARNDGSFVSLVDFLTYAKNATTVSGVMISIENAVYLA-KHGYG  60

Query  1082  VTDAVLLALNKA---DLKTKKVMIHSNDSSVLMKFTNSKYERVYGIKEEISDIQNSTILE  912
             VT AVL AL+     +   KKVMI S DSSVL +F  S YE VY + ++ISDI++STI E
Sbjct  61    VTAAVLEALSNTAYNNQSAKKVMIQSTDSSVLKEFRKSHYELVYRVADDISDIESSTISE  120

Query  911   IKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDP  732
             IK FASSVI+ K SVFP+++ FL+G T+VV KLQ+S + VY +LF+NEFVSQAWDFFSD 
Sbjct  121   IKSFASSVIVTKKSVFPSEEQFLIGQTDVVQKLQSSNLPVYARLFNNEFVSQAWDFFSDS  180

Query  731   YVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQ  552
              VE+N+Y+ GA     DGVIT FP TA RYRRNRCLGYK+ P Y+ PV PG LLQ M+PQ
Sbjct  181   SVEINNYISGAG---IDGVITEFPGTAARYRRNRCLGYKDRPLYLSPVEPGGLLQFMAPQ  237

Query  551   YLPPAEAPYPVLTESDVVEPPLPPVAKI  468
              LP AEAP P+LT+SDVVEPPLPPVAKI
Sbjct  238   LLPAAEAPNPILTDSDVVEPPLPPVAKI  265



>ref|NP_176869.2| putative glycerophosphoryl diester phosphodiesterase 3 [Arabidopsis 
thaliana]
 sp|Q7Y208.2|GPDL1_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase GDPDL1; 
AltName: Full=Glycerophosphodiester phosphodiesterase-like 
1; Short=ATGDPDL1; AltName: Full=Glycerophosphodiesterase-like 
3; AltName: Full=Protein SHV3-LIKE 2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF98209.1|AC007152_5 Unknown protein [Arabidopsis thaliana]
 gb|AEE34579.1| putative glycerophosphoryl diester phosphodiesterase 3 [Arabidopsis 
thaliana]
Length=763

 Score =   353 bits (905),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 182/324 (56%), Positives = 228/324 (70%), Gaps = 9/324 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+ DG+PFC+ S+++ +   A Q  FSN + S+PE+ +   I +F L W +IQSL   I
Sbjct  402   QMSSDGVPFCLRSIDLRNSIAALQNTFSNRSTSVPEISSVPGIFTFSLTWPEIQSLTPAI  461

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNPF  +R+FRNP  KN GK ++L  FL  A   TS+SGVLI+VENAAYL EK+GL V  
Sbjct  462   SNPFRVYRIFRNPREKNSGKLISLSQFLDLAKTYTSLSGVLISVENAAYLREKQGLDVVQ  521

Query  1073  AVLLALNKADLK----TKKVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTILEI  909
             AVL  L +A       T KVMI S +SSVL+ F   SKYE VY I+E I +I++S I +I
Sbjct  522   AVLDTLTEAGYSNGTTTTKVMIQSTNSSVLVDFKKQSKYETVYKIEETIGNIRDSAIEDI  581

Query  908   KKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPY  729
             KKFA++V+I K SVFP  DSFL G TNVV +LQ S++ VYV+LF NEFVSQA+DFFSD  
Sbjct  582   KKFANAVVINKDSVFPNSDSFLTGQTNVVERLQKSQLPVYVELFRNEFVSQAYDFFSDAT  641

Query  728   VELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQY  549
             VE+N+Y++GA  N   G IT FP TA RY+RNRCLG +E+PPYMLPV PG LL +MSP  
Sbjct  642   VEINAYIYGAGIN---GTITEFPFTAARYKRNRCLGREEVPPYMLPVNPGGLLNVMSPLS  698

Query  548   LPPAEAPYPVLTESDVVEPPLPPV  477
             LPPA+AP     E+DV EPPL PV
Sbjct  699   LPPAQAPNQDFIEADVTEPPLSPV  722


 Score = 52.8 bits (125),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 71/283 (25%), Positives = 136/283 (48%), Gaps = 45/283 (16%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNL--AVSIPELKTQNAIHSFDLNWKDIQSLQAQ  1257
             Q+TKDG+  C   +N+ + +T  + + N   + S+  + T+    + D +  ++Q+    
Sbjct  88    QLTKDGLGICFPDLNLANASTIDRVYPNREKSYSVNGVTTKGWFPN-DFSLTELQN----  142

Query  1256  ISNPFAKFRLFRNPVAKNE-----GKFM-TLDDFLTFAANATSVSGVLITVENAAYLAEK  1095
                    F L R  +++ +     G  + T++D +T      +  G  + V++ A+  E+
Sbjct  143   -------FLLIRGILSRTDRFDGNGYLISTIEDVVT----TLNREGFWLNVQHDAFY-EQ  190

Query  1094  KGLGVTDAVLLALNKADLKTKKVMIHSNDSSVLMKFTNS------KYERVYGIKEEISDI  933
             + L ++ + LL++++         I S + +   K T S       +   +  KE+    
Sbjct  191   QNLSMS-SFLLSVSRT---VSIDFISSPEVNFFKKITGSFGRNGPTFVFQFLGKEDFEPT  246

Query  932   QNST---ILE----IKKFASSVIIGKSSVFPTDDS-FLVGVTNVVAKLQASKVKVYVQLF  777
              N T   IL     +K FAS +++ KS + P DD  +LV  T++V     + ++VYV  F
Sbjct  247   TNRTYGSILSNLTFVKTFASGILVPKSYILPLDDEQYLVPHTSLVQDAHKAGLQVYVSGF  306

Query  776   SNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATAN  648
             +N+ V  A+++ SDP  E  S+V     +  DGV++ FP TA+
Sbjct  307   AND-VDIAYNYSSDPVSEYLSFVDNGDFS-VDGVLSDFPITAS  347



>ref|NP_001185333.1| putative glycerophosphoryl diester phosphodiesterase 3 [Arabidopsis 
thaliana]
 gb|AEE34580.1| putative glycerophosphoryl diester phosphodiesterase 3 [Arabidopsis 
thaliana]
Length=785

 Score =   352 bits (904),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 182/324 (56%), Positives = 228/324 (70%), Gaps = 9/324 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+ DG+PFC+ S+++ +   A Q  FSN + S+PE+ +   I +F L W +IQSL   I
Sbjct  424   QMSSDGVPFCLRSIDLRNSIAALQNTFSNRSTSVPEISSVPGIFTFSLTWPEIQSLTPAI  483

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNPF  +R+FRNP  KN GK ++L  FL  A   TS+SGVLI+VENAAYL EK+GL V  
Sbjct  484   SNPFRVYRIFRNPREKNSGKLISLSQFLDLAKTYTSLSGVLISVENAAYLREKQGLDVVQ  543

Query  1073  AVLLALNKADLK----TKKVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTILEI  909
             AVL  L +A       T KVMI S +SSVL+ F   SKYE VY I+E I +I++S I +I
Sbjct  544   AVLDTLTEAGYSNGTTTTKVMIQSTNSSVLVDFKKQSKYETVYKIEETIGNIRDSAIEDI  603

Query  908   KKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPY  729
             KKFA++V+I K SVFP  DSFL G TNVV +LQ S++ VYV+LF NEFVSQA+DFFSD  
Sbjct  604   KKFANAVVINKDSVFPNSDSFLTGQTNVVERLQKSQLPVYVELFRNEFVSQAYDFFSDAT  663

Query  728   VELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQY  549
             VE+N+Y++GA  N   G IT FP TA RY+RNRCLG +E+PPYMLPV PG LL +MSP  
Sbjct  664   VEINAYIYGAGIN---GTITEFPFTAARYKRNRCLGREEVPPYMLPVNPGGLLNVMSPLS  720

Query  548   LPPAEAPYPVLTESDVVEPPLPPV  477
             LPPA+AP     E+DV EPPL PV
Sbjct  721   LPPAQAPNQDFIEADVTEPPLSPV  744


 Score = 52.8 bits (125),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 71/283 (25%), Positives = 136/283 (48%), Gaps = 45/283 (16%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNL--AVSIPELKTQNAIHSFDLNWKDIQSLQAQ  1257
             Q+TKDG+  C   +N+ + +T  + + N   + S+  + T+    + D +  ++Q+    
Sbjct  110   QLTKDGLGICFPDLNLANASTIDRVYPNREKSYSVNGVTTKGWFPN-DFSLTELQN----  164

Query  1256  ISNPFAKFRLFRNPVAKNE-----GKFM-TLDDFLTFAANATSVSGVLITVENAAYLAEK  1095
                    F L R  +++ +     G  + T++D +T      +  G  + V++ A+  E+
Sbjct  165   -------FLLIRGILSRTDRFDGNGYLISTIEDVVT----TLNREGFWLNVQHDAFY-EQ  212

Query  1094  KGLGVTDAVLLALNKADLKTKKVMIHSNDSSVLMKFTNS------KYERVYGIKEEISDI  933
             + L ++ + LL++++         I S + +   K T S       +   +  KE+    
Sbjct  213   QNLSMS-SFLLSVSRT---VSIDFISSPEVNFFKKITGSFGRNGPTFVFQFLGKEDFEPT  268

Query  932   QNST---ILE----IKKFASSVIIGKSSVFPTDDS-FLVGVTNVVAKLQASKVKVYVQLF  777
              N T   IL     +K FAS +++ KS + P DD  +LV  T++V     + ++VYV  F
Sbjct  269   TNRTYGSILSNLTFVKTFASGILVPKSYILPLDDEQYLVPHTSLVQDAHKAGLQVYVSGF  328

Query  776   SNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATAN  648
             +N+ V  A+++ SDP  E  S+V     +  DGV++ FP TA+
Sbjct  329   AND-VDIAYNYSSDPVSEYLSFVDNGDFS-VDGVLSDFPITAS  369



>ref|XP_006452490.1| hypothetical protein CICLE_v10007536mg [Citrus clementina]
 gb|ESR65730.1| hypothetical protein CICLE_v10007536mg [Citrus clementina]
Length=764

 Score =   351 bits (900),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 179/318 (56%), Positives = 228/318 (72%), Gaps = 9/318 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+KDG+PFC+  +N+I+ T AAQ +F+++  +IP++   + I SF LNW +IQ+L  QI
Sbjct  397   QMSKDGVPFCLSFINLINSTNAAQSKFNSITTTIPDIMAGSGIFSFSLNWDEIQTLIPQI  456

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNP+ KF+LFRNP  KN GKFM L DFL  A NA S+SGVLI++ENA YLAEK+G+ VT+
Sbjct  457   SNPYFKFKLFRNPKNKNAGKFMKLSDFLEMAKNANSLSGVLISIENAVYLAEKQGMSVTN  516

Query  1073  AVLLALNKADLKTK---KVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
             +V+ AL  A    +   KVMI S DSSVLMK    + YE VY +KE I D  N TI +IK
Sbjct  517   SVMEALGNAGYNKQTALKVMIQSTDSSVLMKLREKTSYELVYKVKENIRDALNQTIEDIK  576

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             KFA SV++ K SV+P + +F+   T++V +LQ+ K+ VYV+ FSNEFVSQAWDFFSDP V
Sbjct  577   KFADSVVLSKESVYPLNSAFITSATDIVQRLQSFKLPVYVETFSNEFVSQAWDFFSDPTV  636

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMSPQY  549
             E+N+Y  GA     DGVIT FP TA RYRRNRCL   +  PPYM PV PG LL L++  Y
Sbjct  637   EINTYYEGAG---IDGVITEFPMTAARYRRNRCLKRGDKTPPYMNPVQPGGLLPLITSDY  693

Query  548   LPPAEAPYPVLTESDVVE  495
             LPPAEAP P+LTE+ V E
Sbjct  694   LPPAEAPNPILTEAAVTE  711



>ref|XP_004150252.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4 [Cucumis 
sativus]
 gb|KGN59083.1| Glycerophosphoryl diester phosphodiesterase [Cucumis sativus]
Length=764

 Score =   351 bits (900),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 184/326 (56%), Positives = 232/326 (71%), Gaps = 11/326 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             Q++KDGIPFCM S+N+ID TT +Q  F N + +IPE+   + + +FDL W++I+SL   I
Sbjct  395   QISKDGIPFCMSSINLIDSTTISQSPFINRSTNIPEISPNDGVFAFDLTWEEIKSLTPSI  454

Query  1253  SNPF-AKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
              NP+ AK+ LFRNP  +N G+F TL DFL  A NA+++SGVLI +ENAAYLA K G  VT
Sbjct  455   LNPYSAKYTLFRNPRFRNSGEFRTLPDFLALAKNASTLSGVLIQIENAAYLA-KHGFSVT  513

Query  1076  DAVLLALNKADLKTK---KVMIHSNDSSVLMKFT--NSKYERVYGIKEEISDIQNSTILE  912
             DAVL +L++A    +   KV+I S DS+VL+KF   N  YE VY + E ISD+ N+T+ +
Sbjct  514   DAVLSSLSEAGYDNQTAVKVLIQSPDSAVLIKFKQENKNYELVYKVDEPISDVLNTTVED  573

Query  911   IKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDP  732
             IK FA SV I KSSVFP +  FL G T+VV KL+A  + VYV+ FSNEFVSQAWDFFSD 
Sbjct  574   IKSFADSVTITKSSVFPVNQFFLTGATDVVKKLKALNLSVYVESFSNEFVSQAWDFFSDA  633

Query  731   YVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQ  552
              VE+NS+V GA     DGVIT FP T+ RY++NRCL  KE P YM PV PGSLLQL++  
Sbjct  634   TVEINSFVLGAE---IDGVITDFPKTSARYKKNRCLTMKETPTYMSPVQPGSLLQLITQP  690

Query  551   YLPPAEAPYPVLTESDVVEPPLPPVA  474
             YLPP   P PVL + DV EPPLPPV+
Sbjct  691   YLPPKTPPSPVLDDKDVAEPPLPPVS  716



>ref|XP_006474966.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Citrus sinensis]
Length=764

 Score =   351 bits (900),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 179/318 (56%), Positives = 228/318 (72%), Gaps = 9/318 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+KDG+PFC+  +N+I+ T AAQ +F+++  +IP++   + I SF LNW +IQ+L  QI
Sbjct  397   QMSKDGVPFCLSFINLINSTNAAQSKFNSITTTIPDIMAGSGIFSFSLNWDEIQTLIPQI  456

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNP+ KF+LFRNP  KN GKFM L DFL  A NA S+SGVLI++ENA YLAEK+G+ VT+
Sbjct  457   SNPYFKFKLFRNPKNKNAGKFMKLSDFLEMAKNANSLSGVLISIENAVYLAEKQGMSVTN  516

Query  1073  AVLLALNKADLKTK---KVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
             +V+ AL  A    +   KVMI S DSSVLMK    + YE VY +KE I D  N TI +IK
Sbjct  517   SVMEALGNAGYNKQTALKVMIQSTDSSVLMKLREKTSYELVYKVKENIRDALNQTIEDIK  576

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             KFA SV++ K SV+P + +F+   T++V +LQ+ K+ VYV+ FSNEFVSQAWDFFSDP V
Sbjct  577   KFADSVVLSKESVYPLNSAFITSATDIVQRLQSFKLPVYVETFSNEFVSQAWDFFSDPTV  636

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMSPQY  549
             E+N+Y  GA     DGVIT FP TA RYRRNRCL   +  PPYM PV PG LL L++  Y
Sbjct  637   EINTYYEGAG---IDGVITEFPMTAARYRRNRCLKRGDKTPPYMNPVQPGGLLPLITSDY  693

Query  548   LPPAEAPYPVLTESDVVE  495
             LPPAEAP P+LTE+ V E
Sbjct  694   LPPAEAPNPILTEAAVTE  711



>emb|CDY46687.1| BnaA03g48210D [Brassica napus]
Length=717

 Score =   348 bits (894),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 177/323 (55%), Positives = 227/323 (70%), Gaps = 8/323 (2%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+ DG PFC  S+++   T  AQ    N + ++PE+ +   I++F L W +IQ+L   I
Sbjct  350   QMSSDGTPFCSSSIDLGKTTMVAQTPLRNRSTNVPEISSLGGIYTFSLTWPEIQTLTPAI  409

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNP+  + +FRNP  +N GK ++L DFL  A N+TS+SGVLI+VENAAYL E +GL V  
Sbjct  410   SNPYRTYNMFRNPNERNAGKLVSLSDFLNLAKNSTSLSGVLISVENAAYLRENQGLDVVK  469

Query  1073  AVLLALNKA---DLKTKKVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTILEIK  906
             AVL  L +    ++ TKKVMI S +SSVL+ F   S+YE VY ++E I DI +S I +IK
Sbjct  470   AVLDTLTETGYTNITTKKVMIQSTNSSVLLDFKKQSRYETVYKVEETIRDILDSAIEDIK  529

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             +FAS+V+I KSSVFP  + F+ G TNVV +LQ S++ VYV+LF NEFVSQ +DFFSD  V
Sbjct  530   RFASAVVIVKSSVFPDSEGFVTGQTNVVERLQKSQLPVYVELFQNEFVSQPYDFFSDANV  589

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYL  546
             E+NSYV GA  N   G +T FP TA RYRRNRCLG KE PPYM PV PG LLQ+++   L
Sbjct  590   EINSYVTGAGVN---GTVTEFPFTAARYRRNRCLGSKETPPYMAPVQPGGLLQVVNHASL  646

Query  545   PPAEAPYPVLTESDVVEPPLPPV  477
             PPAEAP PV T++DV EPPLPPV
Sbjct  647   PPAEAPNPVFTDADVTEPPLPPV  669



>ref|XP_009137609.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 2 [Brassica rapa]
Length=759

 Score =   348 bits (894),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 177/323 (55%), Positives = 227/323 (70%), Gaps = 8/323 (2%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+ DG PFC  S+++   T  AQ    N + ++PE+ +   I++F L W +IQ+L   I
Sbjct  392   QMSSDGTPFCSSSIDLGKTTMVAQTPLRNRSTNVPEISSLGGIYTFSLTWPEIQTLTPAI  451

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNP+  + +FRNP  +N GK ++L DFL  A N+TS+SGVLI+VENAAYL E +GL V  
Sbjct  452   SNPYRTYNMFRNPNERNAGKLVSLSDFLNLAKNSTSLSGVLISVENAAYLRENQGLDVVK  511

Query  1073  AVLLALNKA---DLKTKKVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTILEIK  906
             AVL  L +    ++ TKKVMI S +SSVL+ F   S+YE VY ++E I DI +S I +IK
Sbjct  512   AVLDTLTETGYTNITTKKVMIQSTNSSVLLDFKKQSRYETVYKVEETIRDILDSAIEDIK  571

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             +FAS+V+I KSSVFP  + F+ G TNVV +LQ S++ VYV+LF NEFVSQ +DFFSD  V
Sbjct  572   RFASAVVIVKSSVFPDSEGFVTGQTNVVERLQKSQLPVYVELFQNEFVSQPYDFFSDANV  631

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYL  546
             E+NSYV GA  N   G +T FP TA RYRRNRCLG KE PPYM PV PG LLQ+++   L
Sbjct  632   EINSYVTGAGVN---GTVTEFPFTAARYRRNRCLGSKETPPYMAPVQPGGLLQVVNHASL  688

Query  545   PPAEAPYPVLTESDVVEPPLPPV  477
             PPAEAP PV T++DV EPPLPPV
Sbjct  689   PPAEAPNPVFTDADVTEPPLPPV  711



>gb|KDO62174.1| hypothetical protein CISIN_1g003550mg [Citrus sinensis]
Length=811

 Score =   349 bits (895),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 179/318 (56%), Positives = 227/318 (71%), Gaps = 9/318 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+KDG+PFC+  +N+I+ T AAQ +F+++  +IPE+   + I SF L W +IQ+L  QI
Sbjct  444   QMSKDGVPFCLSFINLINSTNAAQSKFNSITTTIPEIMAGSGIFSFSLIWDEIQTLIPQI  503

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNP+ KF+LFRNP  KN GKFM L DFL  A NA S+SGVLI++ENA YLAEK+G+ VT+
Sbjct  504   SNPYFKFKLFRNPKNKNAGKFMKLSDFLEMAKNANSLSGVLISIENAVYLAEKQGMSVTN  563

Query  1073  AVLLALNKADLKTK---KVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
             +V+ AL  A    +   KVMI S DSSVLMK    + YE VY +KE I D  N TI +IK
Sbjct  564   SVMEALGNAGYNKQTALKVMIQSTDSSVLMKLREKTSYELVYKVKENIRDALNQTIEDIK  623

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             KFA SV++ K SV+P + +F+   T++V +LQ+ K+ VYV+ FSNEFVSQAWDFFSDP V
Sbjct  624   KFADSVVLSKESVYPLNSAFITSATDIVQRLQSFKLPVYVETFSNEFVSQAWDFFSDPTV  683

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMSPQY  549
             E+N+Y  GA     DGVIT FP TA RYRRNRCL   +  PPYM PV PG LL L++  Y
Sbjct  684   EINTYYEGAG---IDGVITEFPMTAARYRRNRCLKRGDKTPPYMNPVQPGGLLPLITSDY  740

Query  548   LPPAEAPYPVLTESDVVE  495
             LPPAEAP P+LTE+ V E
Sbjct  741   LPPAEAPNPILTEAAVTE  758



>gb|AAP40466.1| unknown protein [Arabidopsis thaliana]
Length=763

 Score =   348 bits (892),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 181/324 (56%), Positives = 227/324 (70%), Gaps = 9/324 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+ DG+PFC+ S+++ +   A Q  FSN + S+PE+ +   I +F L W +IQSL   I
Sbjct  402   QMSSDGVPFCLRSIDLRNSIAALQNTFSNRSTSVPEISSVPGIFTFSLTWPEIQSLTPAI  461

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNPF  +R+FRNP  KN GK ++L  FL  A   TS+SGVLI+VENAAYL EK+GL V  
Sbjct  462   SNPFRVYRIFRNPREKNSGKLISLSQFLDLAKTYTSLSGVLISVENAAYLREKQGLDVVQ  521

Query  1073  AVLLALNKADLK----TKKVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTILEI  909
             AVL  L +A       T KVMI S +SSVL+ F   SKYE VY I+E I +I++S I +I
Sbjct  522   AVLDTLTEAGYSNGTTTTKVMIQSTNSSVLVDFKKQSKYETVYKIEETIGNIRDSAIEDI  581

Query  908   KKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPY  729
             KKFA++V+I K SVFP  DSFL G TNVV +LQ S++ VYV+LF NEFVSQA+DFFSD  
Sbjct  582   KKFANAVVINKDSVFPNSDSFLTGQTNVVERLQKSQLPVYVELFRNEFVSQAYDFFSDAT  641

Query  728   VELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQY  549
             VE+N+Y++GA  N   G IT FP TA RY+RNR LG +E+PPYMLPV PG LL +MSP  
Sbjct  642   VEINAYIYGAGIN---GTITEFPFTAARYKRNRYLGREEVPPYMLPVNPGGLLNVMSPLS  698

Query  548   LPPAEAPYPVLTESDVVEPPLPPV  477
             LPPA+AP     E+DV EPPL PV
Sbjct  699   LPPAQAPNQDFIEADVTEPPLSPV  722


 Score = 52.8 bits (125),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 71/283 (25%), Positives = 136/283 (48%), Gaps = 45/283 (16%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNL--AVSIPELKTQNAIHSFDLNWKDIQSLQAQ  1257
             Q+TKDG+  C   +N+ + +T  + + N   + S+  + T+    + D +  ++Q+    
Sbjct  88    QLTKDGLGICFPDLNLANASTIDRVYPNREKSYSVNGVTTKGWFPN-DFSLTELQN----  142

Query  1256  ISNPFAKFRLFRNPVAKNE-----GKFM-TLDDFLTFAANATSVSGVLITVENAAYLAEK  1095
                    F L R  +++ +     G  + T++D +T      +  G  + V++ A+  E+
Sbjct  143   -------FLLIRGILSRTDRFDGNGYLISTIEDVVT----TLNREGFWLNVQHDAFY-EQ  190

Query  1094  KGLGVTDAVLLALNKADLKTKKVMIHSNDSSVLMKFTNS------KYERVYGIKEEISDI  933
             + L ++ + LL++++         I S + +   K T S       +   +  KE+    
Sbjct  191   QNLSMS-SFLLSVSRT---VSIDFISSPEVNFFKKITGSFGRNGPTFVFQFLGKEDFEPT  246

Query  932   QNST---ILE----IKKFASSVIIGKSSVFPTDDS-FLVGVTNVVAKLQASKVKVYVQLF  777
              N T   IL     +K FAS +++ KS + P DD  +LV  T++V     + ++VYV  F
Sbjct  247   TNRTYGSILSNLTFVKTFASGILVPKSYILPLDDEQYLVPHTSLVQDAHKAGLQVYVSGF  306

Query  776   SNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATAN  648
             +N+ V  A+++ SDP  E  S+V     +  DGV++ FP TA+
Sbjct  307   AND-VDIAYNYSSDPVSEYLSFVDNGDFS-VDGVLSDFPITAS  347



>ref|XP_007020653.1| PLC-like phosphodiesterase family protein, putative isoform 2 
[Theobroma cacao]
 gb|EOY12178.1| PLC-like phosphodiesterase family protein, putative isoform 2 
[Theobroma cacao]
Length=758

 Score =   345 bits (886),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 184/325 (57%), Positives = 239/325 (74%), Gaps = 12/325 (4%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QMTKDG P C+GS+N+ID T  AQ  FSNL+ +IPE+   + I +FD++W+DI SL   I
Sbjct  397   QMTKDGTPICLGSINLIDSTDVAQSSFSNLSKTIPEIMQGSGIFTFDMSWRDILSLTTAI  456

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             S+P ++++LFRNP  KN GKF+TL +FL  A +A+S+ GVLI +ENAAYLAE+ G GVTD
Sbjct  457   SSPQSEYKLFRNPKFKNVGKFLTLSEFLAMAKSASSLQGVLIAIENAAYLAEQ-GFGVTD  515

Query  1073  AVLLALNKA--DLKT-KKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
             AV  AL++A  D +T +KVMI S++SSVLMKF   S Y+ VY + E+I   Q ++I +IK
Sbjct  516   AVFDALSEAGYDKQTAQKVMIQSSNSSVLMKFKGKSNYKLVYKVDEDIGGAQQASIDDIK  575

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
              FAS+V+I K SVFP +++FL GVT+VV +LQA+ + VYV  FSNEF SQAWDFFSD  V
Sbjct  576   SFASAVVISKDSVFPENNAFLTGVTDVVPRLQAANLSVYVHTFSNEFTSQAWDFFSDATV  635

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMSPQY  549
             E+NS+  G   N   GVIT FP T++R+  NRCL   +  P YM PV PGSLLQL++ +Y
Sbjct  636   EVNSFHVGGLIN---GVITDFPETSDRW--NRCLNKGDNTPGYMSPVQPGSLLQLVTAEY  690

Query  548   LPPAEAPYPVLTESDVVEPPLPPVA  474
             LPPAEAP P LTE+D+ E PLPPVA
Sbjct  691   LPPAEAPNPYLTEADIAESPLPPVA  715



>ref|XP_010253010.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
[Nelumbo nucifera]
Length=734

 Score =   344 bits (883),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 177/326 (54%), Positives = 232/326 (71%), Gaps = 10/326 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QMTKDGIP C+GS++++ GTT AQ QF++ + +IPE++    I +F L WK+IQSL+  I
Sbjct  387   QMTKDGIPICLGSIDLLYGTTVAQSQFNSRSSNIPEIQETPGIFTFSLTWKEIQSLKPAI  446

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
              NPF  + LFRNP  KN G F++LDDFL FA  + S+SGVLI++ENAAY+ E  GL V D
Sbjct  447   RNPFMDYNLFRNPAYKNAGSFLSLDDFLAFA-KSKSLSGVLISIENAAYIVENLGLSVID  505

Query  1073  AVLLALNKA---DLKTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
             AV+ AL K+   +   +K+MI S +SSVL+KF   + Y+ VY I E I D   ++I++IK
Sbjct  506   AVVDALKKSGHNNQTNQKIMIQSTNSSVLIKFKEKTNYQLVYKIDEVIRDADKASIMDIK  565

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             +FA S++I KSS+FP + +FL GVT +V+KL +  + VY  +F NEFVS AWDF+SDP V
Sbjct  566   QFAHSLVIRKSSIFPLNSAFLTGVTKIVSKLHSFNLTVYTSVFRNEFVSSAWDFYSDPVV  625

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMSPQY  549
             E+NS+V GA     DGVIT FP TA  YR+NRCL   + IP YM PV PG+L Q +S +Y
Sbjct  626   EINSFVMGAG---IDGVITDFPGTAIMYRKNRCLNRGDNIPSYMRPVQPGNLFQAISAEY  682

Query  548   LPPAEAPYPVLTESDVVEPPLPPVAK  471
             LP AEAP PVLT+SDV EPPLP V K
Sbjct  683   LPLAEAPSPVLTDSDVAEPPLPHVIK  708



>ref|XP_004293798.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Fragaria vesca subsp. vesca]
Length=751

 Score =   344 bits (882),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 174/321 (54%), Positives = 227/321 (71%), Gaps = 8/321 (2%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+KDGIPFC  S+++ D TT AQ  F N  + +PE + +  I++F L W  I++LQ  I
Sbjct  386   QMSKDGIPFCSSSISLNDITTVAQSSFQNFTMVVPEFQAEGRIYTFSLTWDQIKTLQPSI  445

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNP   ++L+RNP  +  G ++ L DFL  A N +SVSGVLI++E AAYLAEK+GL VTD
Sbjct  446   SNPQEYYKLYRNPRFRRAGTYVKLSDFLNMAKNRSSVSGVLISIEYAAYLAEKQGLSVTD  505

Query  1073  AVLLALNKADLKTK---KVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
             AV+  LNKA L  +    +MI S +SSVLMKF   SK + VY I+E I D  ++T+ +IK
Sbjct  506   AVITELNKAGLDNQTGLDIMIQSTNSSVLMKFKEKSKCKLVYKIEEVIRDALHTTLQDIK  565

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             KFA +V+I K+SVFP +  +++G T+VV KL A  + VYV+LFSNE++SQAWDFFSDP V
Sbjct  566   KFADAVVINKASVFPENVEYVIGATDVVTKLHAFDLHVYVELFSNEYLSQAWDFFSDPTV  625

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYL  546
             E+NS+V G +    DG+IT FP TA RY+RN+CL Y+E P YM P+ PG L   +SP  L
Sbjct  626   EINSFVSGVNV---DGIITDFPKTAVRYKRNKCLFYRERPSYMKPIQPGVLFTAISPAQL  682

Query  545   PPAEAPYPVLTESDVVEPPLP  483
             PP EAP PVLTESDV EPPLP
Sbjct  683   PPVEAPNPVLTESDVTEPPLP  703



>ref|XP_010099974.1| putative glycerophosphoryl diester phosphodiesterase 2 [Morus 
notabilis]
 gb|EXB81079.1| putative glycerophosphoryl diester phosphodiesterase 2 [Morus 
notabilis]
Length=748

 Score =   343 bits (881),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 181/327 (55%), Positives = 229/327 (70%), Gaps = 9/327 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+KDG PFC  S+N+ID T   Q  FSNL  S+P++K+   I +F L W  IQ L+  I
Sbjct  378   QMSKDGKPFCFSSINLIDSTDVVQSDFSNLTTSVPQIKSDTGIFTFSLTWDQIQQLKPVI  437

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             ++P++ + L+RNP   N GKF+TL  FL    +  S+SG+LI++++AAYLAE++GL VTD
Sbjct  438   ASPYSAYTLYRNPRNINVGKFITLSAFLDLTKSTKSLSGILISIDHAAYLAEEQGLSVTD  497

Query  1073  AVLLALNKADLKT---KKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
             AVL AL+KA   T    KV+I S++S+VL KF   + YE VY I E+I  I   T+ +IK
Sbjct  498   AVLDALSKAGFDTLTAPKVLIQSSNSAVLQKFKEKNNYELVYKIDEKIRSIDEPTLKDIK  557

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
              FA SV+I K+SVFP    FL G T+VV KLQ+ K+ VYV+ FSNEFVSQAWDFFSD  V
Sbjct  558   SFADSVVINKASVFPDIALFLTGSTDVVKKLQSYKLHVYVETFSNEFVSQAWDFFSDATV  617

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMSPQY  549
             E+NSYV GA+    DGVIT FPATA RY+ NRCLG     P YM PV PGSL++L++  Y
Sbjct  618   EVNSYVTGANV---DGVITEFPATAARYKINRCLGLGNNTPAYMSPVQPGSLVELITTDY  674

Query  548   LPPAEAPYPVLTESDVVEPPLPPVAKI  468
             LPPAEAP PVLTE DV EPPLPP A +
Sbjct  675   LPPAEAPNPVLTEDDVSEPPLPPAAPV  701



>emb|CDX94294.1| BnaC01g18900D [Brassica napus]
Length=757

 Score =   343 bits (881),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 179/324 (55%), Positives = 230/324 (71%), Gaps = 9/324 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+ DG PFC  S+++ + T  AQ    N + S+PE+ + N I++F L W +IQ+L   I
Sbjct  393   QMSSDGKPFCSSSIDLGNTTMVAQSPLRNRSTSVPEISSVNGIYTFTLTWPEIQTLTPAI  452

Query  1253  SNPFAK-FRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
             SNP+++ F +FRNP  +N GK ++L +FL  A N+T++SGVLI+VENAAYL EK+GL V 
Sbjct  453   SNPYSRRFNMFRNPNERNSGKLLSLSEFLNLAKNSTTLSGVLISVENAAYLREKQGLDVV  512

Query  1076  DAVLLALNK---ADLKTKKVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTILEI  909
              AVL AL +   ++  T KVMI S +SSVL+ F   S+YE VY ++E I DI +S I +I
Sbjct  513   KAVLDALTETGYSNRTTTKVMIQSTNSSVLVDFKKQSQYETVYKVEETIRDILDSAIEDI  572

Query  908   KKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPY  729
             KKFAS+V+IGKSSVFP  D F+ G TNVV +LQ S++ VYV+LF NEFVSQ +DFFSD  
Sbjct  573   KKFASAVVIGKSSVFPVVDGFVTGQTNVVERLQKSQLPVYVELFQNEFVSQPFDFFSDAT  632

Query  728   VELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQY  549
             VE+NSYV G   N   G IT FP TA RYRRNRCL  KE   YM PV PG LL+++SP  
Sbjct  633   VEINSYVTGPGIN---GTITEFPFTAARYRRNRCLASKETLSYMAPVQPGGLLEVVSPGS  689

Query  548   LPPAEAPYPVLTESDVVEPPLPPV  477
             +PPAEAP PV T++DV EPPLPPV
Sbjct  690   IPPAEAPNPVFTDADVTEPPLPPV  713



>ref|XP_010496108.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=764

 Score =   343 bits (881),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 183/326 (56%), Positives = 230/326 (71%), Gaps = 11/326 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+ DG  FC+ + ++ D T  AQ QFSNL+ ++PE+ +   I++F L W +IQ+L   I
Sbjct  401   QMSSDGKCFCLSTADLKDSTLVAQSQFSNLSTTVPEISSDVGIYTFSLTWPEIQNLTPAI  460

Query  1253  SNPFAKF-RLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
             SNPF +   +FRNP  +N GK ++L +FL  A  +TS+SGVLI VENAAYL EK+GL V 
Sbjct  461   SNPFRESSNMFRNPNERNSGKLISLSEFLELAKKSTSLSGVLIRVENAAYLREKQGLDVV  520

Query  1076  DAVLLALNKADLK----TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILE  912
              AVL  L +A       T KVMI S +SSVL+ F N SKYE VY I+E I DI++S I +
Sbjct  521   KAVLDTLTEAGYTNGNTTTKVMIQSTNSSVLVDFKNKSKYETVYKIEEIIRDIRDSAIED  580

Query  911   IKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDP  732
             IKKFA++V+I K+SVFP  DSFL G TNVV +LQ S++ VYV+LF NEFVSQA+DFF+D 
Sbjct  581   IKKFANAVVINKASVFPVSDSFLTGQTNVVERLQKSQLLVYVELFRNEFVSQAYDFFTDA  640

Query  731   YVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQ-LMSP  555
              VE+NSY+ GA  N   G IT FP TA RY+RNRCLG K IPPYM  + PG LL  L+SP
Sbjct  641   TVEINSYISGAGIN---GTITEFPYTAARYKRNRCLGRKVIPPYMSAIQPGDLLNTLVSP  697

Query  554   QYLPPAEAPYPVLTESDVVEPPLPPV  477
               LPPA+AP PV T+ DV EPPLPPV
Sbjct  698   LSLPPAQAPNPVFTDGDVTEPPLPPV  723



>ref|XP_006401453.1| hypothetical protein EUTSA_v10012748mg [Eutrema salsugineum]
 gb|ESQ42906.1| hypothetical protein EUTSA_v10012748mg [Eutrema salsugineum]
Length=768

 Score =   343 bits (879),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 177/327 (54%), Positives = 231/327 (71%), Gaps = 12/327 (4%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+ DG+PFC+ S+++ + T A Q  F N + ++PEL T + ++SF L W +IQ+L   I
Sbjct  401   QMSSDGVPFCLSSIDLGESTNAFQSPFRNRSATVPELDTLSKLYSFSLAWSEIQTLTPAI  460

Query  1253  SNPFAK-FRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
             +NP+ K + LFRNP  ++ GK ++L DFL  A N+TS++GVLI+VENA+YL EK+GL V 
Sbjct  461   TNPYNKDYNLFRNPRERSSGKLVSLSDFLNLAKNSTSLAGVLISVENASYLREKQGLDVI  520

Query  1076  DAVLLAL------NKADLKTKKVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTI  918
              AVL  L      N     TKKVMI S +SSVL+ F   S+YE VY ++E I DI +S I
Sbjct  521   KAVLDTLTESGYGNAKTTTTKKVMIQSTNSSVLVDFKKQSRYETVYKVEETIRDILDSAI  580

Query  917   LEIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFS  738
              +IKKFA +V+I K+SVFPT +SF  G TN+VA+LQ  ++ VYV++F NEFVSQ WDFFS
Sbjct  581   EDIKKFADAVVIKKTSVFPTSESFTTGQTNLVARLQKVQLPVYVEVFRNEFVSQPWDFFS  640

Query  737   DPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMS  558
             D  VE+NS+V GA  N   G IT FP TA RY+RNRCL  K+ P YM+PV P  LL ++S
Sbjct  641   DATVEINSHVSGAGIN---GTITEFPLTAARYKRNRCLTRKDPPTYMIPVLPAGLLSIVS  697

Query  557   PQYLPPAEAPYPVLTESDVVEPPLPPV  477
             P  LPPAEAP PV+TE+DV EPPLPPV
Sbjct  698   PTSLPPAEAPNPVITEADVTEPPLPPV  724



>ref|XP_009142640.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=757

 Score =   342 bits (878),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 179/324 (55%), Positives = 229/324 (71%), Gaps = 9/324 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+ DG PFC  S+++ + T  AQ    N + S+PE+ + N I++F L W +IQ+L   I
Sbjct  393   QMSSDGKPFCSSSIDLGNTTMVAQSPLRNRSTSVPEISSVNGIYTFTLTWPEIQTLTPAI  452

Query  1253  SNPFAK-FRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
             SNP+++ F +FRNP  +N GK ++L +FL  A N+T++SGVLI+VENAAYL EK+GL V 
Sbjct  453   SNPYSRRFNMFRNPNERNSGKLLSLSEFLNLAKNSTTLSGVLISVENAAYLREKQGLDVV  512

Query  1076  DAVLLALNK---ADLKTKKVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTILEI  909
              AVL AL +   ++  T KVMI S +SSVL+ F   S+YE VY ++E I DI +S I +I
Sbjct  513   KAVLDALTETGYSNRTTTKVMIQSTNSSVLVDFKKQSQYETVYKVEETIRDILDSAIEDI  572

Query  908   KKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPY  729
             K FAS+V+IGKSSVFP  D F+ G TNVV +LQ S++ VYV+LF NEFVSQ +DFFSD  
Sbjct  573   KTFASAVVIGKSSVFPVVDGFVTGQTNVVERLQKSQLPVYVELFQNEFVSQPFDFFSDAT  632

Query  728   VELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQY  549
             VE+NSYV G   N   G IT FP TA RYRRNRCL  KE   YM PV PG LL+++SP  
Sbjct  633   VEINSYVTGPGIN---GTITEFPFTAARYRRNRCLASKETLSYMAPVQPGGLLEVVSPGS  689

Query  548   LPPAEAPYPVLTESDVVEPPLPPV  477
             LPPAEAP PV T++DV EPPLPPV
Sbjct  690   LPPAEAPNPVFTDADVTEPPLPPV  713



>emb|CDX92806.1| BnaC07g40640D [Brassica napus]
Length=716

 Score =   341 bits (875),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 174/323 (54%), Positives = 226/323 (70%), Gaps = 8/323 (2%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+ DG PFC  S+++ + T  AQ    N + ++PEL +   I++F L W +IQ+L   I
Sbjct  350   QMSSDGTPFCSSSIDLGNTTMVAQTPLRNRSTNVPELSSLGGIYTFSLTWPEIQTLTPAI  409

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNP+  + +FRNP  +N GK ++L +FL  A N+TS+SGVLI+VENAAYL E +G+ V  
Sbjct  410   SNPYRTYNMFRNPNERNAGKLVSLTEFLNLAKNSTSLSGVLISVENAAYLRENQGIDVVK  469

Query  1073  AVLLALNKA---DLKTKKVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTILEIK  906
             AVL  L +    ++ TKKVMI S +SSVL+ F   S+YE VY ++E I DI +S I +IK
Sbjct  470   AVLDTLTQTGYTNITTKKVMIQSTNSSVLLDFKKQSRYETVYKVEETIRDILDSAIEDIK  529

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
              FAS+V+I KSSVFP  + F+   TNVV +LQ S++ VYV+LF NEFVSQ +DFFSD  V
Sbjct  530   AFASAVVIVKSSVFPDSEGFVTEQTNVVERLQKSQLPVYVELFQNEFVSQPYDFFSDANV  589

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYL  546
             E+NSYV GA  N   G +T FP TA R+RRNRCLG KE PPYM PV PG LLQ+++   L
Sbjct  590   EINSYVTGAGVN---GTVTEFPYTAARFRRNRCLGSKETPPYMAPVQPGGLLQVVNHASL  646

Query  545   PPAEAPYPVLTESDVVEPPLPPV  477
             PPAEAP PV T++DV EPPLPPV
Sbjct  647   PPAEAPNPVFTDADVTEPPLPPV  669



>ref|XP_007142366.1| hypothetical protein PHAVU_008G274200g [Phaseolus vulgaris]
 gb|ESW14360.1| hypothetical protein PHAVU_008G274200g [Phaseolus vulgaris]
Length=758

 Score =   342 bits (877),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 175/327 (54%), Positives = 228/327 (70%), Gaps = 7/327 (2%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+KDG PFC+ S+++I+ T  AQ  FS  A++IPE+KT + I +F+L W DI+ L   I
Sbjct  393   QMSKDGTPFCLNSIDLIESTAVAQSNFSKFAMTIPEIKTGSGIFAFNLTWNDIKDLTPSI  452

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
              NPFAK+RLFRNP +KN G+  +L  FL+   N TS+SG+ I+VENAAYLAEK+GL V D
Sbjct  453   LNPFAKYRLFRNPKSKNSGRLTSLSHFLSLTKNQTSLSGISISVENAAYLAEKQGLSVID  512

Query  1073  AVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
             AV+ AL+ A      ++KV I S +SSVL+KF   + YE VY I E + D  ++ + +IK
Sbjct  513   AVINALSSAGYDKPGSQKVYIQSTNSSVLLKFKEKTSYELVYKIDEIVGDAASAAVEDIK  572

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             KFAS+VI+ K SVF  +D FL   T +V KL A+ + V+V+ FSNEFVSQ+WDFFSD  V
Sbjct  573   KFASAVIVSKDSVFSNNDKFLTSTTKIVPKLNAANLSVFVETFSNEFVSQSWDFFSDATV  632

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMSPQY  549
             E+NSY+  A     DG+IT FP TA+RYRRN+CL   +  P YM PV PG L  L++P +
Sbjct  633   EINSYL-NAEGVKIDGIITDFPKTADRYRRNKCLNLGDKKPTYMDPVQPGGLFGLITPGF  691

Query  548   LPPAEAPYPVLTESDVVEPPLPPVAKI  468
             LPP EAP P LTES+V EP LPPV KI
Sbjct  692   LPPTEAPLPPLTESEVAEPALPPVVKI  718



>emb|CDY45656.1| BnaC09g31980D [Brassica napus]
Length=653

 Score =   339 bits (869),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 174/326 (53%), Positives = 225/326 (69%), Gaps = 11/326 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+ DGIPFC+ S ++ + T   Q  F N + ++PE+     ++SF L W +IQ+L+  I
Sbjct  287   QMSLDGIPFCLNSADLGESTNIVQSPFRNRSSTVPEIAPLGGLYSFSLTWSEIQTLRPAI  346

Query  1253  SNPFAK-FRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
             +NP+ + F LFRNP  ++ GK ++L DFL  A N+TS++GVLI+VENAAYL EK+GL V 
Sbjct  347   TNPYNRDFNLFRNPKERSSGKLVSLSDFLNLAKNSTSLAGVLISVENAAYLREKQGLDVV  406

Query  1076  DAVLLALNKADLK-----TKKVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTIL  915
              A+L  L KA        TKKVMI S +SSVL+ F   S+YE VY ++E I DI +S I 
Sbjct  407   KAILDTLTKAGYSNATTTTKKVMIQSTNSSVLVDFKKQSRYETVYQVEETIRDILDSAIE  466

Query  914   EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  735
             +IKKFA +V++ K+SVFP   SF  G TN+V +LQ  ++ VYV+LF NEFVSQ WDF SD
Sbjct  467   DIKKFADAVVVRKNSVFPVSQSFTTGQTNLVERLQRFQLPVYVELFRNEFVSQPWDFLSD  526

Query  734   PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  555
               VE+NS+V GA  N   G IT FP TA RY+RNRCL  K++PPYM PV P  LL +MSP
Sbjct  527   ATVEINSHVTGAGIN---GTITEFPLTAARYKRNRCLTRKDLPPYMSPVQPAGLLSIMSP  583

Query  554   QYLPPAEAPYPVLTESDVVEPPLPPV  477
               LPPAEAP PV T++DV EPPLPPV
Sbjct  584   TSLPPAEAPNPVFTDADVTEPPLPPV  609



>emb|CDY17323.1| BnaA10g09570D [Brassica napus]
Length=768

 Score =   341 bits (874),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 175/326 (54%), Positives = 227/326 (70%), Gaps = 11/326 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+ DGIPFC+ SV++ + T   Q  F N + ++PE+     ++SF L W +IQ+L+  I
Sbjct  402   QMSLDGIPFCLNSVDLGESTNIVQSPFRNRSSTVPEIAPLGGLYSFSLTWSEIQTLRPAI  461

Query  1253  SNPFAK-FRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
             +NP+ + F LFRNP  ++ GK ++L DFL  A N+TS++GVLI+VENAAYL EK+GL V 
Sbjct  462   TNPYNRDFNLFRNPKERSSGKLVSLSDFLNLAKNSTSLAGVLISVENAAYLREKQGLDVV  521

Query  1076  DAVLLALNKADLK-----TKKVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTIL  915
              AVL  L KA        TKKVMI S +SSVL+ F   S+YE VY ++E I DI +S I 
Sbjct  522   KAVLDTLTKAGYSNATTTTKKVMIQSTNSSVLVDFKKQSRYETVYQVEETIRDILDSAIQ  581

Query  914   EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  735
             +IKKFA +V++ K+SVFP  +SF  G TN+V +LQ  ++ VYV+LF NEFVSQ WDF SD
Sbjct  582   DIKKFADAVVVRKNSVFPVSESFTTGQTNLVERLQRFQLPVYVELFRNEFVSQPWDFLSD  641

Query  734   PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  555
               VE+NS+V GA  N   G IT FP TA RY+RN+CL  K++PPYM PV P  LL +MSP
Sbjct  642   ATVEINSHVTGAGIN---GTITEFPLTAARYKRNKCLTRKDLPPYMSPVQPAGLLSIMSP  698

Query  554   QYLPPAEAPYPVLTESDVVEPPLPPV  477
               LPPAEAP PV T++DV EPPLPPV
Sbjct  699   TSLPPAEAPNPVFTDADVTEPPLPPV  724



>emb|CDX89312.1| BnaA01g15810D [Brassica napus]
Length=757

 Score =   340 bits (873),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 178/324 (55%), Positives = 228/324 (70%), Gaps = 9/324 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+ DG PFC  S+++ + T  AQ    N + S+PE+ + N I++F L W +IQ+L   I
Sbjct  393   QMSSDGKPFCSSSIDLGNTTMVAQSPLRNRSTSVPEISSVNGIYTFTLTWPEIQTLTPAI  452

Query  1253  SNPFA-KFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
             SNP++ +F +FRNP  +N GK ++L +FL  A N+T++SGVLI+VENAAYL E +GL V 
Sbjct  453   SNPYSSRFNMFRNPNERNSGKLLSLSEFLNLAKNSTTLSGVLISVENAAYLREMQGLDVV  512

Query  1076  DAVLLALNK---ADLKTKKVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTILEI  909
              AVL AL +   ++  T KVMI S +SSVL+ F   S+YE VY ++E I DI +S I +I
Sbjct  513   KAVLDALTETGYSNRTTTKVMIQSTNSSVLVDFKKQSQYETVYKVEETIRDILDSAIEDI  572

Query  908   KKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPY  729
             K FAS+V+IGKSSVFP  D F+ G TNVV +LQ S++ VYV+LF NEFVSQ +DFFSD  
Sbjct  573   KTFASAVVIGKSSVFPVVDGFVTGQTNVVERLQKSQLPVYVELFQNEFVSQPFDFFSDAT  632

Query  728   VELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQY  549
             VE+NSYV G   N   G IT FP TA RYRRNRCL  KE   YM PV PG LL+++SP  
Sbjct  633   VEINSYVTGPGIN---GTITEFPFTAARYRRNRCLASKETLSYMAPVQPGGLLEVVSPGS  689

Query  548   LPPAEAPYPVLTESDVVEPPLPPV  477
             LPPAEAP PV T++DV EPPLPPV
Sbjct  690   LPPAEAPNPVFTDADVTEPPLPPV  713



>ref|XP_002276757.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4 [Vitis 
vinifera]
 emb|CBI26719.3| unnamed protein product [Vitis vinifera]
Length=757

 Score =   340 bits (872),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 177/326 (54%), Positives = 230/326 (71%), Gaps = 11/326 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QMTKDG P C+ S+N++D T  AQ  FS    +I EL+  + I +F+L W+DI+SL   I
Sbjct  391   QMTKDGTPICLSSINLMDSTKVAQTPFSTFTTTITELQKGSGIFTFNLTWEDIRSLTPAI  450

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSG-VLITVENAAYLAEKKGLGVT  1077
             SNP++ FRL RNP AK  GK ++L DFL+ A  A S+SG VLI +E+AA+L  K GL VT
Sbjct  451   SNPYSTFRLSRNPAAKTAGKLVSLSDFLSIAKEANSLSGGVLIGIEHAAFLV-KVGLSVT  509

Query  1076  DAVLLALNKA---DLKTKKVMIHSNDSSVLMKFTNSK--YERVYGIKEEISDIQNSTILE  912
             DAVL AL+KA   ++ T +VMI S +SSVL +F   K  YE VY + E I D  ++TI +
Sbjct  510   DAVLDALSKAGYDNVTTPRVMIQSTNSSVLKEFKEKKKNYELVYRVDENIRDASDATIED  569

Query  911   IKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDP  732
             IKKFA+SV+I K S++P + +F+ G T++V++L+ + + VYVQ F NEF+SQAWDFFSD 
Sbjct  570   IKKFATSVVISKDSIYPENKAFITGATDIVSRLKKNNLPVYVQRFDNEFISQAWDFFSDA  629

Query  731   YVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQ  552
              VE+NS+V GA     DGVIT FP TA  YR+NRCL YK  P YM PV PGSL+Q+++  
Sbjct  630   TVEINSFVTGAG---IDGVITSFPQTAASYRKNRCLKYKNAPSYMSPVQPGSLMQVITSD  686

Query  551   YLPPAEAPYPVLTESDVVEPPLPPVA  474
              +PPA APYPVLTESDV EPPL  VA
Sbjct  687   DMPPALAPYPVLTESDVAEPPLQEVA  712



>ref|XP_010449676.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
isoform X1 [Camelina sativa]
 ref|XP_010449685.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
isoform X2 [Camelina sativa]
Length=767

 Score =   339 bits (870),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 173/325 (53%), Positives = 230/325 (71%), Gaps = 10/325 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+ DGIPFC+ S+++ + T   Q  F N + ++PELK+   I+SF L W +IQ+L+  I
Sbjct  402   QMSSDGIPFCLSSIDLGESTNVVQSPFRNRSATVPELKSLAGIYSFSLAWSEIQTLRPAI  461

Query  1253  SNPFAK-FRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
              NP+ K F LFRNP  ++ GK ++L DFL  A N++++ GVLI+VENA+YL EK+GL   
Sbjct  462   ENPYNKDFNLFRNPRERSSGKLVSLSDFLNLAKNSSTLVGVLISVENASYLREKQGLDAV  521

Query  1076  DAVLLALNKADLKTK----KVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTILE  912
              A+L +L +A    K    +VMI S +SSVL+ F   S+YE VY ++E ISDI +S I +
Sbjct  522   KAILDSLTEAGYSNKTTTTRVMIQSTNSSVLVDFKKQSRYETVYKVEEAISDILDSAIED  581

Query  911   IKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDP  732
             IKKFA +V+IGK+SVFP+  SF  G TN+V +LQ  K+ VYV++F NEFVSQ +DFFSD 
Sbjct  582   IKKFADAVVIGKTSVFPSSASFTTGQTNLVERLQKLKLPVYVEVFRNEFVSQPYDFFSDA  641

Query  731   YVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQ  552
              VE+NS+V GA  N   G IT FP TA RY+RN CL  K+ PPYM+PV PG LL ++SP 
Sbjct  642   TVEINSHVTGAGVN---GAITEFPLTAARYKRNTCLTRKDPPPYMIPVQPGGLLTIVSPA  698

Query  551   YLPPAEAPYPVLTESDVVEPPLPPV  477
              LPPAEAP PV T++DV+EPPLPPV
Sbjct  699   SLPPAEAPNPVFTDADVIEPPLPPV  723


 Score = 52.4 bits (124),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 70/289 (24%), Positives = 129/289 (45%), Gaps = 58/289 (20%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIH--------SFDLNWKDI  1275
             Q+TKD I  C   V M++        SN+ V  P+ K    ++        + D   KD+
Sbjct  89    QLTKDAIGICFPDVKMMNA-------SNIQVVYPKRKNSYLLNGVPTQDWFTIDFTLKDL  141

Query  1274  QSLQAQISNPFAKFRLFRNPVAKNE---GKFMTLDDFLTFAANATSVSGVLITVENAAYL  1104
             +S+            L R  +++++   G   T+      A     +    + V++ A+ 
Sbjct  142   KSV-----------FLIRGIMSRSDAFDGNGYTISTVQDIATQ-LKLQSFWLNVQHDAFY  189

Query  1103  AEKKGLGVTDAVLLALNKADLKTKKVMIHSNDSSVLMKFTN--SKYER-----VYGIKEE  945
             A+   L ++  +L A       TK V ++   S  +  F N  S++ R     V+   E+
Sbjct  190   AQHN-LSISSFLLSA-------TKTVTVNYLSSPEVNFFRNIGSRFGRKGPKFVFRFLEK  241

Query  944   ISDIQNST----------ILEIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVK  795
               D++ ST          +  IK FAS +++ KS ++P +  +L+  T+VV     + ++
Sbjct  242   -DDVEVSTNQTYGSLAGNLTFIKTFASGILVPKSYIWPVESQYLLPHTSVVQDAHKAGLE  300

Query  794   VYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATAN  648
             VY   F+N+F   A+++  DP  E  S+V     +  DG+++ FP TA+
Sbjct  301   VYASGFANDF-DIAYNYSFDPLAEYLSFVDNGDFS-VDGLVSDFPLTAS  347



>ref|XP_002864395.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH40654.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=757

 Score =   339 bits (870),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 173/325 (53%), Positives = 228/325 (70%), Gaps = 10/325 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+ DGIPFC+ S+N+ D T   Q  F N + ++PE+ +   I+SF L W +IQ+L+  I
Sbjct  392   QMSSDGIPFCLSSINLGDSTNVVQSPFRNRSTAVPEIGSLPGIYSFSLAWSEIQTLRPAI  451

Query  1253  SNPFAK-FRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
              NP+++ F LFRNP  K+ GKF+TL DFL  A N++S++GVLI+VENA YL EK+GL   
Sbjct  452   ENPYSREFTLFRNPREKSSGKFVTLSDFLNLAKNSSSLAGVLISVENATYLREKQGLDAV  511

Query  1076  DAVLLALNKADLKTK----KVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTILE  912
              AVL  L +A    K    +VMI S +SSVL++F   S+YE VY ++E I DI +S I +
Sbjct  512   KAVLDTLTEAGYSNKTTTTRVMIQSTNSSVLVEFKKQSRYETVYKVEEVIRDILDSAIED  571

Query  911   IKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDP  732
             IKKFA +V+I K+SVFPT +SF  G T +V +LQ  ++ VYV++F NEFVSQ WDFF+D 
Sbjct  572   IKKFADAVVIRKTSVFPTSESFTTGQTKLVERLQKFQLPVYVEVFRNEFVSQPWDFFADA  631

Query  731   YVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQ  552
              VE+NS+V GA  N   G IT FP TA RY+RN CL  K+ PPYM+PV P  LL ++SP 
Sbjct  632   TVEINSHVTGAGIN---GTITDFPLTAARYKRNSCLTRKDPPPYMIPVQPAGLLTIVSPA  688

Query  551   YLPPAEAPYPVLTESDVVEPPLPPV  477
              LPPAEAP PV+T++DV EPPLPPV
Sbjct  689   SLPPAEAPNPVITDADVTEPPLPPV  713



>ref|XP_009120058.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Brassica rapa]
Length=768

 Score =   339 bits (870),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 174/326 (53%), Positives = 227/326 (70%), Gaps = 11/326 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+ DGIPFC+ SV++ + T   Q  F N + ++PE+     ++SF L W +IQ+L+  I
Sbjct  402   QMSLDGIPFCLNSVDLGESTNIVQSPFRNRSATVPEIAPLGGLYSFSLTWSEIQTLRPAI  461

Query  1253  SNPFAK-FRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
             +NP+ + F LFRNP  ++ GK ++L DFL  A ++TS++GVLI+VENAAYL EK+GL V 
Sbjct  462   TNPYNRDFNLFRNPKERSSGKLVSLSDFLNLAKSSTSLAGVLISVENAAYLREKQGLDVV  521

Query  1076  DAVLLALNKADLK-----TKKVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTIL  915
              AVL  L KA        TKKVMI S +SSVL+ F   S+YE VY ++E I DI +S I 
Sbjct  522   KAVLDTLTKAGYSNATTTTKKVMIQSTNSSVLVDFKKQSRYETVYQVEETIRDILDSAIQ  581

Query  914   EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  735
             +IKKFA +V++ K+SVFP  +SF  G TN+V +LQ  ++ VYV+LF NEFVSQ WDF SD
Sbjct  582   DIKKFADAVVVRKNSVFPVSESFTTGQTNLVERLQRFQLPVYVELFRNEFVSQPWDFLSD  641

Query  734   PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  555
               VE+NS+V GA  N   G IT FP TA RY+RN+CL  K++PPYM PV P  LL +MSP
Sbjct  642   ATVEINSHVTGAGIN---GTITEFPLTAARYKRNKCLTRKDLPPYMSPVQPAGLLSIMSP  698

Query  554   QYLPPAEAPYPVLTESDVVEPPLPPV  477
               LPPAEAP PV T++DV EPPLPPV
Sbjct  699   TSLPPAEAPNPVFTDADVTEPPLPPV  724



>ref|XP_010511612.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=761

 Score =   337 bits (864),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 177/325 (54%), Positives = 229/325 (70%), Gaps = 10/325 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+ D  PFC+ S+++ D T  AQ  FSN +  IPEL +   I++F L W +IQ+L   I
Sbjct  403   QMSSDRKPFCLSSIDLKDSTMVAQTTFSNRSTPIPELSSVPGIYTFSLTWPEIQNLTPVI  462

Query  1253  SNPFA-KFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
             S PF   + +FRNP  +N GK ++L +FL  A N+TS+SGVLI+VENAAYL EK+GL V 
Sbjct  463   STPFRDSYNMFRNPNERNSGKLISLSEFLELAKNSTSLSGVLISVENAAYLREKQGLDVV  522

Query  1076  DAVLLALNKADLK---TKKVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTILEI  909
              AVL  L +   +   T KVMI S +SSVL+ F    KYE VY I E I +I N  I +I
Sbjct  523   KAVLDTLTETGYENSTTTKVMIQSTNSSVLVDFKKQCKYETVYKIDETIGEILNYGIEDI  582

Query  908   KKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPY  729
             KKFA++V+I K SVFP  DSFL G TNVV +LQ S++ VYV+LF NEF+SQA+DFFSD  
Sbjct  583   KKFANAVVINKESVFPDSDSFLTGQTNVVERLQKSQLPVYVELFRNEFISQAYDFFSDAT  642

Query  728   VELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQ-LMSPQ  552
             VE+N+Y++GA  N   G IT FP TA RY+RNRCLG KEIPPYM P+  G+LL+ L++P 
Sbjct  643   VEINTYIYGAGIN---GTITEFPFTAARYKRNRCLGRKEIPPYMSPIQAGTLLKNLVTPL  699

Query  551   YLPPAEAPYPVLTESDVVEPPLPPV  477
              LPPAEAP  ++T++D++EPPLPPV
Sbjct  700   SLPPAEAPKLIITDADLIEPPLPPV  724



>ref|XP_002867546.1| MRH5/SHV3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43805.1| MRH5/SHV3 [Arabidopsis lyrata subsp. lyrata]
Length=756

 Score =   336 bits (862),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 176/323 (54%), Positives = 222/323 (69%), Gaps = 8/323 (2%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAA-QQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+ DG P C+GS+++ + TT A   F N + ++PEL +   I++F L W +IQ+L   I
Sbjct  393   QMSSDGTPICLGSIDLGNSTTVALTAFRNRSTTVPELGSVGGIYTFSLTWPEIQTLTPAI  452

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNP+   RLFRNP  KN GK  +L DFL  A N+TS+SGVLI+VENAAYL E +GL V  
Sbjct  453   SNPYGVSRLFRNPNQKNAGKLFSLSDFLNLAKNSTSLSGVLISVENAAYLRENQGLDVVK  512

Query  1073  AVLLALNK---ADLKTKKVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTILEIK  906
             AVL  L     ++    KVMI S +SSVL+ F   S+YE VY ++E I DI +S I +IK
Sbjct  513   AVLDTLTHTGYSNNTATKVMIQSTNSSVLVDFKKQSQYETVYKVEENIRDILDSAIEDIK  572

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             KFA +V+I KSSVFP   SF+   TNVV KLQ S++ VYV+LF NEF+SQ +DFF+D  V
Sbjct  573   KFADAVVIQKSSVFPLAQSFITTQTNVVEKLQKSQLPVYVELFQNEFLSQPYDFFADATV  632

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYL  546
             E+NSY+ GA  N   G IT FP TA RY+RN CLG KE  PYM P  PG+LL L+SP  L
Sbjct  633   EINSYITGAGIN---GTITEFPFTAARYKRNLCLGRKETIPYMAPAQPGALLTLVSPTSL  689

Query  545   PPAEAPYPVLTESDVVEPPLPPV  477
             PPA+AP PV T++DV EPPLPPV
Sbjct  690   PPAQAPNPVFTDADVTEPPLPPV  712



>ref|XP_004491450.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Cicer arietinum]
Length=755

 Score =   336 bits (862),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 182/329 (55%), Positives = 229/329 (70%), Gaps = 11/329 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+KDGIPFC+ S ++ + TTA +  FS  A+SIPE+K  N I +F+L W DI+ L   I
Sbjct  389   QMSKDGIPFCLSSADLGESTTAVKSSFSRYAMSIPEIKPGNGIFTFNLTWTDIKGLTPSI  448

Query  1253  SNPF-AKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
              NPF AK+ L R+P  KN G F+TL DFL    N TS+SGVLI VENAAYLAEK+GL VT
Sbjct  449   VNPFFAKYSLVRDPKYKNAGTFVTLSDFLLLTKNQTSLSGVLIIVENAAYLAEKQGLSVT  508

Query  1076  DAVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEI  909
             DAV+ AL+KA      ++KV I S +SSVL+KF   + YE VY I E + D+ ++ + +I
Sbjct  509   DAVIDALSKAGYDKPGSQKVYIQSTNSSVLLKFKEKTSYELVYKIDETVGDVADAAVEDI  568

Query  908   KKFASSVIIGKSSVFPTDDSFLV-GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDP  732
             K FA SV++ K SVFP D +FL   +T  V KL+AS + V+V+ FSNEFVSQAWDFFSDP
Sbjct  569   KSFAGSVVVDKVSVFPRDVAFLTSSLTRTVPKLKASNLSVFVETFSNEFVSQAWDFFSDP  628

Query  731   YVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMSP  555
              VE+NS++  A     DGVIT FP TANRY RN+CL   + +PPYM PV  GSL  ++  
Sbjct  629   IVEINSFIQEAG---IDGVITDFPKTANRYSRNKCLNLGDKVPPYMQPVQAGSLYGIIPS  685

Query  554   QYLPPAEAPYPVLTESDVVEPPLPPVAKI  468
             + LPPA AP P LT S+VVEPPLPPV KI
Sbjct  686   ESLPPALAPLPSLTNSEVVEPPLPPVTKI  714


 Score = 55.8 bits (133),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 66/278 (24%), Positives = 128/278 (46%), Gaps = 38/278 (14%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVS--IPELKTQNAIHSFDLNWKDIQSLQAQ  1257
             Q+TKD +  C+ +V + + T  +  F N + +  +  + T N   S D   KD+ ++   
Sbjct  74    QLTKDEVGICLPNVILDNSTFISYIFPNKSTTYNVNNVPT-NGYFSLDYTLKDLSNV---  129

Query  1256  ISNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
                P  +    R+PV       +T+DD +   A  T   G+ + +++ A+ A+ K L + 
Sbjct  130   ---PLKQVVYSRSPVFDGTYMILTVDDVVKSGAPQTP--GLWLNIQHDAFYAQHK-LSMK  183

Query  1076  DAVLLALNKAD-----------LKTKKVMIHSNDSSVLMKF-----TNSKYERVYGIKEE  945
               VL    +             L++ K  ++   +  + +F     T+    + YG    
Sbjct  184   RFVLSVSRRVRVNYISSPEIGFLRSIKPRLNPKKTKFIFRFLDQNETDPSTNQTYG----  239

Query  944   ISDIQNSTILEIKKFASSVIIGKSSVFPTDDS-FLVGVTNVVAKLQASKVKVYVQLFSNE  768
              S ++N T   IK FAS +++ K  ++P DDS +L   T++V+      ++V+   F+N+
Sbjct  240   -SLLKNLTF--IKSFASGILVPKGYIWPVDDSLYLQPHTSLVSDAHKLGLEVFASGFAND  296

Query  767   FVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  654
               S ++++  DP  E   ++     +  DGV++ FP T
Sbjct  297   -ASFSFNYSYDPLAEYLQFIDNGEFS-VDGVLSDFPVT  332



>ref|NP_200359.1| putative glycerophosphoryl diester phosphodiesterase 1 [Arabidopsis 
thaliana]
 sp|Q9FJ62.1|GPDL4_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase GDPDL4; 
AltName: Full=Glycerophosphodiester phosphodiesterase-like 
4; Short=ATGDPDL4; AltName: Full=Glycerophosphodiesterase-like 
1; AltName: Full=Protein SHV3-LIKE 1; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB08565.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAU94382.1| At5g55480 [Arabidopsis thaliana]
 gb|AAV59273.1| At5g55480 [Arabidopsis thaliana]
 gb|AED96633.1| putative glycerophosphoryl diester phosphodiesterase 1 [Arabidopsis 
thaliana]
Length=766

 Score =   336 bits (862),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 168/326 (52%), Positives = 227/326 (70%), Gaps = 10/326 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+ DGIPFC+ S+N+ + T   Q  F N + ++PE+ +   I+SF L W +IQ+L+  I
Sbjct  401   QMSSDGIPFCLSSINLGESTNVVQSPFRNRSTTVPEIGSLPGIYSFSLAWSEIQTLRPAI  460

Query  1253  SNPFAK-FRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
              NP+++ F +FRNP  ++ GKF++L DFL  A N++S++GVLI+VENA YL EK+GL   
Sbjct  461   ENPYSREFTMFRNPRERSSGKFVSLSDFLNLAKNSSSLTGVLISVENATYLREKQGLDAV  520

Query  1076  DAVLLALNKADLKTK----KVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTILE  912
              AVL  L +A    K    +VMI S +SSVL+ F   S+YE VY ++E I DI ++ I +
Sbjct  521   KAVLDTLTEAGYSNKTTTTRVMIQSTNSSVLIDFKKQSRYETVYKVEETIRDILDTAIED  580

Query  911   IKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDP  732
             IKKFA +V+I K SVFPT +SF  G T +V +LQ  ++ VYV++F NEFVSQ WDFF+D 
Sbjct  581   IKKFADAVVISKKSVFPTSESFTTGQTKLVERLQKFQLPVYVEVFRNEFVSQPWDFFADA  640

Query  731   YVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQ  552
              VE+NS+V GA  N   G IT FP TA RY+RN CL  K++PPYM+PV P  LL ++SP 
Sbjct  641   TVEINSHVTGAGIN---GTITEFPLTAARYKRNSCLTRKDVPPYMIPVQPAGLLTIVSPA  697

Query  551   YLPPAEAPYPVLTESDVVEPPLPPVA  474
              LPPAEAP PV T++DV EPPLPPV+
Sbjct  698   SLPPAEAPSPVFTDADVTEPPLPPVS  723



>ref|XP_006280047.1| hypothetical protein CARUB_v10025925mg [Capsella rubella]
 gb|EOA12945.1| hypothetical protein CARUB_v10025925mg [Capsella rubella]
Length=682

 Score =   333 bits (854),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 169/325 (52%), Positives = 224/325 (69%), Gaps = 10/325 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+ DGIPFC+ S+++   T   Q  F N + ++PEL + + I+SF L W +IQ+L+  I
Sbjct  317   QMSSDGIPFCLSSIDLGKSTNVVQSPFRNRSATVPELNSLSGIYSFSLTWSEIQTLRPAI  376

Query  1253  SNPFAK-FRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
              NP+ K F LFRNP  ++ GK ++L DFL  A N++S+ GVLI+VENA YL EK+GL   
Sbjct  377   ENPYNKDFNLFRNPRERSSGKLVSLSDFLNLAKNSSSLVGVLISVENATYLREKQGLDAV  436

Query  1076  DAVLLALNKADLK----TKKVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTILE  912
              A L +L +A       T +VMI S +SSVL+ F  +S+YE VY ++E I DI +S I +
Sbjct  437   KAALDSLMEAGYSNRTTTTRVMIQSTNSSVLVDFKKHSQYETVYKVEESIRDILDSAIED  496

Query  911   IKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDP  732
             IKKFA ++++GK SVFPT  SF+   TN+VA+LQ  ++ VYV+LF NEFVSQ WDFFSD 
Sbjct  497   IKKFADAIVVGKKSVFPTSASFITRQTNLVARLQKVQLPVYVELFQNEFVSQPWDFFSDA  556

Query  731   YVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQ  552
              VE+NS+V GA      G IT FP TA RY++N CL  K++PPYM PV P  LL ++SP 
Sbjct  557   TVEINSHVTGAG---ISGTITEFPLTAARYKKNSCLNRKDLPPYMTPVQPAGLLTIVSPT  613

Query  551   YLPPAEAPYPVLTESDVVEPPLPPV  477
              LPPAEAP PV T++DV EPPLPPV
Sbjct  614   SLPPAEAPNPVFTDADVTEPPLPPV  638



>ref|XP_010270134.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4 [Nelumbo 
nucifera]
Length=751

 Score =   334 bits (857),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 171/321 (53%), Positives = 229/321 (71%), Gaps = 10/321 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QMT+DGIP C GS+N+ID T  AQ +F+    +IP++++   I +F+L W++I+ L+  I
Sbjct  391   QMTQDGIPICSGSINLIDTTNVAQSKFNTRTTNIPQIQSTPGIFTFNLTWEEIKKLKPVI  450

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNPF  + LFRNPV KN+G+F +LDDF+ FA   +    VLI++E+AAYL E  G  V D
Sbjct  451   SNPFLDYGLFRNPVHKNDGQFFSLDDFMAFAKGNSL--PVLISIEHAAYLVENLGFNVID  508

Query  1073  AVLLALNKADL--KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIKK  903
             AV++ALNK+    + +KVMI S +SSVLMKF   + Y+ VY + E ISDI +S I +IK+
Sbjct  509   AVVVALNKSGYNNENQKVMIQSTNSSVLMKFMEKTNYKLVYSVDEFISDIDDSAIKDIKR  568

Query  902   FASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVE  723
             FA SV I KS+VFP + +F+ G+T VV+KLQA  +  YV LF NEFVSQAWD FSDP VE
Sbjct  569   FAHSVAITKSNVFPVNQAFITGMTKVVSKLQAFNLTAYVYLFRNEFVSQAWDVFSDPTVE  628

Query  722   LNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMSPQYL  546
             +N++V   +    DG+I+ FP TA  YR+NRCLG  K IP YM PV PGSL+Q+++P +L
Sbjct  629   INTFV---TLGKIDGIISDFPGTAAAYRKNRCLGMGKNIPIYMTPVQPGSLMQVITPDFL  685

Query  545   PPAEAPYPVLTESDVVEPPLP  483
             PPAEAP PVL +S+V EPP P
Sbjct  686   PPAEAPNPVLEDSNVAEPPFP  706



>gb|EPS69135.1| glycerophosphodiesterase-like protein, partial [Genlisea aurea]
Length=689

 Score =   333 bits (853),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 178/325 (55%), Positives = 222/325 (68%), Gaps = 11/325 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             Q++ DGIPFC+GS+N+ D T AAQ  F + A   P+L  Q+ I +++L W  IQ+L   +
Sbjct  354   QISSDGIPFCLGSINLRDRTNAAQSAFLSQATDNPDLNIQSGIFTYNLTWSQIQTLSPAM  413

Query  1253  SNPFA-KFRLFRNPVAKNEGKFMTLDDFLTFAAN-ATSVSGVLITVENAAYLAEKKGLGV  1080
              +P+A    L+RNP+A NEGKF+ L +FL FA+N ATSVS +LI VEN AYLA+ +GL +
Sbjct  414   YSPYAVGSSLYRNPIAANEGKFLQLSEFLAFASNNATSVSEILIGVENDAYLAQNQGLDL  473

Query  1079  TDAVLLALNKADLKTKKVMIHSNDSSVLMKFTN----SKYERVYGIKEEISDIQNSTILE  912
             + AVL  L++   K KK++I S+DS+VL +F N    S YE VY ++E I  I NST+ E
Sbjct  474   SGAVLDVLSQFQPK-KKILIRSSDSAVLWRFKNNSSSSGYELVYLVEENIGGILNSTVSE  532

Query  911   IKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDP  732
             I KFASSV+I K SVFP D  F  G T VV  LQ   + VYVQ F NEF SQ WDF+SD 
Sbjct  533   IAKFASSVVISKESVFPLDRQFTTGQTTVVGFLQGYNLSVYVQDFQNEFFSQPWDFYSDA  592

Query  731   YVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQ  552
              VE+NSYV G   N   GV+T +P TANRYRR RCLGYK  P YMLPV PGSL+ L+   
Sbjct  593   TVEINSYVSGVGIN---GVVTDYPGTANRYRRRRCLGYKNTPNYMLPVQPGSLITLLVKN  649

Query  551   YLPPAEAPYPVLTESDVVEPPLPPV  477
              LPPA AP PVLTE DV+E PLPPV
Sbjct  650   QLPPAPAPSPVLTEGDVIEAPLPPV  674



>ref|XP_010511610.1| PREDICTED: LOW QUALITY PROTEIN: glycerophosphodiester phosphodiesterase 
GDPDL1-like [Camelina sativa]
Length=764

 Score =   334 bits (857),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 178/326 (55%), Positives = 228/326 (70%), Gaps = 11/326 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+ DG  FC+ + ++ D T  AQ QFS+ + ++PE+ T   I++F L W +IQ+L   I
Sbjct  401   QMSSDGKSFCLSTADLKDSTLVAQSQFSDRSTTVPEISTVPGIYTFSLTWPEIQNLTTAI  460

Query  1253  SNPF-AKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
             SNP+ + + +FRNP  KN GK ++L +FL  A  +TS+SGVLI VENAAYL EK+GL V 
Sbjct  461   SNPYQSSYNMFRNPNEKNSGKLISLSEFLELAKKSTSLSGVLIRVENAAYLREKQGLDVV  520

Query  1076  DAVLLALNKADLK----TKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTILE  912
              AV+  L +A       T KVM+ S +SSVL+ F + SKYE VY I+E ISDI +S I +
Sbjct  521   KAVIDTLTEAGYSNGNTTLKVMVQSTNSSVLVDFKSQSKYETVYKIEETISDIGDSAIED  580

Query  911   IKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDP  732
             +KKFA++V+IGK SVFP  D+FL G TNVV KLQ SK+ VYV+LF NEFVSQ +DFFSD 
Sbjct  581   MKKFANAVVIGKDSVFPIADNFLSGQTNVVEKLQKSKLPVYVELFQNEFVSQPFDFFSDA  640

Query  731   YVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQ-LMSP  555
              VE+N+Y +G   N   G IT FP TA RY+RNRCLG K IPPYM P+  G LL+ L+SP
Sbjct  641   TVEINTYTYGFGIN---GTITEFPFTAARYKRNRCLGRKVIPPYMSPIQAGILLKNLVSP  697

Query  554   QYLPPAEAPYPVLTESDVVEPPLPPV  477
               LPP +AP PV T+ DV EPPLPPV
Sbjct  698   LSLPPTQAPSPVFTDGDVTEPPLPPV  723



>ref|XP_003544723.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
3-like [Glycine max]
Length=754

 Score =   333 bits (855),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 181/327 (55%), Positives = 234/327 (72%), Gaps = 9/327 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+KDG PFC+ S+++I+ TT AQ  FS  A++IPE+K+ + I +F+L W DI+ L   I
Sbjct  391   QMSKDGTPFCLNSIDLIESTTVAQSSFSKFAMTIPEIKSGSGIFAFNLTWNDIKILTPSI  450

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
              NPFAK+RLFRNP +KN G  + L DFL+   N TS+SGV I VENAAYLA+K+GL V D
Sbjct  451   LNPFAKYRLFRNPRSKNAGTLLALSDFLSLTKNQTSLSGVAIIVENAAYLADKQGLSVID  510

Query  1073  AVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
             AV+ AL+KA      ++KV I S +SSVL+KF   + YE VY I E + D  N+ + +IK
Sbjct  511   AVIGALSKAGYDKPGSQKVYIQSTNSSVLLKFKEKTSYELVYKIDETVGDAANAAVEDIK  570

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
              FASSV++ K SV P ++ FL   TN+V KL+ + + V+V+ FSNEFVSQAWDFFSDP V
Sbjct  571   SFASSVVVNKDSVIPNNNKFLTAYTNIVPKLKNANLSVFVETFSNEFVSQAWDFFSDPTV  630

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMSPQY  549
             E+NSY+ GA     DG+IT FP TA+RYRRN+CLG  +  P YM PV PG L  L++ ++
Sbjct  631   EINSYIEGAQ---IDGIITDFPKTADRYRRNKCLGLGDNKPTYMEPVQPGGLFGLITKEF  687

Query  548   LPPAEAPYPVLTESDVVEPPLPPVAKI  468
             LPPAEAP P LTES+V E PLPPVAKI
Sbjct  688   LPPAEAPLPPLTESEVAESPLPPVAKI  714



>ref|XP_006413151.1| hypothetical protein EUTSA_v10024494mg [Eutrema salsugineum]
 gb|ESQ54604.1| hypothetical protein EUTSA_v10024494mg [Eutrema salsugineum]
Length=757

 Score =   333 bits (855),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 175/324 (54%), Positives = 226/324 (70%), Gaps = 9/324 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+ DG PFC  S+++ + T   Q  F N + ++PE+ +   I++F L W +IQ+L   I
Sbjct  393   QMSSDGKPFCSSSIDLGNTTMVTQTPFRNRSETVPEISSVGGIYTFSLTWPEIQTLTPAI  452

Query  1253  SNPF-AKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
             SNP+   +RL RNP  +N GK ++L +FL  A ++TS+SGVLI+VENAAYL EK+GL V 
Sbjct  453   SNPYRGGYRLSRNPKERNSGKLLSLSEFLNLAKDSTSLSGVLISVENAAYLREKQGLDVV  512

Query  1076  DAVLLALNKA---DLKTKKVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTILEI  909
              AVL  L +    ++ T KVMI S +SSVL+ F   SKYE VY ++E I DI +S I +I
Sbjct  513   KAVLDTLTETGYNNITTTKVMIQSTNSSVLVDFKKQSKYETVYKVEETIRDILDSAIEDI  572

Query  908   KKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPY  729
             K+FAS+V+IGKSSVF   D  ++G T VV +LQ S++ VYV+LF NEFVSQ +DFFSD  
Sbjct  573   KEFASAVVIGKSSVFEVTDGLVIGQTKVVERLQKSQLPVYVELFQNEFVSQPYDFFSDAT  632

Query  728   VELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQY  549
             VE+NSYV G   N   G IT FP TA RY+RN CLG KEIP YM PV PG LL+++SP  
Sbjct  633   VEINSYVTGVGIN---GTITEFPFTAARYKRNPCLGSKEIPFYMAPVPPGGLLEVVSPGS  689

Query  548   LPPAEAPYPVLTESDVVEPPLPPV  477
             LPPAEAP PV T++DV EPPLPPV
Sbjct  690   LPPAEAPKPVFTDADVTEPPLPPV  713



>gb|KHN23877.1| Putative glycerophosphoryl diester phosphodiesterase 3 [Glycine 
soja]
Length=754

 Score =   333 bits (854),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 181/327 (55%), Positives = 234/327 (72%), Gaps = 9/327 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+KDG PFC+ S+++I+ TT AQ  FS  A++IPE+K+ + I +F+L W DI+ L   I
Sbjct  391   QMSKDGTPFCLNSIDLIESTTVAQSSFSKFAMTIPEIKSGSGIFAFNLTWNDIKILTPSI  450

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
              NPFAK+RLFRNP +KN G  + L DFL+   N TS+SGV I VENAAYLA+K+GL V D
Sbjct  451   LNPFAKYRLFRNPRSKNAGTLLALSDFLSLTKNQTSLSGVAIIVENAAYLADKQGLSVID  510

Query  1073  AVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
             AV+ AL+KA      ++KV I S +SSVL+KF   + YE VY I E + D  N+ + +IK
Sbjct  511   AVIGALSKAGYDKPGSQKVYIQSTNSSVLLKFKEKTSYELVYKIDETVGDAANAAVEDIK  570

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
              FASSV++ K SV P ++ FL   TN+V KL+ + + V+V+ FSNEFVSQAWDFFSDP V
Sbjct  571   SFASSVVVNKDSVIPNNNLFLTAYTNIVPKLKNANLSVFVETFSNEFVSQAWDFFSDPTV  630

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMSPQY  549
             E+NSY+ GA     DG+IT FP TA+RYRRN+CLG  +  P YM PV PG L  L++ ++
Sbjct  631   EINSYIEGAQ---IDGIITDFPKTADRYRRNKCLGLGDNKPTYMEPVQPGGLFGLITKEF  687

Query  548   LPPAEAPYPVLTESDVVEPPLPPVAKI  468
             LPPAEAP P LTES+V E PLPPVAKI
Sbjct  688   LPPAEAPLPPLTESEVAESPLPPVAKI  714



>ref|XP_011013351.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Populus euphratica]
Length=753

 Score =   333 bits (853),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 183/321 (57%), Positives = 234/321 (73%), Gaps = 9/321 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             Q++KDGIPFC+GS+N+ D TT AQ  +SN + +IP +K  N I +F L W +IQ+L   I
Sbjct  391   QISKDGIPFCLGSINLYDSTTVAQSSYSNHSQNIPHIKAGNGIFTFSLTWSEIQNLNPVI  450

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNPF+KF L RNP  +N GKF+TL +FL  A + +S+SGVLI++ENA YL +K+GL VTD
Sbjct  451   SNPFSKFELSRNPKFRNSGKFLTLSEFLALAKSTSSLSGVLISIENADYLIQKEGLPVTD  510

Query  1073  AVLLALNKA---DLKTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
              VL  L+KA   D  +KKVMI S +SSVLMKF + + YE VY I+E+I D Q++ + +IK
Sbjct  511   KVLDVLSKAGYDDPTSKKVMIESTNSSVLMKFRDKNNYELVYRIEEDIQDAQDAALKDIK  570

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
              FA+SV++ K+SVFP   SFL+ VTNVV KL    + VYV+ FSNEFVSQAWDFFSD  V
Sbjct  571   DFANSVVVSKASVFPKSSSFLIRVTNVVPKLILHGLSVYVETFSNEFVSQAWDFFSDSTV  630

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYL  546
             E+NSYV G +     GVIT FP T+ RY+RNRCLG  ++PPYM P  PGSL++L+SP  +
Sbjct  631   EINSYVMGVN---ISGVITEFPLTSARYKRNRCLG-SDLPPYMSPAQPGSLMELISPAAM  686

Query  545   PPAEAPYPVLTESDVVEPPLP  483
             PPAE P PVLT SDV E PLP
Sbjct  687   PPAEPPNPVLTASDVTEGPLP  707



>emb|CDY13237.1| BnaC09g24190D [Brassica napus]
Length=759

 Score =   333 bits (853),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 177/326 (54%), Positives = 229/326 (70%), Gaps = 12/326 (4%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+ DG+PFC  S+++ + T  +Q  F+  +  +PE+ +   I++F L W +I++L   I
Sbjct  390   QMSSDGVPFCSRSIDLSNSTMISQTPFAQRSTLVPEISSNGGIYTFSLTWAEIRNLTTAI  449

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
              NP+  + +FRNP  KN GK + L +FL  A N+TS+SGVLI+VENA YL EK+GL V  
Sbjct  450   GNPYRSYAMFRNPNKKNSGKLILLSEFLNLARNSTSLSGVLISVENAVYLREKQGLDVVK  509

Query  1073  AVLLALNK---ADLKTK-KVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTILEI  909
             AVL  L +   ++  TK KVMI S +SSVL++F   SKYE VY + E+ISDI +S I +I
Sbjct  510   AVLDTLTETGYSNGTTKTKVMIQSTNSSVLVEFKKQSKYEAVYKVDEKISDISDSAIEDI  569

Query  908   KKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPY  729
             KK A++V+IGK SVF   DSF+   TNVV KLQ SK+ VYV+LF NEFVSQ +DFFSDP 
Sbjct  570   KKCANAVVIGKESVFSLLDSFITRQTNVVEKLQKSKLPVYVELFQNEFVSQPYDFFSDPT  629

Query  728   VELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMSPQ  552
             VE+NSY+ GA  N   G IT FP TA RYRRNRCLG +E +PPYM PV PGSLLQ ++  
Sbjct  630   VEINSYILGAGIN---GTITEFPFTAARYRRNRCLGTQETLPPYMAPVEPGSLLQAVNA-  685

Query  551   YLPPAEAPYPVLTESDVVEPPLPPVA  474
              +PPA+AP PV T+ DV EPPLPPVA
Sbjct  686   -IPPAQAPNPVFTDDDVTEPPLPPVA  710



>ref|NP_567755.1| glycerophosphoryl diester phosphodiesterase-like 3 [Arabidopsis 
thaliana]
 sp|Q9SZ11.3|GPDL3_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase GDPDL3; 
AltName: Full=Glycerophosphodiester phosphodiesterase-like 
3; Short=ATGDPDL3; AltName: Full=Glycerophosphodiesterase-like 
2; AltName: Full=Protein MUTANT ROOT HAIR 5; AltName: Full=Protein 
SHAVEN 3; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE85238.1| glycerophosphoryl diester phosphodiesterase-like 3 [Arabidopsis 
thaliana]
Length=759

 Score =   332 bits (852),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 173/323 (54%), Positives = 223/323 (69%), Gaps = 8/323 (2%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAA-QQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             Q++ DG PFC+ S+++ + TT +   F N + ++PEL +  AI++F L W +IQ+L   I
Sbjct  396   QLSSDGTPFCLSSIDLGNSTTVSLTAFRNRSTTVPELGSLGAIYTFSLTWAEIQTLTPAI  455

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNP+    LFRNP  KN GK  +L DFL+ A N+TS+SGVLI+VENAAYL E++GL V  
Sbjct  456   SNPYRVTSLFRNPKQKNAGKLFSLSDFLSLAKNSTSLSGVLISVENAAYLREEQGLDVVK  515

Query  1073  AVLLALNK---ADLKTKKVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTILEIK  906
             AVL  L +   ++    KVMI S +SSVL+ F   S+YE VY ++E I DI +S I +IK
Sbjct  516   AVLDTLTQTGYSNSTATKVMIQSTNSSVLVDFKKQSQYETVYKVEENIRDILDSAIEDIK  575

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             KFA +V+I K SVFP   SF+   TNVV KLQ S++ VYV+LF NEF+SQ +DFF+D  V
Sbjct  576   KFADAVVIQKLSVFPVAQSFITTQTNVVEKLQKSQLPVYVELFQNEFLSQPYDFFADATV  635

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYL  546
             E+NSY+ GA  N   G IT FP TA RY+RN CLG KE  PYM P  PG+LL L+SP   
Sbjct  636   EINSYITGAGIN---GTITEFPFTAARYKRNLCLGRKETIPYMAPAQPGALLTLVSPTAF  692

Query  545   PPAEAPYPVLTESDVVEPPLPPV  477
             PPAEAP PV T++DV EPPLPPV
Sbjct  693   PPAEAPNPVFTDADVTEPPLPPV  715



>ref|XP_006280048.1| hypothetical protein CARUB_v10025925mg [Capsella rubella]
 gb|EOA12946.1| hypothetical protein CARUB_v10025925mg [Capsella rubella]
Length=767

 Score =   333 bits (853),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 169/325 (52%), Positives = 224/325 (69%), Gaps = 10/325 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+ DGIPFC+ S+++   T   Q  F N + ++PEL + + I+SF L W +IQ+L+  I
Sbjct  402   QMSSDGIPFCLSSIDLGKSTNVVQSPFRNRSATVPELNSLSGIYSFSLTWSEIQTLRPAI  461

Query  1253  SNPFAK-FRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
              NP+ K F LFRNP  ++ GK ++L DFL  A N++S+ GVLI+VENA YL EK+GL   
Sbjct  462   ENPYNKDFNLFRNPRERSSGKLVSLSDFLNLAKNSSSLVGVLISVENATYLREKQGLDAV  521

Query  1076  DAVLLALNKADLK----TKKVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTILE  912
              A L +L +A       T +VMI S +SSVL+ F  +S+YE VY ++E I DI +S I +
Sbjct  522   KAALDSLMEAGYSNRTTTTRVMIQSTNSSVLVDFKKHSQYETVYKVEESIRDILDSAIED  581

Query  911   IKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDP  732
             IKKFA ++++GK SVFPT  SF+   TN+VA+LQ  ++ VYV+LF NEFVSQ WDFFSD 
Sbjct  582   IKKFADAIVVGKKSVFPTSASFITRQTNLVARLQKVQLPVYVELFQNEFVSQPWDFFSDA  641

Query  731   YVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQ  552
              VE+NS+V GA      G IT FP TA RY++N CL  K++PPYM PV P  LL ++SP 
Sbjct  642   TVEINSHVTGAG---ISGTITEFPLTAARYKKNSCLNRKDLPPYMTPVQPAGLLTIVSPT  698

Query  551   YLPPAEAPYPVLTESDVVEPPLPPV  477
              LPPAEAP PV T++DV EPPLPPV
Sbjct  699   SLPPAEAPNPVFTDADVTEPPLPPV  723


 Score = 52.8 bits (125),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 74/298 (25%), Positives = 129/298 (43%), Gaps = 76/298 (26%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIH--------SFDLNWKDI  1275
             Q+TKD I  C   V M++        SN+ V  P+ K    +         + D N+KD+
Sbjct  89    QLTKDAIGICFPDVKMMNA-------SNIQVVFPKQKNSYLLDGVLTQDWFTIDFNFKDL  141

Query  1274  QSLQAQISNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGV------------L  1131
             +       N F    L R  +++++           F  N  ++S V             
Sbjct  142   K-------NVF----LIRGMLSRSDA----------FDGNNYAISTVQDIATQLKPKSFW  180

Query  1130  ITVENAAYLAEKKGLGVTDAVLLALNKADLKTKKVMIHSNDSSVLMKFTN--SKYER---  966
             + V++ A+ A+   L ++  +L A        K V IH   S  +  F N  S+  R   
Sbjct  181   LNVQHEAFYAQHN-LSISSFLLSA-------PKTVTIHYLSSPEVNFFRNIGSRLGRKGP  232

Query  965   --VYGIKEEISDIQNST----------ILEIKKFASSVIIGKSSVFPTDDSFLVGVTNVV  822
               V+   E+  D++ ST          +  IK FAS +++ KS ++P +  +L+  T+VV
Sbjct  233   KFVFRFLEK-DDVEVSTNQTYGSLAGNLTFIKTFASGILVPKSYIWPVESQYLLPHTSVV  291

Query  821   AKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATAN  648
                  + ++VY   F+N+F   A+++  DP  E  S++     +  DGV++ FP TA+
Sbjct  292   QDAHKAGLEVYASGFANDF-DIAYNYSFDPLAEYLSFIDNGDFS-VDGVLSDFPLTAS  347



>gb|AAL07129.1| unknown protein [Arabidopsis thaliana]
Length=759

 Score =   332 bits (852),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 173/323 (54%), Positives = 223/323 (69%), Gaps = 8/323 (2%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAA-QQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             Q++ DG PFC+ S+++ + TT +   F N + ++PEL +  AI++F L W +IQ+L   I
Sbjct  396   QLSSDGTPFCLSSIDLGNSTTVSLTAFRNRSTTVPELGSLGAIYTFSLTWAEIQTLTPAI  455

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNP+    LFRNP  KN GK  +L DFL+ A N+TS+SGVLI+VENAAYL E++GL V  
Sbjct  456   SNPYRVTSLFRNPKQKNAGKLFSLSDFLSLAKNSTSLSGVLISVENAAYLREEQGLDVVK  515

Query  1073  AVLLALNK---ADLKTKKVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTILEIK  906
             AVL  L +   ++    KVMI S +SSVL+ F   S+YE VY ++E I DI +S I +IK
Sbjct  516   AVLDTLTQTGYSNSTATKVMIQSTNSSVLVDFKKQSQYETVYKVEENIRDILDSAIEDIK  575

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             KFA +V+I K SVFP   SF+   TNVV KLQ S++ VYV+LF NEF+SQ +DFF+D  V
Sbjct  576   KFADAVVIQKLSVFPVAQSFITTQTNVVEKLQKSQLPVYVELFQNEFLSQPYDFFADATV  635

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYL  546
             E+NSY+ GA  N   G IT FP TA RY+RN CLG KE  PYM P  PG+LL L+SP   
Sbjct  636   EINSYITGAGIN---GTITEFPFTAARYKRNLCLGRKETIPYMAPAQPGALLTLVSPTAF  692

Query  545   PPAEAPYPVLTESDVVEPPLPPV  477
             PPAEAP PV T++DV EPPLPPV
Sbjct  693   PPAEAPNPVFTDADVTEPPLPPV  715



>emb|CAB36515.1| putative protein [Arabidopsis thaliana]
 emb|CAB79524.1| putative protein [Arabidopsis thaliana]
Length=770

 Score =   333 bits (853),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 173/323 (54%), Positives = 223/323 (69%), Gaps = 8/323 (2%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAA-QQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             Q++ DG PFC+ S+++ + TT +   F N + ++PEL +  AI++F L W +IQ+L   I
Sbjct  407   QLSSDGTPFCLSSIDLGNSTTVSLTAFRNRSTTVPELGSLGAIYTFSLTWAEIQTLTPAI  466

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNP+    LFRNP  KN GK  +L DFL+ A N+TS+SGVLI+VENAAYL E++GL V  
Sbjct  467   SNPYRVTSLFRNPKQKNAGKLFSLSDFLSLAKNSTSLSGVLISVENAAYLREEQGLDVVK  526

Query  1073  AVLLALNK---ADLKTKKVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTILEIK  906
             AVL  L +   ++    KVMI S +SSVL+ F   S+YE VY ++E I DI +S I +IK
Sbjct  527   AVLDTLTQTGYSNSTATKVMIQSTNSSVLVDFKKQSQYETVYKVEENIRDILDSAIEDIK  586

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             KFA +V+I K SVFP   SF+   TNVV KLQ S++ VYV+LF NEF+SQ +DFF+D  V
Sbjct  587   KFADAVVIQKLSVFPVAQSFITTQTNVVEKLQKSQLPVYVELFQNEFLSQPYDFFADATV  646

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYL  546
             E+NSY+ GA  N   G IT FP TA RY+RN CLG KE  PYM P  PG+LL L+SP   
Sbjct  647   EINSYITGAGIN---GTITEFPFTAARYKRNLCLGRKETIPYMAPAQPGALLTLVSPTAF  703

Query  545   PPAEAPYPVLTESDVVEPPLPPV  477
             PPAEAP PV T++DV EPPLPPV
Sbjct  704   PPAEAPNPVFTDADVTEPPLPPV  726



>ref|XP_012070946.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3 [Jatropha 
curcas]
 gb|KDP39221.1| hypothetical protein JCGZ_00978 [Jatropha curcas]
Length=767

 Score =   332 bits (851),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 185/324 (57%), Positives = 232/324 (72%), Gaps = 11/324 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+KDGIPFC+GS+N+ID TT AQ  +SNLA  IPE+K  + I++F L W  IQ L   I
Sbjct  394   QMSKDGIPFCLGSINLIDSTTVAQSNYSNLAQIIPEIKKGSGIYTFSLTWNQIQKLTPII  453

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNP+AK+ L RNP  KN G F+TL DFL  A NA+S+SGVLI++ENA YL EK+ L VTD
Sbjct  454   SNPYAKYELLRNPKFKNVGNFLTLSDFLDMAKNASSLSGVLISIENAPYLIEKQQLPVTD  513

Query  1073  AVLLALNKADLKTK---KVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
             AVL AL+KA    +   +VM+ S +SSVLMKF   S+Y  VY + E+I D  +S I +IK
Sbjct  514   AVLDALSKAGYDKQVALEVMVQSTNSSVLMKFKGKSRYNLVYKVDEDIRDALDSAITDIK  573

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
               A SV++ KSSVFP +  FL G+T+VV +L  S + VYV+ FSNEFVSQAWDFFSD  V
Sbjct  574   TVADSVVVSKSSVFPDNALFLTGITDVVPRLTKSGLPVYVETFSNEFVSQAWDFFSDATV  633

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMSPQY  549
             E+N++V  A+ +   G+IT FP TA RY+RNRCL   K +P YM PV  G L+QL++   
Sbjct  634   EINTFVVEANVS---GIITDFPKTAARYKRNRCLNLGKNMPSYMRPVEAGGLMQLIA--N  688

Query  548   LPPAEAPYPVLTESDVVEPPLPPV  477
             LPPAEAP PVLTESDV+EPPLP V
Sbjct  689   LPPAEAPNPVLTESDVMEPPLPSV  712



>ref|XP_010545263.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Tarenaya hassleriana]
Length=764

 Score =   332 bits (851),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 175/324 (54%), Positives = 224/324 (69%), Gaps = 10/324 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+ DG+PFC+ S ++ + T  A+  FSN +  +PE+     I++F L W +IQSL   I
Sbjct  401   QMSMDGVPFCLSSFDIGNSTMVARSSFSNRSSIVPEISPVAGIYTFSLTWAEIQSLAPAI  460

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             +NPF ++ +FRNP  KN GK ++L DFL  A N++S++GVL++VENAAYL EK+GL V  
Sbjct  461   ANPFREYNMFRNPREKNSGKLISLSDFLNLARNSSSLTGVLLSVENAAYLREKQGLDVVK  520

Query  1073  AVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
             AVL  L +A       KKVMI S +SSVL++F   S+YE VY I+E I DI +S + +IK
Sbjct  521   AVLDTLGEAGFSNRTAKKVMIQSTNSSVLIEFKQKSRYETVYKIEEAIRDILDSAVQDIK  580

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             KFA+SV + K SVF     F  G T+VV KLQ  +V VYV+LF NEFVSQ +DFFSDP V
Sbjct  581   KFANSVTLTKQSVFSLGGPFTTGQTDVVTKLQKLQVPVYVELFRNEFVSQPFDFFSDPTV  640

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYL  546
             E+NSYV GA  N   G IT FP TA RY+RNRCLG++E P Y  PV PGSLL L +   L
Sbjct  641   EINSYVNGAGVN---GTITEFPLTAARYKRNRCLGFRETPSYSSPVQPGSLLTLATA--L  695

Query  545   PPAEAPYPVLTESDVVEPPLPPVA  474
             PPAEAP PV +++DV EPPLPPVA
Sbjct  696   PPAEAPNPVFSDADVTEPPLPPVA  719



>ref|XP_010482994.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4 [Camelina 
sativa]
Length=769

 Score =   332 bits (850),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 170/325 (52%), Positives = 225/325 (69%), Gaps = 10/325 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+ DGIPFC+ S+N+ + T   Q  F N + ++PEL +   I+SF+L W +IQ+L+  I
Sbjct  404   QMSSDGIPFCLTSINLGESTNVVQSPFRNRSATVPELNSLAGIYSFNLAWSEIQTLRPAI  463

Query  1253  SNPFAK-FRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
              NP+ K F LFRNP  ++ GK ++L DFL  A N++++ GVLI+VENA+YL EK+GL   
Sbjct  464   ENPYNKDFNLFRNPRERSSGKLVSLSDFLNLAKNSSTLVGVLISVENASYLREKQGLDAV  523

Query  1076  DAVLLALNKADLKTK----KVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTILE  912
              A L +L +A    K    +VMI S +SSVL+ F   S+YE VY ++E I DI +S I +
Sbjct  524   KATLDSLTEAGYSNKTTTTRVMIQSTNSSVLVDFKKQSRYETVYKVEEAIRDILDSAIED  583

Query  911   IKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDP  732
             IKKFA +++I K SVFP+  SF  G TN+V +LQ  K+ VYV++F NEFVSQ +DFFSD 
Sbjct  584   IKKFADAIVITKKSVFPSSPSFTTGQTNLVERLQKLKLPVYVEVFRNEFVSQPYDFFSDA  643

Query  731   YVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQ  552
              VE+NS+V GA  N   G IT FP TA RY+RN CL  K+ PPYM+PV PG LL ++SP 
Sbjct  644   TVEINSHVTGAGVN---GAITEFPLTAARYKRNTCLTRKDPPPYMIPVQPGGLLTIVSPA  700

Query  551   YLPPAEAPYPVLTESDVVEPPLPPV  477
              LPPAEAP PV T++DV EPPLPPV
Sbjct  701   SLPPAEAPNPVFTDADVTEPPLPPV  725



>ref|XP_010536709.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Tarenaya hassleriana]
Length=752

 Score =   331 bits (848),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 173/323 (54%), Positives = 227/323 (70%), Gaps = 10/323 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+ D +PFC+ S+++ + +  A+  FSN + ++PE+    AI++F L W +IQ+L   I
Sbjct  391   QMSMDSVPFCLSSIDLGNSSMIARSPFSNRSSTVPEISPVPAIYTFSLTWPEIQTLTPAI  450

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             +NPF  + +FRNP  KN GK ++L DFL+ A N++S++GVL++VENAAYL EK+GL V  
Sbjct  451   ANPFTIYNMFRNPSEKNAGKLISLSDFLSLAKNSSSLTGVLLSVENAAYLREKQGLDVVK  510

Query  1073  AVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
             AVL  L +A      TKKVMI S +SSVL+ F   S+YE VY I+E I DI +  I +IK
Sbjct  511   AVLDTLGEAGFNNRTTKKVMIQSTNSSVLIDFKQKSQYETVYKIEETIRDILDLAIGDIK  570

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             KFA+SV++GK SVFP  ++F  G T+VV KLQ S + VYV+LF NEFVSQ +DFFSD  V
Sbjct  571   KFANSVVVGKKSVFPLSEAFTTGQTDVVTKLQKSLLPVYVELFQNEFVSQPYDFFSDATV  630

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYL  546
             E+NSYV GA  N   G IT FP TA RY++NRCLG KE PPY  PV  G+L+ L +   L
Sbjct  631   EINSYVRGAGVN---GTITEFPLTAARYKKNRCLGLKEPPPYSSPVQAGALVSLATA--L  685

Query  545   PPAEAPYPVLTESDVVEPPLPPV  477
             PPAEAP PV T++DV EPPLPPV
Sbjct  686   PPAEAPNPVFTDADVTEPPLPPV  708



>ref|XP_010443178.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
[Camelina sativa]
Length=767

 Score =   331 bits (848),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 169/325 (52%), Positives = 227/325 (70%), Gaps = 10/325 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+ DGIPFC+ S+++ + T   Q  + N + ++PELK+   I+SF L W +IQ+L+  I
Sbjct  402   QMSSDGIPFCLSSIDLGESTNVVQSPYRNRSATVPELKSFPGIYSFSLAWSEIQTLRPAI  461

Query  1253  SNPFAK-FRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
              NP+ K F LFRNP  ++ GK ++L DFL  A N++++ GVLI+VENA+YL EK+GL   
Sbjct  462   ENPYNKDFNLFRNPRERSSGKLVSLSDFLNLAKNSSTLVGVLISVENASYLREKQGLDSV  521

Query  1076  DAVLLALNKADLK----TKKVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTILE  912
              A L +L +A       T++VMI S +SSVL+ F   S+YE VY ++E I DI +S I +
Sbjct  522   KAALDSLTEAGYSNKATTRRVMIQSTNSSVLVDFKKQSRYETVYKVEEAIRDILDSAIED  581

Query  911   IKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDP  732
             IKKFA +++I K+SVFP+  SF  G TN+V +LQ  K+ VYV +F NEFVSQ +DFFSD 
Sbjct  582   IKKFADAIVITKTSVFPSTASFTTGQTNLVERLQKLKLPVYVDVFQNEFVSQPYDFFSDA  641

Query  731   YVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQ  552
              VE+NS+V GA     DG IT FP TA RY+RN CL  K+ PPYM+PV PG LL ++SP 
Sbjct  642   TVEINSHVTGAG---IDGAITEFPLTAARYKRNTCLTRKDPPPYMIPVQPGGLLTIVSPA  698

Query  551   YLPPAEAPYPVLTESDVVEPPLPPV  477
              LPPAEAP PV T++DV+EPPLPPV
Sbjct  699   SLPPAEAPNPVFTDADVIEPPLPPV  723



>gb|KJB62956.1| hypothetical protein B456_009G445400 [Gossypium raimondii]
Length=604

 Score =   326 bits (835),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 176/325 (54%), Positives = 228/325 (70%), Gaps = 10/325 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QMT DG P C+ S+N+ID TT AQ QFSNL  +IP++   + I SF+L+W +I++L   I
Sbjct  241   QMTMDGTPICLSSINLIDSTTVAQSQFSNLTTTIPQIMPGSGIFSFNLSWSEIKTLTPII  300

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             S+P ++++LFRNP  KN G F+TL +FLT A+NA+S+ GVLI++ENA +L E+ G  VT+
Sbjct  301   SSPQSQYKLFRNPRFKNAGTFLTLSEFLTIASNASSLQGVLISIENAPFLLEQ-GFAVTN  359

Query  1073  AVLLALNKADLKTK---KVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTILEIK  906
             AVL AL+KA    K   KVMI S+ SSVLMKF + + Y+ VY + E+I   Q+STI +IK
Sbjct  360   AVLDALSKAGYGNKTDQKVMIQSSSSSVLMKFKSQTNYDLVYKVDEDIGGAQSSTIDDIK  419

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
              FAS+V+I K SVFP + +F+   TNVV +L+A+ + VYVQ FSNEF SQAWDFFSDP V
Sbjct  420   SFASAVVISKDSVFPENSAFITSATNVVPRLKAANLSVYVQTFSNEFTSQAWDFFSDPTV  479

Query  725   ELNSYVFGASANPFDGVITGFPATA-NRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQY  549
             E+NS+  G   N   GVIT FP T+    R        +IP YM PV PGSL  L++  Y
Sbjct  480   EINSFYLGGGIN---GVITDFPKTSNRYRRNRCLNRRNQIPGYMSPVQPGSLYGLITAPY  536

Query  548   LPPAEAPYPVLTESDVVEPPLPPVA  474
             LPPAEAP P LTE+DV EPPLPPVA
Sbjct  537   LPPAEAPNPFLTEADVNEPPLPPVA  561



>gb|KFK27133.1| hypothetical protein AALP_AA8G339300 [Arabis alpina]
Length=764

 Score =   330 bits (846),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 170/326 (52%), Positives = 223/326 (68%), Gaps = 11/326 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+ DGIP C+ S+++ +     Q  F N + ++PE++    I+SF L+W +IQ+L+  I
Sbjct  398   QMSSDGIPLCLSSIDLGESMDVVQSPFRNRSATVPEIRPLAGIYSFSLSWSEIQTLKPAI  457

Query  1253  SNPFAK-FRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
              NP+++ + LFRNP  KN GK ++L DFL  A N+TS++GVLI+VENAAYL EK+G  V 
Sbjct  458   MNPYSRDYNLFRNPREKNSGKLVSLSDFLNLAKNSTSLTGVLISVENAAYLREKQGFDVV  517

Query  1076  DAVLLALNKADL-----KTKKVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTIL  915
               VL  L KA        T KVMI S +SSVL+ F   S+Y+ VY ++E I DI +S I 
Sbjct  518   KVVLDTLTKAGYGNATTTTTKVMIQSTNSSVLVDFKKQSRYQTVYEVEETIRDILDSAIE  577

Query  914   EIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSD  735
             +IKKFA +V+I  +SVFP   SF  G TN+V +LQ  ++ VYV+LF NEFVSQ WDFFSD
Sbjct  578   DIKKFADAVVIKTTSVFPVSASFTTGQTNLVERLQKFQLPVYVELFRNEFVSQPWDFFSD  637

Query  734   PYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP  555
               VE+NS+V GA  N   G IT FP TA RY+RN+CL  K+ PPYM+PV P  LL ++SP
Sbjct  638   ITVEINSHVTGAGIN---GTITEFPLTAARYKRNQCLTRKDPPPYMIPVQPAGLLTIVSP  694

Query  554   QYLPPAEAPYPVLTESDVVEPPLPPV  477
               LPPAEAP PV T++DV EPPLPPV
Sbjct  695   NSLPPAEAPNPVFTDADVTEPPLPPV  720


 Score = 53.5 bits (127),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 71/277 (26%), Positives = 127/277 (46%), Gaps = 34/277 (12%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVS--IPELKTQNAIHSFDLNWKDIQSLQAQ  1257
             Q+TKDGI  C   + M++ +     + N   S  +  + TQ+   + D   KD++S+   
Sbjct  85    QLTKDGIGICFPDLTMMNASNIQDAYPNRKNSYLVNGVTTQDWF-TIDFTSKDLRSV-FL  142

Query  1256  ISNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
             I    ++   F N    N     T+ D     A      G  + V++ A+ A+   L ++
Sbjct  143   IRGILSRSDAFDN----NRYTISTVQD----VAKQLKPVGFWLNVQHDAFYAQHN-LSMS  193

Query  1076  DAVLLALNKA----DLKTKKVMIHSNDSSVLMKFTNSKYERVYGIKEEISDIQNSTILE-  912
                LL+++K      L + +V    N  S   +F     + V+   E+  D++ ST L  
Sbjct  194   -TFLLSVSKTVTIDYLSSPEVNFFRNIGS---RFGKKGPKFVFRFLEK-DDVEVSTNLTY  248

Query  911   ---------IKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVS  759
                      +K FAS V++ KS ++P +  +L+  T+ V     + ++VY   F+N+F  
Sbjct  249   GSLVKNLTFVKTFASGVMVPKSYIWPVESLYLLPHTSFVQDAHKAGLEVYASGFANDF-D  307

Query  758   QAWDFFSDPYVELNSYVFGASANPFDGVITGFPATAN  648
              A+++  DP  E  S+V     +  DGV++ FP TA+
Sbjct  308   LAYNYSFDPMAEYLSFVDNGDFS-VDGVLSDFPLTAS  343



>ref|XP_006391459.1| hypothetical protein EUTSA_v10018170mg [Eutrema salsugineum]
 gb|ESQ28745.1| hypothetical protein EUTSA_v10018170mg [Eutrema salsugineum]
Length=763

 Score =   329 bits (844),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 169/324 (52%), Positives = 218/324 (67%), Gaps = 9/324 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM++DG PFC  S+++ + T  AQ    N + ++ E+ +   I +F L W +IQSL   I
Sbjct  399   QMSRDGTPFCSSSIDLANSTMVAQTPLRNRSTTVHEISSVGGIFTFSLTWPEIQSLTPAI  458

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNP+  + +FRNP  K  GK ++L +FL  A N+TS+SGVLI+VENA YL +++GL V  
Sbjct  459   SNPYRAYNMFRNPNEKKSGKLISLSEFLNLAKNSTSLSGVLISVENAVYLRKEQGLDVVK  518

Query  1073  AVLLALNKADLK----TKKVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTILEI  909
             AVL  L K        TK VMI S +SSVL  F   S+YE VY ++E ISDI +S I +I
Sbjct  519   AVLDTLTKTGYSNRTTTKNVMIQSTNSSVLADFKKQSQYETVYKVEETISDILDSAIKDI  578

Query  908   KKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPY  729
             KKFA++V+I +SSVFP  D F+   TNVV +L  S++ VYV+LF NEFVSQ +DF SDP 
Sbjct  579   KKFANAVVISRSSVFPFPDGFITRQTNVVERLHKSQLSVYVELFQNEFVSQPYDFLSDPT  638

Query  728   VELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQY  549
             VE+NSY+ G   N   G IT FP TA RY+RNRCLG KE PPYM  V PG LL ++SP  
Sbjct  639   VEINSYISGVGIN---GTITEFPLTAARYKRNRCLGSKETPPYMAHVDPGGLLTVVSPSS  695

Query  548   LPPAEAPYPVLTESDVVEPPLPPV  477
             LPPA+ P PV T++DV EPPLPPV
Sbjct  696   LPPAKPPNPVFTDADVTEPPLPPV  719



>gb|KFK29182.1| hypothetical protein AALP_AA7G100300 [Arabis alpina]
Length=758

 Score =   328 bits (841),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 175/325 (54%), Positives = 230/325 (71%), Gaps = 10/325 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM++DG PFC  S+N+ D TT AQ  F N + ++PE+ +   I++F L W +IQ L   I
Sbjct  393   QMSRDGKPFCSSSINLGDSTTVAQTPFRNRSATVPEISSVEGIYTFSLTWPEIQGLTPAI  452

Query  1253  SNPFAK-FRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
             SNPF + + + RNP  KN GK ++L +FL+ A N+TS+SGVLI+VE AAYL EK+GL V 
Sbjct  453   SNPFREAYNMLRNPNEKNSGKLLSLSEFLSLAKNSTSLSGVLISVEYAAYLREKQGLDVV  512

Query  1076  DAVLLALNKADLK----TKKVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTILE  912
              AVL  L +        TK VMI S +SSVL+ F   S+Y+ VY ++E I DI +  I +
Sbjct  513   KAVLDTLTETGYSNSTITKMVMIQSTNSSVLVDFKKQSQYKTVYKVEEMIRDILDPAIED  572

Query  911   IKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDP  732
             IKKFA++V+IGK+SVFP  D+F+ G TNVV KLQ S++ VYV+LF NEFVSQ++DFFSD 
Sbjct  573   IKKFANAVVIGKTSVFPVADAFITGQTNVVEKLQKSQLPVYVELFQNEFVSQSYDFFSDA  632

Query  731   YVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQ  552
              VE+NS++ GA  N   G IT FP TA R++RNRCLG KE P YM+PV PG LL+++SP 
Sbjct  633   TVEINSFISGAGIN---GTITEFPFTAARFKRNRCLGAKETPNYMIPVEPGGLLKIVSPT  689

Query  551   YLPPAEAPYPVLTESDVVEPPLPPV  477
               PPA+AP PV T++DV EPPLPPV
Sbjct  690   SFPPAQAPNPVFTDADVTEPPLPPV  714



>ref|XP_006283180.1| hypothetical protein CARUB_v10004210mg [Capsella rubella]
 gb|EOA16078.1| hypothetical protein CARUB_v10004210mg [Capsella rubella]
Length=757

 Score =   327 bits (839),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 172/322 (53%), Positives = 224/322 (70%), Gaps = 8/322 (2%)
 Frame = -3

Query  1427  MTKDGIPFCMGSVNMIDGTTAA-QQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  1251
             M+ DGIPFC  S+++ + TT A   F N + ++ EL +   I++F L W +IQ+L   IS
Sbjct  395   MSSDGIPFCSSSIDLGNTTTVALTPFRNRSTTVSELSSVGGIYTFSLTWPEIQTLTPAIS  454

Query  1250  NPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDA  1071
             NP+  + + RNP  KN GK ++L DFL  A N+TS+SGVLI+VENAAY+ E++GL V  A
Sbjct  455   NPYRGYNMLRNPNKKNAGKLLSLADFLNLAKNSTSLSGVLISVENAAYMREEQGLDVVKA  514

Query  1070  VLLALNK---ADLKTKKVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTILEIKK  903
             VL  L +   ++  TKKVMI S +SSVL+ F   S+YE VY ++E I DI +S + +IKK
Sbjct  515   VLDTLTQTGYSNSTTKKVMIQSTNSSVLVDFKKQSQYETVYKVEENIRDILDSAVEDIKK  574

Query  902   FASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVE  723
             FA++V+I K SVFP  +SF+   TNVV KLQ S++ VYV+LF NEFVSQ +DFFSD  VE
Sbjct  575   FANAVVIQKPSVFPLAESFITQQTNVVEKLQKSQLPVYVELFQNEFVSQPYDFFSDATVE  634

Query  722   LNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLP  543
             +NSY+FG   N   G IT FP TA RY+RN CL  K+  PYM PV PG+LL L+S   LP
Sbjct  635   INSYIFGPGIN---GTITEFPFTAARYKRNLCLSSKDNVPYMAPVQPGALLALVSSASLP  691

Query  542   PAEAPYPVLTESDVVEPPLPPV  477
             PAEAP PV T++DV EPPLPPV
Sbjct  692   PAEAPNPVFTDADVTEPPLPPV  713



>ref|XP_009108190.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=758

 Score =   327 bits (839),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 174/325 (54%), Positives = 226/325 (70%), Gaps = 12/325 (4%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+ DG+PFC  S+++ + T  +Q  F+  +  +PE+ +   I++F L W +I++L   I
Sbjct  389   QMSSDGVPFCSRSIDLSNSTMISQTPFAQRSTLVPEISSSGGIYTFSLTWAEIRNLTPAI  448

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
              NP+  + +FRNP  KN GK + L +FL  A N+T +SGVLI+VENA YL EK+GL V  
Sbjct  449   GNPYRSYTMFRNPNKKNSGKLILLSEFLNLANNSTLLSGVLISVENAVYLREKQGLDVVK  508

Query  1073  AVLLALNK---ADLKTK-KVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTILEI  909
             AVL  L +    +  TK KVMI S +SSVL++F   SKYE VY + E+ISDI +S I +I
Sbjct  509   AVLDTLTETGYGNGTTKTKVMIQSTNSSVLVEFKKQSKYEAVYKVDEKISDISDSAIEDI  568

Query  908   KKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPY  729
             KKFA++V+IGK SVF   DSF+   TNVV KLQ SK+ VYV+LF NEFVSQ +DFFSDP 
Sbjct  569   KKFANAVVIGKESVFSLLDSFITRQTNVVEKLQKSKLPVYVELFQNEFVSQPYDFFSDPT  628

Query  728   VELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMSPQ  552
             VE+NSY+ GA  N   G IT FP TA RY+RNRCLG +E +PPYM P  PGSLLQ ++  
Sbjct  629   VEINSYILGAGIN---GTITEFPFTAARYKRNRCLGTQETLPPYMAPFKPGSLLQAVNA-  684

Query  551   YLPPAEAPYPVLTESDVVEPPLPPV  477
              +PPA+AP PV T+ DV EPPLPPV
Sbjct  685   -IPPAQAPNPVFTDDDVTEPPLPPV  708



>ref|XP_003617676.1| Glycerophosphodiesterase-like protein [Medicago truncatula]
 gb|AET00635.1| glycerophosphoryl diester phosphodiesterase family protein [Medicago 
truncatula]
Length=754

 Score =   327 bits (838),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 182/327 (56%), Positives = 233/327 (71%), Gaps = 9/327 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             Q++KDG PFC+ S+++++ TT AQ  FS+LA+S+PE+K+   I SF+L W DI+ L   I
Sbjct  391   QLSKDGTPFCLKSIDLLESTTVAQTSFSDLAMSVPEIKSGRGIFSFNLTWSDIKGLTPSI  450

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
               PF+K+ LFRNP AKN G F+TL DFL+   N TS+SGVLI VENAAYLAEK+GL VTD
Sbjct  451   LAPFSKYTLFRNPKAKNAGTFLTLSDFLSLTKNQTSLSGVLIIVENAAYLAEKQGLSVTD  510

Query  1073  AVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
              V+ AL+ A      ++KV I S +SSVL+KF   +KYE VY I E + D  N+   +IK
Sbjct  511   VVIKALSNAGYDKPGSQKVYIQSTNSSVLLKFKEKTKYELVYQIDESVGDATNAAAEDIK  570

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
              FASSV+I K+SV+P +  ++   TN+V KLQASK+ V+V+ FSNEFVSQA+DFFSD  V
Sbjct  571   TFASSVVINKNSVYPQNAGYVTTKTNIVEKLQASKLSVFVETFSNEFVSQAFDFFSDSTV  630

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMSPQY  549
             E+NS++ GA  N   GVIT FP TA+RY RN+CL      PPYM PV  GSL  ++S   
Sbjct  631   EINSFIQGAGIN---GVITDFPKTAHRYSRNKCLNLGNSTPPYMQPVEAGSLFGVISNTS  687

Query  548   LPPAEAPYPVLTESDVVEPPLPPVAKI  468
             LPPA AP P LT+ +VVEPPLPPVAKI
Sbjct  688   LPPAMAPLPPLTKDEVVEPPLPPVAKI  714



>ref|XP_010448228.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Camelina sativa]
Length=757

 Score =   327 bits (838),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 173/325 (53%), Positives = 224/325 (69%), Gaps = 9/325 (3%)
 Frame = -3

Query  1427  MTKDGIPFCMGSVNMIDGTTAA-QQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  1251
             M+ DG PFC  S+++ + TT A   F N + ++PE+ +   I++F L W +IQ+L   IS
Sbjct  394   MSSDGTPFCSSSIDLGNSTTVALSPFRNRSTTVPEISSLGGIYTFSLTWPEIQTLTPVIS  453

Query  1250  NPF-AKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             NP+   F  FRNP  KN GKF++L DFL  A N+TS+SGVLI+VENAAYL E++GL V  
Sbjct  454   NPYRGAFSFFRNPKMKNAGKFLSLSDFLNLAKNSTSLSGVLISVENAAYLREEQGLDVVK  513

Query  1073  AVLLALNK---ADLKTKKVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTILEIK  906
             AVL  L +   ++  TKKVMI S +SSVL+ F   S+YE VY I+E I DI +S I +IK
Sbjct  514   AVLDTLTETGYSNSTTKKVMIQSTNSSVLVDFKKQSQYETVYKIEENIRDILDSAIEDIK  573

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             KFA++V+I K SVFP   +F+   TNVV KLQ S++ VYV+LF NEFVSQ +DFFSDP V
Sbjct  574   KFANAVVIQKLSVFPVAQAFITRQTNVVEKLQKSQLPVYVELFQNEFVSQPYDFFSDPTV  633

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYL  546
             E+NSY+ G   N   G IT FP TA RY++N CL  KE  PYM P  PG+LL L+S   L
Sbjct  634   EINSYITGPGIN---GTITEFPFTAARYKKNLCLASKENVPYMAPAQPGALLTLVSSTSL  690

Query  545   PPAEAPYPVLTESDVVEPPLPPVAK  471
             PPA+AP P+ T++DV EPPLPPV +
Sbjct  691   PPAQAPNPLFTDADVTEPPLPPVTE  715



>ref|XP_007142367.1| hypothetical protein PHAVU_008G274300g [Phaseolus vulgaris]
 gb|ESW14361.1| hypothetical protein PHAVU_008G274300g [Phaseolus vulgaris]
Length=753

 Score =   327 bits (837),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 179/327 (55%), Positives = 231/327 (71%), Gaps = 7/327 (2%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+KDG PFC+ S+++I+GT  A+  FS   ++IPE+KT + I +F+L W +I++L   I
Sbjct  388   QMSKDGTPFCLNSIDLIEGTAVAKSNFSKFGMTIPEIKTGSGIFAFNLTWNEIKTLTPSI  447

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNPFAK++LFRNP +KN G  ++L DFL+   N TS+SG+ I VENAAYLAEK+GL V D
Sbjct  448   SNPFAKYKLFRNPKSKNSGNLVSLSDFLSLTKNQTSLSGISIIVENAAYLAEKQGLSVID  507

Query  1073  AVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
             AV+ AL+ A      ++KV I S +SSVL+KF   + YE VY I E + D  +  + +IK
Sbjct  508   AVINALSNAGYDKPGSQKVYIQSTNSSVLLKFKEKTSYELVYKIDEIVGDAASEAVEDIK  567

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             KFAS+VI+ K SVF  +D FL G T  V KL A+K+ V+V+ FSNEFVSQAWDF SD  V
Sbjct  568   KFASAVIVNKESVFSINDKFLTGTTKTVPKLNAAKLSVFVETFSNEFVSQAWDFLSDATV  627

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMSPQY  549
             E+NSY+  A     DG+IT FP TA+RYRRN+CL   +  P YM PV PG L  L+SP +
Sbjct  628   EINSYL-NAEGIKIDGIITDFPKTADRYRRNKCLNLGDKKPTYMDPVQPGGLFGLISPDF  686

Query  548   LPPAEAPYPVLTESDVVEPPLPPVAKI  468
             LPPAEAP P LTES+V EP LPPVAKI
Sbjct  687   LPPAEAPLPPLTESEVAEPALPPVAKI  713



>emb|CDY61647.1| BnaCnng38120D [Brassica napus]
Length=755

 Score =   326 bits (835),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 179/330 (54%), Positives = 230/330 (70%), Gaps = 18/330 (5%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+ DG PFC  S+++ + T  AQ  F+  +  +PE+ + + I++F L W +IQ+L+  I
Sbjct  390   QMSSDGKPFCSSSIDLSNITNIAQTSFAQRSTHVPEISSNDGIYTFSLTWSEIQTLKPAI  449

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNP+  + +FRNP  KN GKF+ L +FL+ A N+TS+SGVLI+VE A YL EK+GL V  
Sbjct  450   SNPYRAYNMFRNPNEKNSGKFILLSEFLSLAKNSTSLSGVLISVEKAVYLREKQGLDVVK  509

Query  1073  AVLLAL------NKADLKTKKVMIHSNDSSVLMKF--TNSKYERVYGIKEEISDIQNSTI  918
             AVL  L      N +  KT KVMI S +SSVL+ F   +SKYE VY ++E+I DI +S I
Sbjct  510   AVLDTLTETGYSNGSTTKT-KVMIQSTNSSVLVDFKKQSSKYETVYKVEEKIGDISDSAI  568

Query  917   LEIKKFASSVIIGKSSVFPT-DDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFF  741
              +IKKFA++V+I K+SVFP  DD F++  TNVV KL  SK+ VYV+LF NEFVSQ +DFF
Sbjct  569   EDIKKFANAVVIVKTSVFPLFDDGFIIRQTNVVEKLHKSKLPVYVELFQNEFVSQPFDFF  628

Query  740   SDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPP-YMLPVGPGSLLQ  567
             SDP VE+NSYV GA     DG IT FP TA RY+RNRCLG KE IPP YM PV PG  L 
Sbjct  629   SDPTVEINSYVSGAG---IDGTITEFPFTAARYKRNRCLGTKETIPPQYMSPVPPGLFLN  685

Query  566   LMSPQYLPPAEAPYPVLTESDVVEPPLPPV  477
             L++   +PPA+AP PV T+ DV EPPLPPV
Sbjct  686   LVNA--IPPAQAPNPVFTDDDVTEPPLPPV  713



>ref|XP_009105134.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=756

 Score =   326 bits (835),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 176/330 (53%), Positives = 227/330 (69%), Gaps = 18/330 (5%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+ DG PFC  S+++ + T  AQ  F+  +  +PE+ + + +++F L W +IQ+L+  I
Sbjct  391   QMSSDGKPFCAHSIDLSNITNIAQTPFTKRSTHVPEISSNDGMYTFSLTWSEIQTLKPAI  450

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNP+  + +FRNP  KN GKF+ L DFL  A  +TS+SGVLI+VE A YL EK+GL V  
Sbjct  451   SNPYRVYNMFRNPNEKNSGKFILLSDFLNLAKTSTSLSGVLISVEKAVYLREKQGLDVVK  510

Query  1073  AVLLAL------NKADLKTKKVMIHSNDSSVLMKF--TNSKYERVYGIKEEISDIQNSTI  918
             AVL  L      N +  KT KVMI S +SSVL+ F   +SKYE VY ++E+I DI +S I
Sbjct  511   AVLDTLTETGYSNGSTTKT-KVMIQSTNSSVLVDFKKQSSKYETVYKVEEKIGDISDSAI  569

Query  917   LEIKKFASSVIIGKSSVFPT-DDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFF  741
              +IKKFA++V+IGK +VFP  DD F++  TNVV KL  SK+ VYV++F NEFVSQ +DFF
Sbjct  570   EDIKKFANAVVIGKETVFPLFDDGFIIRQTNVVEKLHKSKLPVYVEVFQNEFVSQPFDFF  629

Query  740   SDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE--IPPYMLPVGPGSLLQ  567
             SDP VE+NSYV GA     DG IT FP TA RY+RNRCLG KE   PPYM PV PG  L 
Sbjct  630   SDPTVEINSYVSGAG---IDGTITEFPFTAARYKRNRCLGTKESLAPPYMSPVRPGFFLN  686

Query  566   LMSPQYLPPAEAPYPVLTESDVVEPPLPPV  477
             L++   +PPA+AP PV T+ DV EPPLPPV
Sbjct  687   LVNA--IPPAQAPNPVFTDDDVTEPPLPPV  714



>gb|KJB62955.1| hypothetical protein B456_009G445400 [Gossypium raimondii]
Length=760

 Score =   325 bits (834),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 176/325 (54%), Positives = 228/325 (70%), Gaps = 10/325 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QMT DG P C+ S+N+ID TT AQ QFSNL  +IP++   + I SF+L+W +I++L   I
Sbjct  397   QMTMDGTPICLSSINLIDSTTVAQSQFSNLTTTIPQIMPGSGIFSFNLSWSEIKTLTPII  456

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             S+P ++++LFRNP  KN G F+TL +FLT A+NA+S+ GVLI++ENA +L E+ G  VT+
Sbjct  457   SSPQSQYKLFRNPRFKNAGTFLTLSEFLTIASNASSLQGVLISIENAPFLLEQ-GFAVTN  515

Query  1073  AVLLALNKADLKTK---KVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTILEIK  906
             AVL AL+KA    K   KVMI S+ SSVLMKF + + Y+ VY + E+I   Q+STI +IK
Sbjct  516   AVLDALSKAGYGNKTDQKVMIQSSSSSVLMKFKSQTNYDLVYKVDEDIGGAQSSTIDDIK  575

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
              FAS+V+I K SVFP + +F+   TNVV +L+A+ + VYVQ FSNEF SQAWDFFSDP V
Sbjct  576   SFASAVVISKDSVFPENSAFITSATNVVPRLKAANLSVYVQTFSNEFTSQAWDFFSDPTV  635

Query  725   ELNSYVFGASANPFDGVITGFPATA-NRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQY  549
             E+NS+  G   N   GVIT FP T+    R        +IP YM PV PGSL  L++  Y
Sbjct  636   EINSFYLGGGIN---GVITDFPKTSNRYRRNRCLNRRNQIPGYMSPVQPGSLYGLITAPY  692

Query  548   LPPAEAPYPVLTESDVVEPPLPPVA  474
             LPPAEAP P LTE+DV EPPLPPVA
Sbjct  693   LPPAEAPNPFLTEADVNEPPLPPVA  717



>emb|CDY11996.1| BnaC03g14220D [Brassica napus]
Length=773

 Score =   325 bits (834),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 162/323 (50%), Positives = 227/323 (70%), Gaps = 8/323 (2%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+ DGIPFC+ S N+ +     Q  F N + ++PE  +   ++SF+L W +IQ+L   I
Sbjct  403   QMSSDGIPFCLNSTNLGESMNIFQTPFRNRSTTVPEFNSLAGLYSFNLAWSEIQTLTPAI  462

Query  1253  SNPFAK-FRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
             SNP+++ F +FRNP  ++ GK ++L +FL  A N++S+ GVLI VE+AAYL EK+GL V 
Sbjct  463   SNPYSRNFHMFRNPRERSSGKLVSLSEFLNLANNSSSLVGVLINVEHAAYLREKQGLDVV  522

Query  1076  DAVLLALNKADLK--TKKVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTILEIK  906
              AVL  L ++     TK+VMI S++SSVL+     S+YE VY ++E I DIQ+S I +IK
Sbjct  523   KAVLDTLKESGYSNATKRVMIQSSNSSVLVDIRKQSRYETVYQVEETIRDIQDSAIQDIK  582

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             KFA +V++G+ S++P   SF+ G TN+V +LQ  K+ VYV+ F NEFVSQA+DFFSD  V
Sbjct  583   KFADAVVVGRYSLYPVSASFITGQTNLVERLQKFKLPVYVETFRNEFVSQAYDFFSDATV  642

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYL  546
             E+N++V GA  +   G IT FP TA RY+RNRC+  K+ P YM+PV P  LL+++SP +L
Sbjct  643   EINTHVTGAGVS---GTITEFPLTAARYKRNRCVARKDTPVYMIPVRPAGLLEIVSPTFL  699

Query  545   PPAEAPYPVLTESDVVEPPLPPV  477
             PPAEAP PV T++D+ EPPLPPV
Sbjct  700   PPAEAPNPVFTDADITEPPLPPV  722



>ref|XP_009132384.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Brassica rapa]
Length=766

 Score =   325 bits (833),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 162/323 (50%), Positives = 227/323 (70%), Gaps = 8/323 (2%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+ DGIPFC+ S N+ +     Q  F N + ++PE  +   ++SF+L W +IQ+L   I
Sbjct  403   QMSSDGIPFCLNSTNLGESMNIVQTPFRNRSTTVPEFNSLAGLYSFNLAWSEIQTLTPAI  462

Query  1253  SNPFAK-FRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
             SNP+++ F +FRNP  ++ GK ++L +FL  A N++S+ GVLI VE+AAYL EK+GL V 
Sbjct  463   SNPYSRNFHMFRNPRERSSGKLVSLSEFLNLANNSSSLVGVLINVEHAAYLREKQGLDVV  522

Query  1076  DAVLLALNKADLK--TKKVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTILEIK  906
              AVL  L ++     TK+VMI S++SSVL+     S+YE VY ++E I DIQ+S I +IK
Sbjct  523   KAVLDTLKESGYSNATKRVMIQSSNSSVLVDIKKQSRYETVYQVEETIRDIQDSAIQDIK  582

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             KFA +V++G+ S++P   SF+ G TN+V +LQ  K+ VYV+ F NEFVSQA+DF SD  V
Sbjct  583   KFADAVVVGRFSLYPISASFITGQTNLVERLQKFKLPVYVETFRNEFVSQAYDFLSDATV  642

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYL  546
             E+N++V GA  +   G IT FP TA RY+RNRC+  K+ P YM+PV P  LL+++SP +L
Sbjct  643   EINTHVTGAGVS---GTITEFPLTAARYKRNRCVARKDTPVYMIPVRPAGLLEIVSPTFL  699

Query  545   PPAEAPYPVLTESDVVEPPLPPV  477
             PPAEAP PV+T++DV EPPLPPV
Sbjct  700   PPAEAPNPVITDADVTEPPLPPV  722



>emb|CDY36746.1| BnaA03g11400D [Brassica napus]
Length=766

 Score =   325 bits (832),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 162/323 (50%), Positives = 226/323 (70%), Gaps = 8/323 (2%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+ DGIPFC+ S N+ +     Q  F N + ++PE  +   ++SF+L W +IQ+L   I
Sbjct  403   QMSSDGIPFCLNSTNLGESMNIVQTPFRNRSATVPEFNSLAGLYSFNLAWSEIQTLTPAI  462

Query  1253  SNPFAK-FRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
             SNP+++ F +FRNP  ++ GK ++L +FL  A N++S+ GVLI VE+AAYL EK+GL V 
Sbjct  463   SNPYSRNFHMFRNPRERSSGKLVSLSEFLNLANNSSSLVGVLINVEHAAYLREKQGLDVV  522

Query  1076  DAVLLALNKA--DLKTKKVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTILEIK  906
              AVL  L ++     TK+VMI S++SSVL+     S+YE VY ++E I DIQ+S I +IK
Sbjct  523   KAVLDTLKESGYSYATKRVMIQSSNSSVLVDIKKQSRYETVYQVEETIRDIQDSAIQDIK  582

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             KFA +V++G+ S++P   SF+ G TN+V +LQ  K+ VYV+ F NEFVSQA+DF SD  V
Sbjct  583   KFADAVVVGRFSLYPISASFITGQTNLVERLQKFKLPVYVETFRNEFVSQAYDFLSDATV  642

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYL  546
             E+N++V GA  +   G IT FP TA RY+RNRC+  K+ P YM+PV P  LL+++SP +L
Sbjct  643   EINTHVTGAGVS---GTITEFPLTAARYKRNRCMARKDTPVYMIPVRPAGLLEIVSPTFL  699

Query  545   PPAEAPYPVLTESDVVEPPLPPV  477
             PPAEAP PV T++DV EPPLPPV
Sbjct  700   PPAEAPNPVFTDADVTEPPLPPV  722



>ref|XP_006279180.1| hypothetical protein CARUB_v10007932mg [Capsella rubella]
 gb|EOA12078.1| hypothetical protein CARUB_v10007932mg [Capsella rubella]
Length=538

 Score =   318 bits (814),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 167/325 (51%), Positives = 213/325 (66%), Gaps = 9/325 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+ DG PFC  S+++ D T  AQ  F N   ++ E+ +   I++F L W +IQ+L   I
Sbjct  183   QMSNDGTPFCASSIDLGDSTMVAQTPFRNRQTTVSEISSDGGIYTFSLTWPEIQNLTPAI  242

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNP+  + + RNP  +N G  + L  FL  A N+TS+S VLI+VEN  YL EK GL +  
Sbjct  243   SNPYRSYDMLRNPNERNSGNLILLSQFLDLAKNSTSLSSVLISVENVVYLREKLGLDLIK  302

Query  1073  AVLLALNKADLK----TKKVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTILEI  909
             AVL  L +        T KVMI S +SSVL+ F   SKY  VY I+E ISDI +S I +I
Sbjct  303   AVLDTLTETGYSNVNTTTKVMIQSTNSSVLLDFKKQSKYVTVYRIEETISDILDSAIQDI  362

Query  908   KKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPY  729
             KKFA +V+IGKSSV     SF    TNVV +LQ S++ VYV++F NEFVSQ  DFFSDP 
Sbjct  363   KKFADAVVIGKSSVSTATRSFATRQTNVVERLQKSQLLVYVEIFQNEFVSQKRDFFSDPT  422

Query  728   VELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQY  549
             VE+N+Y +G   N   G IT FP TA RY+RNRCLG +EIP YMLP+ PGSLL ++SP  
Sbjct  423   VEINTYTYGVGIN---GTITEFPFTAARYKRNRCLGREEIPQYMLPIQPGSLLGVVSPLS  479

Query  548   LPPAEAPYPVLTESDVVEPPLPPVA  474
             LPPAEAP  + T++DV EP LPPV+
Sbjct  480   LPPAEAPSLIFTDADVTEPHLPPVS  504



>ref|XP_010438711.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Camelina sativa]
Length=757

 Score =   323 bits (827),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 173/325 (53%), Positives = 221/325 (68%), Gaps = 9/325 (3%)
 Frame = -3

Query  1427  MTKDGIPFCMGSVNMIDGTTAA-QQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  1251
             M+ DG PFC  S+++ + TT A   F N +  +PE+ +   I++F L W +IQ+L   IS
Sbjct  394   MSSDGTPFCSSSIDLGNSTTVALTPFRNRSTIVPEISSLGGIYTFSLTWPEIQTLTPAIS  453

Query  1250  NPF-AKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             NP+   F  FRNP  KN GKF++L DFL  A N+TS+SGVLI+VENAAYL E++GL V  
Sbjct  454   NPYRGAFSFFRNPKMKNAGKFLSLSDFLNLAKNSTSLSGVLISVENAAYLREEQGLDVVK  513

Query  1073  AVLLALNK---ADLKTKKVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTILEIK  906
             AVL  L     ++  TKKVMI S +SSVL+ F   S+YE VY I+E I DI +S I +IK
Sbjct  514   AVLDTLTMTGYSNSTTKKVMIQSTNSSVLVDFKKQSQYETVYKIEENIRDILDSAIEDIK  573

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             KFA++V+I K SVFP   SF+   TNVV KLQ S++ VYV+LF NEFVSQ +DFFSD  V
Sbjct  574   KFANAVVIQKLSVFPVAQSFITRQTNVVEKLQKSQLPVYVELFQNEFVSQPYDFFSDATV  633

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYL  546
             E+NSY+ G   N   G IT FP TA RY++N CL  KE  PYM P  PG+LL L+S   L
Sbjct  634   EINSYITGPGIN---GTITEFPFTAARYKKNLCLASKENVPYMAPAQPGALLTLVSSTSL  690

Query  545   PPAEAPYPVLTESDVVEPPLPPVAK  471
             PPA+AP P+ T++DV EPPLPPV +
Sbjct  691   PPAQAPNPLFTDADVTEPPLPPVTE  715



>ref|XP_004491451.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Cicer arietinum]
Length=762

 Score =   323 bits (827),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 178/324 (55%), Positives = 223/324 (69%), Gaps = 9/324 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             Q++KDGIPFC+ S+++ + T  AQ  FS  A++IPE+K+ + I +F+L W DI+ L   I
Sbjct  398   QISKDGIPFCLSSIDLFESTNVAQSSFSGYAMTIPEIKSSSGIFTFNLTWADIKGLTPSI  457

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
              NP+ K+ LFRNP  K  G F+TL DFL+   N TS+SGVLI VENAAYLAE +G  VTD
Sbjct  458   INPYTKYTLFRNPKYKKAGTFVTLSDFLSLTKNHTSLSGVLIIVENAAYLAENQGFSVTD  517

Query  1073  AVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
              V+ AL KA      ++KV I S +SSVL+KF   + YE VY I E +SD  N+ + +IK
Sbjct  518   KVIDALRKAGYDKPGSQKVYIQSTNSSVLLKFKEKTNYELVYKIDETVSDAANAAVEDIK  577

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
              FA SV+I K SVFP +  F+ G TN V KLQAS + V+V+ FSNEFVSQAWDFFSD  V
Sbjct  578   TFAGSVVINKDSVFPQNSGFITGATNTVPKLQASNLSVFVETFSNEFVSQAWDFFSDSTV  637

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMSPQY  549
             E+NSY+ GA     DGVIT FP TA+RY RN+CL   K  PPYM  V  G L  ++SPQ 
Sbjct  638   EINSYIQGAG---IDGVITDFPKTASRYSRNKCLNLGKNTPPYMEAVETGGLYSIISPQS  694

Query  548   LPPAEAPYPVLTESDVVEPPLPPV  477
             LPPA AP P LT+S+VVEPPLP V
Sbjct  695   LPPALAPIPPLTKSEVVEPPLPSV  718



>ref|XP_004500131.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Cicer arietinum]
Length=704

 Score =   321 bits (822),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 163/325 (50%), Positives = 221/325 (68%), Gaps = 12/325 (4%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+KDGIPFC+ S+++   TT A  +F N   +IPE+K  + I++F L W +I++L   I
Sbjct  387   QMSKDGIPFCLSSIDLSMSTTVANTKFRNHTATIPEIKNGSGIYTFSLTWNEIKTLTPSI  446

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
               P+ K+ LFRNP  KN+G F+TL +FL+ A      SG+LI++ENAAYLAEK+GL VT+
Sbjct  447   LKPYEKYLLFRNPKFKNQGNFVTLSEFLSLAKG----SGILISIENAAYLAEKRGLSVTN  502

Query  1073  AVLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
             AVL  L KA     K+ KVMI S  SSVL  F N SKYERVY + E I D  +  + +IK
Sbjct  503   AVLNTLKKAGYDKPKSPKVMIQSTHSSVLKIFKNKSKYERVYKVDENIHDADDKAVEDIK  562

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
              FA SV+I K+SVFP  ++FLV  TN V + Q+ K+ VYV+ FSNEFVSQAWD++SD +V
Sbjct  563   TFADSVVIQKASVFPQSEAFLVNSTNTVERFQSFKLSVYVETFSNEFVSQAWDYYSDAFV  622

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYL  546
             E+NS+V GA  N   G+IT FP TA RY +N+CL ++   PY  P+ PG LL+ ++  YL
Sbjct  623   EINSFVIGAKVN---GIITDFPKTAARYTKNKCLKHRNKAPYTRPIEPGKLLKQITQLYL  679

Query  545   PPAEAPYPVLTESDVVEPPLPPVAK  471
             P    P P+L +++V EPPLP V++
Sbjct  680   PAPVPPLPILNDNNVTEPPLPSVSR  704



>ref|XP_009127510.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 2 [Brassica rapa]
Length=749

 Score =   322 bits (824),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 167/323 (52%), Positives = 215/323 (67%), Gaps = 9/323 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             +M+ DG PFC  S+++   T   Q  F N +  IP++ +   I++F+L W +IQSL   I
Sbjct  392   KMSSDGKPFCSSSIDLTQSTMVIQSPFRNRSTIIPDISSDPGIYTFNLTWPEIQSLTPAI  451

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
              NP+  + +FRNP  KN G+ ++L +FL  A  +TS+ GVLI+VE   YL EK+GL V  
Sbjct  452   MNPYRSYNMFRNPNEKNSGRIISLSEFLHLANKSTSIYGVLISVEYVVYLREKQGLDVVK  511

Query  1073  AVLLALNKADLK----TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEI  909
             AVL  L +        T KVMI S  SSVL+ F   SKYE VY ++E I DI +S I +I
Sbjct  512   AVLDTLTETGYSNGTSTTKVMIQSTHSSVLVDFKKKSKYETVYKVEETIRDISDSAIEDI  571

Query  908   KKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPY  729
             KKFA++V+IGKSSVFP   SF+ G TNVV +L+ SK+ VYV+LF NEFVSQ +DF SD  
Sbjct  572   KKFANAVVIGKSSVFPDVGSFVTGQTNVVERLRKSKLPVYVELFQNEFVSQPYDFCSDAT  631

Query  728   VELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQY  549
             VE+N+Y+ GA  N   G IT FP TA+RY+RN+CLG KE P YM P+ PG LL L +P+ 
Sbjct  632   VEINTYITGAGIN---GTITEFPLTASRYKRNQCLGRKETPSYMSPIKPGILLSLANPRS  688

Query  548   LPPAEAPYPVLTESDVVEPPLPP  480
             LPPAEAPYPV TE DV E P PP
Sbjct  689   LPPAEAPYPVFTEDDVTESPQPP  711



>emb|CDY12605.1| BnaA02g12730D [Brassica napus]
Length=716

 Score =   320 bits (820),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 166/323 (51%), Positives = 215/323 (67%), Gaps = 9/323 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             +M+ DG PFC  S+++   T   Q  F N +  IP++ +   I++F+L W +IQSL   I
Sbjct  359   KMSSDGKPFCSSSIDLTQSTMVIQSPFRNRSTIIPDISSDPGIYTFNLTWPEIQSLTPAI  418

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
              NP+  + +FRNP  KN G+ ++L +FL  A  +TS+ GVLI+VE   YL EK+GL V  
Sbjct  419   MNPYRSYNMFRNPNEKNSGRIISLSEFLHLANKSTSIYGVLISVEYVVYLREKQGLDVVK  478

Query  1073  AVLLALNKADLK----TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEI  909
             AVL  L +        T KVMI S  SSVL+ F   SKYE VY ++E I DI +S I +I
Sbjct  479   AVLDTLTETGYSNGTSTTKVMIQSTHSSVLVDFKKKSKYETVYKVEETIRDISDSAIEDI  538

Query  908   KKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPY  729
             KKFA++V+IGKSSVFP   SF+ G TNVV +L+ SK+ VYV+LF NEFVSQ +DF SD  
Sbjct  539   KKFANAVVIGKSSVFPDVGSFVTGQTNVVERLRKSKLPVYVELFQNEFVSQPYDFCSDAT  598

Query  728   VELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQY  549
             VE+N+Y+ GA  N   G IT FP TA+RY+RN+CLG K+ P YM P+ PG LL L +P+ 
Sbjct  599   VEINTYITGAGIN---GTITEFPLTASRYKRNQCLGRKKTPSYMSPIKPGILLSLANPRS  655

Query  548   LPPAEAPYPVLTESDVVEPPLPP  480
             LPPAEAPYPV TE DV E P PP
Sbjct  656   LPPAEAPYPVFTEDDVTESPQPP  678



>ref|XP_010252665.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Nelumbo nucifera]
Length=754

 Score =   321 bits (822),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 168/326 (52%), Positives = 227/326 (70%), Gaps = 11/326 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QMT+DG+  C+GS+N++DGT   Q  F++ + +I +++    I +F+L W++I++L+  I
Sbjct  393   QMTQDGVSICLGSINLMDGTNVVQTDFNSRSTTIRQIQPIPGIFTFNLTWEEIKTLKPVI  452

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNP   F L+RNP  K  G   +L DFL FA +      VLI++ENAAYLAE  GL VT+
Sbjct  453   SNPSRDFALYRNPAYKYAGSIFSLKDFLAFAKDKPL--SVLISIENAAYLAESLGLSVTN  510

Query  1073  AVLLALNKA---DLKTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
             AV+ ALN++   +   +KVMI S++ SVL+KF   + Y+ VY I E+I D  +S+I +IK
Sbjct  511   AVIDALNQSGYNNQTNQKVMIQSSNRSVLIKFKEKTNYQLVYKIDEDIRDADDSSIKDIK  570

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             +FA SV I K SVFPT+  FL G TN+V+KLQ+S + VYV LF NEFVSQAWDFFSDP V
Sbjct  571   QFAHSVAITKESVFPTNQLFLTGATNIVSKLQSSNLTVYVYLFRNEFVSQAWDFFSDPVV  630

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMSPQY  549
             E+NS+V GA     DG+IT FP TA  YR N+CL   K  P YM PV PG+L+Q+++ ++
Sbjct  631   EINSFVMGAG---IDGIITDFPGTATAYRNNKCLKMGKNKPYYMNPVEPGALMQVITAEF  687

Query  548   LPPAEAPYPVLTESDVVEPPLPPVAK  471
             LPPAE+P PVLTESDV EPPL  + K
Sbjct  688   LPPAESPNPVLTESDVAEPPLASITK  713



>emb|CDX92782.1| BnaC07g40400D [Brassica napus]
Length=1322

 Score =   329 bits (844),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 168/316 (53%), Positives = 224/316 (71%), Gaps = 9/316 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+ DG PFC  S+++ + TT +Q  ++  +  +PE+ +   I++F L W +I++L   I
Sbjct  391   QMSSDGKPFCSRSIDLSNSTTISQTSYAQRSTHVPEISSNGGIYTFSLTWAEIRNLTPAI  450

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             +NP+  + +FRNP  KN GK + L +FL  A ++TS+SGVLI+VEN  YL +K+GL +  
Sbjct  451   ANPYRLYNIFRNPNQKNSGKLILLSEFLNLAKHSTSLSGVLISVENVMYLRQKQGLNMVK  510

Query  1073  AVLLALNKADLKTK----KVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEI  909
             AVL  L +    T+    KVMI S DSSVL++F N SKYE VY +++ ISDI +S I EI
Sbjct  511   AVLDTLTETAYSTRITTTKVMIQSTDSSVLVEFRNQSKYETVYKVEKTISDISDSAIKEI  570

Query  908   KKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPY  729
             K+FAS+V+I K+SVFPT D FL+G TNVV +LQ S++ VYV+LF NEFVSQ +DF SD  
Sbjct  571   KEFASAVVITKASVFPTFDGFLMGQTNVVERLQKSQLPVYVELFQNEFVSQPYDFLSDAT  630

Query  728   VELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQY  549
             VE+NSYV GA  N   G IT FP TA RYR+NRCLG KE PPYM PV PG+LLQ+++P  
Sbjct  631   VEINSYVTGAGVN---GTITEFPFTAARYRKNRCLGSKETPPYMAPVQPGALLQVVNPAS  687

Query  548   LPPAEAPYPVLTESDV  501
             LPPAEAP PV T++DV
Sbjct  688   LPPAEAPNPVFTDADV  703



>ref|XP_006603452.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
3-like [Glycine max]
Length=425

 Score =   310 bits (794),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 163/327 (50%), Positives = 219/327 (67%), Gaps = 10/327 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+KDG PF + S+++I+ TT AQ  FS  +++IPE+K+ + I +F+L W DI +L   I
Sbjct  64    QMSKDGTPFFLNSIDLIESTTVAQSSFSKFSMTIPEIKSSSGIFAFNLTWNDINNLTPSI  123

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
              NPFAK RLFRN + KN G  +TL  FL+   N TS+S V I VENA YL +K+GL V D
Sbjct  124   LNPFAKCRLFRN-LPKNAGALLTLSYFLSLTKNQTSLSDVAIIVENATYLVDKQGLSVID  182

Query  1073  AVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
              V+ AL+KA      ++KV I S +SSVL+KF   + YE VY I E + D  N+T+ +IK
Sbjct  183   VVISALSKAGYDKPGSQKVYIQSTNSSVLLKFKEKTSYELVYKIDETVGDAANATVEDIK  242

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
              FASSV++ K SV P ++ FL   TN+V KL+ + + V+V+ FS+EFVS AWDFF+D  V
Sbjct  243   SFASSVVVNKDSVIPNNNQFLTTYTNIVPKLKIANLLVFVETFSSEFVSPAWDFFADATV  302

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMSPQY  549
             E+N+Y+ GA     DG+IT FP   +RYRRN+CLG  +  P YM PV  G +  L++ + 
Sbjct  303   EINTYIEGAQ---IDGIITNFPKIVDRYRRNKCLGLGDNKPTYMEPVQSGGIFGLITKEL  359

Query  548   LPPAEAPYPVLTESDVVEPPLPPVAKI  468
              PP EA +P L ES V EPPLPPVAKI
Sbjct  360   FPPVEATFPPLIESKVAEPPLPPVAKI  386



>ref|XP_010511611.1| PREDICTED: LOW QUALITY PROTEIN: glycerophosphodiester phosphodiesterase 
protein kinase domain-containing GDPDL2-like [Camelina 
sativa]
Length=1150

 Score =   327 bits (838),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 177/326 (54%), Positives = 225/326 (69%), Gaps = 11/326 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+ DG  FC+ + ++ D T  AQ QFSN   ++PE+ +   I++F L W +IQ+L   I
Sbjct  438   QMSSDGKSFCLSTADLKDSTLIAQSQFSNRLTTVPEISSVPGIYTFSLTWPEIQNLTPAI  497

Query  1253  SNPFAKF-RLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
             SNP+  F  +FRNP  KN GK ++L +FL  A  +TS+SGVLI VENAAYL EK+GL V 
Sbjct  498   SNPYQSFYNMFRNPNEKNSGKLISLSEFLELAKKSTSISGVLIRVENAAYLREKQGLDVV  557

Query  1076  DAVLLALNKADLK----TKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTILE  912
              AVL  L KA       T KVMI S +SSVL+ F + SKY  VY I+E ISDI++S I  
Sbjct  558   KAVLGTLTKAGYNDGNTTIKVMIQSTNSSVLVDFKSESKYTTVYKIEETISDIRDSAIEV  617

Query  911   IKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDP  732
             IKKFA++V+I K+SVFP  D+FL G TNVV KLQ S++ VYV+LF NEFVSQ +DFF+D 
Sbjct  618   IKKFANAVVINKASVFPIADNFLSGQTNVVEKLQKSQLPVYVELFQNEFVSQPFDFFTDA  677

Query  731   YVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMS-P  555
              VE+NSY+ GA  N   G IT FP TA RY++NRCL  ++IPPYM P  PG +L+L+S  
Sbjct  678   TVEINSYISGAGIN---GTITEFPXTAARYKKNRCLRRQDIPPYMSPFEPGGVLKLVSRS  734

Query  554   QYLPPAEAPYPVLTESDVVEPPLPPV  477
               LPPA+AP PV T+ DV E PLPPV
Sbjct  735   NSLPPAQAPSPVFTDGDVTESPLPPV  760



>gb|AAF98210.1|AC007152_6 Unknown protein [Arabidopsis thaliana]
Length=1111

 Score =   326 bits (836),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 167/323 (52%), Positives = 219/323 (68%), Gaps = 8/323 (2%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+ DGIPFC  S+++++ TT  Q    N ++ +PE+ +   I +F L W +IQSL   I
Sbjct  407   QMSSDGIPFCSSSIDLVNSTTVGQTHLRNRSIIVPEISSVAGIFTFSLTWHEIQSLTPAI  466

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNPF +  + RNP  +N G  ++L +FL  A N+TS+SG+LI++EN  YL EKKGL V  
Sbjct  467   SNPFRENGMSRNPNERNSGNLISLYEFLNLAKNSTSLSGILISLENVVYLREKKGLDVVK  526

Query  1073  AVLLALNKAD--LKTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIKK  903
              VL  L +    + T KVMI S    VL+ F N S Y+ VY IKE I +I +S I +IKK
Sbjct  527   VVLNRLTETGYIVGTLKVMIQSTTRLVLVDFKNQSTYKTVYKIKETIGNITDSAIEDIKK  586

Query  902   FASSVIIGKSSVFPTDDSFLVG-VTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             FA++V+I K+SVFP  DSFL G  TNV+ +LQ  ++ VYV+LF NEFVSQ +DFF+D  V
Sbjct  587   FANAVVINKASVFPNSDSFLTGQTTNVLERLQKFQLPVYVELFQNEFVSQPFDFFADETV  646

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYL  546
             E+N+Y+FGA  N   G IT FP TA RY+RNRCLG +E+PPYMLPV PG +L L+S   L
Sbjct  647   EINAYIFGAGIN---GTITEFPYTAARYKRNRCLGREEVPPYMLPVNPGGVLTLISTSSL  703

Query  545   PPAEAPYPVLTESDVVEPPLPPV  477
             PPA+ P P+ T  DV EPPLPPV
Sbjct  704   PPAQDPNPIFTHDDVTEPPLPPV  726



>ref|XP_010474164.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=654

 Score =   317 bits (811),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 170/326 (52%), Positives = 213/326 (65%), Gaps = 9/326 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM  DG PFC  S+++ D T  AQ  F N   ++ E+ +   +++F L W +IQ+L   I
Sbjct  301   QMCSDGTPFCSNSIDLGDSTMVAQTPFRNRLTTVSEISSNGGVYTFSLTWPEIQNLTPAI  360

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNP+    + RNP   N G  ++L  FL  A N+TS+SGVLI VEN  YL EK+GL V  
Sbjct  361   SNPYRSNSMLRNPNESNSGNLISLSQFLDLAKNSTSLSGVLIIVENVVYLREKQGLDVIR  420

Query  1073  AVLLALNKA---DLKTKKVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTILEIK  906
             AVL  L +    ++ T KVMI S +SSVL +F   SKYE VY I+E ISDI +S I +IK
Sbjct  421   AVLDTLTETGYNNITTTKVMIQSTNSSVLREFKKQSKYETVYRIEETISDILDSAIQDIK  480

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             KFA++V+IGKSSVFP    FL G T VV +LQ S+++VYV+LF NEFVSQ  D F D  +
Sbjct  481   KFANAVVIGKSSVFPATKRFLTGQTAVVERLQKSQLQVYVELFENEFVSQKLDSFYDATI  540

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQ-LMSPQY  549
             E+N+Y +G   N   G IT +P TA RY+RNRCLG K IPPYM  + PG LL  L+SP  
Sbjct  541   EINTYTYGFGIN---GTITEYPFTAARYKRNRCLGRKVIPPYMSAIQPGDLLNTLVSPLS  597

Query  548   LPPAEAPYPVLTESDVVEPPLPPVAK  471
             LPPAEAP  V T  DV EPPLPPVAK
Sbjct  598   LPPAEAPNLVFTNVDVSEPPLPPVAK  623



>ref|NP_176870.2| suppressor of npr1-1 constitutive 4 [Arabidopsis thaliana]
 sp|D7SFH9.1|GPDL2_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase protein 
kinase domain-containing GDPDL2; AltName: Full=Glycerophosphodiester 
phosphodiesterase-like 2; Short=ATGDPDL2; AltName: 
Full=Protein SUPPRESSOR OF NPR1-1 CONSTITUTIVE 4; Flags: Precursor 
[Arabidopsis thaliana]
 gb|ADI71282.1| SNC4 [Arabidopsis thaliana]
 gb|AEE34581.1| suppressor of npr1-1 constitutive 4 [Arabidopsis thaliana]
Length=1118

 Score =   326 bits (835),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 167/323 (52%), Positives = 219/323 (68%), Gaps = 8/323 (2%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+ DGIPFC  S+++++ TT  Q    N ++ +PE+ +   I +F L W +IQSL   I
Sbjct  405   QMSSDGIPFCSSSIDLVNSTTVGQTHLRNRSIIVPEISSVAGIFTFSLTWHEIQSLTPAI  464

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNPF +  + RNP  +N G  ++L +FL  A N+TS+SG+LI++EN  YL EKKGL V  
Sbjct  465   SNPFRENGMSRNPNERNSGNLISLYEFLNLAKNSTSLSGILISLENVVYLREKKGLDVVK  524

Query  1073  AVLLALNKAD--LKTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIKK  903
              VL  L +    + T KVMI S    VL+ F N S Y+ VY IKE I +I +S I +IKK
Sbjct  525   VVLNRLTETGYIVGTLKVMIQSTTRLVLVDFKNQSTYKTVYKIKETIGNITDSAIEDIKK  584

Query  902   FASSVIIGKSSVFPTDDSFLVG-VTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             FA++V+I K+SVFP  DSFL G  TNV+ +LQ  ++ VYV+LF NEFVSQ +DFF+D  V
Sbjct  585   FANAVVINKASVFPNSDSFLTGQTTNVLERLQKFQLPVYVELFQNEFVSQPFDFFADETV  644

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYL  546
             E+N+Y+FGA  N   G IT FP TA RY+RNRCLG +E+PPYMLPV PG +L L+S   L
Sbjct  645   EINAYIFGAGIN---GTITEFPYTAARYKRNRCLGREEVPPYMLPVNPGGVLTLISTSSL  701

Query  545   PPAEAPYPVLTESDVVEPPLPPV  477
             PPA+ P P+ T  DV EPPLPPV
Sbjct  702   PPAQDPNPIFTHDDVTEPPLPPV  724



>ref|XP_010496109.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Camelina sativa]
Length=1128

 Score =   326 bits (836),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 174/326 (53%), Positives = 228/326 (70%), Gaps = 11/326 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+ DG  FC+ + ++ D T  AQ QFSNL+ ++PE+++   I++F L W +IQ+L   I
Sbjct  419   QMSSDGKCFCLSTADLKDSTLVAQSQFSNLSTTVPEIRSDVGIYTFSLTWPEIQNLTPAI  478

Query  1253  SNPF-AKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
             SNP+ + + +FRNP  KN GK ++L +FL  A ++TS+SGVLI VENAAYL EK+GL V 
Sbjct  479   SNPYQSSYNMFRNPNEKNSGKLISLSEFLELAEHSTSLSGVLIRVENAAYLREKQGLDVV  538

Query  1076  DAVLLALNKADLKTK----KVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTILE  912
              AVL  L +A    +    KVMI S +SSVL+ F   SKYE VY I+E I DI++S I  
Sbjct  539   KAVLDTLTEAGYTNENTKTKVMIQSTNSSVLVDFKKQSKYETVYKIEEIIRDIRDSAIEV  598

Query  911   IKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDP  732
             IKKFA++V+I K+SVFP  DSFL G TNVV +LQ S++ VYV+LF NEFVSQA+DFF+D 
Sbjct  599   IKKFANAVVINKASVFPDSDSFLTGQTNVVERLQKSQLLVYVELFRNEFVSQAYDFFTDA  658

Query  731   YVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMS-P  555
              VE+NSY+ GA  N   G IT FP TA RY++NRCL  + IPPYM P  PG +L+L++  
Sbjct  659   TVEINSYISGAGIN---GTITEFPYTAARYKKNRCLRRQHIPPYMSPFEPGGVLKLVNRS  715

Query  554   QYLPPAEAPYPVLTESDVVEPPLPPV  477
               LPPA+AP  V T+SDV E PL PV
Sbjct  716   NSLPPAQAPSSVFTDSDVTESPLSPV  741



>ref|XP_010470589.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=765

 Score =   319 bits (817),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 171/325 (53%), Positives = 220/325 (68%), Gaps = 10/325 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             Q++ +G PFC  +V++ D TT AQ QFSN + ++PE+ +   I++F L W +IQSL   I
Sbjct  407   QLSSEGKPFCKRTVDLKDSTTVAQSQFSNRSTTVPEISSVGGIYTFSLTWTEIQSLTPAI  466

Query  1253  SNPFA-KFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
             SNPF     +FRNP  +N GK ++L +FL  A N+TS+SGVLI VE  + +         
Sbjct  467   SNPFRDSSNMFRNPNERNSGKLISLSEFLELAKNSTSLSGVLIRVEVGSRVXXXXXXXXV  526

Query  1076  DAVLLALNKADLK---TKKVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTILEI  909
              AVL  L +   +   T KVMI S +SSVL+ F    KYE VY I E I +I +  I  I
Sbjct  527   KAVLDTLTETGYENSTTPKVMIQSTNSSVLVDFKKQCKYETVYKIDETIGEILDYAIEGI  586

Query  908   KKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPY  729
             KKFA++V+I K+SVFP  D+F+ G  NVV +LQ SK+ VYV+LF NEFVSQA+DFFSD  
Sbjct  587   KKFANAVVINKASVFPDSDAFVTGKPNVVERLQKSKLSVYVELFRNEFVSQAYDFFSDAT  646

Query  728   VELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQ-LMSPQ  552
             VELNSY+ GA  N   G IT FP TA RYRRNRCLG KEIPPYMLP+ PG LL  ++SP 
Sbjct  647   VELNSYISGAGIN---GTITEFPFTAARYRRNRCLGRKEIPPYMLPIQPGDLLHDVVSPL  703

Query  551   YLPPAEAPYPVLTESDVVEPPLPPV  477
              LPPAEAP  ++T++D++EPPLPPV
Sbjct  704   SLPPAEAPNLIITDADLIEPPLPPV  728



>ref|XP_006279182.1| hypothetical protein CARUB_v10007932mg [Capsella rubella]
 gb|EOA12080.1| hypothetical protein CARUB_v10007932mg [Capsella rubella]
Length=760

 Score =   317 bits (813),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 167/325 (51%), Positives = 213/325 (66%), Gaps = 9/325 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+ DG PFC  S+++ D T  AQ  F N   ++ E+ +   I++F L W +IQ+L   I
Sbjct  405   QMSNDGTPFCASSIDLGDSTMVAQTPFRNRQTTVSEISSDGGIYTFSLTWPEIQNLTPAI  464

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNP+  + + RNP  +N G  + L  FL  A N+TS+S VLI+VEN  YL EK GL +  
Sbjct  465   SNPYRSYDMLRNPNERNSGNLILLSQFLDLAKNSTSLSSVLISVENVVYLREKLGLDLIK  524

Query  1073  AVLLALNKADLK----TKKVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTILEI  909
             AVL  L +        T KVMI S +SSVL+ F   SKY  VY I+E ISDI +S I +I
Sbjct  525   AVLDTLTETGYSNVNTTTKVMIQSTNSSVLLDFKKQSKYVTVYRIEETISDILDSAIQDI  584

Query  908   KKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPY  729
             KKFA +V+IGKSSV     SF    TNVV +LQ S++ VYV++F NEFVSQ  DFFSDP 
Sbjct  585   KKFADAVVIGKSSVSTATRSFATRQTNVVERLQKSQLLVYVEIFQNEFVSQKRDFFSDPT  644

Query  728   VELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQY  549
             VE+N+Y +G   N   G IT FP TA RY+RNRCLG +EIP YMLP+ PGSLL ++SP  
Sbjct  645   VEINTYTYGVGIN---GTITEFPFTAARYKRNRCLGREEIPQYMLPIQPGSLLGVVSPLS  701

Query  548   LPPAEAPYPVLTESDVVEPPLPPVA  474
             LPPAEAP  + T++DV EP LPPV+
Sbjct  702   LPPAEAPSLIFTDADVTEPHLPPVS  726



>ref|XP_002888565.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH64824.1| glycerophosphoryl diester phosphodiesterase family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
Length=708

 Score =   315 bits (808),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 165/310 (53%), Positives = 213/310 (69%), Gaps = 10/310 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+ DGIPFC+ S+N+ D TT  Q  +SN +  +PE+ +   I++F L W +IQ+L   I
Sbjct  402   QMSSDGIPFCLSSINLGDSTTVTQTLYSNRSTPVPEISSVAGIYTFSLTWPEIQNLTPAI  461

Query  1253  SNPFAK-FRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
             SNP+ + +R+ RNP  KN G  ++L  FL  A N TS+SGVLI+VENAAYL EK+GL V 
Sbjct  462   SNPYFRVYRISRNPKEKNSGTLISLSQFLDLAKNYTSLSGVLISVENAAYLREKQGLDVV  521

Query  1076  DAVLLALNKADLKTK----KVMIHSNDSSVLMKFTNS-KYERVYGIKEEISDIQNSTILE  912
              AVL  L K          KVMI S +SSVL+ F    KYE VY I+E IS+I +  I +
Sbjct  522   QAVLDTLTKTGYNNGTTTTKVMIQSTNSSVLVDFRKQIKYETVYKIEETISNIHDYAIED  581

Query  911   IKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDP  732
             IKKFA++V+I K SVFP  +SFL   TNVV +L+ S++ VYV+LF NEFVSQ +DFF+D 
Sbjct  582   IKKFANAVVINKDSVFPNSESFLTKQTNVVERLKKSQLTVYVELFRNEFVSQPYDFFADA  641

Query  731   YVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQ  552
              VE+N+Y+ GA  +   G IT FP TA RY+RNRCLG KEIPPYMLP+ PG LL +M+P 
Sbjct  642   TVEINTYISGAGVS---GTITEFPFTAARYKRNRCLGRKEIPPYMLPIQPGGLLAIMNPL  698

Query  551   YLPPAEAPYP  522
              LPPA+AP P
Sbjct  699   ALPPAQAPNP  708



>ref|XP_006300773.1| hypothetical protein CARUB_v10019847mg [Capsella rubella]
 gb|EOA33671.1| hypothetical protein CARUB_v10019847mg [Capsella rubella]
Length=766

 Score =   317 bits (811),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 166/323 (51%), Positives = 216/323 (67%), Gaps = 8/323 (2%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAA-QQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+ DG PFC  S+++ + TT A     N + ++PE+ +   I++F L W +I++L   I
Sbjct  406   QMSSDGTPFCSSSIDLGNTTTVALTPLRNRSTTVPEISSIGGIYTFSLTWPEIKNLTPVI  465

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             +NP+  + + RNP  KN GK ++L +FL  A N+TS+S VLI VENAAYL E +GL V  
Sbjct  466   TNPYRTYTMLRNPKEKNSGKLISLSEFLDLAKNSTSLSSVLINVENAAYLRENQGLDVIK  525

Query  1073  AVLLALNKADLK---TKKVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTILEIK  906
             AVL  L     K   T KVMI S +SSVL+ F   SKYE VY I+E IS+I +    EIK
Sbjct  526   AVLDTLTDTGFKDSTTTKVMIQSTNSSVLVDFKKQSKYETVYKIEETISEILDYGTEEIK  585

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             KFA +V+I K SVF   +SF+ G TNVV +L  S++ VYV+LF NEFVSQ +DFF+D  V
Sbjct  586   KFADAVVINKDSVFLQSESFVTGQTNVVERLHKSQLPVYVELFQNEFVSQPYDFFTDATV  645

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYL  546
             E+NSY+ GA  N   G IT FP TA RY+RNRCL  K+ PPYMLP+ PGSLL + +   L
Sbjct  646   EINSYINGAGIN---GTITEFPFTAARYKRNRCLARKDTPPYMLPIKPGSLLGVANRYLL  702

Query  545   PPAEAPYPVLTESDVVEPPLPPV  477
             PPAEAP  + T++DV EPPLPPV
Sbjct  703   PPAEAPSLIFTDADVSEPPLPPV  725



>ref|XP_002888566.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64825.1| kinase family protein, partial [Arabidopsis lyrata subsp. lyrata]
Length=1089

 Score =   322 bits (826),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 166/322 (52%), Positives = 216/322 (67%), Gaps = 7/322 (2%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+ DGIPFC  S+++ + TT  Q    N ++ +PE+ +   I +F L W +IQSL   I
Sbjct  386   QMSSDGIPFCASSIDLANSTTVNQTHLRNRSIFVPEISSAAGIFTFSLTWHEIQSLTPAI  445

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNPF  + + RNP   N G  ++L +FL  A N++S+SGVLI++EN  YL EK+GL V  
Sbjct  446   SNPFRLYSMSRNPNEGNSGNLISLYEFLNLAKNSSSLSGVLISLENVIYLREKQGLDVVK  505

Query  1073  AVLLALNKAD--LKTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIKK  903
              VL  L +      T KVMI S  S VL+ F N SKYE VY I+E I +I +S I +IKK
Sbjct  506   VVLNRLTETGYIFGTLKVMIQSTTSLVLVDFKNQSKYETVYKIEETIGNIPDSAIEDIKK  565

Query  902   FASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVE  723
             FA++V+I K SV P  +SF+ G TNVV +LQ S++ VY++LF NEFVSQ +DFF D  VE
Sbjct  566   FANAVVINKDSVSPNSESFVTGQTNVVERLQKSQLPVYMELFRNEFVSQPYDFFDDATVE  625

Query  722   LNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLP  543
             +N+Y+ G   N   G IT FP TA RY+RNRCLG KEIPPYMLP+ PG LL +M+P  LP
Sbjct  626   INTYISGHGIN---GTITEFPFTAARYKRNRCLGRKEIPPYMLPIQPGGLLAIMNPLALP  682

Query  542   PAEAPYPVLTESDVVEPPLPPV  477
             PA+AP P+ T  DV EPP+PPV
Sbjct  683   PAQAPNPIFTYDDVTEPPVPPV  704



>ref|XP_004499801.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 3-like [Cicer arietinum]
Length=763

 Score =   316 bits (809),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 177/325 (54%), Positives = 227/325 (70%), Gaps = 11/325 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             Q++KDGIPFC+ S++  + TT AQ  FS   +SIPE+K+ + I +F+L W DI+ L   I
Sbjct  399   QISKDGIPFCLSSIDHYESTTVAQSSFSGYDMSIPEIKSCSGIFTFNLTWDDIKGLTPSI  458

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
              NP+++++LFRNP  KN G F+TL DFL+   N TS+SGVLI VENAAYLA+ +G  VTD
Sbjct  459   FNPYSEYKLFRNPKYKNAGTFVTLSDFLSLTKNHTSLSGVLIIVENAAYLAKNQGFSVTD  518

Query  1073  AVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
              V+ AL KA      ++KV I S +SSVL+KF   + YE VY I E +SD  N+ + +IK
Sbjct  519   KVIDALRKAGYDKPGSQKVYIQSTNSSVLLKFKEKTNYELVYKIYETVSDAANAAVEDIK  578

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
              FA SV+I K SVFP +  F++G TN V KL+AS + V+V+ FSNEFVSQAWDFFSD  V
Sbjct  579   TFAGSVVINKGSVFPHNGDFIMGATNTVPKLKASNLSVFVETFSNEFVSQAWDFFSDSTV  638

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRC--LGYKEIPPYMLPVGPGSLLQLMSPQ  552
             E+NS++ GA     DGVIT FP TA+RY RN+C  LG K  PPYM  V  G L  ++SPQ
Sbjct  639   EINSFIQGAG---IDGVITDFPKTASRYSRNKCXNLG-KNTPPYMEAVETGGLYSIISPQ  694

Query  551   YLPPAEAPYPVLTESDVVEPPLPPV  477
              LPPA AP P LT+S+VVEPPLP V
Sbjct  695   SLPPALAPIPPLTKSEVVEPPLPSV  719



>ref|XP_009137635.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=1321

 Score =   324 bits (831),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 170/316 (54%), Positives = 221/316 (70%), Gaps = 9/316 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM++DG PFC  S+++ + T  AQ  F+  +  +PE+ + + I++F L W +IQSL   I
Sbjct  390   QMSRDGKPFCSHSIDLSNITNIAQTSFAQRSTHVPEISSNDGIYTFSLTWSEIQSLIPAI  449

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNP+  + +FRNP  K  GK + L +FL  A ++TS+SGVLI+VENA YL +K+GL +  
Sbjct  450   SNPYRVYNMFRNPNEKKSGKLILLSEFLKLAKHSTSLSGVLISVENAMYLRQKQGLNMVK  509

Query  1073  AVLLALNKADLKTK----KVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEI  909
             AVL  L +    T+    KVMI S DSSVL++F N SKYE VY +++ ISDI +S I EI
Sbjct  510   AVLDTLTETAYSTRITTTKVMIQSTDSSVLVEFRNQSKYETVYKVEKTISDISDSAIEEI  569

Query  908   KKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPY  729
             K+FAS+V+I K SVFPT   F+ G TNVV +LQ S++ VYV+LF NEFVSQ +DFFSD  
Sbjct  570   KEFASAVVITKVSVFPTFYGFVTGQTNVVERLQKSQLPVYVELFQNEFVSQPYDFFSDAT  629

Query  728   VELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQY  549
             VE+NSYV GA  N   G IT FP TA RYRRN+CLG KE  PYM PV PG LL+++SP  
Sbjct  630   VEINSYVTGAGVN---GTITEFPFTAARYRRNKCLGSKETLPYMAPVQPGGLLEVVSPAS  686

Query  548   LPPAEAPYPVLTESDV  501
             LPPAEAP PV T++DV
Sbjct  687   LPPAEAPNPVFTDADV  702



>ref|XP_010513618.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like, 
partial [Camelina sativa]
Length=647

 Score =   311 bits (798),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 171/336 (51%), Positives = 221/336 (66%), Gaps = 19/336 (6%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAA-QQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQ---  1263
             QM+ DG PFC+ S+N+ D T      F N A  IPE  + + I +F L W +I++L    
Sbjct  261   QMSSDGTPFCLSSINLEDSTMVTLSPFMNRATIIPEFSSVDGICTFSLTWPEIKNLTPFF  320

Query  1262  ------AQISNPF-AKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYL  1104
                   A ISN + + + +FRNP  +N GK ++L +FL  A N+TS+SGVLI VEN AYL
Sbjct  321   LPSFCAASISNRYQSPYNMFRNPNERNSGKLISLSEFLELAKNSTSLSGVLIRVENTAYL  380

Query  1103  AEKKGLGVTDAVLLALNKADLKT----KKVMIHSNDSSVLMKFT-NSKYERVYGIKEEIS  939
               K+GL V  AVL  L +A         KV+I S DSSVL+ F   SKY+ VY I+E I 
Sbjct  381   RVKQGLDVVKAVLDTLIEAGYNNGKTASKVIIQSTDSSVLLDFKKQSKYKTVYKIQEFIR  440

Query  938   DIQNSTILEIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVS  759
             DI +  I EIK+FA++V+I K SVF    SF  G TNVV +LQ S++ VYV+LF NEFVS
Sbjct  441   DISDYGIEEIKEFANAVVINKDSVFHYSGSFPNGQTNVVERLQKSQLPVYVELFQNEFVS  500

Query  758   QAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPG  579
             Q +DFFSD  +E+N+Y+  A  N   G+IT FP TA RY+RNRC+G KE PPYM PV PG
Sbjct  501   QPYDFFSDATIEINTYISLAGIN---GIITEFPFTAARYKRNRCMGRKETPPYMEPVKPG  557

Query  578   SLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAK  471
             +LL  MSPQ LPPAEAP  ++T++DV+EPPLPPV +
Sbjct  558   ALLAYMSPQSLPPAEAPNLIITDADVIEPPLPPVTE  593



>ref|XP_010415240.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=780

 Score =   313 bits (803),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 165/326 (51%), Positives = 218/326 (67%), Gaps = 9/326 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAA-QQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+ DG PFC+ S+N+ D T      F N A  IPE  + + I++F L W +I++L    
Sbjct  404   QMSSDGTPFCLSSINLKDSTMVTLSPFMNRATIIPEFSSVDGIYTFSLTWPEIKNLTPAT  463

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             S+P+    +FR+P  +N G  ++L + L  A N+TS+SGVLI VEN AYL  ++GL V  
Sbjct  464   SSPYKNDNMFRHPKERNSGNLISLFEVLNLAKNSTSLSGVLINVENTAYLRVEQGLDVVK  523

Query  1073  AVLLALNKADLK----TKKVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTILEI  909
             AVL  L +A       T K +I S DSSVL+ F   SKY+ VY I+E I DI +  I +I
Sbjct  524   AVLDTLIEAGYNNGTTTSKAIIQSTDSSVLLDFKKQSKYKTVYKIQECIRDISDYGIEKI  583

Query  908   KKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPY  729
             K+FA++V+I K+SVFP  DSFL G TNVV +LQ SK+ VYV LF NEFVSQ +DFF+D  
Sbjct  584   KEFANAVVINKASVFPDSDSFLTGQTNVVERLQKSKLPVYVGLFQNEFVSQPYDFFADAT  643

Query  728   VELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQY  549
             VE+N+Y+   S    +G+IT FP TA RY+ NRCLG KE PPYM PV P +LL  MSPQ 
Sbjct  644   VEINTYI---SLVGINGIITEFPFTAARYKTNRCLGRKETPPYMEPVKPRALLAFMSPQS  700

Query  548   LPPAEAPYPVLTESDVVEPPLPPVAK  471
             LPPAEAP  ++T++DV+EPPLPP+ +
Sbjct  701   LPPAEAPNLIITDADVIEPPLPPITE  726


 Score = 55.5 bits (132),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 70/281 (25%), Positives = 130/281 (46%), Gaps = 40/281 (14%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIP--ELKTQNAIHSFDLNWKDIQSLQAQ  1257
             Q+TKDG+  C   +NM + +T    + N   S P   + TQ    +   + +D+Q++   
Sbjct  89    QLTKDGVGICFPDLNMANASTVQNVYPNGQKSYPVNGVSTQ-GWFTIAFSLRDLQNV---  144

Query  1256  ISNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
                  +  R   +   K +G   T+              G+ + V++ A+  E+  L ++
Sbjct  145   -----SLIRGILSRTDKFDGNGYTIPTIQNVTEQIKPQGGLWLHVQHDAFY-EQHNLSMS  198

Query  1076  DAVLLALNKA---DLKT-------KKVMIH--SNDSSVLMKFTNSK-----YERVYGIKE  948
              + L+++++    D  +       KK+  H   N  S + +F   +       R YG   
Sbjct  199   -SFLVSVSRTVSIDFISSPEVNFFKKITGHFKRNGPSFVFQFLGKEDFEPTTNRTYG---  254

Query  947   EISDIQNSTILEIKKFASSVIIGKSSVFPTDDS-FLVGVTNVVAKLQASKVKVYVQLFSN  771
               S + N  +  +K FAS +++ KS +FP DD+ +L+  T++V     + ++VYV  F+N
Sbjct  255   --SILSN--LAFVKTFASKILVPKSYIFPLDDNQYLLPPTSLVQDAHKAGLEVYVSGFAN  310

Query  770   EFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATAN  648
             +    A+++  DP  E  S+V     +  DGVI+ FP TA+
Sbjct  311   D-NDLAYNYSYDPVSEYLSFVDNGDFS-VDGVISDFPMTAS  349



>ref|XP_010675853.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Beta vulgaris subsp. vulgaris]
Length=752

 Score =   310 bits (794),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 161/320 (50%), Positives = 211/320 (66%), Gaps = 7/320 (2%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+KDG+PFC  SVN+++ T   Q QF +L  ++ +++T+  I SF LNW DI+ L   I
Sbjct  391   QMSKDGVPFCSSSVNLMNTTLVGQTQFRSLISTVNDIQTKPGIFSFSLNWTDIKDLTPVI  450

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNPF  + L+RNP A+N GK  +L DFL  A  ATS+SGV I +  A +LA K+GL +TD
Sbjct  451   SNPFPDYSLYRNPEARNAGKIQSLGDFLDLAKKATSLSGVSIRIGRANFLALKEGLSITD  510

Query  1073  AVLLALNKADL---KTKKVMIHSNDSSVLMKFTNSKYERVYGIKEEISDIQNSTILEIKK  903
             AV  AL+KA       +KVMI S +SSVL      KY+ VY + E I    ++ I  IK 
Sbjct  511   AVKDALDKAGYDGPSAEKVMIVSTNSSVLKAMKGKKYKLVYDVDEGIRGAPDNAIANIKS  570

Query  902   FASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVE  723
             FA +VI+ K+S+FP+D  FL+  T+VV +  + K+ VYV++  NEF+SQA+DFFSDP VE
Sbjct  571   FADAVIVSKASIFPSDGGFLIAATDVVKQFHSHKLPVYVRVLRNEFISQAYDFFSDPIVE  630

Query  722   LNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLP  543
             +NSYV GA     DGVIT FP TA +Y+RN CL  K IP YM PV P  L+ LM+P  +P
Sbjct  631   INSYVMGAEV---DGVITDFPKTAAQYKRNSCLKMKNIPAYMSPVQPNQLMALMNPALMP  687

Query  542   PAEAPYPVLTESDVVEPPLP  483
             PA AP P+L  SDV E PLP
Sbjct  688   PASAPQPLLDVSDVSESPLP  707



>ref|XP_010419030.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=772

 Score =   310 bits (793),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 167/327 (51%), Positives = 218/327 (67%), Gaps = 11/327 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+ +G PFC+ S+++ D T  AQ  F N   ++ E+ +   I++F L W +IQ+L   I
Sbjct  407   QMSSNGTPFCLSSIDLGDSTMVAQTPFRNRLTTVSEISSDGGIYTFSLTWPEIQNLTPAI  466

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNP+    + RNP   N    ++L  FL  A N+TS+SGVLI VEN  YL EK+GL V  
Sbjct  467   SNPYRSNSMLRNPNESNSVNLISLCQFLDLAKNSTSLSGVLIIVENVVYLREKQGLDVIR  526

Query  1073  AVLLALNKA---DLKTKKVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTILEIK  906
             AVL  L +    ++ T KVMI S +SSVL++F   SKYE VY I+E ISDI +S I +IK
Sbjct  527   AVLDTLTETGYNNITTTKVMIQSTNSSVLLEFKKQSKYETVYRIEETISDILDSAIQDIK  586

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             KFA++V+IGKSSVFP    F+ G T VV +LQ S+++VYV+LF NEFVSQ  D+F D  V
Sbjct  587   KFANAVVIGKSSVFPATKRFVTGQTAVVERLQKSQLQVYVELFQNEFVSQKLDWFYDATV  646

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLM--SPQ  552
             ELN+Y +GA  N   G IT FP TA +Y+RNRCLG K IPPYM  + PG+LL ++  SP 
Sbjct  647   ELNTYTYGAGIN---GTITEFPFTAAKYKRNRCLGRKVIPPYMSAIQPGNLLNILVSSPA  703

Query  551   YLPPAEAPYPVLTESDVVEPPLPPVAK  471
             + PPA+AP  V T +DV E PLPPVAK
Sbjct  704   F-PPAQAPNLVFTNADVSEAPLPPVAK  729



>emb|CDY46667.1| BnaA03g48410D [Brassica napus]
Length=1323

 Score =   317 bits (812),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 167/316 (53%), Positives = 219/316 (69%), Gaps = 9/316 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM++DG PFC  S+++ + T  AQ  F+  +  +PE+ + + I++F L W +IQSL   I
Sbjct  392   QMSRDGKPFCSHSIDLSNITNIAQTSFAQRSTHVPEISSNDGIYTFSLTWSEIQSLIPAI  451

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNP+  + +FRNP  K  GK + L +FL  A ++TS+SGVLI+VENA YL +K+GL +  
Sbjct  452   SNPYRVYNMFRNPNEKKSGKLILLSEFLKLAKHSTSLSGVLISVENAMYLRQKQGLNMVK  511

Query  1073  AVLLALNKADLKTK----KVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEI  909
             AVL  L +    T+    KVMI S DSSVL++F N SKYE VY +++ ISDI +S I EI
Sbjct  512   AVLDTLTETAYSTRITTTKVMIQSTDSSVLVEFRNQSKYETVYKVEKTISDISDSAIEEI  571

Query  908   KKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPY  729
             K+FAS+V+I K SVFPT   F+ G TNVV +LQ S++ VYV+LF NEFVSQ +DFFSD  
Sbjct  572   KEFASAVVITKVSVFPTFYGFVTGQTNVVERLQKSQLPVYVELFQNEFVSQPYDFFSDAT  631

Query  728   VELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQY  549
             VE+NSYV GA  N   G IT FP TA RYRRN+CLG  E  PYM PV PG LL++++P  
Sbjct  632   VEINSYVTGAGVN---GTITEFPFTAARYRRNKCLGSIETLPYMAPVQPGGLLEVVNPAS  688

Query  548   LPPAEAPYPVLTESDV  501
             LPPAEAP  V T++DV
Sbjct  689   LPPAEAPNSVFTDADV  704



>gb|KHN28414.1| Putative glycerophosphoryl diester phosphodiesterase 2 [Glycine 
soja]
Length=709

 Score =   307 bits (787),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 168/321 (52%), Positives = 224/321 (70%), Gaps = 9/321 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+KDGIPFC+ S+++ + TT A  Q  N A +IPE+K ++ I++F L W +I++L   I
Sbjct  379   QMSKDGIPFCLSSIDLSESTTVADTQLKNRATTIPEIKYRSGIYTFSLTWDEIKTLTPSI  438

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
              NP+ K+ L RNP +KN GK +TL DFL+     T  S +LI++ENAAYLAEK+ L VTD
Sbjct  439   LNPYEKYILSRNPKSKNLGKLITLSDFLSL----TEGSRILISIENAAYLAEKQNLRVTD  494

Query  1073  AVLLALNKADLKTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIKKFA  897
             AVL AL KA  ++ KVMI S  SSVL  F + SK+ERVY + E I    +S I +IK FA
Sbjct  495   AVLDALQKAKPRSHKVMIQSTHSSVLKIFKDKSKFERVYKVDENIGGAADSAIEDIKTFA  554

Query  896   SSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELN  717
              +V+IGK+SVFP   +FLV  TN+VA+L++ K+ V+V+ FSNEFVSQAWD++SDP +E+N
Sbjct  555   DAVVIGKASVFPESSAFLVNFTNIVARLKSFKLPVFVETFSNEFVSQAWDYYSDPSIEIN  614

Query  716   SYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPA  537
             S+V G   N   G+IT FP TANRYRRN CL +    PYM P+ PG L + +S  YLPP 
Sbjct  615   SFVIGTKVN---GIITDFPKTANRYRRNLCLKHGNEAPYMSPIEPGKLFKQISNLYLPPL  671

Query  536   EAPYPVLTESDVVEPPLPPVA  474
               P P+LT+S+V E PLP V+
Sbjct  672   PPPLPILTDSNVTEAPLPGVS  692



>ref|XP_006300798.1| hypothetical protein CARUB_v10019878mg [Capsella rubella]
 gb|EOA33696.1| hypothetical protein CARUB_v10019878mg [Capsella rubella]
Length=678

 Score =   306 bits (785),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 158/300 (53%), Positives = 208/300 (69%), Gaps = 9/300 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+ DGIPFC  S+++ D T   Q  FS  + ++PE+     I++F+L W +IQ+L   I
Sbjct  382   QMSSDGIPFCSSSIDLKDTTMVVQTPFSKRSTTVPEISPNGGIYTFNLTWPEIQNLTPAI  441

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNP+  + + RNP  +N GK M+L  FL  A N+T++SGVLI+V+NAAYL EK+GL V  
Sbjct  442   SNPYKVYDMVRNPEKRNAGKLMSLSQFLGLAKNSTTLSGVLISVDNAAYLREKQGLDVVK  501

Query  1073  AVLLALNKADLK----TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEI  909
             AVL  L ++       T KVMI S +SSVL+ F N SKYE VY I+E I DI +S I +I
Sbjct  502   AVLETLTESGYSNGTTTTKVMIQSTNSSVLVDFKNQSKYETVYRIEETIRDISDSAIEDI  561

Query  908   KKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPY  729
             KKFA++V+I K SVFP  DSFL   TNVV +LQ S++ VYV+LF NEFV+QA+DFF+D  
Sbjct  562   KKFANAVVINKVSVFPNSDSFLSKHTNVVERLQKSQLPVYVELFQNEFVAQAYDFFADAT  621

Query  728   VELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQY  549
             VE+N+Y +GAS N   G IT FP TA RY+RNRCLG  +IP YMLP+ PG LL ++SP +
Sbjct  622   VEINTYTYGASIN---GTITEFPFTAARYKRNRCLGRDKIPQYMLPIQPGGLLDIVSPLF  678



>ref|XP_003553031.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Glycine max]
Length=722

 Score =   307 bits (787),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 168/321 (52%), Positives = 224/321 (70%), Gaps = 9/321 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+KDGIPFC+ S+++ + TT A  Q  N A +IPE+K ++ I++F L W +I++L   I
Sbjct  392   QMSKDGIPFCLSSIDLSESTTVADTQLKNRATTIPEIKYRSGIYTFSLTWDEIKTLTPSI  451

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
              NP+ K+ L RNP +KN GK +TL DFL+     T  S +LI++ENAAYLAEK+ L VTD
Sbjct  452   LNPYEKYILSRNPKSKNLGKLITLSDFLSL----TEGSRILISIENAAYLAEKQNLRVTD  507

Query  1073  AVLLALNKADLKTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIKKFA  897
             AVL AL KA  ++ KVMI S  SSVL  F + SK+ERVY + E I    +S I +IK FA
Sbjct  508   AVLDALQKAKPRSHKVMIQSTHSSVLKIFKDKSKFERVYKVDENIGGAADSAIEDIKTFA  567

Query  896   SSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELN  717
              +V+IGK+SVFP   +FLV  TN+VA+L++ K+ V+V+ FSNEFVSQAWD++SDP +E+N
Sbjct  568   DAVVIGKASVFPESSAFLVNFTNIVARLKSFKLPVFVETFSNEFVSQAWDYYSDPSIEIN  627

Query  716   SYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPA  537
             S+V G   N   G+IT FP TANRYRRN CL +    PYM P+ PG L + +S  YLPP 
Sbjct  628   SFVIGTKVN---GIITDFPKTANRYRRNLCLKHGNEAPYMSPIEPGKLFKQISNLYLPPL  684

Query  536   EAPYPVLTESDVVEPPLPPVA  474
               P P+LT+S+V E PLP V+
Sbjct  685   PPPLPILTDSNVTEAPLPGVS  705



>ref|XP_006300799.1| hypothetical protein CARUB_v10019878mg [Capsella rubella]
 gb|EOA33697.1| hypothetical protein CARUB_v10019878mg [Capsella rubella]
Length=701

 Score =   306 bits (785),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 158/300 (53%), Positives = 208/300 (69%), Gaps = 9/300 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+ DGIPFC  S+++ D T   Q  FS  + ++PE+     I++F+L W +IQ+L   I
Sbjct  405   QMSSDGIPFCSSSIDLKDTTMVVQTPFSKRSTTVPEISPNGGIYTFNLTWPEIQNLTPAI  464

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNP+  + + RNP  +N GK M+L  FL  A N+T++SGVLI+V+NAAYL EK+GL V  
Sbjct  465   SNPYKVYDMVRNPEKRNAGKLMSLSQFLGLAKNSTTLSGVLISVDNAAYLREKQGLDVVK  524

Query  1073  AVLLALNKADLK----TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEI  909
             AVL  L ++       T KVMI S +SSVL+ F N SKYE VY I+E I DI +S I +I
Sbjct  525   AVLETLTESGYSNGTTTTKVMIQSTNSSVLVDFKNQSKYETVYRIEETIRDISDSAIEDI  584

Query  908   KKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPY  729
             KKFA++V+I K SVFP  DSFL   TNVV +LQ S++ VYV+LF NEFV+QA+DFF+D  
Sbjct  585   KKFANAVVINKVSVFPNSDSFLSKHTNVVERLQKSQLPVYVELFQNEFVAQAYDFFADAT  644

Query  728   VELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQY  549
             VE+N+Y +GAS N   G IT FP TA RY+RNRCLG  +IP YMLP+ PG LL ++SP +
Sbjct  645   VEINTYTYGASIN---GTITEFPFTAARYKRNRCLGRDKIPQYMLPIQPGGLLDIVSPLF  701



>ref|XP_010252664.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Nelumbo nucifera]
Length=756

 Score =   307 bits (787),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 162/326 (50%), Positives = 220/326 (67%), Gaps = 12/326 (4%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QMT+DG+P C+GS+N++D T   Q  F +   +I +++    I +F+L W +I++L+  I
Sbjct  394   QMTQDGVPICLGSINLMDNTNVIQTNFLSRLTTIQQIQPNPGIFTFNLTWDEIKTLKPSI  453

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             +NPF    L+RNP  K  G   +L+DFL FA        VLI++ENA YLA+  GL +TD
Sbjct  454   ANPFIGSYLYRNPAYKYTGNIFSLEDFLAFAKGKPL--SVLISIENATYLAKSLGLSITD  511

Query  1073  AVLLALNKA--DLKTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIKK  903
             AV+ ALN +  +   +KVMI S++SSVL+KF   + Y+ VY + E+I D  +S+I++IK+
Sbjct  512   AVIDALNHSGYNQTKQKVMIQSSNSSVLIKFKEKTNYQLVYKVDEDIRDADDSSIMDIKQ  571

Query  902   FASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVE  723
             FA SV I K+SVFPT+  FL G TN+V+KL +S + VYV +F NE++SQAWDF+SDP  E
Sbjct  572   FAHSVAITKNSVFPTNKLFLTGATNIVSKLHSSNLTVYVHVFHNEYLSQAWDFWSDPNFE  631

Query  722   LNSYVFGASANPFDGVITGFPATANRYRRNRCL--GYKEIPPYMLPVGPGSLLQLMSPQY  549
             +N++V GA     DG+IT FP TAN YR NRCL  G ++ P YM PV P  LL L +P  
Sbjct  632   INNFVMGAR---IDGIITDFPGTANAYRNNRCLKMGNRK-PRYMNPVLPNGLLSLGNPAL  687

Query  548   LPPAEAPYPVLTESDVVEPPLPPVAK  471
             LP  EAP PVLTESDV EPPLP V K
Sbjct  688   LPSVEAPNPVLTESDVAEPPLPSVTK  713



>gb|KHM99502.1| Putative glycerophosphoryl diester phosphodiesterase 2 [Glycine 
soja]
Length=727

 Score =   306 bits (784),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 170/321 (53%), Positives = 222/321 (69%), Gaps = 9/321 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+KDGIPFC+ S+++++ TT A  QF N A +I E+K ++ I++F L W +I++L   I
Sbjct  392   QMSKDGIPFCLSSIDLLESTTVADTQFKNRATTILEIKFRSGIYTFSLTWDEIKTLTPSI  451

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
              NP+ K+ L RNP +KN GK +TL DFL+        S +LI++ENAAYLAEK+ L VTD
Sbjct  452   LNPYEKYILSRNPKSKNLGKLITLSDFLSLNEG----SHILISIENAAYLAEKQNLHVTD  507

Query  1073  AVLLALNKADLKTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIKKFA  897
             AVL AL KA  ++ KVMI S  SSVL  F + SK+ERVY + E I D  +S I +IK FA
Sbjct  508   AVLDALQKAKPRSHKVMIQSTHSSVLKIFKDKSKFERVYKVDENIRDAADSAIEDIKTFA  567

Query  896   SSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELN  717
              SV+IGK+SVFP   +FLV  TN VA+L++ K+ VYV+ FSNEFVSQAWD++SDP +E+N
Sbjct  568   DSVVIGKASVFPESSAFLVNSTNTVARLKSFKLPVYVETFSNEFVSQAWDYYSDPSIEIN  627

Query  716   SYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPA  537
             S+V G   N   G+IT FP TANRYRRN CL      PY  P+ PG L + +S  YLPP 
Sbjct  628   SFVIGTKVN---GIITDFPKTANRYRRNLCLKNGNKEPYRSPIEPGKLFKQISNLYLPPL  684

Query  536   EAPYPVLTESDVVEPPLPPVA  474
               P PVLT+S+V E PLP V+
Sbjct  685   PPPLPVLTDSNVTEAPLPGVS  705



>ref|XP_003530776.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Glycine max]
Length=727

 Score =   306 bits (783),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 170/321 (53%), Positives = 222/321 (69%), Gaps = 9/321 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+KDGIPFC+ S+++++ TT A  QF N A +I E+K ++ I++F L W +I++L   I
Sbjct  392   QMSKDGIPFCLSSIDLLESTTVADTQFKNRATTILEIKFRSGIYTFSLTWDEIKTLTPSI  451

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
              NP+ K+ L RNP +KN GK +TL DFL+        S +LI++ENAAYLAEK+ L VTD
Sbjct  452   LNPYEKYILSRNPKSKNLGKLITLSDFLSLNEG----SHILISIENAAYLAEKQNLHVTD  507

Query  1073  AVLLALNKADLKTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIKKFA  897
             AVL AL KA  ++ KVMI S  SSVL  F + SK+ERVY + E I D  +S I +IK FA
Sbjct  508   AVLDALQKAKPRSHKVMIQSTHSSVLKIFKDKSKFERVYKVDENIRDAADSAIEDIKTFA  567

Query  896   SSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELN  717
              SV+IGK+SVFP   +FLV  TN VA+L++ K+ VYV+ FSNEFVSQAWD++SDP +E+N
Sbjct  568   DSVVIGKASVFPESSAFLVNSTNTVARLKSFKLPVYVETFSNEFVSQAWDYYSDPSIEIN  627

Query  716   SYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPA  537
             S+V G   N   G+IT FP TANRYRRN CL      PY  P+ PG L + +S  YLPP 
Sbjct  628   SFVIGTKVN---GIITDFPKTANRYRRNLCLKNGNKEPYRSPIEPGKLFKQISNLYLPPL  684

Query  536   EAPYPVLTESDVVEPPLPPVA  474
               P PVLT+S+V E PLP V+
Sbjct  685   PPPLPVLTDSNVTEAPLPGVS  705



>ref|XP_007146558.1| hypothetical protein PHAVU_006G050600g [Phaseolus vulgaris]
 gb|ESW18552.1| hypothetical protein PHAVU_006G050600g [Phaseolus vulgaris]
Length=762

 Score =   306 bits (784),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 167/328 (51%), Positives = 215/328 (66%), Gaps = 10/328 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+KDGIPFC  S+++I  T  A+  FSNL+ SIPE++  + I +FDL W DI+SL   +
Sbjct  397   QMSKDGIPFCFNSIDLIKSTNVAKSSFSNLSKSIPEIQAGDGIFAFDLAWNDIKSLSLSM  456

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
              N F++F L+RNP    +   +TL +FL F    TS+ GV+I +E A YLA ++ L V D
Sbjct  457   LNLFSEFNLYRNPKFNEKVSLLTLSEFLNFTQGHTSLLGVVIIIEKAPYLAREQNLSVID  516

Query  1073  AVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
             AV   L+KA      T  VMI S+DSSVL+KF   +KYE VY I E +SDI +S + +IK
Sbjct  517   AVSDTLSKAGYDKTGTPNVMIQSSDSSVLLKFKEKTKYELVYSIPEIVSDIVDSALSDIK  576

Query  905   KFASSVIIGKSSVFPTDDSFLV-GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPY  729
              FA SV++ + SV+P +  F V G T  V+K ++  + VYVQ F NEFVSQAWDF SD  
Sbjct  577   TFAHSVVVVRDSVYPRNALFFVTGSTKTVSKFKSVNLSVYVQTFHNEFVSQAWDFLSDAT  636

Query  728   VELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMSPQ  552
             V++N++V  A     DGVITGFP TANRYRRNRCL   +  PPYM PV  G L QL+   
Sbjct  637   VQINTFVQDAG---IDGVITGFPQTANRYRRNRCLNLGDSTPPYMRPVEIGGLFQLVDKS  693

Query  551   YLPPAEAPYPVLTESDVVEPPLPPVAKI  468
              LPPA AP P LTE+DV EPPL P +KI
Sbjct  694   SLPPAMAPAPSLTEADVTEPPLAPFSKI  721



>gb|KCW70260.1| hypothetical protein EUGRSUZ_F03515 [Eucalyptus grandis]
Length=574

 Score =   300 bits (769),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 154/274 (56%), Positives = 198/274 (72%), Gaps = 8/274 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTT-AAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+KDGIPFC+ S N+ID +  A  +F NL  + PE+++   I SF LNW DIQ+L   I
Sbjct  278   QMSKDGIPFCLSSANLIDSSNVATTKFRNLMTTAPEIQSGTGIFSFSLNWSDIQTLTPAI  337

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             ++P+++F++FRNP  KN GKF++L +FL    N+ SVSGVLI +ENAAYLAEK+ L VTD
Sbjct  338   ASPYSQFKIFRNPANKNAGKFLSLSEFLVLVKNS-SVSGVLIGIENAAYLAEKQSLSVTD  396

Query  1073  AVLLALNKADL--KTKKVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTILEIKK  903
             AVL AL+KA    +T+KVMI S +SSVLM    N+ Y+ VY + E I D  N T+L+IKK
Sbjct  397   AVLAALSKAGFSNQTEKVMIKSTNSSVLMNIKENANYKLVYEVDENIRDANNDTVLDIKK  456

Query  902   FASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVE  723
             FA SV++ K+SVFP +  FL G+T+VV KL A K+ VYVQ FSNEFVSQAWDFFSD  VE
Sbjct  457   FADSVVVMKNSVFPENQFFLTGITDVVTKLHAFKLPVYVQTFSNEFVSQAWDFFSDATVE  516

Query  722   LNSYVFGASANPFDGVITGFPATANRYRRNRCLG  621
             +NS+V G      DGVIT FP T+  Y+RN+CLG
Sbjct  517   VNSFVVGGDV---DGVITDFPKTSASYKRNKCLG  547



>ref|XP_008345038.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Malus domestica]
Length=339

 Score =   291 bits (746),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 152/276 (55%), Positives = 198/276 (72%), Gaps = 8/276 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             Q++KDGIPFC  S+N+ID TT AQ  FS+L   +PE+K  + I++F L WKDI+ L   I
Sbjct  61    QISKDGIPFCASSINLIDSTTVAQSPFSDLTXVVPEIKAGSGIYTFSLTWKDIEGLTPTI  120

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNP++K+ L RNP++K  GK++TL DFL  A  ++S+SGVLI +E AAYLAEK+ L +TD
Sbjct  121   SNPWSKYTLXRNPMSKTGGKYLTLSDFLALAKRSSSLSGVLIGIEYAAYLAEKQKLSITD  180

Query  1073  AVLLALNKADLKTK---KVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
             AV+  L+KA    +    V I S +SSVLMKF   + YE VY I+EEI D  +STI  IK
Sbjct  181   AVMNTLSKAGFDNQTALDVKIQSTNSSVLMKFKEKTSYELVYKIEEEIGDAPSSTIEGIK  240

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             KFA SV+I K+S+FP  ++F+ GVT+VV+KLQ +K+ VYV+LFSNEFVSQ WDFFSDP V
Sbjct  241   KFADSVVINKASIFPEVEAFITGVTDVVSKLQDAKLPVYVELFSNEFVSQPWDFFSDPTV  300

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY  618
             E+NS+V G +    DGVIT FP TA RY+    L Y
Sbjct  301   EINSFVSGVN---IDGVITDFPKTAARYKSKCVLVY  333



>ref|XP_009399679.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Musa acuminata subsp. malaccensis]
Length=772

 Score =   302 bits (773),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 165/327 (50%), Positives = 218/327 (67%), Gaps = 13/327 (4%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQ-SLQAQ  1257
             Q+TKDGI  CM S+N+++ TT     FS+L   IPE+     I +F+L W++IQ +L+  
Sbjct  409   QVTKDGILICMSSINLMEVTTVTTSPFSSLLSVIPEIHDGPGIFTFNLTWEEIQKNLKPA  468

Query  1256  ISNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
             ISNP  ++ ++RNP+ KN+G FM+L DFL F  +   +SG+LI++ENAA+LAEK G  VT
Sbjct  469   ISNPEIQYNIYRNPLYKNDGNFMSLGDFLAFGRDK-DLSGILISIENAAFLAEKLGYSVT  527

Query  1076  DAVLLALNKADLKTK---KVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTILEI  909
             D V+ AL  +    +   +VMI S +SSVL+KF   +KYE VY + E ISD+ NS+I++I
Sbjct  528   DGVMRALQDSGYSNQTGQEVMILSKNSSVLIKFRQQTKYELVYMVDESISDMVNSSIMDI  587

Query  908   KKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPY  729
             K+FA  + I K SV+P    F+ G T +V KLQ++   VYV LF NEFVSQ WDF SDP 
Sbjct  588   KQFAHMIAISKQSVYPVSQQFITGQTKLVQKLQSAGFAVYVYLFRNEFVSQPWDFLSDPT  647

Query  728   VELNSYVFGASANPFDGVITGFPATANRYRRNRC--LGYKEIPPYMLPVGPGSLLQLMSP  555
             VE+N YV GA+    DG+IT +P TA  YRRN C  LG  + P YM PV  G LLQ+M P
Sbjct  648   VEINMYVQGAAV---DGIITEYPGTAAAYRRNTCSKLG-DQAPSYMSPVPIGGLLQIMDP  703

Query  554   QYLPPAEAPYPVLTESDVVEPPLPPVA  474
             Q LPP  AP P L  +DVVEPPLP V+
Sbjct  704   QALPPTLAPMPSLHAADVVEPPLPAVS  730



>ref|XP_007146552.1| hypothetical protein PHAVU_006G050300g [Phaseolus vulgaris]
 gb|ESW18546.1| hypothetical protein PHAVU_006G050300g [Phaseolus vulgaris]
Length=714

 Score =   300 bits (769),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 163/320 (51%), Positives = 212/320 (66%), Gaps = 8/320 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+KDG PFC+ S+++ + TT A   F   + +I E+K  + I++F L W +I++L   I
Sbjct  396   QMSKDGTPFCLSSIDLSESTTVADTNFKTRSTTIQEIKNSSGIYTFSLTWDEIKTLTPSI  455

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
               P+ K+ L RNP  KN+GK +TL  FL+     T  S +LI++ENAAYLAEK+ L V +
Sbjct  456   LKPYGKYSLIRNPKLKNQGKLITLSKFLSL----TKGSLILISIENAAYLAEKQNLSVIN  511

Query  1073  AVLLALNKADLKTKKVMIHSNDSSVLMKFTNSKYERVYGIKEEISDIQNSTILEIKKFAS  894
             AVL ALNK    + KVMI S  SSVL  F  SK+ERVY + E I D   S I +IK FA 
Sbjct  512   AVLDALNKTKPTSYKVMIQSTHSSVLKIFDKSKFERVYKVDENIGDAAVSAIKDIKTFAD  571

Query  893   SVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNS  714
             SV+IGK SVFP   +FLV  TN+VAKL++ K++VYV+ FSNEFVSQAWD++SD  +E+NS
Sbjct  572   SVVIGKKSVFPETSAFLVNSTNIVAKLKSFKLRVYVETFSNEFVSQAWDYYSDASIEINS  631

Query  713   YVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAE  534
             +V G   N   G+IT FP TANRYRRN CL      PYM P+ PG L Q +S  +LPP  
Sbjct  632   FVIGTKVN---GIITDFPKTANRYRRNLCLKNVNKAPYMSPIEPGKLYQQISDFFLPPLP  688

Query  533   APYPVLTESDVVEPPLPPVA  474
              P PVL +S+V E PLP V+
Sbjct  689   PPPPVLIDSNVTEAPLPSVS  708



>gb|AES70468.2| glycerophosphoryl diester phosphodiesterase family protein [Medicago 
truncatula]
Length=717

 Score =   300 bits (767),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 165/324 (51%), Positives = 221/324 (68%), Gaps = 12/324 (4%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             Q++KDG+PFC+ S+++   TT A  +F N    IPE++  + I++F L W +I++L   I
Sbjct  391   QLSKDGVPFCLSSIDLSTSTTVADTKFRNRTAIIPEIQNGSGIYTFSLTWNEIKTLTPSI  450

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
               P+AK+ LFRNP  KN+GKF+TL DFL+ A      S VLI++ENAAYLA K+GL VT 
Sbjct  451   LKPYAKYTLFRNPKFKNQGKFVTLSDFLSLAKG----SRVLISIENAAYLASKRGLSVTK  506

Query  1073  AVLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
             +VL AL KA     K++K+MI S  SSVL  F + SKYERVY + E I D  +  I +IK
Sbjct  507   SVLNALQKAGYDKQKSRKIMIQSTHSSVLKIFKDKSKYERVYKVDENIHDADDKAIKDIK  566

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
              FA SV++ K+SVF  + +FLV  TN VA+LQ+ K+ VYV+ FSNEFVSQAWD++SDP V
Sbjct  567   TFADSVVLQKASVFTQNLAFLVNSTNTVARLQSFKLPVYVETFSNEFVSQAWDYYSDPSV  626

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYL  546
             E+NS+V GA  N   G+IT FP TA RY +NRCL + +  PY+ P+ PG LL+ +    L
Sbjct  627   EINSFVVGAKVN---GIITDFPKTAVRYTKNRCLKHAKKAPYISPIPPGKLLKHIPKLDL  683

Query  545   PPAEAPYPVLTESDVVEPPLPPVA  474
             PP   P PVL +S+V EPPLP V+
Sbjct  684   PPPTPPLPVLNDSNVTEPPLPSVS  707



>gb|KHM99500.1| Putative glycerophosphoryl diester phosphodiesterase 1 [Glycine 
soja]
Length=761

 Score =   300 bits (769),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 171/327 (52%), Positives = 219/327 (67%), Gaps = 9/327 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+K GIPFC+ S+++I+ T  AQ  FS L   IPE+K+ N I +FDL W DI++L   +
Sbjct  397   QMSKGGIPFCLSSIDLIESTNVAQSNFSKLGKIIPEIKSGNGIFTFDLAWDDIKTLTPSM  456

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
              NP++   L+RNP    +G F+TL DFL      TS+ GV+IT+ENAAYLA K+ L VT+
Sbjct  457   LNPYSINSLYRNPKYNKKGHFLTLSDFLNLPKGQTSLLGVVITIENAAYLARKQNLSVTE  516

Query  1073  AVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
             AV+  L+KA        KVMI S +SSVL+KF   +KYE VY I E + D  +S IL+IK
Sbjct  517   AVIDTLSKAGYDKPGAPKVMIQSTNSSVLLKFKEKTKYELVYKIDEIVGDAVDSAILDIK  576

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             +FA SV++ K+SV+P    F+ G T +V K ++S + VYV+ F NEFVSQAWDF SD  V
Sbjct  577   RFAHSVVVKKASVYPVSKFFVTGSTKIVPKFKSSNLSVYVETFRNEFVSQAWDFMSDATV  636

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEI-PPYMLPVGPGSLLQLMSPQY  549
             E+N++V  A     DGVIT FP TANRYRRNRCL   +  PPYM PV  GSLL  M    
Sbjct  637   EINTFVQDAE---IDGVITDFPKTANRYRRNRCLSLGDSKPPYMEPVRVGSLLLAMDKYS  693

Query  548   LPPAEAPYPVLTESDVVEPPLPPVAKI  468
             LPPA AP P LTE+ V EPPLPP++KI
Sbjct  694   LPPALAPAPPLTEAKVTEPPLPPLSKI  720



>ref|XP_003600217.1| Glycerophosphodiesterase-like protein [Medicago truncatula]
Length=740

 Score =   299 bits (766),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 165/324 (51%), Positives = 221/324 (68%), Gaps = 12/324 (4%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             Q++KDG+PFC+ S+++   TT A  +F N    IPE++  + I++F L W +I++L   I
Sbjct  414   QLSKDGVPFCLSSIDLSTSTTVADTKFRNRTAIIPEIQNGSGIYTFSLTWNEIKTLTPSI  473

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
               P+AK+ LFRNP  KN+GKF+TL DFL+ A      S VLI++ENAAYLA K+GL VT 
Sbjct  474   LKPYAKYTLFRNPKFKNQGKFVTLSDFLSLAKG----SRVLISIENAAYLASKRGLSVTK  529

Query  1073  AVLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
             +VL AL KA     K++K+MI S  SSVL  F + SKYERVY + E I D  +  I +IK
Sbjct  530   SVLNALQKAGYDKQKSRKIMIQSTHSSVLKIFKDKSKYERVYKVDENIHDADDKAIKDIK  589

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
              FA SV++ K+SVF  + +FLV  TN VA+LQ+ K+ VYV+ FSNEFVSQAWD++SDP V
Sbjct  590   TFADSVVLQKASVFTQNLAFLVNSTNTVARLQSFKLPVYVETFSNEFVSQAWDYYSDPSV  649

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYL  546
             E+NS+V GA  N   G+IT FP TA RY +NRCL + +  PY+ P+ PG LL+ +    L
Sbjct  650   EINSFVVGAKVN---GIITDFPKTAVRYTKNRCLKHAKKAPYISPIPPGKLLKHIPKLDL  706

Query  545   PPAEAPYPVLTESDVVEPPLPPVA  474
             PP   P PVL +S+V EPPLP V+
Sbjct  707   PPPTPPLPVLNDSNVTEPPLPSVS  730



>ref|XP_007146559.1| hypothetical protein PHAVU_006G050800g [Phaseolus vulgaris]
 gb|ESW18553.1| hypothetical protein PHAVU_006G050800g [Phaseolus vulgaris]
Length=765

 Score =   300 bits (767),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 168/327 (51%), Positives = 217/327 (66%), Gaps = 9/327 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+KDGIPFC+ S+++I+ T  AQ  FS L  +IPE+K+ N I +FDL W DI+SL   +
Sbjct  401   QMSKDGIPFCLSSIDLIESTNVAQSSFSRLGKTIPEIKSGNGIFTFDLAWNDIKSLSPLM  460

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
              NP +   L+RNP    +G+++TL DFL      TS   V+I +ENAAYLA K+ L VTD
Sbjct  461   LNPHSMNNLYRNPEYNKKGQYLTLSDFLNLTKAHTSTLSVVIIIENAAYLARKQNLSVTD  520

Query  1073  AVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
             AV+  L++A        KVMI S +SSVL+KF   +KYE VY I E +    +S I  IK
Sbjct  521   AVIDTLSRAGYDKPGAPKVMIQSTNSSVLLKFKEKAKYELVYKIDEIVGGAVDSAISNIK  580

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             +FA SV++ K+SV+P  + F +G T +V+K ++S + VYV+ FSNEFVSQ WDF SD YV
Sbjct  581   RFAHSVVVKKASVYPVSELFAIGSTKIVSKFKSSNLSVYVETFSNEFVSQDWDFMSDAYV  640

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMSPQY  549
             E+N++V  A     DGVIT FP TANRYRRN+CL   E  P YM PV  G LLQ M    
Sbjct  641   EINTFVQDAE---IDGVITDFPKTANRYRRNKCLNLGEKTPAYMEPVAVGGLLQAMDKSL  697

Query  548   LPPAEAPYPVLTESDVVEPPLPPVAKI  468
             LPPA AP P LTE +V EPPLPP++KI
Sbjct  698   LPPAMAPAPPLTEDEVTEPPLPPLSKI  724



>ref|XP_003530777.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Glycine max]
Length=761

 Score =   298 bits (764),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 170/326 (52%), Positives = 218/326 (67%), Gaps = 9/326 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+K GIPFC+ S+++I+ T  AQ  FS L   IPE+K+ N I +FDL W DI++L   +
Sbjct  397   QMSKGGIPFCLSSIDLIESTNVAQSNFSKLGKIIPEIKSGNGIFTFDLAWDDIKTLTPSM  456

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
              NP++   L+RNP    +G F+TL DFL      TS+ GV+IT+ENAAYLA K+ L VT+
Sbjct  457   LNPYSINSLYRNPKYNKKGHFLTLSDFLNLPKGQTSLLGVVITIENAAYLARKQNLSVTE  516

Query  1073  AVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
             AV+  L+KA        KVMI S +SSVL+KF   +KYE VY I E + D  +S IL+IK
Sbjct  517   AVIDTLSKAGYDKPGAPKVMIQSTNSSVLLKFKEKTKYELVYKIDEIVGDAVDSAILDIK  576

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             +FA SV++ K+SV+P    F+ G T +V K ++S + VYV+ F NEFVSQAWDF SD  V
Sbjct  577   RFAHSVVVKKASVYPVSKFFVTGSTKIVPKFKSSNLSVYVETFRNEFVSQAWDFMSDATV  636

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEI-PPYMLPVGPGSLLQLMSPQY  549
             E+N++V  A     DGVIT FP TANRYRRNRCL   +  PPYM PV  GSLL  M    
Sbjct  637   EINTFVQDAE---IDGVITDFPKTANRYRRNRCLSLGDSKPPYMEPVRVGSLLLAMDKYS  693

Query  548   LPPAEAPYPVLTESDVVEPPLPPVAK  471
             LPPA AP P LTE+ V EPPLPP++K
Sbjct  694   LPPALAPAPPLTEAKVTEPPLPPLSK  719



>ref|XP_010928867.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Elaeis guineensis]
Length=767

 Score =   296 bits (758),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 167/327 (51%), Positives = 219/327 (67%), Gaps = 13/327 (4%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTT-AAQQFSNLAVSIPELKTQNAIHSFDLNWKDI-QSLQAQ  1257
             Q+T+DG   CM S+N+ID TT     FS+ +  IPE++    I +F+L W+DI ++L+  
Sbjct  402   QVTQDGTLICMSSINLIDVTTVTGSPFSSHSSVIPEIQDGPGIFTFNLTWEDISKNLKPT  461

Query  1256  ISNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
             IS+P  K+RL+RNP  KN G FM L DFL FA +  ++SGVLI++ENAA+LAEK G  VT
Sbjct  462   ISSPEIKYRLYRNPRYKNAGNFMRLSDFLDFAKDK-ALSGVLISIENAAFLAEKLGYSVT  520

Query  1076  DAVLLALNKA---DLKTKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTILEI  909
             D V+ AL  +   +   ++VMI S+ SSVL+KF   +KY+ +Y + E I D   S+I++I
Sbjct  521   DGVIKALKDSGYNNQTVQEVMIQSSYSSVLVKFKQQTKYKLLYVVDESIRDAAPSSIVDI  580

Query  908   KKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPY  729
             K+FA SV + K S+FP    F+VG T +V  L+++ + V+V L  NEFVSQ WDFFSDP 
Sbjct  581   KQFAHSVAVSKQSIFPESQQFVVGQTELVKNLKSAGLNVHVYLLMNEFVSQPWDFFSDPI  640

Query  728   VELNSYVFGASANPFDGVITGFPATANRYRRNRC--LGYKEIPPYMLPVGPGSLLQLMSP  555
             VE+N YV GA A   DG+IT FP TA  YRRN C  LG K  P YMLPV  G LL+LM P
Sbjct  641   VEINQYVQGAGA---DGIITDFPGTATAYRRNACSKLGDKA-PNYMLPVQVGGLLELMVP  696

Query  554   QYLPPAEAPYPVLTESDVVEPPLPPVA  474
               LPPA +P PVL  SDVVEPPL P +
Sbjct  697   DALPPALSPMPVLEVSDVVEPPLMPAS  723



>ref|XP_008798764.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 isoform X2 [Phoenix dactylifera]
Length=651

 Score =   293 bits (749),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 164/328 (50%), Positives = 218/328 (66%), Gaps = 13/328 (4%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDI-QSLQAQ  1257
             QMT+DG   CM S+N+ID TT     FS+    IPE++    I +F+L W++I ++L++ 
Sbjct  291   QMTQDGTLVCMSSLNLIDVTTVTTSPFSSRFSVIPEIQGVPGIFAFNLTWEEISKNLKST  350

Query  1256  ISNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
             IS+P   ++L+RNP  KN G FM L DFL FA +  ++SGVLI++ENAA+LAEK G  VT
Sbjct  351   ISSPDVDYQLYRNPRYKNAGNFMKLSDFLDFAKDK-ALSGVLISIENAAFLAEKLGYSVT  409

Query  1076  DAVLLALNKA---DLKTKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTILEI  909
             D V+ AL  +   +   ++VMI S++SSVL+KF   +KY+ VY I E ISD   S+I +I
Sbjct  410   DGVIKALKDSGYDNQTVQEVMIQSSNSSVLVKFRQQTKYQLVYMIDESISDAAPSSIADI  469

Query  908   KKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPY  729
             K+FA SV + K S+FP    F++G T +V KL+++ + VYV L  NEFVSQ WDF SDP 
Sbjct  470   KQFAHSVAVSKQSIFPESLKFVIGQTELVKKLKSAGLNVYVYLLRNEFVSQPWDFLSDPT  529

Query  728   VELNSYVFGASANPFDGVITGFPATANRYRRNRC--LGYKEIPPYMLPVGPGSLLQLMSP  555
              E+N YV  A     DG+IT FP TA  Y+RN C  LG K  P YM+PV  G LL LM+P
Sbjct  530   AEINQYVQDAGV---DGIITDFPGTATAYKRNACSKLGDKA-PKYMVPVHVGDLLGLMAP  585

Query  554   QYLPPAEAPYPVLTESDVVEPPLPPVAK  471
             + LPPA AP PVL  SDV EPPLPP ++
Sbjct  586   ESLPPALAPMPVLEVSDVAEPPLPPASR  613



>ref|XP_010913957.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
isoform X2 [Elaeis guineensis]
Length=728

 Score =   294 bits (753),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 165/328 (50%), Positives = 220/328 (67%), Gaps = 13/328 (4%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDI-QSLQAQ  1257
             QMT+DG   CM S+N+ID TT     FS+ +  IPE++    I +F+L W++I ++L+  
Sbjct  366   QMTQDGTLICMSSINLIDVTTVTTSPFSSRSSVIPEIQGGPGIFTFNLTWEEISKNLKPT  425

Query  1256  ISNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
             IS+P  +++L+RNP  KN G FM L DFL FA +  ++SGVLI++ENAA+LAEK G  VT
Sbjct  426   ISSPEVEYQLYRNPRYKNGGNFMKLSDFLDFAKDK-ALSGVLISIENAAFLAEKLGYSVT  484

Query  1076  DAVLLALNKA---DLKTKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTILEI  909
             D V+ AL  +   +   ++V I S++SSVL+KF   +KY+ +Y + E ISD   S+I +I
Sbjct  485   DGVIKALKDSGYSNQTVQEVTIQSSNSSVLVKFRQQTKYKLLYMVDESISDAAPSSIADI  544

Query  908   KKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPY  729
             K+FA SV + K S+FP    F+VG T +V  L+++ + VYV L  NEFVSQ WDF SDP 
Sbjct  545   KQFAHSVAVSKQSIFPETWKFVVGQTELVKTLKSAGLNVYVYLLRNEFVSQPWDFLSDPT  604

Query  728   VELNSYVFGASANPFDGVITGFPATANRYRRNRC--LGYKEIPPYMLPVGPGSLLQLMSP  555
             VE+N YV GA     DG+IT FP TA  Y+RN C  LG K  P YMLPV  G LL LM+P
Sbjct  605   VEINQYVQGAGV---DGIITDFPGTATVYKRNACSKLGDKA-PTYMLPVQVGDLLGLMAP  660

Query  554   QYLPPAEAPYPVLTESDVVEPPLPPVAK  471
             + LPPA AP PVL  SDVVEPPLPP ++
Sbjct  661   EALPPALAPMPVLEVSDVVEPPLPPASQ  688



>ref|XP_010913956.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
isoform X1 [Elaeis guineensis]
Length=763

 Score =   294 bits (753),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 165/328 (50%), Positives = 220/328 (67%), Gaps = 13/328 (4%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDI-QSLQAQ  1257
             QMT+DG   CM S+N+ID TT     FS+ +  IPE++    I +F+L W++I ++L+  
Sbjct  401   QMTQDGTLICMSSINLIDVTTVTTSPFSSRSSVIPEIQGGPGIFTFNLTWEEISKNLKPT  460

Query  1256  ISNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
             IS+P  +++L+RNP  KN G FM L DFL FA +  ++SGVLI++ENAA+LAEK G  VT
Sbjct  461   ISSPEVEYQLYRNPRYKNGGNFMKLSDFLDFAKDK-ALSGVLISIENAAFLAEKLGYSVT  519

Query  1076  DAVLLALNKA---DLKTKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTILEI  909
             D V+ AL  +   +   ++V I S++SSVL+KF   +KY+ +Y + E ISD   S+I +I
Sbjct  520   DGVIKALKDSGYSNQTVQEVTIQSSNSSVLVKFRQQTKYKLLYMVDESISDAAPSSIADI  579

Query  908   KKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPY  729
             K+FA SV + K S+FP    F+VG T +V  L+++ + VYV L  NEFVSQ WDF SDP 
Sbjct  580   KQFAHSVAVSKQSIFPETWKFVVGQTELVKTLKSAGLNVYVYLLRNEFVSQPWDFLSDPT  639

Query  728   VELNSYVFGASANPFDGVITGFPATANRYRRNRC--LGYKEIPPYMLPVGPGSLLQLMSP  555
             VE+N YV GA     DG+IT FP TA  Y+RN C  LG K  P YMLPV  G LL LM+P
Sbjct  640   VEINQYVQGAGV---DGIITDFPGTATVYKRNACSKLGDKA-PTYMLPVQVGDLLGLMAP  695

Query  554   QYLPPAEAPYPVLTESDVVEPPLPPVAK  471
             + LPPA AP PVL  SDVVEPPLPP ++
Sbjct  696   EALPPALAPMPVLEVSDVVEPPLPPASQ  723



>ref|XP_003530778.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like isoform X1 [Glycine max]
Length=761

 Score =   294 bits (752),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 169/327 (52%), Positives = 219/327 (67%), Gaps = 9/327 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAA-QQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+KDGIPFC+ S+++I+ T  A   FS L   IPE+K+ N I +FDL W DI+SL   +
Sbjct  396   QMSKDGIPFCLSSIDLIESTDVALSSFSKLGKIIPEIKSGNGIFTFDLAWDDIKSLAPSM  455

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
              NP++   L+RNP +  +G+F+TL DFL      TS+ GV+I +ENAAYLA K+ L VT+
Sbjct  456   LNPYSTSSLYRNPKSNKKGQFLTLLDFLNLTKAQTSLLGVVIIIENAAYLARKQNLSVTE  515

Query  1073  AVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
             AV+  L+KA        KVMI S +SSVL+KF   +KYE VY I E I D  +S I +IK
Sbjct  516   AVIDTLSKAGYDKPGAPKVMIQSTNSSVLLKFKEKTKYELVYKIDEIIRDAVDSAISDIK  575

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             +FA SV++ K+SV+P    F+ G T +V K ++S + VYV+ FSNEFVSQAWDF SD  V
Sbjct  576   RFAHSVVVKKASVYPDRKQFVTGSTKIVPKFKSSNLTVYVETFSNEFVSQAWDFMSDATV  635

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEI-PPYMLPVGPGSLLQLMSPQY  549
             E+N++V  A     DGVIT FP TANRYRRNRCL   +  PPYM PV    LL  +    
Sbjct  636   EINTFVKDAG---IDGVITDFPKTANRYRRNRCLNLGDRKPPYMKPVQLPGLLSKIDNFS  692

Query  548   LPPAEAPYPVLTESDVVEPPLPPVAKI  468
             LPPA AP P LTE++V EPPLPP++KI
Sbjct  693   LPPALAPVPPLTEAEVTEPPLPPLSKI  719



>emb|CDY14478.1| BnaC03g21170D [Brassica napus]
Length=1314

 Score =   300 bits (769),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 161/317 (51%), Positives = 214/317 (68%), Gaps = 12/317 (4%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+ DGIPFC  S+++ + T  +   ++  ++++PE+ +   I++F L W +IQSL   I
Sbjct  428   QMSSDGIPFCSRSIDLSNSTVISHTPYAQRSINVPEISSNGGIYTFSLTWAEIQSLTPAI  487

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNP+  + +FRNP   N GK + L +FL  A N+TS+SGVLI+VENA YL EK+GL V  
Sbjct  488   SNPYRLYSMFRNPDETNSGKLILLSEFLNLAKNSTSLSGVLISVENAVYLREKQGLDVVK  547

Query  1073  AVLLALNKAD----LKTKKVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTILEI  909
             AVL  L +      + T+KVMI S +SSVL+ F   SKY+ VY I++ ISDI ++ I  I
Sbjct  548   AVLDTLMETGYSNGITTEKVMIQSTESSVLVDFKEQSKYDTVYKIEKNISDISDAAIQAI  607

Query  908   KKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPY  729
             KKFA++V+I K +VF   DSF+   TNVV KLQ S + VYV+LF NEFVSQ +DFF+DP 
Sbjct  608   KKFANAVVIRKETVFSLFDSFITTQTNVVKKLQKSWLPVYVELFQNEFVSQPYDFFADPT  667

Query  728   VELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMSPQ  552
             VE+NSY+ GA      G I  FP TA RY+RNRCLG KE +PPYM PV PG LL  ++ +
Sbjct  668   VEINSYITGAG---ISGTIIEFPFTAARYKRNRCLGTKEPLPPYMSPVLPGGLLPFLNAK  724

Query  551   YLPPAEAPYPVLTESDV  501
               PPA+AP PV TE DV
Sbjct  725   --PPAQAPNPVFTEEDV  739



>gb|KHN28413.1| Putative glycerophosphoryl diester phosphodiesterase 1 [Glycine 
soja]
Length=761

 Score =   293 bits (749),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 165/327 (50%), Positives = 217/327 (66%), Gaps = 10/327 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM++DGIPFC+ S+++I+ T  AQ  FSN + +IP +K+ + I +FDL W+DI++L   +
Sbjct  398   QMSQDGIPFCLRSIDLIESTNVAQTIFSNRSKTIP-IKSGSGIFAFDLAWEDIKNLTPSM  456

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
              NP++ + LFRN     +GKF+ L DFL      TS+ G +I +ENA YLA +K L VTD
Sbjct  457   FNPYSNYHLFRNQEYNKQGKFLRLTDFLNLIKGQTSLLGAVIIIENADYLAREKNLSVTD  516

Query  1073  AVLLALNKADLKTK---KVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
             AV+  L KA    +    VMI S +SSVL+KF   + YE VY I E + D  +S I +IK
Sbjct  517   AVIDTLRKAGYDKQGAPNVMIQSTNSSVLLKFKEKTNYELVYRIDEIVGDAVDSAIRDIK  576

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             +FA SVI+ KSSV+P +D FL G T +V K ++S + VYV+ FSNEFVS AWDF SD  V
Sbjct  577   RFAHSVILHKSSVYPLNDFFLTGSTKIVPKFKSSNISVYVETFSNEFVSSAWDFLSDSTV  636

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMSPQY  549
             E+N++V  A     DGVIT FP TANRYRRN+CL   E  PPYM PV  G L + ++   
Sbjct  637   EINTFVQDAE---IDGVITDFPKTANRYRRNKCLNLGENTPPYMKPVQVGGLFKQIAKYS  693

Query  548   LPPAEAPYPVLTESDVVEPPLPPVAKI  468
             LPPA AP P LTE +V EPPLP V+KI
Sbjct  694   LPPAVAPAPALTEDEVTEPPLPSVSKI  720



>ref|XP_008798763.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 isoform X1 [Phoenix dactylifera]
Length=763

 Score =   292 bits (747),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 164/328 (50%), Positives = 218/328 (66%), Gaps = 13/328 (4%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDI-QSLQAQ  1257
             QMT+DG   CM S+N+ID TT     FS+    IPE++    I +F+L W++I ++L++ 
Sbjct  403   QMTQDGTLVCMSSLNLIDVTTVTTSPFSSRFSVIPEIQGVPGIFAFNLTWEEISKNLKST  462

Query  1256  ISNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
             IS+P   ++L+RNP  KN G FM L DFL FA +  ++SGVLI++ENAA+LAEK G  VT
Sbjct  463   ISSPDVDYQLYRNPRYKNAGNFMKLSDFLDFAKDK-ALSGVLISIENAAFLAEKLGYSVT  521

Query  1076  DAVLLALNKA---DLKTKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTILEI  909
             D V+ AL  +   +   ++VMI S++SSVL+KF   +KY+ VY I E ISD   S+I +I
Sbjct  522   DGVIKALKDSGYDNQTVQEVMIQSSNSSVLVKFRQQTKYQLVYMIDESISDAAPSSIADI  581

Query  908   KKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPY  729
             K+FA SV + K S+FP    F++G T +V KL+++ + VYV L  NEFVSQ WDF SDP 
Sbjct  582   KQFAHSVAVSKQSIFPESLKFVIGQTELVKKLKSAGLNVYVYLLRNEFVSQPWDFLSDPT  641

Query  728   VELNSYVFGASANPFDGVITGFPATANRYRRNRC--LGYKEIPPYMLPVGPGSLLQLMSP  555
              E+N YV  A     DG+IT FP TA  Y+RN C  LG K  P YM+PV  G LL LM+P
Sbjct  642   AEINQYVQDAGV---DGIITDFPGTATAYKRNACSKLGDKA-PKYMVPVHVGDLLGLMAP  697

Query  554   QYLPPAEAPYPVLTESDVVEPPLPPVAK  471
             + LPPA AP PVL  SDV EPPLPP ++
Sbjct  698   ESLPPALAPMPVLEVSDVAEPPLPPASR  725



>ref|XP_008782908.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Phoenix dactylifera]
Length=767

 Score =   291 bits (744),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 165/327 (50%), Positives = 218/327 (67%), Gaps = 13/327 (4%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDI-QSLQAQ  1257
             Q+T+DG   CM S+N+ID TT     FS+L+  IPE++    I + +L W+DI ++L+  
Sbjct  402   QVTQDGTLICMSSINLIDVTTVTTSPFSSLSSVIPEIQDGPGIFTLNLTWEDISKNLKPT  461

Query  1256  ISNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
             IS+P  K++L RNP  KN GKFM L DFL FA +  ++SGVLI++ENAA+LAEK G  VT
Sbjct  462   ISSPEIKYQLHRNPRYKNAGKFMRLSDFLDFAKD-KALSGVLISIENAAFLAEKLGYSVT  520

Query  1076  DAVLLALNKA---DLKTKKVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTILEI  909
             D V+ AL  +   +   ++VMI S++SSVL+KF   +KY+ VY + E I     S++ +I
Sbjct  521   DGVIKALKDSAYNNQTVQEVMIQSSNSSVLVKFKEQTKYKLVYMVDESIRAAAPSSVADI  580

Query  908   KKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPY  729
             K+FA SV + K S+FP    F++  T +V KL+++ + VYV L  NEFVSQ WDFFSDP 
Sbjct  581   KQFAHSVAVSKQSIFPESQQFVIEQTELVNKLKSAGLNVYVYLLMNEFVSQPWDFFSDPI  640

Query  728   VELNSYVFGASANPFDGVITGFPATANRYRRNRC--LGYKEIPPYMLPVGPGSLLQLMSP  555
             VE+N YV GA     DG+IT FP TA  Y+RN C  LG K  P YMLPV  G LL LM+P
Sbjct  641   VEINQYVQGAYV---DGIITDFPGTAAAYKRNACSKLGDKA-PNYMLPVQVGGLLGLMTP  696

Query  554   QYLPPAEAPYPVLTESDVVEPPLPPVA  474
             + LPPA AP PVL  SDVVEPPL P +
Sbjct  697   EALPPALAPMPVLEASDVVEPPLMPAS  723



>gb|KDO62175.1| hypothetical protein CISIN_1g003550mg [Citrus sinensis]
Length=733

 Score =   289 bits (740),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 149/269 (55%), Positives = 192/269 (71%), Gaps = 8/269 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+KDG+PFC+  +N+I+ T AAQ +F+++  +IPE+   + I SF L W +IQ+L  QI
Sbjct  444   QMSKDGVPFCLSFINLINSTNAAQSKFNSITTTIPEIMAGSGIFSFSLIWDEIQTLIPQI  503

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNP+ KF+LFRNP  KN GKFM L DFL  A NA S+SGVLI++ENA YLAEK+G+ VT+
Sbjct  504   SNPYFKFKLFRNPKNKNAGKFMKLSDFLEMAKNANSLSGVLISIENAVYLAEKQGMSVTN  563

Query  1073  AVLLALNKADLKTK---KVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
             +V+ AL  A    +   KVMI S DSSVLMK    + YE VY +KE I D  N TI +IK
Sbjct  564   SVMEALGNAGYNKQTALKVMIQSTDSSVLMKLREKTSYELVYKVKENIRDALNQTIEDIK  623

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             KFA SV++ K SV+P + +F+   T++V +LQ+ K+ VYV+ FSNEFVSQAWDFFSDP V
Sbjct  624   KFADSVVLSKESVYPLNSAFITSATDIVQRLQSFKLPVYVETFSNEFVSQAWDFFSDPTV  683

Query  725   ELNSYVFGASANPFDGVITGFPATANRYR  639
             E+N+Y  GA     DGVIT FP TA RYR
Sbjct  684   EINTYYEGAG---IDGVITEFPMTAARYR  709



>ref|XP_010483369.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL6-like 
[Camelina sativa]
Length=542

 Score =   283 bits (723),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 155/326 (48%), Positives = 203/326 (62%), Gaps = 9/326 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  1251
             QM+KDGI FC  S ++   TTA   F + A S+PE++  N I SFDL W +IQS++ QI 
Sbjct  179   QMSKDGIAFCHDSADLTASTTAMTTFMSRATSVPEVQPTNGIFSFDLTWAEIQSVKPQIE  238

Query  1250  NPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDA  1071
             NPF      RNP  KN GKF TL DFL   + A +V+GVLI +ENAAYLA KKGLGV DA
Sbjct  239   NPFTSTGFLRNPANKNAGKFTTLVDFLEI-SKAKAVTGVLINIENAAYLASKKGLGVVDA  297

Query  1070  VLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIKK  903
             V  AL  + L    T+KV+I S+DSSVL  F     Y RV  I +EI D    +I EIKK
Sbjct  298   VKSALTNSTLDKQSTQKVLIQSDDSSVLSSFEAVPPYTRVLSIDKEIGDAPKPSIEEIKK  357

Query  902   FASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVE  723
              A +V + ++S+     SF  G TNVV ++  + + VYV +  NE++S A+D+FSDP VE
Sbjct  358   HADAVNLKRTSLVTVSQSFATGKTNVVEEMHKANISVYVSVLRNEYISIAFDYFSDPTVE  417

Query  722   LNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMSPQYL  546
             L +++ G+     DGVIT FPATA RY R+ C    +  PY +LP   G+L+ +   +  
Sbjct  418   LATFIAGSG---VDGVITEFPATATRYLRSPCSDLNKDQPYAILPAEAGALMAVADKEAQ  474

Query  545   PPAEAPYPVLTESDVVEPPLPPVAKI  468
             PPA AP P L   DV++PPLPPVA +
Sbjct  475   PPASAPNPPLDAKDVIDPPLPPVANM  500



>ref|XP_010446175.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL6-like, 
partial [Camelina sativa]
Length=630

 Score =   284 bits (726),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 156/326 (48%), Positives = 203/326 (62%), Gaps = 9/326 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  1251
             QM+KDGI FC  S ++   TTA   F + A S+PE++  N I SFDL W +IQS++ QI 
Sbjct  267   QMSKDGIAFCHDSADLTASTTAMTTFMSRATSVPEVQPTNGIFSFDLTWAEIQSVKPQIE  326

Query  1250  NPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDA  1071
             NPF      RNP  KN GKF TL DFL   + A +V+GVLI +ENAAYLA KKGLGV D 
Sbjct  327   NPFTSTGFLRNPANKNAGKFTTLVDFLEI-SKAKAVTGVLINIENAAYLASKKGLGVVDV  385

Query  1070  VLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIKK  903
             V  AL  + L    T+KV+I S+DSSVL  F     Y RV  I +EI D    +I EIKK
Sbjct  386   VKSALTNSTLDKQSTQKVLIQSDDSSVLSSFEAVPPYTRVLSIDKEIGDAPKPSIEEIKK  445

Query  902   FASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVE  723
              A +V + ++S+F    SF  G TNVV ++  + + VYV +  NE++S A+D+FSDP VE
Sbjct  446   HADAVNLKRTSLFTVSQSFTTGKTNVVEEMHKANISVYVSVLRNEYISIAFDYFSDPTVE  505

Query  722   LNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMSPQYL  546
             L +++ G+     DGVIT FPATA RY R+ C    +  PY +LP   G+L+ +   +  
Sbjct  506   LATFIAGSGV---DGVITEFPATATRYLRSPCSDLNKDQPYAILPAEAGALMAVADKEAQ  562

Query  545   PPAEAPYPVLTESDVVEPPLPPVAKI  468
             PPA AP P L   DV++PPLPPVA I
Sbjct  563   PPASAPNPPLDAKDVIDPPLPPVANI  588



>ref|XP_009415406.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Musa acuminata subsp. malaccensis]
Length=760

 Score =   286 bits (733),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 162/327 (50%), Positives = 216/327 (66%), Gaps = 13/327 (4%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMI-DGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQ-SLQAQ  1257
             Q+T+DGI  CM S+++I D T     F++   SIPE++    I +F+L W +IQ +L+  
Sbjct  396   QVTQDGIAICMSSIDLIVDTTVTKSPFASRLSSIPEIQNTPGIFTFNLTWDEIQKNLKPI  455

Query  1256  ISNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
             ISNP +K++L RNP   N G FM L DFL +A +   + GVLI+VE AA++AE+ G  V 
Sbjct  456   ISNPESKYQLVRNPRYANAGSFMRLSDFLAYAKD-KPLGGVLISVEYAAFMAEQLGFSVI  514

Query  1076  DAVLLALNKADLKTK---KVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEI  909
             D V+ AL+ A    +   +VMI S +SSVL++F   +K++ VY I E I D   S+I+EI
Sbjct  515   DMVISALSDAGHNNQTAFEVMILSTNSSVLVEFRQKTKFKLVYKIDESIRDAVASSIVEI  574

Query  908   KKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPY  729
             K+FA +V I + SV+P    F    T++V+KLQ + + VYV LF NEFV+Q WDFFSD  
Sbjct  575   KEFADAVAIDRQSVYPVTQQFTTRQTDIVSKLQNAGLAVYVYLFQNEFVAQPWDFFSDAT  634

Query  728   VELNSYVFGASANPFDGVITGFPATANRYRRNRC--LGYKEIPPYMLPVGPGSLLQLMSP  555
             VE+N+YV GA     DG+IT FPATA+ Y+RN C  +G K  P YM P   G LLQL+SP
Sbjct  635   VEINTYVQGAGV---DGIITDFPATASTYKRNSCRKMG-KNAPSYMSPAQGGGLLQLISP  690

Query  554   QYLPPAEAPYPVLTESDVVEPPLPPVA  474
             Q LPPA +P PVL  SDVVEPPLPPVA
Sbjct  691   QSLPPALSPMPVLDVSDVVEPPLPPVA  717



>dbj|BAC42822.1| GPI-anchored protein [Arabidopsis thaliana]
Length=359

 Score =   275 bits (702),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 149/325 (46%), Positives = 203/325 (62%), Gaps = 9/325 (3%)
 Frame = -3

Query  1427  MTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQISN  1248
             M+KDGI FC  + ++   TTA   F + A S+PE++  N I SFDL W +IQS++ QI N
Sbjct  1     MSKDGIAFCHDAADLTASTTAMTIFMSRATSVPEIQPTNGIFSFDLTWAEIQSVKPQIEN  60

Query  1247  PFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDAV  1068
             PF      RNP  KN GKF+TL DFL F + A +V+GV+I +ENAAYLA KKG+GV DAV
Sbjct  61    PFTATGFQRNPANKNAGKFITLADFLDF-SKAKAVTGVMINIENAAYLASKKGIGVVDAV  119

Query  1067  LLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIKKF  900
               AL K+ L    T+KV+I S+DSSVL  F     Y RV  I +EI      ++ EIKK+
Sbjct  120   KSALAKSTLDKQSTQKVLIQSDDSSVLASFEAVPPYTRVLSIDKEIGGAPKPSVDEIKKY  179

Query  899   ASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVEL  720
             A +V + ++S+     SF  G TNVV ++    + VYV +  NE++S A+D+FSDP +EL
Sbjct  180   AEAVNLLRTSLVTVSQSFTTGKTNVVEEMHKGNISVYVSVLRNEYISVAFDYFSDPTIEL  239

Query  719   NSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMSPQYLP  543
              +++ G+     DGVIT FPATA RY ++ C    +  PY +LP   G L+ +   +  P
Sbjct  240   ATFISGSG---VDGVITEFPATATRYLKSPCSDLNKEQPYAILPAEAGGLVVVADKEAQP  296

Query  542   PAEAPYPVLTESDVVEPPLPPVAKI  468
             PA AP P L   DV++PPLPPVA +
Sbjct  297   PASAPNPPLEAKDVIDPPLPPVANL  321



>ref|XP_006282081.1| hypothetical protein CARUB_v10028327mg [Capsella rubella]
 gb|EOA14979.1| hypothetical protein CARUB_v10028327mg [Capsella rubella]
Length=752

 Score =   286 bits (731),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 157/326 (48%), Positives = 204/326 (63%), Gaps = 9/326 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  1251
             QM+KDGI FC  S ++   TTA   F + A S+PE++  N I SFDL W +IQS++ QI 
Sbjct  389   QMSKDGIAFCHDSADLTASTTAMTTFMSRATSVPEIQPTNGIFSFDLTWAEIQSVKPQIE  448

Query  1250  NPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDA  1071
             NPF      RNP  KN GKF TL DFL F + A +V+GVLI +ENAAYLA KKGLGV DA
Sbjct  449   NPFTATGFLRNPANKNGGKFTTLADFLEF-SKAKAVTGVLINIENAAYLASKKGLGVVDA  507

Query  1070  VLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIKK  903
             V  AL  + L    T+KV+I S+DSSVL  F     Y RV  I +EI D    ++ EIKK
Sbjct  508   VKSALTNSTLDKQSTQKVLIQSDDSSVLSSFEAVPPYTRVLSIDKEIGDAPKPSLEEIKK  567

Query  902   FASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVE  723
              A +V + ++S+     SF  G TNVV ++  S + VYV +  NE++S A+D+FSDP VE
Sbjct  568   HADAVNLKRTSLVTVSQSFATGKTNVVEEMHKSNISVYVSVLRNEYISIAFDYFSDPTVE  627

Query  722   LNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMSPQYL  546
             L +++ G+     DGVIT FPATA RY R+ C    +  PY +LP   G+LL +   +  
Sbjct  628   LATFIAGSG---VDGVITEFPATATRYLRSPCSDLNKDQPYAILPAEAGALLAVADKEAQ  684

Query  545   PPAEAPYPVLTESDVVEPPLPPVAKI  468
             PPA AP P L   DV++PPLPPVA +
Sbjct  685   PPASAPNPPLDAKDVIDPPLPPVANM  710



>gb|KJB13801.1| hypothetical protein B456_002G094900 [Gossypium raimondii]
Length=686

 Score =   283 bits (723),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 148/274 (54%), Positives = 202/274 (74%), Gaps = 10/274 (4%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QMTKDGIP C+GS+N+I  T   +  FSNL  ++PE+   + I +++L+W DI+SL+  I
Sbjct  397   QMTKDGIPICLGSINLIQSTDIVRTGFSNLTETVPEIMQSSGIFTYNLSWSDIKSLKPVI  456

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             S+P ++++LFRNP  +N GK++ L +FL+ A   +S++GVLI++ENAAYLA K+G GVTD
Sbjct  457   SSPQSQYKLFRNPKFQNAGKYLKLSEFLSMANTTSSLNGVLISIENAAYLA-KQGFGVTD  515

Query  1073  AVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
             AVL ALN+A      T+KVMI S+ SSVLMKF   + Y+ VY I E+I   Q+STI +IK
Sbjct  516   AVLKALNEAGYDKQTTQKVMIQSSSSSVLMKFKGKTNYQLVYKIDEDIGGAQSSTIDDIK  575

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             +FAS+V+I K SVFP + +FL G T+VV++LQA+ + V VQ FSNEF SQAWDFFSD  V
Sbjct  576   RFASAVVISKDSVFPENSAFLAGATDVVSRLQAANLSVLVQTFSNEFTSQAWDFFSDATV  635

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCL  624
             E+NS+  GAS N   GVIT FP T++RY R++CL
Sbjct  636   EINSFCAGASIN---GVITDFPKTSDRY-RSKCL  665



>ref|XP_010483370.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7 [Camelina 
sativa]
Length=753

 Score =   284 bits (726),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 156/326 (48%), Positives = 204/326 (63%), Gaps = 9/326 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  1251
             QM+KDGI FC  S ++   TTA   F + A S+PE++  N I SFDL W +IQS++ QI 
Sbjct  391   QMSKDGIAFCHDSADLTASTTAMTTFMSRATSVPEVQPTNGIFSFDLTWAEIQSVKPQIG  450

Query  1250  NPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDA  1071
             NPF      RNP  KN GKF TL +FL F + A +V GVLI +ENAAYLA KKGLGV DA
Sbjct  451   NPFTSTGFLRNPANKNVGKFTTLAEFLEF-SKAKAVPGVLINIENAAYLASKKGLGVIDA  509

Query  1070  VLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIKK  903
             V  AL  + L    T+KV+I S+DSSVL  F     Y RV  I +EI      ++ EIKK
Sbjct  510   VKSALTNSTLDKQSTQKVLIQSDDSSVLASFEAVPPYTRVLSIDKEIGGAPKPSVDEIKK  569

Query  902   FASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVE  723
              A +V + ++S+F    SF+ G TNVV ++    + VYV +  NE++S A+D+FSDP VE
Sbjct  570   HAEAVNLKRTSLFTVSQSFVTGKTNVVEEMHKGNISVYVSVLRNEYISVAFDYFSDPTVE  629

Query  722   LNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMSPQYL  546
             L +++ G+     DGVIT FPATA RY R+ C    +  PY +LP   G+LL +   +  
Sbjct  630   LATFIAGSGV---DGVITEFPATATRYLRSPCSDLNKDQPYAILPAEAGALLAVADKEAQ  686

Query  545   PPAEAPYPVLTESDVVEPPLPPVAKI  468
             PPA AP P L   DV++PPLPPVAK+
Sbjct  687   PPASAPNPPLDAKDVIDPPLPPVAKL  712



>ref|XP_010453288.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Camelina sativa]
Length=753

 Score =   283 bits (724),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 156/326 (48%), Positives = 204/326 (63%), Gaps = 9/326 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  1251
             QM+KDGI FC  S ++   TTA   F + A S+PE++  N I SFDL W +IQS++ QI 
Sbjct  391   QMSKDGIAFCHDSADLTASTTAMTTFMSRATSVPEVQPTNGIFSFDLTWAEIQSVKPQIG  450

Query  1250  NPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDA  1071
             NPF      RNP  KN GKF TL +FL F + A  V GV+I +ENAAYLA KKGLGV DA
Sbjct  451   NPFTSTGFVRNPANKNVGKFTTLTEFLEF-SKAKKVPGVMINIENAAYLASKKGLGVVDA  509

Query  1070  VLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIKK  903
             V  AL  + L    T++V+I S+DSSVL  F     Y RV  I +EI D    +I EIKK
Sbjct  510   VKSALANSTLDKQSTQRVLIQSDDSSVLASFEAVPPYTRVLSIDKEIGDAPKPSIDEIKK  569

Query  902   FASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVE  723
              A +V + ++S+F    SF+ G TNVV ++    + VYV +  NE++S A+D+FSDP VE
Sbjct  570   HADAVNLKRTSLFTVSQSFVTGKTNVVEEMHKGNISVYVSVLRNEYISVAFDYFSDPTVE  629

Query  722   LNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMSPQYL  546
             L +++ G+     DGVIT FPATA RY R+ C    +  PY +LP   G+LL +   +  
Sbjct  630   LATFIAGSGV---DGVITEFPATATRYLRSPCSDLNKDQPYAILPAEAGALLAVADKEAQ  686

Query  545   PPAEAPYPVLTESDVVEPPLPPVAKI  468
             PPA AP P L   DV++PPLPPVAK+
Sbjct  687   PPAGAPNPPLDAKDVIDPPLPPVAKL  712



>ref|XP_002523503.1| glycerophosphoryl diester phosphodiesterase, putative [Ricinus 
communis]
 gb|EEF38842.1| glycerophosphoryl diester phosphodiesterase, putative [Ricinus 
communis]
Length=753

 Score =   283 bits (724),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 156/327 (48%), Positives = 216/327 (66%), Gaps = 12/327 (4%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  1251
             QM+KDG+ FCM S ++   TTA   F + + +IPE++    I SFDL W +IQ+L+ Q+ 
Sbjct  388   QMSKDGVAFCMDSADLTGDTTAMTTFVSRSSTIPEIQPAAGIFSFDLTWTEIQTLRPQLV  447

Query  1250  NPFAKFRLF-RNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             +P     LF RNP +KN GKFMTL +FL FA    + SG+LI +ENAA+LA KKGL +  
Sbjct  448   SPLGNGNLFPRNPASKNAGKFMTLPEFLDFA-KTKAASGILINIENAAFLAAKKGLDIVT  506

Query  1073  AVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
             AV  AL+ A      T++V+I S+D+SVL KF N   Y+RV  + EEIS     ++ EIK
Sbjct  507   AVTTALSNATFDKQATQQVLIQSDDTSVLSKFLNIPAYKRVLYLGEEISAAPKKSVDEIK  566

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             KFA +V + ++S+ PT++ + V  TNVV ++ A+ + VYV L  NEF +  +DFFSDP V
Sbjct  567   KFADAVNLPRTSLVPTNNGYAVTTTNVVHEMHAANLTVYVSLLRNEFATLPFDFFSDPTV  626

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRC--LGYKEIPPYMLPVGPGSLLQLMSPQ  552
             E+ +Y+ G  A   DG+IT +PATA+RY RN C  L Y ++P  +LP+ P  LLQ ++ +
Sbjct  627   EIATYIAGLEA---DGIITEYPATASRYLRNVCSNLNY-DLPFTVLPIEPPLLLQFINSE  682

Query  551   YLPPAEAPYPVLTESDVVEPPLPPVAK  471
              LPPA AP PVL  +DVV+PPLP VAK
Sbjct  683   MLPPAAAPSPVLDVADVVDPPLPAVAK  709



>gb|KEH28442.1| glycerophosphoryl diester phosphodiesterase family protein [Medicago 
truncatula]
Length=659

 Score =   281 bits (718),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 148/273 (54%), Positives = 196/273 (72%), Gaps = 9/273 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             Q++KDG PFC+ S+++++ TT AQ  FS+LA+S+PE+K+   I SF+L W DI+ L   I
Sbjct  391   QLSKDGTPFCLKSIDLLESTTVAQTSFSDLAMSVPEIKSGRGIFSFNLTWSDIKGLTPSI  450

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
               PF+K+ LFRNP AKN G F+TL DFL+   N TS+SGVLI VENAAYLAEK+GL VTD
Sbjct  451   LAPFSKYTLFRNPKAKNAGTFLTLSDFLSLTKNQTSLSGVLIIVENAAYLAEKQGLSVTD  510

Query  1073  AVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
              V+ AL+ A      ++KV I S +SSVL+KF   +KYE VY I E + D  N+   +IK
Sbjct  511   VVIKALSNAGYDKPGSQKVYIQSTNSSVLLKFKEKTKYELVYQIDESVGDATNAAAEDIK  570

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
              FASSV+I K+SV+P +  ++   TN+V KLQASK+ V+V+ FSNEFVSQA+DFFSD  V
Sbjct  571   TFASSVVINKNSVYPQNAGYVTTKTNIVEKLQASKLSVFVETFSNEFVSQAFDFFSDSTV  630

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRC  627
             E+NS++ GA  N   GVIT FP TA+RY  ++C
Sbjct  631   EINSFIQGAGIN---GVITDFPKTAHRY-SSKC  659



>ref|XP_008806340.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Phoenix dactylifera]
Length=808

 Score =   284 bits (726),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 160/327 (49%), Positives = 215/327 (66%), Gaps = 13/327 (4%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQ-SLQAQ  1257
             Q+T DGI  CM S++++D TT  +  FS+ A  IP++K    I++F+L W +IQ +LQ  
Sbjct  444   QVTHDGILICMKSIDLLDDTTVTRSPFSSYASIIPDIKRTPGIYTFNLTWNEIQKNLQPT  503

Query  1256  ISNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
             +S PF ++ L RNP  KN+G FMTL +FLTFA     +SG+LIT+ENAA++ EK G+GVT
Sbjct  504   MSAPFIEYNLVRNPRYKNKGNFMTLSEFLTFA-KGKDLSGILITIENAAFIVEKLGIGVT  562

Query  1076  DAVLLALNKADLKTK---KVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTILEI  909
             DAV+ A++ A   T+   ++MI S +SSVL KF  ++KY+ VY I   + D  NS++ +I
Sbjct  563   DAVINAISFAGYNTQTTPEIMIQSTNSSVLKKFRQHTKYKLVYKIDGPVGDAVNSSVEDI  622

Query  908   KKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPY  729
             K+FA SV I   S++P    F+   T++V K     + VYV L  NEFVSQ WD+FSDP 
Sbjct  623   KEFADSVAILTDSIYPDTQLFITSKTDIVNKFHRYNLSVYVYLLQNEFVSQPWDYFSDPI  682

Query  728   VELNSYVFGASANPFDGVITGFPATANRYRRNRC--LGYKEIPPYMLPVGPGSLLQLMSP  555
             V++NS+V GA     DG+IT FP TA  Y+RN C  LG K  P +M PV  G LLQL+  
Sbjct  683   VQINSFVEGAKV---DGIITDFPRTARAYKRNSCRNLGPKA-PVFMEPVEAGDLLQLIPF  738

Query  554   QYLPPAEAPYPVLTESDVVEPPLPPVA  474
                PPA AP PVL  S+VVEPPLPPVA
Sbjct  739   AAQPPALAPMPVLNVSNVVEPPLPPVA  765



>gb|KJB13800.1| hypothetical protein B456_002G094900 [Gossypium raimondii]
Length=691

 Score =   281 bits (718),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 146/272 (54%), Positives = 199/272 (73%), Gaps = 9/272 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QMTKDGIP C+GS+N+I  T   +  FSNL  ++PE+   + I +++L+W DI+SL+  I
Sbjct  397   QMTKDGIPICLGSINLIQSTDIVRTGFSNLTETVPEIMQSSGIFTYNLSWSDIKSLKPVI  456

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             S+P ++++LFRNP  +N GK++ L +FL+ A   +S++GVLI++ENAAYLA K+G GVTD
Sbjct  457   SSPQSQYKLFRNPKFQNAGKYLKLSEFLSMANTTSSLNGVLISIENAAYLA-KQGFGVTD  515

Query  1073  AVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
             AVL ALN+A      T+KVMI S+ SSVLMKF   + Y+ VY I E+I   Q+STI +IK
Sbjct  516   AVLKALNEAGYDKQTTQKVMIQSSSSSVLMKFKGKTNYQLVYKIDEDIGGAQSSTIDDIK  575

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             +FAS+V+I K SVFP + +FL G T+VV++LQA+ + V VQ FSNEF SQAWDFFSD  V
Sbjct  576   RFASAVVISKDSVFPENSAFLAGATDVVSRLQAANLSVLVQTFSNEFTSQAWDFFSDATV  635

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNR  630
             E+NS+  GAS N   GVIT FP T++RYR  +
Sbjct  636   EINSFCAGASIN---GVITDFPKTSDRYRSKK  664



>ref|XP_010453117.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL6 [Camelina 
sativa]
Length=754

 Score =   281 bits (720),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 155/326 (48%), Positives = 204/326 (63%), Gaps = 9/326 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  1251
             QM+KDGI FC  S ++   TTA   F + A S+PE++  N I SFDL W +IQS++ QI 
Sbjct  391   QMSKDGIAFCHDSADLTASTTAMTTFMSRATSVPEIQPTNGIFSFDLTWAEIQSVKPQIE  450

Query  1250  NPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDA  1071
             NPF      RNP  KN GKF TL DFL   + A +V+GVLI +ENAAYLA KKGLGV DA
Sbjct  451   NPFTSTGFLRNPANKNAGKFTTLVDFLEI-SKAKAVTGVLINIENAAYLASKKGLGVVDA  509

Query  1070  VLLALNKADL---KTKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTILEIKK  903
             V  AL  + L    T+KV+I S+DSSVL  F T   Y RV  I +EI D    +I EIKK
Sbjct  510   VKSALTNSTLDKQSTQKVLIQSDDSSVLSSFETVPPYTRVLSIDKEIGDAPKPSIEEIKK  569

Query  902   FASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVE  723
              A +V + ++S+     SF  G T+VV ++  + + VYV +  NE++S A+D+FSDP VE
Sbjct  570   HADAVNLKRTSLVTVSQSFATGNTSVVEEMHKANISVYVSVLRNEYISIAFDYFSDPTVE  629

Query  722   LNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMSPQYL  546
             L +++ G+     DGVIT FPATA RY R+ C    +  PY +LP   G+L+ +   +  
Sbjct  630   LATFIAGSGV---DGVITEFPATATRYLRSPCSDLNKDQPYAILPAEAGALMAVADKEAQ  686

Query  545   PPAEAPYPVLTESDVVEPPLPPVAKI  468
             PPA AP P L   DV++PPLPPVA +
Sbjct  687   PPASAPNPPLDAKDVIDPPLPPVANV  712



>ref|XP_009120321.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=755

 Score =   280 bits (717),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 154/327 (47%), Positives = 210/327 (64%), Gaps = 10/327 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  1251
             QM+KDGI FC  S ++   +TA   F + A S+PE++  N + SFDL W +IQSL+ QI 
Sbjct  391   QMSKDGIAFCHDSADLTVSSTAMATFMSRATSVPEIQPTNGVFSFDLTWAEIQSLKPQIQ  450

Query  1250  NPF-AKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             +PF AK  + RNP  KN GKF+TLDDFL F+    +V+GVL+ ++NAAYLA KKGLG+ D
Sbjct  451   SPFIAKVGISRNPANKNAGKFVTLDDFLKFSKE-KAVTGVLVNIQNAAYLASKKGLGIVD  509

Query  1073  AVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
             AV  AL K+ L    T++V+I S+DSSVL  F     Y RV  I +EI D   +++ EIK
Sbjct  510   AVKSALTKSTLDKQTTQRVLIQSDDSSVLAGFEAVPPYTRVLSIDKEIGDAPKASVDEIK  569

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             K A +V I +SS+     SF  G TNVV ++    + VYV +  NE++S A+D+FSDP V
Sbjct  570   KHADAVNILRSSLVSISGSFAAGKTNVVEEMHKGNISVYVSVLRNEYISIAFDYFSDPTV  629

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMSPQY  549
             E  +++ G   N  DGVIT FPATA+RY R+ C    +  PY +LP   G+L+ + + + 
Sbjct  630   EFATFIAG---NGVDGVITEFPATASRYLRSPCSDLNKEQPYAILPAEAGALISVANKEA  686

Query  548   LPPAEAPYPVLTESDVVEPPLPPVAKI  468
              PPA AP P L   DV++PPLPPVA +
Sbjct  687   QPPASAPNPPLDAKDVIDPPLPPVANM  713



>ref|XP_010675854.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Beta vulgaris subsp. vulgaris]
Length=764

 Score =   280 bits (717),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 150/323 (46%), Positives = 206/323 (64%), Gaps = 9/323 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  1251
             QM++DGIPFC+ SVN+++ T A Q F NL  ++PE++    I SF L+W DIQ L   I+
Sbjct  404   QMSQDGIPFCLSSVNLLNNTQATQ-FRNLMSTVPEIQPAPGIFSFMLDWADIQGLTPMIA  462

Query  1250  NPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDA  1071
             +P++   L RNP ++N G+ ++L DFL  A N++S+SGVLI +ENA YLA  + L +T+A
Sbjct  463   SPYSSSFLLRNPRSRNAGRLVSLADFLDLANNSSSLSGVLIKIENAEYLAANQDLSITEA  522

Query  1070  VLLALNKA----DLKTKKVMIHSNDSSVLMKFTNSKYERVYGIKEEISDIQNSTILEIKK  903
             V  AL  +    +   KKVMI S  SSVL     + YE VY + E I    N TI +IK 
Sbjct  523   VSEALELSGFNNNTAAKKVMIQSTSSSVLKAMRGNSYELVYHVDEIIRGALNDTIADIKT  582

Query  902   FASSVIIGKSSVFPTDD-SFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             FA SV++ + SV P +   FL  +TNVV++ QA ++ VYVQ+ SNEF S  +D FSDP V
Sbjct  583   FADSVVVDRKSVLPFNQMGFLTNLTNVVSQFQAFELPVYVQVLSNEFSSIPFDAFSDPVV  642

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYL  546
             ++N++V  A+     GVIT FP TA+ YRRN CL     P YM+P  PG+L+ ++ P   
Sbjct  643   QINTFVHAANVT---GVITDFPRTADAYRRNVCLNMNNTPAYMMPAQPGALIGILPPGAS  699

Query  545   PPAEAPYPVLTESDVVEPPLPPV  477
             PPA +P PVLT  DV +PPL  V
Sbjct  700   PPAGSPTPVLTVDDVSQPPLTSV  722



>emb|CDY58867.1| BnaC09g52640D [Brassica napus]
Length=722

 Score =   279 bits (714),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 149/323 (46%), Positives = 209/323 (65%), Gaps = 14/323 (4%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+ DGIPFC+ S N+++GT   Q  F N + ++PE+     ++SF L W +I++L+  +
Sbjct  359   QMSSDGIPFCLNSSNLLEGTNVFQSPFINRSSTVPEIAPHAGLYSFSLRWTEIKTLRLAM  418

Query  1253  SNPFA-KFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
             ++P++  F LFRNP  K+  K ++L DFL  A  ++S+ GVLI+VEN AYL EK+G+ V 
Sbjct  419   THPYSLGFNLFRNPREKSSEKIVSLYDFLILANKSSSLVGVLISVENVAYLREKQGIDVV  478

Query  1076  DAVLLALNKADL--KTKKVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTILEIK  906
               VL A  +A     TK+VMI S+++ VL+ F   S YE VY +++ + DI +S I EIK
Sbjct  479   KEVLYAFKEAYYINATKRVMIQSSNNPVLVDFKKQSPYEIVYQVEKNVGDIVDSAIEEIK  538

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             KFA +V++ + SV+ T + FL G T++V KL    + VYV+ F NEFVSQ WDFFSD  V
Sbjct  539   KFADAVVVSRLSVYSTRNFFLTGQTHLVEKLHKFNLPVYVKTFRNEFVSQPWDFFSDATV  598

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYL  546
             E+N+YV GA  +   G IT FP TA RY+RNRCL  K+ PPYM  V P  LL  ++    
Sbjct  599   EINTYVAGAGVS---GTITEFPLTAARYKRNRCLTRKDHPPYMPLVKPAGLLGFVN----  651

Query  545   PPAEAPYPVLTESDVVEPPLPPV  477
                ++P+P  T  DV EPPLPPV
Sbjct  652   --HDSPHPAFTADDVTEPPLPPV  672



>dbj|BAD94535.1| Glycerophosphodiesterase-like [Arabidopsis thaliana]
Length=378

 Score =   269 bits (688),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 149/326 (46%), Positives = 199/326 (61%), Gaps = 9/326 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  1251
             QM+KDGI FC  + ++   TTA   F + A S+PE++  N I SF L W +IQS++ QI 
Sbjct  16    QMSKDGIAFCHDAADLSASTTARTTFMSRATSVPEIQPTNGIFSFGLTWAEIQSVKPQIE  75

Query  1250  NPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDA  1071
             NPF      RNP  KN GKF TL DFL     A +V+GVLI ++NAAYLA KKGLGV D 
Sbjct  76    NPFTATGFQRNPANKNAGKFTTLADFLEL-GKAKAVTGVLINIQNAAYLASKKGLGVVDV  134

Query  1070  VLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIKK  903
             V  AL  + L    T+KV+I S+DSSVL  F     Y RV  I +EI D   ++I EIKK
Sbjct  135   VKSALTNSTLDKQSTQKVLIQSDDSSVLSSFEAVPPYTRVLSIDKEIGDAPKTSIEEIKK  194

Query  902   FASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVE  723
              A +V + ++S+     SF  G TNVV ++  + + VYV +  NE+++ A+D+FSDP +E
Sbjct  195   HADAVNLLRTSLITVSQSFATGKTNVVEEMHKANISVYVSVLRNEYIAIAFDYFSDPTIE  254

Query  722   LNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMSPQYL  546
             L +++ G      DGVIT FPATA RY R+ C    +  PY +LP   G+LL +   +  
Sbjct  255   LATFIAGRG---VDGVITEFPATATRYLRSPCSDLNKDQPYAILPADAGALLTVADKEAQ  311

Query  545   PPAEAPYPVLTESDVVEPPLPPVAKI  468
              PA  P P L   DV++PPLPPVAK+
Sbjct  312   LPAIPPNPPLDAKDVIDPPLPPVAKL  337



>ref|XP_002866246.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH42505.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=754

 Score =   279 bits (713),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 152/326 (47%), Positives = 202/326 (62%), Gaps = 9/326 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  1251
             QM+KDGI FC  + ++   TTA   F + A S+PE++  N I SFDL W +IQS++ QI 
Sbjct  391   QMSKDGIAFCHDAADLTASTTAMTTFMSRATSVPEIQPTNGIFSFDLTWAEIQSVKPQIE  450

Query  1250  NPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDA  1071
             NPF      RNP  KN GKF TL DFL  +    +V+GVLI +ENAAYLA KKGLG+ DA
Sbjct  451   NPFTSTGFLRNPANKNAGKFTTLADFLELSKE-KAVTGVLINIENAAYLASKKGLGIVDA  509

Query  1070  VLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIKK  903
             V  AL  + L    T+KV+I S+DSSVL  F     Y RV  I +EI D    ++ EIKK
Sbjct  510   VKSALTNSTLDKQSTQKVLIQSDDSSVLSSFEAVPPYTRVLSIDKEIGDAPKPSVEEIKK  569

Query  902   FASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVE  723
              A +V + ++S+     SF  G TNVV ++  + + VYV +  NE++S A+D+FSDP VE
Sbjct  570   HADAVNLMRTSLVTVSQSFATGKTNVVEEMHKANISVYVSVLRNEYISIAFDYFSDPTVE  629

Query  722   LNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMSPQYL  546
             L +++ G+     DGVIT FPATA RY R+ C    +  PY +LP   G+LL +   +  
Sbjct  630   LATFIAGSGV---DGVITEFPATATRYLRSPCSDLNKDQPYAILPAEAGALLSVADKEAQ  686

Query  545   PPAEAPYPVLTESDVVEPPLPPVAKI  468
             PPA AP P L   DV++PPLPPVA +
Sbjct  687   PPASAPNPPLDAKDVIDPPLPPVANM  712



>ref|XP_002866252.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH42511.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=754

 Score =   278 bits (712),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 152/326 (47%), Positives = 207/326 (63%), Gaps = 9/326 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  1251
             QM+KDGI FC  + ++   TTA   F + A S+PE++  N I SFDL W +IQS++ QI 
Sbjct  391   QMSKDGIAFCHDAADLTASTTAMTTFMSRATSVPEIQPTNGIFSFDLTWAEIQSVKPQIE  450

Query  1250  NPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDA  1071
             +PF      RNP  KN GKF+TL +FL F + A +V+GVLI +ENAAYLA KKGLGV DA
Sbjct  451   SPFTATGFQRNPANKNAGKFITLAEFLDF-SKAKAVAGVLINIENAAYLASKKGLGVVDA  509

Query  1070  VLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIKK  903
             V  AL K+ L    T+KV+I S+D+SVL  F     Y RV  I++EI      ++ EIKK
Sbjct  510   VKSALAKSTLDKQSTQKVLIQSDDTSVLASFEAVPPYTRVLSIEKEIGGAPKPSVDEIKK  569

Query  902   FASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVE  723
             +A +V + ++S+     SF  G TNVV ++  + + VYV +  NE++S A+D+FSDP VE
Sbjct  570   YADAVNLMRTSLVTVSQSFATGKTNVVEEMHKANISVYVSVLRNEYISIAFDYFSDPTVE  629

Query  722   LNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMSPQYL  546
             L +++ G+     DGVIT FPATA RY R+ C    +  PY +LP   G+LL +   +  
Sbjct  630   LATFIAGSGV---DGVITEFPATATRYLRSPCSDLNKDQPYAILPAEAGALLSVADKEAQ  686

Query  545   PPAEAPYPVLTESDVVEPPLPPVAKI  468
             PPA AP P L   DV++PPLPPVA +
Sbjct  687   PPASAPNPPLDAKDVIDPPLPPVANL  712



>ref|XP_009126795.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
3 [Brassica rapa]
Length=751

 Score =   278 bits (711),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 157/327 (48%), Positives = 206/327 (63%), Gaps = 10/327 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  1251
             QM+KDG+ FC  S ++   T A   F + A S+PE++  N I SFDL W +IQSL+ QI 
Sbjct  388   QMSKDGMAFCHDSADITATTNAMTTFMSRATSVPEIQPTNGIFSFDLTWAEIQSLKPQIQ  447

Query  1250  NPFAKFRLF-RNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             +PF+    F RNP  KN GKFMTL DFL F   A +V+GVLI ++NAAYLA KKGLG+ D
Sbjct  448   SPFSTSGGFQRNPANKNAGKFMTLVDFLEFG-KAKAVTGVLINIQNAAYLASKKGLGIVD  506

Query  1073  AVLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
             AV  AL  + L    T+KV+I S+DSSVL  F     Y RV  I +EI D    ++ EIK
Sbjct  507   AVKSALTNSTLDKQSTQKVLIQSDDSSVLSSFEAVPPYTRVLSIDKEIGDAPKPSVDEIK  566

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             K A +V + +SS+    +SF  G TNVV ++    + VYV +  NE++S A+D+FSDP V
Sbjct  567   KHAEAVNLKRSSLDTISESFATGKTNVVEEMHKGNISVYVSVLRNEYISIAFDYFSDPTV  626

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMSPQY  549
             EL +++ G   N  DGVIT FPATA RY R+ C    +  PY +LP   G+LL + + + 
Sbjct  627   ELATFIAG---NGVDGVITEFPATATRYLRSPCSDLNKDQPYAILPAEAGALLSVAAKEA  683

Query  548   LPPAEAPYPVLTESDVVEPPLPPVAKI  468
              PPA AP P L   DV++PPLPPVA I
Sbjct  684   QPPAIAPSPPLDAKDVIDPPLPPVANI  710



>emb|CDX86766.1| BnaA09g21560D [Brassica napus]
Length=633

 Score =   275 bits (704),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 151/323 (47%), Positives = 205/323 (63%), Gaps = 18/323 (6%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+ DGIPFC+ S N+++GT   Q  F N + ++PE+     I+SF L W +I++L+  +
Sbjct  274   QMSSDGIPFCLNSSNLLEGTNVFQSPFINRSSTVPEIAPHAGIYSFSLRWSEIKTLRLAM  333

Query  1253  SNPFA-KFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
             ++P++  F LFRNP  K+  K + L DFL  A  ++S+ GVLI+VEN AYL  K+G+ V 
Sbjct  334   THPYSLGFNLFRNPREKSSEKIVPLYDFLILANKSSSLVGVLISVENVAYLRGKQGIDVV  393

Query  1076  DAVLLALNKADL--KTKKVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTILEIK  906
               VL A  +A     TK+VMI S++S VL+ F   S YE VY ++E + DI +S I EIK
Sbjct  394   KEVLYAFKEACCIDATKRVMIQSSNSPVLVDFKKQSPYEIVYQVEENVGDIVDSAIEEIK  453

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             KFA +V++ + SV+     FL G T++V KL    + VYV+ F NEFVSQ WDFFSD  V
Sbjct  454   KFADAVVVSRRSVY----FFLSGQTHLVEKLHKFNLPVYVKTFRNEFVSQPWDFFSDATV  509

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYL  546
             E+N+YV GA  N   G IT FP TA RY+RNRCL  K+ PPYM  V P  LL  ++    
Sbjct  510   EINTYVAGAGVN---GTITEFPLTAARYKRNRCLTRKDHPPYMPLVKPAGLLGFVN----  562

Query  545   PPAEAPYPVLTESDVVEPPLPPV  477
                ++P+P  T  DV EPPLPPV
Sbjct  563   --HDSPHPAFTADDVTEPPLPPV  583



>ref|XP_008242952.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Prunus mume]
Length=782

 Score =   279 bits (713),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 151/328 (46%), Positives = 213/328 (65%), Gaps = 12/328 (4%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  1251
             Q++ DG+ FC+ ++++  GT A  QF   + +IPEL+ +  + SF L+W +IQSL+ QI 
Sbjct  403   QLSSDGVAFCLDTIDLNSGTNALSQFMTKSETIPELQAEAGVFSFQLSWDEIQSLKPQIQ  462

Query  1250  NPFA-KFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             +P+  K +++RNP  K+ GK +TL DFL F+    +V+G+LI +ENAAYLA K GL +  
Sbjct  463   SPYGTKEKVYRNPANKDVGKLVTLSDFLEFS-KTKAVTGILINIENAAYLASKAGLDIVK  521

Query  1073  AVLLALNKADL---KTKKVMIHSNDSSVLMKFTNSK-YERVYGIKEEISDIQNSTILEIK  906
              V  AL+ A      T++V+I S+D+SVL KF + K Y RV  IKE+ISD   +++ EIK
Sbjct  522   TVTSALSNATFDKQSTQQVLIKSDDTSVLSKFKDVKTYRRVLNIKEKISDAPKASVDEIK  581

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             KFA +V I K S+    D F+ G TNVV +++A+ + VYV    NEFVS  +D+FSDP +
Sbjct  582   KFADAVTISKDSIVKISDYFISGKTNVVKEMKAANISVYVHWLKNEFVSLMFDYFSDPII  641

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRC--LGYKEIPPY-MLPVGPGSLLQLMSP  555
             E+ SY         DG++T FPATAN+Y R  C  +  K   PY +LPV PGSLL L+ P
Sbjct  642   EIASYALEFQV---DGIVTDFPATANKYMRCPCNDMDPKATIPYPILPVEPGSLLGLVVP  698

Query  554   QYLPPAEAPYPVLTESDVVEPPLPPVAK  471
             + L PA+AP P L  S+VV+PPLP V K
Sbjct  699   EALSPAQAPSPALQASNVVDPPLPEVVK  726



>ref|XP_006401135.1| hypothetical protein EUTSA_v10012762mg [Eutrema salsugineum]
 gb|ESQ42588.1| hypothetical protein EUTSA_v10012762mg [Eutrema salsugineum]
Length=753

 Score =   278 bits (711),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 157/327 (48%), Positives = 205/327 (63%), Gaps = 10/327 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  1251
             QM+KDGI FC+ S ++   T A   F + A S+PE++  NAI SFDL W +IQSL+ QI 
Sbjct  391   QMSKDGIAFCLDSADLTKSTNAMTTFMSRATSVPEIQPTNAIFSFDLTWAEIQSLKPQIE  450

Query  1250  NPFAKFRLF-RNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             +PF     F RNP  KN GKFM+L DFL  +  A +V+GVLI V+NAAYLA KKGLGV D
Sbjct  451   SPFLTSGGFQRNPANKNAGKFMSLVDFLELS-KAKAVTGVLINVQNAAYLASKKGLGVVD  509

Query  1073  AVLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
             AV  AL  + L    T+KVMI S+DSSVL  F     + RV  I +EI D    ++ EIK
Sbjct  510   AVKSALTNSTLDKQSTQKVMIQSDDSSVLASFEAVPPFTRVLSIDKEIGDAPKPSVEEIK  569

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             K A +V + ++S+    +SF  G TNVV ++    + VYV +  NEFVS  +D+FSDP V
Sbjct  570   KHADAVNLKRTSLVTVSNSFATGKTNVVEEMHKGNISVYVSVLRNEFVSIVFDYFSDPTV  629

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMSPQY  549
             EL +++ G   N  DGVIT FPATA RY R+ C    +  PY +LP   G+LL + + + 
Sbjct  630   ELATFIAG---NGVDGVITEFPATATRYLRSPCSDLNKDQPYAILPAEAGALLSVAAKEA  686

Query  548   LPPAEAPYPVLTESDVVEPPLPPVAKI  468
              PP  AP P L   DV++PPLPPVA +
Sbjct  687   QPPTSAPNPPLDAKDVIDPPLPPVANM  713



>ref|XP_008811209.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 isoform X1 [Phoenix dactylifera]
Length=768

 Score =   278 bits (711),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 155/326 (48%), Positives = 216/326 (66%), Gaps = 9/326 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  1251
             QM+KDG+ FC+ S +++  TTA   F + + S+PE++  N I SFDL W +I+SL+  ++
Sbjct  408   QMSKDGVAFCLDSADLMGDTTAVDSFMSRSASVPEIQKNNGIFSFDLTWSEIESLKPLLA  467

Query  1250  NPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDA  1071
             NP +   L RNP AKN+GKFMTL  FL FA N+T VSG+LI++ENA YLA KKGL + +A
Sbjct  468   NPLSSANLVRNPAAKNQGKFMTLAKFLDFAKNST-VSGILISIENAPYLASKKGLDIVNA  526

Query  1070  VLLALNKA---DLKTKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTILEIKK  903
             V  AL  A      T+KV+I S+D+SVL  F  NS Y+RV+ ++E ISD   S + EIKK
Sbjct  527   VSSALINAIYDKQTTQKVLIQSDDTSVLSMFKNNSSYKRVFKVEETISDASKSAVDEIKK  586

Query  902   FASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVE  723
             +A +V++ K+S+    +SFL G T V+ K+ A+ + +YV    NEFVS  +D FSDP VE
Sbjct  587   YADAVVVAKTSLISISNSFLTGFTAVIDKMHAANLSIYVSGLRNEFVSIPFDCFSDPLVE  646

Query  722   LNSYVFGASANPFDGVITGFPATANRYRRNRCLGYK-EIPPYMLPVGPGSLLQLMSPQYL  546
             + +Y  G      DG+IT +PATA+ Y R+ C   +  +P  +LPV PGSLL+   P+ L
Sbjct  647   MATYATGLGV---DGIITEYPATASAYFRSPCSDVEANLPFTILPVEPGSLLKEAQPEVL  703

Query  545   PPAEAPYPVLTESDVVEPPLPPVAKI  468
             PPA+AP P L   D+ +PPLPPV K+
Sbjct  704   PPAQAPAPALDAGDIGDPPLPPVVKV  729



>ref|XP_007201937.1| hypothetical protein PRUPE_ppa001673mg [Prunus persica]
 gb|EMJ03136.1| hypothetical protein PRUPE_ppa001673mg [Prunus persica]
Length=782

 Score =   278 bits (710),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 150/328 (46%), Positives = 213/328 (65%), Gaps = 12/328 (4%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  1251
             Q++ DG+ FC+ ++++  GT A  QF   + +IPEL+ +  + SF L+W +IQSL+ QI 
Sbjct  403   QLSSDGVAFCLDTIDLNSGTNALSQFMTKSETIPELQAEAGVFSFQLSWHEIQSLKPQIQ  462

Query  1250  NPFA-KFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             +P+  K +++RNP  K+ GK +TL DFL F+    +V+G+LI +ENAAYLA K GL +  
Sbjct  463   SPYGTKEKVYRNPANKDVGKLVTLSDFLEFS-KTKAVTGILINIENAAYLASKAGLDIVK  521

Query  1073  AVLLALNKADL---KTKKVMIHSNDSSVLMKFTNSK-YERVYGIKEEISDIQNSTILEIK  906
              V  AL+ A      T++V+I S+D+SVL KF + K Y RV  IKE+ISD   +++ EIK
Sbjct  522   TVTSALSNATFDKQSTQQVLIKSDDTSVLSKFKDVKTYRRVLNIKEKISDATKASVDEIK  581

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             KFA +V + K S+    D F+ G TNVV +++A+ + VYV    NEFVS  +D+FSDP +
Sbjct  582   KFADAVTVTKDSIVKISDYFISGKTNVVKEMKAANISVYVHWLKNEFVSLMFDYFSDPII  641

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRC--LGYKEIPPY-MLPVGPGSLLQLMSP  555
             E+ SYV        DG++T FPATAN+Y R  C  +  K   PY +LPV PGSLL L+ P
Sbjct  642   EIASYVLDYQV---DGIVTDFPATANKYMRCPCNDMDPKANIPYPILPVEPGSLLGLVVP  698

Query  554   QYLPPAEAPYPVLTESDVVEPPLPPVAK  471
             + L PA+AP P L  S+V +PPLP V K
Sbjct  699   EALSPAQAPSPALQASNVADPPLPEVVK  726



>ref|XP_010545539.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL5 [Tarenaya 
hassleriana]
Length=732

 Score =   276 bits (706),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 149/326 (46%), Positives = 214/326 (66%), Gaps = 15/326 (5%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             Q++KD + FC+ S+N+++ T  AQ  F NL+V  PE++ ++ I++F L    I++L+  I
Sbjct  386   QISKDQVLFCLSSINLLNSTDVAQTSFRNLSVLAPEIQKESGIYTFSLPMSQIRTLKPAI  445

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNP+   +LFRNP  +N G+F+ L +FL+ A N +S+SG++I VENAAYLAE +GLG+ D
Sbjct  446   SNPYMWTKLFRNPRNRNAGRFLILSEFLSLAKNYSSLSGIIIRVENAAYLAEHQGLGIVD  505

Query  1073  AVLLALNKADLKTK---KVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
              VL  L K+  K +   +++I S+D SVL KF   + +E VY +   I  I +S + +IK
Sbjct  506   TVLDELRKSSQKNQTGPRILIMSSDISVLRKFKEATNHELVYEVDRNIRTISDSAVRDIK  565

Query  905   KFASSVIIGKSSVF-PTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPY  729
             K+ASS++I K SV+      F+   T VV  L++ K++VYV+ FSNEFVSQA DFFSD  
Sbjct  566   KYASSIVISKRSVYHQMSYGFITRATPVVKMLKSHKLRVYVETFSNEFVSQAQDFFSDTT  625

Query  728   VELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQY  549
             VE+NS+V   +    DG+IT FPATA R+RR RC         ++P G   LL L + + 
Sbjct  626   VEINSFV---NEMGIDGLITDFPATAARFRRKRC------DMSLVPTGREKLLDLANEKS  676

Query  548   LPPAEAPYPVLTESDVVEPPLPPVAK  471
             LPPA+APYP L ESD+ EPPLP V +
Sbjct  677   LPPAQAPYPSLKESDIDEPPLPDVIQ  702



>ref|XP_006297062.1| hypothetical protein CARUB_v10013062mg [Capsella rubella]
 gb|EOA29960.1| hypothetical protein CARUB_v10013062mg [Capsella rubella]
Length=729

 Score =   276 bits (706),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 147/330 (45%), Positives = 209/330 (63%), Gaps = 21/330 (6%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+KD IPFC+ S+++++ T   +  F NL+    E++ ++ I++F L    IQ+L+  I
Sbjct  373   QMSKDKIPFCLSSIDLMNITNVIETSFRNLSSVAAEIQQRSGIYTFSLTMSQIQTLKPSI  432

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNP+    L RNP  KN G F+TL +FL      +S+ G+LI VENAAYL E +G+ V D
Sbjct  433   SNPYLASALLRNPRNKNAGSFLTLSEFLFLPNRYSSLIGILIEVENAAYLVEHQGMSVVD  492

Query  1073  AVLLALNKA-----DLKTKKVMIHSNDSSVLMKFTNSKY----ERVYGIKEEISDIQNST  921
             AVL  L +A         +K++I S D SVLM+F   K+    E VY + E I D+++S 
Sbjct  493   AVLDELKRATNQQNQTSARKILIQSTDKSVLMRFKEKKHIFHDELVYRVDENIRDVEDSA  552

Query  920   ILEIKKFASSVIIGKSSVFPTDDSFLVGVT--NVVAKLQASKVKVYVQLFSNEFVSQAWD  747
             I +IK FA SV+I K SVFPT+D F++     +V  +L+ S ++VYV+ FSNEF+SQ +D
Sbjct  553   IRDIKNFAGSVVISKKSVFPTNDGFVIHKKGPDVTQRLKNSGLRVYVETFSNEFISQPFD  612

Query  746   FFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQ  567
             FFSDP +E++ +V G      DG+IT FPAT  RYR+N+C  Y ++     PVG G L+ 
Sbjct  613   FFSDPTLEIDCFVKGIK---IDGIITDFPATTARYRKNQC--YSKLN----PVGTGELIT  663

Query  566   LMSPQYLPPAEAPYPVLTESDVVEPPLPPV  477
               +P +  PA+APYP L +SDV EPPLP V
Sbjct  664   FGNPMFFGPAKAPYPFLNDSDVTEPPLPEV  693



>ref|XP_007011972.1| SHV3-like 5 [Theobroma cacao]
 gb|EOY29591.1| SHV3-like 5 [Theobroma cacao]
Length=754

 Score =   276 bits (707),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 153/327 (47%), Positives = 214/327 (65%), Gaps = 12/327 (4%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  1251
             QM++DG+ FC+ S ++   TTA   F + + SIPE++ +  I SFDL W +IQ+L+ QI 
Sbjct  393   QMSEDGVAFCLDSADLTGDTTAMPTFMSRSSSIPEVQKEKGIFSFDLTWSEIQTLKPQIV  452

Query  1250  NPFAKFRLF-RNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             +PF +   + RNP A+N+GKFMTL DFL FA  A +VSG+LI +ENAAYLA KKGL + D
Sbjct  453   SPFGQNAGYQRNPEAQNKGKFMTLTDFLEFA-KAKAVSGILINIENAAYLASKKGLDMVD  511

Query  1073  AVLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
             +V  AL  A     +T++V+I S+D+SVL KF     Y+R+  IKEEI D    T+ EIK
Sbjct  512   SVTKALGNATFDKQQTQQVLIQSDDTSVLSKFQGVPAYKRLLRIKEEIGDAPKLTVDEIK  571

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             K+A  V++ + S+  TD+ F    TNV+ ++ A  + VYV +  NEFV+  +DF++DP V
Sbjct  572   KYADGVVVARPSLISTDNGFAKAQTNVLQEMHAGNISVYVFVLRNEFVALPFDFYADPMV  631

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYK-EIPPYMLPVGPGSLLQLMSPQY  549
             EL +YV   +A   DGVIT FP TA+RY R+ C+    EI   ++P  PG+LL+ + P  
Sbjct  632   ELATYV---AALEVDGVITDFPGTASRYMRSPCVDLNGEIA--IIPAEPGALLKQVPPMA  686

Query  548   LPPAEAPYPVLTESDVVEPPLPPVAKI  468
             L PA  P P L  +DVV+PPLPPVA +
Sbjct  687   LSPANPPNPPLEVADVVDPPLPPVANV  713



>ref|XP_009358473.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Pyrus x bretschneideri]
Length=777

 Score =   276 bits (706),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 147/326 (45%), Positives = 211/326 (65%), Gaps = 12/326 (4%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  1251
             QM+ DG+ FC+ ++++  GT A  QF   + +IPEL+ +  + SF L+W DIQSL+ QI 
Sbjct  399   QMSSDGVAFCLDTIDLNSGTNALSQFMTNSDTIPELQAEAGVFSFQLSWSDIQSLKPQIQ  458

Query  1250  NPFA-KFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             +P+  K ++ RNP  K+ GK +TL +FL FA    +V+G+LI +ENAAYLA K GL +  
Sbjct  459   SPYGTKEKIVRNPANKDAGKLVTLKEFLEFAKK-NAVTGILINIENAAYLASKAGLDIVG  517

Query  1073  AVLLALNKADL---KTKKVMIHSNDSSVLMKFTNSK-YERVYGIKEEISDIQNSTILEIK  906
             AV  AL+ A L    T++V+I S+D+SVL KF ++  Y+RV+ IKE+ISD    ++ EIK
Sbjct  518   AVSSALSNATLDKQSTQQVLIKSDDTSVLSKFKDANNYKRVFNIKEKISDAPKESVAEIK  577

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             K+A +VI+ K S+    D F+ G TNVV +++A+ + VY     NEFVS  +D+FSDP  
Sbjct  578   KYADAVIVTKDSIVKITDYFISGTTNVVDEMKAANISVYAHWMKNEFVSLMFDYFSDPIT  637

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYK---EIPPYMLPVGPGSLLQLMSP  555
             E+ SY  G      DG++T FP TA++Y R+ C        IP  +LPV PGSL  L++P
Sbjct  638   EIASYAQGFQV---DGIVTDFPGTASKYMRSPCTDMDPKANIPYAILPVEPGSLSSLIAP  694

Query  554   QYLPPAEAPYPVLTESDVVEPPLPPV  477
             + + PA+AP P L  S VV+PPLP V
Sbjct  695   EAMSPAQAPSPALQTSQVVDPPLPEV  720



>ref|XP_004952935.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Setaria italica]
Length=745

 Score =   275 bits (704),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 157/326 (48%), Positives = 218/326 (67%), Gaps = 12/326 (4%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDI-QSLQAQ  1257
             Q+TKDGIP CM S+++ID T  A+ +F++   +I +LK    + +F+L W DI ++L+  
Sbjct  391   QVTKDGIPICMSSIDLIDVTNVAKSEFASQTTTINDLKAGPGVFTFNLTWDDISKNLKPM  450

Query  1256  ISNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
             IS+P  K+ LFRNP  KN G FM L DFL FA +   +SG++ITVENAA++AEK G GV 
Sbjct  451   ISSPMNKYLLFRNPRNKNAGNFMRLSDFLAFAKDK-DLSGIMITVENAAFMAEKLGFGVV  509

Query  1076  DAVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEI  909
             DAV+ AL+ +       +KVMI S +SSVL+KF   +KY+ VY I+E + D   S++ +I
Sbjct  510   DAVIKALDDSGYNKQTAQKVMIQSTNSSVLVKFKQETKYDLVYMIEESVRDAAPSSLADI  569

Query  908   KKFASSVIIGKSSVFPTDDSFLVGVTN-VVAKLQASKVKVYVQLFSNEFVSQAWDFFSDP  732
             KKFAS+V +   SVFPT + FL+  TN +V  LQ++ + VY  +  NEF SQ +DFFSD 
Sbjct  570   KKFASAVSVNTQSVFPTTNQFLINQTNKLVPTLQSAGLSVYAYVLMNEFTSQPYDFFSDA  629

Query  731   YVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQ  552
               ++N+YV  A     DG+IT FP TA+RY+ N C+G K  P +M P  PG L+ +M  +
Sbjct  630   TAQINAYVQSAKV---DGIITDFPGTAHRYKLNSCMG-KNAPDFMRPAQPGGLISVMDQR  685

Query  551   YLPPAEAPYPVLTESDVVEPPLPPVA  474
               PPA AP P+LT+SDV EPPLPPV+
Sbjct  686   AQPPAAAPMPLLTDSDVAEPPLPPVS  711



>ref|NP_200625.1| glycerophosphodiester phosphodiesterase like 7 [Arabidopsis thaliana]
 sp|Q9LVN0.1|GPDL7_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase GDPDL7; 
AltName: Full=Glycerophosphodiester phosphodiesterase-like 
7; Short=ATGDPDL7; AltName: Full=Glycerophosphodiesterase-like 
6; AltName: Full=Protein SHV3-LIKE 5; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAA96908.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED97007.1| glycerophosphodiester phosphodiesterase like 7 [Arabidopsis thaliana]
Length=750

 Score =   275 bits (703),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 151/326 (46%), Positives = 204/326 (63%), Gaps = 9/326 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  1251
             QM+KDGI FC  + ++   TTA   F + A S+PE++  N I SFDL W +IQS++ QI 
Sbjct  391   QMSKDGIAFCHDAADLTASTTAMTIFMSRATSVPEIQPTNGIFSFDLTWAEIQSVKPQIE  450

Query  1250  NPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDA  1071
             NPF      RNP  KN GKF+TL DFL F + A +V+GV+I +ENAAYLA KKGLGV DA
Sbjct  451   NPFTATGFQRNPANKNAGKFITLADFLDF-SKAKAVTGVMINIENAAYLASKKGLGVVDA  509

Query  1070  VLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIKK  903
             V  AL K+ L    T+KV+I S+DSSVL  F     Y RV  I +EI      ++ EIKK
Sbjct  510   VKSALAKSTLDKQSTQKVLIQSDDSSVLASFEAVPPYTRVLSIDKEIGGAPKPSVDEIKK  569

Query  902   FASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVE  723
             +A +V + ++S+     SF  G TNVV ++    + VYV +  NE++S A+D+FSDP +E
Sbjct  570   YAEAVNLLRTSLVTVSQSFTTGKTNVVEEMHKGNISVYVSVLRNEYISVAFDYFSDPTIE  629

Query  722   LNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMSPQYL  546
             L +++ G+     DGVIT FPATA RY ++ C    +  PY +LP   G L+ +   +  
Sbjct  630   LATFISGSGV---DGVITEFPATATRYLKSPCSDLNKEQPYAILPAEAGGLVVVADKEAQ  686

Query  545   PPAEAPYPVLTESDVVEPPLPPVAKI  468
             PPA AP P L   DV++PPLPPVA +
Sbjct  687   PPASAPNPPLEAKDVIDPPLPPVANL  712



>ref|XP_002308389.2| hypothetical protein POPTR_0006s20170g [Populus trichocarpa]
 gb|EEE91912.2| hypothetical protein POPTR_0006s20170g [Populus trichocarpa]
Length=731

 Score =   275 bits (702),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 149/327 (46%), Positives = 212/327 (65%), Gaps = 11/327 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  1251
             QM+KDG+ FC+ SV++   TTAA  F +L+ +IPE++  + I SFDL+W DIQ+LQ Q++
Sbjct  372   QMSKDGVAFCLDSVDVTRDTTAAATFMSLSTTIPEIQQSSGIFSFDLSWSDIQALQPQLT  431

Query  1250  NPFA-KFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             +PF  K  L RNP  KN+GKF+TL +FL  A    +V+G+LI +ENAAYLA +KGL +  
Sbjct  432   SPFENKGGLPRNPANKNKGKFLTLAEFLELA-KVKAVTGILINIENAAYLASQKGLDIVS  490

Query  1073  AVLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
             AV  AL+ A      T+KV+I S+D+SVL KF N   Y RV  +K+EISD   + + EIK
Sbjct  491   AVNTALSNATFDKQSTQKVLIQSDDTSVLSKFQNVPAYTRVLYLKDEISDAPKTPVGEIK  550

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             K+A +V + + S+ PT D F    T VV ++ A+ + VYV +  NEFV+ A+D+F+DP +
Sbjct  551   KYADAVTLPRFSIVPTIDGFTTATTKVVNEMHAANISVYVTVLRNEFVTLAFDYFADPTI  610

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCL--GYKEIPPYMLPVGPGSLLQLMSPQ  552
             E+ +Y  G      DG+IT +PATA+RY RN C      E    ++P   GSLL+ +  +
Sbjct  611   EIATYTSGIGV---DGIITEYPATASRYLRNPCSSDSMPESSYSIIPAEAGSLLKTVPEE  667

Query  551   YLPPAEAPYPVLTESDVVEPPLPPVAK  471
               PPA +P P L  +D+V+PPLP V K
Sbjct  668   TQPPASSPTPALDVADIVDPPLPAVTK  694



>emb|CDY12599.1| BnaA02g12670D [Brassica napus]
Length=408

 Score =   266 bits (679),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 159/326 (49%), Positives = 207/326 (63%), Gaps = 25/326 (8%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+++G PFC  S+++   T AAQ    N +  IPE+ +   I++F L W +I +L   I
Sbjct  75    QMSREGKPFCSNSIDLEKSTMAAQTPLRNRSTIIPEISSHAGIYTFSLTWPEIYNLTPAI  134

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNP+      RNP  ++ G+ M+L +FL  A N+TS+SG+LI+VENA YL EKKGL +  
Sbjct  135   SNPY------RNPNERDSGRIMSLFEFLNLAKNSTSLSGILISVENAVYLREKKGLDLAK  188

Query  1073  AVLLALNKADLK----TKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTILEI  909
             AVL  L +A       TK+VMI S +SSVL+     SKYE VY +++ I DI +S I +I
Sbjct  189   AVLDTLKEAGYSNGTTTKRVMIQSTNSSVLVDIKKQSKYETVYKVEKTIDDISDSAIEDI  248

Query  908   KKFASSVIIGKSSVFP-TDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDP  732
             KKFA +V+I K SV P  DDSF+ G TNVV +LQ SK+ VYV+LF NEFV       SD 
Sbjct  249   KKFADAVVIIKPSVLPLCDDSFVTGKTNVVERLQKSKLLVYVELFQNEFV-------SDA  301

Query  731   YVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP-  555
              VE+NSY+ GA  N   G IT FP TA++Y+RNRCLG KE  PYM PV P  LLQ ++P 
Sbjct  302   TVEINSYITGAGIN---GTITEFPLTASKYKRNRCLGTKETLPYMAPVIPRGLLQTVNPL  358

Query  554   -QYLPPAEAPYPVLTESDVVEPPLPP  480
                  P+ AP PV T+  V  PPLPP
Sbjct  359   SPAPAPSPAPSPVFTDDYVAGPPLPP  384



>ref|XP_009132086.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=752

 Score =   275 bits (702),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 158/327 (48%), Positives = 207/327 (63%), Gaps = 10/327 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  1251
             QM+KDGI FC  S ++   TTA   F + A S+PE++  N I SFDL W +IQSL+ QI 
Sbjct  391   QMSKDGIAFCHDSADLTTSTTAMTTFMSRATSVPEIQPTNGIFSFDLTWAEIQSLKPQIL  450

Query  1250  NPF-AKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             +PF AK    RNP  KN GKFMTL DFL F+    +V+GVLI +ENAAYLA KKGLG+ D
Sbjct  451   SPFLAKGGFQRNPSNKNAGKFMTLADFLEFSKE-KAVTGVLINIENAAYLASKKGLGIVD  509

Query  1073  AVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
              V  A+ K+ L    T+KV+I S+DSSVL  F     Y RV  I +EI D    +I EIK
Sbjct  510   TVQSAITKSTLDKQLTQKVLIQSDDSSVLSSFAAVPPYTRVLTIDKEIGDAPKPSIDEIK  569

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             K A +V + +SS+  T  +F  G TNVV ++    V VYV +  NE++S A+D+FSDP V
Sbjct  570   KHAEAVNLKRSSLVTTSKNFATGKTNVVEEMHKGNVSVYVSVLRNEYLSIAFDYFSDPTV  629

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMSPQY  549
             E+ +++ G   N  DGV+T FP TA RY R+ C    +  PY +LPV  G+LL + + + 
Sbjct  630   EIATFIAG---NSVDGVVTEFPVTATRYLRSPCSDLNKEQPYAILPVEAGALLSVAAKEA  686

Query  548   LPPAEAPYPVLTESDVVEPPLPPVAKI  468
              PPA AP P L   DV++PPLPP+A I
Sbjct  687   QPPASAPNPPLDARDVIDPPLPPIANI  713



>ref|XP_004975931.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Setaria italica]
Length=747

 Score =   274 bits (700),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 150/324 (46%), Positives = 211/324 (65%), Gaps = 11/324 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDI-QSLQAQ  1257
             Q+TKDG+  CM SVN++D TT A+ QF++    I E+++   + +F+L W DI ++L+  
Sbjct  388   QVTKDGVLVCMSSVNLMDDTTVARSQFASQTAVIKEIQSARGVFTFNLTWDDIVKNLRPI  447

Query  1256  ISNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
             IS P + +R+ RNP  +N GKFM L DFL F  N   +SG++I++E+A ++AE+ G  + 
Sbjct  448   ISTPLSTYRMDRNPRYRNAGKFMRLSDFLDFTKNK-DLSGIMISIEHATFVAEELGFDMV  506

Query  1076  DAVLLALNKA---DLKTKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTILEI  909
             D V+ AL  A   +  T+KVMI S +SSVL KF   +KY+ VY I EE+ D   S++++I
Sbjct  507   DTVIKALGDAGYNNQTTQKVMIQSTNSSVLEKFKQQTKYDLVYMINEEVRDATPSSLVDI  566

Query  908   KKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPY  729
             KKFAS+V +  SSVFP    F +  TN+V  LQ + + VYV    NEFVSQ +DFF+D  
Sbjct  567   KKFASAVSVDTSSVFPEPHHFTMYKTNLVQTLQTAGLSVYVYTLMNEFVSQPYDFFADAT  626

Query  728   VELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMSPQ  552
             V++N+YV GA     DG+IT FPATA RY+ N C+      P +M P   G L+Q++S  
Sbjct  627   VQINAYVKGAGV---DGLITDFPATARRYKVNSCMNMGNSAPIFMAPPRAGDLMQIISKL  683

Query  551   YLPPAEAPYPVLTESDVVEPPLPP  480
               PPA AP P+LT+SDV EPPLPP
Sbjct  684   AQPPALAPMPLLTDSDVAEPPLPP  707



>ref|XP_009390640.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Musa acuminata subsp. malaccensis]
Length=755

 Score =   273 bits (699),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 160/325 (49%), Positives = 205/325 (63%), Gaps = 12/325 (4%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVS-IPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             Q+T+D I  CM SV++I+ TT  +   N   S IP+LK    I +F+L W +IQ L+  I
Sbjct  392   QVTQDRILICMSSVDLIEDTTVTKSPYNSRFSFIPKLKRTAGIFTFNLTWNEIQKLKPII  451

Query  1253  SNPFAKFRLF-RNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
             S PF +   F RNP  KN G F  L DFL  A N  SVSG+LI++ENA ++AE+  + V 
Sbjct  452   SQPFYQLYHFERNPRNKNSGNFTKLSDFLALANNK-SVSGILISIENAVFMAEQLRIDVV  510

Query  1076  DAVLLALNKADLKT--KKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
             DAV+ ALN         KVMI S DSS+L+KF   +KY+ VY I E I D   S+I +I 
Sbjct  511   DAVISALNDVGYNKTPSKVMIQSTDSSLLVKFKQLTKYKLVYKIDEVIGDAIASSIKDID  570

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
              FA++V + K S++P ++ F    T +V KLQA+ + VYV +  NEFVSQ WDF SD  V
Sbjct  571   AFANAVALRKESIYPVNNLFTTEQTGLVPKLQAAGLDVYVYVLLNEFVSQPWDFLSDATV  630

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRC--LGYKEIPPYMLPVGPGSLLQLMSPQ  552
             E+N+YV GA     DG+IT FP TA+RY+RN C  LG K+ P YMLP+  G LL LM+P 
Sbjct  631   EINAYVVGAGV---DGIITDFPRTASRYKRNSCSKLGSKK-PNYMLPIEAGQLLPLMAPA  686

Query  551   YLPPAEAPYPVLTESDVVEPPLPPV  477
               PPA AP PVL  SDVVEPP P V
Sbjct  687   VQPPALAPMPVLNASDVVEPPFPQV  711



>ref|XP_008361197.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Malus domestica]
Length=773

 Score =   274 bits (700),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 146/326 (45%), Positives = 209/326 (64%), Gaps = 12/326 (4%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  1251
             QM+ DG+ FC+ ++++  GT A  QF   + +IPEL+ +  + SF L+W DIQSL+ QI 
Sbjct  399   QMSSDGVAFCLDTIDLNSGTNALSQFMTKSDTIPELQAEAGVFSFQLSWSDIQSLKPQIQ  458

Query  1250  NPFA-KFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             +P+  K ++ RNP  K+ GK +TL +FL FA    + +G+LI +ENAAYLA K GL +  
Sbjct  459   SPYGTKEKIVRNPANKDAGKLVTLKEFLEFAKK-NAATGILINIENAAYLASKAGLDIVG  517

Query  1073  AVLLALNKADL---KTKKVMIHSNDSSVLMKFTNSK-YERVYGIKEEISDIQNSTILEIK  906
              V  AL+ A L    T++V+I S+D+SVL KF +SK Y+RV+ IKE+ISD    ++ EIK
Sbjct  518   TVSSALSNATLDKQSTQQVLIKSDDTSVLSKFKDSKNYKRVFNIKEKISDAPKESVAEIK  577

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             K+A +VI+ K S+    D F+ G TNVV +++A+ + VY     NEFVS  +D+FSDP  
Sbjct  578   KYADAVIVTKDSIVKITDYFISGTTNVVKEMKAANISVYAHWMKNEFVSLMFDYFSDPMT  637

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYK---EIPPYMLPVGPGSLLQLMSP  555
             E+ SY  G      DG++T FP TA++Y R+ C        +P  +LPV PGSL  L++P
Sbjct  638   EIASYAQGFQV---DGIVTDFPGTASKYMRSPCTDMDPKANVPYAILPVEPGSLSSLIAP  694

Query  554   QYLPPAEAPYPVLTESDVVEPPLPPV  477
             + L PA+AP   L  S VV+PPLP V
Sbjct  695   EALSPAQAPSQALQTSKVVDPPLPEV  720



>ref|NP_001053060.1| Os04g0472300 [Oryza sativa Japonica Group]
 emb|CAE02867.2| OSJNBb0022F23.4 [Oryza sativa Japonica Group]
 dbj|BAF14974.1| Os04g0472300 [Oryza sativa Japonica Group]
 dbj|BAG91894.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE61172.1| hypothetical protein OsJ_15144 [Oryza sativa Japonica Group]
Length=740

 Score =   273 bits (697),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 148/324 (46%), Positives = 211/324 (65%), Gaps = 11/324 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDI-QSLQAQ  1257
             Q+TKDGIP CM S+N++D TT A+ QF++    I ++++   + +F+L W DI ++L+ +
Sbjct  388   QLTKDGIPICMSSINLMDDTTVAKSQFASQTAVIKDIESVLGVFTFNLTWDDIVKNLRPK  447

Query  1256  ISNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
             IS PF+ F+L RNP  +N G FM L DFL F  +   +SG++I+VE+AA++AE+ G  + 
Sbjct  448   ISTPFSSFKLDRNPRYRNAGNFMRLSDFLDFTKD-KDLSGIMISVEHAAFVAEELGFDMV  506

Query  1076  DAVLLALNKA---DLKTKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTILEI  909
             D+V+  L+ A   +   +KVMI S++SSVL+KF   +KY+ VY I EE+ D   S++  I
Sbjct  507   DSVIKTLDAAGYSNQTAQKVMIQSSNSSVLVKFKQQTKYDLVYMINEEVKDAAPSSLAAI  566

Query  908   KKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPY  729
             KKFA +V +  +S+FP +  F    TN+V  LQ + + VYV    NEF SQ +DFFSD  
Sbjct  567   KKFADAVSVEGNSIFPENRHFTTYQTNLVESLQNAGLPVYVYTLMNEFASQPYDFFSDAT  626

Query  728   VELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMSPQ  552
              ++N+YV GA  N   GVIT FPATA RY+ N C+      P +M P  PG LLQ++S  
Sbjct  627   AQINAYVQGAGVN---GVITDFPATARRYKLNTCMHMGNNTPSFMAPARPGDLLQIISKP  683

Query  551   YLPPAEAPYPVLTESDVVEPPLPP  480
               PPA +P P+LT SDV EPPLPP
Sbjct  684   AQPPAMSPMPLLTGSDVAEPPLPP  707



>emb|CAH67272.1| B0806H07.1 [Oryza sativa Indica Group]
 gb|EEC77457.1| hypothetical protein OsI_16271 [Oryza sativa Indica Group]
Length=740

 Score =   273 bits (697),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 148/324 (46%), Positives = 211/324 (65%), Gaps = 11/324 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDI-QSLQAQ  1257
             Q+TKDGIP CM S+N++D TT A+ QF++    I ++++   + +F+L W DI ++L+ +
Sbjct  388   QLTKDGIPICMSSINLMDDTTVAKSQFASQTAVIKDIESVLGVFTFNLTWDDIVKNLRPK  447

Query  1256  ISNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
             IS PF+ F+L RNP  +N G FM L DFL F  +   +SG++I+VE+AA++AE+ G  + 
Sbjct  448   ISTPFSSFKLDRNPRYRNAGNFMRLSDFLDFTKD-KDLSGIMISVEHAAFVAEELGFDMV  506

Query  1076  DAVLLALNKA---DLKTKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTILEI  909
             D+V+  L+ A   +   +KVMI S++SSVL+KF   +KY+ VY I EE+ D   S++  I
Sbjct  507   DSVIKTLDAAGYSNQTAQKVMIQSSNSSVLVKFKQQTKYDLVYMINEEVKDAAPSSLAAI  566

Query  908   KKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPY  729
             KKFA +V +  +S+FP +  F    TN+V  LQ + + VYV    NEF SQ +DFFSD  
Sbjct  567   KKFADAVSVEGNSIFPENRHFTTYQTNLVESLQNAGLPVYVYTLMNEFASQPYDFFSDAT  626

Query  728   VELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMSPQ  552
              ++N+YV GA  N   GVIT FPATA RY+ N C+      P +M P  PG LLQ++S  
Sbjct  627   AQINAYVQGAGVN---GVITDFPATARRYKLNTCMHMGNNTPSFMAPARPGDLLQIISKP  683

Query  551   YLPPAEAPYPVLTESDVVEPPLPP  480
               PPA +P P+LT SDV EPPLPP
Sbjct  684   AQPPAMSPMPLLTGSDVAEPPLPP  707



>emb|CDX82242.1| BnaA03g35790D [Brassica napus]
Length=443

 Score =   265 bits (677),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 145/328 (44%), Positives = 204/328 (62%), Gaps = 19/328 (6%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTA-AQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+KD IPFCM S+++++ T      F NL+ ++ E++ ++ I++F L    I++L+  I
Sbjct  91    QMSKDKIPFCMSSIDLLNTTNVFDTSFRNLSSTVAEIQPKSGIYTFSLTMSQIKTLKPVI  150

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             +NP     LFRNP  KN GKF+TL +FL  A    S+ GVLI VENA YLA+ +G+ V D
Sbjct  151   TNPKEDHALFRNPRNKNVGKFLTLSEFLFLANRYNSLLGVLIKVENAVYLAKHQGISVVD  210

Query  1073  AVL-----LALNKADLKTKKVMIHSNDSSVLMKFTNSKY----ERVYGIKEEISDIQNST  921
             AVL     L+  +    +  +M  S D SVLM F   K     E VY + E+I D+ +S 
Sbjct  211   AVLNKTERLSTQEGQTTSIAIMFQSTDKSVLMDFKKKKLIYPDELVYRVDEDIRDVTDSA  270

Query  920   ILEIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFF  741
             I EI  FA +++I K SV P +   +   T+VVA+L+AS  +VYV+ FSNEFV+Q +D F
Sbjct  271   IKEIMSFAGTIVISKESVLPYNGGLVKKKTDVVARLKASGFRVYVETFSNEFVTQPFDLF  330

Query  740   SDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLM  561
             SD  VE+N +V G      DG+IT FPAT  RYR+++C  Y+E+  +      G LL   
Sbjct  331   SDSTVEINFFVQGVK---IDGIITDFPATTARYRKSQC--YREMGMFR----TGELLPFA  381

Query  560   SPQYLPPAEAPYPVLTESDVVEPPLPPV  477
             +P+ L PA+APYP+L ESDV+EPPLP V
Sbjct  382   NPRLLSPAQAPYPLLVESDVMEPPLPDV  409



>ref|XP_002325146.2| hypothetical protein POPTR_0018s11890g [Populus trichocarpa]
 gb|EEF03711.2| hypothetical protein POPTR_0018s11890g [Populus trichocarpa]
Length=751

 Score =   272 bits (696),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 149/328 (45%), Positives = 211/328 (64%), Gaps = 13/328 (4%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  1251
             QM+KDG+ FC+ SV++   TTAA  F +L+ +IPE++    I SFDL+W DIQ+LQ Q++
Sbjct  385   QMSKDGVAFCLDSVDVTRDTTAAASFMSLSTTIPEIQESAGIFSFDLSWSDIQTLQPQLT  444

Query  1250  NPFA-KFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             +PF  K  L RNP  K++GKF+TL +FL  A    +V+G+LI +ENAAYLA +KGL +  
Sbjct  445   SPFENKGGLPRNPANKSKGKFLTLAEFLELA-KVKAVTGILINIENAAYLASQKGLDIVS  503

Query  1073  AVLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
             AV  A   A L    T+KV+I S+D+SVL KF N   Y RV  +K+EISD   + + EIK
Sbjct  504   AVNTAFGNATLGKESTQKVLIQSDDTSVLSKFKNVPAYSRVLYLKDEISDAPRTPVEEIK  563

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             K+A +V + + S+ PT + F  G T VV ++QA+ + VYV +  NEF++  +D+FSDP +
Sbjct  564   KYADAVTLPRFSIVPTVNGFTTGTTKVVNEMQAANISVYVSVLRNEFITLPFDYFSDPTI  623

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPP---YMLPVGPGSLLQLMSP  555
             E+ +Y  G      DG+IT +PATA+RY RN C     +P     ++P   GSLL+ +  
Sbjct  624   EIATYTSGIGV---DGIITEYPATASRYLRNPC-SSNSMPDSSYSIIPAEAGSLLKTVPE  679

Query  554   QYLPPAEAPYPVLTESDVVEPPLPPVAK  471
             +  PPA  P P L  +DVV+PPLP V K
Sbjct  680   ETQPPASTPTPALDVADVVDPPLPAVTK  707



>ref|XP_011033465.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL6-like 
[Populus euphratica]
Length=744

 Score =   272 bits (695),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 147/327 (45%), Positives = 210/327 (64%), Gaps = 11/327 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  1251
             QM+KDG+ FC+ SV++   TTAA  F +L+ +IPE++  + I SFDL+W DIQ+LQ Q++
Sbjct  385   QMSKDGVAFCLDSVDVTRDTTAAATFMSLSTTIPEIQQSSGIFSFDLSWSDIQTLQPQLT  444

Query  1250  NPFA-KFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             +PF  K  L RNP  KN+GKF++L +FL  A    +V+G+LI +ENAAYLA +KGL +  
Sbjct  445   SPFENKGGLPRNPANKNKGKFLSLAEFLELA-KVKAVTGILINIENAAYLASQKGLDIVS  503

Query  1073  AVLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
             AV  AL  A      T+KV+I S+D+SVL KF N   Y RV  +K+EI D   + + EIK
Sbjct  504   AVNTALGNATFDKQSTQKVLIQSDDTSVLSKFQNVPAYSRVLYLKDEIGDAPKTPVGEIK  563

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             K+A +V + + S+ PT D F    T VV ++ A+ + VYV +  NEFV+ A+D+F+DP +
Sbjct  564   KYADAVTLPRFSIVPTSDGFTTATTKVVNEMHAANISVYVTVLRNEFVTLAFDYFADPTI  623

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCL--GYKEIPPYMLPVGPGSLLQLMSPQ  552
             E+ +Y  G      DG+IT +PATA+RY RN C      E    ++P   GSLL+ +  +
Sbjct  624   EIATYTSGIGV---DGIITEYPATASRYLRNPCSSDSMPESSYSIIPAEAGSLLKTVPEE  680

Query  551   YLPPAEAPYPVLTESDVVEPPLPPVAK  471
               PPA +P P L  +D+V+PPLP V K
Sbjct  681   TQPPASSPTPALDVADIVDPPLPAVTK  707



>ref|XP_006652401.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Oryza brachyantha]
Length=745

 Score =   272 bits (695),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 148/324 (46%), Positives = 207/324 (64%), Gaps = 11/324 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDI-QSLQAQ  1257
             Q+TKDGIP C+ SVN++D TT A+ QF++    I ++++   + +F+L W DI ++L+ +
Sbjct  389   QLTKDGIPICISSVNLMDDTTVAKSQFASQTAVIKDIESVLGVFTFNLTWDDIVKNLRPK  448

Query  1256  ISNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
             IS PF+ F+L RNP  +N G FM L DFL F  +   +SG++I VE+AA+ AEK G  + 
Sbjct  449   ISTPFSSFKLDRNPRYRNAGNFMRLSDFLDFTKD-KELSGIMINVEHAAFAAEKLGFDMV  507

Query  1076  DAVLLALNKA---DLKTKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTILEI  909
             DAV+  L+ A   +   +KVMI S +SSVL+KF   +KY+ VY + EE+ D + S++  I
Sbjct  508   DAVIKTLDAAGYSNQTAQKVMIQSANSSVLVKFKQQTKYDLVYMVNEEVKDAEPSSLAAI  567

Query  908   KKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPY  729
             KKFA +V +  SS+FP +  F    TN+V  L  + + VYV    NEF SQ +DFFSD  
Sbjct  568   KKFADAVSVEGSSIFPENHHFTTYRTNLVESLHKAGLPVYVYTLMNEFASQPYDFFSDAT  627

Query  728   VELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMSPQ  552
              ++N+YV GA     DGVIT FPATA RY+ N C+      P +M P  PG L+Q++S  
Sbjct  628   AQINAYVQGAGV---DGVITDFPATARRYKLNTCMNMGNNTPSFMAPAHPGDLMQIISKP  684

Query  551   YLPPAEAPYPVLTESDVVEPPLPP  480
               PP  AP P+LT SDV EPPLPP
Sbjct  685   AQPPEMAPMPLLTGSDVAEPPLPP  708



>ref|XP_009126781.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 isoform X1 [Brassica rapa]
Length=738

 Score =   271 bits (694),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 159/324 (49%), Positives = 207/324 (64%), Gaps = 8/324 (2%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  1251
             QMTKDG+ FC+ S ++I  TTAA      A S+PE+++++ I SFDL W +IQSL+ QI 
Sbjct  377   QMTKDGMAFCLDSTDLIPTTTAATTLMTRATSVPEIQSKSGIFSFDLTWAEIQSLKPQIQ  436

Query  1250  NPFAKFRLF-RNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             +PF     F RNP  KN GKFMTL DFL F+  A +V+GVLI V+NAAYLA KKGLG+ D
Sbjct  437   SPFLAADGFPRNPKNKNAGKFMTLADFLKFS-KAKAVTGVLINVQNAAYLASKKGLGIVD  495

Query  1073  AVLLALNKADLKTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIKKFA  897
             AV  AL  + L  KKV+I S+DSSVL  F    +Y RV  I +EI D    TI EIKK A
Sbjct  496   AVKSALTSSKLD-KKVLIQSDDSSVLDSFKAVPQYTRVLSIDKEIGDAPKPTIEEIKKHA  554

Query  896   SSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELN  717
              +V + +SS+     SF  G T VV  +    + VYV +  NE++S  +D+FSDP VEL 
Sbjct  555   DAVNVLRSSLVTISQSFATGKTKVVEAMHKGNISVYVSVLRNEYLSITFDYFSDPTVELA  614

Query  716   SYVFGASANPFDGVITGFPATANRYRRNRCLG-YKEIPPYMLPVGPGSLLQLMSPQYLPP  540
             +++ G   N  DGVIT FPATA RY R+ C   Y+E+   +LP   G+L+ + S +  PP
Sbjct  615   TFIAG---NGVDGVITEFPATATRYLRSPCSDLYRELSFAILPAKAGTLVSVASKEAQPP  671

Query  539   AEAPYPVLTESDVVEPPLPPVAKI  468
             A AP P L   DV++PPLPPVA +
Sbjct  672   ASAPNPPLDAKDVIDPPLPPVANL  695



>ref|XP_009126782.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 isoform X2 [Brassica rapa]
Length=756

 Score =   271 bits (694),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 159/324 (49%), Positives = 207/324 (64%), Gaps = 8/324 (2%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  1251
             QMTKDG+ FC+ S ++I  TTAA      A S+PE+++++ I SFDL W +IQSL+ QI 
Sbjct  395   QMTKDGMAFCLDSTDLIPTTTAATTLMTRATSVPEIQSKSGIFSFDLTWAEIQSLKPQIQ  454

Query  1250  NPFAKFRLF-RNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             +PF     F RNP  KN GKFMTL DFL F+  A +V+GVLI V+NAAYLA KKGLG+ D
Sbjct  455   SPFLAADGFPRNPKNKNAGKFMTLADFLKFS-KAKAVTGVLINVQNAAYLASKKGLGIVD  513

Query  1073  AVLLALNKADLKTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIKKFA  897
             AV  AL  + L  KKV+I S+DSSVL  F    +Y RV  I +EI D    TI EIKK A
Sbjct  514   AVKSALTSSKLD-KKVLIQSDDSSVLDSFKAVPQYTRVLSIDKEIGDAPKPTIEEIKKHA  572

Query  896   SSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELN  717
              +V + +SS+     SF  G T VV  +    + VYV +  NE++S  +D+FSDP VEL 
Sbjct  573   DAVNVLRSSLVTISQSFATGKTKVVEAMHKGNISVYVSVLRNEYLSITFDYFSDPTVELA  632

Query  716   SYVFGASANPFDGVITGFPATANRYRRNRCLG-YKEIPPYMLPVGPGSLLQLMSPQYLPP  540
             +++ G   N  DGVIT FPATA RY R+ C   Y+E+   +LP   G+L+ + S +  PP
Sbjct  633   TFIAG---NGVDGVITEFPATATRYLRSPCSDLYRELSFAILPAKAGTLVSVASKEAQPP  689

Query  539   AEAPYPVLTESDVVEPPLPPVAKI  468
             A AP P L   DV++PPLPPVA +
Sbjct  690   ASAPNPPLDAKDVIDPPLPPVANL  713



>emb|CDY32720.1| BnaA02g07820D [Brassica napus]
Length=752

 Score =   271 bits (693),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 158/324 (49%), Positives = 206/324 (64%), Gaps = 8/324 (2%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  1251
             QMTKDG+ FC+ S ++I  TTAA      A S+PE++++N I SFDL W +IQSL+ QI 
Sbjct  391   QMTKDGMAFCLDSTDLIPTTTAATTLMTRATSVPEIQSKNGIFSFDLTWAEIQSLKPQIQ  450

Query  1250  NPFAKFRLF-RNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             +PF     F RNP  KN GKFMTL DFL F+    +V+GVLI V+NAAYLA KKGLG+ D
Sbjct  451   SPFLAADGFPRNPKNKNAGKFMTLADFLNFS-KTKAVTGVLINVQNAAYLASKKGLGIVD  509

Query  1073  AVLLALNKADLKTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIKKFA  897
             AV  AL  + L  KKV+I S+DSSVL  F    +Y RV  I +EI D    TI EIKK A
Sbjct  510   AVKSALTSSKLD-KKVLIQSDDSSVLDSFKAVPQYTRVLSIDKEIGDAPKPTIEEIKKHA  568

Query  896   SSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELN  717
              +V + +SS+     SF  G T +V  +    + VYV +  NE++S  +D+FSDP VEL 
Sbjct  569   DAVNVLRSSLVTISQSFATGKTKIVEAMHKGNISVYVSVLRNEYLSITFDYFSDPTVELA  628

Query  716   SYVFGASANPFDGVITGFPATANRYRRNRCLG-YKEIPPYMLPVGPGSLLQLMSPQYLPP  540
             +++ G   N  DGVIT FPATA RY R+ C   Y+E+   +LP   G+L+ + S +  PP
Sbjct  629   TFIAG---NGVDGVITEFPATATRYLRSPCSDLYRELSFAILPAKAGTLVSVASKEAQPP  685

Query  539   AEAPYPVLTESDVVEPPLPPVAKI  468
             A AP P L   DV++PPLPPVA +
Sbjct  686   ASAPNPPLDAKDVMDPPLPPVANL  709



>ref|XP_010536984.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Tarenaya hassleriana]
Length=745

 Score =   270 bits (691),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 152/325 (47%), Positives = 202/325 (62%), Gaps = 10/325 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  1251
             QM+KDG+ FC  S +++  TTA   F + A ++PE++  N I SFDL W +I SL+ QI 
Sbjct  386   QMSKDGMAFCQDSADLMPSTTAITTFMSRASTVPEIQATNGIFSFDLTWAEIISLKPQIE  445

Query  1250  NPFAKFRLF-RNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             +PF     F RNP  KN G FMTL DFL FA  A +V+GVLI ++NAAYLA KKG+GV D
Sbjct  446   SPFLTSTGFQRNPANKNVGNFMTLTDFLEFA-KAKAVTGVLINIQNAAYLASKKGIGVVD  504

Query  1073  AVLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
              V  AL  A L    T+KV+I S+DSSVL  F     Y RV  I +EI D    ++ EIK
Sbjct  505   VVKSALINATLDKQSTQKVLIQSDDSSVLTSFQGMPSYSRVLSIDKEIGDAPKPSVEEIK  564

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             K+A +V + ++S+     SF    TNVV ++    + VYV +  NE++S A+D+FSDP V
Sbjct  565   KYADAVNLKRTSLVSISHSFTTAKTNVVEEMHKGNISVYVSVLRNEYISIAFDYFSDPTV  624

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMSPQY  549
             EL +++ G   N  DGV+T FPATA+RY R  C    +  PY +LP  PG+LL + + + 
Sbjct  625   ELATFIAG---NGVDGVVTEFPATASRYLRTPCADLNKDQPYAILPAEPGALLSVAAKEA  681

Query  548   LPPAEAPYPVLTESDVVEPPLPPVA  474
              PP  A  P L   DVV+PPLPPVA
Sbjct  682   QPPVGALNPPLEAKDVVDPPLPPVA  706



>ref|XP_010943202.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Elaeis guineensis]
Length=770

 Score =   271 bits (692),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 154/326 (47%), Positives = 213/326 (65%), Gaps = 9/326 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  1251
             QM+KDG+ FC+ S +++  TTA   F + +  +PE++  N I SFDL W +I+SL+  ++
Sbjct  406   QMSKDGVAFCLDSADLVGDTTAMDSFMSRSALVPEIQKNNGIFSFDLTWSEIESLKPLLA  465

Query  1250  NPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDA  1071
             NPF+   L RNP AKN+GKFMTL  FL FA  +T VSG+LI++ENA YLA KKGL + +A
Sbjct  466   NPFSSTNLVRNPAAKNQGKFMTLAKFLDFAKTST-VSGILISIENAPYLASKKGLDIVNA  524

Query  1070  VLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIKK  903
             V  AL  A      T+KV+I S+D+SVL  F N S Y+RV+ + E ISD   S + EIKK
Sbjct  525   VSSALINASYDKQTTQKVLIQSDDTSVLSTFKNSSSYKRVFKVGETISDASKSAVDEIKK  584

Query  902   FASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVE  723
             +A +V++ K+S+  + +SFL G T V  K+ A+ + +YV    NEFVS  +D FSDP VE
Sbjct  585   YADAVVVSKTSLIASSNSFLTGFTAVRDKMHAANLSIYVLGLRNEFVSIPFDCFSDPLVE  644

Query  722   LNSYVFGASANPFDGVITGFPATANRYRRNRCLGYK-EIPPYMLPVGPGSLLQLMSPQYL  546
             + +Y  G      DG+IT +PAT + Y R+ C   +  +P  +L V PGSLL+   P+ L
Sbjct  645   MATYAAGLGV---DGIITEYPATVSAYFRSPCSDMEANLPFTILGVEPGSLLKEAQPEVL  701

Query  545   PPAEAPYPVLTESDVVEPPLPPVAKI  468
             PPA+AP P L   D+V+PPLPPV KI
Sbjct  702   PPAQAPAPALDAVDIVDPPLPPVVKI  727



>ref|XP_009366150.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Pyrus x bretschneideri]
Length=777

 Score =   271 bits (692),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 147/328 (45%), Positives = 210/328 (64%), Gaps = 12/328 (4%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  1251
             QM+ DG+ FC+ + ++  GT A  QF   + +IPEL+ +  + SF L+W DI+SL+ Q+ 
Sbjct  399   QMSSDGVAFCLDTPDLNSGTNALSQFMTKSETIPELQAEAGVFSFQLSWSDIKSLKPQMQ  458

Query  1250  NPFA-KFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             +P+  K ++ RNP  K+ GK +TL++FL FA    +V+G+LI +E AAYLA K GL V  
Sbjct  459   SPYGTKEKIVRNPANKHAGKLVTLNEFLEFAKK-NAVTGILINIEYAAYLASKAGLDVVG  517

Query  1073  AVLLALNKADL---KTKKVMIHSNDSSVLMKFTNSK-YERVYGIKEEISDIQNSTILEIK  906
              V  AL+ A      T++V+I S+D+SVL KF ++K Y+RV  IKE+ISD    ++ EIK
Sbjct  518   TVSSALSNATFDKQSTQQVLIESDDTSVLAKFKDTKNYKRVLNIKEKISDATKESVAEIK  577

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             K+A +V I K S+    D F+ G TNVV +++A+ + VY     NEFVS  +D+FSDP  
Sbjct  578   KYADAVTITKDSIVKITDYFISGTTNVVKEMKAANITVYAHWLRNEFVSLMFDYFSDPIT  637

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYK---EIPPYMLPVGPGSLLQLMSP  555
             E+ SYV G      DG++T FP TA++Y R+ C        +P  +LPV PG+L  L+ P
Sbjct  638   EIASYVQGFEV---DGIVTDFPGTASKYMRSPCSDTDPKASVPYAILPVEPGALSGLIGP  694

Query  554   QYLPPAEAPYPVLTESDVVEPPLPPVAK  471
             + L PAEAP P L  S+VV+PPLP VAK
Sbjct  695   EALSPAEAPSPALQVSNVVDPPLPGVAK  722



>ref|XP_008645878.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Zea mays]
 gb|AFW72077.1| hypothetical protein ZEAMMB73_869244 [Zea mays]
Length=750

 Score =   270 bits (690),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 151/327 (46%), Positives = 210/327 (64%), Gaps = 12/327 (4%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDI-QSLQAQ  1257
             Q+TKDGI  CM SV+++D TT  +  F++   +I +LK    + +F+L W DI ++LQ  
Sbjct  394   QVTKDGILICMSSVDLMDVTTVGKSSFTSQVTTINDLKAGPGVFTFNLTWDDISKNLQPM  453

Query  1256  ISNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
             ISNP + ++L+RNP  KN G FM L DFLTFA     +SG++ITVE+AA++AEK G GV 
Sbjct  454   ISNPMSTYKLYRNPRNKNAGNFMRLSDFLTFA-KGKDLSGIMITVEHAAFMAEKLGFGVV  512

Query  1076  DAVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEI  909
             DAV+ AL+ +       + VMI S +SSVL KF   +KY  VY I+E + D   S++ +I
Sbjct  513   DAVVKALDDSGYSKQTAQNVMIQSTNSSVLKKFKQETKYSLVYMIEEGVRDAAPSSLADI  572

Query  908   KKFASSVIIGKSSVFPTDDSFLVGVTN-VVAKLQASKVKVYVQLFSNEFVSQAWDFFSDP  732
             KKFA++V +  +SV P    +L   TN +V  LQ++ ++VYV +  NEF SQ  DFF+D 
Sbjct  573   KKFANAVSVSTTSVLPQTHYYLTNQTNKLVTSLQSAGLQVYVYVLMNEFASQPNDFFADA  632

Query  731   YVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMSP  555
               ++N+YV GA     DG+IT FP TA+RY+ N C       P +M P  PGSLL  M+P
Sbjct  633   TSQINAYVQGAKV---DGIITDFPGTAHRYKLNSCTSMGNSAPLFMQPPQPGSLLLTMAP  689

Query  554   QYLPPAEAPYPVLTESDVVEPPLPPVA  474
                PPA AP P+LT++DV EP LPPV+
Sbjct  690   DVQPPAAAPMPLLTDADVAEPALPPVS  716


 Score = 52.4 bits (124),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 73/280 (26%), Positives = 125/280 (45%), Gaps = 44/280 (16%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPE-LKTQNAIHSFDLNW--KDIQSLQA  1260
             ++TKDG   C+ S+NM + T     F       PE  KT N      + W   D  S   
Sbjct  81    RLTKDGDGICLPSINMDNCTMIDNVF-------PEGKKTYNVNGVSTVGWFSVDYTSTDL  133

Query  1259  QISNPFAKFRLFRNPVAKNEGKFMTLDD-FLTFAANATSVSGVLITVENAAYLAEKKGLG  1083
               +    +  L R PV        ++++ F +F A+A     V + V+  ++ ++ K   
Sbjct  134   LPNVTLKQSVLSRTPVYDGSMLINSVENVFTSFNASA-----VWLNVQQDSFYSQFK---  185

Query  1082  VTDAVLLALNKADLKTKKVMIHSNDSSVLMKFTNSKYERVY------------GIKEEIS  939
                   L++    L   K  I    SS  + F  S   RV             G  E  +
Sbjct  186   ------LSMRNYILSLSKQFITDYISSPEVNFLTSISGRVSKKTKLVFRFLDEGSIEPST  239

Query  938   DIQNSTILE----IKKFASSVIIGKSSVFP-TDDSFLVGVTNVVAKLQASKVKVYVQLFS  774
             +    ++L+    +K FAS +++ KS ++P T D++L+  T+VV     + +++Y   F+
Sbjct  240   NQTYGSMLKNLTFVKTFASGILVPKSYIWPVTPDNYLLPYTSVVDDAHKAGLEIYAADFA  299

Query  773   NEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  654
             N+F + ++++  DP  E  S++ G SA   DGV+T FP T
Sbjct  300   NDF-TISYNYSFDPLAEYLSFI-GNSAFSVDGVLTDFPIT  337



>ref|NP_200613.2| glycerophosphodiester phosphodiesterase like 6 [Arabidopsis thaliana]
 sp|Q9FGT9.1|GPDL6_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase GDPDL6; 
AltName: Full=Glycerophosphodiester phosphodiesterase-like 
6; Short=ATGDPDL6; AltName: Full=Glycerophosphodiesterase-like 
5; AltName: Full=Protein SHV3-LIKE 4; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB10996.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL66999.1| putative aluminium tolerance associated protein [Arabidopsis 
thaliana]
 gb|AAN71947.1| putative aluminium tolerance associated protein [Arabidopsis 
thaliana]
 gb|AED96991.1| glycerophosphodiester phosphodiesterase like 6 [Arabidopsis thaliana]
Length=753

 Score =   269 bits (688),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 150/326 (46%), Positives = 200/326 (61%), Gaps = 9/326 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  1251
             QM+KDGI FC  + ++   TTA   F + A S+PE++  N I SFDL W +IQS++ QI 
Sbjct  391   QMSKDGIAFCHDAADLSASTTARTTFMSRATSVPEIQPTNGIFSFDLTWAEIQSVKPQIE  450

Query  1250  NPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDA  1071
             NPF      RNP  KN GKF TL DFL     A +V+GVLI ++NAAYLA KKGLGV D 
Sbjct  451   NPFTATGFQRNPANKNAGKFTTLADFLEL-GKAKAVTGVLINIQNAAYLASKKGLGVVDV  509

Query  1070  VLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIKK  903
             V  AL  + L    T+KV+I S+DSSVL  F     Y RV  I +EI D   ++I EIKK
Sbjct  510   VKSALTNSTLDKQSTQKVLIQSDDSSVLSSFEAVPPYTRVLSIDKEIGDAPKTSIEEIKK  569

Query  902   FASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVE  723
              A +V + ++S+     SF  G TNVV ++  + + VYV +  NE+++ A+D+FSDP +E
Sbjct  570   HADAVNLLRTSLITVSQSFATGKTNVVEEMHKANISVYVSVLRNEYIAIAFDYFSDPTIE  629

Query  722   LNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMSPQYL  546
             L +++ G      DGVIT FPATA RY R+ C    +  PY +LP   G+LL +   +  
Sbjct  630   LATFIAGRGV---DGVITEFPATATRYLRSPCSDLNKDQPYAILPADAGALLTVADKEAQ  686

Query  545   PPAEAPYPVLTESDVVEPPLPPVAKI  468
              PA  P P L   DV++PPLPPVAK+
Sbjct  687   LPAIPPNPPLDAKDVIDPPLPPVAKL  712



>ref|XP_008799657.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Phoenix dactylifera]
Length=760

 Score =   269 bits (688),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 153/326 (47%), Positives = 212/326 (65%), Gaps = 9/326 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  1251
             QM+KDG+ FC+ S +++  TTA   F + +  +PE++  N I SFDL W +I+SL+  ++
Sbjct  396   QMSKDGVAFCLDSADLMGDTTAMDSFMSRSALLPEIQKSNGIFSFDLTWSEIESLKPMLA  455

Query  1250  NPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDA  1071
             NP +   L RNP AKN GKFMTL  FL FA ++T VSG+LI +ENA YLA KKGL +  A
Sbjct  456   NPLSSANLVRNPAAKNLGKFMTLAKFLDFAKSST-VSGILINIENAPYLASKKGLDIVTA  514

Query  1070  VLLALNKADLK---TKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTILEIKK  903
             V  AL  A      T+KV+I S+D+SVL  F  NS Y+RV+ ++E ISD     + EIK+
Sbjct  515   VSSALINASYDKQITQKVLIQSDDTSVLSMFKNNSSYKRVFKVEETISDAPKPAVDEIKQ  574

Query  902   FASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVE  723
             FA +V I K+S+  + +SFL   T V+ K+ A+ + VYV    NEFVS  +D FSDP VE
Sbjct  575   FADAVNIAKTSLIASSNSFLTSFTPVMDKMHAANLSVYVTGLRNEFVSIPFDCFSDPTVE  634

Query  722   LNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMSPQYL  546
             + +Y  G +    DG++T FPATA+ Y R+ C   +   P+ +LPV PGSLL+   P+ L
Sbjct  635   IATYAAGLAV---DGIVTEFPATASAYFRSPCSDVEANLPFSILPVEPGSLLKEAQPELL  691

Query  545   PPAEAPYPVLTESDVVEPPLPPVAKI  468
             PP +AP P L  +D+V+PPLPPV K+
Sbjct  692   PPTQAPAPALDAADIVDPPLPPVVKV  717



>ref|XP_010235616.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
isoform X2 [Brachypodium distachyon]
Length=659

 Score =   266 bits (681),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 155/329 (47%), Positives = 215/329 (65%), Gaps = 13/329 (4%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTA-AQQFSNLAVSIPELKTQNAIHSFDLNWKDI-QSLQAQ  1257
             Q+TKDGIP CM S+++ D T     QF++ AV I ++K    +++F+L W+DI ++L+  
Sbjct  299   QVTKDGIPICMSSIDLKDVTNVVTSQFASEAVIIKDIKADAGVYTFNLTWEDIAKNLKPT  358

Query  1256  ISNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
             ISNP +K+  +RNP  +N G FM L DFL FA +   +SG++ITVE A+++AEK G GV 
Sbjct  359   ISNPMSKYNTYRNPRNRNAGNFMKLSDFLAFAKDK-DLSGIMITVERASFMAEKLGFGVV  417

Query  1076  DAVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEI  909
             DAV+ AL+ +       +KVMI S +SSVLMKF   +KY  VY I E++ D   S++ +I
Sbjct  418   DAVIKALDDSGYSKQTAQKVMIQSTNSSVLMKFRQQTKYNLVYMIDEDVKDAAPSSLADI  477

Query  908   KKFASSVIIGKSSVFPTDDSFLVGVTN-VVAKLQASKVKVYVQLFSNEFVSQAWDFFSDP  732
             KKFA +V +   S++P  + FL+  TN VV  LQ++ + VYV L  NEFVSQ +DFFSD 
Sbjct  478   KKFADAVSVSAMSIYPAANKFLINQTNPVVKSLQSAGLPVYVYLLMNEFVSQPYDFFSDA  537

Query  731   YVELNSYV-FGASANPFDGVITGFPATANRYRRNRC--LGYKEIPPYMLPVGPGSLLQLM  561
               ++N+YV         DGVIT FP TA+RY+ N C  +G K+ P +M P   G L+  +
Sbjct  538   TAQINAYVQKDGDGGGVDGVITDFPGTAHRYKLNSCKNMG-KKTPLFMQPPQRGGLVGTI  596

Query  560   S-PQYLPPAEAPYPVLTESDVVEPPLPPV  477
             S P  LPPA +P PVLT+SDV EPPLPPV
Sbjct  597   SDPSALPPAMSPMPVLTDSDVAEPPLPPV  625



>ref|XP_008345027.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Malus domestica]
Length=299

 Score =   255 bits (652),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 131/219 (60%), Positives = 164/219 (75%), Gaps = 7/219 (3%)
 Frame = -3

Query  1121  ENAAYLAEKKGLGVTDAVLLALNKADLKTKK---VMIHSNDSSVLMKFTN-SKYERVYGI  954
             + AAYLAEK+ L +TDAV+  L+KA    +    V I S +SSVLMKF   + YE VY I
Sbjct  40    QYAAYLAEKQKLSITDAVMNTLSKAGFDNQTALDVKIQSTNSSVLMKFKEKTSYELVYKI  99

Query  953   KEEISDIQNSTILEIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFS  774
             +EEI D  +STI  IKKFA SV+I K+S+FP  ++F+ GVT+VV+KLQ +K+ VYV+LFS
Sbjct  100   EEEIGDAPSSTIEGIKKFADSVVINKASIFPZVEAFITGVTDVVSKLQDAKLPVYVELFS  159

Query  773   NEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYML  594
             NEFVSQ WDFFSDP VE+NS+V G +    DGVIT FP TA RY++NRCLG KE+P YM 
Sbjct  160   NEFVSQPWDFFSDPTVEINSFVSGVN---IDGVITDFPKTAARYKKNRCLGRKEVPNYMS  216

Query  593   PVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  477
             P+ P SL+Q+++P YLPPAEAP P L ESDV+EPPLP V
Sbjct  217   PIQPASLIQVVTPSYLPPAEAPNPTLRESDVIEPPLPSV  255



>gb|EMS58329.1| putative glycerophosphoryl diester phosphodiesterase 1 [Triticum 
urartu]
Length=744

 Score =   268 bits (684),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 148/324 (46%), Positives = 211/324 (65%), Gaps = 11/324 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDI-QSLQAQ  1257
             Q+TKDGIP CMGS+N++D TT A+  F++ A  + ++++   + +F+L W DI ++L+ +
Sbjct  388   QVTKDGIPVCMGSINLMDSTTVAKSPFASQAAVMKDIESVLGVFTFNLTWDDIVKNLKPK  447

Query  1256  ISNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
             IS P + F L RNP  +N G FM L DFL F+ +   +SG++I++E+AA+LAE+ G  + 
Sbjct  448   ISTPLSTFSLDRNPRYRNAGNFMRLSDFLDFSKD-KDLSGIMISIEHAAFLAEELGFDMV  506

Query  1076  DAVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEI  909
             DAV+ AL+ +       +KVMI S +SSVL+KF   +KY+ VY I E++SD   S++  I
Sbjct  507   DAVIKALDDSGYNKQTAQKVMIQSTNSSVLVKFKQETKYDLVYMINEDVSDAAPSSLAGI  566

Query  908   KKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPY  729
             KKFA +V +  SSVFP +  F    T++V  LQ + + VY     NEFVSQ +DFFSD  
Sbjct  567   KKFADAVSVETSSVFPENRHFTSHQTDLVESLQTAGLSVYAYNLMNEFVSQPYDFFSDAT  626

Query  728   VELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMSPQ  552
              ++ +YV GA     DG+IT FPATA RY+ N C+    + P +M P  PG LLQL+S  
Sbjct  627   AQIIAYVQGAGV---DGLITDFPATARRYKSNTCVNMGNKTPSFMAPPRPGDLLQLISKP  683

Query  551   YLPPAEAPYPVLTESDVVEPPLPP  480
               PPA AP P+L +SDV EPPLPP
Sbjct  684   AQPPALAPMPLLMDSDVSEPPLPP  707



>ref|XP_003579951.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Brachypodium distachyon]
Length=744

 Score =   268 bits (684),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 142/324 (44%), Positives = 214/324 (66%), Gaps = 13/324 (4%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDI-QSLQAQ  1257
             Q+TKDGIP CMGS+N++DGTT A+  F++    + ++++   + +F+L W+DI ++L+ +
Sbjct  389   QITKDGIPVCMGSINLMDGTTVAKSPFASQIAVMKDIQSVLGVFTFNLTWEDIVKNLKPK  448

Query  1256  ISNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
             IS P + F L RNP  +N G FM L DFL F+ +   +SG++I++E+AA+LAE+ G  + 
Sbjct  449   ISTPLSTFALDRNPRYRNAGNFMRLSDFLDFSKD-KDLSGIMISIEHAAFLAEELGFDMV  507

Query  1076  DAVLLALNKADLK---TKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTILEI  909
             DAV+ AL+ +       +K+MI S +SSVL+KF   +KY+ VY I E++ D   S++ +I
Sbjct  508   DAVIKALDASGYNKQTAQKIMIQSTNSSVLVKFKQQTKYDLVYMINEDVRDAAPSSLADI  567

Query  908   KKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPY  729
             KKFAS+V +   S+FP +  FL   + +V  L+ + + +Y     NEF+SQ +DFFSD  
Sbjct  568   KKFASAVSVDTGSIFPENHHFLTSPSGLVQSLKTANLSIYAYTLMNEFLSQPYDFFSDAT  627

Query  728   VELNSYVFGASANPFDGVITGFPATANRYRRNRC--LGYKEIPPYMLPVGPGSLLQLMSP  555
              ++N+YV GA     DG+IT +PATA RY+ N C  +G K+ P +M P  PG LLQ++S 
Sbjct  628   AQINAYVQGAKV---DGLITDYPATARRYKLNACKNMG-KKAPSFMAPARPGDLLQIISK  683

Query  554   QYLPPAEAPYPVLTESDVVEPPLP  483
                PPA AP P+L +SDV EPPLP
Sbjct  684   PAQPPALAPMPLLVDSDVTEPPLP  707



>ref|XP_009385529.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Musa acuminata subsp. malaccensis]
Length=622

 Score =   265 bits (677),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 159/326 (49%), Positives = 214/326 (66%), Gaps = 9/326 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  1251
             QM+KDG+ FC+ S +++  TTA + F   A  +PE++ +N I SFDL W +IQSL+ +++
Sbjct  258   QMSKDGVVFCLDSADLMGHTTAIKTFMPRATVVPEIQKENGIFSFDLTWSEIQSLKPELT  317

Query  1250  NPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDA  1071
              P ++  L RNP AKN+GKFMTL DFL FA  +T V+GVLI +ENA YL  KKGLG+ +A
Sbjct  318   TPLSQSGLARNPAAKNQGKFMTLTDFLEFAKKST-VAGVLINIENAGYLVSKKGLGIVEA  376

Query  1070  VLLALNKAD---LKTKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTILEIKK  903
             V  AL  A    L  K+V+I S+D++VL  F  NS Y+RV  +KE ISD    T+ EIK 
Sbjct  377   VSTALTNASYDKLPKKQVLIQSDDTAVLSAFKKNSGYKRVLYVKETISDAPKPTVDEIKH  436

Query  902   FASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVE  723
              A +V + +SS+      F+   T VV K+ A+ + VYV +  NEF++ A+D+FSDP VE
Sbjct  437   SADAVNLPRSSIVADSGFFVSAFTGVVDKMHAANISVYVSVLRNEFLAIAFDYFSDPMVE  496

Query  722   LNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMSPQYL  546
             L +YV G      DGV+T FPAT   Y R+ C       PY +LPV PGSLL L+SP+ L
Sbjct  497   LATYVAGVQV---DGVVTEFPATLAAYLRSPCSNMNAKLPYSILPVEPGSLLSLVSPEAL  553

Query  545   PPAEAPYPVLTESDVVEPPLPPVAKI  468
             PPAEAP PVL  +D+ +PPLPPVA +
Sbjct  554   PPAEAPAPVLAVADIQDPPLPPVADL  579



>ref|XP_006300797.1| hypothetical protein CARUB_v10019878mg [Capsella rubella]
 gb|EOA33695.1| hypothetical protein CARUB_v10019878mg [Capsella rubella]
Length=704

 Score =   266 bits (681),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 141/271 (52%), Positives = 186/271 (69%), Gaps = 9/271 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+ DGIPFC  S+++ D T   Q  FS  + ++PE+     I++F+L W +IQ+L   I
Sbjct  405   QMSSDGIPFCSSSIDLKDTTMVVQTPFSKRSTTVPEISPNGGIYTFNLTWPEIQNLTPAI  464

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNP+  + + RNP  +N GK M+L  FL  A N+T++SGVLI+V+NAAYL EK+GL V  
Sbjct  465   SNPYKVYDMVRNPEKRNAGKLMSLSQFLGLAKNSTTLSGVLISVDNAAYLREKQGLDVVK  524

Query  1073  AVLLALNKADLK----TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEI  909
             AVL  L ++       T KVMI S +SSVL+ F N SKYE VY I+E I DI +S I +I
Sbjct  525   AVLETLTESGYSNGTTTTKVMIQSTNSSVLVDFKNQSKYETVYRIEETIRDISDSAIEDI  584

Query  908   KKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPY  729
             KKFA++V+I K SVFP  DSFL   TNVV +LQ S++ VYV+LF NEFV+QA+DFF+D  
Sbjct  585   KKFANAVVINKVSVFPNSDSFLSKHTNVVERLQKSQLPVYVELFQNEFVAQAYDFFADAT  644

Query  728   VELNSYVFGASANPFDGVITGFPATANRYRR  636
             VE+N+Y +GAS N   G IT FP TA RY+R
Sbjct  645   VEINTYTYGASIN---GTITEFPFTAARYKR  672



>ref|XP_007020655.1| SHV3-like 2, putative isoform 4, partial [Theobroma cacao]
 gb|EOY12180.1| SHV3-like 2, putative isoform 4, partial [Theobroma cacao]
Length=559

 Score =   263 bits (671),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 138/245 (56%), Positives = 184/245 (75%), Gaps = 6/245 (2%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QMTKDG P C+GS+N+ID T  AQ  FSNL+ +IPE+   + I +FD++W+DI SL   I
Sbjct  315   QMTKDGTPICLGSINLIDSTDVAQSSFSNLSKTIPEIMQGSGIFTFDMSWRDILSLTTAI  374

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             S+P ++++LFRNP  KN GKF+TL +FL  A +A+S+ GVLI +ENAAYLAE+ G GVTD
Sbjct  375   SSPQSEYKLFRNPKFKNVGKFLTLSEFLAMAKSASSLQGVLIAIENAAYLAEQ-GFGVTD  433

Query  1073  AVLLALNKA--DLKT-KKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
             AV  AL++A  D +T +KVMI S++SSVLMKF   S Y+ VY + E+I   Q ++I +IK
Sbjct  434   AVFDALSEAGYDKQTAQKVMIQSSNSSVLMKFKGKSNYKLVYKVDEDIGGAQQASIDDIK  493

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
              FAS+V+I K SVFP +++FL GVT+VV +LQA+ + VYV  FSNEF SQAWDFFSD  V
Sbjct  494   SFASAVVISKDSVFPENNAFLTGVTDVVPRLQAANLSVYVHTFSNEFTSQAWDFFSDATV  553

Query  725   ELNSY  711
             E+NS+
Sbjct  554   EVNSF  558



>gb|KDO59429.1| hypothetical protein CISIN_1g005894mg [Citrus sinensis]
Length=671

 Score =   265 bits (678),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 147/328 (45%), Positives = 211/328 (64%), Gaps = 12/328 (4%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  1251
             QM+K+G+ FC+ S ++I  TTAA  F + A S+PE++ +  I SFDL W +IQSL+ QIS
Sbjct  306   QMSKEGVAFCLESPDLIGKTTAATVFMSKATSVPEIQKERGIFSFDLTWTEIQSLKPQIS  365

Query  1250  NPFAKFR--LFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
             +PF K    + RNP AKN+GKF+TLD FL FA    +VSGVLI + NAAYLA KKGLGV 
Sbjct  366   SPFDKSNPPIIRNPEAKNKGKFVTLDGFLEFA-KTKAVSGVLININNAAYLASKKGLGVV  424

Query  1076  DAVLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEI  909
             DAV  AL+ A      T++VMI S+DSSVL KF +   Y++V  I++E+S      + EI
Sbjct  425   DAVTKALSNATFDKQSTQQVMIQSDDSSVLSKFQDVPAYKKVLHIRKEVSAAPREVVEEI  484

Query  908   KKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPY  729
             KK+AS+V + ++SV  T +SF    TN++  L ++ + VY+    NE++S A+D+ +DP 
Sbjct  485   KKYASAVTVTRTSVISTTESFTTNATNILRDLHSANISVYISALRNEYLSIAFDYLADPL  544

Query  728   VELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMSPQ  552
             +E+ ++  G      DG+ T FPATA++Y R++C    E   + +LPV PG LL +   +
Sbjct  545   IEVATFAQGVGV---DGITTEFPATASKYFRSKCSDDVEKQDFRILPVVPGELLDVTDLK  601

Query  551   YLPPAEAPYPVLTESDVVEPPLPPVAKI  468
               P     +P LT +D+V PPLPPV  +
Sbjct  602   TRPNI-IYHPALTVADIVRPPLPPVTPV  628



>ref|XP_010913177.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3 isoform 
X1 [Elaeis guineensis]
Length=759

 Score =   267 bits (682),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 158/328 (48%), Positives = 206/328 (63%), Gaps = 14/328 (4%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQS-LQAQ  1257
             Q+TKDGI  CM S++++  TT  +  FS+    IP++K    I++F+L   +IQ  L   
Sbjct  395   QVTKDGILICMSSIDLLSDTTVTRSPFSSRTSIIPDIKGTPGIYTFNLTLDEIQKYLLPT  454

Query  1256  ISNP-FAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGV  1080
             IS P    + L RNP  KN+G F TL+DFL FA +   +SG+LIT+E+AA++AEK    V
Sbjct  455   ISAPELGGYNLVRNPRYKNKGNFTTLNDFLAFAKDK-DLSGILITIEHAAFMAEKLQFSV  513

Query  1079  TDAVLLALNKADLK---TKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTILE  912
             TDAV+ A + A      T  VMI S +SSVL KF   +KY+ VY I E + D  NS+I +
Sbjct  514   TDAVINATSSAGYNNQITPAVMIQSTNSSVLKKFKQQTKYKLVYKIDETVRDAVNSSIED  573

Query  911   IKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDP  732
             IK+FA SV I   S++P    F+   T++V KL    + VYV L  NEFVSQ WDFFSD 
Sbjct  574   IKEFADSVAIDTDSIYPETQLFIATQTDIVNKLHKHNLSVYVYLLQNEFVSQPWDFFSDA  633

Query  731   YVELNSYVFGASANPFDGVITGFPATANRYRRNRC--LGYKEIPPYMLPVGPGSLLQLMS  558
              V++NS+  GA     DG+IT FP TA  Y+RN C  LG + +P +M PV PG+LLQL+ 
Sbjct  634   TVQINSFFKGAEV---DGIITDFPGTARTYKRNSCRNLGSR-MPVFMEPVEPGALLQLIP  689

Query  557   PQYLPPAEAPYPVLTESDVVEPPLPPVA  474
                 PPA AP PVL  SDVVEPPLPPVA
Sbjct  690   AASQPPALAPMPVLNVSDVVEPPLPPVA  717



>dbj|BAJ85772.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=744

 Score =   266 bits (681),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 147/324 (45%), Positives = 210/324 (65%), Gaps = 11/324 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDI-QSLQAQ  1257
             Q+TKDGIP CMGS+N++DGTT A+  F++    + ++++   + +F+L W DI ++L+ +
Sbjct  388   QVTKDGIPVCMGSINLMDGTTVAKSPFASQTAVMKDIESVLGVFTFNLTWDDIVKNLKPK  447

Query  1256  ISNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
             IS P + F L RNP  +N G FM L DFL F+ +   +SG++I++E+AA+LA + G  + 
Sbjct  448   ISTPLSTFSLDRNPRYRNAGNFMRLSDFLDFSKD-KDLSGIMISIEHAAFLAAELGFDMV  506

Query  1076  DAVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEI  909
             DAV+ AL+ +       +KVMI S +SSVL+KF   +KY+ VY I E++SD   S++  I
Sbjct  507   DAVIKALDDSGYNKQTAQKVMIQSTNSSVLVKFKQQTKYDLVYMINEDVSDAAPSSLAGI  566

Query  908   KKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPY  729
             KKFA +V +  SSVFP +  F    T++V  LQ + + VY     NEFVSQ +DFFSD  
Sbjct  567   KKFADAVSVETSSVFPENRHFTSHQTDLVESLQTAGLSVYAYNLMNEFVSQPYDFFSDAT  626

Query  728   VELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMSPQ  552
              ++ +YV GA     DG+IT FPATA RY+ N C+    + P +M P  PG LLQL+S  
Sbjct  627   AQIIAYVQGAGV---DGLITDFPATARRYKSNTCMNMGNKTPSFMAPPRPGDLLQLISKP  683

Query  551   YLPPAEAPYPVLTESDVVEPPLPP  480
               PPA AP P+L +SDV EPPLPP
Sbjct  684   AQPPALAPMPLLLDSDVSEPPLPP  707



>ref|XP_003575252.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
isoform X1 [Brachypodium distachyon]
Length=749

 Score =   266 bits (681),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 155/329 (47%), Positives = 215/329 (65%), Gaps = 13/329 (4%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTA-AQQFSNLAVSIPELKTQNAIHSFDLNWKDI-QSLQAQ  1257
             Q+TKDGIP CM S+++ D T     QF++ AV I ++K    +++F+L W+DI ++L+  
Sbjct  389   QVTKDGIPICMSSIDLKDVTNVVTSQFASEAVIIKDIKADAGVYTFNLTWEDIAKNLKPT  448

Query  1256  ISNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
             ISNP +K+  +RNP  +N G FM L DFL FA +   +SG++ITVE A+++AEK G GV 
Sbjct  449   ISNPMSKYNTYRNPRNRNAGNFMKLSDFLAFAKD-KDLSGIMITVERASFMAEKLGFGVV  507

Query  1076  DAVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEI  909
             DAV+ AL+ +       +KVMI S +SSVLMKF   +KY  VY I E++ D   S++ +I
Sbjct  508   DAVIKALDDSGYSKQTAQKVMIQSTNSSVLMKFRQQTKYNLVYMIDEDVKDAAPSSLADI  567

Query  908   KKFASSVIIGKSSVFPTDDSFLVGVTN-VVAKLQASKVKVYVQLFSNEFVSQAWDFFSDP  732
             KKFA +V +   S++P  + FL+  TN VV  LQ++ + VYV L  NEFVSQ +DFFSD 
Sbjct  568   KKFADAVSVSAMSIYPAANKFLINQTNPVVKSLQSAGLPVYVYLLMNEFVSQPYDFFSDA  627

Query  731   YVELNSYV-FGASANPFDGVITGFPATANRYRRNRC--LGYKEIPPYMLPVGPGSLLQLM  561
               ++N+YV         DGVIT FP TA+RY+ N C  +G K+ P +M P   G L+  +
Sbjct  628   TAQINAYVQKDGDGGGVDGVITDFPGTAHRYKLNSCKNMG-KKTPLFMQPPQRGGLVGTI  686

Query  560   S-PQYLPPAEAPYPVLTESDVVEPPLPPV  477
             S P  LPPA +P PVLT+SDV EPPLPPV
Sbjct  687   SDPSALPPAMSPMPVLTDSDVAEPPLPPV  715



>ref|XP_010928375.1| PREDICTED: LOW QUALITY PROTEIN: glycerophosphodiester phosphodiesterase 
GDPDL7-like [Elaeis guineensis]
Length=768

 Score =   266 bits (681),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 152/326 (47%), Positives = 209/326 (64%), Gaps = 9/326 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  1251
             QM+KDG+ FC+ S +++  TTA   F + +  +PE++  N I SFDL W +I+SL+  ++
Sbjct  404   QMSKDGVAFCLDSADLMGDTTAMDSFMSRSALVPEIQKNNGIFSFDLTWSEIESLKPVLA  463

Query  1250  NPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDA  1071
             NP +   L RNP AKN GK MTL  FL FA N+T VSG+LI +E+A YLA KKGL +  A
Sbjct  464   NPLSSANLVRNPAAKNMGKLMTLATFLDFAKNST-VSGILINIEHAPYLASKKGLDIVTA  522

Query  1070  VLLALNKADLK---TKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTILEIKK  903
             V  AL  A      T+KV+I S+D+SVL  F  NS Y+RV+ ++E ISD     + EIK+
Sbjct  523   VSSALINASYDKQITQKVLIQSDDTSVLSMFKNNSSYKRVFKVEETISDSPKPAVDEIKQ  582

Query  902   FASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVE  723
             FA +V I K+S+  + +SFL   T V  K+ A+ + VYV    NEFVS  +D FSDP VE
Sbjct  583   FADAVNIAKTSLIASSNSFLTSFTPVTDKMHAANLSVYVSGLRNEFVSIPFDCFSDPMVE  642

Query  722   LNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMSPQYL  546
             + +Y  G +    DG++T FPATA  Y R+ C   +   P+ +LPV PGSLL+   P+ L
Sbjct  643   IATYAAGLAV---DGIVTEFPATARAYFRSPCSDVEANLPFSILPVEPGSLLKEAQPELL  699

Query  545   PPAEAPYPVLTESDVVEPPLPPVAKI  468
             PP +AP P L  +D+V+PPLPPV K+
Sbjct  700   PPTQAPAPALDAADIVDPPLPPVVKV  725



>emb|CDY29432.1| BnaC05g32380D, partial [Brassica napus]
Length=596

 Score =   262 bits (670),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 142/325 (44%), Positives = 206/325 (63%), Gaps = 18/325 (6%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTA-AQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+KD IPFCM S+++++ T      F +L    PE++  + I +F L   +IQ+L+  I
Sbjct  241   QMSKDKIPFCMSSIDLMNSTNVFYTSFRSLMSIAPEIQQGSRIFTFSLTMSEIQTLKPVI  300

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             S+P   + LFRNP  KN GKF+TL +FL      +S+SG+LI +E AAYLA  +G+ + D
Sbjct  301   SDPHRVYGLFRNPRNKNLGKFLTLSEFLLLPNRYSSLSGILIKIEYAAYLATHQGISIVD  360

Query  1073  AVLLALNKADLKTKKVMIHSNDSSVLMKFTN----SKYERVYGIKEEISDIQNSTILEIK  906
             AVL  L +A   T +V+I S D +VLM+F      +  E VY + E+I D+ +S I +IK
Sbjct  361   AVLDELKRA---TSQVLIQSTDKAVLMEFKEKGKMTNEELVYAVDEDIHDVTDSAIKDIK  417

Query  905   KFASSVIIGKSSVFPTDDSF--LVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDP  732
              FA S++I K SV P  +    L   T+VV +L++S ++VYV+ FSNEF++Q +DFFSDP
Sbjct  418   SFAGSIVISKKSVVPYSEGITRLEKETDVVPRLRSSGLRVYVETFSNEFITQPYDFFSDP  477

Query  731   YVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQ  552
              VE++ +V   + N  DG+IT FPAT +RY +N+C    E       +  G L+ L +P+
Sbjct  478   TVEIDYFV--RADNEIDGIITDFPATTSRYIKNQCYSKME------QIRTGELVSLANPE  529

Query  551   YLPPAEAPYPVLTESDVVEPPLPPV  477
              L PAEAPYP+L +S+V EPPLP V
Sbjct  530   ILSPAEAPYPLLLDSNVTEPPLPEV  554



>ref|XP_011017989.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL6-like 
[Populus euphratica]
Length=749

 Score =   266 bits (679),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 146/325 (45%), Positives = 209/325 (64%), Gaps = 13/325 (4%)
 Frame = -3

Query  1421  KDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQISNPF  1242
             KDG+ FC+ SV++   TTAA  F +L+ +IPE++    I SFDL+W DIQ+LQAQ+++PF
Sbjct  386   KDGVAFCLDSVDVTRDTTAAASFMSLSTTIPEIQDSAGIFSFDLSWSDIQTLQAQLTSPF  445

Query  1241  -AKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDAVL  1065
              +K  L RNP  K++GKF+TL +FL  A    +V+G+LI +ENAAYLA +KGL +  AV 
Sbjct  446   ESKGGLPRNPANKSKGKFLTLAEFLELA-KVKAVTGILINIENAAYLASQKGLDIVSAVN  504

Query  1064  LALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIKKFA  897
              A   A      T+KV+I S+D+SVL KF N   Y RV  +K+EISD   + + EIKK+A
Sbjct  505   TAFGNATFGKQSTQKVLIQSDDTSVLSKFMNVPAYSRVLYLKDEISDAPRTPVEEIKKYA  564

Query  896   SSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELN  717
              +V + + S+ PT + F  G T VV ++QA+ + VYV +  NEF++  +D+FSDP +E+ 
Sbjct  565   DAVTLPRFSIVPTVNGFTTGTTKVVNEMQAANISVYVSVLRNEFITLPFDYFSDPTIEIA  624

Query  716   SYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPP---YMLPVGPGSLLQLMSPQYL  546
             +Y  G      DG+IT +PATA+RY RN C     +P     ++P   GSLL+ +  +  
Sbjct  625   TYTSGIGV---DGIITEYPATASRYLRNPC-SSNSMPDSSYSIIPAEAGSLLKTVPEETQ  680

Query  545   PPAEAPYPVLTESDVVEPPLPPVAK  471
              PA +P P L  +DVV+PPLP V K
Sbjct  681   APASSPTPALDVADVVDPPLPAVTK  705



>ref|XP_006474608.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
3-like [Citrus sinensis]
Length=789

 Score =   266 bits (680),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 148/328 (45%), Positives = 211/328 (64%), Gaps = 12/328 (4%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  1251
             QM+KDG+ FC+ S ++I  TTAA  F + A S+PE++ +  I SFDL W +IQSL+ QIS
Sbjct  424   QMSKDGVAFCLESPDLIGKTTAATVFMSKATSVPEIQKERGIFSFDLTWTEIQSLKPQIS  483

Query  1250  NPFAKFR--LFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
             +PF K    + RNP AKN+GKF+TLD FL F A   +VSGVLI + NAAYLA KKGLGV 
Sbjct  484   SPFDKSNPPIIRNPEAKNKGKFVTLDGFLEF-AKTKAVSGVLININNAAYLASKKGLGVV  542

Query  1076  DAVLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEI  909
             DAV  AL+ A      T++VMI S+DSSVL KF +   Y++V  I++E+S      + EI
Sbjct  543   DAVTKALSNATFDKQSTQQVMIQSDDSSVLSKFQDVPAYKKVLHIRKEVSAAPREVVEEI  602

Query  908   KKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPY  729
             KK+AS+V + ++SV  T +SF    TN++  L ++ + VY+    NE++S A+D+ +DP 
Sbjct  603   KKYASAVTVTRTSVISTTESFTTNATNILRDLHSANISVYISALRNEYLSIAFDYLADPL  662

Query  728   VELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMSPQ  552
             +E+ ++  G      DG+ T FPATA++Y R++C    E   + +LPV PG LL +   +
Sbjct  663   IEVATFAQGVGV---DGITTEFPATASKYFRSKCSDDVEKQDFRILPVVPGELLDVTDLK  719

Query  551   YLPPAEAPYPVLTESDVVEPPLPPVAKI  468
               P     +P LT +D+V PPLPPV  +
Sbjct  720   TRPNI-IYHPALTVADIVRPPLPPVTPV  746



>ref|XP_008384576.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 2 [Malus domestica]
Length=770

 Score =   265 bits (676),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 145/328 (44%), Positives = 208/328 (63%), Gaps = 12/328 (4%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  1251
             QM+ DG+ FC+ + ++  GT A  QF   + +IPEL+ +  + SF L+W DI+SL+ Q+ 
Sbjct  399   QMSSDGVAFCLDTPDLNSGTNALSQFMTKSETIPELQAEAGVFSFQLSWSDIKSLKPQMQ  458

Query  1250  NPFA-KFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             +P+  K ++ RNP  K+ GK +TL++FL FA    +V+G+LI +E AAYLA K GL V  
Sbjct  459   SPYGTKEKIVRNPANKDAGKLVTLNEFLEFAKK-NAVTGILINIEYAAYLASKAGLDVVG  517

Query  1073  AVLLALNKADL---KTKKVMIHSNDSSVLMKFTNSK-YERVYGIKEEISDIQNSTILEIK  906
              V  AL+ A      T++V+I S+D+SVL KF ++K Y+RV  IKE+IS     ++ EIK
Sbjct  518   TVSSALSNATFDKQSTQQVLIESDDTSVLAKFKDAKNYKRVLNIKEKISXATKESVAEIK  577

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             K+A +V I K S+    D F+ G TNVV +++A+ + VY     NEFVS  +D+FSDP  
Sbjct  578   KYADAVTITKDSIVKITDYFISGTTNVVKEMKAANITVYAHWLRNEFVSLMFDYFSDPIT  637

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYK---EIPPYMLPVGPGSLLQLMSP  555
             E+ SY  G      DG++T FP TA++Y R+ C        +P  +LPV PG+L  L+ P
Sbjct  638   EIASYAQGFKV---DGIVTDFPGTASKYMRSPCSDTDPKANVPYPILPVEPGALSGLIGP  694

Query  554   QYLPPAEAPYPVLTESDVVEPPLPPVAK  471
             + L PAEAP P L  S+VV+PPLP VAK
Sbjct  695   EALSPAEAPSPALQVSNVVDPPLPGVAK  722



>emb|CDY32730.1| BnaA02g07920D [Brassica napus]
Length=745

 Score =   264 bits (675),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 154/327 (47%), Positives = 200/327 (61%), Gaps = 16/327 (5%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  1251
             QM+KDGI FC  S ++   T A   F + A S+PE++  N I SFDL W +IQSL+ QI 
Sbjct  388   QMSKDGIAFCHDSADITATTNAMTTFMSRATSVPEIQPTNGIFSFDLTWAEIQSLKPQIQ  447

Query  1250  NPFAKFRLF-RNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             +PF+    F RNP  KN GKFMTL DFL F   A +V+G      NAAYLA KKGLG+ D
Sbjct  448   SPFSTSGGFQRNPANKNAGKFMTLVDFLEFG-KAKAVTG------NAAYLASKKGLGIVD  500

Query  1073  AVLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
             AV  AL  + L    T+ V+I S+DSSVL  F     Y RV  I +EI D    ++ EIK
Sbjct  501   AVKSALTNSTLDKQSTQNVLIQSDDSSVLSSFEAVPPYTRVLSIDKEIGDAPKPSVDEIK  560

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             K A +V + +SS+    +SF  G TNVV ++    + VYV +  NE++S A+D+FSDP V
Sbjct  561   KHAEAVNLKRSSLDTISESFATGKTNVVEEMHKGNISVYVSVLRNEYISIAFDYFSDPTV  620

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMSPQY  549
             EL +++ G   N  DGVIT FPATA RY R+ C    +  PY +LP   G+LL + + + 
Sbjct  621   ELATFIAG---NGVDGVITEFPATATRYLRSPCSDLNKDQPYAILPAEAGALLSVAAKEA  677

Query  548   LPPAEAPYPVLTESDVVEPPLPPVAKI  468
              PPA AP P L   DV++PPLPPVA I
Sbjct  678   QPPAIAPSPPLDAKDVIDPPLPPVANI  704



>dbj|BAJ87963.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=744

 Score =   263 bits (673),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 146/324 (45%), Positives = 209/324 (65%), Gaps = 11/324 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDI-QSLQAQ  1257
             Q+TKDGIP CMGS+N++DGTT A+  F++    + ++++   + +F+L W DI ++L+ +
Sbjct  388   QVTKDGIPVCMGSINLMDGTTVAKSPFASQTAVMKDIESVLGVFTFNLTWDDIVKNLKPK  447

Query  1256  ISNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
             IS P + F L RNP  +N G FM L DFL F+ +   +SG++I++E+AA+LA + G  + 
Sbjct  448   ISTPLSTFSLDRNPRYRNAGNFMRLSDFLDFSKD-KDLSGIMISIEHAAFLAAELGFDMV  506

Query  1076  DAVLLALNKADLK---TKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTILEI  909
             DAV+ AL+ +       +KVMI S +SSVL+KF   +KY+ VY I E++SD   S++  I
Sbjct  507   DAVIKALDDSGYNKQTAQKVMIQSTNSSVLVKFKQQTKYDLVYMINEDVSDAAPSSLAGI  566

Query  908   KKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPY  729
             KKFA +V +  SSVFP +  F    T++V  LQ + + VY     NEFVSQ +DFFSD  
Sbjct  567   KKFADAVSVETSSVFPENRHFTSHQTDLVESLQTAGLSVYAYNLMNEFVSQPYDFFSDAT  626

Query  728   VELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMSPQ  552
              ++ +YV GA     DG+IT FPATA RY+ N C+    + P +M P  PG LL L+S  
Sbjct  627   AQIIAYVQGAGV---DGLITDFPATARRYKSNTCMNMGNKTPSFMAPPRPGDLLLLISKP  683

Query  551   YLPPAEAPYPVLTESDVVEPPLPP  480
               PPA AP P+L +SDV EPPLPP
Sbjct  684   AQPPALAPMPLLLDSDVSEPPLPP  707



>ref|XP_008343908.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Malus domestica]
 ref|XP_008343909.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Malus domestica]
Length=781

 Score =   264 bits (674),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 145/328 (44%), Positives = 207/328 (63%), Gaps = 12/328 (4%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  1251
             QM+ DG+ FC+ + ++  GT A  QF   + +IPEL+ +  + SF L+W DI+SL+ Q+ 
Sbjct  399   QMSSDGVAFCLDTPDLNSGTNALSQFMTKSETIPELQAEAGVFSFQLSWSDIKSLKPQMQ  458

Query  1250  NPFA-KFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             +P+  K ++ RNP  K+ GK +TL++FL FA    +V+G+LI +E AAYLA K GL V  
Sbjct  459   SPYGTKEKIVRNPANKDAGKLVTLNEFLEFAKK-NAVTGILINIEYAAYLASKAGLDVVG  517

Query  1073  AVLLALNKADL---KTKKVMIHSNDSSVLMKFTNSK-YERVYGIKEEISDIQNSTILEIK  906
              V  AL+ A      T++V I S+D+SVL KF ++K Y+RV  IKE+IS     ++ EIK
Sbjct  518   TVSSALSNATFDKQSTQQVXIESDDTSVLAKFKDAKNYKRVLNIKEKISXATKESVAEIK  577

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             K+A +V I K S+    D F+ G TNVV +++A+ + VY     NEFVS  +D+FSDP  
Sbjct  578   KYADAVTITKDSIVKITDYFISGTTNVVKEMKAANITVYAHWLRNEFVSLMFDYFSDPIT  637

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYK---EIPPYMLPVGPGSLLQLMSP  555
             E+ SY  G      DG++T FP TA++Y R+ C        +P  +LPV PG+L  L+ P
Sbjct  638   EIASYAQGFKV---DGIVTDFPGTASKYMRSPCSDTDPKANVPYPILPVEPGALSGLIGP  694

Query  554   QYLPPAEAPYPVLTESDVVEPPLPPVAK  471
             + L PAEAP P L  S+VV+PPLP VAK
Sbjct  695   EALSPAEAPSPALQVSNVVDPPLPGVAK  722



>ref|XP_010656583.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7 [Vitis 
vinifera]
Length=750

 Score =   263 bits (672),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 151/324 (47%), Positives = 206/324 (64%), Gaps = 9/324 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  1251
             QM+KDG+ FC+ S +++  + A   F + +  + E++ ++ I SFDL W +IQ+L  Q++
Sbjct  385   QMSKDGVAFCLNSADLLGSSNAMTSFMSRSTMVSEIQPKSGIFSFDLTWSEIQTLTPQLT  444

Query  1250  NPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDA  1071
             +P     L RNP  KN+GKF+TL DFL F A A +VSG+LI +ENAAYLA KKGL + DA
Sbjct  445   SPLPNSGLARNPANKNQGKFITLSDFLDF-AKAKAVSGILIDIENAAYLASKKGLSIIDA  503

Query  1070  VLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIKK  903
             V  AL+ A      T++VMI S+D+SVL KF N   Y+RV  IKE I D+   T+ EIKK
Sbjct  504   VTAALSNATFDKQATQQVMIQSDDTSVLSKFKNVPGYKRVLSIKEIIGDVPKQTVEEIKK  563

Query  902   FASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVE  723
             FA +V + +SS+  T+  F    T VV +L A+ +  YV +  NE+V+ A+DFFSDP VE
Sbjct  564   FADAVNLPRSSIVTTNGGFTTTFTTVVDELHAANISAYVSVLRNEYVAIAFDFFSDPVVE  623

Query  722   LNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMSPQYL  546
             L +YV        DGV+T +P TA+ Y R+ C        Y +LP   G+LL L  P+ L
Sbjct  624   LATYVGRLG---IDGVVTDYPKTADAYLRSPCSDLNAKVAYSILPAEAGALLGLAEPEVL  680

Query  545   PPAEAPYPVLTESDVVEPPLPPVA  474
             PPAEAP P LT  DVV+PPLP V+
Sbjct  681   PPAEAPGPPLTVDDVVDPPLPQVS  704



>ref|XP_002862842.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH39100.1| glycerophosphoryl diester phosphodiesterase family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
Length=719

 Score =   262 bits (670),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 152/330 (46%), Positives = 206/330 (62%), Gaps = 21/330 (6%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNA-IHSFDLNWKDIQSLQAQ  1257
             QM+KD IPFCM S+++I+ T   +  F NL+    E++ Q + I++F L    IQ+L+  
Sbjct  373   QMSKDKIPFCMSSIDLINSTNVIETSFRNLSSVASEIQPQRSGIYTFSLTMSQIQTLKPT  432

Query  1256  ISNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
             ISN      LFRNP  K  GKF+TL +FL    + +S+ G+LI VENAAYL E +G+ V 
Sbjct  433   ISNLERDSGLFRNPRNKKAGKFLTLSEFLFLPNHYSSLLGILIEVENAAYLVEHQGISVV  492

Query  1076  DAVLLALNKADLKTKK-----VMIHSNDSSVLMKFTNSKY----ERVYGIKEEISDIQNS  924
             DAVL  L +A  +  K     ++I S D SVLMKF         E VY ++E I D+ +S
Sbjct  493   DAVLDELKRATNQQNKTSARTILIQSTDKSVLMKFKEKNKMNHDELVYRVEENIGDVADS  552

Query  923   TILEIKKFASSVIIGKSSVFPTDDSF-LVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWD  747
              I +IK FA S++I K SVFP      L   TNVV+KL++S ++VYV+ FSNEFV+QA+D
Sbjct  553   AIKDIKNFAGSIVISKKSVFPYVGFITLTQGTNVVSKLKSSGLRVYVERFSNEFVTQAFD  612

Query  746   FFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQ  567
             F+ DP +E++S+V        DG+IT FPAT  RYR+N+C G      ++LP   G L  
Sbjct  613   FYEDPTLEIDSFVRDIQ---IDGIITDFPATTARYRKNQCYG-----KFVLP-ETGELRT  663

Query  566   LMSPQYLPPAEAPYPVLTESDVVEPPLPPV  477
               +P  LPPAEAPYP+L +SDV EPPLP V
Sbjct  664   FGNPLLLPPAEAPYPLLGDSDVTEPPLPEV  693


 Score = 53.5 bits (127),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 65/288 (23%), Positives = 130/288 (45%), Gaps = 50/288 (17%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWK---DIQSLQA  1260
             Q+TKDG+  C  ++N+ +G       SN+    P  K +    S D  WK   D++  Q 
Sbjct  71    QLTKDGVGICFPNLNLHNG-------SNVISIYPNYKER---FSVDFTWKELSDVKLAQG  120

Query  1259  QISNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGV  1080
              IS P          +  +    + +++     A     SG+ + ++++A+  +   L +
Sbjct  121   VISRP---------EIFDDVSSILPIEEVAKLTA-----SGLWLNIQDSAFYTQ-HNLSM  165

Query  1079  TDAVLLALNKADLKTKKVMIHSNDSSVLMKFTNSKYERVYGI------KEEISDIQNST-  921
              ++V ++L++  +      I S + S L    NS    V  +      +++I    N + 
Sbjct  166   RNSV-ISLSRRLIVN---FISSPEISFLKSMKNSVKPTVTKLIFKFLKQDDIEPFTNQSY  221

Query  920   ------ILEIKKFASSVIIGKSSVFPTDDS-FLVGVTNVVAKLQASKVKVYVQLFSNEFV  762
                   +  I+ F+S +++ KS ++P D + +L   T++V       ++V+   F+N+FV
Sbjct  222   GSLAKNLSYIRTFSSGILVPKSYIWPVDSALYLQPHTSLVTDAHKEGLQVFASEFANDFV  281

Query  761   SQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY  618
               A+++  DP  E  S++   + +  DG ++ FP T   YR   C  +
Sbjct  282   I-AYNYSYDPTAEYLSFIDNGNFS-VDGFLSDFPVTP--YRAINCFSH  325



>ref|XP_002883252.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH59511.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=731

 Score =   262 bits (670),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 145/332 (44%), Positives = 208/332 (63%), Gaps = 23/332 (7%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQ-  1257
             QM+KD IPFCM S+++I+ T   +  F NL+  + E++ ++ I+SF L    IQ+L+ + 
Sbjct  373   QMSKDKIPFCMSSIDLINSTNVIETSFRNLSSVVSEIQPRSGIYSFSLTMSQIQTLKRKS  432

Query  1256  -ISNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGV  1080
              ISNP   + LFRNP     GKF+TL +FL    + +S+ G+LI VENAAYL E +G+ V
Sbjct  433   TISNPERDWGLFRNPRNNKAGKFLTLSEFLFLPNHYSSLLGILIEVENAAYLVEHQGISV  492

Query  1079  TDAVLLALNKAD------LKTKKVMIHSNDSSVLMKFTN----SKYERVYGIKEEISDIQ  930
              DAVL  L +A+         + ++I S D SVLMKF      +  E VY + ++I D++
Sbjct  493   VDAVLDELKRANNNQQNKTSARTILIQSTDKSVLMKFKEKNKMNHDELVYRVDKDIRDVE  552

Query  929   NSTILEIKKFASSVIIGKSSVFPTDDSFLVGVT-NVVAKLQASKVKVYVQLFSNEFVSQA  753
             +S + +IK FA S++I K+SVFP    F+     NVV+KL++S ++VYV+ FSNEFV+Q 
Sbjct  553   DSAVRDIKNFAGSIVIRKNSVFPYKGFFIFKKGPNVVSKLKSSGLRVYVETFSNEFVTQE  612

Query  752   WDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSL  573
             +DF+ DP +E++ +V        DG+IT FPAT  RYR+N+C G  ++P        G L
Sbjct  613   YDFYEDPTLEIDCFVRDIQV---DGIITDFPATTARYRKNQCYGKFDLP------DTGEL  663

Query  572   LQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  477
               L +P  L PAEAPYP+L  SDV EPPLP V
Sbjct  664   RTLGNPMILAPAEAPYPLLRISDVTEPPLPEV  695


 Score = 59.3 bits (142),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 66/285 (23%), Positives = 133/285 (47%), Gaps = 44/285 (15%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  1251
             Q+TKDG+  C  ++N+ +G       S++    P  K +    S D  WK++  ++    
Sbjct  71    QLTKDGVGICFPNLNLDNG-------SDVMTIYPNYKER---FSVDFTWKELSDVK----  116

Query  1250  NPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDA  1071
                A+  L R  +  +    +T+++     A     SG+ + ++++A+ A+   L + ++
Sbjct  117   --LARGVLSRPNIFDDLSSILTIEEVAKLTA-----SGLWLNIQDSAFYAQ-HNLSMRNS  168

Query  1070  VLLALNKADLKTKKVMIHSNDSSVLMKFTNSKYERVYGI------KEEISDIQNST----  921
             V L+L++   + K   I S + S L    NS    V  +      ++ I    N +    
Sbjct  169   V-LSLSR---RLKVNFISSPEISFLKSMKNSVKPTVTKLIFKFLKQDHIEPFTNQSYGSL  224

Query  920   ---ILEIKKFASSVIIGKSSVFPTDDS-FLVGVTNVVAKLQASKVKVYVQLFSNEFVSQA  753
                +  I+ F+S +++ KS ++P D + +L   T++V       ++V+   F+N+FV  A
Sbjct  225   AKNLSYIRTFSSGILVPKSYIWPIDSALYLQPHTSLVTDAHKEGLQVFASEFANDFVI-A  283

Query  752   WDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY  618
             +++  DP  E  S++   + +  DG ++ FP T   YR   C  +
Sbjct  284   YNYSYDPTAEYLSFIDNGNFS-VDGFLSDFPVTP--YRAINCFSH  325



>emb|CBI18678.3| unnamed protein product [Vitis vinifera]
Length=756

 Score =   263 bits (671),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 151/324 (47%), Positives = 206/324 (64%), Gaps = 9/324 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  1251
             QM+KDG+ FC+ S +++  + A   F + +  + E++ ++ I SFDL W +IQ+L  Q++
Sbjct  385   QMSKDGVAFCLNSADLLGSSNAMTSFMSRSTMVSEIQPKSGIFSFDLTWSEIQTLTPQLT  444

Query  1250  NPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDA  1071
             +P     L RNP  KN+GKF+TL DFL F A A +VSG+LI +ENAAYLA KKGL + DA
Sbjct  445   SPLPNSGLARNPANKNQGKFITLSDFLDF-AKAKAVSGILIDIENAAYLASKKGLSIIDA  503

Query  1070  VLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIKK  903
             V  AL+ A      T++VMI S+D+SVL KF N   Y+RV  IKE I D+   T+ EIKK
Sbjct  504   VTAALSNATFDKQATQQVMIQSDDTSVLSKFKNVPGYKRVLSIKEIIGDVPKQTVEEIKK  563

Query  902   FASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVE  723
             FA +V + +SS+  T+  F    T VV +L A+ +  YV +  NE+V+ A+DFFSDP VE
Sbjct  564   FADAVNLPRSSIVTTNGGFTTTFTTVVDELHAANISAYVSVLRNEYVAIAFDFFSDPVVE  623

Query  722   LNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMSPQYL  546
             L +YV        DGV+T +P TA+ Y R+ C        Y +LP   G+LL L  P+ L
Sbjct  624   LATYVGRLG---IDGVVTDYPKTADAYLRSPCSDLNAKVAYSILPAEAGALLGLAEPEVL  680

Query  545   PPAEAPYPVLTESDVVEPPLPPVA  474
             PPAEAP P LT  DVV+PPLP V+
Sbjct  681   PPAEAPGPPLTVDDVVDPPLPQVS  704



>gb|KCW78936.1| hypothetical protein EUGRSUZ_C00368 [Eucalyptus grandis]
Length=737

 Score =   262 bits (670),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 154/325 (47%), Positives = 217/325 (67%), Gaps = 15/325 (5%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  1251
             QM+KDG+ FC+ S ++   TTA   F + +  IPE++  + I SFDL W +IQSL+ Q+ 
Sbjct  379   QMSKDGVAFCLDSADLSGDTTAMPTFMSQSTVIPEIQQNSGIFSFDLTWSEIQSLKPQLV  438

Query  1250  NPFAKFRLF-RNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             +PF     F RNP  KN+GKF+TL +FL  A  + +VSGVLI +ENAAYLA KKGLG+ D
Sbjct  439   SPFGSDAGFQRNPANKNKGKFVTLSEFLELA-KSKAVSGVLINIENAAYLASKKGLGIVD  497

Query  1073  AVLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
              V  AL+ A L    T++V+I S+DSSVL +F N S Y+RV  I+E+ISD     + EIK
Sbjct  498   TVSKALSNATLDKQSTQQVLIQSDDSSVLSQFKNVSTYKRVLTIEEKISDAPKQPVEEIK  557

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             K+A +V + + ++ P  +SFL+  T+V+ ++ A+ + VYV +  NE++S A+D+F+DP +
Sbjct  558   KYADAVTVTRPTIMPISESFLLSNTSVIDEMHAANISVYVSVLRNEYISLAFDYFADPIL  617

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRC--LGYKEIPPYMLPVGPGSLLQLMSPQ  552
             EL +YV G      DG+IT +PATAN+Y R+ C  L  KE    +LPV PGSL+ ++   
Sbjct  618   ELATYVAGFGV---DGIITEYPATANKYMRSPCFDLNAKEA---ILPVQPGSLIGIIQGA  671

Query  551   YLPPAEAPYPVLTESDVVEPPLPPV  477
                PAEAP PVL  SD+V+PPLPPV
Sbjct  672   EP-PAEAPAPVLEVSDIVDPPLPPV  695



>emb|CDY02788.1| BnaC02g11010D [Brassica napus]
Length=745

 Score =   262 bits (669),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 154/327 (47%), Positives = 203/327 (62%), Gaps = 16/327 (5%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  1251
             QM+KDG+ FC  S ++   TTA   F + A S+PE++  N I SFDL W +IQSL+ QI 
Sbjct  388   QMSKDGMAFCHDSADLTATTTAMTTFMSRATSVPEIQPTNGIFSFDLTWAEIQSLKPQIQ  447

Query  1250  NPFAKFRLF-RNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             +PF+    F RNP  KN GKFMTL DFL F   A +V+G      NAAYLA KKGLG+ D
Sbjct  448   SPFSTSGGFQRNPANKNAGKFMTLVDFLEFG-KAKAVTG------NAAYLASKKGLGIVD  500

Query  1073  AVLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
             AV   L  + L    T+KV+I S+DSSVL  F     Y RV  I++EI D    ++ EIK
Sbjct  501   AVKSGLTNSTLDKQSTQKVLIQSDDSSVLSSFEAVPPYTRVLSIEKEIGDAPKPSVDEIK  560

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             K A +V + +SS+    +SF  G TNVV ++    + VYV +  NE++S A+D+FSDP V
Sbjct  561   KHAEAVNLKRSSLDTISESFATGKTNVVEEMHKGNISVYVSVLRNEYISIAFDYFSDPTV  620

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMSPQY  549
             EL +++ G   N  DGVIT FPATA RY R+ C    +  PY +LP   G+LL + + + 
Sbjct  621   ELATFIAG---NGVDGVITEFPATATRYLRSPCSDLNKDQPYAILPAEAGALLSVAAKEA  677

Query  548   LPPAEAPYPVLTESDVVEPPLPPVAKI  468
              PPA AP P L   DV++PPLPPVAK+
Sbjct  678   QPPAIAPSPPLNAKDVIDPPLPPVAKM  704


 Score = 53.5 bits (127),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 74/298 (25%), Positives = 132/298 (44%), Gaps = 55/298 (18%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDL-NW-------KDI  1275
             QMTKDG+  C+  + + + TT +  F       P+ +    ++  DL  W         I
Sbjct  76    QMTKDGVGLCLSDIRLDNATTISTLF-------PKAQKTYKVYGQDLKGWFVLDYSADTI  128

Query  1274  QSLQAQISNPFAKFRLF--RNPVAKNEG-------KFMTLDDFLTFAANATSVSGVLITV  1122
              S  + + N F++  +F  + PV+  E        KF     +L+   +A  +   L   
Sbjct  129   FSNVSLVQNIFSRPSIFDGQMPVSAVEDVLGIKPPKF-----WLSVQYDAFYMEHKL---  180

Query  1121  ENAAYLAEKKGLGVT------DAVLLALNKADLKTK-KVMIHSNDSSVLMKFTNSKYERV  963
               AAYL   +  G+T         L ++     + K K++    D   +   TN KY   
Sbjct  181   SAAAYLRSLRFRGITFISSPEIGFLKSIGMDARRAKTKLIFEFKDPEAIEPTTNKKY---  237

Query  962   YGIKEEISDIQNSTILEIKKFASSVIIGKSSVFPTDDS-FLVGVTNVVAKLQASKVKVYV  786
                    S++Q + +  IK FAS V++ K  ++PTD + +L   +  VA    + ++VY 
Sbjct  238   -------SELQQN-LAAIKAFASGVLVPKDYIWPTDSANYLKPASTFVADAHRAGLEVYA  289

Query  785   QLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE  612
               F+N++ + ++++  DP  E   +V     +  DG IT FP TA+  +   CL +++
Sbjct  290   SGFANDYRT-SYNYSYDPSAEYLQFVDNGQFS-VDGFITDFPPTAS--QAISCLSHQK  343



>ref|XP_010050300.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Eucalyptus grandis]
Length=792

 Score =   262 bits (670),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 154/325 (47%), Positives = 217/325 (67%), Gaps = 15/325 (5%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  1251
             QM+KDG+ FC+ S ++   TTA   F + +  IPE++  + I SFDL W +IQSL+ Q+ 
Sbjct  434   QMSKDGVAFCLDSADLSGDTTAMPTFMSQSTVIPEIQQNSGIFSFDLTWSEIQSLKPQLV  493

Query  1250  NPFAKFRLF-RNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             +PF     F RNP  KN+GKF+TL +FL  A  + +VSGVLI +ENAAYLA KKGLG+ D
Sbjct  494   SPFGSDAGFQRNPANKNKGKFVTLSEFLELA-KSKAVSGVLINIENAAYLASKKGLGIVD  552

Query  1073  AVLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
              V  AL+ A L    T++V+I S+DSSVL +F N S Y+RV  I+E+ISD     + EIK
Sbjct  553   TVSKALSNATLDKQSTQQVLIQSDDSSVLSQFKNVSTYKRVLTIEEKISDAPKQPVEEIK  612

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             K+A +V + + ++ P  +SFL+  T+V+ ++ A+ + VYV +  NE++S A+D+F+DP +
Sbjct  613   KYADAVTVTRPTIMPISESFLLSNTSVIDEMHAANISVYVSVLRNEYISLAFDYFADPIL  672

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRC--LGYKEIPPYMLPVGPGSLLQLMSPQ  552
             EL +YV G      DG+IT +PATAN+Y R+ C  L  KE    +LPV PGSL+ ++   
Sbjct  673   ELATYVAGFGV---DGIITEYPATANKYMRSPCFDLNAKEA---ILPVQPGSLIGIIQGA  726

Query  551   YLPPAEAPYPVLTESDVVEPPLPPV  477
                PAEAP PVL  SD+V+PPLPPV
Sbjct  727   EP-PAEAPAPVLEVSDIVDPPLPPV  750



>emb|CDY02800.1| BnaC02g10890D [Brassica napus]
Length=748

 Score =   259 bits (663),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 154/324 (48%), Positives = 204/324 (63%), Gaps = 12/324 (4%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  1251
             QMTKDG+ FC+ S ++I  TTAA      A S+PE++++N I SFDL W +IQSL+ QI 
Sbjct  391   QMTKDGMAFCLDSADLIPTTTAATTLMTRATSVPEIQSKNGIFSFDLTWAEIQSLKPQIQ  450

Query  1250  NPFAKFRLF-RNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             +PF     F RNP  KN GKFMTL DFL F+  A +V+GVLI ++  +    KKGLG+ D
Sbjct  451   SPFLAADGFPRNPKNKNAGKFMTLADFLKFS-KAKAVTGVLINIQATS----KKGLGIVD  505

Query  1073  AVLLALNKADLKTKKVMIHSNDSSVLMKFTNS-KYERVYGIKEEISDIQNSTILEIKKFA  897
             AV  AL  + L  KKV+I S+DSSVL  F  + +Y RV  I +EI D    TI EIKK A
Sbjct  506   AVKSALTSSKLD-KKVLIQSDDSSVLDSFKAAPQYTRVLSIDKEIGDAPKPTIEEIKKHA  564

Query  896   SSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELN  717
              +V + +SS+     SF  G T VV  +    + VYV +  NE++S  +D+FSDP VEL 
Sbjct  565   DAVNVLRSSLVTISQSFATGKTKVVEAMHKGNISVYVSVLRNEYLSITFDYFSDPTVELA  624

Query  716   SYVFGASANPFDGVITGFPATANRYRRNRCLG-YKEIPPYMLPVGPGSLLQLMSPQYLPP  540
             +++ G   N  DGVIT FPATA RY R+ C   Y+E+P  +LP   G+L+ + S +  PP
Sbjct  625   TFIAG---NGVDGVITEFPATATRYLRSPCSDLYRELPFAILPAKAGTLVSVASKEAQPP  681

Query  539   AEAPYPVLTESDVVEPPLPPVAKI  468
             A AP P L   DV++PPLPPVA +
Sbjct  682   ASAPNPPLDAKDVIDPPLPPVANL  705



>ref|XP_009127505.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 2 [Brassica rapa]
Length=1313

 Score =   265 bits (676),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 159/326 (49%), Positives = 207/326 (63%), Gaps = 25/326 (8%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+++G PFC  S+++   T AAQ    N +  IPE+ +   I++F L W +I +L   I
Sbjct  390   QMSREGKPFCSNSIDLEKSTMAAQTPLRNRSTIIPEISSHAGIYTFSLTWPEIYNLTPAI  449

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNP+      RNP  ++ G+ M+L +FL  A N+TS+SG+LI+VENA YL EKKGL +  
Sbjct  450   SNPY------RNPNERDSGRIMSLFEFLNLAKNSTSLSGILISVENAVYLREKKGLDLAK  503

Query  1073  AVLLALNKADLK----TKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTILEI  909
             AVL  L +A       TK+VMI S +SSVL+     SKYE VY +++ I DI +S I +I
Sbjct  504   AVLDTLTEAGYSNGTTTKRVMIQSRNSSVLVDIKKQSKYETVYKVEKTIDDISDSAIEDI  563

Query  908   KKFASSVIIGKSSVFP-TDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDP  732
             KKFA +V+I K SV P  DDSF+ G TNVV +LQ SK+ VYV+LF NEFV       SD 
Sbjct  564   KKFADAVVIIKPSVLPLCDDSFVTGKTNVVERLQKSKLLVYVELFQNEFV-------SDA  616

Query  731   YVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP-  555
              VE+NSY+ GA  N   G IT FP TA++Y+RNRCLG KE  PYM PV P  LLQ ++P 
Sbjct  617   TVEINSYITGAGIN---GTITEFPLTASKYKRNRCLGTKETLPYMAPVIPRGLLQTVNPL  673

Query  554   -QYLPPAEAPYPVLTESDVVEPPLPP  480
                  P+ AP PV T+  V  PPLPP
Sbjct  674   SPAPAPSPAPSPVFTDDYVAGPPLPP  699



>emb|CDY19634.1| BnaA05g20420D [Brassica napus]
Length=726

 Score =   257 bits (656),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 141/325 (43%), Positives = 203/325 (62%), Gaps = 18/325 (6%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAA-QQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+KD IPFCM S+++++ T      F NL+ ++ E++  + I +F L   +IQ+L+  I
Sbjct  373   QMSKDKIPFCMSSIDLMNSTNVIYTSFRNLSSTVSEIQQGSGIFTFSLTMSEIQTLKPII  432

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNP   + LFRNP  KN GKF+TL +FL      +S+SG LI +E AAYLA  +G+ + D
Sbjct  433   SNPHRVYGLFRNPRNKNLGKFLTLSEFLLLPNRYSSLSGSLIKIEYAAYLATHQGISIVD  492

Query  1073  AVLLALNKADLKTKKVMIHSNDSSVLMKFTN----SKYERVYGIKEEISDIQNSTILEIK  906
             AVL  L +A   T +V+I S D +VL++F      +  E VY + E+I D+ +S I +IK
Sbjct  493   AVLYELKRA---TSQVLIQSTDKAVLIEFKEKGKMTNEELVYAVDEDIHDVADSAIKDIK  549

Query  905   KFASSVIIGKSSVFPTDDSF--LVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDP  732
              FA S++I K SV P  +    L   T+VV +L++S ++VYV+ FSNEF++Q +DFFSDP
Sbjct  550   SFAGSIVISKKSVVPYSEGIARLEKETDVVPRLRSSGLRVYVETFSNEFITQPYDFFSDP  609

Query  731   YVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQ  552
              VE++ +V G      DG+IT FPAT +RY +N C    E       +  G L+ L + +
Sbjct  610   TVEIDYFVRGDPE--VDGIITDFPATTSRYTKNPCYSKME------QIRTGELVSLANRE  661

Query  551   YLPPAEAPYPVLTESDVVEPPLPPV  477
              L PAEAPYP L +S+V EPPLP V
Sbjct  662   MLSPAEAPYPQLLDSNVTEPPLPEV  686



>ref|XP_010687738.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010687740.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010687741.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Beta vulgaris subsp. vulgaris]
Length=751

 Score =   257 bits (657),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 148/331 (45%), Positives = 211/331 (64%), Gaps = 16/331 (5%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  1251
             QM+KDG+ FC+ S +++  TTA   F + + SIPE++ +N I SFDL W +IQSL+ Q++
Sbjct  389   QMSKDGVAFCLDSADLLGDTTAITTFMSKSSSIPEIQPKNGIFSFDLTWSEIQSLKPQLT  448

Query  1250  N--PFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
             +  P     L RNP  K++GKF+TL +FL FA  A +V+GVLI V NA YLA KKGL + 
Sbjct  449   SSIPQDMGGLPRNPANKDKGKFLTLAEFLDFA-KAKAVTGVLINVLNAPYLASKKGLDIV  507

Query  1076  DAVLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEI  909
              AV  AL+ A L    T++VMI S+D++VL KF    KY RVY IK+ ISD    ++ EI
Sbjct  508   GAVTTALSNATLDKQSTQQVMIQSDDTAVLAKFKEVPKYRRVYVIKDIISDAPKPSVDEI  567

Query  908   KKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPY  729
             KK+A +V + + S+  +  SFL   T VV ++ A+ + V+V    NE+ + A+DFFSDP 
Sbjct  568   KKYADAVDVRRPSIVKSTASFLSNFTKVVEEMHAANLSVHVSTLYNEYTTLAFDFFSDPM  627

Query  728   VELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYK----EIPPYMLPVGPGSLLQLM  561
             +EL + + G      D V+T +PATAN Y R+ C        E P  + PV  G+LL+++
Sbjct  628   IELATLIEGLKV---DAVVTEYPATANAYLRSPCSDPTKTNLEYP--ISPVEAGALLEIV  682

Query  560   SPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  468
              PQ LPP+ AP P L  + +V+PPLPPV+K+
Sbjct  683   VPQALPPSGAPAPALEAASIVDPPLPPVSKV  713



>emb|CDX88656.1| BnaA03g09930D [Brassica napus]
Length=775

 Score =   258 bits (658),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 156/350 (45%), Positives = 206/350 (59%), Gaps = 33/350 (9%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  1251
             QM+KDGI FC  S ++   TTA   F + A S+PE++  N I SFDL W +IQSL+ QI 
Sbjct  391   QMSKDGIAFCHDSADLTTSTTAMTTFMSRATSVPEIQPTNGIFSFDLTWAEIQSLKPQIL  450

Query  1250  NPF-AKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVE---------------  1119
             +PF  K    RNP  KN GKF+TL DFL F+    +V+GVLI +E               
Sbjct  451   SPFLTKGGFQRNPANKNAGKFITLVDFLEFSKE-KAVTGVLINIEANTTFQKYTFQDNFT  509

Query  1118  --------NAAYLAEKKGLGVTDAVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SK  975
                     NAAYLA KKGLG+ D V  A+ K+ L    T+KV+I S+DSSVL  F     
Sbjct  510   DDALFCLQNAAYLASKKGLGIVDTVQSAITKSTLDKQLTQKVLIQSDDSSVLSSFAAVPP  569

Query  974   YERVYGIKEEISDIQNSTILEIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVK  795
             Y RV  I +EI D    +I EIKK A +V + +SS+  T  +F  G TNVV ++    V 
Sbjct  570   YTRVLTIDKEIGDAPKPSIDEIKKHAEAVNLKRSSLVTTSKNFATGKTNVVEEMHKGNVS  629

Query  794   VYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYK  615
             VYV +  NE++S A+D+FSDP VE+ +++ G   N  DGV+T FP TA RY R+ C    
Sbjct  630   VYVSVLRNEYLSIAFDYFSDPTVEIATFIAG---NSVDGVVTEFPVTATRYLRSPCSDLN  686

Query  614   EIPPY-MLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  468
             +  PY +LPV  G+LL + + +  PPA AP P L   DV++PPLPP+A I
Sbjct  687   KEQPYAILPVEAGALLSVAAKEAQPPASAPNPPLDARDVIDPPLPPIANI  736



>ref|XP_009145621.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=726

 Score =   256 bits (655),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 140/325 (43%), Positives = 203/325 (62%), Gaps = 18/325 (6%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAA-QQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+KD IPFCM S+++++ T      F NL+ ++ E++  + I +F L   +IQ+L+  I
Sbjct  373   QMSKDKIPFCMSSIDLMNSTNVIYTSFRNLSSTVSEIQQGSGIFTFSLTMSEIQTLKPII  432

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNP   + LFRNP  KN GKF+TL +FL      +S+SG LI +E AAYLA  +G+ + D
Sbjct  433   SNPHRVYGLFRNPRNKNLGKFLTLSEFLLLPNRYSSLSGSLIKIEYAAYLATHQGISIVD  492

Query  1073  AVLLALNKADLKTKKVMIHSNDSSVLMKFTN----SKYERVYGIKEEISDIQNSTILEIK  906
             AVL  L +A   T +V+I S D +VL++F      +  E VY + E+I D+ +S I +IK
Sbjct  493   AVLYELKRA---TSQVLIQSTDKAVLIEFKEKGKMTNEELVYAVDEDIHDVADSAIKDIK  549

Query  905   KFASSVIIGKSSVFPTDDSF--LVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDP  732
              FA S++I K SV P  +    L   T++V +L++S ++VYV+ FSNEF++Q +DFFSDP
Sbjct  550   SFAGSIVISKKSVVPYSEGIARLEKETDIVPRLRSSGLRVYVETFSNEFITQPYDFFSDP  609

Query  731   YVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQ  552
              VE++ +V G      DG+IT FPAT +RY +N C    E       +  G L+ L + +
Sbjct  610   TVEIDYFVRGDPE--VDGIITDFPATTSRYTKNPCYSKME------QIRTGELVSLANRE  661

Query  551   YLPPAEAPYPVLTESDVVEPPLPPV  477
              L PAEAPYP L +S+V EPPLP V
Sbjct  662   MLSPAEAPYPQLLDSNVTEPPLPEV  686



>ref|XP_010109457.1| putative glycerophosphoryl diester phosphodiesterase 3 [Morus 
notabilis]
 gb|EXC22605.1| putative glycerophosphoryl diester phosphodiesterase 3 [Morus 
notabilis]
Length=749

 Score =   257 bits (656),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 146/328 (45%), Positives = 208/328 (63%), Gaps = 11/328 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  1251
             Q++KDG+PFC+ S ++   TTA   F +   +IPE++ +  + SF L W +IQ+L+ Q+ 
Sbjct  387   QLSKDGVPFCLASADLAGDTTAMMPFIDKKDTIPEIQPEIGVFSFALTWSEIQTLKPQLV  446

Query  1250  NPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDA  1071
             +PFA   + RNP  KN GKF+TL +FL F A A +VSG+LI +ENAAYLA K+GL +  A
Sbjct  447   SPFANSSILRNPANKNLGKFVTLTEFLDF-AKAKAVSGILINIENAAYLASKQGLDIVGA  505

Query  1070  VLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIKK  903
             V  AL  A      T++V+I S+D+SVL KF +   Y+RV  IKE+I D    ++ EIKK
Sbjct  506   VATALTNATFDKQSTQQVLIQSDDTSVLSKFKDVPTYKRVLRIKEKIGDAPKPSVDEIKK  565

Query  902   FASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVE  723
             +A +V + +S++    D F V +TNVV ++ A+ + VYV    NE+V+ A+D+FSDP VE
Sbjct  566   YADAVTVPRSAIIKVSDFFTVALTNVVKEMHAANLSVYVNELRNEYVTLAFDYFSDPIVE  625

Query  722   LNSYVFGASANPFDGVITGFPATANRYRRNRCLGYK---EIPPYMLPVGPGSLLQLMSPQ  552
             + +YV        DG +T +P TA++Y R  C        +P  +LP  PGSLL L+ P+
Sbjct  626   IATYV---QVVEVDGFMTDYPGTASKYMRCPCTDTDPKANVPYPILPAEPGSLLSLIPPE  682

Query  551   YLPPAEAPYPVLTESDVVEPPLPPVAKI  468
               PPA AP   L   D+V+PPLPPVAKI
Sbjct  683   IQPPAAAPAAPLLVKDIVDPPLPPVAKI  710



>emb|CDY36036.1| BnaC03g41620D [Brassica napus]
Length=849

 Score =   258 bits (658),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 143/325 (44%), Positives = 201/325 (62%), Gaps = 19/325 (6%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+KD IPFCM S+++++ T      F NL+ ++ E++ ++ I++F L    I++L+  I
Sbjct  497   QMSKDKIPFCMSSIDLLNTTNVFNTSFRNLSSTVAEIQPKSGIYTFSLTMSQIKTLKPVI  556

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNP     LFRNP  KN GKF+TL +FL  A    S+ GVLI VENA YLA+ +G+ V D
Sbjct  557   SNPKEDHALFRNPRNKNVGKFLTLSEFLFLANRYNSLLGVLIKVENAVYLAKHQGISVVD  616

Query  1073  AVL-----LALNKADLKTKKVMIHSNDSSVLMKFTNSKY----ERVYGIKEEISDIQNST  921
             AVL     L   +    +  +M  S D SVLM F   K     E VY + E+I D+ +S 
Sbjct  617   AVLNKTERLTTQEGQTTSIAIMFQSTDKSVLMDFKEKKLIYPDELVYRVDEDIRDVTDSA  676

Query  920   ILEIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFF  741
             I EI  FA +++I K SV P +   +   T+VVA+L+AS  +VYV+ FSNEFV+Q +D F
Sbjct  677   IKEIMSFAGTIVISKESVLPYNGGLVKKKTDVVARLKASGFRVYVETFSNEFVTQPFDLF  736

Query  740   SDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLM  561
             SD  VE++ +V    A   DG+IT FPAT  RYR+++C  Y+E+  +      G LL   
Sbjct  737   SDSTVEIDFFV---QAVKIDGIITDFPATTARYRKSQC--YREMSMFR----TGELLPFG  787

Query  560   SPQYLPPAEAPYPVLTESDVVEPPL  486
             +P+ L PA+APYP+L ESDV+EPPL
Sbjct  788   NPRLLSPAQAPYPLLVESDVMEPPL  812


 Score = 52.8 bits (125),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 69/283 (24%), Positives = 122/283 (43%), Gaps = 46/283 (16%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  1251
             Q+TKDG+  C  ++N+ + +     + N          +N   S D  WKD+  +     
Sbjct  201   QLTKDGVGICFPNLNLYNDSDVKDVYPN----------KNEWFSVDFTWKDLSDVN----  246

Query  1250  NPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANAT-SVSGVLITVENAAYLAEKKGLGVTD  1074
                    L +N V    G F      LT    A     G+ + ++N+A+   +  L + +
Sbjct  247   -------LVQN-VKSRSGVFDGSYQILTVEIVAELGAPGLWLNIQNSAFY-RQHNLSMRN  297

Query  1073  AVLLALNKADLKTKKVMIHSNDSSVL--MKFTNSKYERVYGIKEEISDIQNST-------  921
              V+    + D       I S + S L  MK   +K    +  +++I    N T       
Sbjct  298   YVVSLSKRVDF------ISSPEISFLKSMKKDVTKLIFRFLNQDQIEPFTNQTYSSLSKN  351

Query  920   ILEIKKFASSVIIGKSSVFPT-DDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDF  744
             +  IK F+S +++ KS ++P   D +L   T++V +     ++V+   F+N+FV  A+++
Sbjct  352   LSYIKTFSSGILVPKSYIWPVGSDLYLKPHTSLVTEAHRQGLQVFASEFANDFVF-AYNY  410

Query  743   FSDPYVELNSYVFGASAN-PFDGVITGFPATANRYRRNRCLGY  618
               DP  E  S++   S N   DG ++ FP T   YR   C  +
Sbjct  411   SYDPTAEYLSFI--DSGNFSVDGFLSDFPVTP--YRAISCFSH  449



>emb|CDY43885.1| BnaC09g33580D [Brassica napus]
Length=751

 Score =   256 bits (653),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 154/327 (47%), Positives = 205/327 (63%), Gaps = 14/327 (4%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  1251
             QM+KDGI FC  S ++   TTA   F + A S+PE++  N + S+DL W +IQSL+ QI 
Sbjct  391   QMSKDGIAFCHDSADLTASTTAMATFMSRATSVPEIQPTNGVFSYDLTWAEIQSLKPQIQ  450

Query  1250  NPF-AKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             +PF  K  + RNP  KN GKF+TLDDFL F+    +V+GVL    NAAYLA KKGLG+ D
Sbjct  451   SPFITKVGITRNPANKNAGKFVTLDDFLKFSKE-KAVTGVL----NAAYLASKKGLGIVD  505

Query  1073  AVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
             AV  AL K+ L    T++V+I S+DSSVL  F     Y RV  I +EI D   +++ EIK
Sbjct  506   AVKSALTKSTLDKQTTQRVLIQSDDSSVLAGFEAVPPYTRVLSIDKEIGDAPKASVDEIK  565

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             K A +V I +SS+     SF  G TNVV ++    + VYV +  NE++S A+D+FSDP V
Sbjct  566   KHADAVNILRSSLVTISGSFAAGKTNVVEEMHKGNISVYVSVLRNEYISIAFDYFSDPTV  625

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMSPQY  549
             E  +++ G   N  DGVIT FPATA RY R+ C    +  PY +LP   GSL+ + + + 
Sbjct  626   EFATFIAG---NGVDGVITEFPATATRYLRSPCSDLDKEQPYAILPAEAGSLISVANKEA  682

Query  548   LPPAEAPYPVLTESDVVEPPLPPVAKI  468
              PPA AP P L   DV++PPLPPVA +
Sbjct  683   QPPASAPSPPLDAKDVIDPPLPPVANM  709



>ref|NP_001062173.1| Os08g0503200 [Oryza sativa Japonica Group]
 dbj|BAD09276.1| putative glycerophosphoryl diester phosphodiesterase 2 precursor 
[Oryza sativa Japonica Group]
 dbj|BAF24087.1| Os08g0503200 [Oryza sativa Japonica Group]
 dbj|BAG89421.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89557.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC83836.1| hypothetical protein OsI_29787 [Oryza sativa Indica Group]
 gb|EEE68959.1| hypothetical protein OsJ_27854 [Oryza sativa Japonica Group]
Length=778

 Score =   256 bits (653),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 146/331 (44%), Positives = 200/331 (60%), Gaps = 16/331 (5%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQS--LQA  1260
             QMT DG+P CM S+N+ + T   +  FSN A    +++    I +F+L W DI S  L+ 
Sbjct  406   QMTSDGVPVCMSSINLFETTNVQRTPFSNRASIFKDIQPTPGIFTFNLTWADISSSDLRP  465

Query  1259  QISNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGV  1080
             +IS+P + + L RNPV KN G F  L DFLTFA +   +SG++I ++NA ++A   G  V
Sbjct  466   KISSPESIYYLVRNPVHKNAGNFFRLSDFLTFAKD-KDLSGIMIIIKNAVFMANSLGFDV  524

Query  1079  TDAVLLAL-----NKADLKTKKVMIHSNDSSVL--MKFTNSKYERVYGIKEEISDIQNST  921
              D+V  AL     N    K K+VMI S DS+VL  +K   +KY+ VY +   I D   S+
Sbjct  525   VDSVTKALSDAGYNNQTTKAKEVMIQSEDSAVLVNLKQLETKYKLVYTLPSTIGDASASS  584

Query  920   ILEIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFF  741
             ++++KKFA +VI+ + S+FP    F++  TN+V  L+++ + +Y Q+F NEFVS  WDFF
Sbjct  585   LVDVKKFADAVIVDRESIFPESQGFIMKETNLVKDLRSAGLAIYAQVFRNEFVSPPWDFF  644

Query  740   SDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYK-EIPPYMLPVGPGSLLQL  564
             SD  VE+NSYV   S N  DG+IT FP T  RY+ N C G    +P YM P   G L QL
Sbjct  645   SDVTVEINSYV--QSVN-IDGIITDFPKTVRRYKMNSCTGLGVNMPSYMNPAEIGGLAQL  701

Query  563   MS-PQYLPPAEAPYPVLTESDVVEPPLPPVA  474
             ++  Q  PPA AP PVL  SDV EPP P  A
Sbjct  702   LNGSQAQPPALAPMPVLNSSDVTEPPFPSAA  732



>ref|XP_002300352.2| hypothetical protein POPTR_0001s371702g, partial [Populus trichocarpa]
 gb|EEE85157.2| hypothetical protein POPTR_0001s371702g, partial [Populus trichocarpa]
Length=259

 Score =   241 bits (616),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 132/216 (61%), Positives = 157/216 (73%), Gaps = 8/216 (4%)
 Frame = -3

Query  1118  NAAYLAEKKGLGVTDAVLLALNKA---DLKTKKVMIHSNDSSVLMKFTN-SKYERVYGIK  951
             NAAYL EK+GL  TD VL  L+ A   D  +KKVMI S +SSVLMKF + + YE VY I+
Sbjct  1     NAAYLIEKEGLPFTDKVLEVLSLAGYDDPTSKKVMIESTNSSVLMKFRDKNNYELVYRIE  60

Query  950   EEISDIQNSTILEIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSN  771
             E+I D +++ + +IK FASSV+I K+SVFP   SFL GVTNVV KLQ+  + VYV+ FSN
Sbjct  61    EDIQDAEDAALKDIKDFASSVVISKASVFPESSSFLSGVTNVVPKLQSHGLSVYVETFSN  120

Query  770   EFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLP  591
             EFVSQAWDFFSD  VE+NSYV G +     GVIT FP T+ RY+RNRCLG KE+P YM P
Sbjct  121   EFVSQAWDFFSDSTVEINSYVMGVN---ISGVITEFPLTSARYKRNRCLG-KELPSYMSP  176

Query  590   VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  483
               PG L+QL+SP  LPPAE P PVLT  DVVE PLP
Sbjct  177   AQPGGLMQLISPFALPPAEPPNPVLTAPDVVEGPLP  212



>ref|XP_006660255.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Oryza brachyantha]
Length=785

 Score =   255 bits (652),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 141/328 (43%), Positives = 205/328 (63%), Gaps = 16/328 (5%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQS--LQA  1260
             QMT DG+P CM S+N+ D T   +  FS+ A  I E++T   I +F+L W +I +  L+ 
Sbjct  411   QMTSDGVPICMSSINLFDTTNVQRTIFSSRASIIREIQTTPGIFTFNLTWAEISNSDLKP  470

Query  1259  QISNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGV  1080
             +IS+P + F L RNP+ +N GKF  L DFL FA +   +SG++I +ENAA++AE  G  V
Sbjct  471   KISSPESLFYLVRNPLYQNAGKFFRLSDFLAFAKDK-DLSGIMIIIENAAFMAESLGFDV  529

Query  1079  TDAVLLAL-----NKADLKTKKVMIHSNDSSVLMKFTN--SKYERVYGIKEEISDIQNST  921
               +V  AL     N    + K VMI S DS+VL+K     +KY+ VY +  +I D   S+
Sbjct  530   VQSVANALSDAGYNNQTTEGKDVMIQSKDSAVLVKLKQQETKYKLVYTLPPKIGDASASS  589

Query  920   ILEIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFF  741
             ++++KKFA +V++ + S+FPT   F++  TN++  L+++ + +Y Q+F NEFVS  WDFF
Sbjct  590   LVDVKKFADAVVVQRVSIFPTSQGFIMRETNLMKDLRSAGLAIYAQVFRNEFVSPPWDFF  649

Query  740   SDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKE-IPPYMLPVGPGSLLQL  564
             SD  VE+N+YV        DG IT FP T  RY+ N C+G  + +P YMLPV    L QL
Sbjct  650   SDVTVEINTYVQSVK---IDGFITDFPKTVKRYKMNSCMGLGDNMPQYMLPVEIAGLAQL  706

Query  563   MSPQYL-PPAEAPYPVLTESDVVEPPLP  483
             ++   + PPA +P PVL+ S+V EPPLP
Sbjct  707   LNGSTVQPPALSPMPVLSSSNVTEPPLP  734



>ref|XP_010241663.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Nelumbo nucifera]
 ref|XP_010241664.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Nelumbo nucifera]
Length=749

 Score =   254 bits (650),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 148/324 (46%), Positives = 196/324 (60%), Gaps = 10/324 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  1251
             QMTKDGI FC  S +++  TTA   F +   S+PE++  + I SFDL W +IQSL+  + 
Sbjct  389   QMTKDGIAFCSESPDLMAYTTAMTTFMSRTSSVPEIQQHSGIFSFDLTWSEIQSLKPDLR  448

Query  1250  NPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDA  1071
             +P     L RNP  KN+GKF+TL +FL F A A +V G++I +ENA YLA  KG  + D 
Sbjct  449   SPVPSVSLPRNPANKNKGKFLTLPEFLDF-AKAKAVPGIMIDIENAPYLA-SKGFDIVDI  506

Query  1070  VLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIKK  903
             V  AL  A     +T+ VMI S+DS+VL KF +   Y++V+ I E IS +   T+ EIKK
Sbjct  507   VASALRNASFDKQETQVVMIQSDDSAVLSKFKDVPSYQKVFHIYEIISSVPKETVEEIKK  566

Query  902   FASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVE  723
             FA  V + +SS     +SF V  T+VV   Q S + V+  +F NEF + A D FSDP VE
Sbjct  567   FADIVNLPRSSSLVILNSFTVKYTDVVDTFQLSNISVFTSVFMNEFPTIAIDMFSDPIVE  626

Query  722   LNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMSPQYL  546
             L ++V G      DGV+T +PATA  Y R+ C+      PY + P  PG+LL L SP  L
Sbjct  627   LQTFVAGFG---IDGVVTDYPATARAYSRSPCIDLNANVPYTIFPAQPGALLALASPDAL  683

Query  545   PPAEAPYPVLTESDVVEPPLPPVA  474
             PP  AP P LT  DV++PPLPPV 
Sbjct  684   PPVGAPAPSLTVGDVIDPPLPPVG  707



>ref|XP_006406374.1| hypothetical protein EUTSA_v10020151mg [Eutrema salsugineum]
 gb|ESQ47827.1| hypothetical protein EUTSA_v10020151mg [Eutrema salsugineum]
Length=727

 Score =   254 bits (648),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 140/328 (43%), Positives = 202/328 (62%), Gaps = 19/328 (6%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTA-AQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+KD IPFC+ S+++++ T      F NL+    E++  + I +F L    IQ+L+  I
Sbjct  373   QMSKDKIPFCLSSIDLMNSTNIFDTSFRNLSSVASEIQPNSGIFTFSLTMSQIQTLKPVI  432

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNPF    LFRNP  KN GK++TL +FL      +S+SG+LI VENAAYLAE +G+ V D
Sbjct  433   SNPFRLSALFRNPRNKNLGKYLTLSEFLFLPKRYSSLSGILIKVENAAYLAEHQGISVVD  492

Query  1073  AVLLALNK-----ADLKTKKVMIHSNDSSVLMKFTNSK----YERVYGIKEEISDIQNST  921
             AVL  L K     +    ++++I S D SVLM+F   K     E VY + E+I D+ +S 
Sbjct  493   AVLDELKKDTTQESQASARRILIQSTDKSVLMEFKEKKKMNHEELVYSVDEKIHDVTDSA  552

Query  920   ILEIKKFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFF  741
             I +IK FA S++I + SVF  +  F+   T+V  +L +S ++VYV+  SNEFVS  +DF+
Sbjct  553   IKDIKSFAGSIVINRDSVFSGNAGFITLKTDVFPRLNSSGLRVYVETLSNEFVSYPFDFY  612

Query  740   SDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLM  561
             SDP ++++++V     +   G+IT FPAT  RYR+N+C  Y ++  +      G L+   
Sbjct  613   SDPTMQIDTFVRDIKIH---GIITDFPATTARYRKNQC--YSKMNLFR----TGELITFG  663

Query  560   SPQYLPPAEAPYPVLTESDVVEPPLPPV  477
             +P  +PPA APYP L ESDV EPPLP V
Sbjct  664   NPLLVPPAGAPYPSLVESDVTEPPLPEV  691



>ref|XP_010433460.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3 [Camelina 
sativa]
Length=661

 Score =   253 bits (645),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 140/269 (52%), Positives = 183/269 (68%), Gaps = 9/269 (3%)
 Frame = -3

Query  1427  MTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  1251
             M+ DG PFC  S+++ + TT A   F N + ++PE+ +   I++F L W +IQ+L   IS
Sbjct  394   MSSDGTPFCSSSIDLGNSTTVALSPFRNRSTTVPEISSVGGIYTFSLTWPEIQTLTPAIS  453

Query  1250  NPFAK-FRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             NP+++ F LFRNP  KN GK ++L DFL  A N+TS+SGVLI+VENAAYL E++GL V  
Sbjct  454   NPYSRGFSLFRNPKEKNAGKLLSLSDFLNLAKNSTSLSGVLISVENAAYLREEQGLDVVK  513

Query  1073  AVLLALNK---ADLKTKKVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTILEIK  906
             AVL  L +   ++  TKKVMI S +SSVL+ F   S+YE VY I+E I DI +S I +IK
Sbjct  514   AVLDTLTQTGYSNSTTKKVMIQSTNSSVLVDFKKQSQYETVYKIEENIRDILDSAIEDIK  573

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             KFA+ V+I K SVF    SF+   TNVV KLQ S++ VYV+LF NEFVSQ +DFFSD  V
Sbjct  574   KFANVVVIQKLSVFRIAQSFITRQTNVVEKLQKSQLPVYVELFQNEFVSQPYDFFSDATV  633

Query  725   ELNSYVFGASANPFDGVITGFPATANRYR  639
             E+NSY+ G   N   G IT FP TA RY+
Sbjct  634   EINSYITGPGIN---GTITEFPFTAARYK  659



>ref|XP_006647435.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Oryza brachyantha]
Length=747

 Score =   254 bits (649),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 152/326 (47%), Positives = 207/326 (63%), Gaps = 10/326 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDI-QSLQAQ  1257
             Q+TKDGIP CM S+++ D TT A  QFS+    I ++K    ++SF+L W DI ++L+ +
Sbjct  387   QVTKDGIPICMSSIDLGDVTTVANSQFSSQTSVIKDIKASPGVYSFNLTWDDISKNLKPK  446

Query  1256  ISNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
             ISNP + ++L+RNP   N G FM L DFL FA     +SG++I++E+AA++A+  G GV 
Sbjct  447   ISNPMSTYKLYRNPRNMNAGNFMRLSDFLDFA-KGKDLSGIMISIEHAAFMAQNLGFGVV  505

Query  1076  DAVLLALNKADLK---TKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTILEI  909
             DAV  AL+ +      T++VMI S +SSVL+KF   +KY  VY I+E + D   S+I +I
Sbjct  506   DAVTKALDDSGYSKQTTQQVMIQSTNSSVLVKFKQQTKYNLVYMIEENVRDAAPSSIADI  565

Query  908   KKFASSVIIGKSSVFPTDDSFLVGVTN-VVAKLQASKVKVYVQLFSNEFVSQAWDFFSDP  732
             KKFA +V +   SV+P    FL   TN +V  LQ++ + VYV +  NEFVSQ WDFFSD 
Sbjct  566   KKFADAVSVNTMSVYPVTQKFLTNQTNSLVQSLQSAGLPVYVYVLMNEFVSQPWDFFSDA  625

Query  731   YVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMSP  555
               ++N+YV        DGVIT FPATA+RY+ N C+      P +M P  PG L++ M  
Sbjct  626   TQQINAYV-KRPGGGVDGVITDFPATAHRYKLNSCMNMGNNTPGFMFPAQPGGLIENMPG  684

Query  554   QYLPPAEAPYPVLTESDVVEPPLPPV  477
                PPA AP P LTESDV EPPLP V
Sbjct  685   PVQPPAIAPLPPLTESDVAEPPLPAV  710



>ref|XP_009396661.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Musa acuminata subsp. malaccensis]
Length=744

 Score =   254 bits (648),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 161/323 (50%), Positives = 213/323 (66%), Gaps = 7/323 (2%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  1251
             QM+KDG+ FC+ S +++  TTAA  F   A  +PE++  N I SFDL W +IQSL+  ++
Sbjct  385   QMSKDGVAFCLDSADLMGDTTAAAAFMPRAAMVPEIQQNNGIFSFDLTWSEIQSLKPALT  444

Query  1250  NPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDA  1071
             +P ++  L RNP AK+EGKFMTL DFL FA  +T VSG+LI +ENAAYLA KKGLG  DA
Sbjct  445   SPMSQSGLARNPAAKSEGKFMTLADFLQFAKKST-VSGILINIENAAYLASKKGLGAVDA  503

Query  1070  VLLALNKADLKTKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTILEIKKFAS  894
             V  AL  A    K+V I S+D++VL  F  NS Y+RV  +KE ISD    T+ EIK+FA 
Sbjct  504   VSTALRNASYD-KQVYIQSDDTAVLSAFKKNSGYQRVLHVKETISDAPKPTVEEIKQFAD  562

Query  893   SVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNS  714
             +V + +SS+      F+   TNVV ++ A+ + VYV +  NEF++ A+D+FSDP VEL +
Sbjct  563   AVNLPRSSIVAASGFFVSAFTNVVDQMHAANISVYVSVLRNEFLTIAFDYFSDPMVELAT  622

Query  713   YVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMSPQYLPPA  537
             YV G   +   GV+T FPATA  Y ++ C       PY +LP  PG+LL L SP   PPA
Sbjct  623   YVAGVGVD---GVVTEFPATAAAYLKSPCSDLNANLPYSILPAEPGTLLSLASPDAAPPA  679

Query  536   EAPYPVLTESDVVEPPLPPVAKI  468
             EAP PVL  +DVV+PPLPPVA +
Sbjct  680   EAPAPVLEVADVVDPPLPPVADL  702



>emb|CDY60415.1| BnaC02g45340D [Brassica napus]
Length=1186

 Score =   258 bits (659),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 149/308 (48%), Positives = 198/308 (64%), Gaps = 25/308 (8%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+++G PFC  S+++   T AAQ    N +  IPE+ +   I++F L W +I +L   I
Sbjct  357   QMSREGKPFCSNSIDLEKSTMAAQTPLRNRSTIIPEISSHAGIYTFSLTWPEIYNLTPAI  416

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNP+      RNP  ++ G+ M+L +FL  A N+TS+SG+LI+VENA YL EKKGL +  
Sbjct  417   SNPY------RNPNERDSGRIMSLFEFLNLAKNSTSLSGILISVENAVYLREKKGLDLAK  470

Query  1073  AVLLALNKADLK----TKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTILEI  909
             AVL  L +A       TK+VMI S +SSVL+     SK E VY +++ I DI +S I +I
Sbjct  471   AVLDTLTEAGYSNGTTTKRVMIQSTNSSVLVDIKKQSKSETVYKVEKPIDDISDSAIEDI  530

Query  908   KKFASSVIIGKSSVFP-TDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDP  732
             KKFA +V+I K SV P +DDSF+ G TNVV +LQ SK+ +YV+L  NEFV       SD 
Sbjct  531   KKFADAVVIIKPSVLPLSDDSFVTGKTNVVERLQKSKLLIYVELLQNEFV-------SDA  583

Query  731   YVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQ  552
              VE+NSY+ GA  N   G IT FP TA++Y+RNRCLG KE  PYM PV P  LLQ+++P 
Sbjct  584   TVEINSYITGAGIN---GTITEFPFTASKYKRNRCLGTKETLPYMAPVIPRGLLQMVNP-  639

Query  551   YLPPAEAP  528
              L PA AP
Sbjct  640   -LSPAPAP  646



>gb|KFK39359.1| hypothetical protein AALP_AA3G234500 [Arabis alpina]
Length=752

 Score =   254 bits (648),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 143/350 (41%), Positives = 210/350 (60%), Gaps = 41/350 (12%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  1254
             QM+KD IPFC+ S+++++ T   +  F NL+  + E++ +  I++F L    IQ+L+  I
Sbjct  375   QMSKDEIPFCLSSIDLLNSTNVFETSFRNLSSRVSEIQQKVGIYTFSLTMSQIQTLKPVI  434

Query  1253  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             SNPF  + L+RNP  KN GKF+TL +FL      +S+SG+LI VENAA+LAE +G+ V D
Sbjct  435   SNPFRGYDLYRNPRNKNIGKFLTLSEFLFLPKRYSSLSGLLIKVENAAFLAEHQGISVVD  494

Query  1073  AVLLALNKA--------------DLK----------TKKVMIHSNDSSVLMKFTNSKY--  972
             AVL  L +A              +LK             ++I S D SVLMKF   K   
Sbjct  495   AVLEELKRATELQGISVVGAVLDELKKATSQESHRNATSILIQSTDKSVLMKFKEKKKMN  554

Query  971   --ERVYGIKEEISDIQNSTILEIKKFASSVIIGKSSVFP---TDDSFLVGVTNVVAKLQA  807
               + VY + E+ISD+ +S I +IK  A S++I K SV+P   + D F+   T+VV +LQ+
Sbjct  555   HDDLVYRVDEDISDVTDSAIKDIKDVAGSIVISKKSVYPSYTSRDGFVKLKTDVVPRLQS  614

Query  806   SKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRRNRC  627
             + ++V+V+ F NEF +Q +DF++DP VE++S+V        DG+IT FPAT  RYR+N C
Sbjct  615   NGLRVFVETFHNEFTTQQFDFYADPTVEIHSFVLDIK---IDGIITDFPATTTRYRKNHC  671

Query  626   LGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  477
                 ++ P       G L+ L +  +L PAEAPYP L ++DV+EPPL  V
Sbjct  672   YRKLDLVP------TGVLITLPNLVHLGPAEAPYPTLVDADVIEPPLTEV  715



>ref|XP_002452366.1| hypothetical protein SORBIDRAFT_04g024440 [Sorghum bicolor]
 gb|EES05342.1| hypothetical protein SORBIDRAFT_04g024440 [Sorghum bicolor]
Length=753

 Score =   254 bits (648),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 153/327 (47%), Positives = 212/327 (65%), Gaps = 10/327 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDI-QSLQAQ  1257
             Q+TKDGI  CM SV++++ TT A+ QF++   +I +LK    + +F+L W DI ++L+  
Sbjct  395   QVTKDGILICMSSVDLMNATTVAKSQFASQVTTINDLKAGPGVFTFNLTWDDISKNLKPM  454

Query  1256  ISNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
             ISNP   F  +RNP  KN G FM L DFLTFA     +SG++ITVE+AA++AE+ G GV 
Sbjct  455   ISNPAIGFNQYRNPRNKNAGNFMRLSDFLTFA-KGKDLSGIMITVEHAAFMAEELGFGVV  513

Query  1076  DAVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEI  909
             DAV+ AL+ +       + VMI S +SSVL+KF   +KY  VY I+E + D   S++ +I
Sbjct  514   DAVIKALDDSGYSKQTAQSVMIQSTNSSVLVKFKQETKYNLVYMIEENVRDAAPSSLADI  573

Query  908   KKFASSVIIGKSSVFPTDDSFLVGVTN-VVAKLQASKVKVYVQLFSNEFVSQAWDFFSDP  732
             KKFAS+V +  +SVFP D  +L   TN +V  L+++ ++VY  +  NEF +Q  DFF+D 
Sbjct  574   KKFASAVSVSTTSVFPEDHYYLTNQTNNLVKSLKSAGLQVYAYVLMNEFGTQPNDFFADA  633

Query  731   YVELNSYVFGASANPFDGVITGFPATANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMSP  555
              V++N+YV    AN  DGVIT FP TA+RY+ N C    K  PP+M P  PG LL  M P
Sbjct  634   TVQINAYVHVRGAN-VDGVITDFPGTAHRYKLNSCTSMGKNAPPFMSPPKPGDLLTTMPP  692

Query  554   QYLPPAEAPYPVLTESDVVEPPLPPVA  474
                PPA AP P+LT++DV EP LPPV+
Sbjct  693   FAQPPAAAPMPLLTDADVAEPALPPVS  719



>ref|XP_012071459.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Jatropha curcas]
 gb|KDP38642.1| hypothetical protein JCGZ_03995 [Jatropha curcas]
Length=760

 Score =   253 bits (646),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 143/329 (43%), Positives = 204/329 (62%), Gaps = 13/329 (4%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  1251
             Q++ DG  FCM S ++   T A   F + + ++PE+K    I +FDL W +IQ+LQ ++S
Sbjct  389   QLSSDGTAFCMDSADVSVETNAMSNFMSRSSTVPEIKESAGIFTFDLTWAEIQTLQPRLS  448

Query  1250  NPFAKFRLF-RNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             +P+    L  RNP  K  GKF+ L +FL FA  A + +G+LI +ENA YLA KKGL +  
Sbjct  449   SPYGNDNLLPRNPAYKTAGKFLKLAEFLEFA-KAKAPTGILINIENAPYLASKKGLDIVS  507

Query  1073  AVLLALNKADL---KTKKVMIHSNDSSVLMKFTNSK-YERVYGIKEEISDIQNSTILEIK  906
             AV  AL KA      T+KV+I S+D+SVL KF   K Y+RV  +KEEISD    ++ EIK
Sbjct  508   AVSSALEKASFDKQSTQKVLIQSDDTSVLSKFKKIKAYQRVLHLKEEISDAPKKSVAEIK  567

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
             KFA  V + + S+ PTD  F + +T V+ ++ A+ + VYV +  NEF++ A+D+FSDP +
Sbjct  568   KFADVVNLPRFSIIPTDGQFAMYITKVIDEMHAANLTVYVSVLRNEFLNLAFDYFSDPII  627

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYML-PVGPG--SLLQLMSP  555
             E+ +Y + +     DG+IT FPATA RY  N C   +   PY++ P+ P    LL +   
Sbjct  628   EIATYNYLS----VDGIITEFPATAYRYFTNLCSNPEYDYPYIIAPIQPPMLRLLLISDA  683

Query  554   QYLPPAEAPYPVLTESDVVEPPLPPVAKI  468
             + LPPA +P PVL   DVV+PPLP V K+
Sbjct  684   KVLPPAPSPRPVLAADDVVDPPLPAVTKV  712


 Score = 52.4 bits (124),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 71/281 (25%), Positives = 121/281 (43%), Gaps = 45/281 (16%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDL-NWKDIQSLQAQI  1254
             QMTKD    C   V + + T       N+ +  P       ++  D+  W  I     ++
Sbjct  77    QMTKDRKGICQPDVTLENST-------NIDMVYPNGSKTYKVNGKDVEGWFSIDYTSLEL  129

Query  1253  SNPFAKFRLFRNPVAKNEG-KFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  1077
             SN      +FR P + +E     TL+D L+     + +  V + V    +  E K     
Sbjct  130   SNVTLMQNIFRRPSSFDEMVPLSTLEDLLS-----SKIPSVWLNVRYDMFFTEHK-----  179

Query  1076  DAVLLALNKADL--KTKKVMIHSNDSSVLMKFTNSKYER-------VYGIKEEISDIQNS  924
                   LN A L  K   +   S+     +K  N K ++       V+  KE +    N 
Sbjct  180   ------LNVAPLLQKLPNISYISSPEIGFLKKMNGKGKKAKTKLIFVFLGKEAVEPTTNQ  233

Query  923   T---ILE----IKKFASSVIIGKSSVFPT--DDSFLVGVTNVVAKLQASKVKVYVQLFSN  771
             T   ILE    IK+FAS +++ K+ ++P   D+      T++V       ++VY   F+N
Sbjct  234   TYGSILENLATIKEFASGIVVPKNYIWPVRKDNYLEANPTSLVLDAHKQGLEVYANGFAN  293

Query  770   EFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATAN  648
             ++ ++ +++  DP +E  S++   S    DGVI+ FP TA+
Sbjct  294   DY-AKIYNYSYDPGLEYLSFI-NNSEFSVDGVISDFPNTAS  332



>emb|CDY42328.1| BnaC02g17050D [Brassica napus]
Length=258

 Score =   239 bits (609),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 123/260 (47%), Positives = 163/260 (63%), Gaps = 38/260 (15%)
 Frame = -3

Query  1250  NPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDA  1071
             NP+  + +FRNP  KN G+ ++L +FL  A N+TS+S VLI++E+A YL EK+G      
Sbjct  2     NPYRLYNMFRNPNEKNSGRIISLSEFLNLAKNSTSLSSVLISLEDAVYLREKQG------  55

Query  1070  VLLALNKADLKTKKVMIHSNDSSVLMKFTNSKYERVYGIKEEISDIQNSTILEIKKFASS  891
                                          ++KYE VY I++ I DI +S I +IKKFA++
Sbjct  56    -----------------------------STKYETVYKIEKNIGDISDSAIEDIKKFANA  86

Query  890   VIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSY  711
             V++ KSSVFP  DSF+ G TNVV +LQ SK+ VYV+LF NEFVSQ +DFF D  VE+N+Y
Sbjct  87    VVLRKSSVFPVADSFVTGQTNVVERLQKSKLLVYVKLFHNEFVSQPYDFFCDATVEINTY  146

Query  710   VFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEA  531
             + GA  N   G IT FP TA RY+RN+CLG K+ P YM P+ PG LL +++P+ LPPAE 
Sbjct  147   ITGAGLN---GTITEFPLTAARYKRNQCLGRKQTPSYMSPLKPGGLLSIVNPKSLPPAEP  203

Query  530   PYPVLTESDVVEPPLPPVAK  471
             PY V T  DV E P PP  +
Sbjct  204   PYLVFTADDVTESPQPPATE  223



>ref|XP_006856834.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3 [Amborella 
trichopoda]
 gb|ERN18301.1| hypothetical protein AMTR_s00055p00174750 [Amborella trichopoda]
Length=763

 Score =   252 bits (643),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 155/325 (48%), Positives = 207/325 (64%), Gaps = 11/325 (3%)
 Frame = -3

Query  1430  QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  1251
             QMTKDG P C+GS+++   TTA+  F N + +I +++    I SFDL+W +IQSLQ  I 
Sbjct  396   QMTKDGTPICLGSIDLQADTTASSSFINRSTTITDIQMTAGIFSFDLSWAEIQSLQPVIQ  455

Query  1250  NPFAKFR-LFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  1074
             +P ++   L RNP   N+GKFMTL DFLTF     S+SG+LI +E AAYLAEK+GLGV D
Sbjct  456   SPASRGNGLIRNPAYVNQGKFMTLSDFLTFGKE-NSISGILIRIEYAAYLAEKRGLGVID  514

Query  1073  AVLLALNKADLKTK---KVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILEIK  906
              V+ AL+ A    +   +VMI S DSSVL  F   +KY+ VY ++  IS +QN  I ++K
Sbjct  515   TVITALHDAGYDNQMRQQVMIQSTDSSVLTAFKQKTKYKIVYEVENAISGVQNMAIDDLK  574

Query  905   KFASSVIIGKSSVFPTDDSFLVGVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYV  726
              FA +V + +SS+F    SF+   TNVV  L  + + VYV +  NEF   A+DFF+DP V
Sbjct  575   GFADAVAVRRSSLFSFHGSFIEASTNVVKTLHLNNLDVYVFVLRNEFTFLAFDFFADPTV  634

Query  725   ELNSYVFGASANPFDGVITGFPATANRYRRNRCLGYKEIPPYMLP-VGPGSLLQLMSPQY  549
             E+++YV G +    DG+IT FP TA  Y RN C    +   Y +P + P  LLQ+  P  
Sbjct  635   EIHNYVQGVNV---DGLITEFPRTARSYMRNTCYNASK-SKYNVPLIVPRGLLQVADPSA  690

Query  548   LPPAEAPYPVLTESDVVEPPLPPVA  474
             LPPA+AP P+L   DVVEPPLPPVA
Sbjct  691   LPPADAPAPLLKVPDVVEPPLPPVA  715



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4308734601061